2HSNB

Structural basis of yeast aminoacyl-trna synthetase complex formation revealed by crystal structures of two binary sub-complexes
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
120
structure length
120
Chain Sequence
MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionyl-tRNA synthetase, cytoplasmic
publication title Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/rna binding protein
total genus 40
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hsnB00
5D9VA 3BBYA 3HKRA 5DJLA 4PQHA 3WYWA 1OE8A 4ECIA 4JZQA 4G9HA 3FYGA 2NTOA 3I6AA 3UVHA 2F8FA 4WR4A 5EVOA 2VD0A 4PXOA 1TDIA 4GF0A 2CZ3A 2VO4A 2HRKA 1G7OA 4E8HA 1M9BA 4IJIA 2HSNB 3CSHA 4ZBDA 5ECHB 3G7IA 5DAKB 3GUSA 1G6YA 3Q74A 1PL1A 4MZWA 1ZGNA 1BYEA 3FRCA 3ZFBA 1C72A 3DD3A 1U3IA 3F6FA 1GUHA 1PKZA 1HQOA 3EINA 1HNAA 1AQXA 2HNLA 5AGYA 1NHYA 2C3TA 3GTUB 2GSTA 1TU8A 1YQ1A 1EV4A 5F05A 1GSFA 2ON7A 3IBHA 2HRAA 3I69A 4YQVA 4HZ2A 3VI7A 1IYIA 4MDCA 4GTUA 5ECQB 8GSSA 3FR9A 4YAPA 5GSTA 4HZ4A 1YJ6A 5DCGA 3IC8A 1XWGA 5ECLB 3VK9A 4KDUA 1E6BA 3ERFA 1F2EA 1GUMA 3ERGA 1USBA 18GSA 5D9WA 2WJUA 22GSA 5F0GA 2GSSA 1K3OA 1HNBA 4OFNA 3IK9A 4HJ2A 5HFKA 4AGSA 5IQYA 5ECMB 2AHEA 5A5KA 5ECNB 2CAQA 4ZBBA 3GURA 4F0BA 5FWGA 3LXZA 2YCDA 3M1GA 4ECJA 4JBBA 1GNWA 1AXDA 3Q19A 3GSTA 4TOPA 4YQMA 3VPTA 2C8UA 2D2ZA 2FHEA 5F8BA 2OADA 5AISA 2J9HA 2X64A 4GLTA 3VLNA 2A2RA 7GSSA 3CRTA 1FHEA 3MAKA 4MF7A 1GLPA 4KX4A 4MF6A 4Q5QA 1GTIA 2R3XA 1Z9HA 1GSUA 4ID0A 4JEDA 5G5FA 4EDZA 3QAVA 1OE7A 1F3BA 2CA8A 2YV7A 4LMWA 5FHIA 1HNCA 1ML6A 4PNFA 4ISDA 3AY8A 2GSRA 2OACA 1GTAA 1GSYA 1K0OA 3N9JA 2IMIA 2F3MA 5D9TA 2WDUA 3MDKA 1MD3A 5GZZB 12GSA 4KDXA 4IW9A 4DEJA 1VF1A 2FNOA 2HQTA 4WR5A 4EDYA 1M9AA 3LQ7A 1M0UA 1KBNA 1PX7A 1Y6EA 4IELA 2R6KA 3W8SA 3FY7A 3DGQA 4PUAA 4GSSA 4J2FA 14GSA 1RK4A 2WS2A 4NHWA 4BVYB 4GCIA 3ISOA 4USSA 3KMNA 4OFMA 16GSA 5AIVA 4RI6A 2LJRA 3M8NA 3GX0A 5ECPB 1UA5A 1B4PA 2PVQA 3HJMA 2VCXA 4EXJA 4BVXA 2GDRA 3IR4A 5DQSA 3FR6A 1A0FA 1B48A 3VWXA 4HI7A 4PGTA 5LD0A 2PERA 5F07A 1K0MA 3KXOA 1EV9A 5ELGA 3VI5A 5GSSA 3D0ZA 3QAWA 1BG5A 1U87A 5AN1A 3NIVA 4YH2A 1PA3A 4PTSA 1PN9A 4YAVA 1JZRA 5EY6A 2N5FA 2WB9A 3F63A 3RBTA 3UAPA 4IVFA 5DALA 4BVYA 4O92A 1GSSA 6GSSA 2V6KA 3CSJA 5D73A 3TOUA 5J41A 1LJRA 3F6DA 1PMTA 1VF2A 1K0CA 5DDLA 2A2SA 4BL7B 1XW5A 2GLRA 3VURA 4ECBA 2HSMB 2YV9A 4G10A 1PKWA 1XWKA 3LXTA 3SWLA 4IQ1A 3UARA 5A4VA 2VCVA 1PGTA 2C4JA 3N5OA 1PD21 5B7CA 4L5OA 1MD4A 1M99A 4KDYA 2UZ8A 3P90A 3UBLA 3ZFLA 3GH6A 3IK7A 4ZBAA 1B8XA 1EOHA 4OFTA 5BMUA 4QQ7A 4MP4A 1AQVA 4ZB8A 3R2QA 4PQIA 1JLVA 4BL7A 3KM6A 2CZ2A 2HSMA 2C3QA 3P8WA 19GSA 1K0NA 4G0IA 1FW1A 3LJRA 1V40A 1TW9A 1GUKA 4PNGA 6GSXA 1K3YA 5JCUA 6GSTA 4EC0A 2C80A 3LSZA 1XW6A 2ON5A 5KEJA 2VD1A 4BVXB 1VF3A 2GSQA 2R4VA 4PURA 6GSVA 5ECSA 1K0AA 2IMKA 5F06A 4F03A 4G0KA 1GTUA 2DSAA 1YDKA 3ZMKA 1G6WA 3LYKA 3R3EA 5DJMA 2WRTA 5LCZA 1F3AA 20GSA 1ZL9A 5DALB 5J5NA 3WD6A 3KJYA 2C3NA 4IGJA 1OYJA 3CRUA 3QAGA 4MPGA 4OMVA 4IS0A 4E8EA 1GTBA 4KAEA 4LMVA 5JCWA 4KGIA 1BAYA 5G5EA 2AAWA 4N0VA 3U6VA 4F0CA 1GWCA 1VF4A 1GSEA 4PX1A 1EEMA 1JLWA 4RI7A 1LBKA 3M3MA 17GSA 2OA7A 1GULA 2VCQA 4GSNA 1IYHA 3LFLA 5A4UA 3QR6A 4ECCA 10GSA 2IL3A 5ECIB 4KF9A 4ACSA 3Q18A 1PL2A 4KE3A 4L8EA 5ECKB 5ECOB 2PBJA 2VCZA 4I97A 5FT3A 2AB6A 3O3TA 1AW9A 4L5LA 3HJOA 2R5GA 3KMOA 4EE0A 1YY7A 3EE2A 4Q5NA 1OKTA 1GNEA 3ZMLA 3G7JA 1DUGA 4KSMA 4Q5FA 5DAKA 11GSA 1YKCA 5AIXA 4GSTA 6GSYA 3VPQA 2CAIA 2VCTA 2CVDA 4IQAA 5D9XA 4ZB9A 2JL4A 1GSDA 1GLQA 3M0FA 3GSSA 2GTUA 4G0LA 3TGZA 6GSUA 3CBUA 3IE3A 3LYPA 3GTUA 1AQWA 1GSQA 3CSIA 3TOTA 3KTLA 3O76A 3L0HA 9GSSA 5ELAA 3PGTA 1TU7A 4MK3A 3H1NA 4NHZA 1K3LA 1K0BA 5J4UA 4FQUA 6GSWA 2PGTA 4G19A 2VCWA 5EL8A 4YQUA 1MTCA 3PPUA 1Q4JA 1V2AA 1U88A 2DC5A 4ZXGA 1R5AA 3LG6A 2PMTA 4ZB6A 4IKHA 4MF5A 1K0DA 4IBPA 5A4WA 4MPFA 5ECRB 2HRKB 4K0GA 4O7HA 1EOGA 1BX9A 3UBKA 1N2AA 13GSA 4K0NA 1PX6A 3PR8A 4HOJA 4Q5RA 4CHSA 3FR3A 4KH7A 4NAXA 3C8EA
