6GSXA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
217
Chain Sequence
PMILGFWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Transferase
total genus 75
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gsxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gsxA01
3GURA 4LL1B 3LYPA 2IJYA 3BCIA 3M9KA 4KNDA 3VI7A 2XPDA 3FRCA 2HRKA 2HE3A 3HHVA 4POBA 1OC8A 2GZZA 3HVXA 3PH9A 1SKRB 2CAQA 1SJZA 2B5EA 4K0NA 2YNXA 5F07A 2VM2A 3ZVJA 3GKNA 1TP9A 1SL1B 2LSTA 3RBTA 5GZZB 3VFIA 3KIJA 4JZQA 3LFLA 3QMXA 2HI7A 5J41A 3HJOA 1X9SB 2CVKA 2F3MA 3FR9A 1TK0B 2HSMA 2HT9A 1GLQA 1VF2A 1WRYA 2IMKA 1A8LA 5JWOB 1OC3A 2ZUPA 1B9XC 3UBLA 2BJXA 1OVNA 3FHKA 1OAZA 4WKWA 1GULA 3KTBA 2LV3A 1K0NA 3UVHA 1OKTA 4V2NA 5D73A 2FHEA 2PN8A 2TIRA 4XIHA 5LNKe 1SJIA 4HOJA 2X8GA 3A2WA 1E6BA 1K3YA 2GQKA 1Z6MA 3IDVA 4MPGA 3P7XA 3GMFA 3GV1A 2DJ0A 1GNEA 2WJUA 2M72A 4DEJA 2DJ1A 2VL9A 4MZCA 3IA1A 4BWSA 5KN0A 2NDOA 2GSQA 4XS6A 3F3QA 1AW9A 2XBIA 1ACVA 5ABRA 2DIYA 4JR4A 2IMDA 3I6AA 5AIVA 3WD6A 1ZZYA 4CW9A 5IPHA 2FWEA 3ZTLA 2XC2A 2H0GA 2H75A 2X99A 2X8HA 4HU7A 5COHA 3U6VA 5CRHA 2YWMA 1XOBA 4HS1A 2LEGA 4NPBA 3UAPA 4G10A 4JRRA 3P8WA 3EU3A 3C71A 3A2VA 3IC4A 4KE3A 3FY7A 1LBKA 4EDYA 3IAM2 3FR6A 1NSWA 2MMNA 4GQCA 1U3AA 3GL3A 5A4UA 2FY6A 2K8VA 1PN9A 3GX0A 2G0FA 2H6YA 1Z5YE 3GA4A 4TN8A 1DE1A 4F0BA 5ECIB 2PERA 2MBTA 4PQ1A 4HJ2A 2YCDA 2L5LA 2HQTA 2J9HA 2B7JA 2R4VA 4YH2A 2LJKA 5CP1A 4CDOA 5J5NA 4MPFA 2FA4A 3VK9A 2O7KA 2GGTA 4O7HA 2CVBA 3GL5A 3RPPA 2CX4A 3GH6A 1EOHA 2FNOA 1GSSA 4ZL9A 3EC3A 3IK7A 4RI6A 5D9WA 5G1LA 5H5SA 4ACSA 4EL1A 4ZB8A 2QGVA 2KOKA 4EVMA 1A2LA 1TKDB 5F0GA 2IFQA 1SK0A 3D21A 1B4PA 2VUPA 2TRXA 3IK9A 3M0FA 3F4TA 3IOSA 5IMFA 2GQLA 1KTEA 1JFUA 1VRSD 5J9BA 2JADA 5F05A 22GSA 1IYIA 3JCML 3EYTA 1K0CA 2MBSA 1PL1A 2NVLA 2I1UA 1XBSA 2DJKA 1QGVA 5IM9A 2H73A 4PQIA 2H72A 3TJJA 3PGTA 3KM6A 4K1FA 3Q6OA 4NAXA 1YJ6A 4XRDA 4F82A 3F4SA 4I8BA 1WJKA 4KCEA 1FG4A 1PSQA 2CZ3A 2O87A 3H93A 2PUKC 4IGJA 4EF0A 2A2RA 1F3AA 1R7HA 1T7PB 1M2BA 3GTUA 16GSA 19GSA 1GWCA 4ZB9A 4XS4B 3EVIA 5ELAA 4ECBA 4F0CA 2HZEB 5ECMB 4G0LA 4WR4A 1KEBA 3TCOA 1A0RP 4D73B 2NBSA 3KCMA 2VO4A 1Q4JA 3IRAA 1PRXA 1QXHA 4KW6A 3S9FA 1TRVA 4ZBAA 4USSA 1JZWA 2BTOT 5DJLA 4POMA 4EO3A 5H5RA 2DSAA 1HNBA 1SK2A 2FLSA 4GQFA 1N2AA 4L8EA 5CYYA 2OBKA 3QAWA 2B5YA 2H76A 2WDUA 4ILFA 4TXOB 4FH8A 1SD9A 2P0GA 1J08A 3TKRA 4NHWA 3N5OA 4IJ3A 2C8UA 2VCQA 1ERWA 1AQXA 4TR3A 1XWAA 8GSSA 1F37A 1I5GA 2M46A 1YQ1A 5IMZA 4GSNA 3QPMA 4BL7B 4DSSB 2B3SA 5A4WA 2GDRA 4I2UA 2JZRA 2XHFA 3M8NA 5ELGA 2FWGA 2DIZA 1AQVA 2DBCA 2N5AA 4HU9A 5CRWA 3APSA 3IBHA 1XWCA 2VCWA 1GTBA 3VURA 4PGTA 2B6MA 3HYPA 1MEKA 4K9ZA 5HFKA 3LEFA 3UVTA 2DLXA 1M2DA 3MWHA 3V1WA 4TXVA 5DAKB 4BVXA 3KMNA 5D8IA 4I2TA 3NIVA 2FGXA 3C1RA 1JZRA 1QMVA 1S3DA 4N0VA 1TRWA 4MH2A 1GSDA 4KAEA 1ERUA 1TRSA 2H01A 3K8NA 5DALA 1TOFA 4G0KA 5C00A 4I97A 3SWLA 2JACA 2C80A 4MZBA 1TK5B 5HR1A 2GTUA 1M99A 4F9ZA 3CSJA 2K18A 1FW1A 5IMVA 2HRKB 5D9XA 2VLTA 3F8UA 2GS3A 3E9JB 1B8XA 2WZ9A 3F63A 2ON5A 3DVXA 3A2XA 2HNLA 2DMLA 1XWGA 2J23A 3IAS2 2V32A 3CXGA 3G7JA 2IMFA 2YWIA 1QQ2A 3GSTA 5H5QA 2HSMB 2MYGA 1K0AA 4PXOA 4P3YB 1Z6NA 2VD0A 1OE7A 2AAWA 3TJGA 4WF5A 1EGRA 1HQOA 1Y6EA 3PINA 3TJKA 2OJLA 2DJJA 1PX6A 5GAND 4Q5NA 1AXDA 2VCZA 5HFGA 3FKFA 6GSVA 10GSA 1O81A 3ISOA 5J3RA 2V6OA 5C04A 1R5PA 4KGIA 3HZ8A 1SENA 4J2FA 5DQSA 3MAKA 1DE2A 4GSSA 5CNWA 3FR3A 4F2IA 1F2EA 3HKRA 4ZBDA 4WETA 3GN3A 4ISDA 1XWBA 1O6JA 1XPVA 3H8QA 3GX8A 6GSWA 1MD3A 2GLRA 2OE0A 1S3AA 3FZ4A 1OC9A 3ERWA 3LJRA 2B1KA 3UIWA 1XW6A 1XVQA 4G2EA 3ZRDA 2WB9A 5G5FA 2KP2A 17GSA 3FEUA 3M1GA 3QD9A 3ZL5A 1TXXA 5DCHA 3MNGA 4IHUA 2JSZA 1SKWB 1TI3A 3VI5A 3ZLPA 3TKPA 1N8JA 2WGRA 5IIZA 4FYCA 2RM5A 5EL8A 2LJRA 3LQ7A 4IBPA 3WYWA 1YF0A 2H0HA 2F8AA 3HZ4A 4JBBA 3TRQA 2LQQA 2C3TA 5DVBA 5F06A 4GF0A 1TU8A 3BD2A 2K8SA 2R3XA 4LLRA 1G7OA 3ZYWA 3KXOA 1YKCA 5AISA 3BJ5A 2AV4A 5IOXA 1ZCPA 2IPAA 4OFTA 3IV4A 3I69A 3I9V2 1U6TA 1A8YA 5DBQA 3D4MA 1U87A 2VL3A 3J7Yk 5IOWA 2E7PA 5FHIA 3EMXA 2WS2A 4MZWA 3H1NA 2I81A 4QL7A 1X5EA 3CYNA 4HI7A 5E59A 4WXTA 3HVVA 1TW9A 4XCSA 1VF4A 1YZXA 2H66A 4MF6A 1BEDA 3HJMA 2AHEA 2O89A 4PURA 4PTSA 1TDIA 4YQUA 5KN1A 1ZMAA 2Z9SA 2YJ7A 2NPBA 2YANA 5D9TA 1ON4A 5JCGA 1M9BA 5AN1A 3GTUB 2L59A 1FO5A 2YZHA 5GAPD 1EP8A 2MZCA 4WR5A 1RQMA 2C0GA 4KUNA 5EVOA 3UMAA 3FZ5A 1VF3A 2EIOA 3CSIA 2LNSA 1BQ7A 4X43A 1ZOFA 1PGTA 2HRFA 3WT2A 4GWRA 1EOGA 1EV9A 5BMUA 3QDNA 3LORA 3ZFLA 2GVPA 2IN3A 4YAVA 1JZOA 2H30A 1XWKA 2YP6A 3ZZXA 1LJRA 1HD2A 5G31A 3IPZA 2E2MA 3BCKA 2YN1A 1BAYA 2XBQA 2HYXA 5IPGA 1DUGA 1M9AA 1F9MA 3GNJA 5G5EA 2C0DA 5IQYA 2YPMA 3CTFA 1XFLA 4K7IA 1THXA 1K3LA 3FW2A 2VLUA 1XW5A 3TKSC 5IMCA 4LA1A 2WCIA 4AJ8A 4BWQA 4KDUA 3FZ9A 4LMVA 5JCUA 1FB6A 2HZFA 4KCAA 2YV9A 4X1UA 3H79A 2VCVA 4L5LA 4IP1A 4K2DA 3EINA 2JU5A 4N11A 4FYBA 4Q5QA 2B1LA 2H6ZA 3GSSA 2TRCP 5HR3A 4IN0A 4TR4A 2P5RA 5LCZA 3TKSA 4XHMA 4JU5A 5B8AA 2YJHA 4GXZA 3LXTA 5ECSA 1AQWA 3AY8A 5GSSA 2JZTA 4V2MA 1IYHA 5DJMA 1A24A 1HNCA 4Q5FA 4OFNA 3EE2A 5IO2A 4OMVA 3Q18A 3BOAA 5ECOB 2LQOA 5DALB 4MA9A 2CT6A 1H75A 3DEXA 2KUCA 1XIYA 4PX1A 2H1BA 3DWVA 4OO5A 1K0OA 4G9HA 3CSHA 2C0FA 3EWLA 4OCEA 1SYRA 5G2ZA 6GSXA 7GSSA 2HRNA 3KZQA 2XPEA 1T1VA 1O8XA 1M2AA 3KP9A 2GT5A 4OO4A 3GKMA 4HQZA 5A5KA 5E4WA 3DVWA 1G0TA 4AJ7A 4BA7A 1SJ6A 1W4VA 1XXUA 2X8CA 2OA7A 4ULXA 5ID2B 2O85A 3TKSE 2CA8A 4IW9A 2PBJA 3ME7A 4HZ4A 5JWRB 2GSRA 1NW2A 2CV4A 4O92A 3QR6A 3D6IA 4I5QA 3UJ1A 1BJXA 3GRXA 5ECQB 5D93A 3WGEA 2H1DA 2E2GA 2LKUA 1A2JA 1HYUA 2H8LA 2OKAA 5CRGA 5EPFA 3G7YA 3LG6A 1O8WA 1K3OA 3C73A 1UA5A 3O76A 3TUEA 4AGSA 1X0RA 1LU4A 1MDIA 2JSYA 3HXSA 1JZDA 3FYGA 1J9BA 2DJ2A 4ZILA 3WGDA 4NWYA 2OACA 2I3YA 5ECLB 5F8BA 2AJQB 2QKEA 4YAPA 1WWJA 1ZYQB 14GSA 2K9FA 3QCPA 4K7OA 2AYTA 4IKHA 2WFCA 2IMIA 2O8VB 4O32A 3KGKA 3G7IA 4YQMA 3F4RA 4IP6A 4IQAA 2VIMA 1AAZA 4MF5A 4RI7A 3LWAA 3ZFBA 2OE3A 3KH9A 3L9SA 1BYEA 2LJAA 1A2MA 4TKYA 2I4AA 3FZAA 3TOUA 1ERTA 2RUFA 3L78A 4L0WA 1R4WA 2A2SA 2B7KA 3WGXA 5IO0A 3QAGA 3MDKA 2YV7A 4G0IA 2L4QA 3DRNA 4Z7XA 1YKAA 2E0QA 2VAFA 5JWQB 4BPYA 4V2LA 2CQ9A 1GTAA 5D96A 2F51A 5KN3A 1JHBA 4BVYA 2G2QA 3IXRA 6GSSA 2FWHA 1FOVA 3Q74A 1NHOA 1V58A 6GSUA 2LNTA 4AF2A 1SKSB 4MCUA 1YEPA 5AGYA 2RIIA 4XS4A 4KF9A 4KH7A 5DCGA 2QSIA 2HZEA 3O6TA 2OADA 4MABA 4KB3A 4FQUA 4ZIJA 2GT6A 1XZOA 1JLWA 4LL4B 1B48A 1WMJA 4GTUA 5G30A 5CREA 3O3TA 4TVEA 4IELA 3IC8A 1JLVA 4H86A 1DBYA 4WEYA 3NOFA 4TOPA 2GSTA 1Z7RA 1GRXA 4ZL8A 4EUYA 4PUFC 5DQYA 4J57E 3LSZA 1ERVA 3IE3A 3D0ZA 3FK8A 5CRDA 1FHEA 4FYUA 4EC0A 1GTUA 3CRTA 4RUVA 2R2JA 1K0DA 3WT1A 4ECIA 1MDKA 2VL2C 4PNFA 1AIUA 4NMUA 4ZBBA 4ZL7A 2C3NA 3GHAA 3W6GA 1EEJA 3F6FA 1K0MA 2JZSA 1SU9A 2PVOC 2R5GA 4KA0A 1BG5A 2LUSA 4PUAA 4OCFA 2C0EA 4PNGA 1NM3A 1AUCA 3EURA 2DJ3A 5ECRB 2R6KA 3CMIA 1T00A 2VL2A 5KN2A 5DDLA 1FVKA 3ZMLA 2IIYA 1PL2A 5B6NA 5ECHB 1SYXA 2REMA 5LD0A 1UC7A 1UVZA 3TGZA 2RM6A 3ZMKA 5G1KA 3APOA 4ML1A 1THOA 2OBIA 5DAKA 3L0HA 4IS0A 3L4NA 3DXBA 4RQXA 1RK4A 2RLIA 2HSHA 1M0UA 5CO3A 5JCWA 3LYKA 1CQGA 1KBNA 2ZCTA 2VCTA 1NHYA 5B8BA 4POKA 1UN2A 1DSBA 3ED3A 4FIWA 3GYKA 3KEBA 5B7CA 2P5QA 1SK1A 5EY6A 3TJBA 1FAAA 1R26A 4MF7A 4OWYA 4XTSA 1GP1A 4IQ1A 2IFQB 3QAVA 1H4OA 1YDKA 1MD4A 4X0XA 3IHQA 5ECKB 4GSTA 2PWJA 1GUKA 4KDYA 1TJDA 2N5BA 2EIQA 2DC5A 4E8HA 2H1AA 2PPTA 4EDZA 1GUMA 4MH3A 4GCIA 3F3RA 1F6MC 4K6XA 1X5CA 3RPNA 3EU4A 1V57A 4O5RA 3R3EA 4ECJA 3PR8A 2V41A 1I9DA 2FWFA 4GRFA 3EMPA 1GSYA 4L0UA 3L9UA 4TR1A 3VLNA 1T8EB 1QUWA 3ZREA 3LXZA 2V1MA 4QQ7A 2H70A 1RW1A 1SL2B 1G6YA 3RHCA 4K0GA 1TK8B 4FO5A 12GSA 2YOIA 1ML6A 4MDCA 4F03A 4WBJA 2F8FA 1PKZA 1AC1A 3QFAC 2H0IA 4TW5A 3NZNA 3F0IA 3IR4A 2MMAA 4GLTA 4TR0A 4JR6A 2HSYA 2H74A 2L6DA 3UARA 4EE0A 3APQA 1USBA 3KTLA 3GUSA 1U3IA 5HR2A 1G7EA 2L6CA 1YEXA 4HUAA 3RAZA 3Q19A 1GSFA 5D9VA 1CQHA 1O73A 3KMOA 3ZITA 2CVDA 2WRTA 1MTCA 1PKWA 1ST9A 2L5OA 1ZGNA 3U5RE 2FD3A 5A4VA 4EXJA 11GSA 3LGCA 3VWXA 2WULA 2FA8A 2FUG2 1GSEA 2YZUA 3GFKA 4WBRD 4KDXA 4V1Ap 2VD1A 4WF4A 1GH2A 4MJAA 3D4TA 3E0UA 3RHBA 4NXIA 1J0FA 3BBYA 2QC7A 1GUHA 1WOUA 3TRPA 2P31A 5J9CA 2MMOA 5HFIA 3C8EA 4V1Ag 2HSNB 3TB2A 3UEMA 5IMDA 1QK8A 2EC4A 3UL3A 4OD7A 2H6XA 1PX7A 2CZ2A 2F9SA 4HJMA 1A0FA 2KHPA 2VLVA 3L9VA 3VWUA 2C3QA 4JEDA 5AIXA 3GKXA 4I6XA 3RDWA 1YY7A 1WIKA 2M80A 2V6KA 1WPIA 2H71A 3DYRA 1R5AA 5HQPA 2VCXA 2V2GA 3KD0A 4BVXB 1Q98A 4RQRA 2AB6A 20GSA 3VWVA 3GKKA 2OE1A 4XRAA 5ECPB 3I43A 4NV2A 2C1YA 4ID0A 4PQHA 4NHZA 3W8JA 3H4KA 3HCZA 2BMXA 4NV5A 1PMTA 4BVYB 3CTGA 6GSTA 3G9BA 4MP4A 4DSRA 1GLPA 1XOAA 2UZ8A 3J7Yb 3ZVJD 3KJYA 4DVCA 2JL4A 3F6DA 3ERGA 5INYA 1Z9HA 3HD5A 3DMLA 4YQVA 1ABAA 1ZYEA 3OR5A 2EIRA 3ZIJA 2ALBA 2C4JA 1X5DA 4E8EA 3SBCA 2YWOA 2LS5A 5FWGA 2GSSA 4N10A 1Y25A 2H19A 2LRCA 2X64A 2VM1A 5GSTA 2IL3A 2K6VA 1V98A 3DGQA 2PGTA 2KP1A 3QFBC 3DD3A 4K7NA 1VF1A 1PA3A 1PQNA 1E2YA 2FCHA 3HA9A 3ME8A 3W8SA 2LRTA 4HDEA 2HXKA 3A3TA 4Q5RA 1C72A 4KSMA 3ZIVA 2GQMA 1YF1A 1U88A 3P90A 4LMWA 1GL8A 3US3A 2LRNA 4QL9A 4MMMA 1TU7A 1T4YA 1B4QA 4DSQA 1G6WA 3PPUA 2RUEA 2ON7A 2PMTA 4MK3A 3HVSA 4ECCA 4MJBA 1S3CA 1EZKA 1PD21 1GSQA 1O7UA 5IMAA 4G19A 1W89A 3DIEA 1SD8A 3KP8A 4XS1A 1TTZA 1OKDA 4POLA 3HJPA 3A5WA 1OC9B 2HFDA 2D2ZA 1X9WB 5KEJA 5ENUA 3VPQA 1F3BA 2B5XA 1T3BA 4OFMA 2R37A 1URMA 1TRUA 3TOTA 1K0BA 3UBKA 2YWNA 1GSUA 3ERFA 2PU9C 2ZNMA 4ZB6A 2CX3A 4ML6A 5FT3A 1EP7A 4HEA2 3VWWA 4N0ZA 5CAXA 13GSA 1XCCA 1ILOA 1A23A 3CRUA 6GSYA 1OYJA 4J56E 1V2AA 4JE1A 2GZPA 4KX4A 1Z7PA 3DKSA 3VPTA 3N9JA 1HNAA 4D73A 2KLXA 1KNGA 2L4CA 1GTIA 1V40A 5ID2A 2H1GA 1OE8A 1TI1A 2CAIA 2NTOA 4EKZA 1M7TA 3F9UA 3TDGA 9GSSA 4IVFA 1B9YC 3HDCA 1BX9A 4L5OA 2IWTA 4AJ6A 2IMEA 3MSZA 4TXOA 1EEMA 4HQSA 3P2AA 2HLSA 1GNWA 18GSA 5HR0A 4TR1B 2ES7A 1V9WA 5L71A 3M3MA 3D22A 3E3EA 4K8MA 2A4VA 1FVJA 1EGOA 3GIXA 4MJCA 1X9MB 2DMMA 3HY2A 1XVWA 1SL0B 1WE0A 5B6MA 4BL7A 4DSSA 1ZL9A 2GZYA 5J4UA 3GH9A 1EWXA 3R2QA 3UOMA 2I9HA 3C7MA 2AUVA 1VGLA 2VOCA 3CBUA 2LTKA 4TRXA 1MDJA 1O85A 1EV4A 1FB0A 4HZ2A 2PVQA 3TJFA 3TKQA 2N5FA 4IJIA 4MLYA 3TRXA 4KSOA 1QFNA 1XW9A 3D5JA 4CHSA 2MMZA 5ECNB 3M9JA 4MJEA 2HRAA 3QOUA 4N30A 1T4ZA 3C1SA 1WP0A 4ZXGA 2L57A 3KH7A 1Z3EA
