6GSXA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
217
Chain Sequence
PMILGFWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 75
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gsxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gsxA01
4OCFA 2DSAA 4IELA 2NDOA 2L5OA 3BCKA 1K0OA 1V9WA 4N11A 1U3IA 2J23A 2LKUA 2GT6A 3RAZA 5ID2A 2GGTA 4NV5A 5KN2A 4LLRA 1OE7A 4KDXA 1GSQA 3TCOA 4EXJA 4MH3A 2HSNB 3MDKA 4K7NA 1EEJA 5IM9A 4I5QA 4MJBA 3UBKA 4NMUA 2GQLA 1XIYA 4K7IA 2LRTA 3F63A 1TRWA 1OC9A 4MZBA 1SK2A 3S9FA 4IHUA 5L71A 4RQRA 1GSDA 3UAPA 5IQYA 4IQ1A 4ZBAA 4WBRD 3FK8A 2CX4A 2YPMA 1SD8A 4HU9A 3QR6A 2HI7A 3C1SA 3M9JA 1T4YA 5CP1A 3IA1A 4TXOA 4LA1A 5CAXA 1XVWA 2F8FA 5D9XA 3BCIA 1ZCPA 2LJKA 1FHEA 2AB6A 6GSVA 2Z9SA 2XHFA 4POMA 2HZFA 4DSSA 5KN0A 3RDWA 1PSQA 3GH9A 4NPBA 2O8VB 3P8WA 4DVCA 1JZRA 2GSQA 2VOCA 4QL9A 3M8NA 3Q18A 3ZFBA 2JZRA 3KH9A 2M72A 1N2AA 2HRFA 3EURA 3H1NA 3O6TA 1YDKA 3VLNA 4XRAA 1UVZA 5IMAA 2HRAA 3TKQA 2MBSA 5CO3A 2DMMA 2N5BA 3HVVA 2WULA 3NZNA 1MDJA 1PL2A 5ELGA 3E9JB 4TOPA 2J9HA 2WRTA 1AQVA 4E8EA 1PMTA 3GA4A 2H1GA 4JR6A 3GKMA 4POBA 2LSTA 4MF7A 3KZQA 4XTSA 3ZREA 3UVTA 4TR1A 4WF4A 3TGZA 3PPUA 2RUFA 5ECPB 2GSRA 1URMA 2CVBA 2H70A 3CXGA 1VGLA 4ZIJA 1ERUA 2BJXA 2KLXA 4HJMA 3WGDA 1EOHA 2VL3A 2H75A 4ZB6A 1TU7A 3LJRA 2LJAA 2VUPA 4AJ8A 3US3A 1SJZA 3A2VA 1O73A 5J3RA 2RIIA 4TR0A 2WB9A 1OAZA 4V2LA 1MD3A 3C71A 3H8QA 4K2DA 2YZHA 1ON4A 3GUSA 4CHSA 3APOA 3LG6A 1TK5B 1K0AA 2DJ2A 1AQXA 2LEGA 1FVJA 2HZEB 2XPDA 4EVMA 1X5EA 1MDKA 1HNCA 2V1MA 2LQOA 4ECIA 3H79A 1T3BA 3L0HA 4XCSA 2FA4A 2LRCA 2E2MA 3UMAA 2YV9A 4ZL7A 4WR5A 2VCZA 1M99A 3LFLA 2PBJA 3IAS2 5CYYA 1PD21 2FWFA 2X64A 2H72A 2IMDA 3RBTA 1NHYA 5E59A 1M2DA 2B7JA 2AJQB 2GVPA 4TKYA 3N5OA 3EU4A 3QPMA 18GSA 3L78A 3LQ7A 2RM6A 1J08A 5ECHB 3QFAC 4EL1A 3EINA 2P5RA 1YF0A 4XRDA 2I1UA 2YN1A 2HRKB 4KH7A 1XCCA 3DD3A 1AIUA 4D73B 1TDIA 5IMFA 3ZIVA 2ON5A 1Z7RA 2DJKA 1SL1B 3FHKA 3GH6A 5J5NA 4KDUA 4ID0A 1IYIA 3LXZA 2OE3A 1XWCA 4KUNA 3F3RA 1NM3A 2C3QA 4G10A 1TK0B 2GZZA 1WOUA 1AXDA 1JZOA 4MDCA 2C0EA 2OBIA 2DIZA 4MF6A 1ST9A 1V58A 2BTOT 1GSFA 4GRFA 3U5RE 1JLWA 1B9XC 2PPTA 1OC3A 5J9CA 1O7UA 3UOMA 5INYA 1SD9A 4YAPA 2MMNA 4BVYB 3DWVA 3A2XA 4OO4A 3KTLA 1OE8A 4MJCA 3PR8A 3IBHA 1WIKA 1O8XA 2IMEA 3UJ1A 3HJPA 5CRDA 4IBPA 1PL1A 4PQHA 4PNGA 4USSA 4ULXA 4F9ZA 2NBSA 2CA8A 2OKAA 3LXTA 5CRGA 1ZZYA 3GFKA 2HE3A 4TN8A 3Q19A 1U87A 4OFTA 1U6TA 5J9BA 2V6OA 7GSSA 5G5EA 2R5GA 2YANA 1BG5A 3M9KA 2V2GA 2ES7A 1X5CA 1SENA 4N0VA 3UL3A 1B9YC 1K3YA 2HFDA 4IGJA 1BQ7A 3QAVA 2K6VA 3PINA 3CYNA 2OA7A 3KH7A 4YAVA 2CZ3A 2ALBA 4BL7A 5JCWA 3SWLA 2CX3A 4GF0A 4V1Ap 2KP1A 5IO0A 5DALB 2ON7A 3C8EA 3FEUA 4IS0A 1XWBA 1K3OA 1F3BA 4GSTA 3TJKA 3APSA 3U6VA 3GTUA 2C0DA 1K0DA 1A0RP 2V6KA 4GCIA 3VPQA 4OCEA 5BMUA 4MLYA 2WDUA 2HQTA 1Z9HA 1G6WA 3VWUA 4KSOA 2CT6A 2NVLA 1U3AA 2LNSA 5CRHA 1WWJA 4DEJA 3KEBA 4V2NA 1XW5A 1TRUA 3F4RA 2F51A 2PU9C 2P31A 4HZ2A 1E6BA 3I6AA 4CDOA 4NHWA 3G7IA 3GNJA 3J7Yb 3ZIJA 3F8UA 4NWYA 2R2JA 3LYKA 3KJYA 1OC9B 4KX4A 2EIOA 4HJ2A 3BOAA 2JADA 1TRSA 4G9HA 1JHBA 4ZILA 2IMKA 2TIRA 4TXOB 5EY6A 2X8CA 5ELAA 2WGRA 3EWLA 3D6IA 1JZWA 1YEPA 2FWGA 4F82A 2KUCA 1F37A 3BBYA 5F0GA 4MH2A 5HFKA 2FNOA 5DQYA 4DSSB 3VWXA 3KMNA 4KE3A 1DE1A 4HEA2 5LNKe 4J57E 2LTKA 2QSIA 5HR3A 1SU9A 4HQZA 1H75A 2K8VA 1XBSA 5ECLB 2H73A 5D9TA 3ZMKA 5A5KA 3KM6A 5C04A 1U88A 1K0NA 1SJIA 3GYKA 1MD4A 4KW6A 4IKHA 2FWEA 4GLTA 4K0NA 3IC4A 5AIXA 1QFNA 5ENUA 1X9WB 3CBUA 5HR0A 5G5FA 3R2QA 1BAYA 1GSSA 4K0GA 3DYRA 3LEFA 2FY6A 1NSWA 4TR1B 2I3YA 3QAGA 2C3NA 5D9VA 4PNFA 2OADA 2QC7A 2RM5A 2WZ9A 3LSZA 12GSA 1M9AA 3G7JA 3HDCA 4TR4A 1IYHA 3F4TA 1THOA 2C1YA 3VI5A 2HNLA 2HSMA 4KDYA 2VLTA 2I9HA 3TOTA 3E3EA 4E8HA 3DVXA 4TXVA 4Q5RA 2MMOA 3GL5A 4P3YB 4KCEA 3HHVA 3TRPA 1M0UA 3FKFA 3WYWA 2VL2C 3F6FA 5DQSA 2E0QA 3GV1A 2O87A 1YQ1A 3DIEA 1PKZA 1KNGA 1V2AA 5H5QA 3IK7A 4ECCA 1EGOA 1HNBA 4HU7A 1ABAA 4PGTA 2R4VA 2VLUA 2HLSA 3I43A 4MPGA 1QK8A 2DLXA 1TTZA 6GSUA 3TOUA 4OFMA 1GUKA 4F2IA 5JWOB 1B4QA 4IVFA 2H74A 3D4TA 4X1UA 2YP6A 3RHCA 4KF9A 1O85A 1R5PA 2YWOA 4GSNA 3MWHA 2H0GA 4NXIA 3CSJA 4IJ3A 3HZ4A 3ZRDA 2C8UA 3N9JA 2VAFA 5COHA 1OKTA 3KXOA 1XWAA 3R3EA 1WP0A 3OR5A 2IMFA 5ECOB 4POKA 1YEXA 5B8AA 2O89A 3DMLA 4PX1A 1GL8A 2OE1A 2C3TA 3HD5A 5HR2A 3BD2A 5D96A 4HZ4A 1EP7A 3SBCA 1HD2A 3WGXA 2GSSA 1Z3EA 1SKRB 2CVDA 2TRCP 1SKSB 3ZLPA 1GTIA 4HUAA 4OO5A 3EMXA 2H1AA 1DUGA 2CQ9A 1OVNA 5JCGA 2GLRA 4ISDA 3GIXA 2H0HA 1SJ6A 1G6YA 4PUAA 3IHQA 1ZL9A 1JFUA 3QD9A 2I4AA 5HFIA 3VPTA 4GXZA 2C0FA 4WEYA 1USBA 4KA0A 2FWHA 5G1LA 3F9UA 1TJDA 4YQUA 1M9BA 2IIYA 2REMA 3EE2A 1GNEA 1NW2A 2DBCA 4GTUA 2GQKA 13GSA 1A2JA 5IIZA 3I9V2 4I97A 2DJ0A 4MABA 5DCHA 4FYUA 3LYPA 5JWRB 3PH9A 4JE1A 3F0IA 4MMMA 3QAWA 1LJRA 2B6MA 2I81A 1V40A 3MSZA 3WGEA 4BL7B 3HYPA 1FG4A 1GUMA 2PUKC 3FR9A 4J2FA 1TKDB 3M1GA 4N0ZA 5G2ZA 1K3LA 1TOFA 4L0WA 3EC3A 1EP8A 3FZAA 5IOWA 4TRXA 3RHBA 1PX7A 1Z6NA 2AHEA 3GTUB 3GMFA 2PMTA 2JACA 4I2TA 3D22A 1EOGA 4BWSA 2LV3A 2F8AA 1Z5YE 1LBKA 1K0CA 3UEMA 4ZL8A 17GSA 4IP6A 1M7TA 1V98A 3KIJA 2CVKA 4ZBBA 1Y25A 1Q98A 4NHZA 3JCML 3FZ5A 2YCDA 1WRYA 4CW9A 4V2MA 2FGXA 2VCQA 3K8NA 5AIVA 4RQXA 2OE0A 4KB3A 1N8JA 3O76A 2ZUPA 1EWXA 1ILOA 1X0RA 1OYJA 3TRQA 4O32A 1SYRA 3HJMA 5G1KA 4MJEA 4TVEA 4PQ1A 2IFQA 3C1RA 2LNTA 3GKNA 1TK8B 6GSSA 5JWQB 4MPFA 3CRUA 1QQ2A 2VM2A 3FR6A 2H19A 2V32A 2L5LA 5LCZA 2IMIA 3RPNA 5DJMA 4MJAA 2LRNA 3KCMA 5JCUA 4AGSA 3EU3A 5AN1A 6GSXA 4BA7A 1DSBA 3HA9A 3DGQA 5EL8A 1TXXA 2QGVA 5IPGA 2B5XA 4LMVA 5A4WA 5HFGA 1AC1A 3ERGA 2L57A 4JZQA 1KEBA 3BJ5A 3CSHA 4IQAA 2L6DA 2VO4A 4EDZA 2XC2A 5IPHA 1DE2A 2LJRA 1ERWA 3TKSC 4IP1A 4F0CA 2B5EA 1A23A 2X8HA 3IPZA 4QL7A 3TJBA 5B6NA 3L9SA 5F07A 4OWYA 4BWQA 3DRNA 1GH2A 4XS1A 2JZTA 3Q74A 1FO5A 3HCZA 1UC7A 2WFCA 3WT1A 1OKDA 22GSA 1FB6A 2FA8A 2G0FA 5D8IA 3KMOA 2C0GA 1OC8A 2RUEA 2XBIA 2ZNMA 1GUHA 1FAAA 3ZYWA 4WBJA 20GSA 2LS5A 1VF3A 2H6XA 4FH8A 5ID2B 1SL2B 1AW9A 1A0FA 2HSMB 3ZITA 4KSMA 2OJLA 5AISA 6GSTA 5B8BA 4FIWA 5DAKA 2KP2A 1LU4A 2GS3A 1HNAA 3GRXA 4EO3A 2AV4A 2LUSA 1GRXA 1PKWA 2VCTA 2GQMA 3IAM2 4KCAA 5GSSA 2NTOA 2JZSA 4MP4A 2B7KA 3W6GA 1TRVA 2A2SA 1ERTA 4ECBA 9GSSA 2FUG2 3TJJA 4ZBDA 3PGTA 2DJJA 1JZDA 1WJKA 1BEDA 4G19A 3GKXA 4PXOA 1R26A 2BMXA 2VLVA 4NV2A 3QCPA 5FWGA 4Q5QA 4PTSA 2EIQA 4MZCA 1XW6A 3G9BA 4JRRA 4JEDA 4KAEA 2N5FA 2HRNA 3ED3A 5ECNB 5KN1A 1QXHA 2L59A 2VL2A 1R4WA 1R7HA 1JLVA 3GKKA 5H5RA 5F06A 3J7Yk 4GQCA 1HQOA 1B4PA 2H6YA 4XHMA 1ZMAA 4I8BA 4ZB8A 3L9UA 2WS2A 3GHAA 2O7KA 10GSA 5A4UA 4WXTA 3ERFA 1VF4A 1RW1A 5D9WA 2FHEA 3VWVA 5IMVA 4N30A 2YJHA 5LD0A 4ECJA 3ME8A 1V57A 3G7YA 4XS4A 3TKPA 4FQUA 5CNWA 1GSUA 4DSRA 3APQA 2MMAA 4F0BA 2FLSA 1S3AA 1VF2A 3ZVJA 3NOFA 2JL4A 4HDEA 2IWTA 5J41A 1EEMA 3DEXA 2C80A 3C73A 2H1DA 1VF1A 4HQSA 4LMWA 4MK3A 1T1VA 2GZYA 4NAXA 1H4OA 1TP9A 4O5RA 3P90A 1ZYQB 4WETA 3RPPA 4X43A 1A8YA 1YJ6A 11GSA 3IXRA 3EYTA 2K8SA 2LQQA 3FRCA 1O81A 4XIHA 1XWGA 4RI6A 2CV4A 3TDGA 1M2BA 3I69A 3CRTA 3QFBC 2KOKA 4Q5NA 5KEJA 1CQGA 3H4KA 4O92A 4OD7A 2DJ1A 1S3CA 2B3SA 2R37A 1F9MA 3HVXA 3GSSA 3M3MA 4YH2A 3TKSE 2HSHA 2YWNA 1T4ZA 5C00A 1S3DA 3O3TA 1A2MA 1XOAA 2MYGA 2HT9A 4GSSA 4IN0A 2H76A 14GSA 3TJGA 1I5GA 4KGIA 2WCIA 2VD0A 1GTBA 4OFNA 3D0ZA 5D73A 1GSYA 3HVSA 1FW1A 5FHIA 2H6ZA 1GWCA 2V41A 5IMCA 4V1Ag 2VCVA 5HR1A 2YZUA 4AJ6A 1PX6A 2VD1A 1G0TA 4YQVA 1MDIA 2CAQA 1RK4A 1B48A 3DXBA 3CTGA 2CAIA 3TJFA 4DSQA 1O8WA 3C7MA 1BX9A 5DDLA 3M0FA 2P0GA 1HYUA 1SL0B 2HSYA 3HJOA 1PRXA 3D4MA 3KP9A 5ECMB 4BVXA 2XBQA 1KBNA 5GAND 2QKEA 1Z7PA 2H01A 4WF5A 4FO5A 2OBKA 4JR4A 4HI7A 1PGTA 4O7HA 5GAPD 2GTUA 4FYCA 1ACVA 2OACA 3ZZXA 1XPVA 1XZOA 3QOUA 2MBTA 5AGYA 2VL9A 2L6CA 2PWJA 1UN2A 3VI7A 1NHOA 2P5QA 3ERWA 4LL4B 4IJIA 4EKZA 4EUYA 5CRWA 1PQNA 3GL3A 2IFQB 5EPFA 1J9BA 2PVOC 2TRXA 4OMVA 2JSZA 5GZZB 2HXKA 4X0XA 1SK1A 1E2YA 1XOBA 3IC8A 3IE3A 1QGVA 1XVQA 3W8SA 4WR4A 2VCXA 2MMZA 1Q4JA 1GP1A 3TUEA 5ECSA 3ZVJD 4GWRA 3VK9A 3A3TA 4L5OA 2YOIA 5ECQB 1TW9A 1WPIA 2M80A 1K0MA 3F3QA 3F4SA 3WD6A 2H1BA 5J4UA 2IN3A 5D93A 3HKRA 1C72A 3KD0A 1SYXA 1A8LA 4ML1A 3D21A 3HZ8A 3GURA 5IOXA 3HXSA 1BJXA 4ML6A 5ECRB 4ZXGA 2KHPA 1X9SB 2VCWA 2GSTA 3TB2A 5H5SA 4F03A 1SK0A 3W8JA 2GDRA 3ZTLA 2K18A 1MEKA 1PN9A 1ZYEA 1XXUA 4L0UA 5ECKB 2DC5A 3P7XA 3IV4A 1DBYA 2K9FA 4L8EA 4ACSA 1G7EA 1O6JA 3FYGA 5DJLA 5DAKB 4G0IA 1XW9A 1F3AA 4TR3A 2DJ3A 1XWKA 2EC4A 1GTAA 3TKSA 1F2EA 3VFIA 4I2UA 4RUVA 3UVHA 3ZMLA 1YY7A 5A4VA 2AAWA 3CTFA 2H8LA 4JBBA 3FZ4A 2L4CA 2XPEA 1B8XA 3FR3A 1W89A 3HY2A 2G2QA 4QQ7A 4K8MA 19GSA 3IDVA 1YKAA 5DVBA 4BPYA 3GSTA 3LWAA 4G2EA 1AQWA 1AAZA 1GLQA 3UARA 2GT5A 4IW9A 4I6XA 4EF0A 1ERVA 2O85A 4G0KA 5GSTA 2H66A 1A2LA 1WE0A 2JSYA 2YNXA 4EE0A 2FCHA 2L4QA 1K0BA 2R6KA 3IRAA 2B1KA 1CQHA 1QMVA 2F9SA 1W4VA 3ISOA 1GTUA 3WT2A 4GQFA 3Q6OA 3LORA 2YWIA 1RQMA 3IR4A 3UIWA 2YJ7A 1EV4A 5DCGA 1X9MB 3E0UA 4XS6A 4K6XA 3ZL5A 4HS1A 2A4VA 4XS4B 5ECIB 4Z7XA 4PUFC 1FOVA 1T00A 1QUWA 4MF5A 1T8EB 2UZ8A 2HZEA 5ABRA 1GLPA 3H93A 4J56E 2EIRA 1BYEA 1F6MC 5E4WA 2DIYA 3A5WA 4ZL9A 3EMPA 2NPBA 4PQIA 4POLA 1EZKA 6GSWA 1R5AA 4AF2A 1FB0A 3L4NA 2CZ2A 1KTEA 8GSSA 2FD3A 4PURA 1VRSD 1TU8A 4LL1B 5IMDA 3IOSA 4Q5FA 3TRXA 1Y6EA 1YKCA 4K1FA 3TKRA 2HYXA 1GULA 1I9DA 5F05A 3L9VA 2IL3A 2PVQA 2X99A 5CREA 3MNGA 2IJYA 5IO2A 2C4JA 3FZ9A 4EDYA 3GN3A 2R3XA 3V1WA 5KN3A 1XFLA 5B6MA 4WKWA 3QDNA 3CSIA 3DVWA 2JU5A 1GNWA 3ME7A 1SKWB 4YQMA 4JU5A 3KGKA 2HRKA 4D73A 2H30A 3NIVA 2PN8A 1THXA 3AY8A 3KTBA 2PGTA 4KNDA 3KP8A 1G7OA 2B5YA 1ZGNA 4K7OA 4RI7A 4EC0A 2A2RA 1YF1A 5G31A 2X8GA 5G30A 1EGRA 3UBLA 2VM1A 6GSYA 3VURA 2D2ZA 1AUCA 4L5LA 3GX0A 1TI1A 1UA5A 1ZOFA 2F3MA 4N10A 4G0LA 1WMJA 4BVYA 1M2AA 1X5DA 2PERA 5DBQA 3DKSA 5HQPA 5B7CA 4HOJA 1J0FA 2E7PA 1T7PB 4BVXB 2M46A 3VWWA 4FYBA 1Z6MA 2AYTA 16GSA 2H71A 1A24A 3LGCA 3F6DA 4ZB9A 1PA3A 3IK9A 2ZCTA 1ML6A 2AUVA 4ILFA 1FVKA 3QMXA 2WJUA 5F8BA 3FY7A 4AJ7A 1TI3A 2H0IA 3D5JA 2RLIA 3GX8A 1EV9A 3MAKA 2IPAA 2B1LA 2GZPA 2E2GA 5EVOA 3A2WA 2MZCA 3FW2A 3P2AA 2YV7A 5IMZA 4MCUA 4MZWA 4TW5A 5FT3A 1YZXA 4H86A 3ZFLA 5DALA 3EVIA 2N5AA 4MA9A 1GSEA 2VIMA 2YWMA 1MTCA 3CMIA 2DMLA 4K9ZA
