2HSNB

Structural basis of yeast aminoacyl-trna synthetase complex formation revealed by crystal structures of two binary sub-complexes
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
120
structure length
120
Chain Sequence
b'MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionyl-tRNA synthetase, cytoplasmic
publication title Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/rna binding protein
total genus 40
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hsnB00
1JLVA 5ECMB 10GSA 1K0DA 1ZGNA 1PGTA 1XWKA 4YQMA 1K3OA 5JCWA 5GZZB 3ZFBA 1VF1A 4ZXGA 1GSUA 4ZBBA 3C8EA 2HRKB 4Q5RA 2FHEA 5J41A 1OKTA 2OA7A 3I6AA 2CAIA 2IMKA 3M0FA 3IBHA 4HOJA 2YV7A 1JLWA 4IBPA 4PURA 3VLNA 2CZ2A 1XW6A 3M3MA 4IKHA 4AGSA 1BYEA 4F0BA 2C3QA 1GLQA 3RBTA 3ERFA 5D9TA 4BVXB 5GSSA 1AXDA 3KXOA 1AQVA 1YDKA 5ECKB 1GNWA 3VK9A 19GSA 3F6FA 5ELAA 3VPQA 1PD21 3CRUA 5G5EA 4IJIA 3H1NA 1B8XA 1EV4A 3PPUA 5IQYA 2C8UA 2R5GA 4RI7A 1TU7A 3GTUB 4ECBA 5D9VA 1K0NA 1YJ6A 4YAVA 3ZMKA 1AQXA 4PNGA 1MD4A 4TOPA 1V2AA 1YY7A 3F63A 2J9HA 3Q19A 1GTBA 3QAGA 1M0UA 3CSHA 2R3XA 1K0BA 4ZB9A 5AISA 3O3TA 2AAWA 1V40A 3CSIA 1F2EA 4ECIA 5D9WA 4IGJA 5GSTA 2GTUA 5ECRB 2GSTA 2VCQA 3FR9A 3GSSA 3UARA 8GSSA 3HJOA 4WR5A 4I97A 2FNOA 3N9JA 5EY6A 3KMOA 5ECPB 2GLRA 3QAWA 3HKRA 3PGTA 4O92A 2CVDA 5DAKA 4CHSA 4E8HA 1K0OA 4E8EA 1K3LA 1N2AA 1PMTA 1XWGA 1E6BA 2WS2A 5ECOB 4PUAA 1GLPA 2GDRA 4ISDA 3G7IA 3GUSA 3ISOA 1HNBA 5A5KA 2PMTA 5ECHB 2VCXA 3DD3A 3I69A 11GSA 1GNEA 2DSAA 3FR3A 4HZ4A 5D73A 3IK9A 6GSVA 4GSTA 2YCDA 2GSQA 3VURA 3VI7A 1MTCA 5LD0A 1K3YA 3R2QA 4GTUA 1GSYA 5A4VA 3N5OA 3HJMA 4GSSA 4ZB6A 1DUGA 1USBA 4KF9A 2WDUA 3LFLA 4RI6A 1M9AA 4KX4A 1GSDA 2HRAA 2OADA 1AQWA 1GSSA 4WR4A 5DALB 3TOUA 4G10A 4K0NA 5AIXA 5DDLA 2GSRA 3U6VA 3UVHA 4NHZA 3QR6A 4KDUA 3DGQA 4G19A 1B48A 2GSSA 4KDXA 5FHIA 1GWCA 1KBNA 1GTUA 3UBKA 4MF6A 2HRKA 4GLTA 5ECNB 3CRTA 3MAKA 4MPFA 1PA3A 2D2ZA 3IE3A 3EE2A 1VF2A 4MF5A 1GULA 4J2FA 1XW5A 4DEJA 2HSMB 2HNLA 1RK4A 1VF4A 2VCWA 1GUMA 1K0CA 4LMWA 2R6KA 1U88A 2HQTA 4BVXA 1GSQA 1ML6A 5FWGA 3EINA 4KSMA 4OMVA 3P90A 1GTIA 3O76A 4KE3A 5DQSA 2CAQA 3BBYA 4ACSA 4ZBDA 5DCGA 4OFNA 1HNAA 4USSA 1GTAA 5FT3A 1ZL9A 4JZQA 4NAXA 3FR6A 4Q5NA 3QAVA 3GTUA 4GCIA 5F0GA 5AN1A 4IQAA 2LJRA 4BL7B 2VCVA 5LCZA 1OE8A 1R5AA 6GSXA 3MDKA 17GSA 4KH7A 3LJRA 6GSSA 3KJYA 5KEJA 3LXTA 2AB6A 1IYIA 1B4PA 4MK3A 1M99A 1G7OA 4ZB8A 2PGTA 2F8FA 3P8WA 5ECLB 1LJRA 3GX0A 2VD1A 2DC5A 4MF7A 3TOTA 3FYGA 1OYJA 4LMVA 4ECCA 4IVFA 5F05A 3ZFLA 4O7HA 4KAEA 3SWLA 3F6DA 1PKZA 3IK7A 2YV9A 5AGYA 5JCUA 3LXZA 3VWXA 4PNFA 1TDIA 4OFTA 3WD6A 1K0AA 4BVYB 5DJMA 4IW9A 1PKWA 1G6YA 1FW1A 1PX6A 1AW9A 1PX7A 2C3TA 5J5NA 3Q18A 1YKCA 3R3EA 4FQUA 3NIVA 3M8NA 3TGZA 1NHYA 3LYPA 1HQOA 3L0HA 12GSA 2WJUA 1PL2A 13GSA 4IELA 1PL1A 4EC0A 4G0IA 2ON5A 1U3IA 3VI5A 4MPGA 4G0KA 2C3NA 1PN9A 4YAPA 16GSA 4YQUA 2PVQA 3W8SA 1MD3A 1F3BA 14GSA 2A2RA 4KDYA 6GSUA 3FRCA 4OFMA 2HSNB 5ECIB 9GSSA 4YH2A 1GUHA 6GSWA 1GUKA 3KTLA 2ON7A 4F03A 3IR4A 5J4UA 4L5OA 4PX1A 3KMNA 5DALA 2CA8A 4YQVA 2IL3A 1GSFA 1JZRA 2VO4A 3LSZA 4EDZA 3WYWA 3KM6A 3LYKA 2F3MA 3FY7A 4KGIA 4MP4A 4ID0A 22GSA 4MDCA 4EE0A 2VCTA 4EDYA 5B7CA 3G7JA 2A2SA 2UZ8A 1G6WA 1BG5A 3GSTA 4NHWA 2CZ3A 1TW9A 1OE7A 2V6KA 4HJ2A 2AHEA 5D9XA 3ERGA 2PBJA 2HSMA 4IS0A 2VCZA 1EV9A 1GSEA 3UBLA 4GSNA 1VF3A 2IMIA 4ECJA 2WB9A 4PGTA 4L5LA 1U87A 4HI7A 3PR8A 3CSJA 2NTOA 2R4VA 4QQ7A 4GF0A 5ECSA 2JL4A 1Y6EA 4PTSA 1BX9A 4EXJA 1IYHA 7GSSA 4ZBAA 5ELGA 5DJLA 4JBBA 4MZWA 5G5FA 4G9HA 1UA5A 3GH6A 6GSTA 2N5FA 4PQHA 3AY8A 5DAKB 5EL8A 20GSA 4BL7A 5ECQB 3M1GA 1LBKA 1A0FA 2PERA 4IQ1A 5AIVA 4F0CA 2OACA 4JEDA 4PQIA 4L8EA 1HNCA 6GSYA 4PXOA 2WRTA 1K0MA 1FHEA 4N0VA 1TU8A 3LQ7A 5A4WA 4HZ2A 2X64A 5F07A 1EOGA 2C4JA 3CBUA 3VPTA 1EOHA 2VD0A 3Q74A 1BAYA 4Q5QA 4Q5FA 2C80A 4K0GA 1M9BA 3LG6A 4G0LA 18GSA 1Q4JA 5F06A 3UAPA 1YQ1A 5A4UA 5F8BA 4BVYA 3ZMLA 1Z9HA 5HFKA 1C72A 3IC8A 5EVOA 3GURA 5BMUA 1F3AA 3D0ZA 1EEMA