chains in the Genus database with same CATH superfamily
3GURA 4LL1B 3LYPA 2IJYA 3BCIA 3M9KA 4KNDA 3VI7A 2XPDA 2WW1A 1ZYNA 3FRCA 1FOHA 2HRKA 2HE3A 3HHVA 4POBA 1OC8A 2GZZA 3HVXA 3PH9A 1SKRB 2CAQA 1SJZA 2B5EA 4K0NA 2YNXA 5F07A 2VM2A 3ZVJA 3GKNA 1TP9A 1SL1B 2LSTA 3RBTA 5GZZB 3VFIA 3KIJA 4JZQA 3LFLA 3QMXA 2HI7A 5J41A 3HJOA 1X9SB 2CVKA 2EFCA 2F3MA 3FR9A 1TK0B 2HSMA 1Y1UA 2HT9A 1GLQA 1VF2A 1WRYA 2IMKA 1A8LA 5JWOB 1OC3A 4GDFA 2ZUPA 1B9XC 2WW2A 1BG1A 3UBLA 5J4VA 2BJXA 1OVNA 3FHKA 1OAZA 4WKWA 1GULA 3KTBA 2LV3A 1K0NA 2WZSA 3UVHA 1OKTA 4V2NA 5D73A 2FHEA 2PN8A 2TIRA 4XIHA 5LNKe 1SJIA 4HOJA 2X8GA 3A2WA 1E6BA 1K3YA 2GQKA 1Z6MA 3IDVA 4MPGA 3P7XA 3GMFA 3GV1A 2DJ0A 1GNEA 2WJUA 2M72A 4DEJA 2DJ1A 2VL9A 4MZCA 3IA1A 4BWSA 5KN0A 2NDOA 2GSQA 4XS6A 3F3QA 1AW9A 2XBIA 1ACVA 5ABRA 2DIYA 4JR4A 2IMDA 3I6AA 5AIVA 3WD6A 1ZZYA 4CW9A 5IPHA 2FWEA 3ZTLA 1XG8A 2XC2A 2H0GA 2H75A 2X99A 2X8HA 4HU7A 5COHA 3U6VA 5CRHA 2YWMA 1XOBA 4HS1A 2LEGA 4NPBA 3UAPA 4G10A 4JRRA 3P8WA 3EU3A 3C71A 3A2VA 3IC4A 4KE3A 3FY7A 1LBKA 4EDYA 3IAM2 3FR6A 1NSWA 2MMNA 4GQCA 1U3AA 3GL3A 5A4UA 2FY6A 2K8VA 1PN9A 3GX0A 2OT3A 2G0FA 2H6YA 1Z5YE 3GA4A 4TN8A 1DE1A 4F0BA 2QA1A 5ECIB 2PERA 2MBTA 4PQ1A 4HJ2A 2YCDA 2L5LA 2HQTA 4AKHA 1ZYPA 2J9HA 2B7JA 2R4VA 4YH2A 2LJKA 5CP1A 4CDOA 5J5NA 4MPFA 2FA4A 3VK9A 2O7KA 2GGTA 4O7HA 2CVBA 3GL5A 3RPPA 2CX4A 3GH6A 1EOHA 2FNOA 1GSSA 4ZL9A 3EC3A 3IK7A 4RI6A 5D9WA 5G1LA 5H5SA 4ACSA 4EL1A 4ZB8A 2QGVA 2KOKA 4EVMA 1A2LA 1TKDB 5F0GA 2IFQA 4K2XA 1SK0A 3D21A 1B4PA 2VUPA 2TRXA 3IK9A 5A5HB 3M0FA 3F4TA 3IOSA 5IMFA 2GQLA 1KTEA 1JFUA 1VRSD 5J9BA 2JADA 5F05A 22GSA 1IYIA 3JCML 4AI6A 3EYTA 1K0CA 2MBSA 1PL1A 2NVLA 2I1UA 1XBSA 2DJKA 1QGVA 5IM9A 2H73A 4PQIA 2H72A 3TJJA 3PGTA 3KM6A 4K1FA 3Q6OA 4NAXA 1YJ6A 4XRDA 4F82A 3F4SA 4I8BA 1WJKA 4KCEA 1FG4A 1PSQA 2CZ3A 2O87A 3H93A 2PUKC 4IGJA 4EF0A 3RGBC 2A2RA 1F3AA 1R7HA 1T7PB 1M2BA 3GTUA 16GSA 19GSA 1GWCA 4ZB9A 4XS4B 3EVIA 5ELAA 4ECBA 4F0CA 2HZEB 1KEBA 5ECMB 4G0LA 4WR4A 3TCOA 1A0RP 4D73B 2NBSA 3KCMA 2VO4A 2X49A 1Q4JA 3IRAA 1PRXA 1QXHA 1TXUA 4KW6A 3S9FA 1TRVA 4QMKA 4ZBAA 4USSA 1JZWA 2BTOT 5DJLA 4POMA 4EO3A 4PI0C 5H5RA 2DSAA 1HNBA 1SK2A 2FLSA 4GQFA 1N2AA 4L8EA 5CYYA 2OBKA 3HVNA 3QAWA 2B5YA 2H76A 2WDUA 4ILFA 3CHXC 4TXOB 4FH8A 1SD9A 2P0GA 1J08A 3TKRA 4NHWA 3N5OA 4IJ3A 2C8UA 2VCQA 1ERWA 1AQXA 4TR3A 1XWAA 8GSSA 1F37A 1I5GA 2M46A 1YQ1A 5IMZA 4GSNA 3QPMA 4BL7B 4DSSB 2B3SA 5A4WA 2GDRA 4I2UA 2JZRA 2XHFA 3M8NA 5ELGA 2FWGA 2DIZA 1AQVA 2DBCA 2N5AA 4HU9A 5CRWA 3APSA 3IBHA 1XWCA 2VCWA 1GTBA 3VURA 4PGTA 2B6MA 3HYPA 1MEKA 4K9ZA 5HFKA 3LEFA 3UVTA 2DLXA 1M2DA 3MWHA 3V1WA 4TXVA 5DAKB 4BVXA 3KMNA 5D8IA 4I2TA 3NIVA 2FGXA 3C1RA 1JZRA 1QMVA 1S3DA 4N0VA 1TRWA 4MH2A 1GSDA 4KAEA 1ERUA 1TRSA 2H01A 3K8NA 3HMJG 5DALA 1TOFA 4G0KA 5C00A 4I97A 3SWLA 2JACA 2C80A 4MZBA 1TK5B 5HR1A 2GTUA 1M99A 4F9ZA 3CSJA 2K18A 1FW1A 5IMVA 2WW3A 2HRKB 3A5IA 5D9XA 2VLTA 3F8UA 2EFEA 2GS3A 4CY8A 3E9JB 1B8XA 2WZ9A 3F63A 2ON5A 3DVXA 3A2XA 2HNLA 2DMLA 1XWGA 2J23A 3IAS2 2V32A 3CXGA 3G7JA 2IMFA 2YWIA 1QQ2A 3GSTA 5H5QA 2HSMB 2MYGA 1K0AA 4PXOA 4P3YB 1Z6NA 2VD0A 1OE7A 2AAWA 3TJGA 4WF5A 1EGRA 1HQOA 1Y6EA 3PINA 3TJKA 2OJLA 2DJJA 1PX6A 5GAND 4Q5NA 1AXDA 2EFDA 2VCZA 5HFGA 3FKFA 6GSVA 10GSA 1O81A 3ISOA 5J3RA 2V6OA 5C04A 1R5PA 4KGIA 3HZ8A 1SENA 4J2FA 5DQSA 3MAKA 1DE2A 4GSSA 5CNWA 3FR3A 3RFRC 4F2IA 1F2EA 3HKRA 4ZBDA 4WETA 3GN3A 4ISDA 1XWBA 1O6JA 1XPVA 3H8QA 3GX8A 4A5PA 6GSWA 1MD3A 5A1NA 2EFHA 2GLRA 2OE0A 1S3AA 3FZ4A 1OC9A 3ERWA 3LJRA 2B1KA 3UIWA 1XW6A 1XVQA 4G2EA 3ZRDA 2WB9A 5G5FA 2KP2A 17GSA 3FEUA 3M1GA 3QD9A 3ZL5A 1TXXA 5DCHA 3MNGA 4AKIA 4IHUA 2JSZA 1SKWB 1TI3A 3VI5A 1M3IA 3ZLPA 3TKPA 1SVLA 1N8JA 2WGRA 5IIZA 4FYCA 2RM5A 5EL8A 2LJRA 3LQ7A 4IBPA 3WYWA 1YF0A 2H0HA 2F8AA 3HZ4A 4JBBA 3TRQA 2LQQA 4ZB7A 2C3TA 5DVBA 5F06A 4GF0A 1TU8A 3BD2A 2K8SA 2R3XA 1BF5A 4LLRA 1G7OA 3ZYWA 4HSCX 3KXOA 1YKCA 5AISA 3BJ5A 2AV4A 5IOXA 1ZCPA 2IPAA 4OFTA 3IV4A 3I69A 3I9V2 1U6TA 1A8YA 5DBQA 3D4MA 1U87A 2O5VA 2VL3A 3J7Yk 5IOWA 2E7PA 5FHIA 3EMXA 2WS2A 4MZWA 3H1NA 2I81A 4QL7A 1X5EA 3CYNA 4HI7A 5E59A 4WXTA 3HVVA 1TW9A 4XCSA 4AKXB 2R0CA 1VF4A 1YZXA 2H66A 4MF6A 1BEDA 3HJMA 2AHEA 2O89A 4PURA 4PTSA 1TDIA 4YQUA 5KN1A 1ZMAA 2Z9SA 2YJ7A 2NPBA 2YANA 5D9TA 1ON4A 5JCGA 1M9BA 5AN1A 3GTUB 2L59A 1FO5A 2YZHA 5GAPD 1EP8A 2MZCA 3MYDA 4WR5A 2DKHA 1RQMA 2C0GA 4KUNA 5EVOA 3UMAA 3FZ5A 1VF3A 2EIOA 3CSIA 5BRTA 2LNSA 1BQ7A 2A4HA 4X43A 1YEWC 1ZOFA 1PGTA 2HRFA 3WT2A 4GWRA 1EOGA 1EV9A 5BMUA 3QDNA 3LORA 3ZFLA 2GVPA 2IN3A 4YAVA 1JZOA 2H30A 1XWKA 2YP6A 3ZZXA 1LJRA 1HD2A 5G31A 3IPZA 2E2MA 3BCKA 2YN1A 1BAYA 2XBQA 2HYXA 5IPGA 1DUGA 1M9AA 1F9MA 3GNJA 5G5EA 2C0DA 1SVMA 5IQYA 2YPMA 3CTFA 1XFLA 3FW2A 1THXA 1K3LA 4K7IA 2VLUA 1XW5A 3TKSC 5IMCA 4LA1A 2WCIA 4AJ8A 4BWQA 4KDUA 3FZ9A 4LMVA 5JCUA 1FB6A 2HZFA 4KCAA 2YV9A 4X1UA 3H79A 2VCVA 4L5LA 4IP1A 4K2DA 3EINA 2JU5A 4N11A 4FYBA 4Q5QA 2B1LA 2H6ZA 3GSSA 2TRCP 5HR3A 4IN0A 4TR4A 2P5RA 5LCZA 3TKSA 4XHMA 4JU5A 5B8AA 2YJHA 4GXZA 3LXTA 5ECSA 1AQWA 3AY8A 5GSSA 2JZTA 4V2MA 1IYHA 5DJMA 1A24A 1HNCA 4Q5FA 4OFNA 3EE2A 4K5RA 5IO2A 4OMVA 3Q18A 3BOAA 5ECOB 2LQOA 5DALB 4MA9A 2CT6A 1H75A 3DEXA 2KUCA 1XIYA 4PX1A 2H1BA 3DWVA 4OO5A 1K0OA 4G9HA 3CSHA 2C0FA 3EWLA 4OCEA 1SYRA 5G2ZA 6GSXA 7GSSA 2HRNA 3KZQA 2XPEA 1T1VA 1O8XA 1M2AA 3KP9A 2GT5A 4OO4A 5A34A 3GKMA 4HQZA 5A5KA 5E4WA 3DVWA 1G0TA 4AJ7A 4BA7A 1SJ6A 1W4VA 1XXUA 2X8CA 2OA7A 4ULXA 5ID2B 2O85A 3TKSE 2CA8A 4IW9A 2PBJA 3ME7A 4HZ4A 5JWRB 2GSRA 1NW2A 2CV4A 4O92A 1M3JA 3QR6A 3D6IA 4I5QA 3UJ1A 1BJXA 3GRXA 5ECQB 5D93A 3WGEA 2H1DA 2E2GA 2LKUA 1A2JA 1HYUA 2WVYA 2H8LA 2OKAA 5CRGA 5EPFA 3G7YA 3LG6A 1O8WA 1K3OA 3C73A 1UA5A 3O76A 3TUEA 4AGSA 1X0RA 1LU4A 1MDIA 2JSYA 3HXSA 1JZDA 3FYGA 1J9BA 2DJ2A 4ZILA 3WGDA 4NWYA 2OACA 2I3YA 2HSNA 5ECLB 5F8BA 2AJQB 2QKEA 4YAPA 1WWJA 1ZYQB 14GSA 2K9FA 3QCPA 4K7OA 2AYTA 4IKHA 2WFCA 2IMIA 2O8VB 4O32A 3KGKA 3G7IA 4YQMA 3F4RA 4IP6A 4IQAA 2VIMA 1AAZA 4AKGA 4MF5A 4RI7A 3LWAA 3ZFBA 2OE3A 3KH9A 3L9SA 1BYEA 2LJAA 1A2MA 4TKYA 2I4AA 3FZAA 3TOUA 1ERTA 2RUFA 3L78A 4L0WA 1R4WA 2A2SA 2B7KA 3WGXA 5IO0A 3QAGA 3MDKA 2YV7A 4G0IA 2L4QA 3DRNA 4Z7XA 1YKAA 2E0QA 2VAFA 5JWQB 4BPYA 4V2LA 2CQ9A 1GTAA 5D96A 2F51A 5KN3A 1JHBA 4BVYA 2G2QA 3IXRA 6GSSA 2FWHA 1FOVA 3Q74A 1NHOA 1V58A 6GSUA 2WVXA 2LNTA 4AF2A 1SKSB 4MCUA 4YKFA 1YEPA 5AGYA 2RIIA 4XS4A 4KF9A 4KH7A 5DCGA 2QSIA 2HZEA 3O6TA 2OADA 4MABA 4KB3A 4FQUA 4N3ZA 4ZIJA 2GT6A 1XZOA 1JLWA 4LL4B 1B48A 1WMJA 4GTUA 5G30A 4YKGA 5CREA 3O3TA 4TVEA 4IELA 3IC8A 1JLVA 4H86A 1DBYA 4WEYA 3NOFA 4TOPA 2GSTA 1Z7RA 4O5QA 1GRXA 4ZL8A 4EUYA 4PUFC 2A2PA 5DQYA 4J57E 3LSZA 1ERVA 3IE3A 3D0ZA 3FK8A 5CRDA 1FHEA 4FYUA 4EC0A 1GTUA 3CRTA 4RUVA 2R2JA 1K0DA 3WT1A 4ECIA 4W66A 1MDKA 2VL2C 4PNFA 1AIUA 4NMUA 4ZBBA 4ZL7A 2C3NA 3GHAA 3W6GA 1EEJA 3F6FA 1K0MA 2JZSA 1SU9A 2PVOC 2R5GA 4KA0A 1BG5A 4PI2C 2LUSA 4PUAA 4OCFA 1SVOA 2C0EA 4PNGA 2WW0A 1NM3A 1AUCA 3EURA 2DJ3A 5ECRB 2R6KA 3CMIA 1T00A 2VL2A 5KN2A 5DDLA 1FVKA 4BIKA 3ZMLA 2IIYA 1PL2A 5B6NA 5ECHB 3MIXA 1SYXA 2REMA 2R0GA 5LD0A 1UC7A 1UVZA 5KOWA 3TGZA 2RM6A 3ZMKA 5G1KA 3APOA 5J4YA 4ML1A 1THOA 2OBIA 5DAKA 3L0HA 4IS0A 3L4NA 3DXBA 4RQXA 1RK4A 2RLIA 2HSHA 1M0UA 5CO3A 5JCWA 3LYKA 1CQGA 1KBNA 4Z2UA 2ZCTA 2VCTA 1NHYA 5B8BA 4POKA 1UN2A 1DSBA 3ED3A 4FIWA 3GYKA 3KEBA 5B7CA 2P5QA 1SK1A 5EY6A 3TJBA 1FAAA 1R26A 4MF7A 4OWYA 4XTSA 1GP1A 4IQ1A 2IFQB 3QAVA 1N25A 1H4OA 1YDKA 1MD4A 4X0XA 3IHQA 5ECKB 4GSTA 2PWJA 1GUKA 4KDYA 1TJDA 2N5BA 2EIQA 2DC5A 4E8HA 2H1AA 3TU3B 2PPTA 2QA2A 4EDZA 1GUMA 4MH3A 4GCIA 3F3RA 1F6MC 4K6XA 1X5CA 3CQFA 3RPNA 3EU4A 1V57A 4O5RA 3R3EA 4ECJA 3PR8A 2V41A 1I9DA 2FWFA 4GRFA 3EMPA 1GSYA 4L0UA 3L9UA 4TR1A 3VLNA 1T8EB 1QUWA 3ZREA 3LXZA 2V1MA 4QQ7A 2H70A 1RW1A 4EIQA 1SL2B 1G6YA 3RHCA 4K0GA 2UV8G 1TK8B 4FO5A 12GSA 2YOIA 1ML6A 4MDCA 4F03A 4WBJA 2F8FA 1PKZA 1AC1A 3QFAC 2H0IA 4TW5A 3NZNA 3F0IA 3IR4A 2MMAA 4GLTA 4TR0A 4JR6A 2HSYA 2H74A 2L6DA 3UARA 4EE0A 3APQA 1USBA 3KTLA 3GUSA 1U3IA 5HR2A 5A34B 1G7EA 2L6CA 1YEXA 4HUAA 3RAZA 3Q19A 1YVLA 2R0PA 1GSFA 5D9VA 1CQHA 4CY6A 1O73A 3KMOA 3ZITA 2CVDA 2WRTA 1MTCA 1PKWA 1ST9A 2L5OA 1ZGNA 3U5RE 2FD3A 5A4VA 4EXJA 11GSA 3LGCA 3VWXA 2WULA 4E68A 2FA8A 2FUG2 1GSEA 2YZUA 3GFKA 4WBRD 4KDXA 4V1Ap 2VD1A 4WF4A 1I1IP 1GH2A 4MJAA 3D4TA 3E0UA 3RHBA 4ICYA 4NXIA 1J0FA 3BBYA 2QC7A 1GUHA 1WOUA 3TRPA 2P31A 5J9CA 1S4BP 2MMOA 5HFIA 3C8EA 4V1Ag 2HSNB 3TB2A 3UEMA 5IMDA 1QK8A 2EC4A 3UL3A 4OD7A 2H6XA 1PX7A 2CZ2A 2F9SA 3LW9A 1PFOA 4HJMA 1A0FA 2KHPA 2VLVA 3L9VA 4K5SA 3VWUA 2C3QA 4JEDA 1S3RA 5AIXA 3GKXA 4I6XA 3RDWA 1YY7A 1WIKA 2M80A 2V6KA 1WPIA 2H71A 3DYRA 1R5AA 5HQPA 4FXYP 2VCXA 2V2GA 3KD0A 4BVXB 1Q98A 4RQRA 2AB6A 20GSA 3VWVA 3GKKA 2OE1A 4XRAA 5ECPB 3I43A 4NV2A 2C1YA 3IHGA 4ID0A 4PQHA 4NHZA 3W8JA 3H4KA 3HCZA 2BMXA 4NV5A 1PMTA 4BVYB 3CTGA 6GSTA 3G9BA 4MP4A 4DSRA 1GLPA 2WVXB 1XOAA 2UZ8A 3J7Yb 3ZVJD 3KJYA 4DVCA 3EPTA 2JL4A 3F6DA 3ERGA 5INYA 4O5UA 1Z9HA 3HD5A 3DMLA 4YQVA 1ABAA 1ZYEA 3OR5A 2EIRA 3ZIJA 2ALBA 2C4JA 1X5DA 4E8EA 3SBCA 3FMWA 2YWOA 2LS5A 5FWGA 2GSSA 4N10A 1Y25A 2H19A 2LRCA 2X64A 2VM1A 5GSTA 4Z2TA 4MNNA 2IL3A 2K6VA 1V98A 3DGQA 2PGTA 2KP1A 3QFBC 3DD3A 4K7NA 1VF1A 1PA3A 1PQNA 1E2YA 2FCHA 3HA9A 5KOXA 3ME8A 3W8SA 2LRTA 4HDEA 2HXKA 3A3TA 4Q5RA 1C72A 4KSMA 3ZIVA 2GQMA 3CWGA 1YF1A 1U88A 3P90A 4LMWA 1GL8A 3US3A 2LRNA 4QL9A 4MMMA 1TU7A 1T4YA 5J40A 1B4QA 4DSQA 1G6WA 3PPUA 2RUEA 2ON7A 2PMTA 4MK3A 3HVSA 4ECCA 2O3EA 4MJBA 1S3CA 1EZKA 1PD21 1GSQA 1O7UA 5IMAA 4G19A 5A5HA 1W89A 3DIEA 1SD8A 3KP8A 5A1NB 4XS1A 1TTZA 1OKDA 4POLA 3HJPA 3A5WA 1OC9B 2HFDA 2D2ZA 1X9WB 5KEJA 2WVZA 1PN0A 5ENUA 3VPQA 1F3BA 2B5XA 1T3BA 4OFMA 2R37A 1URMA 1TRUA 3TOTA 1K0BA 3UBKA 2YWNA 1GSUA 3ERFA 2PU9C 2ZNMA 4ZB6A 2CX3A 4ML6A 5FT3A 1EP7A 4HEA2 3VWWA 4N0ZA 5CAXA 13GSA 1XCCA 1ILOA 1A23A 3CRUA 6GSYA 1OYJA 5J47A 4J56E 1V2AA 4JE1A 2GZPA 4KX4A 1Z7PA 3DKSA 3VPTA 2O36A 4PHZC 3N9JA 2DKIA 1HNAA 4D73A 2KLXA 1KNGA 2L4CA 1GTIA 1V40A 5ID2A 2H1GA 4EIPA 1OE8A 1TI1A 2CAIA 2NTOA 4EKZA 1M7TA 4X4JA 3F9UA 3TDGA 9GSSA 4IVFA 1B9YC 3HDCA 1BX9A 4L5OA 2IWTA 4AJ6A 2IMEA 3MSZA 4TXOA 1EEMA 4HQSA 3P2AA 2HLSA 1GNWA 18GSA 5HR0A 4TR1B 2ES7A 1V9WA 5L71A 3M3MA 3D22A 3E3EA 4K8MA 2A4VA 1FVJA 1EGOA 3GIXA 4MJCA 1X9MB 2DMMA 3HY2A 1XVWA 1SL0B 1WE0A 5B6MA 4BL7A 4DSSA 2VKZG 1ZL9A 2GZYA 5J4UA 3GH9A 1EWXA 3R2QA 3UOMA 2I9HA 3C7MA 2AUVA 1VGLA 2VOCA 3CBUA 2LTKA 4TRXA 1MDJA 1O85A 1EV4A 2X4AA 1FB0A 4HZ2A 2PVQA 3TJFA 3TKQA 2N5FA 4IJIA 4MLYA 3TRXA 4KSOA 1QFNA 1XW9A 3D5JA 4CHSA 4Z2RA 2MMZA 5ECNB 3M9JA 4MJEA 2HRAA 3QOUA 5BMUB 4N30A 4G01A 1T4ZA 3C1SA 2H1LA 1WP0A 4ZXGA 2L57A 3KH7A 1Z3EA
