2HSNB

Structural basis of yeast aminoacyl-trna synthetase complex formation revealed by crystal structures of two binary sub-complexes
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
120
structure length
120
Chain Sequence
MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna binding protein
molecule keywords Methionyl-tRNA synthetase, cytoplasmic
publication title Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 40
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hsnB00
4IQAA 4USSA 2ON5A 2CVDA 3VK9A 5A4VA 1GSQA 1YJ6A 3LYPA 4G19A 3IK9A 3C8EA 4EC0A 4L5LA 4QQ7A 4MK3A 6GSTA 3QR6A 2VCQA 1VF1A 1XW6A 4GTUA 5FT3A 1EEMA 1MD4A 22GSA 1ZL9A 5ECSA 4KDXA 1OKTA 3NIVA 3TOTA 4KF9A 1V2AA 4YH2A 3R3EA 5EL8A 4IVFA 2VCXA 2C3QA 3FR9A 1K0DA 1HQOA 1U87A 4Q5FA 1LBKA 3LG6A 3IC8A 3SWLA 1PKWA 5AGYA 4LMVA 5ECLB 4BVYA 1Z9HA 3MDKA 4ZBBA 1YDKA 3WD6A 3QAVA 1PA3A 1GTIA 1IYIA 2FHEA 4KH7A 1BAYA 2C4JA 3M0FA 1XWGA 1GWCA 4PGTA 4IBPA 1JZRA 1E6BA 5F8BA 2GSRA 4ID0A 3PPUA 4HI7A 3HKRA 3DGQA 3FRCA 5J5NA 4ISDA 2VD0A 2GLRA 2HRKA 3DD3A 1GNWA 1PMTA 3GX0A 3O76A 1PL2A 3EE2A 3FY7A 3G7JA 4G0LA 3GTUA 10GSA 5DALA 4I97A 4KSMA 4AGSA 4F0CA 2CAIA 4F0BA 4IELA 1F3AA 3L0HA 1EOGA 4LMWA 1KBNA 1GUKA 1HNCA 3ZFLA 1YKCA 1HNAA 20GSA 3AY8A 4O7HA 1GSUA 3PGTA 3LYKA 2WRTA 3HJMA 4BVXA 1G6YA 1ZGNA 3KMOA 4OMVA 3LJRA 4O92A 3P8WA 1K0AA 4Q5QA 3UBKA 1B4PA 2F8FA 3VPQA 4IKHA 4IGJA 2YV9A 2R4VA 3GURA 5AIXA 3Q18A 3QAGA 1GTUA 2WDUA 1PX6A 1XWKA 3VI5A 2PBJA 5ELAA 4KAEA 4NHZA 4OFTA 5ECKB 3IK7A 4PXOA 4JBBA 1AQWA 4MF7A 4YQMA 4WR5A 1NHYA 2WJUA 4BL7A 1K3LA 4FQUA 3VPTA 3HJOA 1GSEA 3RBTA 2WB9A 2LJRA 2JL4A 1AQXA 4ECCA 4CHSA 1GSYA 5JCWA 1GSDA 4YQVA 5ECNB 5F07A 1TU8A 4Q5RA 4MF5A 1FHEA 3ZMKA 1PL1A 5GSTA 4K0NA 1GUMA 8GSSA 1FW1A 4KGIA 3LXZA 4L8EA 5DALB 4MF6A 6GSUA 2VD1A 2AHEA 2HSMA 4ECBA 5D73A 1GLPA 1VF2A 3R2QA 3I69A 2R5GA 1F2EA 2DSAA 2UZ8A 3M1GA 3UVHA 4F03A 1M99A 1IYHA 3TGZA 5DAKB 5G5EA 5LCZA 3UAPA 1B48A 2AAWA 19GSA 5F06A 4KDUA 5DJLA 1K0OA 1M9BA 1U88A 4E8EA 5BMUA 2HQTA 2VCWA 3ZFBA 6GSWA 5DCGA 4OFMA 4ZB6A 2C80A 3VURA 5EVOA 1G7OA 2F3MA 5F05A 4YQUA 2OA7A 5A5KA 4TOPA 14GSA 4EE0A 2R6KA 1K0NA 1Q4JA 1ML6A 1R5AA 2V6KA 4IW9A 1VF4A 2IMIA 3Q19A 2HSNB 4PUAA 2A2RA 2N5FA 4G0KA 1PKZA 1MD3A 3U6VA 1C72A 4BL7B 12GSA 1GSSA 4ZB9A 3CSIA 3VI7A 1JLWA 1PD21 3FYGA 4PURA 4OFNA 3VWXA 1AXDA 2A2SA 2YCDA 2YV7A 2WS2A 4YAPA 4ECIA 1TW9A 4IJIA 5ECOB 1MTCA 5ECPB 4HZ4A 3KJYA 3CRTA 4PTSA 4EDYA 5HFKA 4HOJA 1M0UA 16GSA 3CSHA 5ECMB 2HSMB 1GNEA 2CAQA 1AW9A 5AIVA 4PQHA 2VCVA 5GZZB 3VLNA 3UARA 1K0BA 3P90A 4GF0A 2GSQA 4G0IA 4EXJA 2GSTA 4BVYB 5DJMA 5A4WA 1EOHA 4MP4A 4Q5NA 2VO4A 3ERFA 1U3IA 3KM6A 3LQ7A 3WYWA 1BX9A 3PR8A 5AN1A 2CZ3A 3G7IA 2D2ZA 3UBLA 5D9XA 3IBHA 2IL3A 4J2FA 4G9HA 4GSSA 5G5FA 2HRKB 1TDIA 1YQ1A 2VCZA 3GTUB 1K0MA 1Y6EA 5J4UA 1F3BA 4PNFA 3LXTA 4K0GA 4GSNA 5DQSA 4IS0A 3Q74A 2GTUA 4KE3A 2C8UA 2HRAA 5ECQB 3CSJA 5GSSA 2PMTA 2IMKA 3BBYA 1K0CA 1M9AA 4PX1A 1TU7A 1GUHA 4MPGA 2FNOA 4BVXB 3IE3A 1BYEA 3QAWA 2AB6A 1PN9A 7GSSA 5ECRB 4IQ1A 3N9JA 5F0GA 3FR3A 1K3OA 3IR4A 4ZBDA 1JLVA 2OADA 1A0FA 4GCIA 1USBA 2X64A 1LJRA 1G6WA 4JEDA 3O3TA 4EDZA 1V40A 4ZB8A 2R3XA 3FR6A 4JZQA 4KX4A 5J41A 4HZ2A 4L5OA 2CZ2A 3GH6A 18GSA 4NAXA 4DEJA 17GSA 1PGTA 1GTAA 4ZBAA 4ECJA 1PX7A 3KMNA 9GSSA 2PERA 4G10A 5B7CA 2CA8A 3M8NA 1EV9A 4HJ2A 6GSYA 2OACA 1N2AA 6GSVA 6GSXA 1UA5A 5ELGA 3GUSA 5A4UA 2PVQA 1GSFA 3M3MA 5LD0A 4KDYA 4GSTA 4WR4A 1DUGA 1VF3A 1BG5A 2C3TA 1GLQA 4PNGA 4NHWA 5JCUA 1XW5A 3ZMLA 2C3NA 3ERGA 5DAKA 5KEJA 13GSA 3F63A 4ACSA 3CBUA 1B8XA 3LSZA 3MAKA 2ON7A 5D9WA 4RI7A 4N0VA 4E8HA 2J9HA 3KTLA 3F6DA 5FHIA 2DC5A 5D9TA 1AQVA 3LFLA 5ECHB 2HNLA 4GLTA 5IQYA 4MDCA 1GULA 5EY6A 2GDRA 11GSA 3CRUA 2PGTA 1K3YA 2NTOA 3GSTA 5ECIB 1OYJA 5AISA 5D9VA 4YAVA 3F6FA 4PQIA 4MPFA 1HNBA 1OE7A 3KXOA 3I6AA 1GTBA 1RK4A 4MZWA 6GSSA 4RI6A 3EINA 2VCTA 3TOUA 3GSSA 3D0ZA 4ZXGA 1YY7A 2GSSA 3N5OA 3H1NA 1EV4A 3W8SA 5FWGA 3ISOA 1OE8A 5DDLA