chains in the Genus database with same CATH superfamily
5D9VA 3BBYA 3HKRA 5DJLA 4PQHA 3WYWA 1OE8A 4ECIA 4JZQA 4G9HA 3FYGA 2NTOA 3I6AA 3UVHA 2F8FA 4WR4A 5EVOA 2VD0A 4PXOA 1TDIA 4GF0A 2CZ3A 2VO4A 4PI0C 2HRKA 1G7OA 4E8HA 1M9BA 4IJIA 2HSNB 3CSHA 4ZBDA 5ECHB 3G7IA 5DAKB 3GUSA 1G6YA 1I1IP 3Q74A 1PL1A 4MZWA 4N3ZA 1ZGNA 1BYEA 3FRCA 3ZFBA 1C72A 3DD3A 1U3IA 3F6FA 1GUHA 1PKZA 1YVLA 1HQOA 3EINA 4G01A 1HNAA 1AQXA 2HNLA 5AGYA 1NHYA 2C3TA 3GTUB 2GSTA 1TU8A 1YQ1A 1EV4A 5F05A 1GSFA 2ON7A 3IBHA 2EFCA 2HRAA 2H1LA 3I69A 4YQVA 4HZ2A 3VI7A 4GDFA 1IYIA 4MDCA 4GTUA 5ECQB 8GSSA 3FR9A 4YAPA 5GSTA 2EFEA 4HZ4A 1YJ6A 4W66A 5DCGA 1BF5A 3IC8A 1XWGA 5ECLB 3VK9A 4KDUA 1E6BA 3ERFA 1F2EA 1GUMA 3ERGA 1USBA 18GSA 4PHZC 2WJUA 5D9WA 22GSA 5F0GA 2GSSA 1K3OA 1HNBA 4OFNA 3IK9A 4HJ2A 5HFKA 5A34B 4AGSA 5IQYA 5ECMB 2AHEA 5A5KA 5ECNB 2CAQA 1N25A 3GURA 4ZBBA 4F0BA 5FWGA 3LXZA 2YCDA 3M1GA 4ECJA 4JBBA 1GNWA 1AXDA 3Q19A 3GSTA 4TOPA 4YQMA 3VPTA 2C8UA 2D2ZA 2UV8G 2FHEA 5F8BA 2OADA 5AISA 2J9HA 2X64A 4GLTA 3VLNA 2A2RA 7GSSA 3CRTA 1FHEA 3MAKA 4ZB7A 4FXYP 4MF7A 1GLPA 4KX4A 4MF6A 4Q5QA 1GTIA 2R3XA 2WZSA 1Z9HA 1GSUA 4ID0A 4JEDA 5G5FA 4EDZA 3QAVA 1OE7A 1F3BA 2CA8A 2YV7A 4LMWA 5FHIA 1HNCA 1ML6A 4PNFA 4ISDA 3AY8A 2GSRA 2OACA 1GTAA 1GSYA 1K0OA 2WW3A 3N9JA 2IMIA 2F3MA 5D9TA 2WDUA 3MDKA 1MD3A 5GZZB 12GSA 4KDXA 4IW9A 4DEJA 1VF1A 5A1NA 2FNOA 2HQTA 4WR5A 4EDYA 1M9AA 3LQ7A 1M0UA 1KBNA 1PX7A 1Y6EA 4IELA 2R6KA 3W8SA 3FY7A 2WW0A 3DGQA 4PUAA 4GSSA 4J2FA 2O36A 14GSA 1RK4A 2WS2A 4NHWA 4BVYB 4GCIA 3ISOA 4USSA 3KMNA 4OFMA 16GSA 5AIVA 4RI6A 2LJRA 3M8NA 3GX0A 2EFHA 5ECPB 1UA5A 1B4PA 2PVQA 3HJMA 2VCXA 4EXJA 2O5VA 4BVXA 2GDRA 3IR4A 5DQSA 3FR6A 1A0FA 1B48A 3VWXA 4HI7A 4PGTA 5LD0A 2PERA 5F07A 1K0MA 3KXOA 1SVLA 1EV9A 5ELGA 3VI5A 5GSSA 3D0ZA 3QAWA 1BG5A 4AKXB 1U87A 5AN1A 3NIVA 4YH2A 1PA3A 4PTSA 1PN9A 4YAVA 1JZRA 5EY6A 2N5FA 2WB9A 3F63A 3RBTA 3UAPA 4IVFA 5DALA 4BVYA 1BG1A 4O92A 1GSSA 6GSSA 2V6KA 3CSJA 5D73A 3TOUA 5J41A 3RGBC 5A5HA 1LJRA 3F6DA 1PMTA 1VF2A 1K0CA 5DDLA 2A2SA 2VKZG 5J40A 4BL7B 1XW5A 2GLRA 3VURA 4ECBA 2HSMB 2YV9A 4G10A 3CHXC 2WVXA 3HMJG 1PKWA 1XWKA 3LXTA 3SWLA 4IQ1A 3UARA 5A4VA 2VCVA 1PGTA 2C4JA 3N5OA 1PD21 3TU3B 5B7CA 4L5OA 1MD4A 1M99A 4KDYA 2UZ8A 3P90A 3UBLA 3ZFLA 3GH6A 3IK7A 4ZBAA 1B8XA 1EOHA 5A1NB 4OFTA 5BMUA 4QQ7A 4MP4A 1AQVA 4ZB8A 4E68A 3R2QA 4PQIA 1JLVA 4BL7A 3KM6A 2CZ2A 4AKIA 2HSMA 5J47A 2C3QA 3P8WA 19GSA 1K0NA 4G0IA 1FW1A 3LJRA 1V40A 1TW9A 1GUKA 4PNGA 6GSXA 5J4VA 1K3YA 5JCUA 6GSTA 4EC0A 2C80A 2WW1A 3LSZA 1XW6A 2ON5A 5KEJA 2VD1A 4BVXB 1VF3A 2GSQA 2R4VA 4PURA 6GSVA 5ECSA 1K0AA 2IMKA 5F06A 4F03A 4G0KA 1Y1UA 1GTUA 2WVZA 2DSAA 1YDKA 3ZMKA 1G6WA 3LYKA 3R3EA 5DJMA 2WRTA 5LCZA 1F3AA 20GSA 1ZL9A 5DALB 5J5NA 3WD6A 3KJYA 2C3NA 4IGJA 5A5HB 1OYJA 3CRUA 3QAGA 4MPGA 4OMVA 4IS0A 4E8EA 1GTBA 4KAEA 4LMVA 5JCWA 4KGIA 1BAYA 5G5EA 2AAWA 4N0VA 1TXUA 3U6VA 4F0CA 1GWCA 1VF4A 1GSEA 4PX1A 1EEMA 2WVXB 1JLWA 4RI7A 1LBKA 3M3MA 17GSA 1S4BP 2OA7A 1GULA 2VCQA 4AKHA 4GSNA 1IYHA 3LFLA 5A4UA 3QR6A 2WW2A 4ECCA 4AKGA 10GSA 2IL3A 5ECIB 4KF9A 4ACSA 4PI2C 3RFRC 2WVYA 3Q18A 1PL2A 2EFDA 4KE3A 4L8EA 5ECKB 