chains in the Genus database with same CATH superfamily
1JLVA 5ECMB 10GSA 1K0DA 1ZGNA 1PGTA 1XWKA 4YQMA 5J4VA 4AKHA 1K3OA 3CHXC 5JCWA 5GZZB 1YVLA 3ZFBA 1S4BP 1SVOA 1VF1A 4ZXGA 1GSUA 4ZBBA 3C8EA 2HRKB 4Q5RA 2FHEA 5J41A 1OKTA 2OA7A 3I6AA 2CAIA 2IMKA 5A34B 3M0FA 3IBHA 4HOJA 2YV7A 1JLWA 4IBPA 4PURA 3VLNA 2CZ2A 1XW6A 3M3MA 4IKHA 4AGSA 1BYEA 4F0BA 2C3QA 1GLQA 3RBTA 3ERFA 5D9TA 5J47A 4BVXB 2HSNA 5GSSA 1AXDA 3KXOA 1AQVA 1YDKA 5ECKB 2WZSA 1GNWA 3VK9A 19GSA 3F6FA 5ELAA 3VPQA 1PD21 3CRUA 5G5EA 4IJIA 3H1NA 1B8XA 2H1LA 1EV4A 3PPUA 5IQYA 2C8UA 1SVMA 2R5GA 4RI7A 1TU7A 3GTUB 4ZB7A 4ECBA 5D9VA 4W66A 1K0NA 2WW0A 1YJ6A 4YAVA 3ZMKA 1AQXA 5J4YA 4PNGA 1N25A 1MD4A 4TOPA 1V2AA 1YY7A 3F63A 2J9HA 3Q19A 1GTBA 2OT3A 3QAGA 1M0UA 3CSHA 2R3XA 1K0BA 4ZB9A 5AISA 3O3TA 2AAWA 1V40A 3CSIA 1F2EA 4ECIA 5D9WA 4IGJA 4QMKA 5GSTA 2GTUA 5ECRB 2GSTA 2VCQA 3FR9A 3GSSA 3UARA 8GSSA 3HJOA 4WR5A 4I97A 2FNOA 3N9JA 5EY6A 1SVLA 3KMOA 5ECPB 2O3EA 2GLRA 3QAWA 3TU3B 5A1NB 3HKRA 3PGTA 4O92A 2CVDA 5DAKA 4CHSA 4E8HA 2EFDA 1K0OA 4E8EA 1K3LA 1N2AA 1PMTA 1XWGA 1E6BA 2WS2A 5ECOB 4PUAA 1GLPA 2GDRA 4ISDA 3G7IA 4AI6A 3GUSA 3ISOA 1HNBA 5A5KA 2PMTA 5ECHB 2VCXA 3DD3A 2O36A 3I69A 11GSA 1GNEA 2DSAA 3FR3A 4HZ4A 5D73A 4PI0C 3IK9A 6GSVA 4GSTA 2YCDA 2GSQA 3VURA 3VI7A 1MTCA 5LD0A 1K3YA 3R2QA 4GTUA 1GSYA 5A5HB 5A4VA 3N5OA 3HJMA 4GSSA 4ZB6A 1DUGA 4PHZC 1USBA 4AKXB 4KF9A 2WDUA 3CWGA 3LFLA 4RI6A 1M9AA 4KX4A 1GSDA 2HRAA 2OADA 1AQWA 1GSSA 2EFCA 4WR4A 5DALB 4G10A 4K0NA 3RGBC 3TOUA 5AIXA 5DDLA 2GSRA 3U6VA 3UVHA 4NHZA 3QR6A 4KDUA 3DGQA 4G19A 1B48A 2GSSA 4KDXA 5FHIA 1GWCA 1KBNA 1GTUA 3UBKA 4MF6A 4GDFA 2HRKA 4GLTA 5ECNB 5A34A 3CRTA 3MAKA 4MPFA 1PA3A 2D2ZA 3IE3A 3EE2A 1VF2A 4MF5A 1GULA 4J2FA 1XW5A 4DEJA 2HSMB 2HNLA 1RK4A 1VF4A 2VCWA 1GUMA 1K0CA 4LMWA 2R6KA 1U88A 2HQTA 4BVXA 1GSQA 1ML6A 5FWGA 3EINA 4KSMA 4OMVA 3P90A 1GTIA 3O76A 4KE3A 5DQSA 2CAQA 3BBYA 4ACSA 4ZBDA 5DCGA 4OFNA 1HNAA 2WVYA 1GTAA 4USSA 5FT3A 1ZL9A 4JZQA 4NAXA 3FR6A 4Q5NA 3QAVA 3GTUA 2WVXB 2WW2A 4GCIA 5F0GA 5AN1A 4IQAA 2LJRA 1BF5A 4BL7B 2VCVA 5LCZA 3HMJG 1OE8A 1R5AA 6GSXA 3MDKA 17GSA 4PI2C 3RFRC 4KH7A 3LJRA 6GSSA 3KJYA 5KEJA 3LXTA 2AB6A 1IYIA 1B4PA 4MK3A 4AKGA 1M99A 1G7OA 4ZB8A 2PGTA 2F8FA 3P8WA 5ECLB 1LJRA 3GX0A 2VD1A 2DC5A 4MF7A 3TOTA 3FYGA 1OYJA 2EFHA 4LMVA 4ECCA 4IVFA 5F05A 3ZFLA 4O7HA 4KAEA 4E68A 3SWLA 3F6DA 1PKZA 2WVZA 3IK7A 2YV9A 5AGYA 5JCUA 1Y1UA 3LXZA 3VWXA 4PNFA 1TDIA 4OFTA 3WD6A 1K0AA 4BVYB 5DJMA 4IW9A 1PKWA 1G6YA 1FW1A 1PX6A 1AW9A 5A1NA 1PX7A 5BMUB 2C3TA 5J5NA 3Q18A 1YKCA 3R3EA 4FQUA 3NIVA 3M8NA 3TGZA 1NHYA 3LYPA 1HQOA 3L0HA 12GSA 2WJUA 1PL2A 13GSA 4IELA 1PL1A 4EC0A 4G0IA 2ON5A 1U3IA 3VI5A 4MPGA 4G0KA 2C3NA 1PN9A 4YAPA 16GSA 4YQUA 2PVQA 3W8SA 1MD3A 1F3BA 14GSA 2A2RA 4KDYA 5A5HA 6GSUA 3FRCA 4OFMA 2HSNB 5ECIB 9GSSA 4YH2A 1GUHA 6GSWA 1GUKA 3KTLA 1TXUA 2ON7A 4F03A 3IR4A 5J4UA 4L5OA 4PX1A 3KMNA 5DALA 2CA8A 4YQVA 2IL3A 1GSFA 1JZRA 2VO4A 3LSZA 4EDZA 3WYWA 3KM6A 3LYKA 2F3MA 3FY7A 1BG1A 4KGIA 4MP4A 4ID0A 22GSA 4MDCA 4EE0A 2VCTA 1YEWC 4EDYA 4G01A 3G7JA 2A2SA 5B7CA 2UZ8A 1G6WA 1BG5A 3GSTA 4NHWA 2CZ3A 1TW9A 1OE7A 2V6KA 4HJ2A 