chains in the Genus database with same CATH superfamily
4IQAA 4USSA 2ON5A 2CVDA 3VK9A 5A4VA 1GSQA 1YJ6A 3LYPA 4G19A 3IK9A 2WVXA 3C8EA 4EC0A 4L5LA 4QQ7A 4MK3A 6GSTA 3QR6A 2VCQA 1VF1A 3CWGA 1XW6A 2H1LA 4GTUA 5FT3A 1EEMA 1MD4A 22GSA 1ZL9A 5ECSA 4KDXA 1OKTA 3NIVA 3TOTA 4KF9A 2WW0A 1V2AA 4YH2A 3R3EA 5EL8A 4IVFA 2VCXA 2C3QA 3FR9A 1K0DA 1HQOA 1U87A 4Q5FA 1LBKA 3LG6A 3IC8A 3SWLA 2O36A 1PKWA 5AGYA 4LMVA 5ECLB 4BVYA 1Z9HA 3MDKA 4ZBBA 1YDKA 3WD6A 3QAVA 1PA3A 1GTIA 1IYIA 2FHEA 4KH7A 1BAYA 2C4JA 3M0FA 1XWGA 1GWCA 4PGTA 4IBPA 5A1NB 1JZRA 1E6BA 5F8BA 4AKHA 2GSRA 4ID0A 3PPUA 4HI7A 3HKRA 3DGQA 3FRCA 5J5NA 4ISDA 2VD0A 2GLRA 2HRKA 3DD3A 1GNWA 3GX0A 1PMTA 3O76A 1PL2A 3EE2A 3FY7A 3G7JA 4G0LA 3GTUA 10GSA 5DALA 4I97A 4KSMA 4E68A 4AGSA 4F0CA 2CAIA 4F0BA 4IELA 1F3AA 3L0HA 1EOGA 4LMWA 1KBNA 1GUKA 1HNCA 3ZFLA 1YKCA 1HNAA 20GSA 3AY8A 4W66A 4O7HA 1GSUA 3PGTA 3LYKA 2WRTA 3HJMA 1SVOA 4BVXA 1G6YA 1ZGNA 3KMOA 4OMVA 4AKIA 3LJRA 4O92A 4FXYP 3P8WA 1K0AA 4Q5QA 3UBKA 1B4PA 2F8FA 3RFRC 3VPQA 4IKHA 4IGJA 2YV9A 2R4VA 3GURA 5AIXA 3Q18A 4PI2C 3QAGA 1GTUA 2WDUA 1PX6A 1XWKA 3VI5A 2PBJA 5ELAA 4N3ZA 4KAEA 5J47A 2O5VA 4NHZA 4OFTA 5ECKB 3IK7A 4PXOA 4JBBA 2HSNA 1AQWA 4MF7A 4YQMA 4WR5A 1NHYA 2WJUA 4BL7A 1K3LA 4FQUA 3VPTA 2WVZA 3HJOA 1GSEA 3RBTA 2WB9A 2LJRA 2JL4A 1AQXA 4ECCA 2VKZG 4CHSA 1GSYA 5JCWA 1GSDA 4YQVA 5ECNB 4GDFA 5F07A 1TU8A 4Q5RA 4MF5A 1FHEA 2OT3A 3ZMKA 1PL1A 5GSTA 4K0NA 1GUMA 8GSSA 1FW1A 4KGIA 1Y1UA 4PI0C 3LXZA 4L8EA 5DALB 4MF6A 6GSUA 2VD1A 2AHEA 2HSMA 4ECBA 5D73A 1GLPA 1VF2A 3R2QA 3I69A 2R5GA 1F2EA 2DSAA 2UZ8A 3M1GA 3UVHA 4F03A 1M99A 1IYHA 3TGZA 5DAKB 5G5EA 4AKXB 5LCZA 3UAPA 1B48A 2AAWA 19GSA 5F06A 4KDUA 5DJLA 1K0OA 1M9BA 1U88A 3CHXC 4E8EA 5BMUA 1S4BP 2HQTA 4AI6A 2VCWA 3ZFBA 6GSWA 5DCGA 4OFMA 4ZB6A 2C80A 3VURA 5EVOA 1G7OA 2F3MA 5F05A 4YQUA 2OA7A 5A5HA 5A5KA 1BG1A 4TOPA 14GSA 4EE0A 2R6KA 1K0NA 1Q4JA 1ML6A 1R5AA 2V6KA 4IW9A 1VF4A 1SVLA 2EFCA 2IMIA 3Q19A 2HSNB 4PUAA 2A2RA 2N5FA 4G0KA 1PKZA 1MD3A 3U6VA 1C72A 4BL7B 2WW2A 12GSA 1GSSA 4ZB9A 3CSIA 3VI7A 1JLWA 1PD21 3FYGA 1YEWC 4PURA 3TU3B 4OFNA 3VWXA 1AXDA 1YVLA 2A2SA 2YCDA 2WVXB 2YV7A 2UV8G 1SVMA 2WS2A 4YAPA 4ECIA 1TW9A 4IJIA 2O3EA 5ECOB 1MTCA 5ECPB 4HZ4A 3KJYA 3CRTA 4PTSA 4EDYA 1TXUA 5HFKA 4HOJA 1M0UA 16GSA 3CSHA 4ZB7A 2EFEA 5A34A 5ECMB 4QMKA 2HSMB 1GNEA 2CAQA 1AW9A 5AIVA 5J4VA 4PQHA 2VCVA 5GZZB 3VLNA 3UARA 1K0BA 3P90A 4GF0A 2GSQA 4G0IA 4EXJA 2GSTA 4BVYB 5DJMA 5A4WA 1EOHA 4MP4A 4Q5NA 3RGBC 2VO4A 3ERFA 1U3IA 3KM6A 3LQ7A 3WYWA 1BX9A 3PR8A 5AN1A 2CZ3A 3G7IA 2D2ZA 3UBLA 5D9XA 3IBHA 2IL3A 4J2FA 2EFHA 4G9HA 4GSSA 5G5FA 2HRKB 1TDIA 1N25A 1YQ1A 2VCZA 3GTUB 1K0MA 1Y6EA 5J4UA 1F3BA 4PNFA 3LXTA 4K0GA 4GSNA 5DQSA 4IS0A 3Q74A 2GTUA 4KE3A 2WW3A 2C8UA 2HRAA 5ECQB 3CSJA 5GSSA 2PMTA 5J4YA 4G01A 2IMKA 3BBYA 1K0CA 1M9AA 4PX1A 1TU7A 1GUHA 4MPGA 2FNOA 4BVXB 3IE3A 1BYEA 5A34B 3QAWA 2AB6A 1PN9A 7GSSA 5ECRB 4AKGA 4IQ1A 3N9JA 5F0GA 3FR3A 1K3OA 3IR4A 4ZBDA 1JLVA 2OADA 1A0FA 4GCIA 1USBA 5J40A 2X64A 1LJRA 1G6WA 4JEDA 3O3TA 4EDZA 1V40A 4ZB8A 2R3XA 3FR6A 4JZQA 4KX4A 5J41A 4HZ2A 4L5OA 2CZ2A 3GH6A 18GSA 4NAXA 4DEJA 17GSA 