chains in the Genus database with same CATH superfamily
4OCFA 2DSAA 4IELA 2NDOA 1S3RA 2L5OA 3BCKA 2WW1A 1K0OA 1V9WA 4N11A 1U3IA 2J23A 2LKUA 2GT6A 3RAZA 5ID2A 2GGTA 4NV5A 5KN2A 4LLRA 1OE7A 4N3ZA 4KDXA 1GSQA 3TCOA 1BG1A 4EXJA 4MH3A 2HSNB 3MDKA 4K7NA 1EEJA 5IM9A 4I5QA 4MJBA 3UBKA 4NMUA 2A4HA 2GQLA 1XIYA 4K7IA 2LRTA 3F63A 1TRWA 1OC9A 4MZBA 1SK2A 3S9FA 4IHUA 5L71A 4RQRA 1GSDA 3UAPA 5IQYA 4IQ1A 4ZBAA 4WBRD 3FK8A 2CX4A 2YPMA 1SD8A 4HU9A 3QR6A 4BIKA 2HI7A 3C1SA 3M9JA 1T4YA 5CP1A 3IA1A 1FOHA 4TXOA 1SVMA 4LA1A 5CAXA 1XVWA 2F8FA 5D9XA 3BCIA 1ZCPA 2LJKA 1FHEA 2AB6A 6GSVA 2Z9SA 2XHFA 4POMA 4ZB7A 2HZFA 4DSSA 5KN0A 3RDWA 4YKFA 1PSQA 3MYDA 3GH9A 4NPBA 2O8VB 3P8WA 4DVCA 1JZRA 2GSQA 2VOCA 4QL9A 5BRTA 3M8NA 3Q18A 3ZFBA 2JZRA 3KH9A 2M72A 1N2AA 2HRFA 3EURA 3H1NA 3O6TA 1YDKA 3VLNA 4XRAA 1UVZA 5IMAA 2HRAA 3TKQA 2MBSA 5CO3A 2DMMA 2N5BA 3HVVA 2WULA 1XG8A 3NZNA 1MDJA 1PL2A 5ELGA 3E9JB 5J47A 4TOPA 2J9HA 2WRTA 1AQVA 4E8EA 1PMTA 3GA4A 2H1GA 4JR6A 3GKMA 4POBA 2LSTA 4MF7A 3KZQA 4XTSA 3ZREA 3UVTA 4TR1A 4WF4A 3TGZA 3PPUA 2RUFA 5ECPB 2DKIA 2GSRA 1URMA 2CVBA 2H70A 3CXGA 1VGLA 4ZIJA 1ERUA 2BJXA 2KLXA 4HJMA 3FMWA 3WGDA 1EOHA 2VL3A 2H75A 3CWGA 4ZB6A 1TU7A 3LJRA 2LJAA 2VUPA 4AJ8A 3US3A 1SJZA 3A2VA 1O73A 5J3RA 2RIIA 2VKZG 4TR0A 2WB9A 5J40A 1OAZA 4V2LA 1MD3A 3C71A 3H8QA 4K2DA 2YZHA 2QA1A 1ON4A 3GUSA 4CHSA 3APOA 3LG6A 1TK5B 1K0AA 2DJ2A 1AQXA 2LEGA 1FVJA 2HZEB 2XPDA 4EVMA 1X5EA 1MDKA 1HNCA 2V1MA 2LQOA 4ECIA 3H79A 1T3BA 3L0HA 4XCSA 2FA4A 2LRCA 3CQFA 2E2MA 3UMAA 2YV9A 4ZL7A 4WR5A 2VCZA 1M99A 3LFLA 2PBJA 3IAS2 5CYYA 1PD21 2FWFA 2X64A 2H72A 2IMDA 3RBTA 1NHYA 5E59A 1M2DA 2B7JA 2AJQB 2GVPA 4TKYA 3N5OA 3EU4A 3QPMA 18GSA 3L78A 3LQ7A 2RM6A 1ZYNA 1J08A 5A34A 5ECHB 3QFAC 4EL1A 3EINA 2P5RA 1YF0A 4XRDA 2I1UA 2YN1A 2HRKB 4KH7A 1XCCA 3DD3A 1AIUA 4D73B 4HSCX 1TDIA 5IMFA 3ZIVA 2ON5A 1Z7RA 2DJKA 1SL1B 3FHKA 3GH6A 5J5NA 4KDUA 4ID0A 1IYIA 3LXZA 2OE3A 1XWCA 4KUNA 3F3RA 4W66A 1NM3A 2C3QA 4G10A 1TK0B 2GZZA 1WOUA 1AXDA 1JZOA 4MDCA 2C0EA 2OBIA 2DIZA 4MF6A 1ST9A 1V58A 2BTOT 1GSFA 4GRFA 3U5RE 1JLWA 1B9XC 2PPTA 1OC3A 4K9ZA 5J9CA 1O7UA 3UOMA 1M3IA 5INYA 1SD9A 4YAPA 2MMNA 4BVYB 3DWVA 3A2XA 4OO4A 3KTLA 1OE8A 4MJCA 3PR8A 3IBHA 1WIKA 1O8XA 2IMEA 3UJ1A 3HJPA 5CRDA 4IBPA 1PL1A 4PQHA 4PNGA 4USSA 4ULXA 4F9ZA 3TU3B 2NBSA 2CA8A 4O5QA 2OKAA 3LXTA 2OT3A 5CRGA 1ZZYA 3GFKA 2HE3A 4TN8A 3Q19A 1U87A 4OFTA 1U6TA 5J9BA 2V6OA 4Z2TA 7GSSA 5G5EA 2R5GA 2YANA 1BG5A 3M9KA 2V2GA 2ES7A 1X5CA 1SENA 4N0VA 3UL3A 1B9YC 1K3YA 2HFDA 4IGJA 1BQ7A 3QAVA 2K6VA 3PINA 3CYNA 2OA7A 3KH7A 4YAVA 2CZ3A 2ALBA 4BL7A 5JCWA 3SWLA 2CX3A 4GF0A 2UV8G 4V1Ap 2KP1A 5IO0A 5DALB 2ON7A 3C8EA 3FEUA 4IS0A 1XWBA 1K3OA 1F3BA 4GSTA 3TJKA 3APSA 3U6VA 3GTUA 2C0DA 1K0DA 1A0RP 2V6KA 4GCIA 3VPQA 4PHZC 4OCEA 5BMUA 4MLYA 2WDUA 2HQTA 1Z9HA 1G6WA 3VWUA 4KSOA 2CT6A 2NVLA 2LNSA 5CRHA 1WWJA 4DEJA 3KEBA 2O3EA 4V2NA 1XW5A 1TRUA 3F4RA 2F51A 2PU9C 2P31A 4HZ2A 1E6BA 3I6AA 4CDOA 4NHWA 3G7IA 3GNJA 3J7Yb 3ZIJA 3F8UA 4NWYA 2R2JA 3LYKA 3KJYA 1OC9B 4KX4A 2EIOA 4HJ2A 3BOAA 2JADA 1TRSA 4G9HA 1YEWC 1JHBA 4ZILA 2IMKA 2TIRA 4TXOB 5EY6A 2X8CA 5ELAA 2WGRA 1PFOA 3EWLA 3D6IA 1JZWA 1YEPA 2FWGA 4F82A 2KUCA 1F37A 3BBYA 5F0GA 4MH2A 5HFKA 2FNOA 5DQYA 4DSSB 3VWXA 3KMNA 4KE3A 1DE1A 4HEA2 5LNKe 4J57E 2LTKA 4G01A 2QSIA 5HR3A 1SU9A 4HQZA 1H75A 2K8VA 1XBSA 5ECLB 2H73A 5D9TA 3ZMKA 5A5KA 3KM6A 5C04A 1U88A 1K0NA 1SJIA 3GYKA 1MD4A 4KW6A 4IKHA 2FWEA 4GLTA 4K0NA 3IC4A 5AIXA 4PI0C 1QFNA 5ENUA 1X9WB 3CBUA 5HR0A 4A5PA 5G5FA 3R2QA 1BAYA 1GSSA 3RFRC 4K0GA 3DYRA 3LEFA 2FY6A 1NSWA 4TR1B 2I3YA 2R0GA 3QAGA 2C3NA 5D9VA 4PNFA 2OADA 2QC7A 2RM5A 2WZ9A 1SVOA 3LSZA 12GSA 1M9AA 3G7JA 3HDCA 4TR4A 1IYHA 3F4TA 1THOA 2C1YA 3VI5A 2HNLA 2HSMA 4KDYA 2VLTA 2I9HA 3TOTA 3E3EA 4E8HA 3DVXA 4TXVA 4Q5RA 2MMOA 3GL5A 4P3YB 3MIXA 4KCEA 3A5IA 3HHVA 3TRPA 1M0UA 3FKFA 3WYWA 2VL2C 3F6FA 5DQSA 2E0QA 3GV1A 2O87A 1YQ1A 3DIEA 1PKZA 1KNGA 1V2AA 5H5QA 3IK7A 3HVNA 4ECCA 1EGOA 1HNBA 4HU7A 1ABAA 4PGTA 2R4VA 2VLUA 4K5SA 2HLSA 3I43A 4MPGA 1QK8A 2DLXA 1TTZA 6GSUA 3TOUA 4OFMA 1GUKA 4F2IA 5JWOB 1B4QA 4IVFA 2H74A 3D4TA 4X1UA 2YP6A 3RHCA 4KF9A 1O85A 1R5PA 2YWOA 4GSNA 3MWHA 2H0GA 4NXIA 3CSJA 4IJ3A 3HZ4A 3ZRDA 2DKHA 2C8UA 3N9JA 2VAFA 1S4BP 5COHA 1OKTA 3KXOA 5A34B 1XWAA 3R3EA 1WP0A 3OR5A 2IMFA 5ECOB 4POKA 1YEXA 5B8AA 2O89A 3DMLA 3IHGA 4PX1A 1GL8A 2OE1A 2C3TA 3HD5A 5HR2A 3BD2A 5D96A 4HZ4A 1EP7A 3SBCA 1HD2A 3WGXA 2GSSA 1Z3EA 1SKRB 2CVDA 2TRCP 1SKSB 3ZLPA 1GTIA 4HUAA 4OO5A 3EMXA 2H1AA 1DUGA 2CQ9A 1OVNA 5JCGA 2GLRA 4ISDA 3GIXA 2H0HA 1SJ6A 1G6YA 4PUAA 3IHQA 1ZL9A 1JFUA 3QD9A 2I4AA 5HFIA 3VPTA 4GXZA 2C0FA 4WEYA 1USBA 4KA0A 2FWHA 5G1LA 3F9UA 1TJDA 4YQUA 1M9BA 2IIYA 2REMA 3EE2A 1GNEA 4Z2RA 1NW2A 2DBCA 4GTUA 2WVZA 4GDFA 2GQKA 13GSA 1A2JA 5IIZA 3I9V2 4I97A 2QA2A 2DJ0A 4MABA 5DCHA 4FYUA 3LYPA 5JWRB 3PH9A 4JE1A 2EFCA 3F0IA 4MMMA 3QAWA 1LJRA 2B6MA 2I81A 1V40A 3MSZA 3WGEA 4BL7B 3HYPA 1FG4A 1GUMA 2PUKC 3FR9A 4J2FA 1TKDB 3M1GA 4EIQA 4N0ZA 5G2ZA 1K3LA 1TOFA 4L0WA 3EC3A 1EP8A 3FZAA 5IOWA 4TRXA 3RHBA 1PX7A 1Z6NA 2AHEA 3GTUB 3GMFA 2PMTA 2JACA 4I2TA 3D22A 2WVXA 1EOGA 5BMUB 4BWSA 2LV3A 2F8AA 1Z5YE 1LBKA 1K0CA 3UEMA 4ZL8A 17GSA 1SVLA 4IP6A 1M7TA 1V98A 3KIJA 2CVKA 4ZBBA 2WZSA 1Y25A 1Q98A 4NHZA 3JCML 3FZ5A 2YCDA 1WRYA 4CW9A 4V2MA 2FGXA 2VCQA 3K8NA 5AIVA 4RQXA 2OE0A 4KB3A 1N8JA 3O76A 2ZUPA 1EWXA 1ILOA 1X0RA 1OYJA 3TRQA 4O32A 1SYRA 3HJMA 5G1KA 4MJEA 4TVEA 4PQ1A 2X49A 2IFQA 3C1RA 2LNTA 3GKNA 1TK8B 6GSSA 5JWQB 4MPFA 3CRUA 1QQ2A 2VM2A 2EFEA 3FR6A 2H19A 2V32A 2L5LA 5LCZA 2IMIA 3RPNA 5DJMA 2O5VA 4MJAA 2LRNA 4QMKA 3KCMA 5JCUA 4AGSA 3EU3A 5AN1A 6GSXA 4BA7A 1DSBA 3HA9A 3DGQA 5EL8A 1TXXA 2O36A 2QGVA 5IPGA 2B5XA 4LMVA 5A4WA 5HFGA 1AC1A 3ERGA 2L57A 4JZQA 1KEBA 3BJ5A 3CSHA 4IQAA 2L6DA 2VO4A 4EDZA 2XC2A 5IPHA 1DE2A 2LJRA 1ERWA 3TKSC 4IP1A 4F0CA 2B5EA 4FXYP 1A23A 2X8HA 3IPZA 4QL7A 3TJBA 5B6NA 3L9SA 5F07A 4OWYA 3HMJG 4BWQA 3DRNA 1GH2A 4XS1A 2JZTA 3Q74A 1FO5A 3HCZA 1UC7A 2WFCA 1TXUA 3WT1A 1OKDA 4AKHA 22GSA 1FB6A 2FA8A 2G0FA 5D8IA 3KMOA 2C0GA 1OC8A 2RUEA 2XBIA 2ZNMA 1GUHA 1FAAA 3ZYWA 4WBJA 20GSA 2LS5A 1VF3A 2H6XA 4FH8A 5ID2B 1SL2B 1AW9A 1A0FA 2HSMB 3ZITA 4KSMA 2OJLA 5AISA 6GSTA 5B8BA 4FIWA 5DAKA 2KP2A 1LU4A 2GS3A 1HNAA 3GRXA 4EO3A 2AV4A 2LUSA 1GRXA 2X4AA 1PKWA 2VCTA 2GQMA 3IAM2 4KCAA 5GSSA 2NTOA 2JZSA 2R0CA 4MP4A 2B7KA 3W6GA 1TRVA 2A2SA 1ERTA 4ECBA 9GSSA 2FUG2 3TJJA 4ZBDA 3PGTA 2DJJA 1JZDA 1WJKA 1BEDA 4G19A 3GKXA 4PXOA 1R26A 2BMXA 2VLVA 4NV2A 3QCPA 5FWGA 4Q5QA 4PTSA 2EIQA 4MZCA 1XW6A 3G9BA 4JRRA 4JEDA 4KAEA 2N5FA 2HRNA 3ED3A 5ECNB 5KN1A 1QXHA 2L59A 2VL2A 1R4WA 1R7HA 4K2XA 1JLVA 3GKKA 5H5RA 3CHXC 5F06A 3J7Yk 4GQCA 1HQOA 1B4PA 2H6YA 4XHMA 1ZMAA 4I8BA 4ZB8A 3L9UA 2WS2A 3GHAA 2O7KA 10GSA 5A4UA 4WXTA 3ERFA 1ZYPA 1VF4A 1RW1A 5D9WA 2FHEA 3VWVA 5IMVA 4N30A 2YJHA 5LD0A 4ECJA 3ME8A 1V57A 3G7YA 4XS4A 5A1NA 3TKPA 4FQUA 5CNWA 1GSUA 4DSRA 3APQA 2MMAA 4F0BA 2FLSA 1S3AA 1VF2A 3ZVJA 3NOFA 2JL4A 4HDEA 2IWTA 1N25A 5J41A 1EEMA 3DEXA 2C80A 3C73A 2H1DA 1VF1A 4HQSA 4LMWA 4MK3A 1T1VA 2GZYA 4NAXA 1H4OA 1TP9A 4PI2C 4O5RA 3P90A 4AKGA 1ZYQB 4WETA 3RPPA 4X43A 1A8YA 1YJ6A 4X4JA 11GSA 3IXRA 3EYTA 2K8SA 2LQQA 3FRCA 1O81A 4XIHA 1XWGA 4RI6A 2CV4A 3TDGA 1M2BA 3I69A 3CRTA 3QFBC 2KOKA 4Q5NA 5KEJA 1CQGA 3H4KA 4O92A 4OD7A 2DJ1A 1S3CA 2B3SA 2R37A 1F9MA 3HVXA 3GSSA 3M3MA 4YH2A 3TKSE 2HSHA 2YWNA 1T4ZA 5C00A 1S3DA 3O3TA 1A2MA 1XOAA 2MYGA 2HT9A 4GSSA 4IN0A 2H76A 14GSA 3TJGA 1I5GA 4KGIA 2WCIA 2VD0A 1GTBA 4OFNA 3D0ZA 5D73A 1GSYA 3HVSA 1FW1A 5A5HA 5FHIA 2H6ZA 1GWCA 2V41A 5IMCA 5J4VA 4V1Ag 2VCVA 5HR1A 2YZUA 4AJ6A 1PX6A 2VD1A 1G0TA 4YQVA 4O5UA 1MDIA 2CAQA 1RK4A 1B48A 3DXBA 3CTGA 2CAIA 2WVXB 3TJFA 4DSQA 1O8WA 3C7MA 1BX9A 1PN0A 5DDLA 3M0FA 4EIPA 2P0GA 1HYUA 1SL0B 2HSYA 3HJOA 1PRXA 3D4MA 5ECMB 4BVXA 3KP9A 2XBQA 1KBNA 5GAND 2QKEA 1Z7PA 2H01A 4WF5A 4E68A 4FO5A 2OBKA 4JR4A 4HI7A 1PGTA 4O7HA 5GAPD 2GTUA 4FYCA 1ACVA 2OACA 4K5RA 3ZZXA 1XPVA 1XZOA 3QOUA 2MBTA 2EFDA 5AGYA 2VL9A 2L6CA 2PWJA 1UN2A 3VI7A 1NHOA 2P5QA 3ERWA 4LL4B 4IJIA 4EKZA 4EUYA 5CRWA 1PQNA 3GL3A 2IFQB 5EPFA 1J9BA 2PVOC 2TRXA 4OMVA 2R0PA 2JSZA 5KOXA 5GZZB 2HXKA 4X0XA 1SK1A 1E2YA 1XOBA 3IC8A 3IE3A 1QGVA 1XVQA 3W8SA 4WR4A 2VCXA 3LW9A 2MMZA 2H1LA 1Q4JA 1GP1A 3TUEA 5ECSA 1Y1UA 3ZVJD 4GWRA 3VK9A 3A3TA 4L5OA 2YOIA 5ECQB 1TW9A 1WPIA 2M80A 1K0MA 3F3QA 3F4SA 3WD6A 2H1BA 5J4UA 2IN3A 3EPTA 5D93A 3HKRA 1C72A 3KD0A 2HSNA 1SYXA 1A8LA 4ML1A 3D21A 3HZ8A 3GURA 5IOXA 3HXSA 1BJXA 4ML6A 2WW2A 5ECRB 4ZXGA 2KHPA 1X9SB 2VCWA 2GSTA 3TB2A 5H5SA 4F03A 1SK0A 3W8JA 2GDRA 3ZTLA 2K18A 1MEKA 1PN9A 1ZYEA 1XXUA 4CY8A 4L0UA 5ECKB 2DC5A 3P7XA 3IV4A 1DBYA 2K9FA 4L8EA 4ACSA 1G7EA 1O6JA 3FYGA 5DJLA 5DAKB 4G0IA 1XW9A 1BF5A 1F3AA 4TR3A 5J4YA 2DJ3A 1XWKA 2EC4A 1GTAA 3TKSA 1F2EA 3VFIA 4I2UA 4RUVA 3UVHA 3ZMLA 1YY7A 5A4VA 4MNNA 2AAWA 3CTFA 2H8LA 4JBBA 3FZ4A 2L4CA 2XPEA 1B8XA 3FR3A 1W89A 3HY2A 2G2QA 4QQ7A 4K8MA 19GSA 3IDVA 1YKAA 5DVBA 4BPYA 3GSTA 3LWAA 1M3JA 4G2EA 1AQWA 1AAZA 1GLQA 3UARA 2GT5A 4IW9A 4I6XA 4EF0A 1ERVA 2O85A 4G0KA 5GSTA 2H66A 1A2LA 1WE0A 4YKGA 2JSYA 2YNXA 4EE0A 2FCHA 2L4QA 1K0BA 2R6KA 3IRAA 2B1KA 1CQHA 1QMVA 1I1IP 2F9SA 1W4VA 3ISOA 1GTUA 3WT2A 4GQFA 3Q6OA 3LORA 2YWIA 1RQMA 3IR4A 3UIWA 2YJ7A 1EV4A 1YVLA 5DCGA 1X9MB 3E0UA 4XS6A 4K6XA 3ZL5A 4HS1A 2A4VA 4XS4B 5ECIB 5A1NB 4PUFC 4Z7XA 1FOVA 1T00A 1QUWA 4MF5A 1T8EB 2UZ8A 2HZEA 5ABRA 1GLPA 3H93A 2WW3A 4J56E 2EIRA 1BYEA 1F6MC 5E4WA 2DIYA 3A5WA 4Z2UA 4ZL9A 3EMPA 2NPBA 4PQIA 4POLA 1EZKA 5KOWA 6GSWA 1R5AA 4AF2A 1FB0A 3L4NA 2CZ2A 1KTEA 8GSSA 2FD3A 4PURA 1VRSD 1TU8A 4LL1B 5IMDA 3IOSA 4Q5FA 3TRXA 1Y6EA 1YKCA 4K1FA 3TKRA 2HYXA 1GULA 1I9DA 5F05A 3L9VA 2IL3A 2PVQA 2X99A 5CREA 3MNGA 2IJYA 5IO2A 2C4JA 3RGBC 3FZ9A 4EDYA 3GN3A 2R3XA 3V1WA 5KN3A 1XFLA 2WW0A 4WKWA 5B6MA 3QDNA 3CSIA 3DVWA 2JU5A 1GNWA 3ME7A 1SKWB 4YQMA 4JU5A 3KGKA 2HRKA 4D73A 2H30A 3NIVA 2PN8A 1THXA 3AY8A 3KTBA 2PGTA 4KNDA 3KP8A 1G7OA 2B5YA 1ZGNA 4K7OA 4RI7A 4EC0A 5A5HB 2A2RA 1YF1A 5G31A 2X8GA 5G30A 4AKIA 1EGRA 3UBLA 2VM1A 6GSYA 3VURA 2D2ZA 1AUCA 4L5LA 3GX0A 1TI1A 1UA5A 1ZOFA 2F3MA 4N10A 4G0LA 1WMJA 4BVYA 1M2AA 4AKXB 1X5DA 2PERA 2EFHA 4AI6A 3DKSA 5DBQA 5HQPA 5B7CA 4HOJA 1J0FA 2E7PA 4CY6A 1T7PB 4BVXB 2M46A 3VWWA 4FYBA 1Z6MA 2AYTA 16GSA 2H71A 1A24A 3LGCA 3F6DA 4ZB9A 2ZCTA 1PA3A 3IK9A 1ML6A 4ICYA 2AUVA 4ILFA 1FVKA 3QMXA 2WJUA 5F8BA 3FY7A 4AJ7A 1TI3A 2H0IA 3D5JA 2RLIA 3GX8A 1EV9A 3MAKA 2IPAA 2B1LA 2WVYA 2A2PA 2GZPA 2E2GA 5EVOA 3A2WA 2MZCA 3FW2A 3P2AA 2YV7A 5IMZA 4MCUA 4MZWA 4TW5A 5FT3A 1YZXA 4H86A 3ZFLA 5DALA 3EVIA 2N5AA 4MA9A 1GSEA 2VIMA 2YWMA 1MTCA 3CMIA 2DMLA 1U3AA
