5DJLA

Structure of wt human glutathione transferase in complex with cisplatin in the presence of glutathione.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glutathione S-transferase P
publication title Glutathione transferase P1-1 can inactivate the anti-cancer drug cisplatin by a novel mechanism
rcsb
source organism Homo sapiens
total genus 83
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5djlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5djlA01
5D9WA 3US3A 2H75A 1NW2A 3L4NA 3CSJA 4JR4A 1QFNA 3PGTA 3KH7A 2H1DA 1O6JA 5KN2A 3J7Yb 3RHCA 2PUKC 1SKRB 4EDYA 1OAZA 2H73A 2GDRA 2DLXA 2OKAA 3UBKA 1XXUA 5B8BA 2DBCA 1GWCA 4ECBA 3HY2A 3BBYA 3GKXA 2IMKA 5AIVA 2XPEA 1XWKA 3GL5A 4WR4A 1XBSA 17GSA 3APQA 3FEUA 4MCUA 4RQXA 5DCGA 2GS3A 4FYCA 3C1RA 1BQ7A 5COHA 1VF1A 5D96A 1GLPA 2JU5A 3JCML 1GSEA 4KW6A 3E3EA 4K8MA 1Z7RA 3OR5A 2CT6A 4K0GA 1T3BA 4X0XA 3N9JA 2DJ2A 1X9MB 2GGTA 4IKHA 3HVSA 3GNJA 2IPAA 1PA3A 1ZZYA 1QMVA 4PTSA 4KSOA 4K7IA 3GKNA 5DALA 5ECKB 1X0RA 2LNSA 5IPHA 1HNBA 3QD9A 3DRNA 2PPTA 4AGSA 5JCGA 2I1UA 4ECCA 4NPBA 1RK4A 3RHBA 5LCZA 3QMXA 4F9ZA 4L5OA 3RDWA 1O85A 1V2AA 1K0CA 3DMLA 3GURA 3IPZA 4TW5A 1YKCA 3PINA 1YF0A 4DEJA 1VGLA 3TKRA 4TR0A 2HZEA 4MJCA 4V1Ag 3GV1A 5J41A 5IMDA 5H5SA 3LYPA 2K9FA 3F63A 3GKKA 5ECNB 2B5XA 1GUMA 2REMA 2MBTA 1QXHA 2B7KA 2PGTA 1TP9A 3BJ5A 2WJUA 2JZSA 1UA5A 4ZBDA 3FK8A 3GH9A 3IRAA 2X64A 4G9HA 5IQYA 4N0ZA 4XRAA 4YH2A 1K0DA 3HVXA 4LL1B 3ZREA 1XIYA 1DE2A 3KH9A 2PU9C 3KP9A 1XVQA 2HZFA 3FR6A 2I9HA 2VLUA 3DXBA 3TUEA 3IA1A 1EOHA 3C1SA 1SK1A 1M9AA 1SYXA 3UL3A 1G7EA 5IMCA 1GH2A 1GTIA 3P90A 4DSRA 4ISDA 1OYJA 2NDOA 2NPBA 3IE3A 3O3TA 4GCIA 1GLQA 3GSSA 3TKSA 1B9XC 2CQ9A 1WE0A 3W8JA 2VCQA 4HJMA 1TI1A 1MD4A 3A2WA 4MZBA 2VM1A 3F8UA 2OE3A 2YWOA 5LNKe 1SL0B 1PL1A 4TXOA 3RPNA 4BPYA 2ES7A 1BEDA 4K1FA 2VL9A 1AUCA 3KGKA 2AV4A 4GQCA 1B8XA 2XC2A 3QDNA 2CZ2A 1ZL9A 3VI7A 4TR1B 1Z7PA 3NOFA 2H6YA 3GSTA 3D4TA 1PKZA 1GSFA 2HI7A 2F8FA 4MF6A 4OFNA 3IK9A 4HZ4A 3DYRA 4FQUA 5KN0A 2WRTA 1Q4JA 1MTCA 4IN0A 2A2SA 3G9BA 1CQHA 4HOJA 2LTKA 2H1GA 3KCMA 1KTEA 5DAKA 2KP1A 4ZL8A 5ID2A 1SK2A 4NWYA 5IPGA 2QC7A 2HSNB 4O5RA 2DJ0A 6GSVA 1AW9A 1V9WA 2OE1A 2V6OA 3QAGA 4ZB8A 2GQLA 4HEA2 4Z7XA 1K3LA 6GSWA 4EF0A 5KN1A 1TKDB 3CYNA 1BYEA 4DSSB 1T00A 1GNWA 2WZ9A 1T4ZA 3H4KA 1SD9A 3ZRDA 1TK5B 2GQKA 5EL8A 4JBBA 2VL3A 4RI7A 3I69A 3IV4A 3TOTA 1YKAA 4NXIA 22GSA 1N8JA 3EU4A 4OWYA 4K0NA 2KLXA 2AJQB 4POLA 2C8UA 4IQ1A 3MAKA 5INYA 3APSA 1AQWA 2DIYA 1DSBA 5A4WA 1X9WB 1BAYA 1PX7A 3GA4A 5JCUA 4EKZA 1EGOA 1WP0A 1SD8A 1OKDA 3TKPA 2LUSA 1ILOA 2NBSA 1LBKA 5ABRA 2V2GA 1Z9HA 4IQAA 2LEGA 2IMEA 4J56E 1G7OA 1A23A 1I5GA 2BJXA 2VL2C 4RI6A 1A24A 4IJ3A 2I81A 3L9VA 1XCCA 3ZMLA 2HYXA 4EO3A 4MZWA 1M7TA 3FW2A 2LJRA 3FR9A 5EPFA 1GSDA 4HU9A 4LLRA 1VRSD 1JZWA 4N11A 2HSMA 3O6TA 1VF4A 3LEFA 5D73A 3TCOA 1S3CA 2X8HA 2O8VB 4YQVA 4LMVA 2GZYA 1XPVA 3VWXA 1K0AA 3APOA 4IVFA 2VLTA 2J23A 2P5RA 4GQFA 2EC4A 2FY6A 2XBIA 4HQSA 2B7JA 2L5LA 3HZ4A 1GSSA 2FA4A 4PGTA 3ISOA 2KUCA 5DDLA 2PVQA 1ERWA 3TJGA 3TKSC 3C8EA 3VWVA 3P7XA 2G0FA 4EC0A 2RM6A 1K0BA 2CA8A 5J3RA 2R37A 1KBNA 3KEBA 14GSA 1R5PA 3KXOA 4NV2A 4ML1A 5AIXA 4GTUA 4O7HA 3M1GA 5EY6A 2RM5A 2HSHA 3HJOA 3HJPA 1BJXA 1JHBA 3BOAA 2MMAA 2HQTA 5G2ZA 1K0MA 1DUGA 1SU9A 3N5OA 1A2JA 4I5QA 4PUFC 1WPIA 1PQNA 2L59A 2PMTA 1EWXA 5IMZA 1U3IA 3ZL5A 20GSA 4ZILA 2H6XA 4WEYA 4MH2A 2H01A 4FYBA 4YQUA 2IMDA 2RUFA 2VCXA 4GSSA 5IMVA 3D4MA 5J4UA 3BCIA 5DALB 1Y25A 1O8WA 1A2LA 4KCAA 1GSUA 3M9JA 3F3RA 4K6XA 4AJ6A 1UN2A 3NIVA 2C1YA 1THOA 4KNDA 2GTUA 2HRKA 4N10A 2LNTA 4MPGA 2HFDA 2VCZA 4KDYA 6GSYA 4TN8A 2H70A 4K2DA 2LRNA 2YJ7A 1W4VA 2YZUA 4XS6A 3ZZXA 2YOIA 3F9UA 5D93A 3KP8A 5HFKA 2I4AA 3L0HA 2ZUPA 3NZNA 3F6DA 2NVLA 4CHSA 3HD5A 4EDZA 2L5OA 4QQ7A 2ALBA 2HZEB 3M0FA 1GUKA 5DBQA 3TB2A 1HYUA 19GSA 1PX6A 2YPMA 2YWIA 4XHMA 5CRHA 1T7PB 3DVXA 3GIXA 3GN3A 4OFMA 1GTAA 1WWJA 4MP4A 2H72A 3CTFA 2GQMA 3FKFA 3LFLA 1U3AA 1KNGA 2WCIA 2QSIA 4PQHA 2WS2A 2IMFA 1XW5A 1PKWA 2DSAA 1M2DA 2L4CA 3UARA 3C71A 1EZKA 2XPDA 2RUEA 4P3YB 1ST9A 1XZOA 4K7NA 5IMFA 3IC4A 1ERUA 2L4QA 3DIEA 4MH3A 1U87A 2TRXA 3D6IA 3FR3A 2OE0A 2R6KA 3VPQA 2O85A 3A2XA 1ON4A 1EEMA 5HR1A 2OADA 4WXTA 2LSTA 2ON5A 1FW1A 2CAIA 4HZ2A 2V6KA 4ZL7A 5J9CA 2YANA 2IJYA 5D9TA 4BL7A 5JCWA 4ZBAA 1TTZA 2FD3A 1GSYA 3EMPA 1DBYA 4CDOA 9GSSA 4FO5A 3GHAA 3QPMA 2H0HA 4FH8A 4GSTA 5ECMB 1YZXA 4TXOB 3LQ7A 1ZCPA 1H75A 3WT1A 4XRDA 4ML6A 5DVBA 3PH9A 2HSYA 3FZ5A 2H30A 1SENA 2LJKA 4MF7A 1TI3A 5D8IA 2UZ8A 1USBA 4XCSA 3IDVA 2HXKA 2GSQA 4G0LA 2YWNA 1O8XA 2PWJA 2CVBA 5DQYA 4KSMA 5B7CA 3UEMA 3D5JA 2TRCP 3IR4A 1E6BA 1X9SB 2VUPA 2MYGA 3DEXA 4G10A 4JZQA 2M72A 4ULXA 1PMTA 2E7PA 4XIHA 4XS4A 5DAKB 5CP1A 5ID2B 1OVNA 3GFKA 2MBSA 2E2MA 2P5QA 3A5WA 2CZ3A 1S3DA 2F3MA 2H19A 1SL1B 4TKYA 1Q98A 1JZOA 4BVYB 3MSZA 6GSTA 4DSQA 3FY7A 2LV3A 4O92A 5G5EA 3ZVJA 4L0WA 2ON7A 3UJ1A 4YQMA 2VD1A 4POBA 1GNEA 2G2QA 1EEJA 4JR6A 3F4RA 5BMUA 4HI7A 5DJMA 1TU7A 2LRTA 4MF5A 3QAVA 4EVMA 4EE0A 3FHKA 1SKSB 1ERTA 3HDCA 1CQGA 4WBRD 1X5DA 4OCFA 1QQ2A 4MJAA 4TXVA 2F8AA 5CRDA 3HXSA 4J57E 4QL9A 4ECJA 4GXZA 1OKTA 3H8QA 1VF2A 2EIRA 16GSA 1ZOFA 2YCDA 4KH7A 4TOPA 4WF5A 2B5YA 2VCVA 4XS1A 4MZCA 5B6NA 1I9DA 2F9SA 4I97A 3E9JB 4L0UA 3I6AA 2JACA 5C00A 1T8EB 5CRWA 2YN1A 1NHYA 4TR4A 5CNWA 3M9KA 3TJBA 5F06A 3TKQA 2C0FA 2HSMB 2WB9A 2I3YA 1TJDA 1THXA 4PNGA 1A2MA 5CYYA 3CXGA 1SKWB 1W89A 1GL8A 1XOBA 5JWRB 2R3XA 1NSWA 4IP1A 1EOGA 1QUWA 1HNCA 4IGJA 2DJ3A 4GLTA 4F0BA 3G7YA 2C3QA 3ME8A 3VI5A 6GSXA 3C73A 4AJ8A 4XTSA 1GULA 4BVYA 1YF1A 5EVOA 3SWLA 2Z9SA 1TRWA 5G1LA 1UC7A 2A2RA 4G2EA 1FAAA 4BWSA 3ERFA 2ZNMA 4KB3A 1GSQA 2KOKA 5G31A 3HYPA 4MLYA 2XBQA 2R5GA 3H1NA 3A2VA 2TIRA 2V1MA 1J9BA 1F3AA 4O32A 5L71A 2M80A 2GZPA 5GAND 1VF3A 4NHWA 4YAPA 2FWHA 5ECIB 5IM9A 3UOMA 4IP6A 3EC3A 1FG4A 3DGQA 2VD0A 3VWUA 2LRCA 2O87A 3VPTA 3DVWA 2H74A 2JZTA 5IIZA 2VCWA 4K7OA 4EUYA 3UVHA 1JZRA 1K0OA 3F3QA 1QGVA 1WOUA 4IBPA 2FWFA 4OMVA 2H66A 4Q5FA 5CAXA 1OE7A 6GSUA 1XWAA 2LKUA 1MD3A 1XFLA 4DVCA 2HRKB 3GL3A 4JU5A 1FB6A 2MMZA 