chains in the Genus database with same CATH topology
3GURA 4LL1B 3LYPA 2IJYA 3BCIA 3M9KA 4KNDA 3VI7A 2XPDA 1ZYNA 3FRCA 1FOHA 2HRKA 2HE3A 3HHVA 4POBA 1OC8A 2GZZA 3HVXA 3PH9A 1SKRB 2CAQA 1SJZA 2B5EA 4K0NA 2YNXA 5F07A 2VM2A 3ZVJA 3GKNA 1TP9A 1SL1B 2LSTA 3RBTA 5GZZB 3VFIA 3KIJA 4JZQA 3LFLA 3QMXA 2HI7A 5J41A 3HJOA 1X9SB 2CVKA 2EFCA 2F3MA 3FR9A 1TK0B 2HSMA 1Y1UA 2HT9A 1GLQA 1VF2A 1WRYA 2IMKA 1A8LA 5JWOB 1OC3A 4GDFA 2ZUPA 1B9XC 1BG1A 3UBLA 5J4VA 2BJXA 1OVNA 3FHKA 1OAZA 4WKWA 1GULA 3KTBA 2LV3A 1K0NA 3UVHA 1OKTA 4V2NA 5D73A 2FHEA 2PN8A 2TIRA 4XIHA 5LNKe 1SJIA 4HOJA 2X8GA 3A2WA 1E6BA 1K3YA 2GQKA 1Z6MA 3IDVA 4MPGA 3P7XA 3GMFA 3GV1A 2DJ0A 1GNEA 2WJUA 2M72A 4DEJA 2DJ1A 2VL9A 4MZCA 3IA1A 4BWSA 5KN0A 2NDOA 2GSQA 4XS6A 3F3QA 1AW9A 2XBIA 1ACVA 5ABRA 2DIYA 4JR4A 2IMDA 3I6AA 5AIVA 3WD6A 1ZZYA 4CW9A 5IPHA 2FWEA 3ZTLA 2XC2A 2H0GA 2H75A 2X99A 2X8HA 4HU7A 5COHA 3U6VA 5CRHA 2YWMA 1XOBA 4HS1A 2LEGA 4NPBA 3UAPA 4G10A 4JRRA 3P8WA 3EU3A 3C71A 3A2VA 3IC4A 4KE3A 3FY7A 1LBKA 4EDYA 3IAM2 3FR6A 1NSWA 2MMNA 4GQCA 1U3AA 3GL3A 5A4UA 2FY6A 2K8VA 1PN9A 3GX0A 2OT3A 2G0FA 2H6YA 1Z5YE 3GA4A 4TN8A 1DE1A 4F0BA 2QA1A 5ECIB 2PERA 2MBTA 4PQ1A 4HJ2A 2YCDA 2L5LA 2HQTA 4AKHA 1ZYPA 2J9HA 2B7JA 2R4VA 4YH2A 2LJKA 5CP1A 4CDOA 5J5NA 4MPFA 2FA4A 3VK9A 2O7KA 2GGTA 4O7HA 2CVBA 3GL5A 3RPPA 2CX4A 3GH6A 1EOHA 2FNOA 1GSSA 4ZL9A 3EC3A 3IK7A 4RI6A 5D9WA 5G1LA 5H5SA 4ACSA 4EL1A 4ZB8A 2QGVA 2KOKA 4EVMA 1A2LA 1TKDB 5F0GA 2IFQA 4K2XA 1SK0A 3D21A 1B4PA 2VUPA 2TRXA 3IK9A 5A5HB 3M0FA 3F4TA 3IOSA 5IMFA 2GQLA 1KTEA 1JFUA 1VRSD 5J9BA 2JADA 5F05A 22GSA 1IYIA 3JCML 4AI6A 3EYTA 1K0CA 2MBSA 1PL1A 2NVLA 2I1UA 1XBSA 2DJKA 1QGVA 5IM9A 2H73A 4PQIA 2H72A 3TJJA 3PGTA 3KM6A 4K1FA 3Q6OA 4NAXA 1YJ6A 4XRDA 4F82A 3F4SA 4I8BA 1WJKA 4KCEA 1FG4A 1PSQA 2CZ3A 2O87A 3H93A 2PUKC 4IGJA 4EF0A 2A2RA 1F3AA 1R7HA 1T7PB 1M2BA 3GTUA 16GSA 19GSA 1GWCA 4ZB9A 4XS4B 3EVIA 5ELAA 4ECBA 4F0CA 2HZEB 5ECMB 4G0LA 4WR4A 1KEBA 3TCOA 1A0RP 4D73B 2NBSA 3KCMA 2VO4A 2X49A 1Q4JA 3IRAA 1PRXA 1QXHA 1TXUA 4KW6A 3S9FA 1TRVA 4QMKA 4ZBAA 4USSA 1JZWA 2BTOT 5DJLA 4POMA 4EO3A 5H5RA 2DSAA 1HNBA 1SK2A 2FLSA 4GQFA 1N2AA 4L8EA 5CYYA 2OBKA 3QAWA 2B5YA 2H76A 2WDUA 4ILFA 4TXOB 4FH8A 1SD9A 2P0GA 1J08A 3TKRA 4NHWA 3N5OA 4IJ3A 2C8UA 2VCQA 1ERWA 1AQXA 4TR3A 1XWAA 8GSSA 1F37A 1I5GA 2M46A 1YQ1A 5IMZA 4GSNA 3QPMA 4BL7B 4DSSB 2B3SA 5A4WA 2GDRA 4I2UA 2JZRA 2XHFA 3M8NA 5ELGA 2FWGA 2DIZA 1AQVA 2DBCA 2N5AA 4HU9A 5CRWA 3APSA 3IBHA 1XWCA 2VCWA 1GTBA 3VURA 4PGTA 2B6MA 3HYPA 1MEKA 4K9ZA 5HFKA 3LEFA 3UVTA 2DLXA 1M2DA 3MWHA 3V1WA 4TXVA 5DAKB 4BVXA 3KMNA 5D8IA 4I2TA 3NIVA 2FGXA 3C1RA 1JZRA 1QMVA 1S3DA 4N0VA 1TRWA 4MH2A 1GSDA 4KAEA 1ERUA 1TRSA 2H01A 3K8NA 3HMJG 5DALA 1TOFA 4G0KA 5C00A 4I97A 3SWLA 2JACA 2C80A 4MZBA 1TK5B 5HR1A 2GTUA 1M99A 4F9ZA 3CSJA 2K18A 1FW1A 5IMVA 2HRKB 3A5IA 5D9XA 2VLTA 3F8UA 2EFEA 2GS3A 4CY8A 3E9JB 1B8XA 2WZ9A 3F63A 2ON5A 3DVXA 3A2XA 2HNLA 2DMLA 1XWGA 2J23A 3IAS2 2V32A 3CXGA 3G7JA 2IMFA 2YWIA 1QQ2A 3GSTA 5H5QA 2HSMB 2MYGA 1K0AA 4PXOA 4P3YB 1Z6NA 2VD0A 1OE7A 2AAWA 3TJGA 4WF5A 1EGRA 1HQOA 1Y6EA 3PINA 3TJKA 2OJLA 2DJJA 1PX6A 5GAND 4Q5NA 1AXDA 2EFDA 2VCZA 5HFGA 3FKFA 6GSVA 10GSA 1O81A 3ISOA 5J3RA 2V6OA 5C04A 1R5PA 4KGIA 3HZ8A 1SENA 4J2FA 5DQSA 3MAKA 1DE2A 4GSSA 5CNWA 3FR3A 4F2IA 1F2EA 3HKRA 4ZBDA 4WETA 3GN3A 4ISDA 1XWBA 1O6JA 1XPVA 3H8QA 3GX8A 4A5PA 6GSWA 1MD3A 5A1NA 2EFHA 2GLRA 2OE0A 1S3AA 3FZ4A 1OC9A 3ERWA 3LJRA 2B1KA 3UIWA 1XW6A 1XVQA 4G2EA 3ZRDA 2WB9A 5G5FA 2KP2A 17GSA 3FEUA 3M1GA 3QD9A 3ZL5A 1TXXA 5DCHA 3MNGA 4AKIA 4IHUA 2JSZA 1SKWB 1TI3A 3VI5A 3ZLPA 3TKPA 1SVLA 1N8JA 2WGRA 5IIZA 4FYCA 2RM5A 5EL8A 2LJRA 3LQ7A 4IBPA 3WYWA 1YF0A 2H0HA 2F8AA 3HZ4A 4JBBA 3TRQA 2LQQA 4ZB7A 2C3TA 5DVBA 5F06A 4GF0A 1TU8A 3BD2A 2K8SA 2R3XA 1BF5A 4LLRA 1G7OA 3ZYWA 3KXOA 1YKCA 5AISA 3BJ5A 2AV4A 5IOXA 1ZCPA 2IPAA 4OFTA 3IV4A 3I69A 3I9V2 1U6TA 1A8YA 5DBQA 3D4MA 1U87A 2O5VA 2VL3A 3J7Yk 5IOWA 2E7PA 5FHIA 3EMXA 2WS2A 4MZWA 3H1NA 2I81A 4QL7A 1X5EA 3CYNA 4HI7A 5E59A 4WXTA 3HVVA 1TW9A 4XCSA 4AKXB 2R0CA 1VF4A 1YZXA 2H66A 4MF6A 1BEDA 3HJMA 2AHEA 2O89A 4PURA 4PTSA 1TDIA 4YQUA 5KN1A 1ZMAA 2Z9SA 2YJ7A 2NPBA 2YANA 5D9TA 1ON4A 5JCGA 1M9BA 5AN1A 3GTUB 2L59A 1FO5A 2YZHA 5GAPD 1EP8A 2MZCA 3MYDA 4WR5A 2DKHA 1RQMA 2C0GA 4KUNA 5EVOA 3UMAA 3FZ5A 1VF3A 2EIOA 3CSIA 5BRTA 2LNSA 1BQ7A 2A4HA 4X43A 1ZOFA 1PGTA 2HRFA 3WT2A 4GWRA 1EOGA 1EV9A 5BMUA 3QDNA 3LORA 3ZFLA 2GVPA 2IN3A 4YAVA 1JZOA 2H30A 1XWKA 2YP6A 3ZZXA 1LJRA 1HD2A 5G31A 3IPZA 2E2MA 3BCKA 2YN1A 1BAYA 2XBQA 2HYXA 5IPGA 1DUGA 1M9AA 1F9MA 3GNJA 5G5EA 2C0DA 1SVMA 5IQYA 2YPMA 3CTFA 1XFLA 3FW2A 1THXA 1K3LA 4K7IA 2VLUA 1XW5A 3TKSC 5IMCA 4LA1A 2WCIA 4AJ8A 4BWQA 4KDUA 3FZ9A 4LMVA 5JCUA 1FB6A 2HZFA 4KCAA 2YV9A 4X1UA 3H79A 2VCVA 4L5LA 4IP1A 4K2DA 3EINA 2JU5A 4N11A 4FYBA 4Q5QA 2B1LA 2H6ZA 3GSSA 2TRCP 5HR3A 4IN0A 4TR4A 2P5RA 5LCZA 3TKSA 4XHMA 4JU5A 5B8AA 2YJHA 4GXZA 3LXTA 5ECSA 1AQWA 3AY8A 5GSSA 2JZTA 4V2MA 1IYHA 5DJMA 1A24A 1HNCA 4Q5FA 4OFNA 3EE2A 4K5RA 5IO2A 4OMVA 3Q18A 3BOAA 5ECOB 2LQOA 5DALB 4MA9A 2CT6A 1H75A 3DEXA 2KUCA 1XIYA 4PX1A 2H1BA 3DWVA 4OO5A 1K0OA 4G9HA 3CSHA 2C0FA 3EWLA 4OCEA 1SYRA 5G2ZA 6GSXA 7GSSA 2HRNA 3KZQA 2XPEA 1T1VA 1O8XA 1M2AA 3KP9A 2GT5A 4OO4A 5A34A 3GKMA 4HQZA 5A5KA 5E4WA 3DVWA 1G0TA 4AJ7A 4BA7A 1SJ6A 1W4VA 1XXUA 2X8CA 2OA7A 4ULXA 5ID2B 2O85A 3TKSE 2CA8A 4IW9A 2PBJA 3ME7A 4HZ4A 5JWRB 2GSRA 1NW2A 2CV4A 4O92A 3QR6A 3D6IA 4I5QA 3UJ1A 1BJXA 3GRXA 5ECQB 5D93A 3WGEA 2H1DA 2E2GA 2LKUA 1A2JA 1HYUA 2H8LA 2OKAA 5CRGA 5EPFA 3G7YA 3LG6A 1O8WA 1K3OA 3C73A 1UA5A 3O76A 3TUEA 4AGSA 1X0RA 1LU4A 1MDIA 2JSYA 3HXSA 1JZDA 3FYGA 1J9BA 2DJ2A 4ZILA 3WGDA 4NWYA 2OACA 2I3YA 2HSNA 5ECLB 5F8BA 2AJQB 2QKEA 4YAPA 1WWJA 1ZYQB 14GSA 2K9FA 3QCPA 4K7OA 2AYTA 4IKHA 2WFCA 2IMIA 2O8VB 4O32A 3KGKA 3G7IA 4YQMA 3F4RA 4IP6A 4IQAA 2VIMA 1AAZA 4AKGA 4MF5A 4RI7A 3LWAA 3ZFBA 2OE3A 3KH9A 3L9SA 1BYEA 2LJAA 1A2MA 4TKYA 2I4AA 3FZAA 3TOUA 1ERTA 2RUFA 3L78A 4L0WA 1R4WA 2A2SA 2B7KA 3WGXA 5IO0A 3QAGA 3MDKA 2YV7A 4G0IA 2L4QA 3DRNA 4Z7XA 1YKAA 2E0QA 2VAFA 5JWQB 4BPYA 4V2LA 2CQ9A 1GTAA 5D96A 2F51A 5KN3A 1JHBA 4BVYA 2G2QA 3IXRA 6GSSA 2FWHA 1FOVA 3Q74A 1NHOA 1V58A 6GSUA 2LNTA 4AF2A 1SKSB 4MCUA 4YKFA 1YEPA 5AGYA 2RIIA 4XS4A 4KF9A 4KH7A 5DCGA 2QSIA 2HZEA 3O6TA 2OADA 4MABA 4KB3A 4FQUA 4N3ZA 4ZIJA 2GT6A 1XZOA 1JLWA 4LL4B 1B48A 1WMJA 4GTUA 5G30A 4YKGA 5CREA 3O3TA 4TVEA 4IELA 3IC8A 1JLVA 4H86A 1DBYA 4WEYA 3NOFA 4TOPA 2GSTA 1Z7RA 4O5QA 1GRXA 4ZL8A 4EUYA 4PUFC 2A2PA 5DQYA 4J57E 3LSZA 1ERVA 3IE3A 3D0ZA 3FK8A 5CRDA 1FHEA 4FYUA 4EC0A 1GTUA 3CRTA 4RUVA 2R2JA 1K0DA 3WT1A 4ECIA 4W66A 1MDKA 2VL2C 4PNFA 1AIUA 4NMUA 4ZBBA 4ZL7A 2C3NA 3GHAA 3W6GA 1EEJA 3F6FA 1K0MA 2JZSA 1SU9A 2PVOC 2R5GA 4KA0A 1BG5A 2LUSA 4PUAA 4OCFA 1SVOA 2C0EA 4PNGA 1NM3A 1AUCA 3EURA 2DJ3A 5ECRB 2R6KA 3CMIA 1T00A 2VL2A 5KN2A 5DDLA 1FVKA 3ZMLA 2IIYA 1PL2A 5B6NA 5ECHB 3MIXA 1SYXA 2REMA 2R0GA 5LD0A 1UC7A 1UVZA 5KOWA 3TGZA 2RM6A 3ZMKA 5G1KA 3APOA 5J4YA 4ML1A 1THOA 2OBIA 5DAKA 3L0HA 4IS0A 3L4NA 3DXBA 4RQXA 1RK4A 2RLIA 2HSHA 1M0UA 5CO3A 5JCWA 3LYKA 1CQGA 1KBNA 4Z2UA 2ZCTA 2VCTA 1NHYA 5B8BA 4POKA 1UN2A 1DSBA 3ED3A 4FIWA 3GYKA 3KEBA 5B7CA 2P5QA 1SK1A 5EY6A 3TJBA 1FAAA 1R26A 4MF7A 4OWYA 4XTSA 1GP1A 4IQ1A 2IFQB 3QAVA 1N25A 1H4OA 1YDKA 1MD4A 4X0XA 3IHQA 5ECKB 4GSTA 2PWJA 1GUKA 4KDYA 1TJDA 2N5BA 2EIQA 2DC5A 4E8HA 2H1AA 3TU3B 2PPTA 2QA2A 4EDZA 1GUMA 4MH3A 4GCIA 3F3RA 1F6MC 4K6XA 1X5CA 3RPNA 3EU4A 1V57A 4O5RA 3R3EA 4ECJA 3PR8A 2V41A 1I9DA 2FWFA 4GRFA 3EMPA 1GSYA 4L0UA 3L9UA 4TR1A 3VLNA 1T8EB 1QUWA 3ZREA 3LXZA 2V1MA 4QQ7A 2H70A 1RW1A 4EIQA 1SL2B 1G6YA 3RHCA 4K0GA 2UV8G 1TK8B 4FO5A 12GSA 2YOIA 1ML6A 4MDCA 4F03A 4WBJA 2F8FA 1PKZA 1AC1A 3QFAC 2H0IA 4TW5A 3NZNA 3F0IA 3IR4A 2MMAA 4GLTA 4TR0A 4JR6A 2HSYA 2H74A 2L6DA 3UARA 4EE0A 3APQA 1USBA 3KTLA 3GUSA 1U3IA 5HR2A 5A34B 1G7EA 2L6CA 1YEXA 4HUAA 3RAZA 3Q19A 1YVLA 2R0PA 1GSFA 5D9VA 1CQHA 4CY6A 1O73A 3KMOA 3ZITA 2CVDA 2WRTA 1MTCA 1PKWA 1ST9A 2L5OA 1ZGNA 3U5RE 2FD3A 5A4VA 4EXJA 11GSA 3LGCA 3VWXA 2WULA 4E68A 2FA8A 2FUG2 1GSEA 2YZUA 3GFKA 4WBRD 4KDXA 4V1Ap 2VD1A 4WF4A 1GH2A 4MJAA 3D4TA 3E0UA 3RHBA 4ICYA 4NXIA 1J0FA 3BBYA 2QC7A 1GUHA 1WOUA 3TRPA 2P31A 5J9CA 2MMOA 5HFIA 3C8EA 4V1Ag 2HSNB 3TB2A 3UEMA 5IMDA 1QK8A 2EC4A 3UL3A 4OD7A 2H6XA 1PX7A 2CZ2A 2F9SA 