5ECOB 2PBJA 2VCZA 4I97A 5FT3A 2AB6A 3O3TA 1AW9A 4L5LA 3HJOA 5BMUB 1SVOA 2R5GA 3KMOA 4EE0A 1YY7A 3EE2A 4Q5NA 1OKTA 1GNEA 2HSNA 3ZMLA 3G7JA 1DUGA 2OT3A 4KSMA 4Q5FA 5DAKA 11GSA 1YKCA 5AIXA 4GSTA 6GSYA 3VPQA 2CAIA 2VCTA 2CVDA 4IQAA 5D9XA 4ZB9A 2JL4A 1GSDA 1GLQA 2O3EA 3M0FA 3GSSA 2GTUA 4G0LA 3TGZA 6GSUA 3CBUA 3IE3A 3LYPA 3GTUA 1AQWA 1GSQA 3CSIA 3TOTA 3KTLA 3O76A 3L0HA 9GSSA 5ELAA 1SVMA 1TU7A 3PGTA 4MK3A 3H1NA 4NHZA 1K3LA 1K0BA 5J4YA 5J4UA 4FQUA 6GSWA 2PGTA 4G19A 2VCWA 5EL8A 4YQUA 1MTCA 3PPUA 1Q4JA 1V2AA 1U88A 2DC5A 4ZXGA 1R5AA 3LG6A 2PMTA 4ZB6A 4IKHA 4MF5A 1K0DA 4IBPA 1YEWC 5A4WA 4MPFA 5ECRB 2HRKB 3CWGA 4K0GA 4O7HA 1EOGA 4QMKA 1BX9A 3UBKA 1N2AA 13GSA 4K0NA 1PX6A 5A34A 3PR8A 4AI6A 4HOJA 4Q5RA 4CHSA 3FR3A 4KH7A 4NAXA 3C8EA
chains in the Genus database with same CATH topology
5D9VA 3BBYA 3HKRA 5DJLA 4PQHA 3WYWA 1OE8A 4ECIA 4JZQA 4G9HA 3FYGA 2NTOA 3I6AA 3UVHA 2F8FA 4WR4A 5EVOA 2VD0A 4PXOA 1TDIA 4GF0A 2CZ3A 2VO4A 2HRKA 1G7OA 4E8HA 1M9BA 4IJIA 2HSNB 3CSHA 4ZBDA 5ECHB 3G7IA 5DAKB 3GUSA 1G6YA 3Q74A 4N3ZA 1PL1A 4MZWA 1ZGNA 1BYEA 3FRCA 3ZFBA 1C72A 3DD3A 1U3IA 3F6FA 1GUHA 1PKZA 1YVLA 1HQOA 3EINA 4G01A 1HNAA 1AQXA 2HNLA 5AGYA 1NHYA 2C3TA 3GTUB 2GSTA 1TU8A 1YQ1A 1EV4A 5F05A 1GSFA 2ON7A 3IBHA 2EFCA 2HRAA 2H1LA 3I69A 4YQVA 4HZ2A 3VI7A 4GDFA 1IYIA 4MDCA 4GTUA 5ECQB 8GSSA 3FR9A 4YAPA 5GSTA 2EFEA 4HZ4A 1YJ6A 4W66A 5DCGA 1BF5A 3IC8A 1XWGA 5ECLB 3VK9A 4KDUA 1E6BA 3ERFA 1F2EA 1GUMA 3ERGA 1USBA 18GSA 5D9WA 2WJUA 22GSA 5F0GA 2GSSA 1K3OA 1HNBA 4OFNA 3IK9A 4HJ2A 5HFKA 5A34B 4AGSA 5IQYA 5ECMB 2AHEA 5A5KA 5ECNB 2CAQA 1N25A 3GURA 4ZBBA 4F0BA 5FWGA 3LXZA 2YCDA 3M1GA 4ECJA 4JBBA 1GNWA 1AXDA 3Q19A 3GSTA 4TOPA 4YQMA 3VPTA 2C8UA 2D2ZA 2UV8G 2FHEA 5F8BA 2OADA 5AISA 2J9HA 2X64A 4GLTA 3VLNA 2A2RA 7GSSA 3CRTA 1FHEA 3MAKA 4ZB7A 4MF7A 1GLPA 4KX4A 4MF6A 4Q5QA 1GTIA 2R3XA 1Z9HA 1GSUA 4ID0A 4JEDA 5G5FA 4EDZA 3QAVA 1OE7A 1F3BA 2CA8A 2YV7A 4LMWA 5FHIA 1HNCA 1ML6A 4PNFA 4ISDA 3AY8A 2GSRA 2OACA 1GTAA 1GSYA 1K0OA 3N9JA 2IMIA 2F3MA 5D9TA 2WDUA 3MDKA 1MD3A 5GZZB 12GSA 4KDXA 4IW9A 4DEJA 1VF1A 5A1NA 2FNOA 2HQTA 4WR5A 4EDYA 1M9AA 3LQ7A 1M0UA 1KBNA 1PX7A 1Y6EA 4IELA 2R6KA 3W8SA 3FY7A 3DGQA 4PUAA 4GSSA 4J2FA 14GSA 1RK4A 2WS2A 4NHWA 4BVYB 4GCIA 3ISOA 4USSA 3KMNA 4OFMA 16GSA 5AIVA 4RI6A 2LJRA 3M8NA 3GX0A 2EFHA 5ECPB 1UA5A 1B4PA 2PVQA 3HJMA 2VCXA 4EXJA 2O5VA 4BVXA 2GDRA 3IR4A 5DQSA 3FR6A 1A0FA 1B48A 3VWXA 4HI7A 4PGTA 5LD0A 2PERA 5F07A 1K0MA 3KXOA 1SVLA 1EV9A 5ELGA 3VI5A 5GSSA 3D0ZA 3QAWA 1BG5A 4AKXB 1U87A 5AN1A 3NIVA 4YH2A 1PA3A 4PTSA 1PN9A 4YAVA 1JZRA 5EY6A 2N5FA 2WB9A 3F63A 3RBTA 3UAPA 4IVFA 5DALA 4BVYA 1BG1A 4O92A 1GSSA 6GSSA 2V6KA 3CSJA 5D73A 3TOUA 5J41A 5A5HA 1LJRA 3F6DA 1PMTA 1VF2A 1K0CA 5DDLA 2A2SA 2VKZG 5J40A 4BL7B 1XW5A 2GLRA 3VURA 4ECBA 2HSMB 2YV9A 4G10A 3HMJG 1PKWA 1XWKA 3LXTA 3SWLA 4IQ1A 3UARA 5A4VA 2VCVA 1PGTA 2C4JA 3N5OA 1PD21 3TU3B 5B7CA 4L5OA 1MD4A 1M99A 4KDYA 2UZ8A 3P90A 3UBLA 3ZFLA 3GH6A 3IK7A 4ZBAA 1B8XA 1EOHA 5A1NB 4OFTA 5BMUA 4QQ7A 4MP4A 1AQVA 4ZB8A 4E68A 3R2QA 4PQIA 1JLVA 4BL7A 3KM6A 2CZ2A 4AKIA 2HSMA 5J47A 2C3QA 3P8WA 19GSA 1K0NA 4G0IA 1FW1A 3LJRA 1V40A 1TW9A 1GUKA 4PNGA 6GSXA 5J4VA 1K3YA 5JCUA 6GSTA 4EC0A 2C80A 3LSZA 1XW6A 2ON5A 5KEJA 2VD1A 4BVXB 1VF3A 2GSQA 2R4VA 4PURA 6GSVA 5ECSA 1K0AA 2IMKA 5F06A 4F03A 4G0KA 1Y1UA 1GTUA 2DSAA 1YDKA 3ZMKA 1G6WA 3LYKA 3R3EA 5DJMA 2WRTA 5LCZA 1F3AA 20GSA 1ZL9A 5DALB 5J5NA 3WD6A 3KJYA 2C3NA 4IGJA 5A5HB 1OYJA 3CRUA 3QAGA 4MPGA 4OMVA 4IS0A 4E8EA 1GTBA 4KAEA 4LMVA 5JCWA 4KGIA 1BAYA 