2RLIA 4Q5RA 3VK9A 1V57A 3GUSA 2R4VA 5KEJA 2BMXA 3D0ZA 2JADA 3R2QA 3ZFLA 3MNGA 3ZIVA 1X5EA 5ELGA 2E0QA 2IFQA 1XW6A 4L8EA 1WJKA 2JSZA 2MZCA 1YY7A 2CX3A 2X8GA 2JZRA 3ZLPA 5IO2A 3IXRA 3CBUA 3UMAA 2OACA 2AHEA 2LS5A 3UVTA 2HT9A 3CMIA 3L78A 4NMUA 2YWMA 1PD21 3GRXA 3Q18A 3QFBC 4ZXGA 1SJIA 4AJ7A 2VIMA 4LL4B 1R5AA 3Q74A 2CX4A 2AYTA 2AB6A 1A8YA 3IAM2 3S9FA 1M0UA 2VAFA 1Z5YE 2DIZA 3M3MA 1AC1A 2V41A 1IYIA 3UBLA 3EU3A 1G0TA 4KGIA 3WGXA 3IBHA 4USSA 3ZVJD 3QR6A 4I2UA 4POKA 5ECOB 2KHPA 4ZIJA 3KIJA 2DJ1A 2V32A 5D9VA 4E8HA 1EV9A 1FVKA 3BCKA 2WGRA 4KX4A 5C04A 3TJKA 3FZ9A 3GX8A 4WKWA 5H5RA 1TOFA 4NAXA 4BL7B 4ACSA 5HR3A 4OO4A 1EGRA 2CVKA 4MA9A 2C0GA 4KDUA 2JSYA 4MMMA 1OC8A 3IK7A 2K6VA 1X5CA 1FVJA 3ME7A 5IO0A 4F82A 4HQZA 4WBJA 2OBKA 2HE3A 5A5KA 1V58A 2H8LA 5DJLA 3DD3A 1F2EA 1RW1A 1A0RP 3WGEA 1TRUA 1Y6EA 2C0DA 2MMOA 1AXDA 2J9HA 3TOUA 3KMOA 4IW9A 1AIUA 3IOSA 1BG5A 1AQXA 2BTOT 2FWGA 2C3NA 4HU7A 4F0CA 5HFGA 2IL3A 1XWGA 2M46A 3TKSE 3HCZA 3ZYWA 1C72A 4OCEA 2FUG2 3GTUB 3L9UA 3W6GA 3GKMA 4XS4B 2C80A 1M9BA 1M99A 4BWQA 2FWEA 4KE3A 2FCHA 5LD0A 1R4WA 1M2BA 4KDXA 4GWRA 1LU4A 2IIYA 3ED3A 2B1LA 1ZMAA 4GF0A 3J7Yk 3A3TA 3PR8A 1J08A 4MDCA 4V2MA 1EV4A 3Q6OA 2P31A 4I8BA 4TVEA 5J9BA 5HQPA 3LSZA 3HA9A 4IELA 1K3YA 2GVPA 1TK0B 4TR3A 1YQ1A 4KA0A 2YP6A 1ZGNA 4G19A 5A4UA 3MDKA 5J5NA 2IN3A 3CSIA 2GZZA 2YNXA 2C0EA 1YDKA 2A4VA 2H71A 1PRXA 2FHEA 1SJ6A 1TRVA 2LQQA 3I9V2 4BVXA 3E0UA 2DC5A 3EVIA 1LJRA 2GT5A 3IHQA 3CRUA 13GSA 2H1AA 3O76A 1R7HA 2WULA 3LXTA 2XHFA 5GSSA 2FLSA 2WFCA 4AF2A 1GTBA 1G6YA 3HVVA 4OD7A 2VCTA 4N0VA 3TGZA 5AGYA 3AY8A 2LQOA 3WGDA 5F0GA 3LG6A 2DMLA 5F05A 4WF4A 4I2TA 5FT3A 5IMAA 2B6MA 4BA7A 4L5LA 2HLSA 2HNLA 1YEPA 1U6TA 1MDKA 1JLVA 4HDEA 2EIQA 2HRAA 4J2FA 3L9SA 1A8LA 3DWVA 3M8NA 2GSTA 2L57A 3VLNA 3U5RE 4EXJA 2N5FA 1V40A 1Z6MA 5AN1A 2DMMA 1B48A 3GTUA 4D73A 5CO3A 1YJ6A 3HZ8A 3LYKA 1DE1A 2HRFA 4RQRA 1TRSA 3LXZA 3UIWA 1HQOA 1OE8A 1K0NA 3RBTA 3EYTA 1OC9A 2K8VA 1ZYEA 1GRXA 2YJHA 2O7KA 1WIKA 4GSNA 2B3SA 1ERVA 3EURA 3BD2A 5F07A 1HNAA 3WYWA 2VL2A 3GYKA 4PNFA 1R26A 1YEXA 5ELAA 4V1Ap 5CRGA 12GSA 4MPFA 3EINA 1RQMA 3WT2A 2GT6A 2H6ZA 3W8SA 4KCEA 3VFIA 3TJJA 3IC8A 3KJYA 3CSHA 11GSA 2F51A 4EL1A 5DQSA 3RPPA 4JEDA 2L6CA 1OC3A 7GSSA 3K8NA 4G0IA 1ABAA 3WD6A 4MK3A 3Q19A 1GP1A 1NM3A 3TRXA 2QGVA 2DJKA 4LMWA 3QAWA 1E2YA 4ZL9A 1PN9A 3PPUA 2B5EA 4LA1A 2GSRA 5B6MA 1SL2B 4HS1A 3FYGA 4KUNA 2DJJA 1XWBA 2X8CA 4GRFA 1F3BA 4V2NA 3SBCA 2N5AA 2PERA 2IFQB 4WETA 2K18A 3G7IA 2VLVA 4IJIA 4Q5NA 1F9MA 1M2AA 3RAZA 3ZITA 2GLRA 3LGCA 2D2ZA 1ACVA 2YV9A 4ID0A 5HFIA 3V1WA 3F4TA 1MDIA 1WRYA 3QFAC 4HUAA 5H5QA 4PUAA 2LJAA 4MJBA 10GSA 1FO5A 2MMNA 4ECIA 3P8WA 5G30A 2OA7A 3GX0A 4N30A 5ECRB 3TRPA 2FGXA 2FNOA 2C4JA 5B8AA 1JFUA 3TDGA 4K9ZA 5E4WA 2OBIA 1Z6NA 3EWLA 1BX9A 1A0FA 3EE2A 5F8BA 1K3OA 2X99A 2P0GA 1ZYQB 5IOXA 1B4QA 2C3TA 5GAPD 3ZMKA 3LWAA 3HHVA 2PBJA 1WMJA 2PN8A 1S3AA 1TK8B 1T4YA 1B4PA 2K8SA 1FHEA 1QK8A 3FRCA 3G7JA 1F6MC 4OFTA 2FA8A 1AAZA 1IYHA 2IWTA 2AUVA 3MWHA 3HJMA 1HD2A 2O89A 3FZAA 2RIIA 6GSSA 3R3EA 3TRQA 2KP2A 3P2AA 1URMA 4JRRA 3F6FA 2GSSA 3ZFBA 4WR5A 2H0GA 4ZBBA 1MEKA 3KMNA 5DCHA 4OO5A 4ILFA 3ERGA 2CV4A 4X1UA 4JE1A 5ENUA 5ECLB 4PQIA 3KD0A 2QKEA 3U6VA 3C7MA 5GSTA 3ZTLA 1TXXA 1KEBA 1JLWA 2R2JA 3TJFA 5JWOB 1XW9A 2L6DA 1MDJA 4E8EA 3D22A 1SK0A 2B1KA 4TR1A 2E2GA 1ML6A 4NHZA 4MABA 1XOAA 1PSQA 1SJZA 2ZCTA 4FIWA 4PQ1A 5HR0A 1H4OA 4X43A 3HKRA 3D21A 3GH6A 3KTBA 1U88A 3I43A 1EP8A 4QL7A 3DKSA 3IAS2 5FWGA 3FZ4A 3F4SA 4IS0A 1GUHA 1B9YC 1PL2A 4F03A 4POMA 3QCPA 3KZQA 5AISA 5G1KA 1O73A 4G0KA 1Z3EA 4TRXA 4HJ2A 4ZB6A 5KN3A 1JZDA 5JWQB 2CVDA 4CW9A 3CTGA 4KF9A 2JL4A 4V2LA 2YV7A 4KAEA 3EMXA 1GTUA 4DSSA 1J0FA 4BVXB 5ECQB 1AQVA 5HR2A 2HRNA 5G5FA 2CAQA 5ECPB 2H76A 5FHIA 3F0IA 3LORA 1TU8A 2N5BA 8GSSA 1EP7A 2VO4A 5A4VA 3VWWA 1TDIA 18GSA 1O81A 4NV5A 2H0IA 2H1BA 4Q5QA 3UAPA 5GZZB 3VURA 4PXOA 3LJRA 2OJLA 1UVZA 1PGTA 4F2IA 2AAWA 4ZB9A 1XVWA 5E59A 1SYRA 5IOWA 1V98A 3H93A 1F37A 1T1VA 2YZHA 3ERWA 4PURA 2VOCA 2IMIA 4RUVA 4D73B 1NHOA 3QOUA 1FB0A 4YAVA 3CRTA 4H86A 5D9XA 5CREA 2NTOA 2EIOA 3KTLA 4I6XA 1N2AA 5ECHB 1FOVA 1OC9B 4FYUA 1G6WA 4IHUA 1O7UA 3H79A 3GMFA 3ZIJA 1XWCA 5ECSA 2VM2A 4PX1A 3KM6A 2WDUA 1TW9A 4MJEA 2PVOC
chains in the Genus database with same CATH superfamily
5D9WA 3US3A 2H75A 1NW2A 3L4NA 3CSJA 4JR4A 1QFNA 3PGTA 3KH7A 2H1DA 1O6JA 5KN2A 3J7Yb 3RHCA 2PUKC 1SKRB 4EDYA 1OAZA 2H73A 2GDRA 2DLXA 2OKAA 3UBKA 1XXUA 5B8BA 2DBCA 1GWCA 4ECBA 3HY2A 3BBYA 3GKXA 2IMKA 5AIVA 2XPEA 1XWKA 3GL5A 4WR4A 1XBSA 17GSA 3APQA 3FEUA 4MCUA 4MNNA 4RQXA 5DCGA 2GS3A 4FYCA 3C1RA 4G01A 1BQ7A 5COHA 1VF1A 5D96A 1GLPA 2JU5A 3JCML 1GSEA 4KW6A 3E3EA 4K8MA 1Z7RA 3OR5A 2CT6A 4K0GA 1T3BA 4X0XA 3N9JA 2DJ2A 1X9MB 2GGTA 4IKHA 3HVSA 3GNJA 2IPAA 1PA3A 1ZZYA 1QMVA 4PTSA 4KSOA 4K7IA 3GKNA 5DALA 5ECKB 1X0RA 2LNSA 5IPHA 1HNBA 3QD9A 3DRNA 2PPTA 4AGSA 5JCGA 2I1UA 4ECCA 4NPBA 1RK4A 3RHBA 5A34B 5LCZA 3QMXA 4F9ZA 4L5OA 3RDWA 1O85A 1V2AA 4Z2RA 1K0CA 3DMLA 3GURA 3IPZA 4TW5A 1YKCA 3PINA 1YF0A 4DEJA 1VGLA 3TKRA 4TR0A 2HZEA 4MJCA 4V1Ag 2WVZA 3GV1A 5J41A 2QA2A 5IMDA 5H5SA 3LYPA 2K9FA 3F63A 3GKKA 5ECNB 2B5XA 1GUMA 2REMA 2MBTA 1QXHA 2B7KA 2PGTA 1TP9A 3BJ5A 2WJUA 2JZSA 1UA5A 4ZBDA 3FK8A 3GH9A 3IRAA 2X64A 4G9HA 5IQYA 2O5VA 4N0ZA 4XRAA 4YH2A 1K0DA 3HVXA 4LL1B 3ZREA 1XIYA 1DE2A 3KH9A 2PU9C 3KP9A 1XVQA 2HZFA 3FR6A 2I9HA 2VLUA 3DXBA 1YVLA 3TUEA 3IA1A 1EOHA 3C1SA 1SK1A 1M9AA 1SYXA 3UL3A 1G7EA 5IMCA 1GH2A 1GTIA 3P90A 4DSRA 4ISDA 1OYJA 2NDOA 3CHXC 2NPBA 3IE3A 3O3TA 4GCIA 1GLQA 3GSSA 3TKSA 1B9XC 2CQ9A 1WE0A 3W8JA 2VCQA 4HJMA 1TI1A 1MD4A 3A2WA 4MZBA 2VM1A 3F8UA 2OE3A 2YWOA 5LNKe 1SL0B 1PL1A 4TXOA 3RPNA 4BPYA 2ES7A 1BEDA 4K1FA 2VL9A 5A1NB 1AUCA 3KGKA 2AV4A 4GQCA 1B8XA 2XC2A 3QDNA 2CZ2A 1ZL9A 3VI7A 4TR1B 1Z7PA 3NOFA 2H6YA 3GSTA 3D4TA 1PKZA 1GSFA 2HI7A 2F8FA 4MF6A 4OFNA 3IK9A 4HZ4A 3DYRA 4FQUA 5KN0A 2WRTA 1Q4JA 1MTCA 4IN0A 2A2SA 1BF5A 4PI0C 3G9BA 1CQHA 4HOJA 2LTKA 2H1GA 1SVMA 3KCMA 1KTEA 5DAKA 2KP1A 4ZL8A 5ID2A 1SK2A 4NWYA 5IPGA 2QC7A 2HSNB 4O5RA 2DJ0A 6GSVA 