chains in the Genus database with same CATH topology
4OCFA 2DSAA 4IELA 2NDOA 2L5OA 3BCKA 1K0OA 1V9WA 4N11A 1U3IA 2J23A 2LKUA 2GT6A 3RAZA 5ID2A 2GGTA 4NV5A 5KN2A 4LLRA 1OE7A 4N3ZA 4KDXA 1GSQA 3TCOA 1BG1A 4EXJA 4MH3A 2HSNB 3MDKA 4K7NA 1EEJA 5IM9A 4I5QA 4MJBA 3UBKA 4NMUA 2A4HA 2GQLA 1XIYA 4K7IA 2LRTA 3F63A 1TRWA 1OC9A 4MZBA 1SK2A 3S9FA 4IHUA 5L71A 4RQRA 1GSDA 3UAPA 5IQYA 4IQ1A 4ZBAA 4WBRD 3FK8A 2CX4A 2YPMA 1SD8A 4HU9A 3QR6A 2HI7A 3C1SA 3M9JA 1T4YA 5CP1A 3IA1A 1FOHA 4TXOA 1SVMA 4LA1A 5CAXA 1XVWA 2F8FA 5D9XA 3BCIA 1ZCPA 2LJKA 1FHEA 2AB6A 6GSVA 2Z9SA 2XHFA 4POMA 4ZB7A 2HZFA 4DSSA 5KN0A 3RDWA 4YKFA 1PSQA 3MYDA 3GH9A 4NPBA 2O8VB 3P8WA 4DVCA 1JZRA 2GSQA 2VOCA 4QL9A 5BRTA 3M8NA 3Q18A 3ZFBA 2JZRA 3KH9A 2M72A 1N2AA 2HRFA 3EURA 3H1NA 3O6TA 1YDKA 3VLNA 4XRAA 1UVZA 5IMAA 2HRAA 3TKQA 2MBSA 5CO3A 2DMMA 2N5BA 3HVVA 2WULA 3NZNA 1MDJA 1PL2A 5ELGA 3E9JB 5J47A 4TOPA 2J9HA 2WRTA 1AQVA 4E8EA 1PMTA 3GA4A 2H1GA 4JR6A 3GKMA 4POBA 2LSTA 4MF7A 3KZQA 4XTSA 3ZREA 3UVTA 4TR1A 4WF4A 3TGZA 3PPUA 2RUFA 5ECPB 2DKIA 2GSRA 1URMA 2CVBA 2H70A 3CXGA 1VGLA 4ZIJA 1ERUA 2BJXA 2KLXA 4HJMA 3FMWA 3WGDA 1EOHA 2VL3A 2H75A 3CWGA 4ZB6A 1TU7A 3LJRA 2LJAA 2VUPA 4AJ8A 3US3A 1SJZA 3A2VA 1O73A 5J3RA 2RIIA 2VKZG 4TR0A 2WB9A 5J40A 1OAZA 4V2LA 1MD3A 3C71A 3H8QA 4K2DA 2YZHA 2QA1A 1ON4A 3GUSA 4CHSA 3APOA 3LG6A 1TK5B 1K0AA 2DJ2A 1AQXA 2LEGA 1FVJA 2HZEB 2XPDA 4EVMA 1X5EA 1MDKA 1HNCA 2V1MA 2LQOA 4ECIA 3H79A 1T3BA 3L0HA 4XCSA 2FA4A 2LRCA 2E2MA 3UMAA 2YV9A 4ZL7A 4WR5A 2VCZA 1M99A 3LFLA 2PBJA 3IAS2 5CYYA 1PD21 2FWFA 2X64A 2H72A 2IMDA 3RBTA 1NHYA 5E59A 1M2DA 2B7JA 2AJQB 2GVPA 4TKYA 3N5OA 3EU4A 3QPMA 18GSA 3L78A 3LQ7A 2RM6A 1ZYNA 1J08A 5A34A 5ECHB 3QFAC 4EL1A 3EINA 2P5RA 1YF0A 4XRDA 2I1UA 2YN1A 2HRKB 4KH7A 1XCCA 3DD3A 1AIUA 4D73B 1TDIA 5IMFA 3ZIVA 2ON5A 1Z7RA 2DJKA 1SL1B 3FHKA 3GH6A 5J5NA 4KDUA 4ID0A 1IYIA 3LXZA 2OE3A 1XWCA 4KUNA 3F3RA 4W66A 1NM3A 2C3QA 4G10A 1TK0B 2GZZA 1WOUA 1AXDA 1JZOA 4MDCA 2C0EA 2OBIA 2DIZA 4MF6A 1ST9A 1V58A 2BTOT 1GSFA 4GRFA 3U5RE 1JLWA 1B9XC 2PPTA 1OC3A 4K9ZA 5J9CA 1O7UA 3UOMA 5INYA 1SD9A 4YAPA 2MMNA 4BVYB 3DWVA 3A2XA 4OO4A 3KTLA 1OE8A 4MJCA 3PR8A 3IBHA 1WIKA 1O8XA 2IMEA 3UJ1A 3HJPA 5CRDA 4IBPA 1PL1A 4PQHA 4PNGA 4USSA 4ULXA 4F9ZA 3TU3B 2NBSA 2CA8A 4O5QA 2OKAA 3LXTA 2OT3A 5CRGA 1ZZYA 3GFKA 2HE3A 4TN8A 3Q19A 1U87A 4OFTA 1U6TA 5J9BA 2V6OA 4Z2TA 7GSSA 5G5EA 2R5GA 2YANA 1BG5A 3M9KA 2V2GA 2ES7A 1X5CA 1SENA 4N0VA 3UL3A 1B9YC 1K3YA 2HFDA 4IGJA 1BQ7A 3QAVA 2K6VA 3PINA 3CYNA 2OA7A 3KH7A 4YAVA 2CZ3A 2ALBA 4BL7A 5JCWA 3SWLA 2CX3A 4GF0A 2UV8G 4V1Ap 2KP1A 5IO0A 5DALB 2ON7A 3C8EA 3FEUA 4IS0A 1XWBA 1K3OA 1F3BA 4GSTA 3TJKA 3APSA 3U6VA 3GTUA 2C0DA 1K0DA 1A0RP 2V6KA 4GCIA 3VPQA 4OCEA 5BMUA 4MLYA 2WDUA 2HQTA 1Z9HA 1G6WA 3VWUA 4KSOA 2CT6A 2NVLA 2LNSA 5CRHA 1WWJA 4DEJA 3KEBA 4V2NA 1XW5A 1TRUA 3F4RA 2F51A 2PU9C 2P31A 4HZ2A 1E6BA 3I6AA 4CDOA 4NHWA 3G7IA 3GNJA 3J7Yb 3ZIJA 3F8UA 4NWYA 2R2JA 3LYKA 3KJYA 1OC9B 4KX4A 2EIOA 4HJ2A 3BOAA 2JADA 1TRSA 4G9HA 1JHBA 4ZILA 2IMKA 2TIRA 4TXOB 5EY6A 2X8CA 5ELAA 2WGRA 3EWLA 3D6IA 1JZWA 1YEPA 2FWGA 4F82A 2KUCA 1F37A 3BBYA 5F0GA 4MH2A 5HFKA 2FNOA 5DQYA 4DSSB 3VWXA 3KMNA 4KE3A 1DE1A 4HEA2 5LNKe 4J57E 2LTKA 4G01A 2QSIA 5HR3A 1SU9A 4HQZA 1H75A 2K8VA 1XBSA 5ECLB 2H73A 5D9TA 3ZMKA 5A5KA 3KM6A 5C04A 1U88A 1K0NA 1SJIA 3GYKA 1MD4A 4KW6A 4IKHA 2FWEA 4GLTA 4K0NA 3IC4A 5AIXA 1QFNA 5ENUA 1X9WB 3CBUA 5HR0A 4A5PA 5G5FA 3R2QA 1BAYA 1GSSA 4K0GA 3DYRA 3LEFA 2FY6A 1NSWA 4TR1B 2I3YA 2R0GA 3QAGA 2C3NA 5D9VA 4PNFA 2OADA 2QC7A 2RM5A 2WZ9A 1SVOA 3LSZA 12GSA 1M9AA 3G7JA 3HDCA 4TR4A 1IYHA 3F4TA 1THOA 2C1YA 3VI5A 2HNLA 2HSMA 4KDYA 2VLTA 2I9HA 3TOTA 3E3EA 4E8HA 3DVXA 4TXVA 4Q5RA 2MMOA 3GL5A 4P3YB 3MIXA 4KCEA 3A5IA 3HHVA 3TRPA 1M0UA 3FKFA 3WYWA 2VL2C 3F6FA 5DQSA 2E0QA 3GV1A 2O87A 1YQ1A 3DIEA 1PKZA 1KNGA 1V2AA 5H5QA 3IK7A 4ECCA 1EGOA 1HNBA 4HU7A 1ABAA 4PGTA 2R4VA 2VLUA 4K5SA 2HLSA 3I43A 4MPGA 1QK8A 2DLXA 1TTZA 6GSUA 3TOUA 4OFMA 1GUKA 4F2IA 5JWOB 1B4QA 4IVFA 2H74A 3D4TA 4X1UA 2YP6A 3RHCA 4KF9A 1O85A 1R5PA 2YWOA 4GSNA 3MWHA 2H0GA 4NXIA 3CSJA 4IJ3A 3HZ4A 3ZRDA 2DKHA 2C8UA 3N9JA 2VAFA 5COHA 1OKTA 3KXOA 5A34B 1XWAA 3R3EA 1WP0A 3OR5A 2IMFA 5ECOB 4POKA 1YEXA 5B8AA 2O89A 3DMLA 3IHGA 4PX1A 1GL8A 2OE1A 2C3TA 3HD5A 5HR2A 3BD2A 5D96A 4HZ4A 1EP7A 3SBCA 1HD2A 3WGXA 2GSSA 1Z3EA 1SKRB 2CVDA 2TRCP 1SKSB 3ZLPA 1GTIA 4HUAA 4OO5A 3EMXA 2H1AA 1DUGA 2CQ9A 1OVNA 5JCGA 2GLRA 4ISDA 3GIXA 2H0HA 1SJ6A 1G6YA 4PUAA 3IHQA 1ZL9A 1JFUA 3QD9A 2I4AA 5HFIA 3VPTA 4GXZA 2C0FA 4WEYA 1USBA 4KA0A 2FWHA 5G1LA 3F9UA 1TJDA 4YQUA 1M9BA 2IIYA 2REMA 3EE2A 1GNEA 4Z2RA 1NW2A 2DBCA 4GTUA 4GDFA 2GQKA 13GSA 1A2JA 5IIZA 3I9V2 4I97A 2QA2A 2DJ0A 4MABA 5DCHA 4FYUA 3LYPA 5JWRB 3PH9A 4JE1A 2EFCA 3F0IA 4MMMA 3QAWA 1LJRA 2B6MA 2I81A 1V40A 3MSZA 3WGEA 4BL7B 3HYPA 1FG4A 1GUMA 2PUKC 3FR9A 4J2FA 1TKDB 3M1GA 4EIQA 4N0ZA 5G2ZA 1K3LA 1TOFA 4L0WA 3EC3A 1EP8A 3FZAA 5IOWA 4TRXA 3RHBA 1PX7A 1Z6NA 2AHEA 3GTUB 3GMFA 2PMTA 2JACA 4I2TA 3D22A 1EOGA 5BMUB 4BWSA 2LV3A 2F8AA 1Z5YE 1LBKA 1K0CA 3UEMA 4ZL8A 17GSA 1SVLA 4IP6A 1M7TA 1V98A 3KIJA 2CVKA 4ZBBA 1Y25A 1Q98A 4NHZA 3JCML 3FZ5A 2YCDA 1WRYA 4CW9A 4V2MA 2FGXA 2VCQA 3K8NA 5AIVA 4RQXA 2OE0A 4KB3A 1N8JA 3O76A 2ZUPA 1EWXA 1ILOA 1X0RA 1OYJA 3TRQA 4O32A 1SYRA 3HJMA 5G1KA 4MJEA 4TVEA 4PQ1A 2X49A 2IFQA 3C1RA 2LNTA 3GKNA 1TK8B 6GSSA 5JWQB 4MPFA 3CRUA 1QQ2A 2VM2A 2EFEA 3FR6A 2H19A 2V32A 2L5LA 5LCZA 2IMIA 3RPNA 5DJMA 2O5VA 4MJAA 2LRNA 4QMKA 3KCMA 5JCUA 4AGSA 3EU3A 5AN1A 6GSXA 4BA7A 1DSBA 3HA9A 3DGQA 5EL8A 1TXXA 2QGVA 5IPGA 2B5XA 4LMVA 5A4WA 5HFGA 1AC1A 3ERGA 2L57A 4JZQA 1KEBA 3BJ5A 3CSHA 4IQAA 2L6DA 2VO4A 4EDZA 2XC2A 5IPHA 1DE2A 2LJRA 1ERWA 3TKSC 4IP1A 4F0CA 2B5EA 1A23A 2X8HA 3IPZA 4QL7A 3TJBA 5B6NA 3L9SA 5F07A 4OWYA 3HMJG 4BWQA 3DRNA 1GH2A 4XS1A 2JZTA 3Q74A 1FO5A 3HCZA 1UC7A 2WFCA 1TXUA 3WT1A 1OKDA 4AKHA 22GSA 1FB6A 2FA8A 2G0FA 5D8IA 3KMOA 2C0GA 1OC8A 2RUEA 2XBIA 2ZNMA 1GUHA 1FAAA 3ZYWA 4WBJA 20GSA 2LS5A 1VF3A 2H6XA 4FH8A 5ID2B 1SL2B 1AW9A 1A0FA 2HSMB 3ZITA 4KSMA 2OJLA 5AISA 6GSTA 5B8BA 4FIWA 5DAKA 2KP2A 1LU4A 2GS3A 1HNAA 3GRXA 4EO3A 2AV4A 2LUSA 1GRXA 2X4AA 1PKWA 2VCTA 2GQMA 3IAM2 4KCAA 5GSSA 2NTOA 2JZSA 2R0CA 4MP4A 2B7KA 3W6GA 1TRVA 2A2SA 1ERTA 4ECBA 9GSSA 2FUG2 3TJJA 4ZBDA 3PGTA 2DJJA 1JZDA 1WJKA 1BEDA 4G19A 3GKXA 4PXOA 1R26A 2BMXA 2VLVA 4NV2A 3QCPA 5FWGA 4Q5QA 4PTSA 2EIQA 4MZCA 1XW6A 3G9BA 4JRRA 4JEDA 4KAEA 2N5FA 2HRNA 3ED3A 5ECNB 5KN1A 1QXHA 2L59A 2VL2A 1R4WA 1R7HA 4K2XA 1JLVA 3GKKA 5H5RA 5F06A 3J7Yk 4GQCA 1HQOA 1B4PA 2H6YA 4XHMA 1ZMAA 4I8BA 4ZB8A 3L9UA 2WS2A 3GHAA 2O7KA 10GSA 5A4UA 4WXTA 3ERFA 1ZYPA 1VF4A 1RW1A 5D9WA 2FHEA 3VWVA 5IMVA 4N30A 2YJHA 5LD0A 4ECJA 3ME8A 1V57A 3G7YA 4XS4A 5A1NA 3TKPA 4FQUA 5CNWA 1GSUA 4DSRA 3APQA 2MMAA 4F0BA 2FLSA 1S3AA 1VF2A 3ZVJA 3NOFA 2JL4A 4HDEA 2IWTA 1N25A 5J41A 1EEMA 3DEXA 2C80A 3C73A 2H1DA 1VF1A 4HQSA 4LMWA 4MK3A 1T1VA 2GZYA 4NAXA 1H4OA 1TP9A 4O5RA 3P90A 4AKGA 1ZYQB 4WETA 3RPPA 4X43A 1A8YA 1YJ6A 4X4JA 11GSA 3IXRA 3EYTA 2K8SA 2LQQA 3FRCA 1O81A 4XIHA 1XWGA 4RI6A 2CV4A 3TDGA 1M2BA 3I69A 3CRTA 3QFBC 2KOKA 4Q5NA 5KEJA 1CQGA 3H4KA 4O92A 4OD7A 2DJ1A 1S3CA 2B3SA 2R37A 1F9MA 3HVXA 3GSSA 3M3MA 4YH2A 3TKSE 2HSHA 2YWNA 1T4ZA 5C00A 1S3DA 3O3TA 1A2MA 1XOAA 2MYGA 2HT9A 4GSSA 4IN0A 2H76A 14GSA 3TJGA 1I5GA 4KGIA 2WCIA 2VD0A 1GTBA 4OFNA 3D0ZA 5D73A 1GSYA 3HVSA 1FW1A 5A5HA 5FHIA 2H6ZA 1GWCA 2V41A 5IMCA 5J4VA 4V1Ag 2VCVA 5HR1A 2YZUA 4AJ6A 1PX6A 2VD1A 1G0TA 4YQVA 4O5UA 1MDIA 2CAQA 1RK4A 1B48A 3DXBA 3CTGA 2CAIA 3TJFA 4DSQA 1O8WA 3C7MA 1BX9A 1PN0A 5DDLA 3M0FA 4EIPA 2P0GA 1HYUA 1SL0B 2HSYA 3HJOA 1PRXA 3D4MA 3KP9A 5ECMB 4BVXA 2XBQA 1KBNA 5GAND 2QKEA 1Z7PA 2H01A 4WF5A 4E68A 4FO5A 2OBKA 4JR4A 4HI7A 1PGTA 4O7HA 5GAPD 2GTUA 4FYCA 1ACVA 2OACA 4K5RA 3ZZXA 1XPVA 1XZOA 3QOUA 2MBTA 2EFDA 5AGYA 2VL9A 2L6CA 2PWJA 1UN2A 3VI7A 1NHOA 2P5QA 3ERWA 4LL4B 4IJIA 4EKZA 4EUYA 5CRWA 1PQNA 3GL3A 2IFQB 5EPFA 1J9BA 2PVOC 2TRXA 4OMVA 2R0PA 2JSZA 5KOXA 5GZZB 2HXKA 4X0XA 1SK1A 1E2YA 1XOBA 3IC8A 3IE3A 1QGVA 1XVQA 3W8SA 4WR4A 2VCXA 3LW9A 2MMZA 2H1LA 1Q4JA 1GP1A 3TUEA 5ECSA 1Y1UA 3ZVJD 4GWRA 3VK9A 3A3TA 4L5OA 2YOIA 5ECQB 1TW9A 1WPIA 2M80A 1K0MA 3F3QA 3F4SA 3WD6A 2H1BA 5J4UA 2IN3A 3EPTA 5D93A 3HKRA 1C72A 3KD0A 2HSNA 1SYXA 1A8LA 4ML1A 3D21A 3HZ8A 3GURA 5IOXA 3HXSA 1BJXA 4ML6A 5ECRB 