5G5EA 2AAWA 4N0VA 1TXUA 3U6VA 4F0CA 1GWCA 1VF4A 1GSEA 4PX1A 1EEMA 1JLWA 4RI7A 1LBKA 3M3MA 17GSA 2OA7A 1GULA 2VCQA 4AKHA 4GSNA 1IYHA 3LFLA 5A4UA 3QR6A 4ECCA 4AKGA 10GSA 2IL3A 5ECIB 4KF9A 4ACSA 3Q18A 1PL2A 2EFDA 4KE3A 4L8EA 5ECKB 5ECOB 2PBJA 2VCZA 4I97A 5FT3A 2AB6A 3O3TA 1AW9A 4L5LA 3HJOA 5BMUB 1SVOA 2R5GA 3KMOA 4EE0A 1YY7A 3EE2A 4Q5NA 1OKTA 1GNEA 2HSNA 3ZMLA 3G7JA 1DUGA 2OT3A 4KSMA 4Q5FA 5DAKA 11GSA 1YKCA 5AIXA 4GSTA 6GSYA 3VPQA 2CAIA 2VCTA 2CVDA 4IQAA 5D9XA 4ZB9A 2JL4A 1GSDA 1GLQA 3M0FA 3GSSA 2GTUA 4G0LA 3TGZA 6GSUA 3CBUA 3IE3A 3LYPA 3GTUA 1AQWA 1GSQA 3CSIA 3TOTA 3KTLA 3O76A 3L0HA 9GSSA 5ELAA 1SVMA 1TU7A 3PGTA 4MK3A 3H1NA 4NHZA 1K3LA 1K0BA 5J4YA 5J4UA 4FQUA 6GSWA 2PGTA 4G19A 2VCWA 5EL8A 4YQUA 1MTCA 3PPUA 1Q4JA 1V2AA 1U88A 2DC5A 4ZXGA 1R5AA 3LG6A 2PMTA 4ZB6A 4IKHA 4MF5A 1K0DA 4IBPA 5A4WA 4MPFA 5ECRB 2HRKB 3CWGA 4K0GA 4O7HA 1EOGA 4QMKA 1BX9A 3UBKA 1N2AA 13GSA 4K0NA 1PX6A 5A34A 3PR8A 4AI6A 4HOJA 4Q5RA 4CHSA 3FR3A 4KH7A 4NAXA 3C8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D9V A;  3BBY A;  3HKR A;  5DJL A;  4PQH A;  3WYW A;  1OE8 A;  4ECI A;  4JZQ A;  4G9H A;  3FYG A;  2NTO A;  3I6A A;  3UVH A;  2F8F A;  4WR4 A;  5EVO A;  2VD0 A;  4PXO A;  1TDI A;  4GF0 A;  2CZ3 A;  2VO4 A;  2HRK A;  1G7O A;  4E8H A;  1M9B A;  4IJI A;  2HSN B;  3CSH A;  4ZBD A;  5ECH B;  3G7I A;  5DAK B;  3GUS A;  1G6Y A;  3Q74 A;  1PL1 A;  4MZW A;  1ZGN A;  1BYE A;  3FRC A;  3ZFB A;  1C72 A;  3DD3 A;  1U3I A;  3F6F A;  1GUH A;  1PKZ A;  1HQO A;  3EIN A;  1HNA A;  1AQX A;  2HNL A;  5AGY A;  1NHY A;  2C3T A;  3GTU B;  2GST A;  1TU8 A;  1YQ1 A;  1EV4 A;  5F05 A;  1GSF A;  2ON7 A;  3IBH A;  2HRA A;  3I69 A;  4YQV A;  4HZ2 A;  3VI7 A;  1IYI A;  4MDC A;  4GTU A;  5ECQ B;  8GSS A;  3FR9 A;  4YAP A;  5GST A;  4HZ4 A;  1YJ6 A;  5DCG A;  3IC8 A;  1XWG A;  5ECL B;  3VK9 A;  4KDU A;  1E6B A;  3ERF A;  1F2E A;  1GUM A;  3ERG A;  1USB A;  18GS A;  5D9W A;  2WJU A;  22GS A;  5F0G A;  2GSS A;  1K3O A;  1HNB A;  4OFN A;  3IK9 A;  4HJ2 A;  5HFK A;  4AGS A;  5IQY A;  5ECM B;  2AHE A;  5A5K A;  5ECN B;  2CAQ A;  4ZBB A;  3GUR A;  4F0B A;  5FWG A;  3LXZ A;  2YCD A;  3M1G A;  4ECJ A;  4JBB A;  1GNW A;  1AXD A;  3Q19 A;  3GST A;  4TOP A;  4YQM A;  3VPT A;  2C8U A;  2D2Z A;  2FHE A;  5F8B A;  2OAD A;  5AIS A;  2J9H A;  2X64 A;  4GLT A;  3VLN A;  2A2R A;  7GSS A;  3CRT A;  1FHE A;  3MAK A;  4MF7 A;  1GLP A;  4KX4 A;  4MF6 A;  4Q5Q A;  1GTI A;  2R3X A;  1Z9H A;  1GSU A;  4ID0 A;  4JED A;  5G5F A;  4EDZ A;  3QAV A;  1OE7 A;  1F3B A;  2CA8 A;  2YV7 A;  4LMW A;  5FHI A;  1HNC A;  1ML6 A;  4PNF A;  4ISD A;  3AY8 A;  2GSR A;  2OAC A;  1GTA A;  1GSY A;  1K0O A;  3N9J A;  2IMI A;  2F3M A;  5D9T A;  2WDU A;  3MDK A;  1MD3 A;  5GZZ B;  12GS A;  4KDX A;  4IW9 A;  4DEJ A;  1VF1 A;  2FNO A;  2HQT A;  4WR5 A;  4EDY A;  1M9A A;  3LQ7 A;  1M0U A;  1KBN A;  1PX7 A;  1Y6E A;  4IEL A;  2R6K A;  3W8S A;  3FY7 A;  3DGQ A;  4PUA A;  4GSS A;  4J2F A;  14GS A;  1RK4 A;  2WS2 A;  4NHW A;  4BVY B;  4GCI A;  3ISO A;  4USS A;  3KMN A;  4OFM A;  16GS A;  5AIV A;  4RI6 A;  2LJR A;  3M8N A;  3GX0 A;  5ECP B;  1UA5 A;  1B4P A;  2PVQ A;  3HJM A;  2VCX A;  4EXJ A;  4BVX A;  2GDR A;  3IR4 A;  5DQS A;  3FR6 A;  1A0F A;  1B48 A;  3VWX A;  4HI7 A;  4PGT A;  5LD0 A;  2PER A;  5F07 A;  1K0M A;  3KXO A;  1EV9 A;  5ELG A;  3VI5 A;  5GSS A;  3D0Z A;  3QAW A;  1BG5 A;  1U87 A;  5AN1 A;  3NIV A;  4YH2 A;  1PA3 A;  4PTS A;  1PN9 A;  4YAV A;  1JZR A;  5EY6 A;  2N5F A;  2WB9 