3LW9A 4HJMA 1A0FA 2KHPA 2VLVA 3L9VA 4K5SA 3VWUA 2C3QA 4JEDA 5AIXA 3GKXA 4I6XA 3RDWA 1YY7A 1WIKA 2M80A 2V6KA 1WPIA 2H71A 3DYRA 1R5AA 5HQPA 2VCXA 2V2GA 3KD0A 4BVXB 1Q98A 4RQRA 2AB6A 20GSA 3VWVA 3GKKA 2OE1A 4XRAA 5ECPB 3I43A 4NV2A 2C1YA 3IHGA 4ID0A 4PQHA 4NHZA 3W8JA 3H4KA 3HCZA 2BMXA 4NV5A 1PMTA 4BVYB 3CTGA 6GSTA 3G9BA 4MP4A 4DSRA 1GLPA 1XOAA 2UZ8A 3J7Yb 3ZVJD 3KJYA 4DVCA 3EPTA 2JL4A 3F6DA 3ERGA 5INYA 4O5UA 1Z9HA 3HD5A 3DMLA 4YQVA 1ABAA 1ZYEA 3OR5A 2EIRA 3ZIJA 2ALBA 2C4JA 1X5DA 4E8EA 3SBCA 3FMWA 2YWOA 2LS5A 5FWGA 2GSSA 4N10A 1Y25A 2H19A 2LRCA 2X64A 2VM1A 5GSTA 4Z2TA 4MNNA 2IL3A 2K6VA 1V98A 3DGQA 2PGTA 2KP1A 3QFBC 3DD3A 4K7NA 1VF1A 1PA3A 1PQNA 1E2YA 2FCHA 3HA9A 5KOXA 3ME8A 3W8SA 2LRTA 4HDEA 2HXKA 3A3TA 4Q5RA 1C72A 4KSMA 3ZIVA 2GQMA 3CWGA 1YF1A 1U88A 3P90A 4LMWA 1GL8A 3US3A 2LRNA 4QL9A 4MMMA 1TU7A 1T4YA 5J40A 1B4QA 4DSQA 1G6WA 3PPUA 2RUEA 2ON7A 2PMTA 4MK3A 3HVSA 4ECCA 4MJBA 1S3CA 1EZKA 1PD21 1GSQA 1O7UA 5IMAA 4G19A 5A5HA 1W89A 3DIEA 1SD8A 3KP8A 5A1NB 4XS1A 1TTZA 1OKDA 4POLA 3HJPA 3A5WA 1OC9B 2HFDA 2D2ZA 1X9WB 5KEJA 1PN0A 5ENUA 3VPQA 1F3BA 2B5XA 1T3BA 4OFMA 2R37A 1URMA 1TRUA 3TOTA 1K0BA 3UBKA 2YWNA 1GSUA 3ERFA 2PU9C 2ZNMA 4ZB6A 2CX3A 4ML6A 5FT3A 1EP7A 4HEA2 3VWWA 4N0ZA 5CAXA 13GSA 1XCCA 1ILOA 1A23A 3CRUA 6GSYA 1OYJA 5J47A 4J56E 1V2AA 4JE1A 2GZPA 4KX4A 1Z7PA 3DKSA 3VPTA 3N9JA 2DKIA 1HNAA 4D73A 2KLXA 1KNGA 2L4CA 1GTIA 1V40A 5ID2A 2H1GA 4EIPA 1OE8A 1TI1A 2CAIA 2NTOA 4EKZA 1M7TA 4X4JA 3F9UA 3TDGA 9GSSA 4IVFA 1B9YC 3HDCA 1BX9A 4L5OA 2IWTA 4AJ6A 2IMEA 3MSZA 4TXOA 1EEMA 4HQSA 3P2AA 2HLSA 1GNWA 18GSA 5HR0A 4TR1B 2ES7A 1V9WA 5L71A 3M3MA 3D22A 3E3EA 4K8MA 2A4VA 1FVJA 1EGOA 3GIXA 4MJCA 1X9MB 2DMMA 3HY2A 1XVWA 1SL0B 1WE0A 5B6MA 4BL7A 4DSSA 2VKZG 1ZL9A 2GZYA 5J4UA 3GH9A 1EWXA 3R2QA 3UOMA 2I9HA 3C7MA 2AUVA 1VGLA 2VOCA 3CBUA 2LTKA 4TRXA 1MDJA 1O85A 1EV4A 2X4AA 1FB0A 4HZ2A 2PVQA 3TJFA 3TKQA 2N5FA 4IJIA 4MLYA 3TRXA 4KSOA 1QFNA 1XW9A 3D5JA 4CHSA 4Z2RA 2MMZA 5ECNB 3M9JA 4MJEA 2HRAA 3QOUA 5BMUB 4N30A 4G01A 1T4ZA 3C1SA 2H1LA 1WP0A 4ZXGA 2L57A 3KH7A 1Z3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GUR A;  4LL1 B;  3LYP A;  2IJY A;  3BCI A;  3M9K A;  4KND A;  3VI7 A;  2XPD A;  3FRC A;  2HRK A;  2HE3 A;  3HHV A;  4POB A;  1OC8 A;  2GZZ A;  3HVX A;  3PH9 A;  1SKR B;  2CAQ A;  1SJZ A;  2B5E A;  4K0N A;  2YNX A;  5F07 A;  2VM2 A;  3ZVJ A;  3GKN A;  1TP9 A;  1SL1 B;  2LST A;  3RBT A;  5GZZ B;  3VFI A;  3KIJ A;  4JZQ A;  3LFL A;  3QMX A;  2HI7 A;  5J41 A;  3HJO A;  1X9S B;  2CVK A;  2F3M A;  3FR9 A;  1TK0 B;  2HSM A;  2HT9 A;  1GLQ A;  1VF2 A;  1WRY A;  2IMK A;  1A8L A;  5JWO B;  1OC3 A;  2ZUP A;  1B9X C;  3UBL A;  2BJX A;  1OVN A;  3FHK A;  1OAZ A;  4WKW A;  1GUL A;  3KTB A;  2LV3 A;  1K0N A;  3UVH A;  1OKT A;  4V2N A;  5D73 A;  2FHE A;  2PN8 A;  2TIR A;  4XIH A;  5LNK e;  1SJI A;  4HOJ A;  2X8G A;  3A2W A;  1E6B A;  1K3Y A;  2GQK A;  1Z6M A;  3IDV A;  4MPG A;  3P7X A;  3GMF A;  3GV1 A;  2DJ0 A;  1GNE A;  2WJU A;  2M72 A;  4DEJ A;  2DJ1 A;  2VL9 A;  4MZC A;  3IA1 A;  4BWS A;  5KN0 A;  2NDO A;  2GSQ A;  4XS6 A;  3F3Q A;  1AW9 A;  2XBI A;  1ACV A;  5ABR A;  2DIY A;  4JR4 A;  2IMD A;  3I6A A;  5AIV A;  3WD6 A;  1ZZY A;  4CW9 A;  5IPH A;  2FWE A;  3ZTL A;  2XC2 A;  2H0G A;  2H75 A;  2X99 A;  2X8H A;  4HU7 A;  5COH A;  3U6V A;  5CRH A;  2YWM A;  1XOB A;  4HS1 A;  2LEG A;  4NPB A;  3UAP A;  4G10 A;  4JRR A;  3P8W A;  3EU3 A;  3C71 A;  3A2V A;  3IC4 A;  4KE3 A;  3FY7 A;  1LBK A;  4EDY A;  3IAM 2;  3FR6 A;  1NSW A;  2MMN A;  4GQC A;  1U3A A;  3GL3 A;  5A4U A;  2FY6 A;  2K8V A;  1PN9 A;  3GX0 A;  2G0F A;  2H6Y A;  1Z5Y E;  3GA4 A;  4TN8 A;  1DE1 A;  4F0B A;  5ECI B;  2PER A;  2MBT A;  4PQ1 A;  4HJ2 A;  2YCD A;  2L5L A;  2HQT A;  2J9H A;  2B7J A;  2R4V A;  4YH2 A;  2LJK A;  5CP1 A;  4CDO A;  5J5N A;  4MPF A;  2FA4 A;  3VK9 A;  2O7K A;  2GGT A;  4O7H A;  2CVB A;  3GL5 A;  3RPP A;  2CX4 A;  3GH6 A;  1EOH A;  2FNO A;  1GSS A;  4ZL9 A;  3EC3 A;  3IK7 A;  4RI6 A;  5D9W A;  5G1L A;  5H5S A;  4ACS A;  4EL1 A;  4ZB8 A;  2QGV A;  2KOK A;  4EVM A;  1A2L A;  1TKD B;  5F0G A;  2IFQ A;  1SK0 A;  3D21 A;  1B4P A;  2VUP A;  2TRX A;  3IK9 A;  3M0F A;  3F4T A;  3IOS A;  5IMF A;  2GQL A;  1KTE A;  1JFU A;  1VRS D;  5J9B A;  2JAD A;  5F05 A;  22GS A;  1IYI A;  3JCM L;  3EYT A;  1K0C A;  2MBS A;  1PL1 A;  2NVL A;  2I1U A;  1XBS A;  2DJK A;  1QGV A;  5IM9 A;  2H73 A;  4PQI A;  2H72 A;  3TJJ A;  3PGT A;  3KM6 A;  4K1F A;  3Q6O A;  4NAX A;  1YJ6 A;  4XRD A;  4F82 A;  3F4S A;  4I8B A;  1WJK A;  4KCE A;  1FG4 A;  1PSQ A;  2CZ3 A;  2O87 A;  3H93 A;  2PUK C;  4IGJ A;  4EF0 A;  2A2R A;  1F3A A;  1R7H A;  1T7P B;  1M2B A;  3GTU A;  16GS A;  19GS A;  1GWC A;  4ZB9 A;  4XS4 B;  3EVI A;  5ELA A;  4ECB A;  4F0C A;  2HZE B;  5ECM B;  4G0L A;  4WR4 A;  1KEB A;  3TCO A;  1A0R P;  4D73 B;  2NBS A;  3KCM A;  2VO4 A;  1Q4J A;  3IRA A;  1PRX A;  1QXH A;  4KW6 A;  3S9F A;  1TRV A;  4ZBA A;  4USS A;  1JZW A;  2BTO T;  5DJL A;  4POM A;  4EO3 A;  5H5R A;  2DSA A;  1HNB A;  1SK2 A;  2FLS A;  4GQF A;  1N2A A;  4L8E A;  5CYY A;  2OBK A;  3QAW A;  2B5Y A;  2H76 A;  2WDU A;  4ILF A;  4TXO B;  4FH8 A;  1SD9 A;  2P0G A;  1J08 A;  3TKR A;  4NHW A;  3N5O A;  4IJ3 A;  2C8U A;  2VCQ A;  1ERW A;  1AQX A;  4TR3 A;  1XWA A;  8GSS A;  1F37 A;  1I5G A;  2M46 A;  1YQ1 A;  5IMZ A;  4GSN A;  3QPM A;  4BL7 B;  4DSS B;  2B3S A;  5A4W A;  2GDR A;  4I2U A;  2JZR A;  2XHF A;  3M8N A;  5ELG A;  2FWG A;  2DIZ A;  1AQV A;  2DBC A;  2N5A A;  4HU9 A;  5CRW A;  3APS A;  3IBH A;  1XWC A;  2VCW A;  1GTB A;  3VUR A;  4PGT A;  2B6M A;  3HYP A;  1MEK A;  4K9Z A;  5HFK A;  3LEF A;  3UVT A;  2DLX A;  1M2D A;  3MWH A;  3V1W A;  4TXV A;  5DAK B;  4BVX A;  3KMN A;  5D8I A;  4I2T A;  3NIV A;  2FGX A;  3C1R A;  1JZR A;  1QMV A;  1S3D A;  4N0V A;  1TRW A;  4MH2 A;  1GSD A;  4KAE A;  1ERU A;  1TRS A;  2H01 A;  3K8N A;  5DAL A;  1TOF A;  4G0K A;  5C00 A;  4I97 A;  3SWL A;  2JAC A;  2C80 A;  4MZB A;  1TK5 B;  5HR1 A;  2GTU A;  1M99 A;  4F9Z A;  3CSJ A;  2K18 A;  1FW1 A;  5IMV A;  2HRK B;  5D9X A;  2VLT A;  3F8U A;  2GS3 A;  3E9J B;  1B8X A;  2WZ9 A;  3F63 A;  2ON5 A;  3DVX A;  3A2X A;  2HNL A;  2DML A;  1XWG A;  2J23 A;  3IAS 2;  2V32 A;  3CXG A;  3G7J A;  2IMF A;  2YWI A;  1QQ2 A;  3GST A;  5H5Q A;  2HSM B;  2MYG A;  1K0A A;  4PXO A;  4P3Y B;  1Z6N A;  2VD0 A;  1OE7 A;  2AAW A;  3TJG A;  4WF5 A;  1EGR A;  1HQO A;  1Y6E A;  3PIN A;  3TJK A;  2OJL A;  2DJJ A;  1PX6 A;  5GAN D;  4Q5N A;  1AXD A;  2VCZ A;  5HFG A;  3FKF A;  6GSV A;  10GS A;  1O81 A;  3ISO A;  5J3R A;  2V6O A;  5C04 A;  1R5P A;  4KGI A;  3HZ8 A;  1SEN A;  4J2F A;  5DQS A;  3MAK A;  1DE2 A;  4GSS A;  5CNW A;  3FR3 A;  4F2I A;  1F2E A;  3HKR A;  4ZBD A;  4WET A;  3GN3 A;  4ISD A;  1XWB A;  1O6J A;  1XPV A;  3H8Q A;  3GX8 A;  6GSW A;  1MD3 A;  2GLR A;  2OE0 A;  1S3A A;  3FZ4 A;  1OC9 A;  3ERW A;  3LJR A;  2B1K A;  3UIW A;  1XW6 A;  1XVQ A;  4G2E A;  3ZRD A;  2WB9 A;  5G5F A;  2KP2 A;  17GS A;  3FEU A;  3M1G A;  3QD9 A;  3ZL5 A;  1TXX A;  5DCH A;  3MNG A;  4IHU A;  2JSZ A;  1SKW B;  1TI3 A;  3VI5 A;  3ZLP A;  3TKP A;  1N8J A;  2WGR A;  5IIZ A;  4FYC A;  2RM5 A;  5EL8 A;  2LJR A;  3LQ7 A;  4IBP A;  3WYW A;  1YF0 A;  2H0H A;  2F8A A;  3HZ4 A;  4JBB A;  3TRQ A;  2LQQ A;  2C3T A;  5DVB A;  5F06 A;  4GF0 A;  1TU8 A;  3BD2 A;  2K8S A;  2R3X A;  4LLR A;  1G7O A;  3ZYW A;  3KXO A;  1YKC A;  5AIS A;  3BJ5 A;  2AV4 A;  5IOX A;  1ZCP A;  2IPA A;  4OFT A;  3IV4 A;  3I69 A;  3I9V 2;  1U6T A;  1A8Y A;  5DBQ A;  3D4M A;  1U87 A;  2VL3 A;  3J7Y k;  5IOW A;  2E7P A;  5FHI A;  3EMX A;  2WS2 A;  4MZW A;  3H1N A;  2I81 A;  4QL7 A;  1X5E A;  3CYN A;  4HI7 A;  5E59 A;  4WXT A;  3HVV A;  1TW9 A;  4XCS A;  1VF4 A;  1YZX A;  2H66 A;  4MF6 A;  1BED A;  3HJM A;  2AHE A;  2O89 A;  4PUR A;  4PTS A;  1TDI A;  4YQU A;  5KN1 A;  1ZMA A;  2Z9S A;  2YJ7 A;  2NPB A;  2YAN A;  5D9T A;  1ON4 A;  5JCG A;  1M9B A;  5AN1 A;  3GTU B;  2L59 A;  1FO5 A;  2YZH A;  5GAP D;  1EP8 A;  2MZC A;  4WR5 A;  1RQM A;  2C0G A;  4KUN A;  5EVO A;  3UMA A;  3FZ5 A;  1VF3 A;  2EIO A;  3CSI A;  2LNS A;  1BQ7 A;  4X43 A;  1ZOF A;  1PGT A;  2HRF A;  3WT2 A;  4GWR A;  1EOG A;  1EV9 A;  5BMU A;  3QDN A;  3LOR A;  3ZFL A;  2GVP A;  2IN3 A;  4YAV A;  1JZO A;  2H30 A;  1XWK A;  2YP6 A;  3ZZX A;  1LJR A;  1HD2 A;  5G31 A;  3IPZ A;  2E2M A;  3BCK A;  2YN1 A;  1BAY A;  2XBQ A;  2HYX A;  5IPG A;  1DUG A;  1M9A A;  1F9M A;  3GNJ A;  5G5E A;  2C0D A;  5IQY A;  2YPM A;  3CTF A;  1XFL A;  4K7I A;  1THX A;  1K3L A;  3FW2 A;  2VLU A;  1XW5 A;  3TKS C;  5IMC A;  4LA1 A;  2WCI A;  4AJ8 A;  4BWQ A;  4KDU A;  3FZ9 A;  4LMV A;  5JCU A;  1FB6 A;  2HZF A;  4KCA A;  2YV9 A;  4X1U A;  3H79 A;  2VCV A;  4L5L A;  4IP1 A;  4K2D A;  3EIN A;  2JU5 A;  4N11 A;  4FYB A;  4Q5Q A;  2B1L A;  2H6Z A;  3GSS A;  2TRC P;  5HR3 A;  4IN0 A;  4TR4 A;  2P5R A;  5LCZ A;  3TKS A;  4XHM A;  4JU5 A;  5B8A A;  2YJH A;  4GXZ A;  3LXT A;  5ECS A;  1AQW A;  3AY8 A;  5GSS A;  2JZT A;  4V2M A;  1IYH A;  5DJM A;  1A24 A;  1HNC A;  4Q5F A;  4OFN A;  3EE2 A;  5IO2 A;  4OMV A;  3Q18 A;  3BOA A;  5ECO B;  2LQO A;  5DAL B;  4MA9 A;  2CT6 A;  1H75 A;  3DEX A;  2KUC A;  1XIY A;  4PX1 A;  2H1B A;  3DWV A;  4OO5 A;  1K0O A;  4G9H A;  3CSH A;  2C0F A;  3EWL A;  4OCE A;  1SYR A;  5G2Z A;  6GSX A;  7GSS A;  2HRN A;  3KZQ A;  2XPE A;  1T1V A;  1O8X A;  1M2A A;  3KP9 A;  2GT5 A;  4OO4 A;  3GKM A;  4HQZ A;  5A5K A;  5E4W A;  3DVW A;  1G0T A;  4AJ7 A;  4BA7 A;  1SJ6 A;  1W4V A;  1XXU A;  