1AW9A 1V9WA 2OE1A 2V6OA 3QAGA 4ZB8A 2GQLA 4HEA2 4Z7XA 1K3LA 6GSWA 4EF0A 5KN1A 1TKDB 3CYNA 1BYEA 4DSSB 1T00A 1GNWA 2WZ9A 1T4ZA 3H4KA 1SD9A 3ZRDA 1TK5B 2GQKA 1TXUA 5EL8A 4JBBA 2VL3A 4RI7A 3I69A 3IV4A 3TOTA 1YKAA 4NXIA 22GSA 1N8JA 3EU4A 4OWYA 4K0NA 2KLXA 2AJQB 4POLA 2C8UA 4IQ1A 3MAKA 5INYA 3APSA 1AQWA 2DIYA 5BRTA 1DSBA 5A4WA 1X9WB 1BAYA 1PX7A 3GA4A 5JCUA 4EKZA 1EGOA 1WP0A 1SD8A 2WW2A 1OKDA 3TKPA 2LUSA 1ILOA 2EFDA 2NBSA 1LBKA 5ABRA 2V2GA 1Z9HA 4IQAA 2LEGA 4A5PA 2IMEA 4J56E 1G7OA 1A23A 2O36A 4O5QA 1I5GA 2BJXA 2VL2C 4RI6A 1A24A 4IJ3A 2I81A 3L9VA 1XCCA 3ZMLA 2HYXA 4EO3A 2O3EA 4MZWA 1M7TA 3FW2A 2LJRA 3FR9A 5EPFA 1GSDA 4HU9A 4LLRA 4CY6A 1VRSD 1JZWA 4N11A 2HSMA 3O6TA 1VF4A 3LEFA 5D73A 3TCOA 1S3CA 2X8HA 2WZSA 2O8VB 4YQVA 4LMVA 2GZYA 1XPVA 3VWXA 1K0AA 3APOA 4IVFA 2VLTA 2J23A 4O5UA 2P5RA 4GQFA 2EC4A 2FY6A 2XBIA 2B7JA 4HQSA 3HZ4A 2L5LA 1GSSA 2FA4A 4PGTA 3ISOA 2KUCA 5DDLA 2PVQA 1ERWA 3TJGA 3TKSC 3C8EA 5KOXA 3VWVA 2EFCA 3TU3B 3P7XA 2G0FA 4EC0A 2RM6A 1K0BA 2CA8A 1PN0A 5J3RA 2R37A 1KBNA 3KEBA 14GSA 1R5PA 3KXOA 4NV2A 4ML1A 5AIXA 4GTUA 4O7HA 3M1GA 5EY6A 2RM5A 2HSHA 3HJOA 2X4AA 3HJPA 1BJXA 1JHBA 3BOAA 2MMAA 2HQTA 5G2ZA 1K0MA 1DUGA 1SU9A 3N5OA 1A2JA 4I5QA 4PUFC 1WPIA 1PQNA 2L59A 2PMTA 1EWXA 5IMZA 1U3IA 3ZL5A 20GSA 4ZILA 4CY8A 2H6XA 4WEYA 4MH2A 2H01A 4FYBA 2VKZG 4YQUA 2IMDA 2RUFA 2VCXA 4GSSA 5IMVA 3D4MA 5J4UA 3BCIA 5DALB 1Y25A 1O8WA 1A2LA 4KCAA 1GSUA 3M9JA 3F3RA 4K6XA 4AJ6A 1UN2A 1XG8A 3NIVA 2C1YA 1THOA 4KNDA 2GTUA 2HRKA 4N10A 2LNTA 4MPGA 2HFDA 2VCZA 4KDYA 6GSYA 1M3JA 4TN8A 1SVLA 2H70A 4K2DA 2LRNA 2YJ7A 1W4VA 2YZUA 4XS6A 3ZZXA 2YOIA 3F9UA 5D93A 3KP8A 5HFKA 2I4AA 3L0HA 5J4VA 2ZUPA 4FXYP 3NZNA 3F6DA 2NVLA 4CHSA 3HD5A 4EDZA 2L5OA 4QQ7A 2ALBA 2HZEB 3M0FA 4AI6A 1GUKA 5DBQA 3TB2A 1HYUA 19GSA 1PX6A 2YPMA 2YWIA 4XHMA 5CRHA 1T7PB 3DVXA 3GIXA 3GN3A 4OFMA 1GTAA 1WWJA 4MP4A 2H72A 3CTFA 2GQMA 3FKFA 3LFLA 1U3AA 1KNGA 2WCIA 1PFOA 2QSIA 4PQHA 2WS2A 2IMFA 1XW5A 1PKWA 2DSAA 1M2DA 2L4CA 3UARA 3C71A 1EZKA 2XPDA 2RUEA 4P3YB 1ST9A 1XZOA 4K7NA 5IMFA 3IC4A 1ERUA 2L4QA 3DIEA 4MH3A 1U87A 2TRXA 3D6IA 3FR3A 2OE0A 2R6KA 3VPQA 2O85A 3A2XA 1ON4A 1EEMA 5HR1A 2OADA 4WXTA 2LSTA 2ON5A 1FW1A 1Y1UA 4AKIA 2CAIA 4HZ2A 2V6KA 4ZL7A 2WW0A 5J9CA 2YANA 2IJYA 2OT3A 5D9TA 4BL7A 5JCWA 4ZBAA 1TTZA 2FD3A 1GSYA 3EMPA 1DBYA 4CDOA 9GSSA 4FO5A 3GHAA 3QPMA 2H0HA 4FH8A 4GSTA 5ECMB 1YZXA 4TXOB 3LQ7A 1ZCPA 1H75A 3WT1A 4XRDA 4ML6A 5DVBA 3PH9A 2HSYA 2DKIA 3FZ5A 2H30A 1SENA 2LJKA 4EIQA 4MF7A 1TI3A 2R0GA 5D8IA 2A4HA 5J4YA 2UZ8A 1USBA 4XCSA 3IDVA 2HXKA 2GSQA 4G0LA 2YWNA 4Z2UA 1N25A 1O8XA 2PWJA 2CVBA 5DQYA 4KSMA 5B7CA 3UEMA 3D5JA 3HVNA 2TRCP 3IR4A 1E6BA 1X9SB 2VUPA 2MYGA 1S3RA 3DEXA 4G10A 4JZQA 2M72A 4ULXA 1PMTA 2E7PA 4XIHA 4XS4A 5DAKB 5CP1A 5ID2B 1OVNA 3GFKA 2MBSA 2E2MA 2P5QA 3A5WA 2CZ3A 1S3DA 2F3MA 2H19A 1SL1B 4TKYA 1Q98A 1JZOA 4BVYB 3MSZA 6GSTA 4DSQA 3FY7A 2LV3A 4O92A 5G5EA 3ZVJA 4L0WA 2ON7A 3UJ1A 4PHZC 4YQMA 2VD1A 4POBA 1GNEA 2G2QA 1EEJA 4JR6A 3F4RA 5BMUA 4HI7A 5DJMA 1TU7A 2LRTA 4MF5A 3QAVA 4EVMA 4EE0A 3FHKA 1SKSB 3RGBC 3RFRC 1ERTA 3HDCA 1CQGA 4WBRD 1X5DA 4OCFA 1QQ2A 4MJAA 4TXVA 2F8AA 5CRDA 3HXSA 4J57E 4QL9A 4ECJA 4GXZA 1OKTA 3H8QA 1VF2A 2EIRA 16GSA 1ZOFA 2YCDA 4KH7A 4TOPA 4WF5A 2B5YA 2VCVA 4XS1A 4MZCA 5B6NA 1I9DA 2F9SA 4I97A 3E9JB 4L0UA 3I6AA 2JACA 5C00A 1T8EB 2DKHA 5CRWA 2YN1A 1NHYA 4TR4A 5CNWA 3M9KA 3TJBA 5F06A 3TKQA 2C0FA 2HSMB 2WB9A 2R0PA 2H1LA 2I3YA 1TJDA 1THXA 3CQFA 3IHGA 2WW1A 4PNGA 1A2MA 5CYYA 3CXGA 1SKWB 1W89A 1GL8A 1XOBA 1ZYPA 5JWRB 2R3XA 1NSWA 4IP1A 1EOGA 1QUWA 1HNCA 4IGJA 2DJ3A 4GLTA 4F0BA 3G7YA 2C3QA 3CWGA 3VI5A 3ME8A 6GSXA 3C73A 4AJ8A 4XTSA 1GULA 4BVYA 1YF1A 5EVOA 3SWLA 2Z9SA 1TRWA 5G1LA 1UC7A 2A2RA 4G2EA 1FAAA 4BWSA 3ERFA 2ZNMA 4KB3A 1GSQA 2KOKA 5G31A 3HYPA 4MLYA 2XBQA 2R5GA 3H1NA 3A2VA 4X4JA 2TIRA 2V1MA 1J9BA 1F3AA 4O32A 5L71A 2M80A 2GZPA 5GAND 1VF3A 4NHWA 4YAPA 2FWHA 5ECIB 5IM9A 3UOMA 4IP6A 3EC3A 1FG4A 3DGQA 2VD0A 2WVYA 3VWUA 2LRCA 2O87A 4PI2C 3VPTA 3DVWA 2H74A 2JZTA 4QMKA 5IIZA 2VCWA 4K7OA 4EUYA 3UVHA 1JZRA 1K0OA 3F3QA 1QGVA 1WOUA 4Z2TA 4IBPA 2FWFA 4OMVA 2H66A 4Q5FA 5CAXA 1OE7A 6GSUA 1XWAA 2LKUA 1MD3A 1XFLA 4DVCA 2HRKB 3GL3A 4JU5A 1FB6A 2MMZA 2RLIA 4Q5RA 3VK9A 1V57A 3GUSA 2R4VA 5KEJA 2BMXA 3D0ZA 2JADA 3R2QA 3ZFLA 5KOWA 3MNGA 3ZIVA 1X5EA 5ELGA 2E0QA 2IFQA 1XW6A 4L8EA 1WJKA 2JSZA 2MZCA 1YY7A 2CX3A 2X8GA 2UV8G 2JZRA 3ZLPA 5IO2A 3IXRA 3CBUA 3UMAA 2OACA 2AHEA 2LS5A 3UVTA 2HT9A 3CMIA 3L78A 4NMUA 2YWMA 1PD21 3GRXA 3Q18A 3QFBC 4ZXGA 1SJIA 4AJ7A 2VIMA 4LL4B 4W66A 1R5AA 3Q74A 2CX4A 2AYTA 2AB6A 1A8YA 3IAM2 3S9FA 1M0UA 2VAFA 1Z5YE 2DIZA 3M3MA 1AC1A 2V41A 1IYIA 3UBLA 3EU3A 1G0TA 4KGIA 3WGXA 3IBHA 4USSA 3ZVJD 3QR6A 4I2UA 4POKA 5ECOB 2KHPA 4ZIJA 3KIJA 2DJ1A 2V32A 5D9VA 4E8HA 1EV9A 1FVKA 3BCKA 4AKGA 2WGRA 4KX4A 5C04A 3TJKA 3FZ9A 4YKFA 3GX8A 4WKWA 5H5RA 1TOFA 4NAXA 4BL7B 4ACSA 5HR3A 1YEWC 4OO4A 1EGRA 2CVKA 4MA9A 2C0GA 4KDUA 2JSYA 4MMMA 1OC8A 3IK7A 2K6VA 1X5CA 1FVJA 3ME7A 5IO0A 4F82A 4HQZA 4WBJA 4ICYA 2OBKA 2HE3A 5A5KA 1V58A 2H8LA 5DJLA 3DD3A 1F2EA 1RW1A 1A0RP 3WGEA 1TRUA 1Y6EA 2C0DA 2MMOA 1AXDA 2J9HA 3TOUA 3KMOA 4IW9A 1AIUA 3IOSA 1BG5A 1AQXA 2BTOT 2FWGA 2C3NA 4HU7A 4F0CA 5HFGA 2IL3A 1XWGA 2M46A 3TKSE 3HCZA 3ZYWA 1C72A 4OCEA 2FUG2 3GTUB 3L9UA 3W6GA 3GKMA 4XS4B 2C80A 1M9BA 1M99A 4BWQA 4HSCX 2FWEA 4KE3A 2FCHA 5LD0A 1R4WA 1M2BA 4KDXA 4GWRA 1LU4A 2IIYA 3ED3A 2B1LA 3FMWA 1ZMAA 4GF0A 3J7Yk 3A3TA 3PR8A 1J08A 4MDCA 4V2MA 1EV4A 3Q6OA 2P31A 4I8BA 4TVEA 5J9BA 5HQPA 3LSZA 3HA9A 4IELA 1S4BP 1K3YA 2GVPA 1TK0B 4TR3A 5BMUB 1YQ1A 4KA0A 1I1IP 2YP6A 1ZGNA 3LW9A 4G19A 5A4UA 3MDKA 5J5NA 2IN3A 3CSIA 2GZZA 2YNXA 2C0EA 1YDKA 2A4VA 2H71A 1PRXA 2FHEA 1SJ6A 1TRVA 2LQQA 3I9V2 4BVXA 3E0UA 2DC5A 3EVIA 1LJRA 2GT5A 3IHQA 3CRUA 13GSA 2H1AA 3O76A 1R7HA 2WULA 3LXTA 2XHFA 5GSSA 2FLSA 2WFCA 4AF2A 1GTBA 1G6YA 3HVVA 4OD7A 2VCTA 4N0VA 3MIXA 3TGZA 5AGYA 3AY8A 2LQOA 3WGDA 5F0GA 3LG6A 2DMLA 5F05A 4WF4A 4I2TA 5FT3A 5IMAA 2B6MA 4ZB7A 4BA7A 4L5LA 4EIPA 2HLSA 2HNLA 1YEPA 1U6TA 1MDKA 1JLVA 3A5IA 4HDEA 