3HMJG 1PGTA 1GTAA 4ZBAA 4ECJA 1PX7A 1BF5A 3KMNA 2EFDA 9GSSA 2PERA 4G10A 5B7CA 2CA8A 3M8NA 1EV9A 4HJ2A 6GSYA 2OACA 1N2AA 6GSVA 2WVYA 6GSXA 1UA5A 5ELGA 4PHZC 3GUSA 5A4UA 2PVQA 1GSFA 3M3MA 5LD0A 4KDYA 4GSTA 4WR4A 1DUGA 1VF3A 1BG5A 2C3TA 1GLQA 4PNGA 4NHWA 5JCUA 1XW5A 3ZMLA 2WW1A 2C3NA 3ERGA 5DAKA 5KEJA 13GSA 3F63A 4ACSA 3CBUA 1B8XA 3LSZA 3MAKA 2ON7A 5D9WA 4RI7A 4N0VA 4E8HA 2J9HA 3KTLA 3F6DA 5FHIA 2DC5A 5D9TA 1AQVA 3LFLA 5ECHB 2HNLA 5BMUB 4GLTA 5IQYA 4MDCA 1GULA 5EY6A 2GDRA 11GSA 3CRUA 2PGTA 1K3YA 2NTOA 3GSTA 5ECIB 5A1NA 1OYJA 5AISA 5D9VA 2WZSA 4YAVA 3F6FA 4PQIA 4MPFA 5A5HB 1I1IP 1HNBA 1OE7A 3KXOA 3I6AA 1GTBA 1RK4A 4MZWA 6GSSA 4RI6A 3EINA 2VCTA 3TOUA 3GSSA 3D0ZA 4ZXGA 1YY7A 2GSSA 3N5OA 3H1NA 1EV4A 3W8SA 5FWGA 3ISOA 1OE8A 5DDLA
chains in the Genus database with same CATH topology
4IQAA 4USSA 2ON5A 2CVDA 3VK9A 5A4VA 1GSQA 1YJ6A 3LYPA 4G19A 3IK9A 3C8EA 4EC0A 4L5LA 4QQ7A 4MK3A 6GSTA 3QR6A 2VCQA 1VF1A 3CWGA 1XW6A 2H1LA 4GTUA 5FT3A 1EEMA 1MD4A 22GSA 1ZL9A 5ECSA 4KDXA 1OKTA 3NIVA 3TOTA 4KF9A 1V2AA 4YH2A 3R3EA 5EL8A 4IVFA 2VCXA 2C3QA 3FR9A 1K0DA 1HQOA 1U87A 4Q5FA 1LBKA 3LG6A 3IC8A 3SWLA 1PKWA 5AGYA 4LMVA 5ECLB 4BVYA 1Z9HA 3MDKA 4ZBBA 1YDKA 3WD6A 3QAVA 1PA3A 1GTIA 1IYIA 2FHEA 4KH7A 1BAYA 2C4JA 3M0FA 1XWGA 1GWCA 4PGTA 4IBPA 5A1NB 1JZRA 1E6BA 5F8BA 4AKHA 2GSRA 4ID0A 3PPUA 4HI7A 3HKRA 3DGQA 3FRCA 5J5NA 4ISDA 2VD0A 2GLRA 2HRKA 3DD3A 1GNWA 1PMTA 3GX0A 3O76A 1PL2A 3EE2A 3FY7A 3G7JA 4G0LA 3GTUA 10GSA 5DALA 4I97A 4KSMA 4E68A 4AGSA 4F0CA 2CAIA 4F0BA 4IELA 1F3AA 3L0HA 1EOGA 4LMWA 1KBNA 1GUKA 1HNCA 3ZFLA 1YKCA 1HNAA 20GSA 3AY8A 4W66A 4O7HA 1GSUA 3PGTA 3LYKA 2WRTA 3HJMA 1SVOA 4BVXA 1G6YA 1ZGNA 3KMOA 4OMVA 4AKIA 3LJRA 4O92A 3P8WA 1K0AA 4Q5QA 3UBKA 1B4PA 2F8FA 3VPQA 4IKHA 4IGJA 2YV9A 2R4VA 3GURA 5AIXA 3Q18A 3QAGA 1GTUA 2WDUA 1PX6A 1XWKA 3VI5A 2PBJA 5ELAA 4N3ZA 4KAEA 5J47A 2O5VA 4NHZA 4OFTA 5ECKB 3IK7A 4PXOA 4JBBA 2HSNA 1AQWA 4MF7A 4YQMA 4WR5A 1NHYA 2WJUA 4BL7A 1K3LA 4FQUA 3VPTA 3HJOA 1GSEA 3RBTA 2WB9A 2LJRA 2JL4A 1AQXA 4ECCA 2VKZG 4CHSA 1GSYA 5JCWA 1GSDA 4YQVA 5ECNB 4GDFA 5F07A 1TU8A 4Q5RA 4MF5A 1FHEA 2OT3A 3ZMKA 1PL1A 5GSTA 4K0NA 1GUMA 8GSSA 1FW1A 4KGIA 1Y1UA 3LXZA 4L8EA 5DALB 4MF6A 6GSUA 2VD1A 2AHEA 2HSMA 4ECBA 5D73A 1GLPA 1VF2A 3R2QA 3I69A 2R5GA 1F2EA 2DSAA 2UZ8A 3M1GA 3UVHA 4F03A 1M99A 1IYHA 3TGZA 5DAKB 5G5EA 4AKXB 5LCZA 3UAPA 1B48A 2AAWA 19GSA 5F06A 4KDUA 5DJLA 1K0OA 1M9BA 1U88A 4E8EA 5BMUA 2HQTA 4AI6A 2VCWA 3ZFBA 6GSWA 5DCGA 4OFMA 4ZB6A 2C80A 3VURA 5EVOA 1G7OA 2F3MA 5F05A 4YQUA 2OA7A 5A5HA 5A5KA 1BG1A 4TOPA 14GSA 4EE0A 2R6KA 1K0NA 1Q4JA 1ML6A 1R5AA 2V6KA 4IW9A 1VF4A 1SVLA 2EFCA 2IMIA 3Q19A 2HSNB 4PUAA 2A2RA 2N5FA 4G0KA 1PKZA 1MD3A 3U6VA 1C72A 4BL7B 12GSA 1GSSA 4ZB9A 3CSIA 3VI7A 1JLWA 1PD21 3FYGA 4PURA 3TU3B 4OFNA 3VWXA 1AXDA 1YVLA 2A2SA 2YCDA 2YV7A 2UV8G 1SVMA 2WS2A 4YAPA 4ECIA 1TW9A 4IJIA 5ECOB 1MTCA 5ECPB 4HZ4A 3KJYA 3CRTA 4PTSA 4EDYA 1TXUA 5HFKA 4HOJA 1M0UA 16GSA 3CSHA 4ZB7A 2EFEA 5A34A 5ECMB 4QMKA 2HSMB 1GNEA 2CAQA 1AW9A 5AIVA 5J4VA 4PQHA 2VCVA 5GZZB 3VLNA 3UARA 1K0BA 3P90A 4GF0A 2GSQA 4G0IA 4EXJA 2GSTA 4BVYB 5DJMA 5A4WA 1EOHA 4MP4A 4Q5NA 2VO4A 3ERFA 1U3IA 3KM6A 3LQ7A 3WYWA 1BX9A 3PR8A 5AN1A 2CZ3A 3G7IA 2D2ZA 3UBLA 5D9XA 3IBHA 2IL3A 4J2FA 2EFHA 4G9HA 4GSSA 5G5FA 2HRKB 1TDIA 1N25A 1YQ1A 2VCZA 3GTUB 1K0MA 1Y6EA 5J4UA 1F3BA 4PNFA 3LXTA 4K0GA 4GSNA 5DQSA 4IS0A 3Q74A 2GTUA 4KE3A 2C8UA 2HRAA 5ECQB 3CSJA 5GSSA 2PMTA 5J4YA 4G01A 2IMKA 3BBYA 1K0CA 1M9AA 4PX1A 1TU7A 1GUHA 4MPGA 2FNOA 4BVXB 3IE3A 1BYEA 