4ZXGA 2KHPA 1X9SB 2VCWA 2GSTA 3TB2A 5H5SA 4F03A 1SK0A 3W8JA 2GDRA 3ZTLA 2K18A 1MEKA 1PN9A 1ZYEA 1XXUA 4CY8A 4L0UA 5ECKB 2DC5A 3P7XA 3IV4A 1DBYA 2K9FA 4L8EA 4ACSA 1G7EA 1O6JA 3FYGA 5DJLA 5DAKB 4G0IA 1XW9A 1BF5A 1F3AA 4TR3A 5J4YA 2DJ3A 1XWKA 2EC4A 1GTAA 3TKSA 1F2EA 3VFIA 4I2UA 4RUVA 3UVHA 3ZMLA 1YY7A 5A4VA 4MNNA 2AAWA 3CTFA 2H8LA 4JBBA 3FZ4A 2L4CA 2XPEA 1B8XA 3FR3A 1W89A 3HY2A 2G2QA 4QQ7A 4K8MA 19GSA 3IDVA 1YKAA 5DVBA 4BPYA 3GSTA 3LWAA 4G2EA 1AQWA 1AAZA 1GLQA 3UARA 2GT5A 4IW9A 4I6XA 4EF0A 1ERVA 2O85A 4G0KA 5GSTA 2H66A 1A2LA 1WE0A 4YKGA 2JSYA 2YNXA 4EE0A 2FCHA 2L4QA 1K0BA 2R6KA 3IRAA 2B1KA 1CQHA 1QMVA 2F9SA 1W4VA 3ISOA 1GTUA 3WT2A 4GQFA 3Q6OA 3LORA 2YWIA 1RQMA 3IR4A 3UIWA 2YJ7A 1EV4A 1YVLA 5DCGA 1X9MB 3E0UA 4XS6A 4K6XA 3ZL5A 4HS1A 2A4VA 4XS4B 5ECIB 5A1NB 4PUFC 4Z7XA 1FOVA 1T00A 1QUWA 4MF5A 1T8EB 2UZ8A 2HZEA 5ABRA 1GLPA 3H93A 4J56E 2EIRA 1BYEA 1F6MC 5E4WA 2DIYA 3A5WA 4Z2UA 4ZL9A 3EMPA 2NPBA 4PQIA 4POLA 1EZKA 5KOWA 6GSWA 1R5AA 4AF2A 1FB0A 3L4NA 2CZ2A 1KTEA 8GSSA 2FD3A 4PURA 1VRSD 1TU8A 4LL1B 5IMDA 3IOSA 4Q5FA 3TRXA 1Y6EA 1YKCA 4K1FA 3TKRA 2HYXA 1GULA 1I9DA 5F05A 3L9VA 2IL3A 2PVQA 2X99A 5CREA 3MNGA 2IJYA 5IO2A 2C4JA 3FZ9A 4EDYA 3GN3A 2R3XA 3V1WA 5KN3A 1XFLA 5B6MA 4WKWA 3QDNA 3CSIA 3DVWA 2JU5A 1GNWA 3ME7A 1SKWB 4YQMA 4JU5A 3KGKA 2HRKA 4D73A 2H30A 3NIVA 2PN8A 1THXA 3AY8A 3KTBA 2PGTA 4KNDA 3KP8A 1G7OA 2B5YA 1ZGNA 4K7OA 4RI7A 4EC0A 5A5HB 2A2RA 1YF1A 5G31A 2X8GA 5G30A 4AKIA 1EGRA 3UBLA 2VM1A 6GSYA 3VURA 2D2ZA 1AUCA 4L5LA 3GX0A 1TI1A 1UA5A 1ZOFA 2F3MA 4N10A 4G0LA 1WMJA 4BVYA 1M2AA 4AKXB 1X5DA 2PERA 2EFHA 4AI6A 3DKSA 5DBQA 5HQPA 5B7CA 4HOJA 1J0FA 2E7PA 4CY6A 1T7PB 4BVXB 2M46A 3VWWA 4FYBA 1Z6MA 2AYTA 16GSA 2H71A 1A24A 3LGCA 3F6DA 4ZB9A 1PA3A 3IK9A 2ZCTA 1ML6A 4ICYA 2AUVA 4ILFA 1FVKA 3QMXA 2WJUA 5F8BA 3FY7A 4AJ7A 1TI3A 2H0IA 3D5JA 2RLIA 3GX8A 1EV9A 3MAKA 2IPAA 2B1LA 2A2PA 2GZPA 2E2GA 5EVOA 3A2WA 2MZCA 3FW2A 3P2AA 2YV7A 5IMZA 4MCUA 4MZWA 4TW5A 5FT3A 1YZXA 4H86A 3ZFLA 5DALA 3EVIA 2N5AA 4MA9A 1GSEA 2VIMA 2YWMA 1MTCA 3CMIA 2DMLA 1U3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OCF A;  2DSA A;  4IEL A;  2NDO A;  2L5O A;  3BCK A;  1K0O A;  1V9W A;  4N11 A;  1U3I A;  2J23 A;  2LKU A;  2GT6 A;  3RAZ A;  5ID2 A;  2GGT A;  4NV5 A;  5KN2 A;  4LLR A;  1OE7 A;  4KDX A;  1GSQ A;  3TCO A;  4EXJ A;  4MH3 A;  2HSN B;  3MDK A;  4K7N A;  1EEJ A;  5IM9 A;  4I5Q A;  4MJB A;  3UBK A;  4NMU A;  2GQL A;  1XIY A;  4K7I A;  2LRT A;  3F63 A;  1TRW A;  1OC9 A;  4MZB A;  1SK2 A;  3S9F A;  4IHU A;  5L71 A;  4RQR A;  1GSD A;  3UAP A;  5IQY A;  4IQ1 A;  4ZBA A;  4WBR D;  3FK8 A;  2CX4 A;  2YPM A;  1SD8 A;  4HU9 A;  3QR6 A;  2HI7 A;  3C1S A;  3M9J A;  1T4Y A;  5CP1 A;  3IA1 A;  4TXO A;  4LA1 A;  5CAX A;  1XVW A;  2F8F A;  5D9X A;  3BCI A;  1ZCP A;  2LJK A;  1FHE A;  2AB6 A;  6GSV A;  2Z9S A;  2XHF A;  4POM A;  2HZF A;  4DSS A;  5KN0 A;  3RDW A;  1PSQ A;  3GH9 A;  4NPB A;  2O8V B;  3P8W A;  4DVC A;  1JZR A;  2GSQ A;  2VOC A;  4QL9 A;  3M8N A;  3Q18 A;  3ZFB A;  2JZR A;  3KH9 A;  2M72 A;  1N2A A;  2HRF A;  3EUR A;  3H1N A;  3O6T A;  1YDK A;  3VLN A;  4XRA A;  1UVZ A;  5IMA A;  2HRA A;  3TKQ A;  2MBS A;  5CO3 A;  2DMM A;  2N5B A;  3HVV A;  2WUL A;  3NZN A;  1MDJ A;  1PL2 A;  5ELG A;  3E9J B;  4TOP A;  2J9H A;  2WRT A;  1AQV A;  4E8E A;  1PMT A;  3GA4 A;  2H1G A;  4JR6 A;  3GKM A;  4POB A;  2LST A;  4MF7 A;  3KZQ A;  4XTS A;  3ZRE A;  3UVT A;  4TR1 A;  4WF4 A;  3TGZ A;  3PPU A;  2RUF A;  5ECP B;  2GSR A;  1URM A;  2CVB A;  2H70 A;  3CXG A;  1VGL A;  4ZIJ A;  1ERU A;  2BJX A;  2KLX A;  4HJM A;  3WGD A;  1EOH A;  2VL3 A;  2H75 A;  4ZB6 A;  1TU7 A;  3LJR A;  2LJA A;  2VUP A;  4AJ8 A;  3US3 A;  1SJZ A;  3A2V A;  1O73 A;  5J3R A;  2RII A;  4TR0 A;  2WB9 A;  1OAZ A;  4V2L A;  1MD3 A;  3C71 A;  3H8Q A;  4K2D A;  2YZH A;  1ON4 A;  3GUS A;  4CHS A;  3APO A;  3LG6 A;  1TK5 B;  1K0A A;  2DJ2 A;  1AQX A;  2LEG A;  1FVJ A;  2HZE B;  2XPD A;  4EVM A;  1X5E A;  1MDK A;  1HNC A;  2V1M A;  2LQO A;  4ECI A;  3H79 A;  1T3B A;  3L0H A;  4XCS A;  2FA4 A;  2LRC A;  2E2M A;  3UMA A;  2YV9 A;  4ZL7 A;  4WR5 A;  2VCZ A;  1M99 A;  3LFL A;  2PBJ A;  3IAS 2;  5CYY A;  1PD2 1;  2FWF A;  2X64 A;  2H72 A;  2IMD A;  3RBT A;  1NHY A;  5E59 A;  1M2D A;  2B7J A;  2AJQ B;  2GVP A;  4TKY A;  3N5O A;  3EU4 A;  3QPM A;  18GS A;  3L78 A;  3LQ7 A;  2RM6 A;  1J08 A;  5ECH B;  3QFA C;  4EL1 A;  3EIN A;  2P5R A;  1YF0 A;  4XRD A;  2I1U A;  2YN1 A;  2HRK B;  4KH7 A;  1XCC A;  3DD3 A;  1AIU A;  4D73 B;  1TDI A;  5IMF A;  3ZIV A;  2ON5 A;  1Z7R A;  2DJK A;  1SL1 B;  3FHK A;  3GH6 A;  5J5N A;  4KDU A;  4ID0 A;  1IYI A;  3LXZ A;  2OE3 A;  1XWC A;  4KUN A;  3F3R A;  1NM3 A;  2C3Q A;  4G10 A;  1TK0 B;  2GZZ A;  1WOU A;  1AXD A;  1JZO A;  4MDC A;  2C0E A;  2OBI A;  2DIZ A;  4MF6 A;  1ST9 A;  1V58 A;  2BTO T;  1GSF A;  4GRF A;  3U5R E;  1JLW A;  1B9X C;  2PPT A;  1OC3 A;  5J9C A;  1O7U A;  3UOM A;  5INY A;  1SD9 A;  4YAP A;  2MMN A;  4BVY B;  3DWV A;  3A2X A;  4OO4 A;  3KTL A;  1OE8 A;  4MJC A;  3PR8 A;  3IBH A;  1WIK A;  1O8X A;  2IME A;  3UJ1 A;  3HJP A;  5CRD A;  4IBP A;  1PL1 A;  4PQH A;  4PNG A;  4USS A;  4ULX A;  4F9Z A;  2NBS A;  2CA8 A;  2OKA A;  3LXT A;  5CRG A;  1ZZY A;  3GFK A;  2HE3 A;  4TN8 A;  3Q19 A;  1U87 A;  4OFT A;  1U6T A;  5J9B A;  2V6O A;  7GSS A;  5G5E A;  2R5G A;  2YAN A;  1BG5 A;  3M9K A;  2V2G A;  2ES7 A;  1X5C A;  1SEN A;  4N0V A;  3UL3 A;  1B9Y C;  1K3Y A;  2HFD A;  4IGJ A;  1BQ7 A;  3QAV A;  2K6V A;  3PIN A;  3CYN A;  2OA7 A;  3KH7 A;  4YAV A;  2CZ3 A;  2ALB A;  4BL7 A;  5JCW A;  3SWL A;  2CX3 A;  4GF0 A;  4V1A p;  2KP1 A;  5IO0 A;  5DAL B;  2ON7 A;  3C8E A;  3FEU A;  4IS0 A;  1XWB A;  1K3O A;  1F3B A;  4GST A;  3TJK A;  3APS A;  3U6V A;  3GTU A;  2C0D A;  1K0D A;  1A0R P;  2V6K A;  4GCI A;  3VPQ A;  4OCE A;  5BMU A;  4MLY A;  2WDU A;  2HQT A;  1Z9H A;  1G6W A;  3VWU A;  4KSO A;  2CT6 A;  2NVL A;  1U3A A;  2LNS A;  5CRH A;  1WWJ A;  4DEJ A;  3KEB A;  4V2N A;  1XW5 A;  1TRU A;  3F4R A;  2F51 A;  2PU9 C;  2P31 A;  4HZ2 A;  1E6B A;  3I6A A;  4CDO A;  4NHW A;  3G7I A;  3GNJ A;  3J7Y b;  3ZIJ A;  3F8U A;  4NWY A;  2R2J A;  3LYK A;  3KJY A;  1OC9 B;  4KX4 A;  2EIO A;  4HJ2 A;  3BOA A;  2JAD A;  1TRS A;  4G9H A;  1JHB A;  4ZIL A;  2IMK A;  2TIR A;  4TXO B;  5EY6 A;  2X8C A;  5ELA A;  2WGR A;  3EWL A;  3D6I A;  1JZW A;  1YEP A;  2FWG A;  4F82 A;  2KUC A;  1F37 A;  3BBY A;  5F0G A;  4MH2 A;  5HFK A;  2FNO A;  5DQY A;  4DSS B;  3VWX A;  3KMN A;  4KE3 A;  1DE1 A;  4HEA 2;  5LNK e;  4J57 E;  2LTK A;  2QSI A;  5HR3 A;  1SU9 A;  4HQZ A;  1H75 A;  2K8V A;  1XBS A;  5ECL B;  2H73 A;  5D9T A;  3ZMK A;  5A5K A;  3KM6 A;  5C04 A;  1U88 A;  1K0N A;  1SJI A;  3GYK A;  1MD4 A;  4KW6 A;  4IKH A;  2FWE A;  4GLT A;  4K0N A;  3IC4 A;  5AIX A;  1QFN A;  5ENU A;  1X9W B;  3CBU A;  5HR0 A;  5G5F A;  3R2Q A;  1BAY A;  1GSS A;  4K0G A;  3DYR A;  3LEF A;  2FY6 A;  1NSW A;  4TR1 B;  2I3Y A;  3QAG A;  2C3N A;  5D9V A;  4PNF A;  2OAD A;  2QC7 A;  2RM5 A;  2WZ9 A;  3LSZ A;  12GS A;  1M9A A;  3G7J A;  3HDC A;  4TR4 A;  1IYH A;  3F4T A;  1THO A;  2C1Y A;  3VI5 A;  2HNL A;  2HSM A;  4KDY A;  2VLT A;  2I9H A;  3TOT A;  3E3E A;  4E8H A;  3DVX A;  4TXV A;  4Q5R A;  2MMO A;  3GL5 A;  4P3Y B;  4KCE A;  3HHV A;  3TRP A;  1M0U A;  3FKF A;  3WYW A;  2VL2 C;  3F6F A;  5DQS A;  2E0Q A;  3GV1 A;  2O87 A;  1YQ1 A;  3DIE A;  1PKZ A;  1KNG A;  1V2A A;  5H5Q A;  3IK7 A;  4ECC A;  1EGO A;  1HNB A;  4HU7 A;  1ABA A;  4PGT A;  2R4V A;  2VLU A;  2HLS A;  3I43 A;  4MPG A;  1QK8 A;  2DLX A;  1TTZ A;  6GSU A;  3TOU A;  4OFM A;  1GUK A;  4F2I A;  5JWO B;  1B4Q A;  4IVF A;  2H74 A;  3D4T A;  4X1U A;  2YP6 A;  3RHC A;  4KF9 A;  1O85 A;  1R5P A;  2YWO A;  4GSN A;  3MWH A;  2H0G A;  4NXI A;  3CSJ A;  4IJ3 A;  3HZ4 A;  3ZRD A;  2C8U A;  3N9J A;  2VAF A;  5COH A;  1OKT A;  3KXO A;  1XWA A;  3R3E A;  1WP0 A;  3OR5 A;  2IMF A;  5ECO B;  4POK A;  1YEX A;  5B8A A;  2O89 A;  3DML A;  4PX1 A;  1GL8 A;  2OE1 A;  2C3T A;  3HD5 A;  5HR2 A;  3BD2 A;  5D96 A;  4HZ4 A;  1EP7 A;  3SBC A;  1HD2 A;  3WGX A;  2GSS A;  1Z3E A;  1SKR B;  2CVD A;  2TRC P;  1SKS B;  3ZLP A;  1GTI A;  4HUA A;  4OO5 A;  3EMX A;  2H1A A;  1DUG A;  2CQ9 A;  1OVN A;  5JCG A;  2GLR A;  4ISD A;  3GIX A;  2H0H A;  1SJ6 A;  1G6Y A;  4PUA A;  3IHQ A;  1ZL9 A;  1JFU A;  3QD9 A;  2I4A A;  5HFI A;  3VPT A;  4GXZ A;  2C0F A;  4WEY A;  1USB A;  4KA0 A;  2FWH A;  5G1L A;  3F9U A;  1TJD A;  4YQU A;  1M9B A;  2IIY A;  2REM A;  3EE2 A;  1GNE A;  1NW2 A;  2DBC A;  4GTU A;  2GQK A;  13GS A;  1A2J A;  5IIZ A;  3I9V 2;  4I97 A;  2DJ0 A;  4MAB A;  5DCH A;  4FYU A;  3LYP A;  5JWR B;  3PH9 A;  4JE1 A;  3F0I A;  4MMM A;  3QAW A;  1LJR A;  2B6M A;  2I81 A;  1V40 A;  3MSZ A;  3WGE A;  4BL7 B;  3HYP A;  1FG4 A;  1GUM A;  2PUK C;  3FR9 A;  4J2F A;  1TKD B;  3M1G A;  4N0Z A;  5G2Z A;  1K3L A;  1TOF A;  4L0W A;  3EC3 A;  1EP8 A;  3FZA A;  5IOW A;  4TRX A;  3RHB A;  1PX7 A;  1Z6N A;  2AHE A;  3GTU B;  3GMF A;  2PMT A;  2JAC A;  4I2T A;  3D22 A;  1EOG A;  4BWS A;  2LV3 A;  2F8A A;  1Z5Y E;  1LBK A;  1K0C A;  3UEM A;  4ZL8 A;  17GS A;  4IP6 A;  1M7T A;  1V98 A;  3KIJ A;  2CVK A;  4ZBB A;  1Y25 A;  1Q98 A;  4NHZ A;  3JCM L;  3FZ5 A;  2YCD A;  1WRY A;  4CW9 A;  4V2M A;  2FGX A;  2VCQ A;  3K8N A;  5AIV A;  4RQX A;  2OE0 A;  4KB3 A;  1N8J A;  3O76 A;  2ZUP A;  1EWX A;  1ILO A;  1X0R A;  1OYJ A;  3TRQ A;  4O32 A;  1SYR A;  3HJM A;  5G1K A;  4MJE A;  4TVE A;  4PQ1 A;  2IFQ A;  3C1R A;  2LNT A;  3GKN A;  