A;  3F63 A;  3RBT A;  3UAP A;  4IVF A;  5DAL A;  4BVY A;  4O92 A;  1GSS A;  6GSS A;  2V6K A;  3CSJ A;  5D73 A;  3TOU A;  5J41 A;  1LJR A;  3F6D A;  1PMT A;  1VF2 A;  1K0C A;  5DDL A;  2A2S A;  4BL7 B;  1XW5 A;  2GLR A;  3VUR A;  4ECB A;  2HSM B;  2YV9 A;  4G10 A;  1PKW A;  1XWK A;  3LXT A;  3SWL A;  4IQ1 A;  3UAR A;  5A4V A;  2VCV A;  1PGT A;  2C4J A;  3N5O A;  1PD2 1;  5B7C A;  4L5O A;  1MD4 A;  1M99 A;  4KDY A;  2UZ8 A;  3P90 A;  3UBL A;  3ZFL A;  3GH6 A;  3IK7 A;  4ZBA A;  1B8X A;  1EOH A;  4OFT A;  5BMU A;  4QQ7 A;  4MP4 A;  1AQV A;  4ZB8 A;  3R2Q A;  4PQI A;  1JLV A;  4BL7 A;  3KM6 A;  2CZ2 A;  2HSM A;  2C3Q A;  3P8W A;  19GS A;  1K0N A;  4G0I A;  1FW1 A;  3LJR A;  1V40 A;  1TW9 A;  1GUK A;  4PNG A;  6GSX A;  1K3Y A;  5JCU A;  6GST A;  4EC0 A;  2C80 A;  3LSZ A;  1XW6 A;  2ON5 A;  5KEJ A;  2VD1 A;  4BVX B;  1VF3 A;  2GSQ A;  2R4V A;  4PUR A;  6GSV A;  5ECS A;  1K0A A;  2IMK A;  5F06 A;  4F03 A;  4G0K A;  1GTU A;  2DSA A;  1YDK A;  3ZMK A;  1G6W A;  3LYK A;  3R3E A;  5DJM A;  2WRT A;  5LCZ A;  1F3A A;  20GS A;  1ZL9 A;  5DAL B;  5J5N A;  3WD6 A;  3KJY A;  2C3N A;  4IGJ A;  1OYJ A;  3CRU A;  3QAG A;  4MPG A;  4OMV A;  4IS0 A;  4E8E A;  1GTB A;  4KAE A;  4LMV A;  5JCW A;  4KGI A;  1BAY A;  5G5E A;  2AAW A;  4N0V A;  3U6V A;  4F0C A;  1GWC A;  1VF4 A;  1GSE A;  4PX1 A;  1EEM A;  1JLW A;  4RI7 A;  1LBK A;  3M3M A;  17GS A;  2OA7 A;  1GUL A;  2VCQ A;  4GSN A;  1IYH A;  3LFL A;  5A4U A;  3QR6 A;  4ECC A;  10GS A;  2IL3 A;  5ECI B;  4KF9 A;  4ACS A;  3Q18 A;  1PL2 A;  4KE3 A;  4L8E A;  5ECK B;  5ECO B;  2PBJ A;  2VCZ A;  4I97 A;  5FT3 A;  2AB6 A;  3O3T A;  1AW9 A;  4L5L A;  3HJO A;  2R5G A;  3KMO A;  4EE0 A;  1YY7 A;  3EE2 A;  4Q5N A;  1OKT A;  1GNE A;  3ZML A;  3G7J A;  1DUG A;  4KSM A;  4Q5F A;  5DAK A;  11GS A;  1YKC A;  5AIX A;  4GST A;  6GSY A;  3VPQ A;  2CAI A;  2VCT A;  2CVD A;  4IQA A;  5D9X A;  4ZB9 A;  2JL4 A;  1GSD A;  1GLQ A;  3M0F A;  3GSS A;  2GTU A;  4G0L A;  3TGZ A;  6GSU A;  3CBU A;  3IE3 A;  3LYP A;  3GTU A;  1AQW A;  1GSQ A;  3CSI A;  3TOT A;  3KTL A;  3O76 A;  3L0H A;  9GSS A;  5ELA A;  3PGT A;  1TU7 A;  4MK3 A;  3H1N A;  4NHZ A;  1K3L A;  1K0B A;  5J4U A;  4FQU A;  6GSW A;  2PGT A;  4G19 A;  2VCW A;  5EL8 A;  4YQU A;  1MTC A;  3PPU A;  1Q4J A;  1V2A A;  1U88 A;  2DC5 A;  4ZXG A;  1R5A A;  3LG6 A;  2PMT A;  4ZB6 A;  4IKH A;  4MF5 A;  1K0D A;  4IBP A;  5A4W A;  4MPF A;  5ECR B;  2HRK B;  4K0G A;  4O7H A;  1EOG A;  1BX9 A;  3UBK A;  1N2A A;  13GS A;  4K0N A;  1PX6 A;  3PR8 A;  4HOJ A;  4Q5R A;  4CHS A;  3FR3 A;  4KH7 A;  4NAX A;  3C8E A; 
#chains in the Genus database with same CATH topology
 5D9V A;  3BBY A;  3HKR A;  5DJL A;  4PQH A;  3WYW A;  1OE8 A;  4ECI A;  4JZQ A;  4G9H A;  3FYG A;  2NTO A;  3I6A A;  3UVH A;  2F8F A;  4WR4 A;  5EVO A;  2VD0 A;  4PXO A;  1TDI A;  4GF0 A;  2CZ3 A;  2VO4 A;  4PI0 C;  2HRK A;  1G7O A;  4E8H A;  1M9B A;  4IJI A;  2HSN B;  3CSH A;  4ZBD A;  5ECH B;  3G7I A;  5DAK B;  3GUS A;  1G6Y A;  1I1I P;  3Q74 A;  1PL1 A;  4MZW A;  4N3Z A;  1ZGN A;  1BYE A;  3FRC A;  3ZFB A;  1C72 A;  3DD3 A;  1U3I A;  3F6F A;  1GUH A;  1PKZ A;  1YVL A;  1HQO A;  3EIN A;  4G01 A;  1HNA A;  1AQX A;  2HNL A;  5AGY A;  1NHY A;  2C3T A;  3GTU B;  2GST A;  1TU8 A;  1YQ1 A;  1EV4 A;  5F05 A;  1GSF A;  2ON7 A;  3IBH A;  2EFC A;  2HRA A;  2H1L A;  3I69 A;  4YQV A;  4HZ2 A;  3VI7 A;  4GDF A;  1IYI A;  4MDC A;  4GTU A;  5ECQ B;  8GSS A;  3FR9 A;  4YAP A;  5GST A;  