2EIQA 2HRAA 4J2FA 3L9SA 1A8LA 3DWVA 3M8NA 2GSTA 2L57A 3VLNA 3U5RE 1SVOA 4EXJA 2N5FA 1V40A 1Z6MA 5AN1A 1ZYNA 2DMMA 1B48A 3GTUA 4D73A 5CO3A 1YJ6A 3HZ8A 3LYKA 1DE1A 2HRFA 4RQRA 1TRSA 3LXZA 3UIWA 1HQOA 1OE8A 5A5HA 1K0NA 3RBTA 4N3ZA 3EYTA 1OC9A 2K8VA 2R0CA 1ZYEA 1GRXA 2YJHA 2O7KA 1WIKA 4GSNA 2WVXA 2B3SA 3EURA 1ERVA 3BD2A 5F07A 1HNAA 3WYWA 2VL2A 3GYKA 4PNFA 1R26A 1YEXA 5ELAA 4V1Ap 5CRGA 12GSA 4MPFA 4BIKA 3EINA 1RQMA 3WT2A 2GT6A 2H6ZA 3W8SA 4KCEA 3VFIA 3TJJA 3IC8A 3KJYA 3CSHA 11GSA 2F51A 4EL1A 5DQSA 3RPPA 4JEDA 2L6CA 1OC3A 7GSSA 3K8NA 4G0IA 1ABAA 3WD6A 5J40A 4MK3A 3Q19A 1GP1A 1NM3A 3TRXA 4K2XA 2QGVA 2DJKA 1FOHA 4LMWA 3QAWA 1E2YA 4ZL9A 1PN9A 3PPUA 2B5EA 4LA1A 2GSRA 5B6MA 1SL2B 2EFEA 4HS1A 3FYGA 4KUNA 2DJJA 1XWBA 2X8CA 2A2PA 4GRFA 1F3BA 4V2NA 3SBCA 2N5AA 2PERA 2IFQB 4WETA 2K18A 3G7IA 2VLVA 4IJIA 4Q5NA 1F9MA 1M2AA 3RAZA 3ZITA 4AKHA 2GLRA 3LGCA 2D2ZA 1ACVA 2YV9A 4ID0A 5A34A 5HFIA 3V1WA 3F4TA 1MDIA 1WRYA 3QFAC 4HUAA 5H5QA 4PUAA 2LJAA 4MJBA 10GSA 1FO5A 2MMNA 4ECIA 3P8WA 5G30A 2OA7A 3GX0A 4N30A 5ECRB 3TRPA 2FGXA 2FNOA 2C4JA 5B8AA 1JFUA 3TDGA 4K9ZA 5E4WA 2OBIA 1Z6NA 3EWLA 1BX9A 3MYDA 1A0FA 2WW3A 3EE2A 5F8BA 1K3OA 2X99A 2P0GA 1ZYQB 5IOXA 1B4QA 2C3TA 5GAPD 3ZMKA 3LWAA 3HHVA 2PBJA 1WMJA 2PN8A 1S3AA 1TK8B 1T4YA 1B4PA 2K8SA 1FHEA 1QK8A 3FRCA 3G7JA 1F6MC 4OFTA 2FA8A 1AAZA 1IYHA 2IWTA 2AUVA 3MWHA 3HJMA 1HD2A 2O89A 3FZAA 2RIIA 6GSSA 3R3EA 1M3IA 3TRQA 2KP2A 3P2AA 1URMA 4JRRA 3F6FA 2GSSA 3ZFBA 4WR5A 2H0GA 4ZBBA 1MEKA 3KMNA 5DCHA 4OO5A 4ILFA 3ERGA 2CV4A 4X1UA 4JE1A 5ENUA 5ECLB 4AKXB 4PQIA 3KD0A 2QKEA 3U6VA 3C7MA 5GSTA 3ZTLA 1TXXA 1KEBA 1JLWA 2R2JA 3TJFA 5JWOB 1XW9A 2L6DA 5A1NA 1MDJA 4E8EA 3D22A 1SK0A 2B1KA 4TR1A 2E2GA 1ML6A 4NHZA 4MABA 1XOAA 1PSQA 1SJZA 2ZCTA 4FIWA 4PQ1A 5HR0A 1H4OA 4X43A 3HKRA 3D21A 3GH6A 3KTBA 1U88A 3I43A 1EP8A 4QL7A 3DKSA 3IAS2 5FWGA 3FZ4A 3F4SA 4IS0A 1GUHA 1B9YC 1PL2A 4F03A 4POMA 3QCPA 3KZQA 5AISA 5G1KA 1O73A 4G0KA 1Z3EA 4TRXA 4HJ2A 2HSNA 4ZB6A 5KN3A 4GDFA 1JZDA 2CVDA 5JWQB 4K5RA 4E68A 2QA1A 4CW9A 3CTGA 4KF9A 1BG1A 2JL4A 4V2LA 3HMJG 2YV7A 4KAEA 3EMXA 1GTUA 4DSSA 1J0FA 4BVXB 5ECQB 1AQVA 5HR2A 2HRNA 5G5FA 2CAQA 5ECPB 2H76A 5FHIA 3F0IA 3LORA 1TU8A 4YKGA 2N5BA 8GSSA 1EP7A 2VO4A 5A4VA 3VWWA 1TDIA 18GSA 1O81A 4NV5A 2H0IA 2H1BA 4Q5QA 3UAPA 5GZZB 2X49A 3VURA 3EPTA 4PXOA 5J47A 3LJRA 4K5SA 2OJLA 1UVZA 1PGTA 4F2IA 2AAWA 4ZB9A 1XVWA 5E59A 1SYRA 5IOWA 1V98A 3H93A 1F37A 1T1VA 2YZHA 3ERWA 4PURA 2VOCA 2IMIA 4RUVA 4D73B 1NHOA 3QOUA 1FB0A 4YAVA 3CRTA 4H86A 5D9XA 5CREA 2NTOA 2EIOA 3KTLA 4I6XA 1N2AA 5ECHB 5A5HB 2EFHA 1FOVA 1OC9B 4FYUA 1G6WA 4IHUA 1O7UA 3H79A 3GMFA 3ZIJA 1XWCA 2WVXB 5ECSA 2VM2A 4PX1A 3KM6A 2WDUA 1TW9A 4MJEA 2PVOC
chains in the Genus database with same CATH topology
5D9WA 3US3A 2H75A 1NW2A 3L4NA 3CSJA 4JR4A 1QFNA 3PGTA 3KH7A 2H1DA 1O6JA 5KN2A 3J7Yb 3RHCA 2PUKC 1SKRB 4EDYA 1OAZA 2H73A 2GDRA 2DLXA 2OKAA 3UBKA 1XXUA 5B8BA 2DBCA 1GWCA 4ECBA 3HY2A 3BBYA 3GKXA 2IMKA 5AIVA 2XPEA 1XWKA 3GL5A 4WR4A 1XBSA 17GSA 3APQA 3FEUA 4MCUA 4MNNA 4RQXA 5DCGA 2GS3A 4FYCA 3C1RA 4G01A 1BQ7A 5COHA 1VF1A 5D96A 1GLPA 2JU5A 3JCML 1GSEA 4KW6A 3E3EA 4K8MA 1Z7RA 3OR5A 2CT6A 4K0GA 1T3BA 4X0XA 3N9JA 2DJ2A 1X9MB 2GGTA 4IKHA 3HVSA 3GNJA 2IPAA 1PA3A 1ZZYA 1QMVA 4PTSA 4KSOA 4K7IA 3GKNA 5DALA 5ECKB 1X0RA 2LNSA 5IPHA 1HNBA 3QD9A 3DRNA 2PPTA 4AGSA 5JCGA 2I1UA 4ECCA 4NPBA 1RK4A 3RHBA 5A34B 5LCZA 3QMXA 4F9ZA 4L5OA 3RDWA 1O85A 1V2AA 4Z2RA 1K0CA 3DMLA 3GURA 3IPZA 4TW5A 1YKCA 3PINA 1YF0A 4DEJA 1VGLA 3TKRA 4TR0A 2HZEA 4MJCA 4V1Ag 3GV1A 5J41A 2QA2A 5IMDA 5H5SA 3LYPA 2K9FA 3F63A 3GKKA 5ECNB 2B5XA 1GUMA 2REMA 2MBTA 1QXHA 2B7KA 2PGTA 1TP9A 3BJ5A 2WJUA 2JZSA 1UA5A 4ZBDA 3FK8A 3GH9A 3IRAA 2X64A 4G9HA 5IQYA 2O5VA 4N0ZA 4XRAA 4YH2A 1K0DA 3HVXA 4LL1B 3ZREA 1XIYA 1DE2A 3KH9A 2PU9C 3KP9A 1XVQA 2HZFA 3FR6A 2I9HA 2VLUA 3DXBA 1YVLA 3TUEA 3IA1A 1EOHA 3C1SA 1SK1A 1M9AA 1SYXA 3UL3A 1G7EA 5IMCA 1GH2A 1GTIA 3P90A 4DSRA 4ISDA 1OYJA 2NDOA 2NPBA 3IE3A 3O3TA 4GCIA 1GLQA 3GSSA 3TKSA 1B9XC 2CQ9A 1WE0A 3W8JA 2VCQA 4HJMA 1TI1A 1MD4A 3A2WA 4MZBA 2VM1A 3F8UA 2OE3A 2YWOA 5LNKe 1SL0B 1PL1A 4TXOA 3RPNA 4BPYA 2ES7A 1BEDA 4K1FA 2VL9A 5A1NB 1AUCA 3KGKA 2AV4A 4GQCA 1B8XA 2XC2A 3QDNA 2CZ2A 1ZL9A 3VI7A 4TR1B 1Z7PA 3NOFA 2H6YA 3GSTA 3D4TA 1PKZA 1GSFA 2HI7A 2F8FA 4MF6A 4OFNA 3IK9A 4HZ4A 3DYRA 4FQUA 5KN0A 2WRTA 1Q4JA 1MTCA 4IN0A 2A2SA 1BF5A 3G9BA 1CQHA 4HOJA 2LTKA 2H1GA 1SVMA 3KCMA 1KTEA 5DAKA 2KP1A 4ZL8A 5ID2A 1SK2A 4NWYA 5IPGA 2QC7A 2HSNB 4O5RA 2DJ0A 6GSVA 1AW9A 1V9WA 2OE1A 2V6OA 3QAGA 4ZB8A 2GQLA 4HEA2 4Z7XA 1K3LA 6GSWA 4EF0A 5KN1A 1TKDB 3CYNA 1BYEA 4DSSB 1T00A 1GNWA 2WZ9A 1T4ZA 3H4KA 1SD9A 3ZRDA 1TK5B 2GQKA 1TXUA 5EL8A 4JBBA 2VL3A 4RI7A 3I69A 3IV4A 3TOTA 1YKAA 4NXIA 22GSA 1N8JA 3EU4A 4OWYA 4K0NA 2KLXA 2AJQB 4POLA 2C8UA 4IQ1A 3MAKA 5INYA 3APSA 1AQWA 2DIYA 5BRTA 1DSBA 5A4WA 1X9WB 1BAYA 1PX7A 3GA4A 5JCUA 4EKZA 1EGOA 1WP0A 1SD8A 1OKDA 3TKPA 2LUSA 1ILOA 2EFDA 2NBSA 1LBKA 5ABRA 2V2GA 1Z9HA 4IQAA 2LEGA 4A5PA 2IMEA 4J56E 1G7OA 1A23A 4O5QA 1I5GA 2BJXA 2VL2C 4RI6A 1A24A 4IJ3A 2I81A 3L9VA 1XCCA 3ZMLA 2HYXA 4EO3A 4MZWA 1M7TA 3FW2A 2LJRA 3FR9A 5EPFA 1GSDA 4HU9A 4LLRA 4CY6A 1VRSD 1JZWA 4N11A 2HSMA 3O6TA 1VF4A 3LEFA 5D73A 3TCOA 1S3CA 2X8HA 2O8VB 4YQVA 4LMVA 2GZYA 1XPVA 3VWXA 1K0AA 3APOA 4IVFA 2VLTA 2J23A 4O5UA 2P5RA 4GQFA 2EC4A 2FY6A 2XBIA 2B7JA 4HQSA 3HZ4A 2L5LA 1GSSA 2FA4A 4PGTA 3ISOA 2KUCA 5DDLA 2PVQA 1ERWA 3TJGA 3TKSC 3C8EA 5KOXA 3VWVA 2EFCA 3TU3B 3P7XA 2G0FA 4EC0A 2RM6A 1K0BA 2CA8A 1PN0A 5J3RA 2R37A 1KBNA 3KEBA 14GSA 1R5PA 3KXOA 4NV2A 4ML1A 5AIXA 4GTUA 4O7HA 3M1GA 5EY6A 2RM5A 2HSHA 3HJOA 2X4AA 3HJPA 1BJXA 1JHBA 3BOAA 2MMAA 2HQTA 5G2ZA 1K0MA 1DUGA 1SU9A 3N5OA 1A2JA 4I5QA 4PUFC 1WPIA 1PQNA 2L59A 2PMTA 1EWXA 5IMZA 1U3IA 3ZL5A 20GSA 4ZILA 4CY8A 2H6XA 4WEYA 4MH2A 2H01A 4FYBA 2VKZG 4YQUA 2IMDA 2RUFA 2VCXA 4GSSA 5IMVA 3D4MA 5J4UA 3BCIA 5DALB 1Y25A 1O8WA 1A2LA 4KCAA 1GSUA 3M9JA 3F3RA 4K6XA 4AJ6A 1UN2A 3NIVA 2C1YA 1THOA 4KNDA 2GTUA 2HRKA 4N10A 2LNTA 4MPGA 2HFDA 2VCZA 4KDYA 6GSYA 4TN8A 