2AHEA 5D9XA 3ERGA 2PBJA 2HSMA 4IS0A 2VCZA 1EV9A 1GSEA 3UBLA 4GSNA 1I1IP 2WW1A 1VF3A 2IMIA 4ECJA 2WB9A 4PGTA 4L5LA 2EFEA 1U87A 4HI7A 3PR8A 3CSJA 2NTOA 2R4VA 4QQ7A 5J40A 2UV8G 4GF0A 5ECSA 2JL4A 1Y6EA 4PTSA 1BX9A 4EXJA 1IYHA 7GSSA 4ZBAA 5ELGA 5DJLA 4JBBA 4MZWA 5G5FA 4G9HA 1UA5A 2WVXA 2WW3A 3GH6A 4FXYP 6GSTA 2N5FA 4PQHA 3AY8A 5DAKB 5EL8A 20GSA 4BL7A 5ECQB 3M1GA 1LBKA 1A0FA 2PERA 4IQ1A 5AIVA 4F0CA 2OACA 4JEDA 4PQIA 4L8EA 1HNCA 6GSYA 2VKZG 4N3ZA 2WRTA 4PXOA 1K0MA 1FHEA 4N0VA 1TU8A 3LQ7A 5A4WA 4HZ2A 2X64A 5F07A 1EOGA 2C4JA 3CBUA 3VPTA 2O5VA 1EOHA 2VD0A 3Q74A 1BAYA 4Q5QA 4Q5FA 2C80A 4K0GA 1M9BA 3LG6A 4G0LA 18GSA 1Q4JA 5F06A 3UAPA 1YQ1A 5A4UA 5F8BA 4BVYA 3ZMLA 1Z9HA 5HFKA 4AKIA 1C72A 3IC8A 5EVOA 3GURA 5BMUA 1F3AA 3D0ZA 1EEMA
chains in the Genus database with same CATH topology
1JLVA 5ECMB 10GSA 1K0DA 1ZGNA 1PGTA 1XWKA 4YQMA 5J4VA 4AKHA 1K3OA 5JCWA 5GZZB 1YVLA 3ZFBA 1SVOA 1VF1A 4ZXGA 1GSUA 4ZBBA 3C8EA 2HRKB 4Q5RA 2FHEA 5J41A 1OKTA 2OA7A 3I6AA 2CAIA 2IMKA 5A34B 3M0FA 3IBHA 4HOJA 2YV7A 1JLWA 4IBPA 4PURA 3VLNA 2CZ2A 1XW6A 3M3MA 4IKHA 4AGSA 1BYEA 4F0BA 2C3QA 1GLQA 3RBTA 3ERFA 5D9TA 5J47A 4BVXB 2HSNA 5GSSA 1AXDA 3KXOA 1AQVA 1YDKA 5ECKB 1GNWA 3VK9A 19GSA 3F6FA 5ELAA 3VPQA 1PD21 3CRUA 5G5EA 4IJIA 3H1NA 1B8XA 2H1LA 1EV4A 3PPUA 5IQYA 2C8UA 1SVMA 2R5GA 4RI7A 1TU7A 3GTUB 4ZB7A 4ECBA 5D9VA 4W66A 1K0NA 1YJ6A 4YAVA 3ZMKA 1AQXA 5J4YA 4PNGA 1N25A 1MD4A 4TOPA 1V2AA 1YY7A 3F63A 2J9HA 3Q19A 1GTBA 2OT3A 3QAGA 1M0UA 3CSHA 2R3XA 1K0BA 4ZB9A 5AISA 3O3TA 2AAWA 1V40A 3CSIA 1F2EA 4ECIA 5D9WA 4IGJA 4QMKA 5GSTA 2GTUA 5ECRB 2GSTA 2VCQA 3FR9A 3GSSA 3UARA 8GSSA 3HJOA 4WR5A 4I97A 2FNOA 3N9JA 5EY6A 1SVLA 3KMOA 5ECPB 2GLRA 3QAWA 3TU3B 5A1NB 3HKRA 3PGTA 4O92A 2CVDA 5DAKA 4CHSA 4E8HA 2EFDA 1K0OA 4E8EA 1K3LA 1N2AA 1PMTA 1XWGA 1E6BA 2WS2A 5ECOB 4PUAA 1GLPA 2GDRA 4ISDA 3G7IA 4AI6A 3GUSA 3ISOA 1HNBA 5A5KA 2PMTA 5ECHB 2VCXA 3DD3A 3I69A 11GSA 1GNEA 2DSAA 3FR3A 4HZ4A 5D73A 3IK9A 6GSVA 4GSTA 2YCDA 2GSQA 3VURA 3VI7A 1MTCA 5LD0A 1K3YA 3R2QA 4GTUA 1GSYA 5A5HB 5A4VA 3N5OA 3HJMA 4GSSA 4ZB6A 1DUGA 1USBA 4AKXB 4KF9A 2WDUA 3CWGA 3LFLA 4RI6A 1M9AA 4KX4A 1GSDA 2HRAA 2OADA 1AQWA 1GSSA 2EFCA 4WR4A 5DALB 4G10A 4K0NA 3TOUA 5AIXA 5DDLA 2GSRA 3U6VA 3UVHA 4NHZA 3QR6A 4KDUA 3DGQA 4G19A 1B48A 2GSSA 4KDXA 5FHIA 1GWCA 1KBNA 1GTUA 3UBKA 4MF6A 4GDFA 2HRKA 4GLTA 5ECNB 5A34A 3CRTA 3MAKA 4MPFA 1PA3A 2D2ZA 3IE3A 3EE2A 1VF2A 4MF5A 1GULA 4J2FA 1XW5A 4DEJA 2HSMB 2HNLA 1RK4A 1VF4A 2VCWA 1GUMA 1K0CA 4LMWA 2R6KA 1U88A 2HQTA 4BVXA 1GSQA 1ML6A 5FWGA 3EINA 4KSMA 4OMVA 3P90A 1GTIA 3O76A 4KE3A 5DQSA 2CAQA 3BBYA 4ACSA 4ZBDA 5DCGA 4OFNA 1HNAA 4USSA 1GTAA 5FT3A 1ZL9A 4JZQA 4NAXA 3FR6A 4Q5NA 3QAVA 3GTUA 4GCIA 5F0GA 5AN1A 4IQAA 2LJRA 1BF5A 4BL7B 2VCVA 5LCZA 3HMJG 1OE8A 1R5AA 6GSXA 3MDKA 17GSA 4KH7A 3LJRA 6GSSA 3KJYA 5KEJA 3LXTA 2AB6A 1IYIA 1B4PA 4MK3A 4AKGA 1M99A 1G7OA 4ZB8A 2PGTA 2F8FA 3P8WA 5ECLB 1LJRA 3GX0A 2VD1A 2DC5A 4MF7A 3TOTA 3FYGA 1OYJA 2EFHA 4LMVA 4ECCA 4IVFA 5F05A 3ZFLA 4O7HA 4KAEA 4E68A 3SWLA 3F6DA 1PKZA 3IK7A 2YV9A 5AGYA 5JCUA 1Y1UA 3LXZA 3VWXA 4PNFA 1TDIA 4OFTA 3WD6A 1K0AA 4BVYB 5DJMA 4IW9A 1PKWA 1G6YA 1FW1A 1PX6A 1AW9A 5A1NA 1PX7A 5BMUB 2C3TA 5J5NA 3Q18A 1YKCA 3R3EA 4FQUA 3NIVA 3M8NA 3TGZA 1NHYA 3LYPA 1HQOA 3L0HA 12GSA 2WJUA 1PL2A 13GSA 4IELA 1PL1A 4EC0A 4G0IA 2ON5A 1U3IA 3VI5A 4MPGA 4G0KA 2C3NA 1PN9A 4YAPA 16GSA 4YQUA 2PVQA 3W8SA 1MD3A 1F3BA 14GSA 2A2RA 4KDYA 5A5HA 6GSUA 3FRCA 4OFMA 2HSNB 5ECIB 9GSSA 4YH2A 1GUHA 6GSWA 1GUKA 3KTLA 1TXUA 2ON7A 4F03A 3IR4A 