2EFE A;  4HZ4 A;  1YJ6 A;  4W66 A;  5DCG A;  1BF5 A;  3IC8 A;  1XWG A;  5ECL B;  3VK9 A;  4KDU A;  1E6B A;  3ERF A;  1F2E A;  1GUM A;  3ERG A;  1USB A;  18GS A;  4PHZ C;  2WJU A;  5D9W A;  22GS A;  5F0G A;  2GSS A;  1K3O A;  1HNB A;  4OFN A;  3IK9 A;  4HJ2 A;  5HFK A;  5A34 B;  4AGS A;  5IQY A;  5ECM B;  2AHE A;  5A5K A;  5ECN B;  2CAQ A;  1N25 A;  3GUR A;  4ZBB A;  4F0B A;  5FWG A;  3LXZ A;  2YCD A;  3M1G A;  4ECJ A;  4JBB A;  1GNW A;  1AXD A;  3Q19 A;  3GST A;  4TOP A;  4YQM A;  3VPT A;  2C8U A;  2D2Z A;  2UV8 G;  2FHE A;  5F8B A;  2OAD A;  5AIS A;  2J9H A;  2X64 A;  4GLT A;  3VLN A;  2A2R A;  7GSS A;  3CRT A;  1FHE A;  3MAK A;  4ZB7 A;  4FXY P;  4MF7 A;  1GLP A;  4KX4 A;  4MF6 A;  4Q5Q A;  1GTI A;  2R3X A;  2WZS A;  1Z9H A;  1GSU A;  4ID0 A;  4JED A;  5G5F A;  4EDZ A;  3QAV A;  1OE7 A;  1F3B A;  2CA8 A;  2YV7 A;  4LMW A;  5FHI A;  1HNC A;  1ML6 A;  4PNF A;  4ISD A;  3AY8 A;  2GSR A;  2OAC A;  1GTA A;  1GSY A;  1K0O A;  2WW3 A;  3N9J A;  2IMI A;  2F3M A;  5D9T A;  2WDU A;  3MDK A;  1MD3 A;  5GZZ B;  12GS A;  4KDX A;  4IW9 A;  4DEJ A;  1VF1 A;  5A1N A;  2FNO A;  2HQT A;  4WR5 A;  4EDY A;  1M9A A;  3LQ7 A;  1M0U A;  1KBN A;  1PX7 A;  1Y6E A;  4IEL A;  2R6K A;  3W8S A;  3FY7 A;  2WW0 A;  3DGQ A;  4PUA A;  4GSS A;  4J2F A;  2O36 A;  14GS A;  1RK4 A;  2WS2 A;  4NHW A;  4BVY B;  4GCI A;  3ISO A;  4USS A;  3KMN A;  4OFM A;  16GS A;  5AIV A;  4RI6 A;  2LJR A;  3M8N A;  3GX0 A;  2EFH A;  5ECP B;  1UA5 A;  1B4P A;  2PVQ A;  3HJM A;  2VCX A;  4EXJ A;  2O5V A;  4BVX A;  2GDR A;  3IR4 A;  5DQS A;  3FR6 A;  1A0F A;  1B48 A;  3VWX A;  4HI7 A;  4PGT A;  5LD0 A;  2PER A;  5F07 A;  1K0M A;  3KXO A;  1SVL A;  1EV9 A;  5ELG A;  3VI5 A;  5GSS A;  3D0Z A;  3QAW A;  1BG5 A;  4AKX B;  1U87 A;  5AN1 A;  3NIV A;  4YH2 A;  1PA3 A;  4PTS A;  1PN9 A;  4YAV A;  1JZR A;  5EY6 A;  2N5F A;  2WB9 A;  3F63 A;  3RBT A;  3UAP A;  4IVF A;  5DAL A;  4BVY A;  1BG1 A;  4O92 A;  1GSS A;  6GSS A;  2V6K A;  3CSJ A;  5D73 A;  3TOU A;  5J41 A;  3RGB C;  5A5H A;  1LJR A;  3F6D A;  1PMT A;  1VF2 A;  1K0C A;  5DDL A;  2A2S A;  2VKZ G;  5J40 A;  4BL7 B;  1XW5 A;  2GLR A;  3VUR A;  4ECB A;  2HSM B;  2YV9 A;  4G10 A;  3CHX C;  2WVX A;  3HMJ G;  1PKW A;  1XWK A;  3LXT A;  3SWL A;  4IQ1 A;  3UAR A;  5A4V A;  2VCV A;  1PGT A;  2C4J A;  3N5O A;  1PD2 1;  3TU3 B;  5B7C A;  4L5O A;  1MD4 A;  1M99 A;  4KDY A;  2UZ8 A;  3P90 A;  3UBL A;  3ZFL A;  3GH6 A;  3IK7 A;  4ZBA A;  1B8X A;  1EOH A;  5A1N B;  4OFT A;  5BMU A;  4QQ7 A;  4MP4 A;  1AQV A;  4ZB8 A;  4E68 A;  3R2Q A;  4PQI A;  1JLV A;  4BL7 A;  3KM6 A;  2CZ2 A;  4AKI A;  2HSM A;  5J47 A;  2C3Q A;  3P8W A;  19GS A;  1K0N A;  4G0I A;  1FW1 A;  3LJR A;  1V40 A;  1TW9 A;  1GUK A;  4PNG A;  6GSX A;  5J4V A;  1K3Y A;  5JCU A;  6GST A;  4EC0 A;  2C80 A;  2WW1 A;  3LSZ A;  1XW6 A;  2ON5 A;  5KEJ A;  2VD1 A;  4BVX B;  1VF3 A;  2GSQ A;  2R4V A;  4PUR A;  6GSV A;  5ECS A;  1K0A A;  2IMK A;  5F06 A;  4F03 A;  4G0K A;  1Y1U A;  1GTU A;  2WVZ A;  2DSA A;  1YDK A;  3ZMK A;  1G6W A;  3LYK A;  3R3E A;  5DJM A;  2WRT A;  5LCZ A;  1F3A A;  20GS A;  1ZL9 A;  5DAL B;  5J5N A;  3WD6 A;  3KJY A;  2C3N A;  4IGJ A;  5A5H B;  1OYJ A;  3CRU A;  3QAG A;  4MPG A;  4OMV A;  4IS0 A;  4E8E A;  1GTB A;  4KAE A;  4LMV A;  5JCW A;  4KGI A;  1BAY A;  5G5E A;  2AAW A;  4N0V A;  1TXU A;  3U6V A;  4F0C A;  1GWC A;  1VF4 A;  1GSE A;  4PX1 A;  1EEM A;  2WVX B;  1JLW A;  4RI7 A;  1LBK A;  3M3M A;  17GS A;  1S4B P;  2OA7 