5A34B 3QAWA 2AB6A 1PN9A 7GSSA 5ECRB 4AKGA 4IQ1A 3N9JA 5F0GA 3FR3A 1K3OA 3IR4A 4ZBDA 1JLVA 2OADA 1A0FA 4GCIA 1USBA 5J40A 2X64A 1LJRA 1G6WA 4JEDA 3O3TA 4EDZA 1V40A 4ZB8A 2R3XA 3FR6A 4JZQA 4KX4A 5J41A 4HZ2A 4L5OA 2CZ2A 3GH6A 18GSA 4NAXA 4DEJA 17GSA 3HMJG 1PGTA 1GTAA 4ZBAA 4ECJA 1PX7A 1BF5A 3KMNA 2EFDA 9GSSA 2PERA 4G10A 5B7CA 2CA8A 3M8NA 1EV9A 4HJ2A 6GSYA 2OACA 1N2AA 6GSVA 6GSXA 1UA5A 5ELGA 3GUSA 5A4UA 2PVQA 1GSFA 3M3MA 5LD0A 4KDYA 4GSTA 4WR4A 1DUGA 1VF3A 1BG5A 2C3TA 1GLQA 4PNGA 4NHWA 5JCUA 1XW5A 3ZMLA 2C3NA 3ERGA 5DAKA 5KEJA 13GSA 3F63A 4ACSA 3CBUA 1B8XA 3LSZA 3MAKA 2ON7A 5D9WA 4RI7A 4N0VA 4E8HA 2J9HA 3KTLA 3F6DA 5FHIA 2DC5A 5D9TA 1AQVA 3LFLA 5ECHB 2HNLA 5BMUB 4GLTA 5IQYA 4MDCA 1GULA 5EY6A 2GDRA 11GSA 3CRUA 2PGTA 1K3YA 2NTOA 3GSTA 5ECIB 5A1NA 1OYJA 5AISA 5D9VA 4YAVA 3F6FA 4PQIA 4MPFA 5A5HB 1HNBA 1OE7A 3KXOA 3I6AA 1GTBA 1RK4A 4MZWA 6GSSA 4RI6A 3EINA 2VCTA 3TOUA 3GSSA 3D0ZA 4ZXGA 1YY7A 2GSSA 3N5OA 3H1NA 1EV4A 3W8SA 5FWGA 3ISOA 1OE8A 5DDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQA A;  4USS A;  2ON5 A;  2CVD A;  3VK9 A;  5A4V A;  1GSQ A;  1YJ6 A;  3LYP A;  4G19 A;  3IK9 A;  3C8E A;  4EC0 A;  4L5L A;  4QQ7 A;  4MK3 A;  6GST A;  3QR6 A;  2VCQ A;  1VF1 A;  1XW6 A;  4GTU A;  5FT3 A;  1EEM A;  1MD4 A;  22GS A;  1ZL9 A;  5ECS A;  4KDX A;  1OKT A;  3NIV A;  3TOT A;  4KF9 A;  1V2A A;  4YH2 A;  3R3E A;  5EL8 A;  4IVF A;  2VCX A;  2C3Q A;  3FR9 A;  1K0D A;  1HQO A;  1U87 A;  4Q5F A;  1LBK A;  3LG6 A;  3IC8 A;  3SWL A;  1PKW A;  5AGY A;  4LMV A;  5ECL B;  4BVY A;  1Z9H A;  3MDK A;  4ZBB A;  1YDK A;  3WD6 A;  3QAV A;  1PA3 A;  1GTI A;  1IYI A;  2FHE A;  4KH7 A;  1BAY A;  2C4J A;  3M0F A;  1XWG A;  1GWC A;  4PGT A;  4IBP A;  1JZR A;  1E6B A;  5F8B A;  2GSR A;  4ID0 A;  3PPU A;  4HI7 A;  3HKR A;  3DGQ A;  3FRC A;  5J5N A;  4ISD A;  2VD0 A;  2GLR A;  2HRK A;  3DD3 A;  1GNW A;  1PMT A;  3GX0 A;  3O76 A;  1PL2 A;  3EE2 A;  3FY7 A;  3G7J A;  4G0L A;  3GTU A;  10GS A;  5DAL A;  4I97 A;  4KSM A;  4AGS A;  4F0C A;  2CAI A;  4F0B A;  4IEL A;  1F3A A;  3L0H A;  1EOG A;  4LMW A;  1KBN A;  1GUK A;  1HNC A;  3ZFL A;  1YKC A;  1HNA A;  20GS A;  3AY8 A;  4O7H A;  1GSU A;  3PGT A;  3LYK A;  2WRT A;  3HJM A;  4BVX A;  1G6Y A;  1ZGN A;  3KMO A;  4OMV A;  3LJR A;  4O92 A;  3P8W A;  1K0A A;  4Q5Q A;  3UBK A;  1B4P A;  2F8F A;  3VPQ A;  4IKH A;  4IGJ A;  2YV9 A;  2R4V A;  3GUR A;  5AIX A;  3Q18 A;  3QAG A;  1GTU A;  2WDU A;  1PX6 A;  1XWK A;  3VI5 A;  2PBJ A;  5ELA A;  4KAE A;  4NHZ A;  4OFT A;  5ECK B;  3IK7 A;  4PXO A;  4JBB A;  1AQW A;  4MF7 A;  4YQM A;  4WR5 A;  1NHY A;  2WJU A;  4BL7 A;  1K3L A;  4FQU A;  3VPT A;  3HJO A;  1GSE A;  3RBT A;  2WB9 A;  2LJR A;  2JL4 A;  1AQX A;  4ECC A;  4CHS A;  1GSY A;  5JCW A;  1GSD A;  4YQV A;  5ECN B;  5F07 A;  1TU8 A;  4Q5R A;  4MF5 A;  1FHE A;  3ZMK A;  1PL1 A;  5GST A;  4K0N A;  1GUM A;  8GSS A;  1FW1 A;  4KGI A;  3LXZ A;  4L8E A;  5DAL B;  4MF6 A;  6GSU A;  2VD1 A;  2AHE A;  2HSM A;  4ECB A;  5D73 A;  1GLP A;  1VF2 A;  3R2Q A;  3I69 A;  2R5G A;  1F2E A;  2DSA A;  2UZ8 A;  3M1G A;  3UVH A;  4F03 A;  1M99 A;  1IYH A;  3TGZ A;  5DAK B;  5G5E A;  5LCZ A;  3UAP A;  1B48 A;  2AAW A;  19GS A;  5F06 A;  4KDU A;  5DJL A;  1K0O A;  1M9B A;  1U88 A;  4E8E A;  5BMU A;  2HQT A;  2VCW A;  3ZFB A;  6GSW A;  5DCG A;  4OFM A;  4ZB6 A;  2C80 A;  3VUR A;  5EVO A;  1G7O A;  2F3M A;  5F05 A;  4YQU A;  2OA7 A;  5A5K A;  4TOP A;  14GS A;  4EE0 A;  2R6K A;  1K0N A;  1Q4J A;  1ML6 A;  