5J4UA 4L5OA 4PX1A 3KMNA 5DALA 2CA8A 4YQVA 2IL3A 1GSFA 1JZRA 2VO4A 3LSZA 4EDZA 3WYWA 3KM6A 3LYKA 2F3MA 3FY7A 1BG1A 4KGIA 4MP4A 4ID0A 22GSA 4MDCA 4EE0A 2VCTA 4EDYA 4G01A 3G7JA 2A2SA 5B7CA 2UZ8A 1G6WA 1BG5A 3GSTA 4NHWA 2CZ3A 1TW9A 1OE7A 2V6KA 4HJ2A 2AHEA 5D9XA 3ERGA 2PBJA 2HSMA 4IS0A 2VCZA 1EV9A 1GSEA 3UBLA 4GSNA 1VF3A 2IMIA 4ECJA 2WB9A 4PGTA 4L5LA 2EFEA 1U87A 4HI7A 3PR8A 3CSJA 2NTOA 2R4VA 4QQ7A 5J40A 2UV8G 4GF0A 5ECSA 2JL4A 1Y6EA 4PTSA 1BX9A 4EXJA 1IYHA 7GSSA 4ZBAA 5ELGA 5DJLA 4JBBA 4MZWA 5G5FA 4G9HA 1UA5A 3GH6A 6GSTA 2N5FA 4PQHA 3AY8A 5DAKB 5EL8A 20GSA 4BL7A 5ECQB 3M1GA 1LBKA 1A0FA 2PERA 4IQ1A 5AIVA 4F0CA 2OACA 4JEDA 4PQIA 4L8EA 1HNCA 6GSYA 2VKZG 4N3ZA 2WRTA 4PXOA 1K0MA 1FHEA 4N0VA 1TU8A 3LQ7A 5A4WA 4HZ2A 2X64A 5F07A 1EOGA 2C4JA 3CBUA 3VPTA 2O5VA 1EOHA 2VD0A 3Q74A 1BAYA 4Q5QA 4Q5FA 2C80A 4K0GA 1M9BA 3LG6A 4G0LA 18GSA 1Q4JA 5F06A 3UAPA 1YQ1A 5A4UA 5F8BA 4BVYA 3ZMLA 1Z9HA 5HFKA 4AKIA 1C72A 3IC8A 5EVOA 3GURA 5BMUA 1F3AA 3D0ZA 1EEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JLV A;  5ECM B;  10GS A;  1K0D A;  1ZGN A;  1PGT A;  1XWK A;  4YQM A;  1K3O A;  5JCW A;  5GZZ B;  3ZFB A;  1VF1 A;  4ZXG A;  1GSU A;  4ZBB A;  3C8E A;  2HRK B;  4Q5R A;  2FHE A;  5J41 A;  1OKT A;  2OA7 A;  3I6A A;  2CAI A;  2IMK A;  3M0F A;  3IBH A;  4HOJ A;  2YV7 A;  1JLW A;  4IBP A;  4PUR A;  3VLN A;  2CZ2 A;  1XW6 A;  3M3M A;  4IKH A;  4AGS A;  1BYE A;  4F0B A;  2C3Q A;  1GLQ A;  3RBT A;  3ERF A;  5D9T A;  4BVX B;  5GSS A;  1AXD A;  3KXO A;  1AQV A;  1YDK A;  5ECK B;  1GNW A;  3VK9 A;  19GS A;  3F6F A;  5ELA A;  3VPQ A;  1PD2 1;  3CRU A;  5G5E A;  4IJI A;  3H1N A;  1B8X A;  1EV4 A;  3PPU A;  5IQY A;  2C8U A;  2R5G A;  4RI7 A;  1TU7 A;  3GTU B;  4ECB A;  5D9V A;  1K0N A;  1YJ6 A;  4YAV A;  3ZMK A;  1AQX A;  4PNG A;  1MD4 A;  4TOP A;  1V2A A;  1YY7 A;  3F63 A;  2J9H A;  3Q19 A;  1GTB A;  3QAG A;  1M0U A;  3CSH A;  2R3X A;  1K0B A;  4ZB9 A;  5AIS A;  3O3T A;  2AAW A;  1V40 A;  3CSI A;  1F2E A;  4ECI A;  5D9W A;  4IGJ A;  5GST A;  2GTU A;  5ECR B;  2GST A;  2VCQ A;  3FR9 A;  3GSS A;  3UAR A;  8GSS A;  3HJO A;  4WR5 A;  4I97 A;  2FNO A;  3N9J A;  5EY6 A;  3KMO A;  5ECP B;  2GLR A;  3QAW A;  3HKR A;  3PGT A;  4O92 A;  2CVD A;  5DAK A;  4CHS A;  4E8H A;  1K0O A;  4E8E A;  1K3L A;  1N2A A;  1PMT A;  1XWG A;  1E6B A;  2WS2 A;  5ECO B;  4PUA A;  1GLP A;  2GDR A;  4ISD A;  3G7I A;  3GUS A;  3ISO A;  1HNB A;  5A5K A;  2PMT A;  5ECH B;  2VCX A;  3DD3 A;  3I69 A;  11GS A;  1GNE A;  2DSA A;  3FR3 A;  4HZ4 A;  5D73 A;  3IK9 A;  6GSV A;  4GST A;  2YCD A;  2GSQ A;  3VUR A;  3VI7 A;  1MTC A;  5LD0 A;  1K3Y A;  3R2Q A;  4GTU A;  1GSY A;  5A4V A;  3N5O A;  3HJM A;  4GSS A;  4ZB6 A;  1DUG A;  1USB A;  4KF9 A;  2WDU A;  3LFL A;  4RI6 A;  1M9A A;  4KX4 A;  1GSD A;  2HRA A;  2OAD A;  1AQW A;  1GSS A;  4WR4 A;  5DAL B;  3TOU A;  4G10 A;  4K0N A;  5AIX A;  5DDL A;  2GSR A;  3U6V A;  3UVH A;  4NHZ A;  3QR6 A;  4KDU A;  3DGQ A;  4G19 A;  1B48 A;  2GSS A;  4KDX A;  5FHI A;  1GWC A;  1KBN A;  1GTU A;  3UBK A;  4MF6 A;  2HRK A;  4GLT A;  5ECN B;  3CRT A;  3MAK A;  4MPF A;  1PA3 A;  2D2Z A;  3IE3 A;  3EE2 A;  1VF2 A;  4MF5 A;  1GUL A;  4J2F A;  1XW5 A;  4DEJ A;  2HSM B;  2HNL A;  1RK4 A;  1VF4 A;  2VCW A;  1GUM A;  1K0C A;  4LMW A;  2R6K A;  1U88 A;  2HQT A;  4BVX A;  1GSQ A;  1ML6 A;  5FWG A;  3EIN A;  4KSM A;  4OMV A;  3P90 A;  1GTI A;  3O76 A;  4KE3 A;  5DQS A;  2CAQ A;  3BBY A;  4ACS A;  4ZBD A;  5DCG A;  4OFN A;  1HNA A;  4USS