1TK8 B;  6GSS A;  5JWQ B;  4MPF A;  3CRU A;  1QQ2 A;  2VM2 A;  3FR6 A;  2H19 A;  2V32 A;  2L5L A;  5LCZ A;  2IMI A;  3RPN A;  5DJM A;  4MJA A;  2LRN A;  3KCM A;  5JCU A;  4AGS A;  3EU3 A;  5AN1 A;  6GSX A;  4BA7 A;  1DSB A;  3HA9 A;  3DGQ A;  5EL8 A;  1TXX A;  2QGV A;  5IPG A;  2B5X A;  4LMV A;  5A4W A;  5HFG A;  1AC1 A;  3ERG A;  2L57 A;  4JZQ A;  1KEB A;  3BJ5 A;  3CSH A;  4IQA A;  2L6D A;  2VO4 A;  4EDZ A;  2XC2 A;  5IPH A;  1DE2 A;  2LJR A;  1ERW A;  3TKS C;  4IP1 A;  4F0C A;  2B5E A;  1A23 A;  2X8H A;  3IPZ A;  4QL7 A;  3TJB A;  5B6N A;  3L9S A;  5F07 A;  4OWY A;  4BWQ A;  3DRN A;  1GH2 A;  4XS1 A;  2JZT A;  3Q74 A;  1FO5 A;  3HCZ A;  1UC7 A;  2WFC A;  3WT1 A;  1OKD A;  22GS A;  1FB6 A;  2FA8 A;  2G0F A;  5D8I A;  3KMO A;  2C0G A;  1OC8 A;  2RUE A;  2XBI A;  2ZNM A;  1GUH A;  1FAA A;  3ZYW A;  4WBJ A;  20GS A;  2LS5 A;  1VF3 A;  2H6X A;  4FH8 A;  5ID2 B;  1SL2 B;  1AW9 A;  1A0F A;  2HSM B;  3ZIT A;  4KSM A;  2OJL A;  5AIS A;  6GST A;  5B8B A;  4FIW A;  5DAK A;  2KP2 A;  1LU4 A;  2GS3 A;  1HNA A;  3GRX A;  4EO3 A;  2AV4 A;  2LUS A;  1GRX A;  1PKW A;  2VCT A;  2GQM A;  3IAM 2;  4KCA A;  5GSS A;  2NTO A;  2JZS A;  4MP4 A;  2B7K A;  3W6G A;  1TRV A;  2A2S A;  1ERT A;  4ECB A;  9GSS A;  2FUG 2;  3TJJ A;  4ZBD A;  3PGT A;  2DJJ A;  1JZD A;  1WJK A;  1BED A;  4G19 A;  3GKX A;  4PXO A;  1R26 A;  2BMX A;  2VLV A;  4NV2 A;  3QCP A;  5FWG A;  4Q5Q A;  4PTS A;  2EIQ A;  4MZC A;  1XW6 A;  3G9B A;  4JRR A;  4JED A;  4KAE A;  2N5F A;  2HRN A;  3ED3 A;  5ECN B;  5KN1 A;  1QXH A;  2L59 A;  2VL2 A;  1R4W A;  1R7H A;  1JLV A;  3GKK A;  5H5R A;  5F06 A;  3J7Y k;  4GQC A;  1HQO A;  1B4P A;  2H6Y A;  4XHM A;  1ZMA A;  4I8B A;  4ZB8 A;  3L9U A;  2WS2 A;  3GHA A;  2O7K A;  10GS A;  5A4U A;  4WXT A;  3ERF A;  1VF4 A;  1RW1 A;  5D9W A;  2FHE A;  3VWV A;  5IMV A;  4N30 A;  2YJH A;  5LD0 A;  4ECJ A;  3ME8 A;  1V57 A;  3G7Y A;  4XS4 A;  3TKP A;  4FQU A;  5CNW A;  1GSU A;  4DSR A;  3APQ A;  2MMA A;  4F0B A;  2FLS A;  1S3A A;  1VF2 A;  3ZVJ A;  3NOF A;  2JL4 A;  4HDE A;  2IWT A;  5J41 A;  1EEM A;  3DEX A;  2C80 A;  3C73 A;  2H1D A;  1VF1 A;  4HQS A;  4LMW A;  4MK3 A;  1T1V A;  2GZY A;  4NAX A;  1H4O A;  1TP9 A;  4O5R A;  3P90 A;  1ZYQ B;  4WET A;  3RPP A;  4X43 A;  1A8Y A;  1YJ6 A;  11GS A;  3IXR A;  3EYT A;  2K8S A;  2LQQ A;  3FRC A;  1O81 A;  4XIH A;  1XWG A;  4RI6 A;  2CV4 A;  3TDG A;  1M2B A;  3I69 A;  3CRT A;  3QFB C;  2KOK A;  4Q5N A;  5KEJ A;  1CQG A;  3H4K A;  4O92 A;  4OD7 A;  2DJ1 A;  1S3C A;  2B3S A;  2R37 A;  1F9M A;  3HVX A;  3GSS A;  3M3M A;  4YH2 A;  3TKS E;  2HSH A;  2YWN A;  1T4Z A;  5C00 A;  1S3D A;  3O3T A;  1A2M A;  1XOA A;  2MYG A;  2HT9 A;  4GSS A;  4IN0 A;  2H76 A;  14GS A;  3TJG A;  1I5G A;  4KGI A;  2WCI A;  2VD0 A;  1GTB A;  4OFN A;  3D0Z A;  5D73 A;  1GSY A;  3HVS A;  1FW1 A;  5FHI A;  2H6Z A;  1GWC A;  2V41 A;  5IMC A;  4V1A g;  2VCV A;  5HR1 A;  2YZU A;  4AJ6 A;  1PX6 A;  2VD1 A;  1G0T A;  4YQV A;  1MDI A;  2CAQ A;  1RK4 A;  1B48 A;  3DXB A;  3CTG A;  2CAI A;  3TJF A;  4DSQ A;  1O8W A;  3C7M A;  1BX9 A;  5DDL A;  3M0F A;  2P0G A;  1HYU A;  1SL0 B;  2HSY A;  3HJO A;  1PRX A;  3D4M A;  3KP9 A;  5ECM B;  4BVX A;  2XBQ A;  1KBN A;  5GAN D;  2QKE A;  1Z7P A;  2H01 A;  4WF5 A;  4FO5 A;  2OBK A;  4JR4 A;  4HI7 A;  1PGT A;  4O7H A;  5GAP D;  2GTU A;  4FYC A;  1ACV A;  2OAC A;  3ZZX A;  1XPV A;  1XZO A;  3QOU A;  2MBT A;  5AGY A;  2VL9 A;  2L6C A;  2PWJ A;  1UN2 A;  3VI7 A;  1NHO A;  2P5Q A;  3ERW A;  4LL4 B;  4IJI A;  4EKZ A;  4EUY A;  5CRW A;  1PQN A;  3GL3 A;  2IFQ B;  5EPF A;  1J9B A;  2PVO C;  2TRX A;  4OMV A;  2JSZ A;  5GZZ B;  2HXK A;  4X0X A;  1SK1 A;  1E2Y A;  1XOB A;  3IC8 A;  3IE3 A;  1QGV A;  1XVQ A;  3W8S A;  4WR4 A;  2VCX A;  2MMZ A;  1Q4J A;  1GP1 A;  3TUE A;  5ECS A;  3ZVJ D;  4GWR A;  3VK9 A;  3A3T A;  4L5O A;  2YOI A;  5ECQ B;  1TW9 A;  1WPI A;  2M80 A;  1K0M A;  3F3Q A;  3F4S A;  3WD6 A;  2H1B A;  5J4U A;  2IN3 A;  5D93 A;  3HKR A;  1C72 A;  3KD0 A;  1SYX A;  1A8L A;  4ML1 A;  3D21 A;  3HZ8 A;  3GUR A;  5IOX A;  3HXS A;  1BJX A;  4ML6 A;  5ECR B;  4ZXG A;  2KHP A;  1X9S B;  2VCW A;  2GST A;  3TB2 A;  5H5S A;  4F03 A;  1SK0 A;  3W8J A;  2GDR A;  3ZTL A;  2K18 A;  1MEK A;  1PN9 A;  1ZYE A;  1XXU A;  4L0U A;  5ECK B;  2DC5 A;  3P7X A;  3IV4 A;  1DBY A;  2K9F A;  4L8E A;  4ACS A;  1G7E A;  1O6J A;  3FYG A;  5DJL A;  5DAK B;  4G0I A;  1XW9 A;  1F3A A;  4TR3 A;  2DJ3 A;  1XWK A;  2EC4 A;  1GTA A;  3TKS A;  1F2E A;  3VFI A;  4I2U A;  4RUV A;  3UVH A;  3ZML A;  1YY7 A;  5A4V A;  2AAW A;  3CTF A;  2H8L A;  4JBB A;  3FZ4 A;  2L4C A;  2XPE A;  1B8X A;  3FR3 A;  1W89 A;  3HY2 A;  2G2Q A;  4QQ7 A;  4K8M A;  19GS A;  3IDV A;  1YKA A;  5DVB A;  4BPY A;  3GST A;  3LWA A;  4G2E A;  1AQW A;  1AAZ A;  1GLQ A;  3UAR A;  2GT5 A;  4IW9 A;  4I6X A;  4EF0 A;  1ERV A;  2O85 A;  4G0K A;  5GST A;  2H66 A;  1A2L A;  1WE0 A;  2JSY A;  2YNX A;  4EE0 A;  2FCH A;  2L4Q A;  1K0B A;  2R6K A;  3IRA A;  2B1K A;  1CQH A;  1QMV A;  2F9S A;  1W4V A;  3ISO A;  1GTU A;  3WT2 A;  4GQF A;  3Q6O A;  3LOR A;  2YWI A;  1RQM A;  3IR4 A;  3UIW A;  2YJ7 A;  1EV4 A;  5DCG A;  1X9M B;  3E0U A;  4XS6 A;  4K6X A;  3ZL5 A;  4HS1 A;  2A4V A;  4XS4 B;  5ECI B;  4Z7X A;  4PUF C;  1FOV A;  1T00 A;  1QUW A;  4MF5 A;  1T8E B;  2UZ8 A;  2HZE A;  5ABR A;  1GLP A;  3H93 A;  4J56 E;  2EIR A;  1BYE A;  1F6M C;  5E4W A;  2DIY A;  3A5W A;  4ZL9 A;  3EMP A;  2NPB A;  4PQI A;  4POL A;  1EZK A;  6GSW A;  1R5A A;  4AF2 A;  1FB0 A;  3L4N A;  2CZ2 A;  1KTE A;  8GSS A;  2FD3 A;  4PUR A;  1VRS D;  1TU8 A;  4LL1 B;  5IMD A;  3IOS A;  4Q5F A;  3TRX A;  1Y6E A;  1YKC A;  4K1F A;  3TKR A;  2HYX A;  1GUL A;  1I9D A;  5F05 A;  3L9V A;  2IL3 A;  2PVQ A;  2X99 A;  5CRE A;  3MNG A;  2IJY A;  5IO2 A;  2C4J A;  3FZ9 A;  4EDY A;  3GN3 A;  2R3X A;  3V1W A;  5KN3 A;  1XFL A;  5B6M A;  4WKW A;  3QDN A;  3CSI A;  3DVW A;  2JU5 A;  1GNW A;  3ME7 A;  1SKW B;  4YQM A;  4JU5 A;  3KGK A;  2HRK A;  4D73 A;  2H30 A;  3NIV A;  2PN8 A;  1THX A;  3AY8 A;  3KTB A;  2PGT A;  4KND A;  3KP8 A;  1G7O A;  2B5Y A;  1ZGN A;  4K7O A;  4RI7 A;  4EC0 A;  2A2R A;  1YF1 A;  5G31 A;  2X8G A;  5G30 A;  1EGR A;  3UBL A;  2VM1 A;  6GSY A;  3VUR A;  2D2Z A;  1AUC A;  4L5L A;  3GX0 A;  1TI1 A;  1UA5 A;  1ZOF A;  2F3M A;  4N10 A;  4G0L A;  1WMJ A;  4BVY A;  1M2A A;  1X5D A;  2PER A;  5DBQ A;  3DKS A;  5HQP A;  5B7C A;  4HOJ A;  1J0F A;  2E7P A;  1T7P B;  4BVX B;  2M46 A;  3VWW A;  4FYB A;  1Z6M A;  2AYT A;  16GS A;  2H71 A;  1A24 A;  3LGC A;  3F6D A;  4ZB9 A;  1PA3 A;  3IK9 A;  2ZCT A;  1ML6 A;  2AUV A;  4ILF A;  1FVK A;  3QMX A;  2WJU A;  5F8B A;  3FY7 A;  4AJ7 A;  1TI3 A;  2H0I A;  3D5J A;  2RLI A;  3GX8 A;  1EV9 A;  3MAK A;  2IPA A;  2B1L A;  2GZP A;  2E2G A;  5EVO A;  3A2W A;  2MZC A;  3FW2 A;  3P2A A;  2YV7 A;  5IMZ A;  4MCU A;  4MZW A;  4TW5 A;  5FT3 A;  1YZX A;  4H86 A;  3ZFL A;  5DAL A;  3EVI A;  2N5A A;  4MA9 A;  1GSE A;  2VIM A;  2YWM A;  1MTC A;  3CMI A;  2DML A;  4K9Z A; 
#chains in the Genus database with same CATH topology
 4OCF A;  2DSA A;  4IEL A;  2NDO A;  1S3R A;  2L5O A;  3BCK A;  2WW1 A;  1K0O A;  1V9W A;  4N11 A;  1U3I A;  2J23 A;  2LKU A;  2GT6 A;  3RAZ A;  5ID2 A;  2GGT A;  4NV5 A;  5KN2 A;  4LLR A;  1OE7 A;  4N3Z A;  4KDX A;  1GSQ A;  3TCO A;  1BG1 A;  4EXJ A;  4MH3 A;  2HSN B;  3MDK A;  4K7N A;  1EEJ A;  5IM9 A;  4I5Q A;  4MJB A;  3UBK A;  4NMU A;  2A4H A;  2GQL A;  1XIY A;  4K7I A;  2LRT A;  3F63 A;  1TRW A;  1OC9 A;  4MZB A;  1SK2 A;  3S9F A;  4IHU A;  5L71 A;  4RQR A;  1GSD A;  3UAP A;  5IQY A;  4IQ1 A;  4ZBA A;  4WBR D;  3FK8 A;  2CX4 A;  2YPM A;  1SD8 A;  4HU9 A;  3QR6 A;  4BIK A;  2HI7 A;  3C1S A;  3M9J A;  1T4Y A;  5CP1 A;  3IA1 A;  1FOH A;  4TXO A;  1SVM A;  4LA1 A;  5CAX A;  1XVW A;  2F8F A;  5D9X A;  3BCI A;  1ZCP A;  2LJK A;  1FHE A;  2AB6 A;  6GSV A;  2Z9S A;  2XHF A;  4POM A;  4ZB7 A;  2HZF A;  4DSS A;  5KN0 A;  3RDW A;  4YKF A;  1PSQ A;  3MYD A;  3GH9 A;  4NPB A;  2O8V B;  3P8W A;  4DVC A;  1JZR A;  2GSQ A;  2VOC A;  4QL9 A;  5BRT A;  3M8N A;  3Q18 A;  3ZFB A;  2JZR A;  3KH9 A;  2M72 A;  1N2A A;  2HRF A;  3EUR A;  3H1N A;  3O6T A;  1YDK A;  3VLN A;  4XRA A;  1UVZ A;  5IMA A;  2HRA A;  3TKQ A;  2MBS A;  5CO3 A;  2DMM A;  2N5B A;  3HVV A;  2WUL A;  1XG8 A;  3NZN A;  1MDJ A;  1PL2 A;  5ELG A;  3E9J B;  5J47 A;  4TOP A;  2J9H A;  2WRT A;  1AQV A;  4E8E A;  1PMT A;  3GA4 A;  2H1G A;  4JR6 A;  3GKM A;  4POB A;  2LST A;  4MF7 A;  3KZQ A;  4XTS A;  3ZRE A;  3UVT A;  4TR1 A;  4WF4 A;  3TGZ A;  3PPU A;  2RUF A;  5ECP B;  2DKI A;  2GSR A;  1URM A;  2CVB A;  2H70 A;  3CXG A;  1VGL A;  4ZIJ A;  1ERU A;  2BJX A;  2KLX A;  4HJM A;  3FMW A;  3WGD A;  1EOH A;  2VL3 A;  2H75 A;  3CWG A;  4ZB6 A;  1TU7 A;  3LJR A;  2LJA A;  2VUP A;  4AJ8 A;  3US3 A;  1SJZ A;  3A2V A;  1O73 A;  5J3R A;  2RII A;  2VKZ G;  4TR0 A;  2WB9 A;  5J40 A;  1OAZ A;  4V2L A;  1MD3 A;  3C71 A;  3H8Q A;  4K2D A;  2YZH A;  2QA1 A;  1ON4 A;  3GUS A;  4CHS A;  3APO A;  3LG6 A;  1TK5 B;  1K0A A;  2DJ2 A;  1AQX A;  2LEG A;  1FVJ A;  2HZE B;  2XPD A;  4EVM A;  1X5E A;  1MDK A;  1HNC A;  2V1M A;  2LQO A;  4ECI A;  3H79 A;  1T3B A;  3L0H A;  4XCS A;  2FA4 A;  2LRC A;  3CQF A;  2E2M A;  3UMA A;  2YV9 A;  4ZL7 A;  4WR5 A;  2VCZ A;  1M99 A;  3LFL A;  2PBJ A;  3IAS 2;  5CYY A;  1PD2 1;  2FWF A;  2X64 A;  2H72 A;  2IMD A;  3RBT A;  1NHY A;  5E59 A;  1M2D A;  2B7J A;  2AJQ B;  2GVP A;  4TKY A;  3N5O A;  3EU4 A;  3QPM A;  