1R5A A;  2V6K A;  4IW9 A;  1VF4 A;  2IMI A;  3Q19 A;  2HSN B;  4PUA A;  2A2R A;  2N5F A;  4G0K A;  1PKZ A;  1MD3 A;  3U6V A;  1C72 A;  4BL7 B;  12GS A;  1GSS A;  4ZB9 A;  3CSI A;  3VI7 A;  1JLW A;  1PD2 1;  3FYG A;  4PUR A;  4OFN A;  3VWX A;  1AXD A;  2A2S A;  2YCD A;  2YV7 A;  2WS2 A;  4YAP A;  4ECI A;  1TW9 A;  4IJI A;  5ECO B;  1MTC A;  5ECP B;  4HZ4 A;  3KJY A;  3CRT A;  4PTS A;  4EDY A;  5HFK A;  4HOJ A;  1M0U A;  16GS A;  3CSH A;  5ECM B;  2HSM B;  1GNE A;  2CAQ A;  1AW9 A;  5AIV A;  4PQH A;  2VCV A;  5GZZ B;  3VLN A;  3UAR A;  1K0B A;  3P90 A;  4GF0 A;  2GSQ A;  4G0I A;  4EXJ A;  2GST A;  4BVY B;  5DJM A;  5A4W A;  1EOH A;  4MP4 A;  4Q5N A;  2VO4 A;  3ERF A;  1U3I A;  3KM6 A;  3LQ7 A;  3WYW A;  1BX9 A;  3PR8 A;  5AN1 A;  2CZ3 A;  3G7I A;  2D2Z A;  3UBL A;  5D9X A;  3IBH A;  2IL3 A;  4J2F A;  4G9H A;  4GSS A;  5G5F A;  2HRK B;  1TDI A;  1YQ1 A;  2VCZ A;  3GTU B;  1K0M A;  1Y6E A;  5J4U A;  1F3B A;  4PNF A;  3LXT A;  4K0G A;  4GSN A;  5DQS A;  4IS0 A;  3Q74 A;  2GTU A;  4KE3 A;  2C8U A;  2HRA A;  5ECQ B;  3CSJ A;  5GSS A;  2PMT A;  2IMK A;  3BBY A;  1K0C A;  1M9A A;  4PX1 A;  1TU7 A;  1GUH A;  4MPG A;  2FNO A;  4BVX B;  3IE3 A;  1BYE A;  3QAW A;  2AB6 A;  1PN9 A;  7GSS A;  5ECR B;  4IQ1 A;  3N9J A;  5F0G A;  3FR3 A;  1K3O A;  3IR4 A;  4ZBD A;  1JLV A;  2OAD A;  1A0F A;  4GCI A;  1USB A;  2X64 A;  1LJR A;  1G6W A;  4JED A;  3O3T A;  4EDZ A;  1V40 A;  4ZB8 A;  2R3X A;  3FR6 A;  4JZQ A;  4KX4 A;  5J41 A;  4HZ2 A;  4L5O A;  2CZ2 A;  3GH6 A;  18GS A;  4NAX A;  4DEJ A;  17GS A;  1PGT A;  1GTA A;  4ZBA A;  4ECJ A;  1PX7 A;  3KMN A;  9GSS A;  2PER A;  4G10 A;  5B7C A;  2CA8 A;  3M8N A;  1EV9 A;  4HJ2 A;  6GSY A;  2OAC A;  1N2A A;  6GSV A;  6GSX A;  1UA5 A;  5ELG A;  3GUS A;  5A4U A;  2PVQ A;  1GSF A;  3M3M A;  5LD0 A;  4KDY A;  4GST A;  4WR4 A;  1DUG A;  1VF3 A;  1BG5 A;  2C3T A;  1GLQ A;  4PNG A;  4NHW A;  5JCU A;  1XW5 A;  3ZML A;  2C3N A;  3ERG A;  5DAK A;  5KEJ A;  13GS A;  3F63 A;  4ACS A;  3CBU A;  1B8X A;  3LSZ A;  3MAK A;  2ON7 A;  5D9W A;  4RI7 A;  4N0V A;  4E8H A;  2J9H A;  3KTL A;  3F6D A;  5FHI A;  2DC5 A;  5D9T A;  1AQV A;  3LFL A;  5ECH B;  2HNL A;  4GLT A;  5IQY A;  4MDC A;  1GUL A;  5EY6 A;  2GDR A;  11GS A;  3CRU A;  2PGT A;  1K3Y A;  2NTO A;  3GST A;  5ECI B;  1OYJ A;  5AIS A;  5D9V A;  4YAV A;  3F6F A;  4PQI A;  4MPF A;  1HNB A;  1OE7 A;  3KXO A;  3I6A A;  1GTB A;  1RK4 A;  4MZW A;  6GSS A;  4RI6 A;  3EIN A;  2VCT A;  3TOU A;  3GSS A;  3D0Z A;  4ZXG A;  1YY7 A;  2GSS A;  3N5O A;  3H1N A;  1EV4 A;  3W8S A;  5FWG A;  3ISO A;  1OE8 A;  5DDL A; 
#chains in the Genus database with same CATH topology
 4IQA A;  4USS A;  2ON5 A;  2CVD A;  3VK9 A;  5A4V A;  1GSQ A;  1YJ6 A;  3LYP A;  4G19 A;  3IK9 A;  2WVX A;  3C8E A;  4EC0 A;  4L5L A;  4QQ7 A;  4MK3 A;  6GST A;  3QR6 A;  2VCQ A;  1VF1 A;  3CWG A;  1XW6 A;  2H1L A;  4GTU A;  5FT3 A;  1EEM A;  1MD4 A;  22GS A;  1ZL9 A;  5ECS A;  4KDX A;  1OKT A;  3NIV A;  3TOT A;  4KF9 A;  2WW0 A;  1V2A A;  4YH2 A;  3R3E A;  5EL8 A;  4IVF A;  2VCX A;  2C3Q A;  3FR9 A;  1K0D A;  1HQO A;  1U87 A;  4Q5F A;  1LBK A;  3LG6 A;  3IC8 A;  3SWL A;  2O36 A;  1PKW A;  5AGY A;  4LMV A;  5ECL B;  4BVY A;  1Z9H A;  3MDK A;  4ZBB A;  1YDK A;  3WD6 A;  3QAV A;  1PA3 A;  1GTI A;  1IYI A;  2FHE A;  4KH7 A;  1BAY A;  2C4J A;  3M0F A;  1XWG A;  1GWC A;  4PGT A;  4IBP A;  5A1N B;  1JZR A;  1E6B A;  5F8B A;  4AKH A;  2GSR A;  4ID0 A;  3PPU A;  4HI7 A;  3HKR