A;  1GUL A;  2VCQ A;  4AKH A;  4GSN A;  1IYH A;  3LFL A;  5A4U A;  3QR6 A;  2WW2 A;  4ECC A;  4AKG A;  10GS A;  2IL3 A;  5ECI B;  4KF9 A;  4ACS A;  4PI2 C;  3RFR C;  2WVY A;  3Q18 A;  1PL2 A;  2EFD A;  4KE3 A;  4L8E A;  5ECK B;  5ECO B;  2PBJ A;  2VCZ A;  4I97 A;  5FT3 A;  2AB6 A;  3O3T A;  1AW9 A;  4L5L A;  3HJO A;  5BMU B;  1SVO A;  2R5G A;  3KMO A;  4EE0 A;  1YY7 A;  3EE2 A;  4Q5N A;  1OKT A;  1GNE A;  2HSN A;  3ZML A;  3G7J A;  1DUG A;  2OT3 A;  4KSM A;  4Q5F A;  5DAK A;  11GS A;  1YKC A;  5AIX A;  4GST A;  6GSY A;  3VPQ A;  2CAI A;  2VCT A;  2CVD A;  4IQA A;  5D9X A;  4ZB9 A;  2JL4 A;  1GSD A;  1GLQ A;  2O3E A;  3M0F A;  3GSS A;  2GTU A;  4G0L A;  3TGZ A;  6GSU A;  3CBU A;  3IE3 A;  3LYP A;  3GTU A;  1AQW A;  1GSQ A;  3CSI A;  3TOT A;  3KTL A;  3O76 A;  3L0H A;  9GSS A;  5ELA A;  1SVM A;  1TU7 A;  3PGT A;  4MK3 A;  3H1N A;  4NHZ A;  1K3L A;  1K0B A;  5J4Y A;  5J4U A;  4FQU A;  6GSW A;  2PGT A;  4G19 A;  2VCW A;  5EL8 A;  4YQU A;  1MTC A;  3PPU A;  1Q4J A;  1V2A A;  1U88 A;  2DC5 A;  4ZXG A;  1R5A A;  3LG6 A;  2PMT A;  4ZB6 A;  4IKH A;  4MF5 A;  1K0D A;  4IBP A;  1YEW C;  5A4W A;  4MPF A;  5ECR B;  2HRK B;  3CWG A;  4K0G A;  4O7H A;  1EOG A;  4QMK A;  1BX9 A;  3UBK A;  1N2A A;  13GS A;  4K0N A;  1PX6 A;  5A34 A;  3PR8 A;  4AI6 A;  4HOJ A;  4Q5R A;  4CHS A;  3FR3 A;  4KH7 A;  4NAX A;  3C8E A; 
#chains in the Genus database with same CATH homology
 5D9V A;  3BBY A;  3HKR A;  5DJL A;  4PQH A;  3WYW A;  1OE8 A;  4ECI A;  4JZQ A;  4G9H A;  3FYG A;  2NTO A;  3I6A A;  3UVH A;  2F8F A;  4WR4 A;  5EVO A;  2VD0 A;  4PXO A;  1TDI A;  4GF0 A;  2CZ3 A;  2VO4 A;  2HRK A;  1G7O A;  4E8H A;  1M9B A;  4IJI A;  2HSN B;  3CSH A;  4ZBD A;  5ECH B;  3G7I A;  5DAK B;  3GUS A;  1G6Y A;  3Q74 A;  4N3Z A;  1PL1 A;  4MZW A;  1ZGN A;  1BYE A;  3FRC A;  3ZFB A;  1C72 A;  3DD3 A;  1U3I A;  3F6F A;  1GUH A;  1PKZ A;  1YVL A;  1HQO A;  3EIN A;  4G01 A;  1HNA A;  1AQX A;  2HNL A;  5AGY A;  1NHY A;  2C3T A;  3GTU B;  2GST A;  1TU8 A;  1YQ1 A;  1EV4 A;  5F05 A;  1GSF A;  2ON7 A;  3IBH A;  2EFC A;  2HRA A;  2H1L A;  3I69 A;  4YQV A;  4HZ2 A;  3VI7 A;  4GDF A;  1IYI A;  4MDC A;  4GTU A;  5ECQ B;  8GSS A;  3FR9 A;  4YAP A;  5GST A;  2EFE A;  4HZ4 A;  1YJ6 A;  4W66 A;  5DCG A;  1BF5 A;  3IC8 A;  1XWG A;  5ECL B;  3VK9 A;  4KDU A;  1E6B A;  3ERF A;  1F2E A;  1GUM A;  3ERG A;  1USB A;  18GS A;  5D9W A;  2WJU A;  22GS A;  5F0G A;  2GSS A;  1K3O A;  1HNB A;  4OFN A;  3IK9 A;  4HJ2 A;  5HFK A;  5A34 B;  4AGS A;  5IQY A;  5ECM B;  2AHE A;  5A5K A;  5ECN B;  2CAQ A;  1N25 A;  3GUR A;  4ZBB A;  4F0B A;  5FWG A;  3LXZ A;  2YCD A;  3M1G A;  4ECJ A;  4JBB A;  1GNW A;  1AXD A;  3Q19 A;  3GST A;  4TOP A;  4YQM A;  3VPT A;  2C8U A;  2D2Z A;  2UV8 G;  2FHE A;  5F8B A;  2OAD A;  5AIS A;  2J9H A;  2X64 A;  4GLT A;  3VLN A;  2A2R A;  7GSS A;  3CRT A;  1FHE A;  3MAK A;  4ZB7 A;  4MF7 A;  1GLP A;  4KX4 A;  4MF6 A;  4Q5Q A;  1GTI A;  2R3X A;  1Z9H A;  1GSU A;  4ID0 A;  4JED A;  5G5F A;  4EDZ A;  3QAV A;  1OE7 A;  1F3B A;  2CA8 A;  2YV7 A;  4LMW A;  5FHI A;  1HNC A;  1ML6 A;  4PNF A;  4ISD A;  3AY8 A;  2GSR A;  2OAC A;  1GTA A;  1GSY A;  1K0O A;  3N9J A;  2IMI A;  2F3M A;  5D9T A;  2WDU A;  3MDK A;  1MD3 A;  5GZZ B;  12GS A;  4KDX A;  4IW9 A;  4DEJ A;  1VF1 A;  5A1N A;  2FNO A;  2HQT A;  4WR5 A;  4EDY A;  1M9A A;  3LQ7 A;  1M0U A;  1KBN A;  1PX7 A;  1Y6E A;  4IEL A;  2R6K A;  3W8S A;  3FY7 A;  3DGQ A;  4PUA A;  4GSS A;  4J2F A;  