2X8C A;  2OA7 A;  4ULX A;  5ID2 B;  2O85 A;  3TKS E;  2CA8 A;  4IW9 A;  2PBJ A;  3ME7 A;  4HZ4 A;  5JWR B;  2GSR A;  1NW2 A;  2CV4 A;  4O92 A;  3QR6 A;  3D6I A;  4I5Q A;  3UJ1 A;  1BJX A;  3GRX A;  5ECQ B;  5D93 A;  3WGE A;  2H1D A;  2E2G A;  2LKU A;  1A2J A;  1HYU A;  2H8L A;  2OKA A;  5CRG A;  5EPF A;  3G7Y A;  3LG6 A;  1O8W A;  1K3O A;  3C73 A;  1UA5 A;  3O76 A;  3TUE A;  4AGS A;  1X0R A;  1LU4 A;  1MDI A;  2JSY A;  3HXS A;  1JZD A;  3FYG A;  1J9B A;  2DJ2 A;  4ZIL A;  3WGD A;  4NWY A;  2OAC A;  2I3Y A;  5ECL B;  5F8B A;  2AJQ B;  2QKE A;  4YAP A;  1WWJ A;  1ZYQ B;  14GS A;  2K9F A;  3QCP A;  4K7O A;  2AYT A;  4IKH A;  2WFC A;  2IMI A;  2O8V B;  4O32 A;  3KGK A;  3G7I A;  4YQM A;  3F4R A;  4IP6 A;  4IQA A;  2VIM A;  1AAZ A;  4MF5 A;  4RI7 A;  3LWA A;  3ZFB A;  2OE3 A;  3KH9 A;  3L9S A;  1BYE A;  2LJA A;  1A2M A;  4TKY A;  2I4A A;  3FZA A;  3TOU A;  1ERT A;  2RUF A;  3L78 A;  4L0W A;  1R4W A;  2A2S A;  2B7K A;  3WGX A;  5IO0 A;  3QAG A;  3MDK A;  2YV7 A;  4G0I A;  2L4Q A;  3DRN A;  4Z7X A;  1YKA A;  2E0Q A;  2VAF A;  5JWQ B;  4BPY A;  4V2L A;  2CQ9 A;  1GTA A;  5D96 A;  2F51 A;  5KN3 A;  1JHB A;  4BVY A;  2G2Q A;  3IXR A;  6GSS A;  2FWH A;  1FOV A;  3Q74 A;  1NHO A;  1V58 A;  6GSU A;  2LNT A;  4AF2 A;  1SKS B;  4MCU A;  1YEP A;  5AGY A;  2RII A;  4XS4 A;  4KF9 A;  4KH7 A;  5DCG A;  2QSI A;  2HZE A;  3O6T A;  2OAD A;  4MAB A;  4KB3 A;  4FQU A;  4ZIJ A;  2GT6 A;  1XZO A;  1JLW A;  4LL4 B;  1B48 A;  1WMJ A;  4GTU A;  5G30 A;  5CRE A;  3O3T A;  4TVE A;  4IEL A;  3IC8 A;  1JLV A;  4H86 A;  1DBY A;  4WEY A;  3NOF A;  4TOP A;  2GST A;  1Z7R A;  1GRX A;  4ZL8 A;  4EUY A;  4PUF C;  5DQY A;  4J57 E;  3LSZ A;  1ERV A;  3IE3 A;  3D0Z A;  3FK8 A;  5CRD A;  1FHE A;  4FYU A;  4EC0 A;  1GTU A;  3CRT A;  4RUV A;  2R2J A;  1K0D A;  3WT1 A;  4ECI A;  1MDK A;  2VL2 C;  4PNF A;  1AIU A;  4NMU A;  4ZBB A;  4ZL7 A;  2C3N A;  3GHA A;  3W6G A;  1EEJ A;  3F6F A;  1K0M A;  2JZS A;  1SU9 A;  2PVO C;  2R5G A;  4KA0 A;  1BG5 A;  2LUS A;  4PUA A;  4OCF A;  2C0E A;  4PNG A;  1NM3 A;  1AUC A;  3EUR A;  2DJ3 A;  5ECR B;  2R6K A;  3CMI A;  1T00 A;  2VL2 A;  5KN2 A;  5DDL A;  1FVK A;  3ZML A;  2IIY A;  1PL2 A;  5B6N A;  5ECH B;  1SYX A;  2REM A;  5LD0 A;  1UC7 A;  1UVZ A;  3TGZ A;  2RM6 A;  3ZMK A;  5G1K A;  3APO A;  4ML1 A;  1THO A;  2OBI A;  5DAK A;  3L0H A;  4IS0 A;  3L4N A;  3DXB A;  4RQX A;  1RK4 A;  2RLI A;  2HSH A;  1M0U A;  5CO3 A;  5JCW A;  3LYK A;  1CQG A;  1KBN A;  2ZCT A;  2VCT A;  1NHY A;  5B8B A;  4POK A;  1UN2 A;  1DSB A;  3ED3 A;  4FIW A;  3GYK A;  3KEB A;  5B7C A;  2P5Q A;  1SK1 A;  5EY6 A;  3TJB A;  1FAA A;  1R26 A;  4MF7 A;  4OWY A;  4XTS A;  1GP1 A;  4IQ1 A;  2IFQ B;  3QAV A;  1H4O A;  1YDK A;  1MD4 A;  4X0X A;  3IHQ A;  5ECK B;  4GST A;  2PWJ A;  1GUK A;  4KDY A;  1TJD A;  2N5B A;  2EIQ A;  2DC5 A;  4E8H A;  2H1A A;  2PPT A;  4EDZ A;  1GUM A;  4MH3 A;  4GCI A;  3F3R A;  1F6M C;  4K6X A;  1X5C A;  3RPN A;  3EU4 A;  1V57 A;  4O5R A;  3R3E A;  4ECJ A;  3PR8 A;  2V41 A;  1I9D A;  2FWF A;  4GRF A;  3EMP A;  1GSY A;  4L0U A;  3L9U A;  4TR1 A;  3VLN A;  1T8E B;  1QUW A;  3ZRE A;  3LXZ A;  2V1M A;  4QQ7 A;  2H70 A;  1RW1 A;  1SL2 B;  1G6Y A;  3RHC A;  4K0G A;  1TK8 B;  4FO5 A;  12GS A;  2YOI A;  1ML6 A;  4MDC A;  4F03 A;  4WBJ A;  2F8F A;  1PKZ A;  1AC1 A;  3QFA C;  2H0I A;  4TW5 A;  3NZN A;  3F0I A;  3IR4 A;  2MMA A;  4GLT A;  4TR0 A;  4JR6 A;  2HSY A;  2H74 A;  2L6D A;  3UAR A;  4EE0 A;  3APQ A;  1USB A;  3KTL A;  3GUS A;  1U3I A;  5HR2 A;  1G7E A;  2L6C A;  1YEX A;  4HUA A;  3RAZ A;  3Q19 A;  1GSF A;  5D9V A;  1CQH A;  1O73 A;  3KMO A;  3ZIT A;  2CVD A;  2WRT A;  1MTC A;  1PKW A;  1ST9 A;  2L5O A;  1ZGN A;  3U5R E;  2FD3 A;  5A4V A;  4EXJ A;  11GS A;  3LGC A;  3VWX A;  2WUL A;  2FA8 A;  2FUG 2;  1GSE A;  2YZU A;  3GFK A;  4WBR D;  4KDX A;  4V1A p;  2VD1 A;  4WF4 A;  1GH2 A;  4MJA A;  3D4T A;  3E0U A;  3RHB A;  4NXI A;  1J0F A;  3BBY A;  2QC7 A;  1GUH A;  1WOU A;  3TRP A;  2P31 A;  5J9C A;  2MMO A;  5HFI A;  3C8E A;  4V1A g;  2HSN B;  3TB2 A;  3UEM A;  5IMD A;  1QK8 A;  2EC4 A;  3UL3 A;  4OD7 A;  2H6X A;  1PX7 A;  2CZ2 A;  2F9S A;  4HJM A;  1A0F A;  2KHP A;  2VLV A;  3L9V A;  3VWU A;  2C3Q A;  4JED A;  5AIX A;  3GKX A;  4I6X A;  3RDW A;  1YY7 A;  1WIK A;  2M80 A;  2V6K A;  1WPI A;  2H71 A;  3DYR A;  1R5A A;  5HQP A;  2VCX A;  2V2G A;  3KD0 A;  4BVX B;  1Q98 A;  4RQR A;  2AB6 A;  20GS A;  3VWV A;  3GKK A;  2OE1 A;  4XRA A;  5ECP B;  3I43 A;  4NV2 A;  2C1Y A;  4ID0 A;  4PQH A;  4NHZ A;  3W8J A;  3H4K A;  3HCZ A;  2BMX A;  4NV5 A;  1PMT A;  4BVY B;  3CTG A;  6GST A;  3G9B A;  4MP4 A;  4DSR A;  1GLP A;  1XOA A;  2UZ8 A;  3J7Y b;  3ZVJ D;  3KJY A;  4DVC A;  2JL4 A;  3F6D A;  3ERG A;  5INY A;  1Z9H A;  3HD5 A;  3DML A;  4YQV A;  1ABA A;  1ZYE A;  3OR5 A;  2EIR A;  3ZIJ A;  2ALB A;  2C4J A;  1X5D A;  4E8E A;  3SBC A;  2YWO A;  2LS5 A;  5FWG A;  2GSS A;  4N10 A;  1Y25 A;  2H19 A;  2LRC A;  2X64 A;  2VM1 A;  5GST A;  2IL3 A;  2K6V A;  1V98 A;  3DGQ A;  2PGT A;  2KP1 A;  3QFB C;  3DD3 A;  4K7N A;  1VF1 A;  1PA3 A;  1PQN A;  1E2Y A;  2FCH A;  3HA9 A;  3ME8 A;  3W8S A;  2LRT A;  4HDE A;  2HXK A;  3A3T A;  4Q5R A;  1C72 A;  4KSM A;  3ZIV A;  2GQM A;  1YF1 A;  1U88 A;  3P90 A;  4LMW A;  1GL8 A;  3US3 A;  2LRN A;  4QL9 A;  4MMM A;  1TU7 A;  1T4Y A;  1B4Q A;  4DSQ A;  1G6W A;  3PPU A;  2RUE A;  2ON7 A;  2PMT A;  4MK3 A;  3HVS A;  4ECC A;  4MJB A;  1S3C A;  1EZK A;  1PD2 1;  1GSQ A;  1O7U A;  5IMA A;  4G19 A;  1W89 A;  3DIE A;  1SD8 A;  3KP8 A;  4XS1 A;  1TTZ A;  1OKD A;  4POL A;  3HJP A;  3A5W A;  1OC9 B;  2HFD A;  2D2Z A;  1X9W B;  5KEJ A;  5ENU A;  3VPQ A;  1F3B A;  2B5X A;  1T3B A;  4OFM A;  2R37 A;  1URM A;  1TRU A;  3TOT A;  1K0B A;  3UBK A;  2YWN A;  1GSU A;  3ERF A;  2PU9 C;  2ZNM A;  4ZB6 A;  2CX3 A;  4ML6 A;  5FT3 A;  1EP7 A;  4HEA 2;  3VWW A;  4N0Z A;  5CAX A;  13GS A;  1XCC A;  1ILO A;  1A23 A;  3CRU A;  6GSY A;  1OYJ A;  4J56 E;  1V2A A;  4JE1 A;  2GZP A;  4KX4 A;  1Z7P A;  3DKS A;  3VPT A;  3N9J A;  1HNA A;  4D73 A;  2KLX A;  1KNG A;  2L4C A;  1GTI A;  1V40 A;  5ID2 A;  2H1G A;  1OE8 A;  1TI1 A;  2CAI A;  2NTO A;  4EKZ A;  1M7T A;  3F9U A;  3TDG A;  9GSS A;  4IVF A;  1B9Y C;  3HDC A;  1BX9 A;  4L5O A;  2IWT A;  4AJ6 A;  2IME A;  3MSZ A;  4TXO A;  1EEM A;  4HQS A;  3P2A A;  2HLS A;  1GNW A;  18GS A;  5HR0 A;  4TR1 B;  2ES7 A;  1V9W A;  5L71 A;  3M3M A;  3D22 A;  3E3E A;  4K8M A;  2A4V A;  1FVJ A;  1EGO A;  3GIX A;  4MJC A;  1X9M B;  2DMM A;  3HY2 A;  1XVW A;  1SL0 B;  1WE0 A;  5B6M A;  4BL7 A;  4DSS A;  1ZL9 A;  2GZY A;  5J4U A;  3GH9 A;  1EWX A;  3R2Q A;  3UOM A;  2I9H A;  3C7M A;  2AUV A;  1VGL A;  2VOC A;  3CBU A;  2LTK A;  4TRX A;  1MDJ A;  1O85 A;  1EV4 A;  1FB0 A;  4HZ2 A;  2PVQ A;  3TJF A;  3TKQ A;  2N5F A;  4IJI A;  4MLY A;  3TRX A;  4KSO A;  1QFN A;  1XW9 A;  3D5J A;  4CHS A;  2MMZ A;  5ECN B;  3M9J A;  4MJE A;  2HRA A;  3QOU A;  4N30 A;  1T4Z A;  3C1S A;  1WP0 A;  4ZXG A;  2L57 A;  3KH7 A;  1Z3E A; 
#chains in the Genus database with same CATH topology
 3GUR A;  4LL1 B;  3LYP A;  2IJY A;  3BCI A;  3M9K A;  4KND A;  3VI7 A;  2XPD A;  2WW1 A;  1ZYN A;  3FRC A;  1FOH A;  2HRK A;  2HE3 A;  3HHV A;  4POB A;  1OC8 A;  2GZZ A;  3HVX A;  3PH9 A;  1SKR B;  2CAQ A;  1SJZ A;  2B5E A;  4K0N A;  2YNX A;  5F07 A;  2VM2 A;  3ZVJ A;  3GKN A;  1TP9 A;  1SL1 B;  2LST A;  3RBT A;  5GZZ B;  3VFI A;  3KIJ A;  4JZQ A;  3LFL A;  3QMX A;  2HI7 A;  5J41 A;  3HJO A;  1X9S B;  2CVK A;  2EFC A;  2F3M A;  3FR9 A;  1TK0 B;  2HSM A;  1Y1U A;  2HT9 A;  1GLQ A;  1VF2 A;  1WRY A;  2IMK A;  1A8L A;  5JWO B;  1OC3 A;  4GDF A;  2ZUP A;  1B9X C;  2WW2 A;  1BG1 A;  3UBL A;  5J4V A;  2BJX A;  1OVN A;  3FHK A;  1OAZ A;  4WKW A;  1GUL A;  3KTB A;  2LV3 A;  1K0N A;  2WZS A;  3UVH A;  1OKT A;  4V2N A;  5D73 A;  2FHE A;  2PN8 A;  2TIR A;  4XIH A;  5LNK e;  1SJI A;  4HOJ A;  2X8G A;  3A2W A;  1E6B A;  1K3Y A;  2GQK A;  1Z6M A;  3IDV A;  4MPG A;  3P7X A;  3GMF A;  3GV1 A;  2DJ0 A;  1GNE A;  2WJU A;  2M72 A;  4DEJ A;  2DJ1 A;  2VL9 A;  4MZC A;  3IA1 A;  4BWS A;  5KN0 A;  2NDO A;  2GSQ A;  4XS6 A;  3F3Q A;  1AW9 A;  2XBI A;  1ACV A;  5ABR A;  2DIY A;  4JR4 A;  2IMD A;  3I6A A;  5AIV A;  3WD6 A;  1ZZY A;  4CW9 A;  5IPH A;  2FWE A;  3ZTL A;  1XG8 A;  2XC2 A;  2H0G A;  2H75 A;  2X99 A;  2X8H A;  4HU7 A;  5COH A;  3U6V A;  5CRH A;  2YWM A;  1XOB A;  4HS1 A;  2LEG A;  4NPB A;  3UAP A;  4G10 A;  4JRR A;  3P8W A;  3EU3 A;  3C71 A;  3A2V A;  3IC4 A;  4KE3 A;  3FY7 A;  1LBK A;  4EDY A;  3IAM 2;  3FR6 A;  1NSW A;  2MMN A;  4GQC A;  1U3A A;  3GL3 A;  5A4U A;  2FY6 A;  2K8V A;  1PN9 A;  3GX0 A;  2OT3 A;  2G0F A;  2H6Y A;  1Z5Y E;  3GA4 A;  4TN8 A;  1DE1 A;  4F0B A;  2QA1 A;  5ECI B;  2PER A;  2MBT A;  4PQ1 A;  4HJ2 A;  2YCD A;  2L5L A;  2HQT A;  4AKH A;  1ZYP A;  2J9H A;  2B7J A;  2R4V A;  4YH2 A;  2LJK A;  5CP1 A;  4CDO A;  5J5N A;  4MPF A;  2FA4 A;  3VK9 A;  2O7K A;  2GGT A;  4O7H A;  2CVB A;  3GL5 A;  3RPP A;  2CX4 A;  3GH6 A;  1EOH A;  2FNO A;  1GSS A;  4ZL9 A;  3EC3 A;  3IK7 A;  4RI6 A;  5D9W A;  5G1L A;  5H5S A;  4ACS A;  4EL1 A;  4ZB8 A;  2QGV A;  2KOK A;  4EVM A;  1A2L A;  1TKD B;  5F0G A;  2IFQ A;  4K2X A;  1SK0 A;  3D21 A;  1B4P A;  2VUP A;  2TRX A;  3IK9 A;  5A5H B;  3M0F A;  3F4T A;  3IOS A;  5IMF A;  2GQL A;  1KTE A;  1JFU A;  1VRS D;  5J9B A;  2JAD A;  5F05 A;  22GS A;  1IYI A;  3JCM L;  4AI6 A;  3EYT A;  1K0C A;  2MBS A;  1PL1 A;  2NVL A;  2I1U A;  