1SVLA 2H70A 4K2DA 2LRNA 2YJ7A 1W4VA 2YZUA 4XS6A 3ZZXA 2YOIA 3F9UA 5D93A 3KP8A 5HFKA 2I4AA 3L0HA 5J4VA 2ZUPA 3NZNA 3F6DA 2NVLA 4CHSA 3HD5A 4EDZA 2L5OA 4QQ7A 2ALBA 2HZEB 3M0FA 4AI6A 1GUKA 5DBQA 3TB2A 1HYUA 19GSA 1PX6A 2YPMA 2YWIA 4XHMA 5CRHA 1T7PB 3DVXA 3GIXA 3GN3A 4OFMA 1GTAA 1WWJA 4MP4A 2H72A 3CTFA 2GQMA 3FKFA 3LFLA 1U3AA 1KNGA 2WCIA 2QSIA 4PQHA 2WS2A 2IMFA 1XW5A 1PKWA 2DSAA 1M2DA 2L4CA 3UARA 3C71A 1EZKA 2XPDA 2RUEA 4P3YB 1ST9A 1XZOA 4K7NA 5IMFA 3IC4A 1ERUA 2L4QA 3DIEA 4MH3A 1U87A 2TRXA 3D6IA 3FR3A 2OE0A 2R6KA 3VPQA 2O85A 3A2XA 1ON4A 1EEMA 5HR1A 2OADA 4WXTA 2LSTA 2ON5A 1FW1A 1Y1UA 4AKIA 2CAIA 4HZ2A 2V6KA 4ZL7A 5J9CA 2YANA 2IJYA 2OT3A 5D9TA 4BL7A 5JCWA 4ZBAA 1TTZA 2FD3A 1GSYA 3EMPA 1DBYA 4CDOA 9GSSA 4FO5A 3GHAA 3QPMA 2H0HA 4FH8A 4GSTA 5ECMB 1YZXA 4TXOB 3LQ7A 1ZCPA 1H75A 3WT1A 4XRDA 4ML6A 5DVBA 3PH9A 2HSYA 2DKIA 3FZ5A 2H30A 1SENA 2LJKA 4EIQA 4MF7A 1TI3A 2R0GA 5D8IA 2A4HA 5J4YA 2UZ8A 1USBA 4XCSA 3IDVA 2HXKA 2GSQA 4G0LA 2YWNA 4Z2UA 1N25A 1O8XA 2PWJA 2CVBA 5DQYA 4KSMA 5B7CA 3UEMA 3D5JA 2TRCP 3IR4A 1E6BA 1X9SB 2VUPA 2MYGA 3DEXA 4G10A 4JZQA 2M72A 4ULXA 1PMTA 2E7PA 4XIHA 4XS4A 5DAKB 5CP1A 5ID2B 1OVNA 3GFKA 2MBSA 2E2MA 2P5QA 3A5WA 2CZ3A 1S3DA 2F3MA 2H19A 1SL1B 4TKYA 1Q98A 1JZOA 4BVYB 3MSZA 6GSTA 4DSQA 3FY7A 2LV3A 4O92A 5G5EA 3ZVJA 4L0WA 2ON7A 3UJ1A 4YQMA 2VD1A 4POBA 1GNEA 2G2QA 1EEJA 4JR6A 3F4RA 5BMUA 4HI7A 5DJMA 1TU7A 2LRTA 4MF5A 3QAVA 4EVMA 4EE0A 3FHKA 1SKSB 1ERTA 3HDCA 1CQGA 4WBRD 1X5DA 4OCFA 1QQ2A 4MJAA 4TXVA 2F8AA 5CRDA 3HXSA 4J57E 4QL9A 4ECJA 4GXZA 1OKTA 3H8QA 1VF2A 2EIRA 16GSA 1ZOFA 2YCDA 4KH7A 4TOPA 4WF5A 2B5YA 2VCVA 4XS1A 4MZCA 5B6NA 1I9DA 2F9SA 4I97A 3E9JB 4L0UA 3I6AA 2JACA 5C00A 1T8EB 2DKHA 5CRWA 2YN1A 1NHYA 4TR4A 5CNWA 3M9KA 3TJBA 5F06A 3TKQA 2C0FA 2HSMB 2WB9A 2R0PA 2H1LA 2I3YA 1TJDA 1THXA 3IHGA 4PNGA 1A2MA 5CYYA 3CXGA 1SKWB 1W89A 1GL8A 1XOBA 1ZYPA 5JWRB 2R3XA 1NSWA 4IP1A 1EOGA 1QUWA 1HNCA 4IGJA 2DJ3A 4GLTA 4F0BA 3G7YA 2C3QA 3CWGA 3VI5A 3ME8A 6GSXA 3C73A 4AJ8A 4XTSA 1GULA 4BVYA 1YF1A 5EVOA 3SWLA 2Z9SA 1TRWA 5G1LA 1UC7A 2A2RA 4G2EA 1FAAA 4BWSA 3ERFA 2ZNMA 4KB3A 1GSQA 2KOKA 5G31A 3HYPA 4MLYA 2XBQA 2R5GA 3H1NA 3A2VA 4X4JA 2TIRA 2V1MA 1J9BA 1F3AA 4O32A 5L71A 2M80A 2GZPA 5GAND 1VF3A 4NHWA 4YAPA 2FWHA 5ECIB 5IM9A 3UOMA 4IP6A 3EC3A 1FG4A 3DGQA 2VD0A 3VWUA 2LRCA 2O87A 3VPTA 3DVWA 2H74A 2JZTA 4QMKA 5IIZA 2VCWA 4K7OA 4EUYA 3UVHA 1JZRA 1K0OA 3F3QA 1QGVA 1WOUA 4Z2TA 4IBPA 2FWFA 4OMVA 2H66A 4Q5FA 5CAXA 1OE7A 6GSUA 1XWAA 2LKUA 1MD3A 1XFLA 4DVCA 2HRKB 3GL3A 4JU5A 1FB6A 2MMZA 2RLIA 4Q5RA 3VK9A 1V57A 3GUSA 2R4VA 5KEJA 2BMXA 3D0ZA 2JADA 3R2QA 3ZFLA 5KOWA 3MNGA 3ZIVA 1X5EA 5ELGA 2E0QA 2IFQA 1XW6A 4L8EA 1WJKA 2JSZA 2MZCA 1YY7A 2CX3A 2X8GA 2UV8G 2JZRA 3ZLPA 5IO2A 3IXRA 3CBUA 3UMAA 2OACA 2AHEA 2LS5A 3UVTA 2HT9A 3CMIA 3L78A 4NMUA 2YWMA 1PD21 3GRXA 3Q18A 3QFBC 4ZXGA 1SJIA 4AJ7A 2VIMA 4LL4B 4W66A 1R5AA 3Q74A 2CX4A 2AYTA 2AB6A 1A8YA 3IAM2 3S9FA 1M0UA 2VAFA 1Z5YE 2DIZA 3M3MA 1AC1A 2V41A 1IYIA 3UBLA 3EU3A 1G0TA 4KGIA 3WGXA 3IBHA 4USSA 3ZVJD 3QR6A 4I2UA 4POKA 5ECOB 2KHPA 4ZIJA 3KIJA 2DJ1A 2V32A 5D9VA 4E8HA 1EV9A 1FVKA 3BCKA 4AKGA 2WGRA 4KX4A 5C04A 3TJKA 3FZ9A 4YKFA 3GX8A 4WKWA 5H5RA 1TOFA 4NAXA 4BL7B 4ACSA 5HR3A 4OO4A 1EGRA 2CVKA 4MA9A 2C0GA 4KDUA 2JSYA 4MMMA 1OC8A 3IK7A 2K6VA 1X5CA 1FVJA 3ME7A 5IO0A 4F82A 4HQZA 4WBJA 4ICYA 2OBKA 2HE3A 5A5KA 1V58A 2H8LA 5DJLA 3DD3A 1F2EA 1RW1A 1A0RP 3WGEA 1TRUA 1Y6EA 2C0DA 2MMOA 1AXDA 2J9HA 3TOUA 3KMOA 4IW9A 1AIUA 3IOSA 1BG5A 1AQXA 2BTOT 2FWGA 2C3NA 4HU7A 4F0CA 5HFGA 2IL3A 1XWGA 2M46A 3TKSE 3HCZA 3ZYWA 1C72A 4OCEA 2FUG2 3GTUB 3L9UA 3W6GA 3GKMA 4XS4B 2C80A 1M9BA 1M99A 4BWQA 2FWEA 4KE3A 2FCHA 5LD0A 1R4WA 1M2BA 4KDXA 4GWRA 1LU4A 2IIYA 3ED3A 2B1LA 3FMWA 1ZMAA 4GF0A 3J7Yk 3A3TA 3PR8A 1J08A 4MDCA 4V2MA 1EV4A 3Q6OA 2P31A 4I8BA 4TVEA 5J9BA 5HQPA 3LSZA 3HA9A 4IELA 1K3YA 2GVPA 1TK0B 4TR3A 5BMUB 1YQ1A 4KA0A 2YP6A 1ZGNA 3LW9A 4G19A 5A4UA 3MDKA 5J5NA 2IN3A 3CSIA 2GZZA 2YNXA 2C0EA 1YDKA 2A4VA 2H71A 1PRXA 2FHEA 1SJ6A 1TRVA 2LQQA 3I9V2 4BVXA 3E0UA 2DC5A 3EVIA 1LJRA 2GT5A 3IHQA 3CRUA 13GSA 2H1AA 3O76A 1R7HA 2WULA 3LXTA 2XHFA 5GSSA 2FLSA 2WFCA 4AF2A 1GTBA 1G6YA 3HVVA 4OD7A 2VCTA 3MIXA 4N0VA 3TGZA 5AGYA 3AY8A 2LQOA 3WGDA 5F0GA 3LG6A 2DMLA 5F05A 4WF4A 4I2TA 5FT3A 5IMAA 2B6MA 4ZB7A 4BA7A 4L5LA 4EIPA 2HLSA 2HNLA 1YEPA 1U6TA 1MDKA 1JLVA 3A5IA 4HDEA 2EIQA 2HRAA 4J2FA 3L9SA 1A8LA 3DWVA 3M8NA 2GSTA 2L57A 3VLNA 3U5RE 1SVOA 4EXJA 2N5FA 1V40A 1Z6MA 5AN1A 1ZYNA 2DMMA 1B48A 3GTUA 4D73A 5CO3A 1YJ6A 3HZ8A 3LYKA 1DE1A 2HRFA 4RQRA 1TRSA 3LXZA 3UIWA 1HQOA 1OE8A 5A5HA 1K0NA 3RBTA 4N3ZA 3EYTA 1OC9A 2K8VA 2R0CA 1ZYEA 1GRXA 2YJHA 2O7KA 1WIKA 4GSNA 2B3SA 3EURA 1ERVA 3BD2A 5F07A 1HNAA 3WYWA 2VL2A 3GYKA 4PNFA 1R26A 1YEXA 5ELAA 4V1Ap 5CRGA 12GSA 4MPFA 3EINA 1RQMA 3WT2A 2GT6A 2H6ZA 3W8SA 4KCEA 3VFIA 3TJJA 3IC8A 3KJYA 3CSHA 11GSA 2F51A 4EL1A 5DQSA 3RPPA 4JEDA 2L6CA 1OC3A 7GSSA 3K8NA 4G0IA 1ABAA 3WD6A 5J40A 4MK3A 3Q19A 1GP1A 1NM3A 3TRXA 4K2XA 2QGVA 2DJKA 1FOHA 4LMWA 3QAWA 1E2YA 4ZL9A 1PN9A 3PPUA 2B5EA 4LA1A 2GSRA 5B6MA 1SL2B 2EFEA 4HS1A 3FYGA 4KUNA 2DJJA 1XWBA 2X8CA 2A2PA 4GRFA 1F3BA 4V2NA 3SBCA 2N5AA 2PERA 2IFQB 4WETA 2K18A 3G7IA 2VLVA 4IJIA 4Q5NA 1F9MA 1M2AA 3RAZA 3ZITA 4AKHA 2GLRA 3LGCA 2D2ZA 1ACVA 2YV9A 4ID0A 5A34A 5HFIA 3V1WA 3F4TA 1MDIA 1WRYA 3QFAC 4HUAA 5H5QA 4PUAA 2LJAA 4MJBA 10GSA 1FO5A 2MMNA 4ECIA 3P8WA 5G30A 2OA7A 3GX0A 4N30A 5ECRB 3TRPA 2FGXA 2FNOA 2C4JA 5B8AA 1JFUA 3TDGA 4K9ZA 5E4WA 2OBIA 1Z6NA 3EWLA 1BX9A 3MYDA 1A0FA 3EE2A 5F8BA 1K3OA 2X99A 2P0GA 1ZYQB 5IOXA 1B4QA 2C3TA 5GAPD 3ZMKA 3LWAA 3HHVA 2PBJA 1WMJA 2PN8A 1S3AA 1TK8B 1T4YA 1B4PA 2K8SA 1FHEA 1QK8A 3FRCA 3G7JA 1F6MC 4OFTA 2FA8A 1AAZA 1IYHA 2IWTA 2AUVA 3MWHA 3HJMA 1HD2A 2O89A 3FZAA 2RIIA 6GSSA 3R3EA 3TRQA 2KP2A 3P2AA 1URMA 4JRRA 3F6FA 2GSSA 3ZFBA 4WR5A 2H0GA 4ZBBA 1MEKA 3KMNA 5DCHA 4OO5A 4ILFA 3ERGA 2CV4A 4X1UA 4JE1A 5ENUA 5ECLB 4AKXB 4PQIA 3KD0A 2QKEA 3U6VA 3C7MA 5GSTA 3ZTLA 1TXXA 1KEBA 1JLWA 2R2JA 3TJFA 5JWOB 1XW9A 2L6DA 5A1NA 1MDJA 4E8EA 3D22A 