A;  1GTA A;  5FT3 A;  1ZL9 A;  4JZQ A;  4NAX A;  3FR6 A;  4Q5N A;  3QAV A;  3GTU A;  4GCI A;  5F0G A;  5AN1 A;  4IQA A;  2LJR A;  4BL7 B;  2VCV A;  5LCZ A;  1OE8 A;  1R5A A;  6GSX A;  3MDK A;  17GS A;  4KH7 A;  3LJR A;  6GSS A;  3KJY A;  5KEJ A;  3LXT A;  2AB6 A;  1IYI A;  1B4P A;  4MK3 A;  1M99 A;  1G7O A;  4ZB8 A;  2PGT A;  2F8F A;  3P8W A;  5ECL B;  1LJR A;  3GX0 A;  2VD1 A;  2DC5 A;  4MF7 A;  3TOT A;  3FYG A;  1OYJ A;  4LMV A;  4ECC A;  4IVF A;  5F05 A;  3ZFL A;  4O7H A;  4KAE A;  3SWL A;  3F6D A;  1PKZ A;  3IK7 A;  2YV9 A;  5AGY A;  5JCU A;  3LXZ A;  3VWX A;  4PNF A;  1TDI A;  4OFT A;  3WD6 A;  1K0A A;  4BVY B;  5DJM A;  4IW9 A;  1PKW A;  1G6Y A;  1FW1 A;  1PX6 A;  1AW9 A;  1PX7 A;  2C3T A;  5J5N A;  3Q18 A;  1YKC A;  3R3E A;  4FQU A;  3NIV A;  3M8N A;  3TGZ A;  1NHY A;  3LYP A;  1HQO A;  3L0H A;  12GS A;  2WJU A;  1PL2 A;  13GS A;  4IEL A;  1PL1 A;  4EC0 A;  4G0I A;  2ON5 A;  1U3I A;  3VI5 A;  4MPG A;  4G0K A;  2C3N A;  1PN9 A;  4YAP A;  16GS A;  4YQU A;  2PVQ A;  3W8S A;  1MD3 A;  1F3B A;  14GS A;  2A2R A;  4KDY A;  6GSU A;  3FRC A;  4OFM A;  2HSN B;  5ECI B;  9GSS A;  4YH2 A;  1GUH A;  6GSW A;  1GUK A;  3KTL A;  2ON7 A;  4F03 A;  3IR4 A;  5J4U A;  4L5O A;  4PX1 A;  3KMN A;  5DAL A;  2CA8 A;  4YQV A;  2IL3 A;  1GSF A;  1JZR A;  2VO4 A;  3LSZ A;  4EDZ A;  3WYW A;  3KM6 A;  3LYK A;  2F3M A;  3FY7 A;  4KGI A;  4MP4 A;  4ID0 A;  22GS A;  4MDC A;  4EE0 A;  2VCT A;  4EDY A;  5B7C A;  3G7J A;  2A2S A;  2UZ8 A;  1G6W A;  1BG5 A;  3GST A;  4NHW A;  2CZ3 A;  1TW9 A;  1OE7 A;  2V6K A;  4HJ2 A;  2AHE A;  5D9X A;  3ERG A;  2PBJ A;  2HSM A;  4IS0 A;  2VCZ A;  1EV9 A;  1GSE A;  3UBL A;  4GSN A;  1VF3 A;  2IMI A;  4ECJ A;  2WB9 A;  4PGT A;  4L5L A;  1U87 A;  4HI7 A;  3PR8 A;  3CSJ A;  2NTO A;  2R4V A;  4QQ7 A;  4GF0 A;  5ECS A;  2JL4 A;  1Y6E A;  4PTS A;  1BX9 A;  4EXJ A;  1IYH A;  7GSS A;  4ZBA A;  5ELG A;  5DJL A;  4JBB A;  4MZW A;  5G5F A;  4G9H A;  1UA5 A;  3GH6 A;  6GST A;  2N5F A;  4PQH A;  3AY8 A;  5DAK B;  5EL8 A;  20GS A;  4BL7 A;  5ECQ B;  3M1G A;  1LBK A;  1A0F A;  2PER A;  4IQ1 A;  5AIV A;  4F0C A;  2OAC A;  4JED A;  4PQI A;  4L8E A;  1HNC A;  6GSY A;  4PXO A;  2WRT A;  1K0M A;  1FHE A;  4N0V A;  1TU8 A;  3LQ7 A;  5A4W A;  4HZ2 A;  2X64 A;  5F07 A;  1EOG A;  2C4J A;  3CBU A;  3VPT A;  1EOH A;  2VD0 A;  3Q74 A;  1BAY A;  4Q5Q A;  4Q5F A;  2C80 A;  4K0G A;  1M9B A;  3LG6 A;  4G0L A;  18GS A;  1Q4J A;  5F06 A;  3UAP A;  1YQ1 A;  5A4U A;  5F8B A;  4BVY A;  3ZML A;  1Z9H A;  5HFK A;  1C72 A;  3IC8 A;  5EVO A;  3GUR A;  5BMU A;  1F3A A;  3D0Z A;  1EEM A; 
#chains in the Genus database with same CATH topology
 1JLV A;  5ECM B;  10GS A;  1K0D A;  1ZGN A;  1PGT A;  1XWK A;  4YQM A;  5J4V A;  4AKH A;  1K3O A;  3CHX C;  5JCW A;  5GZZ B;  1YVL A;  3ZFB A;  1S4B P;  1SVO A;  1VF1 A;  4ZXG A;  1GSU A;  4ZBB A;  3C8E A;  2HRK B;  4Q5R A;  2FHE A;  5J41 A;  1OKT A;  2OA7 A;  3I6A A;  2CAI A;  2IMK A;  5A34 B;  3M0F A;  3IBH A;  4HOJ A;  2YV7 A;  1JLW A;  4IBP A;  4PUR A;  3VLN A;  2CZ2 A;  1XW6 A;  3M3M A;  4IKH A;  4AGS A;  1BYE A;  4F0B A;  2C3Q A;  1GLQ A;  3RBT A;  3ERF A;  5D9T A;  5J47 A;  4BVX B;  2HSN A;  5GSS A;  1AXD A;  3KXO A;  1AQV A;  1YDK A;  5ECK B;  2WZS A;  1GNW A;  3VK9 A;  19GS A;  3F6F A;  5ELA A;  3VPQ A;  1PD2 1;  3CRU A;  5G5E A;  4IJI A;  3H1N A;  1B8X A;  2H1L A;  1EV4 A;  3PPU A;  5IQY A;  2C8U A;  1SVM A;  2R5G A;  4RI7 A;  1TU7 A;  3GTU B;  4ZB7 A;  4ECB A;  