18GS A;  3L78 A;  3LQ7 A;  2RM6 A;  1ZYN A;  1J08 A;  5A34 A;  5ECH B;  3QFA C;  4EL1 A;  3EIN A;  2P5R A;  1YF0 A;  4XRD A;  2I1U A;  2YN1 A;  2HRK B;  4KH7 A;  1XCC A;  3DD3 A;  1AIU A;  4D73 B;  4HSC X;  1TDI A;  5IMF A;  3ZIV A;  2ON5 A;  1Z7R A;  2DJK A;  1SL1 B;  3FHK A;  3GH6 A;  5J5N A;  4KDU A;  4ID0 A;  1IYI A;  3LXZ A;  2OE3 A;  1XWC A;  4KUN A;  3F3R A;  4W66 A;  1NM3 A;  2C3Q A;  4G10 A;  1TK0 B;  2GZZ A;  1WOU A;  1AXD A;  1JZO A;  4MDC A;  2C0E A;  2OBI A;  2DIZ A;  4MF6 A;  1ST9 A;  1V58 A;  2BTO T;  1GSF A;  4GRF A;  3U5R E;  1JLW A;  1B9X C;  2PPT A;  1OC3 A;  4K9Z A;  5J9C A;  1O7U A;  3UOM A;  1M3I A;  5INY A;  1SD9 A;  4YAP A;  2MMN A;  4BVY B;  3DWV A;  3A2X A;  4OO4 A;  3KTL A;  1OE8 A;  4MJC A;  3PR8 A;  3IBH A;  1WIK A;  1O8X A;  2IME A;  3UJ1 A;  3HJP A;  5CRD A;  4IBP A;  1PL1 A;  4PQH A;  4PNG A;  4USS A;  4ULX A;  4F9Z A;  3TU3 B;  2NBS A;  2CA8 A;  4O5Q A;  2OKA A;  3LXT A;  2OT3 A;  5CRG A;  1ZZY A;  3GFK A;  2HE3 A;  4TN8 A;  3Q19 A;  1U87 A;  4OFT A;  1U6T A;  5J9B A;  2V6O A;  4Z2T A;  7GSS A;  5G5E A;  2R5G A;  2YAN A;  1BG5 A;  3M9K A;  2V2G A;  2ES7 A;  1X5C A;  1SEN A;  4N0V A;  3UL3 A;  1B9Y C;  1K3Y A;  2HFD A;  4IGJ A;  1BQ7 A;  3QAV A;  2K6V A;  3PIN A;  3CYN A;  2OA7 A;  3KH7 A;  4YAV A;  2CZ3 A;  2ALB A;  4BL7 A;  5JCW A;  3SWL A;  2CX3 A;  4GF0 A;  2UV8 G;  4V1A p;  2KP1 A;  5IO0 A;  5DAL B;  2ON7 A;  3C8E A;  3FEU A;  4IS0 A;  1XWB A;  1K3O A;  1F3B A;  4GST A;  3TJK A;  3APS A;  3U6V A;  3GTU A;  2C0D A;  1K0D A;  1A0R P;  2V6K A;  4GCI A;  3VPQ A;  4PHZ C;  4OCE A;  5BMU A;  4MLY A;  2WDU A;  2HQT A;  1Z9H A;  1G6W A;  3VWU A;  4KSO A;  2CT6 A;  2NVL A;  2LNS A;  5CRH A;  1WWJ A;  4DEJ A;  3KEB A;  2O3E A;  4V2N A;  1XW5 A;  1TRU A;  3F4R A;  2F51 A;  2PU9 C;  2P31 A;  4HZ2 A;  1E6B A;  3I6A A;  4CDO A;  4NHW A;  3G7I A;  3GNJ A;  3J7Y b;  3ZIJ A;  3F8U A;  4NWY A;  2R2J A;  3LYK A;  3KJY A;  1OC9 B;  4KX4 A;  2EIO A;  4HJ2 A;  3BOA A;  2JAD A;  1TRS A;  4G9H A;  1YEW C;  1JHB A;  4ZIL A;  2IMK A;  2TIR A;  4TXO B;  5EY6 A;  2X8C A;  5ELA A;  2WGR A;  1PFO A;  3EWL A;  3D6I A;  1JZW A;  1YEP A;  2FWG A;  4F82 A;  2KUC A;  1F37 A;  3BBY A;  5F0G A;  4MH2 A;  5HFK A;  2FNO A;  5DQY A;  4DSS B;  3VWX A;  3KMN A;  4KE3 A;  1DE1 A;  4HEA 2;  5LNK e;  4J57 E;  2LTK A;  4G01 A;  2QSI A;  5HR3 A;  1SU9 A;  4HQZ A;  1H75 A;  2K8V A;  1XBS A;  5ECL B;  2H73 A;  5D9T A;  3ZMK A;  5A5K A;  3KM6 A;  5C04 A;  1U88 A;  1K0N A;  1SJI A;  3GYK A;  1MD4 A;  4KW6 A;  4IKH A;  2FWE A;  4GLT A;  4K0N A;  3IC4 A;  5AIX A;  4PI0 C;  1QFN A;  5ENU A;  1X9W B;  3CBU A;  5HR0 A;  4A5P A;  5G5F A;  3R2Q A;  1BAY A;  1GSS A;  3RFR C;  4K0G A;  3DYR A;  3LEF A;  2FY6 A;  1NSW A;  4TR1 B;  2I3Y A;  2R0G A;  3QAG A;  2C3N A;  5D9V A;  4PNF A;  2OAD A;  2QC7 A;  2RM5 A;  2WZ9 A;  1SVO A;  3LSZ A;  12GS A;  1M9A A;  3G7J A;  3HDC A;  4TR4 A;  1IYH A;  3F4T A;  1THO A;  2C1Y A;  3VI5 A;  2HNL A;  2HSM A;  4KDY A;  2VLT A;  2I9H A;  3TOT A;  3E3E A;  4E8H A;  3DVX A;  4TXV A;  4Q5R A;  2MMO A;  3GL5 A;  4P3Y B;  3MIX A;  4KCE A;  3A5I A;  3HHV A;  3TRP A;  1M0U A;  3FKF A;  3WYW A;  2VL2 C;  3F6F A;  5DQS A;  2E0Q A;  3GV1 A;  2O87 A;  1YQ1 A;  3DIE A;  1PKZ A;  1KNG A;  1V2A A;  5H5Q A;  3IK7 A;  3HVN A;  4ECC A;  1EGO A;  1HNB A;  4HU7 A;  1ABA A;  4PGT A;  2R4V A;  2VLU A;  4K5S A;  2HLS A;  3I43 A;  4MPG A;  1QK8 A;  2DLX A;  1TTZ A;  6GSU A;  3TOU A;  4OFM A;  1GUK A;  4F2I A;  5JWO B;  1B4Q A;  4IVF A;  2H74 A;  3D4T A;  4X1U A;  2YP6 A;  3RHC A;  4KF9 A;  1O85 A;  1R5P A;  2YWO A;  4GSN A;  3MWH A;  2H0G A;  4NXI A;  3CSJ A;  4IJ3 A;  3HZ4 A;  3ZRD A;  2DKH A;  2C8U A;  3N9J A;  2VAF A;  1S4B P;  5COH A;  1OKT A;  3KXO A;  5A34 B;  1XWA A;  3R3E A;  1WP0 A;  3OR5 A;  2IMF A;  5ECO B;  4POK A;  1YEX A;  5B8A A;  2O89 A;  3DML A;  3IHG A;  4PX1 A;  1GL8 A;  2OE1 A;  2C3T A;  3HD5 A;  5HR2 A;  3BD2 A;  5D96 A;  4HZ4 A;  1EP7 A;  3SBC A;  1HD2 A;  3WGX A;  2GSS A;  1Z3E A;  1SKR B;  2CVD A;  2TRC P;  1SKS B;  3ZLP A;  1GTI A;  4HUA A;  4OO5 A;  3EMX A;  2H1A A;  1DUG A;  2CQ9 A;  1OVN A;  5JCG A;  2GLR A;  4ISD A;  3GIX A;  2H0H A;  1SJ6 A;  1G6Y A;  4PUA A;  3IHQ A;  1ZL9 A;  1JFU A;  3QD9 A;  2I4A A;  5HFI A;  3VPT A;  4GXZ A;  2C0F A;  4WEY A;  1USB A;  4KA0 A;  2FWH A;  5G1L A;  3F9U A;  1TJD A;  4YQU A;  1M9B A;  2IIY A;  2REM A;  3EE2 A;  1GNE A;  4Z2R A;  1NW2 A;  2DBC A;  4GTU A;  2WVZ A;  4GDF A;  2GQK A;  13GS A;  1A2J A;  5IIZ A;  3I9V 2;  4I97 A;  2QA2 A;  2DJ0 A;  4MAB A;  5DCH A;  4FYU A;  3LYP A;  5JWR B;  3PH9 A;  4JE1 A;  2EFC A;  3F0I A;  4MMM A;  3QAW A;  1LJR A;  2B6M A;  2I81 A;  1V40 A;  3MSZ A;  3WGE A;  4BL7 B;  3HYP A;  1FG4 A;  1GUM A;  2PUK C;  3FR9 A;  4J2F A;  1TKD B;  3M1G A;  4EIQ A;  4N0Z A;  5G2Z A;  1K3L A;  1TOF A;  4L0W A;  3EC3 A;  1EP8 A;  3FZA A;  5IOW A;  4TRX A;  3RHB A;  1PX7 A;  1Z6N A;  2AHE A;  3GTU B;  3GMF A;  2PMT A;  2JAC A;  4I2T A;  3D22 A;  2WVX A;  1EOG A;  5BMU B;  4BWS A;  2LV3 A;  2F8A A;  1Z5Y E;  1LBK A;  1K0C A;  3UEM A;  4ZL8 A;  17GS A;  1SVL A;  4IP6 A;  1M7T A;  1V98 A;  3KIJ A;  2CVK A;  4ZBB A;  2WZS A;  1Y25 A;  1Q98 A;  4NHZ A;  3JCM L;  3FZ5 A;  2YCD A;  1WRY A;  4CW9 A;  4V2M A;  2FGX A;  2VCQ A;  3K8N A;  5AIV A;  4RQX A;  2OE0 A;  4KB3 A;  1N8J A;  3O76 A;  2ZUP A;  1EWX A;  1ILO A;  1X0R A;  1OYJ A;  3TRQ A;  4O32 A;  1SYR A;  3HJM A;  5G1K A;  4MJE A;  4TVE A;  4PQ1 A;  2X49 A;  2IFQ A;  3C1R A;  2LNT A;  3GKN A;  1TK8 B;  6GSS A;  5JWQ B;  4MPF A;  3CRU A;  1QQ2 A;  2VM2 A;  2EFE A;  3FR6 A;  2H19 A;  2V32 A;  2L5L A;  5LCZ A;  2IMI A;  3RPN A;  5DJM A;  2O5V A;  4MJA A;  2LRN A;  4QMK A;  3KCM A;  5JCU A;  4AGS A;  3EU3 A;  5AN1 A;  6GSX A;  4BA7 A;  1DSB A;  3HA9 A;  3DGQ A;  5EL8 A;  1TXX A;  2O36 A;  2QGV A;  5IPG A;  2B5X A;  4LMV A;  5A4W A;  5HFG A;  1AC1 A;  3ERG A;  2L57 A;  4JZQ A;  1KEB A;  3BJ5 A;  3CSH A;  4IQA A;  2L6D A;  2VO4 A;  4EDZ A;  2XC2 A;  5IPH A;  1DE2 A;  2LJR A;  1ERW A;  3TKS C;  4IP1 A;  4F0C A;  2B5E A;  4FXY P;  1A23 A;  2X8H A;  3IPZ A;  4QL7 A;  3TJB A;  5B6N A;  3L9S A;  5F07 A;  4OWY A;  3HMJ G;  4BWQ A;  3DRN A;  1GH2 A;  4XS1 A;  2JZT A;  3Q74 A;  1FO5 A;  3HCZ A;  1UC7 A;  2WFC A;  1TXU A;  3WT1 A;  1OKD A;  4AKH A;  22GS A;  1FB6 A;  2FA8 A;  2G0F A;  5D8I A;  3KMO A;  2C0G A;  1OC8 A;  2RUE A;  2XBI A;  2ZNM A;  1GUH A;  1FAA A;  3ZYW A;  4WBJ A;  20GS A;  2LS5 A;  1VF3 A;  2H6X A;  4FH8 A;  5ID2 B;  1SL2 B;  1AW9 A;  1A0F A;  2HSM B;  3ZIT A;  4KSM A;  2OJL A;  5AIS A;  6GST A;  5B8B A;  4FIW A;  5DAK A;  2KP2 A;  1LU4 A;  2GS3 A;  1HNA A;  3GRX A;  4EO3 A;  2AV4 A;  2LUS A;  1GRX A;  2X4A A;  1PKW A;  2VCT A;  2GQM A;  3IAM 2;  4KCA A;  5GSS A;  2NTO A;  2JZS A;  2R0C A;  4MP4 A;  2B7K A;  3W6G A;  1TRV A;  2A2S A;  1ERT A;  4ECB A;  9GSS A;  2FUG 2;  3TJJ A;  4ZBD A;  3PGT A;  2DJJ A;  1JZD A;  1WJK A;  1BED A;  4G19 A;  3GKX A;  4PXO A;  1R26 A;  2BMX A;  2VLV A;  4NV2 A;  3QCP A;  5FWG A;  4Q5Q A;  4PTS A;  2EIQ A;  4MZC A;  1XW6 A;  3G9B A;  4JRR A;  4JED A;  4KAE A;  2N5F A;  2HRN A;  3ED3 A;  5ECN B;  5KN1 A;  1QXH A;  2L59 A;  2VL2 A;  1R4W A;  1R7H A;  4K2X A;  1JLV A;  3GKK A;  5H5R A;  3CHX C;  5F06 A;  3J7Y k;  4GQC A;  1HQO A;  1B4P A;  2H6Y A;  4XHM A;  1ZMA A;  4I8B A;  4ZB8 A;  3L9U A;  2WS2 A;  3GHA A;  2O7K A;  10GS A;  5A4U A;  4WXT A;  3ERF A;  1ZYP A;  1VF4 A;  1RW1 A;  5D9W A;  2FHE A;  3VWV A;  5IMV A;  4N30 A;  2YJH A;  5LD0 A;  4ECJ A;  3ME8 A;  1V57 A;  3G7Y A;  4XS4 A;  5A1N A;  3TKP A;  4FQU A;  5CNW A;  1GSU A;  4DSR A;  3APQ A;  2MMA A;  4F0B A;  2FLS A;  1S3A A;  1VF2 A;  3ZVJ A;  3NOF A;  2JL4 A;  4HDE A;  2IWT A;  1N25 A;  5J41 A;  1EEM A;  3DEX A;  2C80 A;  3C73 A;  2H1D A;  1VF1 A;  4HQS A;  4LMW A;  4MK3 A;  1T1V A;  2GZY A;  4NAX A;  1H4O A;  1TP9 A;  4PI2 C;  4O5R A;  3P90 A;  4AKG A;  1ZYQ B;  4WET A;  3RPP A;  4X43 A;  1A8Y A;  1YJ6 A;  4X4J A;  11GS A;  3IXR A;  3EYT A;  2K8S A;  2LQQ A;  3FRC A;  1O81 A;  4XIH A;  1XWG A;  4RI6 A;  2CV4 A;  3TDG A;  1M2B A;  3I69 A;  3CRT A;  3QFB C;  2KOK A;  4Q5N A;  5KEJ A;  1CQG A;  3H4K A;  4O92 A;  4OD7 A;  2DJ1 A;  1S3C A;  2B3S A;  2R37 A;  1F9M A;  3HVX A;  3GSS A;  3M3M A;  4YH2 A;  3TKS E;  2HSH A;  2YWN A;  1T4Z A;  5C00 A;  1S3D A;  3O3T A;  1A2M A;  1XOA A;  2MYG A;  2HT9 A;  4GSS A;  4IN0 A;  2H76 A;  14GS A;  3TJG A;  1I5G A;  4KGI A;  2WCI A;  2VD0 A;  1GTB A;  4OFN A;  3D0Z A;  5D73 A;  1GSY A;  3HVS A;  1FW1 A;  5A5H A;  5FHI A;  2H6Z A;  1GWC A;  2V41 A;  5IMC A;  5J4V A;  4V1A g;  2VCV A;  5HR1 A;  2YZU A;  4AJ6 A;  1PX6 A;  2VD1 A;  1G0T A;  4YQV A;  4O5U A;  1MDI A;  2CAQ A;  1RK4 A;  1B48 A;  3DXB A;  3CTG A;  2CAI A;  2WVX B;  3TJF A;  4DSQ A;  1O8W A;  3C7M A;  1BX9 A;  1PN0 A;  5DDL A;  3M0F A;  4EIP A;  2P0G A;  1HYU A;  1SL0 B;  2HSY A;  3HJO A;  1PRX A;  3D4M A;  5ECM B;  4BVX A;  3KP9 A;  2XBQ A;  1KBN A;  5GAN D;  2QKE A;  1Z7P A;  2H01 A;  4WF5 A;  4E68 A;  4FO5 A;  2OBK A;  4JR4 A;  4HI7 A;  1PGT A;  4O7H A;  5GAP D;  2GTU A;  4FYC A;  1ACV A;  2OAC A;  4K5R A;  3ZZX A;  1XPV A;  1XZO A;  3QOU A;  2MBT A;  2EFD A;  5AGY A;  2VL9 A;  2L6C A;  2PWJ A;  1UN2 A;  3VI7 A;  1NHO A;  2P5Q A;  3ERW A;  4LL4 B;  4IJI A;  4EKZ A;  4EUY A;  5CRW A;  1PQN A;  3GL3 A;  2IFQ B;  5EPF A;  1J9B A;  2PVO C;  2TRX A;  4OMV A;  2R0P A;  2JSZ A;  5KOX A;  5GZZ B;  2HXK A;  4X0X