1SK0A 2B1KA 4TR1A 2E2GA 1ML6A 4NHZA 4MABA 1XOAA 1PSQA 1SJZA 2ZCTA 4FIWA 4PQ1A 5HR0A 1H4OA 4X43A 3HKRA 3D21A 3GH6A 3KTBA 1U88A 3I43A 1EP8A 4QL7A 3DKSA 3IAS2 5FWGA 3FZ4A 3F4SA 4IS0A 1GUHA 1B9YC 1PL2A 4F03A 4POMA 3QCPA 3KZQA 5AISA 5G1KA 1O73A 4G0KA 1Z3EA 4TRXA 4HJ2A 2HSNA 4ZB6A 5KN3A 4GDFA 1JZDA 2CVDA 5JWQB 4K5RA 4E68A 2QA1A 4CW9A 3CTGA 4KF9A 1BG1A 2JL4A 4V2LA 3HMJG 2YV7A 4KAEA 3EMXA 1GTUA 4DSSA 1J0FA 4BVXB 5ECQB 1AQVA 5HR2A 2HRNA 5G5FA 2CAQA 5ECPB 2H76A 5FHIA 3F0IA 3LORA 1TU8A 4YKGA 2N5BA 8GSSA 1EP7A 2VO4A 5A4VA 3VWWA 1TDIA 18GSA 1O81A 4NV5A 2H0IA 2H1BA 4Q5QA 3UAPA 5GZZB 2X49A 3VURA 3EPTA 4PXOA 5J47A 3LJRA 4K5SA 2OJLA 1UVZA 1PGTA 4F2IA 2AAWA 4ZB9A 1XVWA 5E59A 1SYRA 5IOWA 1V98A 3H93A 1F37A 1T1VA 2YZHA 3ERWA 4PURA 2VOCA 2IMIA 4RUVA 4D73B 1NHOA 3QOUA 1FB0A 4YAVA 3CRTA 4H86A 5D9XA 5CREA 2NTOA 2EIOA 3KTLA 4I6XA 1N2AA 5ECHB 5A5HB 2EFHA 1FOVA 1OC9B 4FYUA 1G6WA 4IHUA 1O7UA 3H79A 3GMFA 3ZIJA 1XWCA 5ECSA 2VM2A 4PX1A 3KM6A 2WDUA 1TW9A 4MJEA 2PVOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D9W A;  3US3 A;  2H75 A;  1NW2 A;  3L4N A;  3CSJ A;  4JR4 A;  1QFN A;  3PGT A;  3KH7 A;  2H1D A;  1O6J A;  5KN2 A;  3J7Y b;  3RHC A;  2PUK C;  1SKR B;  4EDY A;  1OAZ A;  2H73 A;  2GDR A;  2DLX A;  2OKA A;  3UBK A;  1XXU A;  5B8B A;  2DBC A;  1GWC A;  4ECB A;  3HY2 A;  3BBY A;  3GKX A;  2IMK A;  5AIV A;  2XPE A;  1XWK A;  3GL5 A;  4WR4 A;  1XBS A;  17GS A;  3APQ A;  3FEU A;  4MCU A;  4RQX A;  5DCG A;  2GS3 A;  4FYC A;  3C1R A;  1BQ7 A;  5COH A;  1VF1 A;  5D96 A;  1GLP A;  2JU5 A;  3JCM L;  1GSE A;  4KW6 A;  3E3E A;  4K8M A;  1Z7R A;  3OR5 A;  2CT6 A;  4K0G A;  1T3B A;  4X0X A;  3N9J A;  2DJ2 A;  1X9M B;  2GGT A;  4IKH A;  3HVS A;  3GNJ A;  2IPA A;  1PA3 A;  1ZZY A;  1QMV A;  4PTS A;  4KSO A;  4K7I A;  3GKN A;  5DAL A;  5ECK B;  1X0R A;  2LNS A;  5IPH A;  1HNB A;  3QD9 A;  3DRN A;  2PPT A;  4AGS A;  5JCG A;  2I1U A;  4ECC A;  4NPB A;  1RK4 A;  3RHB A;  5LCZ A;  3QMX A;  4F9Z A;  4L5O A;  3RDW A;  1O85 A;  1V2A A;  1K0C A;  3DML A;  3GUR A;  3IPZ A;  4TW5 A;  1YKC A;  3PIN A;  1YF0 A;  4DEJ A;  1VGL A;  3TKR A;  4TR0 A;  2HZE A;  4MJC A;  4V1A g;  3GV1 A;  5J41 A;  5IMD A;  5H5S A;  3LYP A;  2K9F A;  3F63 A;  3GKK A;  5ECN B;  2B5X A;  1GUM A;  2REM A;  2MBT A;  1QXH A;  2B7K A;  2PGT A;  1TP9 A;  3BJ5 A;  2WJU A;  2JZS A;  1UA5 A;  4ZBD A;  3FK8 A;  3GH9 A;  3IRA A;  2X64 A;  4G9H A;  5IQY A;  4N0Z A;  4XRA A;  4YH2 A;  1K0D A;  3HVX A;  4LL1 B;  3ZRE A;  1XIY A;  1DE2 A;  3KH9 A;  2PU9 C;  3KP9 A;  1XVQ A;  2HZF A;  3FR6 A;  2I9H A;  2VLU A;  3DXB A;  3TUE A;  3IA1 A;  1EOH A;  3C1S A;  1SK1 A;  1M9A A;  1SYX A;  3UL3 A;  1G7E A;  5IMC A;  1GH2 A;  1GTI A;  3P90 A;  4DSR A;  4ISD A;  1OYJ A;  2NDO A;  2NPB A;  3IE3 A;  3O3T A;  4GCI A;  1GLQ A;  3GSS A;  3TKS A;  1B9X C;  2CQ9 A;  1WE0 A;  3W8J A;  2VCQ A;  4HJM A;  1TI1 A;  1MD4 A;  3A2W A;  4MZB A;  2VM1 A;  3F8U A;  2OE3 A;  2YWO A;  5LNK e;  1SL0 B;  1PL1 A;  4TXO A;  3RPN A;  4BPY A;  2ES7 A;  1BED A;  4K1F A;  2VL9 A;  1AUC A;  3KGK A;  2AV4 A;  4GQC A;  1B8X A;  2XC2 A;  3QDN A;  2CZ2 A;  1ZL9 A;  3VI7 A;  4TR1 B;  1Z7P A;  3NOF A;  2H6Y A;  3GST A;  3D4T A;  1PKZ A;  1GSF A;  2HI7 A;  2F8F A;  4MF6 A;  4OFN A;  3IK9 A;  4HZ4 A;  3DYR A;  4FQU A;  5KN0 A;  2WRT A;  1Q4J A;  1MTC A;  4IN0 A;  2A2S A;  3G9B A;  1CQH A;  4HOJ A;  2LTK A;  2H1G A;  3KCM A;  1KTE A;  5DAK A;  2KP1 A;  4ZL8 A;  5ID2 A;  1SK2 A;  4NWY A;  5IPG A;  2QC7 A;  2HSN B;  4O5R A;  2DJ0 A;  6GSV A;  1AW9 A;  1V9W A;  2OE1 A;  2V6O A;  3QAG A;  4ZB8 A;  2GQL A;  4HEA 2;  4Z7X A;  1K3L A;  6GSW A;  4EF0 A;  5KN1 A;  1TKD B;  3CYN A;  1BYE A;  4DSS B;  1T00 A;  1GNW A;  2WZ9 A;  1T4Z A;  3H4K A;  1SD9 A;  3ZRD A;  1TK5 B;  2GQK A;  5EL8 A;  4JBB A;  2VL3 A;  4RI7 A;  3I69 A;  3IV4 A;  3TOT A;  1YKA A;  4NXI A;  22GS A;  1N8J A;  3EU4 A;  4OWY A;  4K0N A;  2KLX A;  2AJQ B;  4POL A;  2C8U A;  4IQ1 A;  3MAK A;  5INY A;  3APS A;  1AQW A;  2DIY A;  1DSB A;  5A4W A;  1X9W B;  1BAY A;  1PX7 A;  3GA4 A;  5JCU A;  4EKZ A;  1EGO A;  1WP0 A;  1SD8 A;  1OKD A;  3TKP A;  2LUS A;  1ILO A;  2NBS A;  1LBK A;  5ABR A;  2V2G A;  1Z9H A;  4IQA A;  2LEG A;  2IME A;  4J56 E;  1G7O A;  1A23 A;  1I5G A;  2BJX A;  2VL2 C;  4RI6 A;  1A24 A;  4IJ3 A;  2I81 A;  3L9V A;  1XCC A;  3ZML A;  2HYX A;  4EO3 A;  4MZW A;  1M7T A;  3FW2 A;  2LJR A;  3FR9 A;  5EPF A;  1GSD A;  4HU9 A;  4LLR A;  1VRS D;  1JZW A;  4N11 A;  2HSM A;  3O6T A;  1VF4 A;  3LEF A;  5D73 A;  3TCO A;  1S3C A;  2X8H A;  2O8V B;  4YQV A;  4LMV A;  2GZY A;  1XPV A;  3VWX A;  1K0A A;  3APO A;  4IVF A;  2VLT A;  2J23 A;  2P5R A;  4GQF A;  2EC4 A;  2FY6 A;  2XBI A;  4HQS A;  2B7J A;  2L5L A;  3HZ4 A;  1GSS A;  2FA4 A;  4PGT A;  3ISO A;  2KUC A;  5DDL A;  2PVQ A;  1ERW A;  3TJG A;  3TKS C;  3C8E A;  3VWV A;  3P7X A;  2G0F A;  4EC0 A;  2RM6 A;  1K0B A;  2CA8 A;  5J3R A;  2R37 A;  1KBN A;  3KEB A;  14GS A;  1R5P A;  3KXO A;  4NV2 A;  4ML1 A;  5AIX A;  4GTU A;  4O7H A;  3M1G A;  5EY6 A;  2RM5 A;  2HSH A;  3HJO A;  3HJP A;  1BJX A;  1JHB A;  3BOA A;  2MMA A;  2HQT A;  5G2Z A;  1K0M A;  1DUG A;  1SU9 A;  3N5O A;  1A2J A;  4I5Q A;  4PUF C;  1WPI A;  1PQN A;  2L59 A;  2PMT A;  1EWX A;  5IMZ A;  1U3I A;  3ZL5 A;  20GS A;  4ZIL A;  2H6X A;  4WEY A;  4MH2 A;  2H01 A;  4FYB A;  4YQU A;  2IMD A;  2RUF A;  2VCX A;  4GSS A;  5IMV A;  3D4M A;  5J4U A;  3BCI A;  5DAL B;  1Y25 A;  1O8W A;  1A2L A;  4KCA A;  1GSU A;  3M9J A;  3F3R A;  4K6X A;  4AJ6 A;  1UN2 A;  3NIV A;  2C1Y A;  1THO A;  4KND A;  2GTU A;  2HRK A;  4N10 A;  2LNT A;  4MPG A;  2HFD A;  2VCZ A;  4KDY A;  6GSY A;  4TN8 A;  2H70 A;  4K2D A;  2LRN A;  2YJ7 A;  1W4V A;  2YZU A;  4XS6 A;  3ZZX A;  2YOI A;  3F9U A;  5D93 A;  3KP8 A;  5HFK A;  2I4A A;  3L0H A;  2ZUP A;  3NZN A;  3F6D A;  2NVL A;  4CHS A;  3HD5 A;  4EDZ A;  2L5O A;  4QQ7 A;  2ALB A;  2HZE B;  3M0F A;  1GUK A;  5DBQ A;  3TB2 A;  1HYU A;  19GS