5D9V A;  4W66 A;  1K0N A;  2WW0 A;  1YJ6 A;  4YAV A;  3ZMK A;  1AQX A;  5J4Y A;  4PNG A;  1N25 A;  1MD4 A;  4TOP A;  1V2A A;  1YY7 A;  3F63 A;  2J9H A;  3Q19 A;  1GTB A;  2OT3 A;  3QAG A;  1M0U A;  3CSH A;  2R3X A;  1K0B A;  4ZB9 A;  5AIS A;  3O3T A;  2AAW A;  1V40 A;  3CSI A;  1F2E A;  4ECI A;  5D9W A;  4IGJ A;  4QMK A;  5GST A;  2GTU A;  5ECR B;  2GST A;  2VCQ A;  3FR9 A;  3GSS A;  3UAR A;  8GSS A;  3HJO A;  4WR5 A;  4I97 A;  2FNO A;  3N9J A;  5EY6 A;  1SVL A;  3KMO A;  5ECP B;  2O3E A;  2GLR A;  3QAW A;  3TU3 B;  5A1N B;  3HKR A;  3PGT A;  4O92 A;  2CVD A;  5DAK A;  4CHS A;  4E8H A;  2EFD A;  1K0O A;  4E8E A;  1K3L A;  1N2A A;  1PMT A;  1XWG A;  1E6B A;  2WS2 A;  5ECO B;  4PUA A;  1GLP A;  2GDR A;  4ISD A;  3G7I A;  4AI6 A;  3GUS A;  3ISO A;  1HNB A;  5A5K A;  2PMT A;  5ECH B;  2VCX A;  3DD3 A;  2O36 A;  3I69 A;  11GS A;  1GNE A;  2DSA A;  3FR3 A;  4HZ4 A;  5D73 A;  4PI0 C;  3IK9 A;  6GSV A;  4GST A;  2YCD A;  2GSQ A;  3VUR A;  3VI7 A;  1MTC A;  5LD0 A;  1K3Y A;  3R2Q A;  4GTU A;  1GSY A;  5A5H B;  5A4V A;  3N5O A;  3HJM A;  4GSS A;  4ZB6 A;  1DUG A;  4PHZ C;  1USB A;  4AKX B;  4KF9 A;  2WDU A;  3CWG A;  3LFL A;  4RI6 A;  1M9A A;  4KX4 A;  1GSD A;  2HRA A;  2OAD A;  1AQW A;  1GSS A;  2EFC A;  4WR4 A;  5DAL B;  4G10 A;  4K0N A;  3RGB C;  3TOU A;  5AIX A;  5DDL A;  2GSR A;  3U6V A;  3UVH A;  4NHZ A;  3QR6 A;  4KDU A;  3DGQ A;  4G19 A;  1B48 A;  2GSS A;  4KDX A;  5FHI A;  1GWC A;  1KBN A;  1GTU A;  3UBK A;  4MF6 A;  4GDF A;  2HRK A;  4GLT A;  5ECN B;  5A34 A;  3CRT A;  3MAK A;  4MPF A;  1PA3 A;  2D2Z A;  3IE3 A;  3EE2 A;  1VF2 A;  4MF5 A;  1GUL A;  4J2F A;  1XW5 A;  4DEJ A;  2HSM B;  2HNL A;  1RK4 A;  1VF4 A;  2VCW A;  1GUM A;  1K0C A;  4LMW A;  2R6K A;  1U88 A;  2HQT A;  4BVX A;  1GSQ A;  1ML6 A;  5FWG A;  3EIN A;  4KSM A;  4OMV A;  3P90 A;  1GTI A;  3O76 A;  4KE3 A;  5DQS A;  2CAQ A;  3BBY A;  4ACS A;  4ZBD A;  5DCG A;  4OFN A;  1HNA A;  2WVY A;  1GTA A;  4USS A;  5FT3 A;  1ZL9 A;  4JZQ A;  4NAX A;  3FR6 A;  4Q5N A;  3QAV A;  3GTU A;  2WVX B;  2WW2 A;  4GCI A;  5F0G A;  5AN1 A;  4IQA A;  2LJR A;  1BF5 A;  4BL7 B;  2VCV A;  5LCZ A;  3HMJ G;  1OE8 A;  1R5A A;  6GSX A;  3MDK A;  17GS A;  4PI2 C;  3RFR C;  4KH7 A;  3LJR A;  6GSS A;  3KJY A;  5KEJ A;  3LXT A;  2AB6 A;  1IYI A;  1B4P A;  4MK3 A;  4AKG A;  1M99 A;  1G7O A;  4ZB8 A;  2PGT A;  2F8F A;  3P8W A;  5ECL B;  1LJR A;  3GX0 A;  2VD1 A;  2DC5 A;  4MF7 A;  3TOT A;  3FYG A;  1OYJ A;  2EFH A;  4LMV A;  4ECC A;  4IVF A;  5F05 A;  3ZFL A;  4O7H A;  4KAE A;  4E68 A;  3SWL A;  3F6D A;  1PKZ A;  2WVZ A;  3IK7 A;  2YV9 A;  5AGY A;  5JCU A;  1Y1U A;  3LXZ A;  3VWX A;  4PNF A;  1TDI A;  4OFT A;  3WD6 A;  1K0A A;  4BVY B;  5DJM A;  4IW9 A;  1PKW A;  1G6Y A;  1FW1 A;  1PX6 A;  1AW9 A;  5A1N A;  1PX7 A;  5BMU B;  2C3T A;  5J5N A;  3Q18 A;  1YKC A;  3R3E A;  4FQU A;  3NIV A;  3M8N A;  3TGZ A;  1NHY A;  3LYP A;  1HQO A;  3L0H A;  12GS A;  2WJU A;  1PL2 A;  13GS A;  4IEL A;  1PL1 A;  4EC0 A;  4G0I A;  2ON5 A;  1U3I A;  3VI5 A;  4MPG A;  4G0K A;  2C3N A;  1PN9 A;  4YAP A;  16GS A;  4YQU A;  2PVQ A;  3W8S A;  1MD3 A;  1F3B A;  14GS A;  2A2R A;  4KDY A;  5A5H A;  6GSU A;  3FRC A;  4OFM A;  2HSN B;  5ECI B;  9GSS A;  4YH2 A;  1GUH A;  6GSW A;  1GUK A;  3KTL A;  1TXU A;  2ON7 A;  4F03 A;  3IR4 A;  5J4U A;  4L5O A;  4PX1 A;  3KMN A;  5DAL A;  2CA8 A;  4YQV A;  2IL3 A;  1GSF A;  1JZR A;  2VO4 A;  3LSZ A;  4EDZ A;  3WYW A;  3KM6 A;  3LYK A;  2F3M