A;  3DGQ A;  3FRC A;  5J5N A;  4ISD A;  2VD0 A;  2GLR A;  2HRK A;  3DD3 A;  1GNW A;  3GX0 A;  1PMT A;  3O76 A;  1PL2 A;  3EE2 A;  3FY7 A;  3G7J A;  4G0L A;  3GTU A;  10GS A;  5DAL A;  4I97 A;  4KSM A;  4E68 A;  4AGS A;  4F0C A;  2CAI A;  4F0B A;  4IEL A;  1F3A A;  3L0H A;  1EOG A;  4LMW A;  1KBN A;  1GUK A;  1HNC A;  3ZFL A;  1YKC A;  1HNA A;  20GS A;  3AY8 A;  4W66 A;  4O7H A;  1GSU A;  3PGT A;  3LYK A;  2WRT A;  3HJM A;  1SVO A;  4BVX A;  1G6Y A;  1ZGN A;  3KMO A;  4OMV A;  4AKI A;  3LJR A;  4O92 A;  4FXY P;  3P8W A;  1K0A A;  4Q5Q A;  3UBK A;  1B4P A;  2F8F A;  3RFR C;  3VPQ A;  4IKH A;  4IGJ A;  2YV9 A;  2R4V A;  3GUR A;  5AIX A;  3Q18 A;  4PI2 C;  3QAG A;  1GTU A;  2WDU A;  1PX6 A;  1XWK A;  3VI5 A;  2PBJ A;  5ELA A;  4N3Z A;  4KAE A;  5J47 A;  2O5V A;  4NHZ A;  4OFT A;  5ECK B;  3IK7 A;  4PXO A;  4JBB A;  2HSN A;  1AQW A;  4MF7 A;  4YQM A;  4WR5 A;  1NHY A;  2WJU A;  4BL7 A;  1K3L A;  4FQU A;  3VPT A;  2WVZ A;  3HJO A;  1GSE A;  3RBT A;  2WB9 A;  2LJR A;  2JL4 A;  1AQX A;  4ECC A;  2VKZ G;  4CHS A;  1GSY A;  5JCW A;  1GSD A;  4YQV A;  5ECN B;  4GDF A;  5F07 A;  1TU8 A;  4Q5R A;  4MF5 A;  1FHE A;  2OT3 A;  3ZMK A;  1PL1 A;  5GST A;  4K0N A;  1GUM A;  8GSS A;  1FW1 A;  4KGI A;  1Y1U A;  4PI0 C;  3LXZ A;  4L8E A;  5DAL B;  4MF6 A;  6GSU A;  2VD1 A;  2AHE A;  2HSM A;  4ECB A;  5D73 A;  1GLP A;  1VF2 A;  3R2Q A;  3I69 A;  2R5G A;  1F2E A;  2DSA A;  2UZ8 A;  3M1G A;  3UVH A;  4F03 A;  1M99 A;  1IYH A;  3TGZ A;  5DAK B;  5G5E A;  4AKX B;  5LCZ A;  3UAP A;  1B48 A;  2AAW A;  19GS A;  5F06 A;  4KDU A;  5DJL A;  1K0O A;  1M9B A;  1U88 A;  3CHX C;  4E8E A;  5BMU A;  1S4B P;  2HQT A;  4AI6 A;  2VCW A;  3ZFB A;  6GSW A;  5DCG A;  4OFM A;  4ZB6 A;  2C80 A;  3VUR A;  5EVO A;  1G7O A;  2F3M A;  5F05 A;  4YQU A;  2OA7 A;  5A5H A;  5A5K A;  1BG1 A;  4TOP A;  14GS A;  4EE0 A;  2R6K A;  1K0N A;  1Q4J A;  1ML6 A;  1R5A A;  2V6K A;  4IW9 A;  1VF4 A;  1SVL A;  2EFC A;  2IMI A;  3Q19 A;  2HSN B;  4PUA A;  2A2R A;  2N5F A;  4G0K A;  1PKZ A;  1MD3 A;  3U6V A;  1C72 A;  4BL7 B;  2WW2 A;  12GS A;  1GSS A;  4ZB9 A;  3CSI A;  3VI7 A;  1JLW A;  1PD2 1;  3FYG A;  1YEW C;  4PUR A;  3TU3 B;  4OFN A;  3VWX A;  1AXD A;  1YVL A;  2A2S A;  2YCD A;  2WVX B;  2YV7 A;  2UV8 G;  1SVM A;  2WS2 A;  4YAP A;  4ECI A;  1TW9 A;  4IJI A;  2O3E A;  5ECO B;  1MTC A;  5ECP B;  4HZ4 A;  3KJY A;  3CRT A;  4PTS A;  4EDY A;  1TXU A;  5HFK A;  4HOJ A;  1M0U A;  16GS A;  3CSH A;  4ZB7 A;  2EFE A;  5A34 A;  5ECM B;  4QMK A;  2HSM B;  1GNE A;  2CAQ A;  1AW9 A;  5AIV A;  5J4V A;  4PQH A;  2VCV A;  5GZZ B;  3VLN A;  3UAR A;  1K0B A;  3P90 A;  4GF0 A;  2GSQ A;  4G0I A;  4EXJ A;  2GST A;  4BVY B;  5DJM A;  5A4W A;  1EOH A;  4MP4 A;  4Q5N A;  3RGB C;  2VO4 A;  3ERF A;  1U3I A;  3KM6 A;  3LQ7 A;  3WYW A;  1BX9 A;  3PR8 A;  5AN1 A;  2CZ3 A;  3G7I A;  2D2Z A;  3UBL A;  5D9X A;  3IBH A;  2IL3 A;  4J2F A;  2EFH A;  4G9H A;  4GSS A;  5G5F A;  2HRK B;  1TDI A;  1N25 A;  1YQ1 A;  2VCZ A;  3GTU B;  1K0M A;  1Y6E A;  5J4U A;  1F3B A;  4PNF A;  3LXT A;  4K0G A;  4GSN A;  5DQS A;  4IS0 A;  3Q74 A;  2GTU A;  4KE3 A;  2WW3 A;  2C8U A;  2HRA A;  5ECQ B;  3CSJ A;  5GSS A;  2PMT A;  5J4Y A;  4G01 A;  2IMK A;  3BBY A;  1K0C A;  1M9A A;  4PX1 A;  1TU7 A;  1GUH A;  4MPG A;  2FNO A;  4BVX B;  3IE3 A;  1BYE A;  5A34 B;  3QAW A;  2AB6 A;  1PN9 A;  7GSS A;  5ECR B;  4AKG A;  4IQ1 A;  3N9J A;  5F0G A;  3FR3 A;  1K3O A;  3IR4 A;  4ZBD A;  1JLV A;  2OAD A;  1A0F