1XBS A;  2DJK A;  1QGV A;  5IM9 A;  2H73 A;  4PQI A;  2H72 A;  3TJJ A;  3PGT A;  3KM6 A;  4K1F A;  3Q6O A;  4NAX A;  1YJ6 A;  4XRD A;  4F82 A;  3F4S A;  4I8B A;  1WJK A;  4KCE A;  1FG4 A;  1PSQ A;  2CZ3 A;  2O87 A;  3H93 A;  2PUK C;  4IGJ A;  4EF0 A;  3RGB C;  2A2R A;  1F3A A;  1R7H A;  1T7P B;  1M2B A;  3GTU A;  16GS A;  19GS A;  1GWC A;  4ZB9 A;  4XS4 B;  3EVI A;  5ELA A;  4ECB A;  4F0C A;  2HZE B;  1KEB A;  5ECM B;  4G0L A;  4WR4 A;  3TCO A;  1A0R P;  4D73 B;  2NBS A;  3KCM A;  2VO4 A;  2X49 A;  1Q4J A;  3IRA A;  1PRX A;  1QXH A;  1TXU A;  4KW6 A;  3S9F A;  1TRV A;  4QMK A;  4ZBA A;  4USS A;  1JZW A;  2BTO T;  5DJL A;  4POM A;  4EO3 A;  4PI0 C;  5H5R A;  2DSA A;  1HNB A;  1SK2 A;  2FLS A;  4GQF A;  1N2A A;  4L8E A;  5CYY A;  2OBK A;  3HVN A;  3QAW A;  2B5Y A;  2H76 A;  2WDU A;  4ILF A;  3CHX C;  4TXO B;  4FH8 A;  1SD9 A;  2P0G A;  1J08 A;  3TKR A;  4NHW A;  3N5O A;  4IJ3 A;  2C8U A;  2VCQ A;  1ERW A;  1AQX A;  4TR3 A;  1XWA A;  8GSS A;  1F37 A;  1I5G A;  2M46 A;  1YQ1 A;  5IMZ A;  4GSN A;  3QPM A;  4BL7 B;  4DSS B;  2B3S A;  5A4W A;  2GDR A;  4I2U A;  2JZR A;  2XHF A;  3M8N A;  5ELG A;  2FWG A;  2DIZ A;  1AQV A;  2DBC A;  2N5A A;  4HU9 A;  5CRW A;  3APS A;  3IBH A;  1XWC A;  2VCW A;  1GTB A;  3VUR A;  4PGT A;  2B6M A;  3HYP A;  1MEK A;  4K9Z A;  5HFK A;  3LEF A;  3UVT A;  2DLX A;  1M2D A;  3MWH A;  3V1W A;  4TXV A;  5DAK B;  4BVX A;  3KMN A;  5D8I A;  4I2T A;  3NIV A;  2FGX A;  3C1R A;  1JZR A;  1QMV A;  1S3D A;  4N0V A;  1TRW A;  4MH2 A;  1GSD A;  4KAE A;  1ERU A;  1TRS A;  2H01 A;  3K8N A;  3HMJ G;  5DAL A;  1TOF A;  4G0K A;  5C00 A;  4I97 A;  3SWL A;  2JAC A;  2C80 A;  4MZB A;  1TK5 B;  5HR1 A;  2GTU A;  1M99 A;  4F9Z A;  3CSJ A;  2K18 A;  1FW1 A;  5IMV A;  2WW3 A;  2HRK B;  3A5I A;  5D9X A;  2VLT A;  3F8U A;  2EFE A;  2GS3 A;  4CY8 A;  3E9J B;  1B8X A;  2WZ9 A;  3F63 A;  2ON5 A;  3DVX A;  3A2X A;  2HNL A;  2DML A;  1XWG A;  2J23 A;  3IAS 2;  2V32 A;  3CXG A;  3G7J A;  2IMF A;  2YWI A;  1QQ2 A;  3GST A;  5H5Q A;  2HSM B;  2MYG A;  1K0A A;  4PXO A;  4P3Y B;  1Z6N A;  2VD0 A;  1OE7 A;  2AAW A;  3TJG A;  4WF5 A;  1EGR A;  1HQO A;  1Y6E A;  3PIN A;  3TJK A;  2OJL A;  2DJJ A;  1PX6 A;  5GAN D;  4Q5N A;  1AXD A;  2EFD A;  2VCZ A;  5HFG A;  3FKF A;  6GSV A;  10GS A;  1O81 A;  3ISO A;  5J3R A;  2V6O A;  5C04 A;  1R5P A;  4KGI A;  3HZ8 A;  1SEN A;  4J2F A;  5DQS A;  3MAK A;  1DE2 A;  4GSS A;  5CNW A;  3FR3 A;  3RFR C;  4F2I A;  1F2E A;  3HKR A;  4ZBD A;  4WET A;  3GN3 A;  4ISD A;  1XWB A;  1O6J A;  1XPV A;  3H8Q A;  3GX8 A;  4A5P A;  6GSW A;  1MD3 A;  5A1N A;  2EFH A;  2GLR A;  2OE0 A;  1S3A A;  3FZ4 A;  1OC9 A;  3ERW A;  3LJR A;  2B1K A;  3UIW A;  1XW6 A;  1XVQ A;  4G2E A;  3ZRD A;  2WB9 A;  5G5F A;  2KP2 A;  17GS A;  3FEU A;  3M1G A;  3QD9 A;  3ZL5 A;  1TXX A;  5DCH A;  3MNG A;  4AKI A;  4IHU A;  2JSZ A;  1SKW B;  1TI3 A;  3VI5 A;  1M3I A;  3ZLP A;  3TKP A;  1SVL A;  1N8J A;  2WGR A;  5IIZ A;  4FYC A;  2RM5 A;  5EL8 A;  2LJR A;  3LQ7 A;  4IBP A;  3WYW A;  1YF0 A;  2H0H A;  2F8A A;  3HZ4 A;  4JBB A;  3TRQ A;  2LQQ A;  4ZB7 A;  2C3T A;  5DVB A;  5F06 A;  4GF0 A;  1TU8 A;  3BD2 A;  2K8S A;  2R3X A;  1BF5 A;  4LLR A;  1G7O A;  3ZYW A;  4HSC X;  3KXO A;  1YKC A;  5AIS A;  3BJ5 A;  2AV4 A;  5IOX A;  1ZCP A;  2IPA A;  4OFT A;  3IV4 A;  3I69 A;  3I9V 2;  1U6T A;  1A8Y A;  5DBQ A;  3D4M A;  1U87 A;  2O5V A;  2VL3 A;  3J7Y k;  5IOW A;  2E7P A;  5FHI A;  3EMX A;  2WS2 A;  4MZW A;  3H1N A;  2I81 A;  4QL7 A;  1X5E A;  3CYN A;  4HI7 A;  5E59 A;  4WXT A;  3HVV A;  1TW9 A;  4XCS A;  4AKX B;  2R0C A;  1VF4 A;  1YZX A;  2H66 A;  4MF6 A;  1BED A;  3HJM A;  2AHE A;  2O89 A;  4PUR A;  4PTS A;  1TDI A;  4YQU A;  5KN1 A;  1ZMA A;  2Z9S A;  2YJ7 A;  2NPB A;  2YAN A;  5D9T A;  1ON4 A;  5JCG A;  1M9B A;  5AN1 A;  3GTU B;  2L59 A;  1FO5 A;  2YZH A;  5GAP D;  1EP8 A;  2MZC A;  3MYD A;  4WR5 A;  2DKH A;  1RQM A;  2C0G A;  4KUN A;  5EVO A;  3UMA A;  3FZ5 A;  1VF3 A;  2EIO A;  3CSI A;  5BRT A;  2LNS A;  1BQ7 A;  2A4H A;  4X43 A;  1YEW C;  1ZOF A;  1PGT A;  2HRF A;  3WT2 A;  4GWR A;  1EOG A;  1EV9 A;  5BMU A;  3QDN A;  3LOR A;  3ZFL A;  2GVP A;  2IN3 A;  4YAV A;  1JZO A;  2H30 A;  1XWK A;  2YP6 A;  3ZZX A;  1LJR A;  1HD2 A;  5G31 A;  3IPZ A;  2E2M A;  3BCK A;  2YN1 A;  1BAY A;  2XBQ A;  2HYX A;  5IPG A;  1DUG A;  1M9A A;  1F9M A;  3GNJ A;  5G5E A;  2C0D A;  1SVM A;  5IQY A;  2YPM A;  3CTF A;  1XFL A;  3FW2 A;  1THX A;  1K3L A;  4K7I A;  2VLU A;  1XW5 A;  3TKS C;  5IMC A;  4LA1 A;  2WCI A;  4AJ8 A;  4BWQ A;  4KDU A;  3FZ9 A;  4LMV A;  5JCU A;  1FB6 A;  2HZF A;  4KCA A;  2YV9 A;  4X1U A;  3H79 A;  2VCV A;  4L5L A;  4IP1 A;  4K2D A;  3EIN A;  2JU5 A;  4N11 A;  4FYB A;  4Q5Q A;  2B1L A;  2H6Z A;  3GSS A;  2TRC P;  5HR3 A;  4IN0 A;  4TR4 A;  2P5R A;  5LCZ A;  3TKS A;  4XHM A;  4JU5 A;  5B8A A;  2YJH A;  4GXZ A;  3LXT A;  5ECS A;  1AQW A;  3AY8 A;  5GSS A;  2JZT A;  4V2M A;  1IYH A;  5DJM A;  1A24 A;  1HNC A;  4Q5F A;  4OFN A;  3EE2 A;  4K5R A;  5IO2 A;  4OMV A;  3Q18 A;  3BOA A;  5ECO B;  2LQO A;  5DAL B;  4MA9 A;  2CT6 A;  1H75 A;  3DEX A;  2KUC A;  1XIY A;  4PX1 A;  2H1B A;  3DWV A;  4OO5 A;  1K0O A;  4G9H A;  3CSH A;  2C0F A;  3EWL A;  4OCE A;  1SYR A;  5G2Z A;  6GSX A;  7GSS A;  2HRN A;  3KZQ A;  2XPE A;  1T1V A;  1O8X A;  1M2A A;  3KP9 A;  2GT5 A;  4OO4 A;  5A34 A;  3GKM A;  4HQZ A;  5A5K A;  5E4W A;  3DVW A;  1G0T A;  4AJ7 A;  4BA7 A;  1SJ6 A;  1W4V A;  1XXU A;  2X8C A;  2OA7 A;  4ULX A;  5ID2 B;  2O85 A;  3TKS E;  2CA8 A;  4IW9 A;  2PBJ A;  3ME7 A;  4HZ4 A;  5JWR B;  2GSR A;  1NW2 A;  2CV4 A;  4O92 A;  1M3J A;  3QR6 A;  3D6I A;  4I5Q A;  3UJ1 A;  1BJX A;  3GRX A;  5ECQ B;  5D93 A;  3WGE A;  2H1D A;  2E2G A;  2LKU A;  1A2J A;  1HYU A;  2WVY A;  2H8L A;  2OKA A;  5CRG A;  5EPF A;  3G7Y A;  3LG6 A;  1O8W A;  1K3O A;  3C73 A;  1UA5 A;  3O76 A;  3TUE A;  4AGS A;  1X0R A;  1LU4 A;  1MDI A;  2JSY A;  3HXS A;  1JZD A;  3FYG A;  1J9B A;  2DJ2 A;  4ZIL A;  3WGD A;  4NWY A;  2OAC A;  2I3Y A;  2HSN A;  5ECL B;  5F8B A;  2AJQ B;  2QKE A;  4YAP A;  1WWJ A;  1ZYQ B;  14GS A;  2K9F A;  3QCP A;  4K7O A;  2AYT A;  4IKH A;  2WFC A;  2IMI A;  2O8V B;  4O32 A;  3KGK A;  3G7I A;  4YQM A;  3F4R A;  4IP6 A;  4IQA A;  2VIM A;  1AAZ A;  4AKG A;  4MF5 A;  4RI7 A;  3LWA A;  3ZFB A;  2OE3 A;  3KH9 A;  3L9S A;  1BYE A;  2LJA A;  1A2M A;  4TKY A;  2I4A A;  3FZA A;  3TOU A;  1ERT A;  2RUF A;  3L78 A;  4L0W A;  1R4W A;  2A2S A;  2B7K A;  3WGX A;  5IO0 A;  3QAG A;  3MDK A;  2YV7 A;  4G0I A;  2L4Q A;  3DRN A;  4Z7X A;  1YKA A;  2E0Q A;  2VAF A;  5JWQ B;  4BPY A;  4V2L A;  2CQ9 A;  1GTA A;  5D96 A;  2F51 A;  5KN3 A;  1JHB A;  4BVY A;  2G2Q A;  3IXR A;  6GSS A;  2FWH A;  1FOV A;  3Q74 A;  1NHO A;  1V58 A;  6GSU A;  2WVX A;  2LNT A;  4AF2 A;  1SKS B;  4MCU A;  4YKF A;  1YEP A;  5AGY A;  2RII A;  4XS4 A;  4KF9 A;  4KH7 A;  5DCG A;  2QSI A;  2HZE A;  3O6T A;  2OAD A;  4MAB A;  4KB3 A;  4FQU A;  4N3Z A;  4ZIJ A;  2GT6 A;  1XZO A;  1JLW A;  4LL4 B;  1B48 A;  1WMJ A;  4GTU A;  5G30 A;  4YKG A;  5CRE A;  3O3T A;  4TVE A;  4IEL A;  3IC8 A;  1JLV A;  4H86 A;  1DBY A;  4WEY A;  3NOF A;  4TOP A;  2GST A;  1Z7R A;  4O5Q A;  1GRX A;  4ZL8 A;  4EUY A;  4PUF C;  2A2P A;  5DQY A;  4J57 E;  3LSZ A;  1ERV A;  3IE3 A;  3D0Z A;  3FK8 A;  5CRD A;  1FHE A;  4FYU A;  4EC0 A;  1GTU A;  3CRT A;  4RUV A;  2R2J A;  1K0D A;  3WT1 A;  4ECI A;  4W66 A;  1MDK A;  2VL2 C;  4PNF A;  1AIU A;  4NMU A;  4ZBB A;  4ZL7 A;  2C3N A;  3GHA A;  3W6G A;  1EEJ A;  3F6F A;  1K0M A;  2JZS A;  1SU9 A;  2PVO C;  2R5G A;  4KA0 A;  1BG5 A;  4PI2 C;  2LUS A;  4PUA A;  4OCF A;  1SVO A;  2C0E A;  4PNG A;  2WW0 A;  1NM3 A;  1AUC A;  3EUR A;  2DJ3 A;  5ECR B;  2R6K A;  3CMI A;  1T00 A;  2VL2 A;  5KN2 A;  5DDL A;  1FVK A;  4BIK A;  3ZML A;  2IIY A;  1PL2 A;  5B6N A;  5ECH B;  3MIX A;  1SYX A;  2REM A;  2R0G A;  5LD0 A;  1UC7 A;  1UVZ A;  5KOW A;  3TGZ A;  2RM6 A;  3ZMK A;  5G1K A;  3APO A;  5J4Y A;  4ML1 A;  1THO A;  2OBI A;  5DAK A;  3L0H A;  4IS0 A;  3L4N A;  3DXB A;  4RQX A;  1RK4 A;  2RLI A;  2HSH A;  1M0U A;  5CO3 A;  5JCW A;  3LYK A;  1CQG A;  1KBN A;  4Z2U A;  2ZCT A;  2VCT A;  1NHY A;  5B8B A;  4POK A;  1UN2 A;  1DSB A;  3ED3 A;  4FIW A;  3GYK A;  3KEB A;  5B7C A;  2P5Q A;  1SK1 A;  5EY6 A;  3TJB A;  1FAA A;  1R26 A;  4MF7 A;  4OWY A;  4XTS A;  1GP1 A;  4IQ1 A;  2IFQ B;  3QAV A;  1N25 A;  1H4O A;  1YDK A;  1MD4 A;  4X0X A;  3IHQ A;  5ECK B;  4GST A;  2PWJ A;  1GUK A;  4KDY A;  1TJD A;  2N5B A;  2EIQ A;  2DC5 A;  4E8H A;  2H1A A;  3TU3 B;  2PPT A;  2QA2 A;  4EDZ A;  1GUM A;  4MH3 A;  4GCI A;  3F3R A;  1F6M C;  4K6X A;  1X5C A;  3CQF A;  3RPN A;  3EU4 A;  1V57 A;  4O5R A;  3R3E A;  4ECJ A;  3PR8 A;  2V41 A;  1I9D A;  2FWF A;  4GRF A;  3EMP A;  1GSY A;  4L0U A;  3L9U A;  4TR1 A;  3VLN A;  1T8E B;  1QUW A;  3ZRE A;  3LXZ A;  2V1M A;  4QQ7 A;  2H70 A;  1RW1 A;  4EIQ A;  1SL2 B;  1G6Y A;  3RHC A;  4K0G A;  2UV8 G;  1TK8 B;  4FO5 A;  12GS A;  2YOI A;  1ML6 A;  4MDC A;  4F03 A;  4WBJ A;  2F8F A;  1PKZ A;  1AC1 A;  3QFA C;  2H0I A;  4TW5 A;  3NZN A;  3F0I A;  3IR4 A;  2MMA A;  4GLT A;  4TR0 A;  4JR6 A;  2HSY A;  2H74 A;  2L6D A;  3UAR A;  4EE0 A;  3APQ A;  1USB A;  3KTL A;  3GUS A;  1U3I A;  5HR2 A;  5A34 B;  1G7E A;  2L6C A;  1YEX A;  4HUA A;  3RAZ A;  3Q19 A;  1YVL A;  2R0P A;  1GSF A;  5D9V A;  1CQH A;  4CY6 A;  1O73 A;  3KMO A;  3ZIT A;  2CVD A;  2WRT A;  1MTC A;  1PKW A;  1ST9 A;  2L5O A;  1ZGN A;  3U5R E;  2FD3 