A;  3FY7 A;  1BG1 A;  4KGI A;  4MP4 A;  4ID0 A;  22GS A;  4MDC A;  4EE0 A;  2VCT A;  1YEW C;  4EDY A;  4G01 A;  3G7J A;  2A2S A;  5B7C A;  2UZ8 A;  1G6W A;  1BG5 A;  3GST A;  4NHW A;  2CZ3 A;  1TW9 A;  1OE7 A;  2V6K A;  4HJ2 A;  2AHE A;  5D9X A;  3ERG A;  2PBJ A;  2HSM A;  4IS0 A;  2VCZ A;  1EV9 A;  1GSE A;  3UBL A;  4GSN A;  1I1I P;  2WW1 A;  1VF3 A;  2IMI A;  4ECJ A;  2WB9 A;  4PGT A;  4L5L A;  2EFE A;  1U87 A;  4HI7 A;  3PR8 A;  3CSJ A;  2NTO A;  2R4V A;  4QQ7 A;  5J40 A;  2UV8 G;  4GF0 A;  5ECS A;  2JL4 A;  1Y6E A;  4PTS A;  1BX9 A;  4EXJ A;  1IYH A;  7GSS A;  4ZBA A;  5ELG A;  5DJL A;  4JBB A;  4MZW A;  5G5F A;  4G9H A;  1UA5 A;  2WVX A;  2WW3 A;  3GH6 A;  4FXY P;  6GST A;  2N5F A;  4PQH A;  3AY8 A;  5DAK B;  5EL8 A;  20GS A;  4BL7 A;  5ECQ B;  3M1G A;  1LBK A;  1A0F A;  2PER A;  4IQ1 A;  5AIV A;  4F0C A;  2OAC A;  4JED A;  4PQI A;  4L8E A;  1HNC A;  6GSY A;  2VKZ G;  4N3Z A;  2WRT A;  4PXO A;  1K0M A;  1FHE A;  4N0V A;  1TU8 A;  3LQ7 A;  5A4W A;  4HZ2 A;  2X64 A;  5F07 A;  1EOG A;  2C4J A;  3CBU A;  3VPT A;  2O5V A;  1EOH A;  2VD0 A;  3Q74 A;  1BAY A;  4Q5Q A;  4Q5F A;  2C80 A;  4K0G A;  1M9B A;  3LG6 A;  4G0L A;  18GS A;  1Q4J A;  5F06 A;  3UAP A;  1YQ1 A;  5A4U A;  5F8B A;  4BVY A;  3ZML A;  1Z9H A;  5HFK A;  4AKI A;  1C72 A;  3IC8 A;  5EVO A;  3GUR A;  5BMU A;  1F3A A;  3D0Z A;  1EEM A; 
#chains in the Genus database with same CATH homology
 1JLV A;  5ECM B;  10GS A;  1K0D A;  1ZGN A;  1PGT A;  1XWK A;  4YQM A;  5J4V A;  4AKH A;  1K3O A;  5JCW A;  5GZZ B;  1YVL A;  3ZFB A;  1SVO A;  1VF1 A;  4ZXG A;  1GSU A;  4ZBB A;  3C8E A;  2HRK B;  4Q5R A;  2FHE A;  5J41 A;  1OKT A;  2OA7 A;  3I6A A;  2CAI A;  2IMK A;  5A34 B;  3M0F A;  3IBH A;  4HOJ A;  2YV7 A;  1JLW A;  4IBP A;  4PUR A;  3VLN A;  2CZ2 A;  1XW6 A;  3M3M A;  4IKH A;  4AGS A;  1BYE A;  4F0B A;  2C3Q A;  1GLQ A;  3RBT A;  3ERF A;  5D9T A;  5J47 A;  4BVX B;  2HSN A;  5GSS A;  1AXD A;  3KXO A;  1AQV A;  1YDK A;  5ECK B;  1GNW A;  3VK9 A;  19GS A;  3F6F A;  5ELA A;  3VPQ A;  1PD2 1;  3CRU A;  5G5E A;  4IJI A;  3H1N A;  1B8X A;  2H1L A;  1EV4 A;  3PPU A;  5IQY A;  2C8U A;  1SVM A;  2R5G A;  4RI7 A;  1TU7 A;  3GTU B;  4ZB7 A;  4ECB A;  5D9V A;  4W66 A;  1K0N A;  1YJ6 A;  4YAV A;  3ZMK A;  1AQX A;  5J4Y A;  4PNG A;  1N25 A;  1MD4 A;  4TOP A;  1V2A A;  1YY7 A;  3F63 A;  2J9H A;  3Q19 A;  1GTB A;  2OT3 A;  3QAG A;  1M0U A;  3CSH A;  2R3X A;  1K0B A;  4ZB9 A;  5AIS A;  3O3T A;  2AAW A;  1V40 A;  3CSI A;  1F2E A;  4ECI A;  5D9W A;  4IGJ A;  4QMK A;  5GST A;  2GTU A;  5ECR B;  2GST A;  2VCQ A;  3FR9 A;  3GSS A;  3UAR A;  8GSS A;  3HJO A;  4WR5 A;  4I97 A;  2FNO A;  3N9J A;  5EY6 A;  1SVL A;  3KMO A;  5ECP B;  2GLR A;  3QAW A;  3TU3 B;  5A1N B;  3HKR A;  3PGT A;  4O92 A;  2CVD A;  5DAK A;  4CHS A;  4E8H A;  2EFD A;  1K0O A;  4E8E A;  1K3L A;  1N2A A;  1PMT A;  1XWG A;  1E6B A;  2WS2 A;  5ECO B;  4PUA A;  1GLP A;  2GDR A;  4ISD A;  3G7I A;  4AI6 A;  3GUS A;  3ISO A;  1HNB A;  5A5K A;  2PMT A;  5ECH B;  2VCX A;  3DD3 A;  3I69 A;  11GS A;  1GNE A;  2DSA A;  3FR3 A;  4HZ4 A;  5D73 A;  3IK9 A;  6GSV A;  4GST A;  2YCD A;  2GSQ A;  3VUR A;  3VI7 A;  1MTC A;  5LD0 A;  1K3Y A;  3R2Q A;  4GTU A;  1GSY A;  5A5H B;  5A4V A;  3N5O A;  3HJM A;  4GSS A;  4ZB6 A;  1DUG A;  1USB A;  4AKX B;  4KF9 A;  2WDU A;  3CWG A;  3LFL A;  4RI6 A;  1M9A A;  4KX4 A;  1GSD A;  2HRA A;  2OAD A;  1AQW A;  1GSS A;  2EFC A;  4WR4 A;  5DAL B;  4G10 A;  4K0N A;  