A;  4GCI A;  1USB A;  5J40 A;  2X64 A;  1LJR A;  1G6W A;  4JED A;  3O3T A;  4EDZ A;  1V40 A;  4ZB8 A;  2R3X A;  3FR6 A;  4JZQ A;  4KX4 A;  5J41 A;  4HZ2 A;  4L5O A;  2CZ2 A;  3GH6 A;  18GS A;  4NAX A;  4DEJ A;  17GS A;  3HMJ G;  1PGT A;  1GTA A;  4ZBA A;  4ECJ A;  1PX7 A;  1BF5 A;  3KMN A;  2EFD A;  9GSS A;  2PER A;  4G10 A;  5B7C A;  2CA8 A;  3M8N A;  1EV9 A;  4HJ2 A;  6GSY A;  2OAC A;  1N2A A;  6GSV A;  2WVY A;  6GSX A;  1UA5 A;  5ELG A;  4PHZ C;  3GUS A;  5A4U A;  2PVQ A;  1GSF A;  3M3M A;  5LD0 A;  4KDY A;  4GST A;  4WR4 A;  1DUG A;  1VF3 A;  1BG5 A;  2C3T A;  1GLQ A;  4PNG A;  4NHW A;  5JCU A;  1XW5 A;  3ZML A;  2WW1 A;  2C3N A;  3ERG A;  5DAK A;  5KEJ A;  13GS A;  3F63 A;  4ACS A;  3CBU A;  1B8X A;  3LSZ A;  3MAK A;  2ON7 A;  5D9W A;  4RI7 A;  4N0V A;  4E8H A;  2J9H A;  3KTL A;  3F6D A;  5FHI A;  2DC5 A;  5D9T A;  1AQV A;  3LFL A;  5ECH B;  2HNL A;  5BMU B;  4GLT A;  5IQY A;  4MDC A;  1GUL A;  5EY6 A;  2GDR A;  11GS A;  3CRU A;  2PGT A;  1K3Y A;  2NTO A;  3GST A;  5ECI B;  5A1N A;  1OYJ A;  5AIS A;  5D9V A;  2WZS A;  4YAV A;  3F6F A;  4PQI A;  4MPF A;  5A5H B;  1I1I P;  1HNB A;  1OE7 A;  3KXO A;  3I6A A;  1GTB A;  1RK4 A;  4MZW A;  6GSS A;  4RI6 A;  3EIN A;  2VCT A;  3TOU A;  3GSS A;  3D0Z A;  4ZXG A;  1YY7 A;  2GSS A;  3N5O A;  3H1N A;  1EV4 A;  3W8S A;  5FWG A;  3ISO A;  1OE8 A;  5DDL A; 
#chains in the Genus database with same CATH homology
 4IQA A;  4USS A;  2ON5 A;  2CVD A;  3VK9 A;  5A4V A;  1GSQ A;  1YJ6 A;  3LYP A;  4G19 A;  3IK9 A;  3C8E A;  4EC0 A;  4L5L A;  4QQ7 A;  4MK3 A;  6GST A;  3QR6 A;  2VCQ A;  1VF1 A;  3CWG A;  1XW6 A;  2H1L A;  4GTU A;  5FT3 A;  1EEM A;  1MD4 A;  22GS A;  1ZL9 A;  5ECS A;  4KDX A;  1OKT A;  3NIV A;  3TOT A;  4KF9 A;  1V2A A;  4YH2 A;  3R3E A;  5EL8 A;  4IVF A;  2VCX A;  2C3Q A;  3FR9 A;  1K0D A;  1HQO A;  1U87 A;  4Q5F A;  1LBK A;  3LG6 A;  3IC8 A;  3SWL A;  1PKW A;  5AGY A;  4LMV A;  5ECL B;  4BVY A;  1Z9H A;  3MDK A;  4ZBB A;  1YDK A;  3WD6 A;  3QAV A;  1PA3 A;  1GTI A;  1IYI A;  2FHE A;  4KH7 A;  1BAY A;  2C4J A;  3M0F A;  1XWG A;  1GWC A;  4PGT A;  4IBP A;  5A1N B;  1JZR A;  1E6B A;  5F8B A;  4AKH A;  2GSR A;  4ID0 A;  3PPU A;  4HI7 A;  3HKR A;  3DGQ A;  3FRC A;  5J5N A;  4ISD A;  2VD0 A;  2GLR A;  2HRK A;  3DD3 A;  1GNW A;  1PMT A;  3GX0 A;  3O76 A;  1PL2 A;  3EE2 A;  3FY7 A;  3G7J A;  4G0L A;  3GTU A;  10GS A;  5DAL A;  4I97 A;  4KSM A;  4E68 A;  4AGS A;  4F0C A;  2CAI A;  4F0B A;  4IEL A;  1F3A A;  3L0H A;  1EOG A;  4LMW A;  1KBN A;  1GUK A;  1HNC A;  3ZFL A;  1YKC A;  1HNA A;  20GS A;  3AY8 A;  4W66 A;  4O7H A;  1GSU A;  3PGT A;  3LYK A;  2WRT A;  3HJM A;  1SVO A;  4BVX A;  1G6Y A;  1ZGN A;  3KMO A;  4OMV A;  4AKI A;  3LJR A;  4O92 A;  3P8W A;  1K0A A;  4Q5Q A;  3UBK A;  1B4P A;  2F8F A;  3VPQ A;  4IKH A;  4IGJ A;  2YV9 A;  2R4V A;  3GUR A;  5AIX A;  3Q18 A;  3QAG A;  1GTU A;  2WDU A;  1PX6 A;  1XWK A;  3VI5 A;  2PBJ A;  5ELA A;  4N3Z A;  4KAE A;  5J47 A;  2O5V A;  4NHZ A;  4OFT A;  5ECK B;  3IK7 A;  4PXO A;  4JBB A;  2HSN A;  1AQW A;  4MF7 A;  4YQM A;  4WR5 A;  1NHY A;  2WJU A;  4BL7 A;  1K3L A;  4FQU A;  3VPT A;  3HJO A;  1GSE A;  3RBT A;  2WB9 A;  2LJR A;  2JL4 A;  1AQX A;  4ECC A;  2VKZ G;  4CHS A;  1GSY A;  5JCW A;  1GSD A;  4YQV A;  5ECN B;  4GDF A;  5F07 A;  1TU8 A;  4Q5R A;  4MF5 A;  1FHE A;  2OT3 A;  3ZMK A;  1PL1 A;  5GST A;  4K0N A;  1GUM A;  8GSS A;  1FW1 A;  4KGI A;  1Y1U A;  3LXZ A;  4L8E A;  5DAL B;  4MF6 A;  