A;  1SK1 A;  1E2Y A;  1XOB A;  3IC8 A;  3IE3 A;  1QGV A;  1XVQ A;  3W8S A;  4WR4 A;  2VCX A;  3LW9 A;  2MMZ A;  2H1L A;  1Q4J A;  1GP1 A;  3TUE A;  5ECS A;  1Y1U A;  3ZVJ D;  4GWR A;  3VK9 A;  3A3T A;  4L5O A;  2YOI A;  5ECQ B;  1TW9 A;  1WPI A;  2M80 A;  1K0M A;  3F3Q A;  3F4S A;  3WD6 A;  2H1B A;  5J4U A;  2IN3 A;  3EPT A;  5D93 A;  3HKR A;  1C72 A;  3KD0 A;  2HSN A;  1SYX A;  1A8L A;  4ML1 A;  3D21 A;  3HZ8 A;  3GUR A;  5IOX A;  3HXS A;  1BJX A;  4ML6 A;  2WW2 A;  5ECR B;  4ZXG A;  2KHP A;  1X9S B;  2VCW A;  2GST A;  3TB2 A;  5H5S A;  4F03 A;  1SK0 A;  3W8J A;  2GDR A;  3ZTL A;  2K18 A;  1MEK A;  1PN9 A;  1ZYE A;  1XXU A;  4CY8 A;  4L0U A;  5ECK B;  2DC5 A;  3P7X A;  3IV4 A;  1DBY A;  2K9F A;  4L8E A;  4ACS A;  1G7E A;  1O6J A;  3FYG A;  5DJL A;  5DAK B;  4G0I A;  1XW9 A;  1BF5 A;  1F3A A;  4TR3 A;  5J4Y A;  2DJ3 A;  1XWK A;  2EC4 A;  1GTA A;  3TKS A;  1F2E A;  3VFI A;  4I2U A;  4RUV A;  3UVH A;  3ZML A;  1YY7 A;  5A4V A;  4MNN A;  2AAW A;  3CTF A;  2H8L A;  4JBB A;  3FZ4 A;  2L4C A;  2XPE A;  1B8X A;  3FR3 A;  1W89 A;  3HY2 A;  2G2Q A;  4QQ7 A;  4K8M A;  19GS A;  3IDV A;  1YKA A;  5DVB A;  4BPY A;  3GST A;  3LWA A;  1M3J A;  4G2E A;  1AQW A;  1AAZ A;  1GLQ A;  3UAR A;  2GT5 A;  4IW9 A;  4I6X A;  4EF0 A;  1ERV A;  2O85 A;  4G0K A;  5GST A;  2H66 A;  1A2L A;  1WE0 A;  4YKG A;  2JSY A;  2YNX A;  4EE0 A;  2FCH A;  2L4Q A;  1K0B A;  2R6K A;  3IRA A;  2B1K A;  1CQH A;  1QMV A;  1I1I P;  2F9S A;  1W4V A;  3ISO A;  1GTU A;  3WT2 A;  4GQF A;  3Q6O A;  3LOR A;  2YWI A;  1RQM A;  3IR4 A;  3UIW A;  2YJ7 A;  1EV4 A;  1YVL A;  5DCG A;  1X9M B;  3E0U A;  4XS6 A;  4K6X A;  3ZL5 A;  4HS1 A;  2A4V A;  4XS4 B;  5ECI B;  5A1N B;  4PUF C;  4Z7X A;  1FOV A;  1T00 A;  1QUW A;  4MF5 A;  1T8E B;  2UZ8 A;  2HZE A;  5ABR A;  1GLP A;  3H93 A;  2WW3 A;  4J56 E;  2EIR A;  1BYE A;  1F6M C;  5E4W A;  2DIY A;  3A5W A;  4Z2U A;  4ZL9 A;  3EMP A;  2NPB A;  4PQI A;  4POL A;  1EZK A;  5KOW A;  6GSW A;  1R5A A;  4AF2 A;  1FB0 A;  3L4N A;  2CZ2 A;  1KTE A;  8GSS A;  2FD3 A;  4PUR A;  1VRS D;  1TU8 A;  4LL1 B;  5IMD A;  3IOS A;  4Q5F A;  3TRX A;  1Y6E A;  1YKC A;  4K1F A;  3TKR A;  2HYX A;  1GUL A;  1I9D A;  5F05 A;  3L9V A;  2IL3 A;  2PVQ A;  2X99 A;  5CRE A;  3MNG A;  2IJY A;  5IO2 A;  2C4J A;  3RGB C;  3FZ9 A;  4EDY A;  3GN3 A;  2R3X A;  3V1W A;  5KN3 A;  1XFL A;  2WW0 A;  4WKW A;  5B6M A;  3QDN A;  3CSI A;  3DVW A;  2JU5 A;  1GNW A;  3ME7 A;  1SKW B;  4YQM A;  4JU5 A;  3KGK A;  2HRK A;  4D73 A;  2H30 A;  3NIV A;  2PN8 A;  1THX A;  3AY8 A;  3KTB A;  2PGT A;  4KND A;  3KP8 A;  1G7O A;  2B5Y A;  1ZGN A;  4K7O A;  4RI7 A;  4EC0 A;  5A5H B;  2A2R A;  1YF1 A;  5G31 A;  2X8G A;  5G30 A;  4AKI A;  1EGR A;  3UBL A;  2VM1 A;  6GSY A;  3VUR A;  2D2Z A;  1AUC A;  4L5L A;  3GX0 A;  1TI1 A;  1UA5 A;  1ZOF A;  2F3M A;  4N10 A;  4G0L A;  1WMJ A;  4BVY A;  1M2A A;  4AKX B;  1X5D A;  2PER A;  2EFH A;  4AI6 A;  3DKS A;  5DBQ A;  5HQP A;  5B7C A;  4HOJ A;  1J0F A;  2E7P A;  4CY6 A;  1T7P B;  4BVX B;  2M46 A;  3VWW A;  4FYB A;  1Z6M A;  2AYT A;  16GS A;  2H71 A;  1A24 A;  3LGC A;  3F6D A;  4ZB9 A;  2ZCT A;  1PA3 A;  3IK9 A;  1ML6 A;  4ICY A;  2AUV A;  4ILF A;  1FVK A;  3QMX A;  2WJU A;  5F8B A;  3FY7 A;  4AJ7 A;  1TI3 A;  2H0I A;  3D5J A;  2RLI A;  3GX8 A;  1EV9 A;  3MAK A;  2IPA A;  2B1L A;  2WVY A;  2A2P A;  2GZP A;  2E2G A;  5EVO A;  3A2W A;  2MZC A;  3FW2 A;  3P2A A;  2YV7 A;  5IMZ A;  4MCU A;  4MZW A;  4TW5 A;  5FT3 A;  1YZX A;  4H86 A;  3ZFL A;  5DAL A;  3EVI A;  2N5A A;  4MA9 A;  1GSE A;  2VIM A;  2YWM A;  1MTC A;  3CMI A;  2DML A;  1U3A A; 
#chains in the Genus database with same CATH homology
 4OCF A;  2DSA A;  4IEL A;  2NDO A;  2L5O A;  3BCK A;  1K0O A;  1V9W A;  4N11 A;  1U3I A;  2J23 A;  2LKU A;  2GT6 A;  3RAZ A;  5ID2 A;  2GGT A;  4NV5 A;  5KN2 A;  4LLR A;  1OE7 A;  4N3Z A;  4KDX A;  1GSQ A;  3TCO A;  1BG1 A;  4EXJ A;  4MH3 A;  2HSN B;  3MDK A;  4K7N A;  1EEJ A;  5IM9 A;  4I5Q A;  4MJB A;  3UBK A;  4NMU A;  2A4H A;  2GQL A;  1XIY A;  4K7I A;  2LRT A;  3F63 A;  1TRW A;  1OC9 A;  4MZB A;  1SK2 A;  3S9F A;  4IHU A;  5L71 A;  4RQR A;  1GSD A;  3UAP A;  5IQY A;  4IQ1 A;  4ZBA A;  4WBR D;  3FK8 A;  2CX4 A;  2YPM A;  1SD8 A;  4HU9 A;  3QR6 A;  2HI7 A;  3C1S A;  3M9J A;  1T4Y A;  5CP1 A;  3IA1 A;  1FOH A;  4TXO A;  1SVM A;  4LA1 A;  5CAX A;  1XVW A;  2F8F A;  5D9X A;  3BCI A;  1ZCP A;  2LJK A;  1FHE A;  2AB6 A;  6GSV A;  2Z9S A;  2XHF A;  4POM A;  4ZB7 A;  2HZF A;  4DSS A;  5KN0 A;  3RDW A;  4YKF A;  1PSQ A;  3MYD A;  3GH9 A;  4NPB A;  2O8V B;  3P8W A;  4DVC A;  1JZR A;  2GSQ A;  2VOC A;  4QL9 A;  5BRT A;  3M8N A;  3Q18 A;  3ZFB A;  2JZR A;  3KH9 A;  2M72 A;  1N2A A;  2HRF A;  3EUR A;  3H1N A;  3O6T A;  1YDK A;  3VLN A;  4XRA A;  1UVZ A;  5IMA A;  2HRA A;  3TKQ A;  2MBS A;  5CO3 A;  2DMM A;  2N5B A;  3HVV A;  2WUL A;  3NZN A;  1MDJ A;  1PL2 A;  5ELG A;  3E9J B;  5J47 A;  4TOP A;  2J9H A;  2WRT A;  1AQV A;  4E8E A;  1PMT A;  3GA4 A;  2H1G A;  4JR6 A;  3GKM A;  4POB A;  2LST A;  4MF7 A;  3KZQ A;  4XTS A;  3ZRE A;  3UVT A;  4TR1 A;  4WF4 A;  3TGZ A;  3PPU A;  2RUF A;  5ECP B;  2DKI A;  2GSR A;  1URM A;  2CVB A;  2H70 A;  3CXG A;  1VGL A;  4ZIJ A;  1ERU A;  2BJX A;  2KLX A;  4HJM A;  3FMW A;  3WGD A;  1EOH A;  2VL3 A;  2H75 A;  3CWG A;  4ZB6 A;  1TU7 A;  3LJR A;  2LJA A;  2VUP A;  4AJ8 A;  3US3 A;  1SJZ A;  3A2V A;  1O73 A;  5J3R A;  2RII A;  2VKZ G;  4TR0 A;  2WB9 A;  5J40 A;  1OAZ A;  4V2L A;  1MD3 A;  3C71 A;  3H8Q A;  4K2D A;  2YZH A;  2QA1 A;  1ON4 A;  3GUS A;  4CHS A;  3APO A;  3LG6 A;  1TK5 B;  1K0A A;  2DJ2 A;  1AQX A;  2LEG A;  1FVJ A;  2HZE B;  2XPD A;  4EVM A;  1X5E A;  1MDK A;  1HNC A;  2V1M A;  2LQO A;  4ECI A;  3H79 A;  1T3B A;  3L0H A;  4XCS A;  2FA4 A;  2LRC A;  2E2M A;  3UMA A;  2YV9 A;  4ZL7 A;  4WR5 A;  2VCZ A;  1M99 A;  3LFL A;  2PBJ A;  3IAS 2;  5CYY A;  1PD2 1;  2FWF A;  2X64 A;  2H72 A;  2IMD A;  3RBT A;  1NHY A;  5E59 A;  1M2D A;  2B7J A;  2AJQ B;  2GVP A;  4TKY A;  3N5O A;  3EU4 A;  3QPM A;  18GS A;  3L78 A;  3LQ7 A;  2RM6 A;  1ZYN A;  1J08 A;  5A34 A;  5ECH B;  3QFA C;  4EL1 A;  3EIN A;  2P5R A;  1YF0 A;  4XRD A;  2I1U A;  2YN1 A;  2HRK B;  4KH7 A;  1XCC A;  3DD3 A;  1AIU A;  4D73 B;  1TDI A;  5IMF A;  3ZIV A;  2ON5 A;  1Z7R A;  2DJK A;  1SL1 B;  3FHK A;  3GH6 A;  5J5N A;  4KDU A;  4ID0 A;  1IYI A;  3LXZ A;  2OE3 A;  1XWC A;  4KUN A;  3F3R A;  4W66 A;  1NM3 A;  2C3Q A;  4G10 A;  1TK0 B;  2GZZ A;  1WOU A;  1AXD A;  1JZO A;  4MDC A;  2C0E A;  2OBI A;  2DIZ A;  4MF6 A;  1ST9 A;  1V58 A;  2BTO T;  1GSF A;  4GRF A;  3U5R E;  1JLW A;  1B9X C;  2PPT A;  1OC3 A;  4K9Z A;  5J9C A;  1O7U A;  3UOM A;  5INY A;  1SD9 A;  4YAP A;  2MMN A;  4BVY B;  3DWV A;  3A2X A;  4OO4 A;  3KTL A;  1OE8 A;  4MJC A;  3PR8 A;  3IBH A;  1WIK A;  1O8X A;  2IME A;  3UJ1 A;  3HJP A;  5CRD A;  4IBP A;  1PL1 A;  4PQH A;  4PNG A;  4USS A;  4ULX A;  4F9Z A;  3TU3 B;  2NBS A;  2CA8 A;  4O5Q A;  2OKA A;  3LXT A;  2OT3 A;  5CRG A;  1ZZY A;  3GFK A;  2HE3 A;  4TN8 A;  3Q19 A;  1U87 A;  4OFT A;  1U6T A;  5J9B A;  2V6O A;  4Z2T A;  7GSS A;  5G5E A;  2R5G A;  2YAN A;  1BG5 A;  3M9K A;  2V2G A;  2ES7 A;  1X5C A;  1SEN A;  4N0V A;  3UL3 A;  1B9Y C;  1K3Y A;  2HFD A;  4IGJ A;  1BQ7 A;  3QAV A;  2K6V A;  3PIN A;  3CYN A;  2OA7 A;  3KH7 A;  4YAV A;  2CZ3 A;  2ALB A;  4BL7 A;  5JCW A;  3SWL A;  2CX3 A;  4GF0 A;  2UV8 G;  4V1A p;  2KP1 A;  5IO0 A;  5DAL B;  2ON7 A;  3C8E A;  3FEU A;  4IS0 A;  1XWB A;  1K3O A;  1F3B A;  4GST A;  3TJK A;  3APS A;  3U6V A;  3GTU A;  2C0D A;  1K0D A;  1A0R P;  2V6K A;  4GCI A;  3VPQ A;  4OCE A;  5BMU A;  4MLY A;  2WDU A;  2HQT A;  1Z9H A;  1G6W A;  3VWU A;  4KSO A;  2CT6 A;  2NVL A;  2LNS A;  5CRH A;  1WWJ A;  4DEJ A;  3KEB A;  4V2N A;  1XW5 A;  1TRU A;  3F4R A;  2F51 A;  2PU9 C;  2P31 A;  4HZ2 A;  1E6B A;  3I6A A;  4CDO A;  4NHW A;  3G7I A;  3GNJ A;  3J7Y b;  3ZIJ A;  3F8U A;  4NWY A;  2R2J A;  3LYK A;  3KJY A;  1OC9 B;  4KX4 A;  2EIO A;  4HJ2 A;  3BOA A;  2JAD A;  1TRS A;  4G9H A;  1JHB A;  4ZIL A;  2IMK A;  2TIR A;  4TXO B;  5EY6 A;  2X8C A;  5ELA A;  2WGR A;  3EWL A;  3D6I A;  1JZW A;  1YEP A;  2FWG A;  4F82 A;  2KUC A;  1F37 A;  3BBY A;  5F0G A;  4MH2 A;  5HFK A;  2FNO A;  5DQY A;  4DSS B;  3VWX A;  3KMN A;  4KE3 A;  1DE1 A;  4HEA 2;  5LNK e;  4J57 E;  2LTK A;  4G01 A;  2QSI A;  5HR3 A;  1SU9 A;  4HQZ A;  1H75 A;  2K8V A;  1XBS A;  5ECL B;  2H73 A;  5D9T A;  3ZMK A;  5A5K A;  3KM6 A;  5C04 A;  1U88 A;  1K0N A;  1SJI A;  3GYK A;  1MD4 A;  4KW6 A;  4IKH A;  2FWE A;  4GLT A;  4K0N A;  3IC4 A;  5AIX A;  1QFN A;  5ENU A;  1X9W B;  3CBU A;  5HR0 A;  4A5P A;  5G5F A;  3R2Q A;  1BAY A;  1GSS A;  4K0G A;  3DYR A;  3LEF A;  2FY6 A;  1NSW A;  4TR1 B;  2I3Y A;  2R0G A;  3QAG A;  2C3N A;  5D9V A;  4PNF A;  2OAD A;  2QC7 A;  2RM5 A;  2WZ9 A;  1SVO A;  3LSZ A;  12GS A;  1M9A A;  3G7J A;  3HDC A;  4TR4 A;  1IYH A;  3F4T A;  1THO A;  2C1Y A;  3VI5 A;  2HNL A;  2HSM A;  4KDY A;  2VLT A;  2I9H A;  3TOT A;  3E3E A;  4E8H A;  3DVX A;  4TXV A;  4Q5R A;  2MMO A;  3GL5 A;  4P3Y B;  3MIX A;  4KCE A;  3A5I A;  3HHV A;  3TRP A;  1M0U A;  3FKF A;  3WYW A;  2VL2 C;  3F6F A;  5DQS A;  2E0Q A;  3GV1 A;  2O87 A;  1YQ1 A;  3DIE A;  1PKZ A;  1KNG A;  1V2A A;  5H5Q A;  3IK7 A;  4ECC A;  1EGO A;  1HNB A;  4HU7 A;  1ABA A;  4PGT A;  2R4V A;  2VLU A;  4K5S A;  2HLS A;  3I43 A;  4MPG A;  1QK8 A;  2DLX A;  1TTZ A;  6GSU A;  3TOU A;  4OFM A;  1GUK A;  4F2I A;  5JWO B;  1B4Q