3TOU A;  5AIX A;  5DDL A;  2GSR A;  3U6V A;  3UVH A;  4NHZ A;  3QR6 A;  4KDU A;  3DGQ A;  4G19 A;  1B48 A;  2GSS A;  4KDX A;  5FHI A;  1GWC A;  1KBN A;  1GTU A;  3UBK A;  4MF6 A;  4GDF A;  2HRK A;  4GLT A;  5ECN B;  5A34 A;  3CRT A;  3MAK A;  4MPF A;  1PA3 A;  2D2Z A;  3IE3 A;  3EE2 A;  1VF2 A;  4MF5 A;  1GUL A;  4J2F A;  1XW5 A;  4DEJ A;  2HSM B;  2HNL A;  1RK4 A;  1VF4 A;  2VCW A;  1GUM A;  1K0C A;  4LMW A;  2R6K A;  1U88 A;  2HQT A;  4BVX A;  1GSQ A;  1ML6 A;  5FWG A;  3EIN A;  4KSM A;  4OMV A;  3P90 A;  1GTI A;  3O76 A;  4KE3 A;  5DQS A;  2CAQ A;  3BBY A;  4ACS A;  4ZBD A;  5DCG A;  4OFN A;  1HNA A;  4USS A;  1GTA A;  5FT3 A;  1ZL9 A;  4JZQ A;  4NAX A;  3FR6 A;  4Q5N A;  3QAV A;  3GTU A;  4GCI A;  5F0G A;  5AN1 A;  4IQA A;  2LJR A;  1BF5 A;  4BL7 B;  2VCV A;  5LCZ A;  3HMJ G;  1OE8 A;  1R5A A;  6GSX A;  3MDK A;  17GS A;  4KH7 A;  3LJR A;  6GSS A;  3KJY A;  5KEJ A;  3LXT A;  2AB6 A;  1IYI A;  1B4P A;  4MK3 A;  4AKG A;  1M99 A;  1G7O A;  4ZB8 A;  2PGT A;  2F8F A;  3P8W A;  5ECL B;  1LJR A;  3GX0 A;  2VD1 A;  2DC5 A;  4MF7 A;  3TOT A;  3FYG A;  1OYJ A;  2EFH A;  4LMV A;  4ECC A;  4IVF A;  5F05 A;  3ZFL A;  4O7H A;  4KAE A;  4E68 A;  3SWL A;  3F6D A;  1PKZ A;  3IK7 A;  2YV9 A;  5AGY A;  5JCU A;  1Y1U A;  3LXZ A;  3VWX A;  4PNF A;  1TDI A;  4OFT A;  3WD6 A;  1K0A A;  4BVY B;  5DJM A;  4IW9 A;  1PKW A;  1G6Y A;  1FW1 A;  1PX6 A;  1AW9 A;  5A1N A;  1PX7 A;  5BMU B;  2C3T A;  5J5N A;  3Q18 A;  1YKC A;  3R3E A;  4FQU A;  3NIV A;  3M8N A;  3TGZ A;  1NHY A;  3LYP A;  1HQO A;  3L0H A;  12GS A;  2WJU A;  1PL2 A;  13GS A;  4IEL A;  1PL1 A;  4EC0 A;  4G0I A;  2ON5 A;  1U3I A;  3VI5 A;  4MPG A;  4G0K A;  2C3N A;  1PN9 A;  4YAP A;  16GS A;  4YQU A;  2PVQ A;  3W8S A;  1MD3 A;  1F3B A;  14GS A;  2A2R A;  4KDY A;  5A5H A;  6GSU A;  3FRC A;  4OFM A;  2HSN B;  5ECI B;  9GSS A;  4YH2 A;  1GUH A;  6GSW A;  1GUK A;  3KTL A;  1TXU A;  2ON7 A;  4F03 A;  3IR4 A;  5J4U A;  4L5O A;  4PX1 A;  3KMN A;  5DAL A;  2CA8 A;  4YQV A;  2IL3 A;  1GSF A;  1JZR A;  2VO4 A;  3LSZ A;  4EDZ A;  3WYW A;  3KM6 A;  3LYK A;  2F3M A;  3FY7 A;  1BG1 A;  4KGI A;  4MP4 A;  4ID0 A;  22GS A;  4MDC A;  4EE0 A;  2VCT A;  4EDY A;  4G01 A;  3G7J A;  2A2S A;  5B7C A;  2UZ8 A;  1G6W A;  1BG5 A;  3GST A;  4NHW A;  2CZ3 A;  1TW9 A;  1OE7 A;  2V6K A;  4HJ2 A;  2AHE A;  5D9X A;  3ERG A;  2PBJ A;  2HSM A;  4IS0 A;  2VCZ A;  1EV9 A;  1GSE A;  3UBL A;  4GSN A;  1VF3 A;  2IMI A;  4ECJ A;  2WB9 A;  4PGT A;  4L5L A;  2EFE A;  1U87 A;  4HI7 A;  3PR8 A;  3CSJ A;  2NTO A;  2R4V A;  4QQ7 A;  5J40 A;  2UV8 G;  4GF0 A;  5ECS A;  2JL4 A;  1Y6E A;  4PTS A;  1BX9 A;  4EXJ A;  1IYH A;  7GSS A;  4ZBA A;  5ELG A;  5DJL A;  4JBB A;  4MZW A;  5G5F A;  4G9H A;  1UA5 A;  3GH6 A;  6GST A;  2N5F A;  4PQH A;  3AY8 A;  5DAK B;  5EL8 A;  20GS A;  4BL7 A;  5ECQ B;  3M1G A;  1LBK A;  1A0F A;  2PER A;  4IQ1 A;  5AIV A;  4F0C A;  2OAC A;  4JED A;  4PQI A;  4L8E A;  1HNC A;  6GSY A;  2VKZ G;  4N3Z A;  2WRT A;  4PXO A;  1K0M A;  1FHE A;  4N0V A;  1TU8 A;  3LQ7 A;  5A4W A;  4HZ2 A;  2X64 A;  5F07 A;  1EOG A;  2C4J A;  3CBU A;  3VPT A;  2O5V A;  1EOH A;  2VD0 A;  3Q74 A;  1BAY A;  4Q5Q A;  4Q5F A;  2C80 A;  4K0G A;  1M9B A;  3LG6 A;  4G0L A;  18GS A;  1Q4J A;  5F06 A;  3UAP A;  1YQ1 A;  5A4U A;  5F8B A;  4BVY A;  3ZML A;  1Z9H A;  5HFK A;  4AKI A;  1C72 A;  3IC8 A;  5EVO A;  3GUR A;  5BMU A;  1F3A A;  3D0Z A;  1EEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...