A;  5A4V A;  4EXJ A;  11GS A;  3LGC A;  3VWX A;  2WUL A;  4E68 A;  2FA8 A;  2FUG 2;  1GSE A;  2YZU A;  3GFK A;  4WBR D;  4KDX A;  4V1A p;  2VD1 A;  4WF4 A;  1I1I P;  1GH2 A;  4MJA A;  3D4T A;  3E0U A;  3RHB A;  4ICY A;  4NXI A;  1J0F A;  3BBY A;  2QC7 A;  1GUH A;  1WOU A;  3TRP A;  2P31 A;  5J9C A;  1S4B P;  2MMO A;  5HFI A;  3C8E A;  4V1A g;  2HSN B;  3TB2 A;  3UEM A;  5IMD A;  1QK8 A;  2EC4 A;  3UL3 A;  4OD7 A;  2H6X A;  1PX7 A;  2CZ2 A;  2F9S A;  3LW9 A;  1PFO A;  4HJM A;  1A0F A;  2KHP A;  2VLV A;  3L9V A;  4K5S A;  3VWU A;  2C3Q A;  4JED A;  1S3R A;  5AIX A;  3GKX A;  4I6X A;  3RDW A;  1YY7 A;  1WIK A;  2M80 A;  2V6K A;  1WPI A;  2H71 A;  3DYR A;  1R5A A;  5HQP A;  4FXY P;  2VCX A;  2V2G A;  3KD0 A;  4BVX B;  1Q98 A;  4RQR A;  2AB6 A;  20GS A;  3VWV A;  3GKK A;  2OE1 A;  4XRA A;  5ECP B;  3I43 A;  4NV2 A;  2C1Y A;  3IHG A;  4ID0 A;  4PQH A;  4NHZ A;  3W8J A;  3H4K A;  3HCZ A;  2BMX A;  4NV5 A;  1PMT A;  4BVY B;  3CTG A;  6GST A;  3G9B A;  4MP4 A;  4DSR A;  1GLP A;  2WVX B;  1XOA A;  2UZ8 A;  3J7Y b;  3ZVJ D;  3KJY A;  4DVC A;  3EPT A;  2JL4 A;  3F6D A;  3ERG A;  5INY A;  4O5U A;  1Z9H A;  3HD5 A;  3DML A;  4YQV A;  1ABA A;  1ZYE A;  3OR5 A;  2EIR A;  3ZIJ A;  2ALB A;  2C4J A;  1X5D A;  4E8E A;  3SBC A;  3FMW A;  2YWO A;  2LS5 A;  5FWG A;  2GSS A;  4N10 A;  1Y25 A;  2H19 A;  2LRC A;  2X64 A;  2VM1 A;  5GST A;  4Z2T A;  4MNN A;  2IL3 A;  2K6V A;  1V98 A;  3DGQ A;  2PGT A;  2KP1 A;  3QFB C;  3DD3 A;  4K7N A;  1VF1 A;  1PA3 A;  1PQN A;  1E2Y A;  2FCH A;  3HA9 A;  5KOX A;  3ME8 A;  3W8S A;  2LRT A;  4HDE A;  2HXK A;  3A3T A;  4Q5R A;  1C72 A;  4KSM A;  3ZIV A;  2GQM A;  3CWG A;  1YF1 A;  1U88 A;  3P90 A;  4LMW A;  1GL8 A;  3US3 A;  2LRN A;  4QL9 A;  4MMM A;  1TU7 A;  1T4Y A;  5J40 A;  1B4Q A;  4DSQ A;  1G6W A;  3PPU A;  2RUE A;  2ON7 A;  2PMT A;  4MK3 A;  3HVS A;  4ECC A;  2O3E A;  4MJB A;  1S3C A;  1EZK A;  1PD2 1;  1GSQ A;  1O7U A;  5IMA A;  4G19 A;  5A5H A;  1W89 A;  3DIE A;  1SD8 A;  3KP8 A;  5A1N B;  4XS1 A;  1TTZ A;  1OKD A;  4POL A;  3HJP A;  3A5W A;  1OC9 B;  2HFD A;  2D2Z A;  1X9W B;  5KEJ A;  2WVZ A;  1PN0 A;  5ENU A;  3VPQ A;  1F3B A;  2B5X A;  1T3B A;  4OFM A;  2R37 A;  1URM A;  1TRU A;  3TOT A;  1K0B A;  3UBK A;  2YWN A;  1GSU A;  3ERF A;  2PU9 C;  2ZNM A;  4ZB6 A;  2CX3 A;  4ML6 A;  5FT3 A;  1EP7 A;  4HEA 2;  3VWW A;  4N0Z A;  5CAX A;  13GS A;  1XCC A;  1ILO A;  1A23 A;  3CRU A;  6GSY A;  1OYJ A;  5J47 A;  4J56 E;  1V2A A;  4JE1 A;  2GZP A;  4KX4 A;  1Z7P A;  3DKS A;  3VPT A;  2O36 A;  4PHZ C;  3N9J A;  2DKI A;  1HNA A;  4D73 A;  2KLX A;  1KNG A;  2L4C A;  1GTI A;  1V40 A;  5ID2 A;  2H1G A;  4EIP A;  1OE8 A;  1TI1 A;  2CAI A;  2NTO A;  4EKZ A;  1M7T A;  4X4J A;  3F9U A;  3TDG A;  9GSS A;  4IVF A;  1B9Y C;  3HDC A;  1BX9 A;  4L5O A;  2IWT A;  4AJ6 A;  2IME A;  3MSZ A;  4TXO A;  1EEM A;  4HQS A;  3P2A A;  2HLS A;  1GNW A;  18GS A;  5HR0 A;  4TR1 B;  2ES7 A;  1V9W A;  5L71 A;  3M3M A;  3D22 A;  3E3E A;  4K8M A;  2A4V A;  1FVJ A;  1EGO A;  3GIX A;  4MJC A;  1X9M B;  2DMM A;  3HY2 A;  1XVW A;  1SL0 B;  1WE0 A;  5B6M A;  4BL7 A;  4DSS A;  2VKZ G;  1ZL9 A;  2GZY A;  5J4U A;  3GH9 A;  1EWX A;  3R2Q A;  3UOM A;  2I9H A;  3C7M A;  2AUV A;  1VGL A;  2VOC A;  3CBU A;  2LTK A;  4TRX A;  1MDJ A;  1O85 A;  1EV4 A;  2X4A A;  1FB0 A;  4HZ2 A;  2PVQ A;  3TJF A;  3TKQ A;  2N5F A;  4IJI A;  4MLY A;  3TRX A;  4KSO A;  1QFN A;  1XW9 A;  3D5J A;  4CHS A;  4Z2R A;  2MMZ A;  5ECN B;  3M9J A;  4MJE A;  2HRA A;  3QOU A;  5BMU B;  4N30 A;  4G01 A;  1T4Z A;  3C1S A;  2H1L A;  1WP0 A;  4ZXG A;  2L57 A;  3KH7 A;  1Z3E A; 
#chains in the Genus database with same CATH homology
 3GUR A;  4LL1 B;  3LYP A;  2IJY A;  3BCI A;  3M9K A;  4KND A;  3VI7 A;  2XPD A;  1ZYN A;  3FRC A;  1FOH A;  2HRK A;  2HE3 A;  3HHV A;  4POB A;  1OC8 A;  2GZZ A;  3HVX A;  3PH9 A;  1SKR B;  2CAQ A;  1SJZ A;  2B5E A;  4K0N A;  2YNX A;  5F07 A;  2VM2 A;  3ZVJ A;  3GKN A;  1TP9 A;  1SL1 B;  2LST A;  3RBT A;  5GZZ B;  3VFI A;  3KIJ A;  4JZQ A;  3LFL A;  3QMX A;  2HI7 A;  5J41 A;  3HJO A;  1X9S B;  2CVK A;  2EFC A;  2F3M A;  3FR9 A;  1TK0 B;  2HSM A;  1Y1U A;  2HT9 A;  1GLQ A;  1VF2 A;  1WRY A;  2IMK A;  1A8L A;  5JWO B;  1OC3 A;  4GDF A;  2ZUP A;  1B9X C;  1BG1 A;  3UBL A;  5J4V A;  2BJX A;  1OVN A;  3FHK A;  1OAZ A;  4WKW A;  1GUL A;  3KTB A;  2LV3 A;  1K0N A;  3UVH A;  1OKT A;  4V2N A;  5D73 A;  2FHE A;  2PN8 A;  2TIR A;  4XIH A;  5LNK e;  1SJI A;  4HOJ A;  2X8G A;  3A2W A;  1E6B A;  1K3Y A;  2GQK A;  1Z6M A;  3IDV A;  4MPG A;  3P7X A;  3GMF A;  3GV1 A;  2DJ0 A;  1GNE A;  2WJU A;  2M72 A;  4DEJ A;  2DJ1 A;  2VL9 A;  4MZC A;  3IA1 A;  4BWS A;  5KN0 A;  2NDO A;  2GSQ A;  4XS6 A;  3F3Q A;  1AW9 A;  2XBI A;  1ACV A;  5ABR A;  2DIY A;  4JR4 A;  2IMD A;  3I6A A;  5AIV A;  3WD6 A;  1ZZY A;  4CW9 A;  5IPH A;  2FWE A;  3ZTL A;  2XC2 A;  2H0G A;  2H75 A;  2X99 A;  2X8H A;  4HU7 A;  5COH A;  3U6V A;  5CRH A;  2YWM A;  1XOB A;  4HS1 A;  2LEG A;  4NPB A;  3UAP A;  4G10 A;  4JRR A;  3P8W A;  3EU3 A;  3C71 A;  3A2V A;  3IC4 A;  4KE3 A;  3FY7 A;  1LBK A;  4EDY A;  3IAM 2;  3FR6 A;  1NSW A;  2MMN A;  4GQC A;  1U3A A;  3GL3 A;  5A4U A;  2FY6 A;  2K8V A;  1PN9 A;  3GX0 A;  2OT3 A;  2G0F A;  2H6Y A;  1Z5Y E;  3GA4 A;  4TN8 A;  1DE1 A;  4F0B A;  2QA1 A;  5ECI B;  2PER A;  2MBT A;  4PQ1 A;  4HJ2 A;  2YCD A;  2L5L A;  2HQT A;  4AKH A;  1ZYP A;  2J9H A;  2B7J A;  2R4V A;  4YH2 A;  2LJK A;  5CP1 A;  4CDO A;  5J5N A;  4MPF A;  2FA4 A;  3VK9 A;  2O7K A;  2GGT A;  4O7H A;  2CVB A;  3GL5 A;  3RPP A;  2CX4 A;  3GH6 A;  1EOH A;  2FNO A;  1GSS A;  4ZL9 A;  3EC3 A;  3IK7 A;  4RI6 A;  5D9W A;  5G1L A;  5H5S A;  4ACS A;  4EL1 A;  4ZB8 A;  2QGV A;  2KOK A;  4EVM A;  1A2L A;  1TKD B;  5F0G A;  2IFQ A;  4K2X A;  1SK0 A;  3D21 A;  1B4P A;  2VUP A;  2TRX A;  3IK9 A;  5A5H B;  3M0F A;  3F4T A;  3IOS A;  5IMF A;  2GQL A;  1KTE A;  1JFU A;  1VRS D;  5J9B A;  2JAD A;  5F05 A;  22GS A;  1IYI A;  3JCM L;  4AI6 A;  3EYT A;  1K0C A;  2MBS A;  1PL1 A;  2NVL A;  2I1U A;  1XBS A;  2DJK A;  1QGV A;  5IM9 A;  2H73 A;  4PQI A;  2H72 A;  3TJJ A;  3PGT A;  3KM6 A;  4K1F A;  3Q6O A;  4NAX A;  1YJ6 A;  4XRD A;  4F82 A;  3F4S A;  4I8B A;  1WJK A;  4KCE A;  1FG4 A;  1PSQ A;  2CZ3 A;  2O87 A;  3H93 A;  2PUK C;  4IGJ A;  4EF0 A;  2A2R A;  1F3A A;  1R7H A;  1T7P B;  1M2B A;  3GTU A;  16GS A;  19GS A;  1GWC A;  4ZB9 A;  4XS4 B;  3EVI A;  5ELA A;  4ECB A;  4F0C A;  2HZE B;  5ECM B;  4G0L A;  4WR4 A;  1KEB A;  3TCO A;  1A0R P;  4D73 B;  2NBS A;  3KCM A;  2VO4 A;  2X49 A;  1Q4J A;  3IRA A;  1PRX A;  1QXH A;  1TXU A;  4KW6 A;  3S9F A;  1TRV A;  4QMK A;  4ZBA A;  4USS A;  1JZW A;  2BTO T;  5DJL A;  4POM A;  4EO3 A;  5H5R A;  2DSA A;  1HNB A;  1SK2 A;  2FLS A;  4GQF A;  1N2A A;  4L8E A;  5CYY A;  2OBK A;  3QAW A;  2B5Y A;  2H76 A;  2WDU A;  4ILF A;  4TXO B;  4FH8 A;  1SD9 A;  2P0G A;  1J08 A;  3TKR A;  4NHW A;  3N5O A;  4IJ3 A;  2C8U A;  2VCQ A;  1ERW A;  1AQX A;  4TR3 A;  1XWA A;  8GSS A;  1F37 A;  1I5G A;  2M46 A;  1YQ1 A;  5IMZ A;  4GSN A;  3QPM A;  4BL7 B;  4DSS B;  2B3S A;  5A4W A;  2GDR A;  4I2U A;  2JZR A;  2XHF A;  3M8N A;  5ELG A;  2FWG A;  2DIZ A;  1AQV A;  2DBC A;  2N5A A;  4HU9 A;  5CRW A;  3APS A;  3IBH A;  1XWC A;  2VCW A;  1GTB A;  3VUR A;  4PGT A;  2B6M A;  3HYP A;  1MEK A;  4K9Z A;  5HFK A;  3LEF A;  3UVT A;  2DLX A;  1M2D A;  3MWH A;  3V1W A;  4TXV A;  5DAK B;  4BVX A;  3KMN A;  5D8I A;  4I2T A;  3NIV A;  2FGX A;  3C1R A;  1JZR A;  1QMV A;  1S3D A;  4N0V A;  1TRW A;  4MH2 A;  1GSD A;  4KAE A;  1ERU A;  1TRS A;  2H01 A;  3K8N A;  3HMJ G;  5DAL A;  1TOF A;  4G0K A;  5C00 A;  4I97 A;  3SWL A;  2JAC A;  2C80 A;  4MZB A;  1TK5 B;  5HR1 A;  2GTU A;  1M99 A;  4F9Z A;  3CSJ A;  2K18 A;  1FW1 A;  5IMV A;  2HRK B;  3A5I A;  5D9X A;  2VLT A;  3F8U A;  2EFE A;  2GS3 A;  4CY8 A;  3E9J B;  1B8X A;  2WZ9 A;  3F63 A;  2ON5 A;  3DVX A;  3A2X A;  2HNL A;  2DML A;  1XWG A;  2J23 A;  3IAS 2;  2V32 A;  3CXG A;  3G7J A;  2IMF A;  2YWI A;  1QQ2 A;  3GST A;  5H5Q A;  2HSM B;  2MYG A;  1K0A A;  4PXO A;  4P3Y B;  1Z6N A;  2VD0 A;  1OE7 A;  2AAW A;  3TJG A;  4WF5 A;  1EGR A;  1HQO A;  1Y6E A;  3PIN A;  3TJK A;  2OJL A;  2DJJ A;  1PX6 A;  5GAN D;  4Q5N A;  1AXD A;  2EFD A;  2VCZ A;  5HFG A;  3FKF A;  6GSV A;  10GS A;  1O81 A;  3ISO A;  5J3R A;  2V6O A;  5C04 A;  1R5P A;  4KGI A;  3HZ8 A;  1SEN A;  4J2F A;  5DQS A;  3MAK A;  1DE2 A;  4GSS A;  5CNW A;  3FR3 A;  4F2I A;  1F2E A;  3HKR A;  4ZBD A;  4WET A;  3GN3 A;  4ISD A;  1XWB A;  1O6J A;  1XPV A;  3H8Q A;  3GX8 A;  4A5P A;  6GSW A;  1MD3 A;  5A1N A;  2EFH A;  2GLR A;  2OE0 A;  1S3A A;  3FZ4 A;  1OC9 A;  3ERW A;  3LJR A;  2B1K A;  3UIW A;  1XW6 A;  1XVQ A;  4G2E A;  3ZRD A;  2WB9 A;  5G5F A;  2KP2 A;  17GS A;  3FEU A;  3M1G A;  3QD9 A;  3ZL5 A;  1TXX A;  5DCH A;  3MNG A;  4AKI A;  4IHU A;  2JSZ A;  1SKW B;  1TI3 A;  3VI5 A;  3ZLP A;  3TKP A;  1SVL A;  1N8J A;  2WGR A;  5IIZ A;  4FYC A;  2RM5 A;  5EL8 A;  2LJR A;  3LQ7 A;  4IBP A;  3WYW A;  1YF0 A;  2H0H A;  2F8A A;  3HZ4 A;  4JBB A;  3TRQ A;  2LQQ A;  4ZB7 A;  2C3T A;  5DVB A;  5F06 A;  4GF0 A;  1TU8 A;  3BD2 A;  2K8S A;  2R3X A;  1BF5 A;  4LLR A;  1G7O A;  3ZYW A;  3KXO A;  1YKC A;  5AIS A;  3BJ5 A;  2AV4 A;  5IOX A;  1ZCP A;  2IPA A;  4OFT A;  3IV4 A;  3I69 A;  3I9V 2;  1U6T A;  1A8Y A;  5DBQ A;  3D4M A;  1U87 A;  2O5V A;  2VL3 A;  3J7Y k;  5IOW A;  2E7P A;  5FHI A;  3EMX A;  2WS2 A;  4MZW A;  3H1N A;  2I81 A;  4QL7 A;  