A;  1PX6 A;  2YPM A;  2YWI A;  4XHM A;  5CRH A;  1T7P B;  3DVX A;  3GIX A;  3GN3 A;  4OFM A;  1GTA A;  1WWJ A;  4MP4 A;  2H72 A;  3CTF A;  2GQM A;  3FKF A;  3LFL A;  1U3A A;  1KNG A;  2WCI A;  2QSI A;  4PQH A;  2WS2 A;  2IMF A;  1XW5 A;  1PKW A;  2DSA A;  1M2D A;  2L4C A;  3UAR A;  3C71 A;  1EZK A;  2XPD A;  2RUE A;  4P3Y B;  1ST9 A;  1XZO A;  4K7N A;  5IMF A;  3IC4 A;  1ERU A;  2L4Q A;  3DIE A;  4MH3 A;  1U87 A;  2TRX A;  3D6I A;  3FR3 A;  2OE0 A;  2R6K A;  3VPQ A;  2O85 A;  3A2X A;  1ON4 A;  1EEM A;  5HR1 A;  2OAD A;  4WXT A;  2LST A;  2ON5 A;  1FW1 A;  2CAI A;  4HZ2 A;  2V6K A;  4ZL7 A;  5J9C A;  2YAN A;  2IJY A;  5D9T A;  4BL7 A;  5JCW A;  4ZBA A;  1TTZ A;  2FD3 A;  1GSY A;  3EMP A;  1DBY A;  4CDO A;  9GSS A;  4FO5 A;  3GHA A;  3QPM A;  2H0H A;  4FH8 A;  4GST A;  5ECM B;  1YZX A;  4TXO B;  3LQ7 A;  1ZCP A;  1H75 A;  3WT1 A;  4XRD A;  4ML6 A;  5DVB A;  3PH9 A;  2HSY A;  3FZ5 A;  2H30 A;  1SEN A;  2LJK A;  4MF7 A;  1TI3 A;  5D8I A;  2UZ8 A;  1USB A;  4XCS A;  3IDV A;  2HXK A;  2GSQ A;  4G0L A;  2YWN A;  1O8X A;  2PWJ A;  2CVB A;  5DQY A;  4KSM A;  5B7C A;  3UEM A;  3D5J A;  2TRC P;  3IR4 A;  1E6B A;  1X9S B;  2VUP A;  2MYG A;  3DEX A;  4G10 A;  4JZQ A;  2M72 A;  4ULX A;  1PMT A;  2E7P A;  4XIH A;  4XS4 A;  5DAK B;  5CP1 A;  5ID2 B;  1OVN A;  3GFK A;  2MBS A;  2E2M A;  2P5Q A;  3A5W A;  2CZ3 A;  1S3D A;  2F3M A;  2H19 A;  1SL1 B;  4TKY A;  1Q98 A;  1JZO A;  4BVY B;  3MSZ A;  6GST A;  4DSQ A;  3FY7 A;  2LV3 A;  4O92 A;  5G5E A;  3ZVJ A;  4L0W A;  2ON7 A;  3UJ1 A;  4YQM A;  2VD1 A;  4POB A;  1GNE A;  2G2Q A;  1EEJ A;  4JR6 A;  3F4R A;  5BMU A;  4HI7 A;  5DJM A;  1TU7 A;  2LRT A;  4MF5 A;  3QAV A;  4EVM A;  4EE0 A;  3FHK A;  1SKS B;  1ERT A;  3HDC A;  1CQG A;  4WBR D;  1X5D A;  4OCF A;  1QQ2 A;  4MJA A;  4TXV A;  2F8A A;  5CRD A;  3HXS A;  4J57 E;  4QL9 A;  4ECJ A;  4GXZ A;  1OKT A;  3H8Q A;  1VF2 A;  2EIR A;  16GS A;  1ZOF A;  2YCD A;  4KH7 A;  4TOP A;  4WF5 A;  2B5Y A;  2VCV A;  4XS1 A;  4MZC A;  5B6N A;  1I9D A;  2F9S A;  4I97 A;  3E9J B;  4L0U A;  3I6A A;  2JAC A;  5C00 A;  1T8E B;  5CRW A;  2YN1 A;  1NHY A;  4TR4 A;  5CNW A;  3M9K A;  3TJB A;  5F06 A;  3TKQ A;  2C0F A;  2HSM B;  2WB9 A;  2I3Y A;  1TJD A;  1THX A;  4PNG A;  1A2M A;  5CYY A;  3CXG A;  1SKW B;  1W89 A;  1GL8 A;  1XOB A;  5JWR B;  2R3X A;  1NSW A;  4IP1 A;  1EOG A;  1QUW A;  1HNC A;  4IGJ A;  2DJ3 A;  4GLT A;  4F0B A;  3G7Y A;  2C3Q A;  3ME8 A;  3VI5 A;  6GSX A;  3C73 A;  4AJ8 A;  4XTS A;  1GUL A;  4BVY A;  1YF1 A;  5EVO A;  3SWL A;  2Z9S A;  1TRW A;  5G1L A;  1UC7 A;  2A2R A;  4G2E A;  1FAA A;  4BWS A;  3ERF A;  2ZNM A;  4KB3 A;  1GSQ A;  2KOK A;  5G31 A;  3HYP A;  4MLY A;  2XBQ A;  2R5G A;  3H1N A;  3A2V A;  2TIR A;  2V1M A;  1J9B A;  1F3A A;  4O32 A;  5L71 A;  2M80 A;  2GZP A;  5GAN D;  1VF3 A;  4NHW A;  4YAP A;  2FWH A;  5ECI B;  5IM9 A;  3UOM A;  4IP6 A;  3EC3 A;  1FG4 A;  3DGQ A;  2VD0 A;  3VWU A;  2LRC A;  2O87 A;  3VPT A;  3DVW A;  2H74 A;  2JZT A;  5IIZ A;  2VCW A;  4K7O A;  4EUY A;  3UVH A;  1JZR A;  1K0O A;  3F3Q A;  1QGV A;  1WOU A;  4IBP A;  2FWF A;  4OMV A;  2H66 A;  4Q5F A;  5CAX A;  1OE7 A;  6GSU A;  1XWA A;  2LKU A;  1MD3 A;  1XFL A;  4DVC A;  2HRK B;  3GL3 A;  4JU5 A;  1FB6 A;  2MMZ A;  2RLI A;  4Q5R A;  3VK9 A;  1V57 A;  3GUS A;  2R4V A;  5KEJ A;  2BMX A;  3D0Z A;  2JAD A;  3R2Q A;  3ZFL A;  3MNG A;  3ZIV A;  1X5E A;  5ELG A;  2E0Q A;  2IFQ A;  1XW6 A;  4L8E A;  1WJK A;  2JSZ A;  2MZC A;  1YY7 A;  2CX3 A;  2X8G A;  2JZR A;  3ZLP A;  5IO2 A;  3IXR A;  3CBU A;  3UMA A;  2OAC A;  2AHE A;  2LS5 A;  3UVT A;  2HT9 A;  3CMI A;  3L78 A;  4NMU A;  2YWM A;  1PD2 1;  3GRX A;  3Q18 A;  3QFB C;  4ZXG A;  1SJI A;  4AJ7 A;  2VIM A;  4LL4 B;  1R5A A;  3Q74 A;  2CX4 A;  2AYT A;  2AB6 A;  1A8Y A;  3IAM 2;  3S9F A;  1M0U A;  2VAF A;  1Z5Y E;  2DIZ A;  3M3M A;  1AC1 A;  2V41 A;  1IYI A;  3UBL A;  3EU3 A;  1G0T A;  4KGI A;  3WGX A;  3IBH A;  4USS A;  3ZVJ D;  3QR6 A;  4I2U A;  4POK A;  5ECO B;  2KHP A;  4ZIJ A;  3KIJ A;  2DJ1 A;  2V32 A;  5D9V A;  4E8H A;  1EV9 A;  1FVK A;  3BCK A;  2WGR A;  4KX4 A;  5C04 A;  3TJK A;  3FZ9 A;  3GX8 A;  4WKW A;  5H5R A;  1TOF A;  4NAX A;  4BL7 B;  4ACS A;  5HR3 A;  4OO4 A;  1EGR A;  2CVK A;  4MA9 A;  2C0G A;  4KDU A;  2JSY A;  4MMM A;  1OC8 A;  3IK7 A;  2K6V A;  1X5C A;  1FVJ A;  3ME7 A;  5IO0 A;  4F82 A;  4HQZ A;  4WBJ A;  2OBK A;  2HE3 A;  5A5K A;  1V58 A;  2H8L A;  5DJL A;  3DD3 A;  1F2E A;  1RW1 A;  1A0R P;  3WGE A;  1TRU A;  1Y6E A;  2C0D A;  2MMO A;  1AXD A;  2J9H A;  3TOU A;  3KMO A;  4IW9 A;  1AIU A;  3IOS A;  1BG5 A;  1AQX A;  2BTO T;  2FWG A;  2C3N A;  4HU7 A;  4F0C A;  5HFG A;  2IL3 A;  1XWG A;  2M46 A;  3TKS E;  3HCZ A;  3ZYW A;  1C72 A;  4OCE A;  2FUG 2;  3GTU B;  3L9U A;  3W6G A;  3GKM A;  4XS4 B;  2C80 A;  1M9B A;  1M99 A;  4BWQ A;  2FWE A;  4KE3 A;  2FCH A;  5LD0 A;  1R4W A;  1M2B A;  4KDX A;  4GWR A;  1LU4 A;  2IIY A;  3ED3 A;  2B1L A;  1ZMA A;  4GF0 A;  3J7Y k;  3A3T A;  3PR8 A;  1J08 A;  4MDC A;  4V2M A;  1EV4 A;  3Q6O A;  2P31 A;  4I8B A;  4TVE A;  5J9B A;  5HQP A;  3LSZ A;  3HA9 A;  4IEL A;  1K3Y A;  2GVP A;  1TK0 B;  4TR3 A;  1YQ1 A;  4KA0 A;  2YP6 A;  1ZGN A;  4G19 A;  5A4U A;  3MDK A;  5J5N A;  2IN3 A;  3CSI A;  2GZZ A;  2YNX A;  2C0E A;  1YDK A;  2A4V A;  2H71 A;  1PRX A;  2FHE A;  1SJ6 A;  1TRV A;  2LQQ A;  3I9V 2;  4BVX A;  3E0U A;  2DC5 A;  3EVI A;  1LJR A;  2GT5 A;  3IHQ A;  3CRU A;  13GS A;  2H1A A;  3O76 A;  1R7H A;  2WUL A;  3LXT A;  2XHF A;  5GSS A;  2FLS A;  2WFC A;  4AF2 A;  1GTB A;  1G6Y A;  3HVV A;  4OD7 A;  2VCT A;  4N0V A;  3TGZ A;  5AGY A;  3AY8 A;  2LQO A;  3WGD A;  5F0G A;  3LG6 A;  2DML A;  5F05 A;  4WF4 A;  4I2T A;  5FT3 A;  5IMA A;  2B6M A;  4BA7 A;  4L5L A;  2HLS A;  2HNL A;  1YEP A;  1U6T A;  1MDK A;  1JLV A;  4HDE A;  2EIQ A;  2HRA A;  4J2F A;  3L9S A;  1A8L A;  3DWV A;  3M8N A;  2GST A;  2L57 A;  3VLN A;  3U5R E;  4EXJ A;  2N5F A;  