A;  4IVF A;  2H74 A;  3D4T A;  4X1U A;  2YP6 A;  3RHC A;  4KF9 A;  1O85 A;  1R5P A;  2YWO A;  4GSN A;  3MWH A;  2H0G A;  4NXI A;  3CSJ A;  4IJ3 A;  3HZ4 A;  3ZRD A;  2DKH A;  2C8U A;  3N9J A;  2VAF A;  5COH A;  1OKT A;  3KXO A;  5A34 B;  1XWA A;  3R3E A;  1WP0 A;  3OR5 A;  2IMF A;  5ECO B;  4POK A;  1YEX A;  5B8A A;  2O89 A;  3DML A;  3IHG A;  4PX1 A;  1GL8 A;  2OE1 A;  2C3T A;  3HD5 A;  5HR2 A;  3BD2 A;  5D96 A;  4HZ4 A;  1EP7 A;  3SBC A;  1HD2 A;  3WGX A;  2GSS A;  1Z3E A;  1SKR B;  2CVD A;  2TRC P;  1SKS B;  3ZLP A;  1GTI A;  4HUA A;  4OO5 A;  3EMX A;  2H1A A;  1DUG A;  2CQ9 A;  1OVN A;  5JCG A;  2GLR A;  4ISD A;  3GIX A;  2H0H A;  1SJ6 A;  1G6Y A;  4PUA A;  3IHQ A;  1ZL9 A;  1JFU A;  3QD9 A;  2I4A A;  5HFI A;  3VPT A;  4GXZ A;  2C0F A;  4WEY A;  1USB A;  4KA0 A;  2FWH A;  5G1L A;  3F9U A;  1TJD A;  4YQU A;  1M9B A;  2IIY A;  2REM A;  3EE2 A;  1GNE A;  4Z2R A;  1NW2 A;  2DBC A;  4GTU A;  4GDF A;  2GQK A;  13GS A;  1A2J A;  5IIZ A;  3I9V 2;  4I97 A;  2QA2 A;  2DJ0 A;  4MAB A;  5DCH A;  4FYU A;  3LYP A;  5JWR B;  3PH9 A;  4JE1 A;  2EFC A;  3F0I A;  4MMM A;  3QAW A;  1LJR A;  2B6M A;  2I81 A;  1V40 A;  3MSZ A;  3WGE A;  4BL7 B;  3HYP A;  1FG4 A;  1GUM A;  2PUK C;  3FR9 A;  4J2F A;  1TKD B;  3M1G A;  4EIQ A;  4N0Z A;  5G2Z A;  1K3L A;  1TOF A;  4L0W A;  3EC3 A;  1EP8 A;  3FZA A;  5IOW A;  4TRX A;  3RHB A;  1PX7 A;  1Z6N A;  2AHE A;  3GTU B;  3GMF A;  2PMT A;  2JAC A;  4I2T A;  3D22 A;  1EOG A;  5BMU B;  4BWS A;  2LV3 A;  2F8A A;  1Z5Y E;  1LBK A;  1K0C A;  3UEM A;  4ZL8 A;  17GS A;  1SVL A;  4IP6 A;  1M7T A;  1V98 A;  3KIJ A;  2CVK A;  4ZBB A;  1Y25 A;  1Q98 A;  4NHZ A;  3JCM L;  3FZ5 A;  2YCD A;  1WRY A;  4CW9 A;  4V2M A;  2FGX A;  2VCQ A;  3K8N A;  5AIV A;  4RQX A;  2OE0 A;  4KB3 A;  1N8J A;  3O76 A;  2ZUP A;  1EWX A;  1ILO A;  1X0R A;  1OYJ A;  3TRQ A;  4O32 A;  1SYR A;  3HJM A;  5G1K A;  4MJE A;  4TVE A;  4PQ1 A;  2X49 A;  2IFQ A;  3C1R A;  2LNT A;  3GKN A;  1TK8 B;  6GSS A;  5JWQ B;  4MPF A;  3CRU A;  1QQ2 A;  2VM2 A;  2EFE A;  3FR6 A;  2H19 A;  2V32 A;  2L5L A;  5LCZ A;  2IMI A;  3RPN A;  5DJM A;  2O5V A;  4MJA A;  2LRN A;  4QMK A;  3KCM A;  5JCU A;  4AGS A;  3EU3 A;  5AN1 A;  6GSX A;  4BA7 A;  1DSB A;  3HA9 A;  3DGQ A;  5EL8 A;  1TXX A;  2QGV A;  5IPG A;  2B5X A;  4LMV A;  5A4W A;  5HFG A;  1AC1 A;  3ERG A;  2L57 A;  4JZQ A;  1KEB A;  3BJ5 A;  3CSH A;  4IQA A;  2L6D A;  2VO4 A;  4EDZ A;  2XC2 A;  5IPH A;  1DE2 A;  2LJR A;  1ERW A;  3TKS C;  4IP1 A;  4F0C A;  2B5E A;  1A23 A;  2X8H A;  3IPZ A;  4QL7 A;  3TJB A;  5B6N A;  3L9S A;  5F07 A;  4OWY A;  3HMJ G;  4BWQ A;  3DRN A;  1GH2 A;  4XS1 A;  2JZT A;  3Q74 A;  1FO5 A;  3HCZ A;  1UC7 A;  2WFC A;  1TXU A;  3WT1 A;  1OKD A;  4AKH A;  22GS A;  1FB6 A;  2FA8 A;  2G0F A;  5D8I A;  3KMO A;  2C0G A;  1OC8 A;  2RUE A;  2XBI A;  2ZNM A;  1GUH A;  1FAA A;  3ZYW A;  4WBJ A;  20GS A;  2LS5 A;  1VF3 A;  2H6X A;  4FH8 A;  5ID2 B;  1SL2 B;  1AW9 A;  1A0F A;  2HSM B;  3ZIT A;  4KSM A;  2OJL A;  5AIS A;  6GST A;  5B8B A;  4FIW A;  5DAK A;  2KP2 A;  1LU4 A;  2GS3 A;  1HNA A;  3GRX A;  4EO3 A;  2AV4 A;  2LUS A;  1GRX A;  2X4A A;  1PKW A;  2VCT A;  2GQM A;  3IAM 2;  4KCA A;  5GSS A;  2NTO A;  2JZS A;  2R0C A;  4MP4 A;  2B7K A;  3W6G A;  1TRV A;  2A2S A;  1ERT A;  4ECB A;  9GSS A;  2FUG 2;  3TJJ A;  4ZBD A;  3PGT A;  2DJJ A;  1JZD A;  1WJK A;  1BED A;  4G19 A;  3GKX A;  4PXO A;  1R26 A;  2BMX A;  2VLV A;  4NV2 A;  3QCP A;  5FWG A;  4Q5Q A;  4PTS A;  2EIQ A;  4MZC A;  1XW6 A;  3G9B A;  4JRR A;  4JED A;  4KAE A;  2N5F A;  2HRN A;  3ED3 A;  5ECN B;  5KN1 A;  1QXH A;  2L59 A;  2VL2 A;  1R4W A;  1R7H A;  4K2X A;  1JLV A;  3GKK A;  5H5R A;  5F06 A;  3J7Y k;  4GQC A;  1HQO A;  1B4P A;  2H6Y A;  4XHM A;  1ZMA A;  4I8B A;  4ZB8 A;  3L9U A;  2WS2 A;  3GHA A;  2O7K A;  10GS A;  5A4U A;  4WXT A;  3ERF A;  1ZYP A;  1VF4 A;  1RW1 A;  5D9W A;  2FHE A;  3VWV A;  5IMV A;  4N30 A;  2YJH A;  5LD0 A;  4ECJ A;  3ME8 A;  1V57 A;  3G7Y A;  4XS4 A;  5A1N A;  3TKP A;  4FQU A;  5CNW A;  1GSU A;  4DSR A;  3APQ A;  2MMA A;  4F0B A;  2FLS A;  1S3A A;  1VF2 A;  3ZVJ A;  3NOF A;  2JL4 A;  4HDE A;  2IWT A;  1N25 A;  5J41 A;  1EEM A;  3DEX A;  2C80 A;  3C73 A;  2H1D A;  1VF1 A;  4HQS A;  4LMW A;  4MK3 A;  1T1V A;  2GZY A;  4NAX A;  1H4O A;  1TP9 A;  4O5R A;  3P90 A;  4AKG A;  1ZYQ B;  4WET A;  3RPP A;  4X43 A;  1A8Y A;  1YJ6 A;  4X4J A;  11GS A;  3IXR A;  3EYT A;  2K8S A;  2LQQ A;  3FRC A;  1O81 A;  4XIH A;  1XWG A;  4RI6 A;  2CV4 A;  3TDG A;  1M2B A;  3I69 A;  3CRT A;  3QFB C;  2KOK A;  4Q5N A;  5KEJ A;  1CQG A;  3H4K A;  4O92 A;  4OD7 A;  2DJ1 A;  1S3C A;  2B3S A;  2R37 A;  1F9M A;  3HVX A;  3GSS A;  3M3M A;  4YH2 A;  3TKS E;  2HSH A;  2YWN A;  1T4Z A;  5C00 A;  1S3D A;  3O3T A;  1A2M A;  1XOA A;  2MYG A;  2HT9 A;  4GSS A;  4IN0 A;  2H76 A;  14GS A;  3TJG A;  1I5G A;  4KGI A;  2WCI A;  2VD0 A;  1GTB A;  4OFN A;  3D0Z A;  5D73 A;  1GSY A;  3HVS A;  1FW1 A;  5A5H A;  5FHI A;  2H6Z A;  1GWC A;  2V41 A;  5IMC A;  5J4V A;  4V1A g;  2VCV A;  5HR1 A;  2YZU A;  4AJ6 A;  1PX6 A;  2VD1 A;  1G0T A;  4YQV A;  4O5U A;  1MDI A;  2CAQ A;  1RK4 A;  1B48 A;  3DXB A;  3CTG A;  2CAI A;  3TJF A;  4DSQ A;  1O8W A;  3C7M A;  1BX9 A;  1PN0 A;  5DDL A;  3M0F A;  4EIP A;  2P0G A;  1HYU A;  1SL0 B;  2HSY A;  3HJO A;  1PRX A;  3D4M A;  3KP9 A;  5ECM B;  4BVX A;  2XBQ A;  1KBN A;  5GAN D;  2QKE A;  1Z7P A;  2H01 A;  4WF5 A;  4E68 A;  4FO5 A;  2OBK A;  4JR4 A;  4HI7 A;  1PGT A;  4O7H A;  5GAP D;  2GTU A;  4FYC A;  1ACV A;  2OAC A;  4K5R A;  3ZZX A;  1XPV A;  1XZO A;  3QOU A;  2MBT A;  2EFD A;  5AGY A;  2VL9 A;  2L6C A;  2PWJ A;  1UN2 A;  3VI7 A;  1NHO A;  2P5Q A;  3ERW A;  4LL4 B;  4IJI A;  4EKZ A;  4EUY A;  5CRW A;  1PQN A;  3GL3 A;  2IFQ B;  5EPF A;  1J9B A;  2PVO C;  2TRX A;  4OMV A;  2R0P A;  2JSZ A;  5KOX A;  5GZZ B;  2HXK A;  4X0X A;  1SK1 A;  1E2Y A;  1XOB A;  3IC8 A;  3IE3 A;  1QGV A;  1XVQ A;  3W8S A;  4WR4 A;  2VCX A;  3LW9 A;  2MMZ A;  2H1L A;  1Q4J A;  1GP1 A;  3TUE A;  5ECS A;  1Y1U A;  3ZVJ D;  4GWR A;  3VK9 A;  3A3T A;  4L5O A;  2YOI A;  5ECQ B;  1TW9 A;  1WPI A;  2M80 A;  1K0M A;  3F3Q A;  3F4S A;  3WD6 A;  2H1B A;  5J4U A;  2IN3 A;  3EPT A;  5D93 A;  3HKR A;  1C72 A;  3KD0 A;  2HSN A;  1SYX A;  1A8L A;  4ML1 A;  3D21 A;  3HZ8 A;  3GUR A;  5IOX A;  3HXS A;  1BJX A;  4ML6 A;  5ECR B;  4ZXG A;  2KHP A;  1X9S B;  2VCW A;  2GST A;  3TB2 A;  5H5S A;  4F03 A;  1SK0 A;  3W8J A;  2GDR A;  3ZTL A;  2K18 A;  1MEK A;  1PN9 A;  1ZYE A;  1XXU A;  4CY8 A;  4L0U A;  5ECK B;  2DC5 A;  3P7X A;  3IV4 A;  1DBY A;  2K9F A;  4L8E A;  4ACS A;  1G7E A;  1O6J A;  3FYG A;  5DJL A;  5DAK B;  4G0I A;  1XW9 A;  1BF5 A;  1F3A A;  4TR3 A;  5J4Y A;  2DJ3 A;  1XWK A;  2EC4 A;  1GTA A;  3TKS A;  1F2E A;  3VFI A;  4I2U A;  4RUV A;  3UVH A;  3ZML A;  1YY7 A;  5A4V A;  4MNN A;  2AAW A;  3CTF A;  2H8L A;  4JBB A;  3FZ4 A;  2L4C A;  2XPE A;  1B8X A;  3FR3 A;  1W89 A;  3HY2 A;  2G2Q A;  4QQ7 A;  4K8M A;  19GS A;  3IDV A;  1YKA A;  5DVB A;  4BPY A;  3GST A;  3LWA A;  4G2E A;  1AQW A;  1AAZ A;  1GLQ A;  3UAR A;  2GT5 A;  4IW9 A;  4I6X A;  4EF0 A;  1ERV A;  2O85 A;  4G0K A;  5GST A;  2H66 A;  1A2L A;  1WE0 A;  4YKG A;  2JSY A;  2YNX A;  4EE0 A;  2FCH A;  2L4Q A;  1K0B A;  2R6K A;  3IRA A;  2B1K A;  1CQH A;  1QMV A;  2F9S A;  1W4V A;  3ISO A;  1GTU A;  3WT2 A;  4GQF A;  3Q6O A;  3LOR A;  2YWI A;  1RQM A;  3IR4 A;  3UIW A;  2YJ7 A;  1EV4 A;  1YVL A;  5DCG A;  1X9M B;  3E0U A;  4XS6 A;  4K6X A;  3ZL5 A;  4HS1 A;  2A4V A;  4XS4 B;  5ECI B;  5A1N B;  4PUF C;  4Z7X A;  1FOV A;  1T00 A;  1QUW A;  4MF5 A;  1T8E B;  2UZ8 A;  2HZE A;  5ABR A;  1GLP A;  3H93 A;  4J56 E;  2EIR A;  1BYE A;  1F6M C;  5E4W A;  2DIY A;  3A5W A;  4Z2U A;  4ZL9 A;  3EMP A;  2NPB A;  4PQI A;  4POL A;  1EZK A;  5KOW A;  6GSW A;  1R5A A;  4AF2 A;  1FB0 A;  3L4N A;  2CZ2 A;  1KTE A;  8GSS A;  2FD3 A;  4PUR A;  1VRS D;  1TU8 A;  4LL1 B;  5IMD A;  3IOS A;  4Q5F A;  3TRX A;  1Y6E A;  1YKC A;  4K1F A;  3TKR A;  2HYX A;  1GUL A;  1I9D A;  5F05 A;  3L9V A;  2IL3 A;  2PVQ A;  2X99 A;  5CRE A;  3MNG A;  2IJY A;  5IO2 A;  2C4J A;  3FZ9 A;  4EDY A;  3GN3 A;  2R3X A;  3V1W A;  5KN3 A;  1XFL A;  5B6M A;  4WKW A;  3QDN A;  3CSI A;  3DVW A;  2JU5 A;  1GNW A;  3ME7 A;  1SKW B;  4YQM A;  4JU5 A;  3KGK A;  2HRK A;  4D73 A;  2H30 A;  3NIV A;  2PN8 A;  1THX A;  3AY8 A;  3KTB A;  2PGT A;  4KND A;  3KP8 A;  1G7O A;  2B5Y A;  1ZGN A;  4K7O A;  4RI7 A;  4EC0 A;  5A5H B;  2A2R A;  1YF1 A;  5G31 A;  2X8G A;  5G30 A;  4AKI A;  1EGR A;  3UBL A;  2VM1 A;  6GSY A;  3VUR A;  2D2Z A;  1AUC A;  4L5L A;  3GX0 A;  1TI1 A;  1UA5 A;  1ZOF A;  2F3M A;  4N10 A;  4G0L A;  1WMJ A;  4BVY A;  1M2A A;  4AKX B;  1X5D A;  2PER A;  2EFH A;  4AI6 A;  3DKS A;  5DBQ A;  5HQP A;  5B7C A;  4HOJ A;  1J0F A;  2E7P A;  4CY6 A;  1T7P B;  4BVX B;  2M46 A;  3VWW A;  4FYB A;  1Z6M A;  2AYT A;  16GS A;  2H71 A;  1A24 A;  3LGC A;  3F6D A;  4ZB9 A;  1PA3 A;  3IK9 A;  2ZCT A;  1ML6 A;  4ICY A;  2AUV A;  4ILF A;  1FVK A;  3QMX A;  2WJU A;  5F8B A;  3FY7 A;  4AJ7 A;  1TI3 A;  2H0I A;  3D5J A;  2RLI A;  3GX8 A;  1EV9 A;  3MAK A;  2IPA A;  2B1L A;  2A2P A;  2GZP A;  2E2G A;  5EVO A;  3A2W A;  2MZC A;  3FW2 A;  3P2A A;  2YV7 A;  5IMZ A;  4MCU A;  4MZW A;  4TW5 A;  5FT3 A;  1YZX A;  4H86 A;  3ZFL A;  5DAL A;  3EVI A;  2N5A A;  4MA9 A;  1GSE A;  2VIM A;  2YWM A;  1MTC A;  3CMI A;  2DML A;  1U3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...