1X5E A;  3CYN A;  4HI7 A;  5E59 A;  4WXT A;  3HVV A;  1TW9 A;  4XCS A;  4AKX B;  2R0C A;  1VF4 A;  1YZX A;  2H66 A;  4MF6 A;  1BED A;  3HJM A;  2AHE A;  2O89 A;  4PUR A;  4PTS A;  1TDI A;  4YQU A;  5KN1 A;  1ZMA A;  2Z9S A;  2YJ7 A;  2NPB A;  2YAN A;  5D9T A;  1ON4 A;  5JCG A;  1M9B A;  5AN1 A;  3GTU B;  2L59 A;  1FO5 A;  2YZH A;  5GAP D;  1EP8 A;  2MZC A;  3MYD A;  4WR5 A;  2DKH A;  1RQM A;  2C0G A;  4KUN A;  5EVO A;  3UMA A;  3FZ5 A;  1VF3 A;  2EIO A;  3CSI A;  5BRT A;  2LNS A;  1BQ7 A;  2A4H A;  4X43 A;  1ZOF A;  1PGT A;  2HRF A;  3WT2 A;  4GWR A;  1EOG A;  1EV9 A;  5BMU A;  3QDN A;  3LOR A;  3ZFL A;  2GVP A;  2IN3 A;  4YAV A;  1JZO A;  2H30 A;  1XWK A;  2YP6 A;  3ZZX A;  1LJR A;  1HD2 A;  5G31 A;  3IPZ A;  2E2M A;  3BCK A;  2YN1 A;  1BAY A;  2XBQ A;  2HYX A;  5IPG A;  1DUG A;  1M9A A;  1F9M A;  3GNJ A;  5G5E A;  2C0D A;  1SVM A;  5IQY A;  2YPM A;  3CTF A;  1XFL A;  3FW2 A;  1THX A;  1K3L A;  4K7I A;  2VLU A;  1XW5 A;  3TKS C;  5IMC A;  4LA1 A;  2WCI A;  4AJ8 A;  4BWQ A;  4KDU A;  3FZ9 A;  4LMV A;  5JCU A;  1FB6 A;  2HZF A;  4KCA A;  2YV9 A;  4X1U A;  3H79 A;  2VCV A;  4L5L A;  4IP1 A;  4K2D A;  3EIN A;  2JU5 A;  4N11 A;  4FYB A;  4Q5Q A;  2B1L A;  2H6Z A;  3GSS A;  2TRC P;  5HR3 A;  4IN0 A;  4TR4 A;  2P5R A;  5LCZ A;  3TKS A;  4XHM A;  4JU5 A;  5B8A A;  2YJH A;  4GXZ A;  3LXT A;  5ECS A;  1AQW A;  3AY8 A;  5GSS A;  2JZT A;  4V2M A;  1IYH A;  5DJM A;  1A24 A;  1HNC A;  4Q5F A;  4OFN A;  3EE2 A;  4K5R A;  5IO2 A;  4OMV A;  3Q18 A;  3BOA A;  5ECO B;  2LQO A;  5DAL B;  4MA9 A;  2CT6 A;  1H75 A;  3DEX A;  2KUC A;  1XIY A;  4PX1 A;  2H1B A;  3DWV A;  4OO5 A;  1K0O A;  4G9H A;  3CSH A;  2C0F A;  3EWL A;  4OCE A;  1SYR A;  5G2Z A;  6GSX A;  7GSS A;  2HRN A;  3KZQ A;  2XPE A;  1T1V A;  1O8X A;  1M2A A;  3KP9 A;  2GT5 A;  4OO4 A;  5A34 A;  3GKM A;  4HQZ A;  5A5K A;  5E4W A;  3DVW A;  1G0T A;  4AJ7 A;  4BA7 A;  1SJ6 A;  1W4V A;  1XXU A;  2X8C A;  2OA7 A;  4ULX A;  5ID2 B;  2O85 A;  3TKS E;  2CA8 A;  4IW9 A;  2PBJ A;  3ME7 A;  4HZ4 A;  5JWR B;  2GSR A;  1NW2 A;  2CV4 A;  4O92 A;  3QR6 A;  3D6I A;  4I5Q A;  3UJ1 A;  1BJX A;  3GRX A;  5ECQ B;  5D93 A;  3WGE A;  2H1D A;  2E2G A;  2LKU A;  1A2J A;  1HYU A;  2H8L A;  2OKA A;  5CRG A;  5EPF A;  3G7Y A;  3LG6 A;  1O8W A;  1K3O A;  3C73 A;  1UA5 A;  3O76 A;  3TUE A;  4AGS A;  1X0R A;  1LU4 A;  1MDI A;  2JSY A;  3HXS A;  1JZD A;  3FYG A;  1J9B A;  2DJ2 A;  4ZIL A;  3WGD A;  4NWY A;  2OAC A;  2I3Y A;  2HSN A;  5ECL B;  5F8B A;  2AJQ B;  2QKE A;  4YAP A;  1WWJ A;  1ZYQ B;  14GS A;  2K9F A;  3QCP A;  4K7O A;  2AYT A;  4IKH A;  2WFC A;  2IMI A;  2O8V B;  4O32 A;  3KGK A;  3G7I A;  4YQM A;  3F4R A;  4IP6 A;  4IQA A;  2VIM A;  1AAZ A;  4AKG A;  4MF5 A;  4RI7 A;  3LWA A;  3ZFB A;  2OE3 A;  3KH9 A;  3L9S A;  1BYE A;  2LJA A;  1A2M A;  4TKY A;  2I4A A;  3FZA A;  3TOU A;  1ERT A;  2RUF A;  3L78 A;  4L0W A;  1R4W A;  2A2S A;  2B7K A;  3WGX A;  5IO0 A;  3QAG A;  3MDK A;  2YV7 A;  4G0I A;  2L4Q A;  3DRN A;  4Z7X A;  1YKA A;  2E0Q A;  2VAF A;  5JWQ B;  4BPY A;  4V2L A;  2CQ9 A;  1GTA A;  5D96 A;  2F51 A;  5KN3 A;  1JHB A;  4BVY A;  2G2Q A;  3IXR A;  6GSS A;  2FWH A;  1FOV A;  3Q74 A;  1NHO A;  1V58 A;  6GSU A;  2LNT A;  4AF2 A;  1SKS B;  4MCU A;  4YKF A;  1YEP A;  5AGY A;  2RII A;  4XS4 A;  4KF9 A;  4KH7 A;  5DCG A;  2QSI A;  2HZE A;  3O6T A;  2OAD A;  4MAB A;  4KB3 A;  4FQU A;  4N3Z A;  4ZIJ A;  2GT6 A;  1XZO A;  1JLW A;  4LL4 B;  1B48 A;  1WMJ A;  4GTU A;  5G30 A;  4YKG A;  5CRE A;  3O3T A;  4TVE A;  4IEL A;  3IC8 A;  1JLV A;  4H86 A;  1DBY A;  4WEY A;  3NOF A;  4TOP A;  2GST A;  1Z7R A;  4O5Q A;  1GRX A;  4ZL8 A;  4EUY A;  4PUF C;  2A2P A;  5DQY A;  4J57 E;  3LSZ A;  1ERV A;  3IE3 A;  3D0Z A;  3FK8 A;  5CRD A;  1FHE A;  4FYU A;  4EC0 A;  1GTU A;  3CRT A;  4RUV A;  2R2J A;  1K0D A;  3WT1 A;  4ECI A;  4W66 A;  1MDK A;  2VL2 C;  4PNF A;  1AIU A;  4NMU A;  4ZBB A;  4ZL7 A;  2C3N A;  3GHA A;  3W6G A;  1EEJ A;  3F6F A;  1K0M A;  2JZS A;  1SU9 A;  2PVO C;  2R5G A;  4KA0 A;  1BG5 A;  2LUS A;  4PUA A;  4OCF A;  1SVO A;  2C0E A;  4PNG A;  1NM3 A;  1AUC A;  3EUR A;  2DJ3 A;  5ECR B;  2R6K A;  3CMI A;  1T00 A;  2VL2 A;  5KN2 A;  5DDL A;  1FVK A;  3ZML A;  2IIY A;  1PL2 A;  5B6N A;  5ECH B;  3MIX A;  1SYX A;  2REM A;  2R0G A;  5LD0 A;  1UC7 A;  1UVZ A;  5KOW A;  3TGZ A;  2RM6 A;  3ZMK A;  5G1K A;  3APO A;  5J4Y A;  4ML1 A;  1THO A;  2OBI A;  5DAK A;  3L0H A;  4IS0 A;  3L4N A;  3DXB A;  4RQX A;  1RK4 A;  2RLI A;  2HSH A;  1M0U A;  5CO3 A;  5JCW A;  3LYK A;  1CQG A;  1KBN A;  4Z2U A;  2ZCT A;  2VCT A;  1NHY A;  5B8B A;  4POK A;  1UN2 A;  1DSB A;  3ED3 A;  4FIW A;  3GYK A;  3KEB A;  5B7C A;  2P5Q A;  1SK1 A;  5EY6 A;  3TJB A;  1FAA A;  1R26 A;  4MF7 A;  4OWY A;  4XTS A;  1GP1 A;  4IQ1 A;  2IFQ B;  3QAV A;  1N25 A;  1H4O A;  1YDK A;  1MD4 A;  4X0X A;  3IHQ A;  5ECK B;  4GST A;  2PWJ A;  1GUK A;  4KDY A;  1TJD A;  2N5B A;  2EIQ A;  2DC5 A;  4E8H A;  2H1A A;  3TU3 B;  2PPT A;  2QA2 A;  4EDZ A;  1GUM A;  4MH3 A;  4GCI A;  3F3R A;  1F6M C;  4K6X A;  1X5C A;  3RPN A;  3EU4 A;  1V57 A;  4O5R A;  3R3E A;  4ECJ A;  3PR8 A;  2V41 A;  1I9D A;  2FWF A;  4GRF A;  3EMP A;  1GSY A;  4L0U A;  3L9U A;  4TR1 A;  3VLN A;  1T8E B;  1QUW A;  3ZRE A;  3LXZ A;  2V1M A;  4QQ7 A;  2H70 A;  1RW1 A;  4EIQ A;  1SL2 B;  1G6Y A;  3RHC A;  4K0G A;  2UV8 G;  1TK8 B;  4FO5 A;  12GS A;  2YOI A;  1ML6 A;  4MDC A;  4F03 A;  4WBJ A;  2F8F A;  1PKZ A;  1AC1 A;  3QFA C;  2H0I A;  4TW5 A;  3NZN A;  3F0I A;  3IR4 A;  2MMA A;  4GLT A;  4TR0 A;  4JR6 A;  2HSY A;  2H74 A;  2L6D A;  3UAR A;  4EE0 A;  3APQ A;  1USB A;  3KTL A;  3GUS A;  1U3I A;  5HR2 A;  5A34 B;  1G7E A;  2L6C A;  1YEX A;  4HUA A;  3RAZ A;  3Q19 A;  1YVL A;  2R0P A;  1GSF A;  5D9V A;  1CQH A;  4CY6 A;  1O73 A;  3KMO A;  3ZIT A;  2CVD A;  2WRT A;  1MTC A;  1PKW A;  1ST9 A;  2L5O A;  1ZGN A;  3U5R E;  2FD3 A;  5A4V A;  4EXJ A;  11GS A;  3LGC A;  3VWX A;  2WUL A;  4E68 A;  2FA8 A;  2FUG 2;  1GSE A;  2YZU A;  3GFK A;  4WBR D;  4KDX A;  4V1A p;  2VD1 A;  4WF4 A;  1GH2 A;  4MJA A;  3D4T A;  3E0U A;  3RHB A;  4ICY A;  4NXI A;  1J0F A;  3BBY A;  2QC7 A;  1GUH A;  1WOU A;  3TRP A;  2P31 A;  5J9C A;  2MMO A;  5HFI A;  3C8E A;  4V1A g;  2HSN B;  3TB2 A;  3UEM A;  5IMD A;  1QK8 A;  2EC4 A;  3UL3 A;  4OD7 A;  2H6X A;  1PX7 A;  2CZ2 A;  2F9S A;  3LW9 A;  4HJM A;  1A0F A;  2KHP A;  2VLV A;  3L9V A;  4K5S A;  3VWU A;  2C3Q A;  4JED A;  5AIX A;  3GKX A;  4I6X A;  3RDW A;  1YY7 A;  1WIK A;  2M80 A;  2V6K A;  1WPI A;  2H71 A;  3DYR A;  1R5A A;  5HQP A;  2VCX A;  2V2G A;  3KD0 A;  4BVX B;  1Q98 A;  4RQR A;  2AB6 A;  20GS A;  3VWV A;  3GKK A;  2OE1 A;  4XRA A;  5ECP B;  3I43 A;  4NV2 A;  2C1Y A;  3IHG A;  4ID0 A;  4PQH A;  4NHZ A;  3W8J A;  3H4K A;  3HCZ A;  2BMX A;  4NV5 A;  1PMT A;  4BVY B;  3CTG A;  6GST A;  3G9B A;  4MP4 A;  4DSR A;  1GLP A;  1XOA A;  2UZ8 A;  3J7Y b;  3ZVJ D;  3KJY A;  4DVC A;  3EPT A;  2JL4 A;  3F6D A;  3ERG A;  5INY A;  4O5U A;  1Z9H A;  3HD5 A;  3DML A;  4YQV A;  1ABA A;  1ZYE A;  3OR5 A;  2EIR A;  3ZIJ A;  2ALB A;  2C4J A;  1X5D A;  4E8E A;  3SBC A;  3FMW A;  2YWO A;  2LS5 A;  5FWG A;  2GSS A;  4N10 A;  1Y25 A;  2H19 A;  2LRC A;  2X64 A;  2VM1 A;  5GST A;  4Z2T A;  4MNN A;  2IL3 A;  2K6V A;  1V98 A;  3DGQ A;  2PGT A;  2KP1 A;  3QFB C;  3DD3 A;  4K7N A;  1VF1 A;  1PA3 A;  1PQN A;  1E2Y A;  2FCH A;  3HA9 A;  5KOX A;  3ME8 A;  3W8S A;  2LRT A;  4HDE A;  2HXK A;  3A3T A;  4Q5R A;  1C72 A;  4KSM A;  3ZIV A;  2GQM A;  3CWG A;  1YF1 A;  1U88 A;  3P90 A;  4LMW A;  1GL8 A;  3US3 A;  2LRN A;  4QL9 A;  4MMM A;  1TU7 A;  1T4Y A;  5J40 A;  1B4Q A;  4DSQ A;  1G6W A;  3PPU A;  2RUE A;  2ON7 A;  2PMT A;  4MK3 A;  3HVS A;  4ECC A;  4MJB A;  1S3C A;  1EZK A;  1PD2 1;  1GSQ A;  1O7U A;  5IMA A;  4G19 A;  5A5H A;  1W89 A;  3DIE A;  1SD8 A;  3KP8 A;  5A1N B;  4XS1 A;  1TTZ A;  1OKD A;  4POL A;  3HJP A;  3A5W A;  1OC9 B;  2HFD A;  2D2Z A;  1X9W B;  5KEJ A;  1PN0 A;  5ENU A;  3VPQ A;  1F3B A;  2B5X A;  1T3B A;  4OFM A;  2R37 A;  1URM A;  1TRU A;  3TOT A;  1K0B A;  3UBK A;  2YWN A;  1GSU A;  3ERF A;  2PU9 C;  2ZNM A;  4ZB6 A;  2CX3 A;  4ML6 A;  5FT3 A;  1EP7 A;  4HEA 2;  3VWW A;  4N0Z A;  5CAX A;  13GS A;  1XCC A;  1ILO A;  1A23 A;  3CRU A;  6GSY A;  1OYJ A;  5J47 A;  4J56 E;  1V2A A;  4JE1 A;  2GZP A;  4KX4 A;  1Z7P A;  3DKS A;  3VPT A;  3N9J A;  2DKI A;  1HNA A;  4D73 A;  2KLX A;  1KNG A;  2L4C A;  1GTI A;  1V40 A;  5ID2 A;  2H1G A;  4EIP A;  1OE8 A;  1TI1 A;  2CAI A;  2NTO A;  4EKZ A;  1M7T A;  4X4J A;  3F9U A;  3TDG A;  9GSS A;  4IVF A;  1B9Y C;  3HDC A;  1BX9 A;  4L5O A;  2IWT A;  4AJ6 A;  2IME A;  3MSZ A;  4TXO A;  1EEM A;  4HQS A;  3P2A A;  2HLS A;  1GNW A;  18GS A;  5HR0 A;  4TR1 B;  2ES7 A;  1V9W A;  5L71 A;  3M3M A;  3D22 A;  3E3E A;  4K8M A;  2A4V A;  1FVJ A;  1EGO A;  3GIX A;  4MJC A;  1X9M B;  2DMM A;  3HY2 A;  1XVW A;  1SL0 B;  1WE0 A;  5B6M A;  4BL7 A;  4DSS A;  2VKZ G;  1ZL9 A;  2GZY A;  5J4U A;  3GH9 A;  1EWX A;  3R2Q A;  3UOM A;  2I9H A;  3C7M A;  2AUV A;  1VGL A;  2VOC A;  3CBU A;  2LTK A;  4TRX A;  1MDJ A;  1O85 A;  1EV4 A;  2X4A A;  1FB0 A;  4HZ2 A;  2PVQ A;  3TJF A;  3TKQ A;  2N5F A;  4IJI A;  4MLY A;  3TRX A;  4KSO A;  1QFN A;  1XW9 A;  3D5J A;  4CHS A;  4Z2R A;  2MMZ A;  5ECN B;  3M9J A;  4MJE A;  2HRA A;  3QOU A;  5BMU B;  4N30 A;  4G01 A;  1T4Z A;  3C1S A;  2H1L A;  1WP0 A;  4ZXG A;  2L57 A;  3KH7 A;  1Z3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...