14GS A;  1RK4 A;  2WS2 A;  4NHW A;  4BVY B;  4GCI A;  3ISO A;  4USS A;  3KMN A;  4OFM A;  16GS A;  5AIV A;  4RI6 A;  2LJR A;  3M8N A;  3GX0 A;  2EFH A;  5ECP B;  1UA5 A;  1B4P A;  2PVQ A;  3HJM A;  2VCX A;  4EXJ A;  2O5V A;  4BVX A;  2GDR A;  3IR4 A;  5DQS A;  3FR6 A;  1A0F A;  1B48 A;  3VWX A;  4HI7 A;  4PGT A;  5LD0 A;  2PER A;  5F07 A;  1K0M A;  3KXO A;  1SVL A;  1EV9 A;  5ELG A;  3VI5 A;  5GSS A;  3D0Z A;  3QAW A;  1BG5 A;  4AKX B;  1U87 A;  5AN1 A;  3NIV A;  4YH2 A;  1PA3 A;  4PTS A;  1PN9 A;  4YAV A;  1JZR A;  5EY6 A;  2N5F A;  2WB9 A;  3F63 A;  3RBT A;  3UAP A;  4IVF A;  5DAL A;  4BVY A;  1BG1 A;  4O92 A;  1GSS A;  6GSS A;  2V6K A;  3CSJ A;  5D73 A;  3TOU A;  5J41 A;  5A5H A;  1LJR A;  3F6D A;  1PMT A;  1VF2 A;  1K0C A;  5DDL A;  2A2S A;  2VKZ G;  5J40 A;  4BL7 B;  1XW5 A;  2GLR A;  3VUR A;  4ECB A;  2HSM B;  2YV9 A;  4G10 A;  3HMJ G;  1PKW A;  1XWK A;  3LXT A;  3SWL A;  4IQ1 A;  3UAR A;  5A4V A;  2VCV A;  1PGT A;  2C4J A;  3N5O A;  1PD2 1;  3TU3 B;  5B7C A;  4L5O A;  1MD4 A;  1M99 A;  4KDY A;  2UZ8 A;  3P90 A;  3UBL A;  3ZFL A;  3GH6 A;  3IK7 A;  4ZBA A;  1B8X A;  1EOH A;  5A1N B;  4OFT A;  5BMU A;  4QQ7 A;  4MP4 A;  1AQV A;  4ZB8 A;  4E68 A;  3R2Q A;  4PQI A;  1JLV A;  4BL7 A;  3KM6 A;  2CZ2 A;  4AKI A;  2HSM A;  5J47 A;  2C3Q A;  3P8W A;  19GS A;  1K0N A;  4G0I A;  1FW1 A;  3LJR A;  1V40 A;  1TW9 A;  1GUK A;  4PNG A;  6GSX A;  5J4V A;  1K3Y A;  5JCU A;  6GST A;  4EC0 A;  2C80 A;  3LSZ A;  1XW6 A;  2ON5 A;  5KEJ A;  2VD1 A;  4BVX B;  1VF3 A;  2GSQ A;  2R4V A;  4PUR A;  6GSV A;  5ECS A;  1K0A A;  2IMK A;  5F06 A;  4F03 A;  4G0K A;  1Y1U A;  1GTU A;  2DSA A;  1YDK A;  3ZMK A;  1G6W A;  3LYK A;  3R3E A;  5DJM A;  2WRT A;  5LCZ A;  1F3A A;  20GS A;  1ZL9 A;  5DAL B;  5J5N A;  3WD6 A;  3KJY A;  2C3N A;  4IGJ A;  5A5H B;  1OYJ A;  3CRU A;  3QAG A;  4MPG A;  4OMV A;  4IS0 A;  4E8E A;  1GTB A;  4KAE A;  4LMV A;  5JCW A;  4KGI A;  1BAY A;  5G5E A;  2AAW A;  4N0V A;  1TXU A;  3U6V A;  4F0C A;  1GWC A;  1VF4 A;  1GSE A;  4PX1 A;  1EEM A;  1JLW A;  4RI7 A;  1LBK A;  3M3M A;  17GS A;  2OA7 A;  1GUL A;  2VCQ A;  4AKH A;  4GSN A;  1IYH A;  3LFL A;  5A4U A;  3QR6 A;  4ECC A;  4AKG A;  10GS A;  2IL3 A;  5ECI B;  4KF9 A;  4ACS A;  3Q18 A;  1PL2 A;  2EFD A;  4KE3 A;  4L8E A;  5ECK B;  5ECO B;  2PBJ A;  2VCZ A;  4I97 A;  5FT3 A;  2AB6 A;  3O3T A;  1AW9 A;  4L5L A;  3HJO A;  5BMU B;  1SVO A;  2R5G A;  3KMO A;  4EE0 A;  1YY7 A;  3EE2 A;  4Q5N A;  1OKT A;  1GNE A;  2HSN A;  3ZML A;  3G7J A;  1DUG A;  2OT3 A;  4KSM A;  4Q5F A;  5DAK A;  11GS A;  1YKC A;  5AIX A;  4GST A;  6GSY A;  3VPQ A;  2CAI A;  2VCT A;  2CVD A;  4IQA A;  5D9X A;  4ZB9 A;  2JL4 A;  1GSD A;  1GLQ A;  3M0F A;  3GSS A;  2GTU A;  4G0L A;  3TGZ A;  6GSU A;  3CBU A;  3IE3 A;  3LYP A;  3GTU A;  1AQW A;  1GSQ A;  3CSI A;  3TOT A;  3KTL A;  3O76 A;  3L0H A;  9GSS A;  5ELA A;  1SVM A;  1TU7 A;  3PGT A;  4MK3 A;  3H1N A;  4NHZ A;  1K3L A;  1K0B A;  5J4Y A;  5J4U A;  4FQU A;  6GSW A;  2PGT A;  4G19 A;  2VCW A;  5EL8 A;  4YQU A;  1MTC A;  3PPU A;  1Q4J A;  1V2A A;  1U88 A;  2DC5 A;  4ZXG A;  1R5A A;  3LG6 A;  2PMT A;  4ZB6 A;  4IKH A;  4MF5 A;  1K0D A;  4IBP A;  5A4W A;  4MPF A;  5ECR B;  2HRK B;  3CWG A;  4K0G A;  4O7H A;  1EOG A;  4QMK A;  1BX9 A;  3UBK A;  1N2A A;  13GS A;  4K0N A;  1PX6 A;  5A34 A;  3PR8 A;  4AI6 A;  4HOJ A;  4Q5R A;  4CHS A;  3FR3 A;  4KH7 A;  4NAX A;  3C8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...