6GSU A;  2VD1 A;  2AHE A;  2HSM A;  4ECB A;  5D73 A;  1GLP A;  1VF2 A;  3R2Q A;  3I69 A;  2R5G A;  1F2E A;  2DSA A;  2UZ8 A;  3M1G A;  3UVH A;  4F03 A;  1M99 A;  1IYH A;  3TGZ A;  5DAK B;  5G5E A;  4AKX B;  5LCZ A;  3UAP A;  1B48 A;  2AAW A;  19GS A;  5F06 A;  4KDU A;  5DJL A;  1K0O A;  1M9B A;  1U88 A;  4E8E A;  5BMU A;  2HQT A;  4AI6 A;  2VCW A;  3ZFB A;  6GSW A;  5DCG A;  4OFM A;  4ZB6 A;  2C80 A;  3VUR A;  5EVO A;  1G7O A;  2F3M A;  5F05 A;  4YQU A;  2OA7 A;  5A5H A;  5A5K A;  1BG1 A;  4TOP A;  14GS A;  4EE0 A;  2R6K A;  1K0N A;  1Q4J A;  1ML6 A;  1R5A A;  2V6K A;  4IW9 A;  1VF4 A;  1SVL A;  2EFC A;  2IMI A;  3Q19 A;  2HSN B;  4PUA A;  2A2R A;  2N5F A;  4G0K A;  1PKZ A;  1MD3 A;  3U6V A;  1C72 A;  4BL7 B;  12GS A;  1GSS A;  4ZB9 A;  3CSI A;  3VI7 A;  1JLW A;  1PD2 1;  3FYG A;  4PUR A;  3TU3 B;  4OFN A;  3VWX A;  1AXD A;  1YVL A;  2A2S A;  2YCD A;  2YV7 A;  2UV8 G;  1SVM A;  2WS2 A;  4YAP A;  4ECI A;  1TW9 A;  4IJI A;  5ECO B;  1MTC A;  5ECP B;  4HZ4 A;  3KJY A;  3CRT A;  4PTS A;  4EDY A;  1TXU A;  5HFK A;  4HOJ A;  1M0U A;  16GS A;  3CSH A;  4ZB7 A;  2EFE A;  5A34 A;  5ECM B;  4QMK A;  2HSM B;  1GNE A;  2CAQ A;  1AW9 A;  5AIV A;  5J4V A;  4PQH A;  2VCV A;  5GZZ B;  3VLN A;  3UAR A;  1K0B A;  3P90 A;  4GF0 A;  2GSQ A;  4G0I A;  4EXJ A;  2GST A;  4BVY B;  5DJM A;  5A4W A;  1EOH A;  4MP4 A;  4Q5N A;  2VO4 A;  3ERF A;  1U3I A;  3KM6 A;  3LQ7 A;  3WYW A;  1BX9 A;  3PR8 A;  5AN1 A;  2CZ3 A;  3G7I A;  2D2Z A;  3UBL A;  5D9X A;  3IBH A;  2IL3 A;  4J2F A;  2EFH A;  4G9H A;  4GSS A;  5G5F A;  2HRK B;  1TDI A;  1N25 A;  1YQ1 A;  2VCZ A;  3GTU B;  1K0M A;  1Y6E A;  5J4U A;  1F3B A;  4PNF A;  3LXT A;  4K0G A;  4GSN A;  5DQS A;  4IS0 A;  3Q74 A;  2GTU A;  4KE3 A;  2C8U A;  2HRA A;  5ECQ B;  3CSJ A;  5GSS A;  2PMT A;  5J4Y A;  4G01 A;  2IMK A;  3BBY A;  1K0C A;  1M9A A;  4PX1 A;  1TU7 A;  1GUH A;  4MPG A;  2FNO A;  4BVX B;  3IE3 A;  1BYE A;  5A34 B;  3QAW A;  2AB6 A;  1PN9 A;  7GSS A;  5ECR B;  4AKG A;  4IQ1 A;  3N9J A;  5F0G A;  3FR3 A;  1K3O A;  3IR4 A;  4ZBD A;  1JLV A;  2OAD A;  1A0F A;  4GCI A;  1USB A;  5J40 A;  2X64 A;  1LJR A;  1G6W A;  4JED A;  3O3T A;  4EDZ A;  1V40 A;  4ZB8 A;  2R3X A;  3FR6 A;  4JZQ A;  4KX4 A;  5J41 A;  4HZ2 A;  4L5O A;  2CZ2 A;  3GH6 A;  18GS A;  4NAX A;  4DEJ A;  17GS A;  3HMJ G;  1PGT A;  1GTA A;  4ZBA A;  4ECJ A;  1PX7 A;  1BF5 A;  3KMN A;  2EFD A;  9GSS A;  2PER A;  4G10 A;  5B7C A;  2CA8 A;  3M8N A;  1EV9 A;  4HJ2 A;  6GSY A;  2OAC A;  1N2A A;  6GSV A;  6GSX A;  1UA5 A;  5ELG A;  3GUS A;  5A4U A;  2PVQ A;  1GSF A;  3M3M A;  5LD0 A;  4KDY A;  4GST A;  4WR4 A;  1DUG A;  1VF3 A;  1BG5 A;  2C3T A;  1GLQ A;  4PNG A;  4NHW A;  5JCU A;  1XW5 A;  3ZML A;  2C3N A;  3ERG A;  5DAK A;  5KEJ A;  13GS A;  3F63 A;  4ACS A;  3CBU A;  1B8X A;  3LSZ A;  3MAK A;  2ON7 A;  5D9W A;  4RI7 A;  4N0V A;  4E8H A;  2J9H A;  3KTL A;  3F6D A;  5FHI A;  2DC5 A;  5D9T A;  1AQV A;  3LFL A;  5ECH B;  2HNL A;  5BMU B;  4GLT A;  5IQY A;  4MDC A;  1GUL A;  5EY6 A;  2GDR A;  11GS A;  3CRU A;  2PGT A;  1K3Y A;  2NTO A;  3GST A;  5ECI B;  5A1N A;  1OYJ A;  5AIS A;  5D9V A;  4YAV A;  3F6F A;  4PQI A;  4MPF A;  5A5H B;  1HNB A;  1OE7 A;  3KXO A;  3I6A A;  1GTB A;  1RK4 A;  4MZW A;  6GSS A;  4RI6 A;  3EIN A;  2VCT A;  3TOU A;  3GSS A;  3D0Z A;  4ZXG A;  1YY7 A;  2GSS A;  3N5O A;  3H1N A;  1EV4 A;  3W8S A;  5FWG A;  3ISO A;  1OE8 A;  5DDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...