1V40 A;  1Z6M A;  5AN1 A;  2DMM A;  1B48 A;  3GTU A;  4D73 A;  5CO3 A;  1YJ6 A;  3HZ8 A;  3LYK A;  1DE1 A;  2HRF A;  4RQR A;  1TRS A;  3LXZ A;  3UIW A;  1HQO A;  1OE8 A;  1K0N A;  3RBT A;  3EYT A;  1OC9 A;  2K8V A;  1ZYE A;  1GRX A;  2YJH A;  2O7K A;  1WIK A;  4GSN A;  2B3S A;  1ERV A;  3EUR A;  3BD2 A;  5F07 A;  1HNA A;  3WYW A;  2VL2 A;  3GYK A;  4PNF A;  1R26 A;  1YEX A;  5ELA A;  4V1A p;  5CRG A;  12GS A;  4MPF A;  3EIN A;  1RQM A;  3WT2 A;  2GT6 A;  2H6Z A;  3W8S A;  4KCE A;  3VFI A;  3TJJ A;  3IC8 A;  3KJY A;  3CSH A;  11GS A;  2F51 A;  4EL1 A;  5DQS A;  3RPP A;  4JED A;  2L6C A;  1OC3 A;  7GSS A;  3K8N A;  4G0I A;  1ABA A;  3WD6 A;  4MK3 A;  3Q19 A;  1GP1 A;  1NM3 A;  3TRX A;  2QGV A;  2DJK A;  4LMW A;  3QAW A;  1E2Y A;  4ZL9 A;  1PN9 A;  3PPU A;  2B5E A;  4LA1 A;  2GSR A;  5B6M A;  1SL2 B;  4HS1 A;  3FYG A;  4KUN A;  2DJJ A;  1XWB A;  2X8C A;  4GRF A;  1F3B A;  4V2N A;  3SBC A;  2N5A A;  2PER A;  2IFQ B;  4WET A;  2K18 A;  3G7I A;  2VLV A;  4IJI A;  4Q5N A;  1F9M A;  1M2A A;  3RAZ A;  3ZIT A;  2GLR A;  3LGC A;  2D2Z A;  1ACV A;  2YV9 A;  4ID0 A;  5HFI A;  3V1W A;  3F4T A;  1MDI A;  1WRY A;  3QFA C;  4HUA A;  5H5Q A;  4PUA A;  2LJA A;  4MJB A;  10GS A;  1FO5 A;  2MMN A;  4ECI A;  3P8W A;  5G30 A;  2OA7 A;  3GX0 A;  4N30 A;  5ECR B;  3TRP A;  2FGX A;  2FNO A;  2C4J A;  5B8A A;  1JFU A;  3TDG A;  4K9Z A;  5E4W A;  2OBI A;  1Z6N A;  3EWL A;  1BX9 A;  1A0F A;  3EE2 A;  5F8B A;  1K3O A;  2X99 A;  2P0G A;  1ZYQ B;  5IOX A;  1B4Q A;  2C3T A;  5GAP D;  3ZMK A;  3LWA A;  3HHV A;  2PBJ A;  1WMJ A;  2PN8 A;  1S3A A;  1TK8 B;  1T4Y A;  1B4P A;  2K8S A;  1FHE A;  1QK8 A;  3FRC A;  3G7J A;  1F6M C;  4OFT A;  2FA8 A;  1AAZ A;  1IYH A;  2IWT A;  2AUV A;  3MWH A;  3HJM A;  1HD2 A;  2O89 A;  3FZA A;  2RII A;  6GSS A;  3R3E A;  3TRQ A;  2KP2 A;  3P2A A;  1URM A;  4JRR A;  3F6F A;  2GSS A;  3ZFB A;  4WR5 A;  2H0G A;  4ZBB A;  1MEK A;  3KMN A;  5DCH A;  4OO5 A;  4ILF A;  3ERG A;  2CV4 A;  4X1U A;  4JE1 A;  5ENU A;  5ECL B;  4PQI A;  3KD0 A;  2QKE A;  3U6V A;  3C7M A;  5GST A;  3ZTL A;  1TXX A;  1KEB A;  1JLW A;  2R2J A;  3TJF A;  5JWO B;  1XW9 A;  2L6D A;  1MDJ A;  4E8E A;  3D22 A;  1SK0 A;  2B1K A;  4TR1 A;  2E2G A;  1ML6 A;  4NHZ A;  4MAB A;  1XOA A;  1PSQ A;  1SJZ A;  2ZCT A;  4FIW A;  4PQ1 A;  5HR0 A;  1H4O A;  4X43 A;  3HKR A;  3D21 A;  3GH6 A;  3KTB A;  1U88 A;  3I43 A;  1EP8 A;  4QL7 A;  3DKS A;  3IAS 2;  5FWG A;  3FZ4 A;  3F4S A;  4IS0 A;  1GUH A;  1B9Y C;  1PL2 A;  4F03 A;  4POM A;  3QCP A;  3KZQ A;  5AIS A;  5G1K A;  1O73 A;  4G0K A;  1Z3E A;  4TRX A;  4HJ2 A;  4ZB6 A;  5KN3 A;  1JZD A;  5JWQ B;  2CVD A;  4CW9 A;  3CTG A;  4KF9 A;  2JL4 A;  4V2L A;  2YV7 A;  4KAE A;  3EMX A;  1GTU A;  4DSS A;  1J0F A;  4BVX B;  5ECQ B;  1AQV A;  5HR2 A;  2HRN A;  5G5F A;  2CAQ A;  5ECP B;  2H76 A;  5FHI A;  3F0I A;  3LOR A;  1TU8 A;  2N5B A;  8GSS A;  1EP7 A;  2VO4 A;  5A4V A;  3VWW A;  1TDI A;  18GS A;  1O81 A;  4NV5 A;  2H0I A;  2H1B A;  4Q5Q A;  3UAP A;  5GZZ B;  3VUR A;  4PXO A;  3LJR A;  2OJL A;  1UVZ A;  1PGT A;  4F2I A;  2AAW A;  4ZB9 A;  1XVW A;  5E59 A;  1SYR A;  5IOW A;  1V98 A;  3H93 A;  1F37 A;  1T1V A;  2YZH A;  3ERW A;  4PUR A;  2VOC A;  2IMI A;  4RUV A;  4D73 B;  1NHO A;  3QOU A;  1FB0 A;  4YAV A;  3CRT A;  4H86 A;  5D9X A;  5CRE A;  2NTO A;  2EIO A;  3KTL A;  4I6X A;  1N2A A;  5ECH B;  1FOV A;  1OC9 B;  4FYU A;  1G6W A;  4IHU A;  1O7U A;  3H79 A;  3GMF A;  3ZIJ A;  1XWC A;  5ECS A;  2VM2 A;  4PX1 A;  3KM6 A;  2WDU A;  1TW9 A;  4MJE A;  2PVO C; 
#chains in the Genus database with same CATH topology
 5D9W A;  3US3 A;  2H75 A;  1NW2 A;  3L4N A;  3CSJ A;  4JR4 A;  1QFN A;  3PGT A;  3KH7 A;  2H1D A;  1O6J A;  5KN2 A;  3J7Y b;  3RHC A;  2PUK C;  1SKR B;  4EDY A;  1OAZ A;  2H73 A;  2GDR A;  2DLX A;  2OKA A;  3UBK A;  1XXU A;  5B8B A;  2DBC A;  1GWC A;  4ECB A;  3HY2 A;  3BBY A;  3GKX A;  2IMK A;  5AIV A;  2XPE A;  1XWK A;  3GL5 A;  4WR4 A;  1XBS A;  17GS A;  3APQ A;  3FEU A;  4MCU A;  4MNN A;  4RQX A;  5DCG A;  2GS3 A;  4FYC A;  3C1R A;  4G01 A;  1BQ7 A;  5COH A;  1VF1 A;  5D96 A;  1GLP A;  2JU5 A;  3JCM L;  1GSE A;  4KW6 A;  3E3E A;  4K8M A;  1Z7R A;  3OR5 A;  2CT6 A;  4K0G A;  1T3B A;  4X0X A;  3N9J A;  2DJ2 A;  1X9M B;  2GGT A;  4IKH A;  3HVS A;  3GNJ A;  2IPA A;  1PA3 A;  1ZZY A;  1QMV A;  4PTS A;  4KSO A;  4K7I A;  3GKN A;  5DAL A;  5ECK B;  1X0R A;  2LNS A;  5IPH A;  1HNB A;  3QD9 A;  3DRN A;  2PPT A;  4AGS A;  5JCG A;  2I1U A;  4ECC A;  4NPB A;  1RK4 A;  3RHB A;  5A34 B;  5LCZ A;  3QMX A;  4F9Z A;  4L5O A;  3RDW A;  1O85 A;  1V2A A;  4Z2R A;  1K0C A;  3DML A;  3GUR A;  3IPZ A;  4TW5 A;  1YKC A;  3PIN A;  1YF0 A;  4DEJ A;  1VGL A;  3TKR A;  4TR0 A;  2HZE A;  4MJC A;  4V1A g;  2WVZ A;  3GV1 A;  5J41 A;  2QA2 A;  5IMD A;  5H5S A;  3LYP A;  2K9F A;  3F63 A;  3GKK A;  5ECN B;  2B5X A;  1GUM A;  2REM A;  2MBT A;  1QXH A;  2B7K A;  2PGT A;  1TP9 A;  3BJ5 A;  2WJU A;  2JZS A;  1UA5 A;  4ZBD A;  3FK8 A;  3GH9 A;  3IRA A;  2X64 A;  4G9H A;  5IQY A;  2O5V A;  4N0Z A;  4XRA A;  4YH2 A;  1K0D A;  3HVX A;  4LL1 B;  3ZRE A;  1XIY A;  1DE2 A;  3KH9 A;  2PU9 C;  3KP9 A;  1XVQ A;  2HZF A;  3FR6 A;  2I9H A;  2VLU A;  3DXB A;  1YVL A;  3TUE A;  3IA1 A;  1EOH A;  3C1S A;  1SK1 A;  1M9A A;  1SYX A;  3UL3 A;  1G7E A;  5IMC A;  1GH2 A;  1GTI A;  3P90 A;  4DSR A;  4ISD A;  1OYJ A;  2NDO A;  3CHX C;  2NPB A;  3IE3 A;  3O3T A;  4GCI A;  1GLQ A;  3GSS A;  3TKS A;  1B9X C;  2CQ9 A;  1WE0 A;  3W8J A;  2VCQ A;  4HJM A;  1TI1 A;  1MD4 A;  3A2W A;  4MZB A;  2VM1 A;  3F8U A;  2OE3 A;  2YWO A;  5LNK e;  1SL0 B;  1PL1 A;  4TXO A;  3RPN A;  4BPY A;  2ES7 A;  1BED A;  4K1F A;  2VL9 A;  5A1N B;  1AUC A;  3KGK A;  2AV4 A;  4GQC A;  1B8X A;  2XC2 A;  3QDN A;  2CZ2 A;  1ZL9 A;  3VI7 A;  4TR1 B;  1Z7P A;  3NOF A;  2H6Y A;  3GST A;  3D4T A;  1PKZ A;  1GSF A;  2HI7 A;  2F8F A;  4MF6 A;  4OFN A;  3IK9 A;  4HZ4 A;  3DYR A;  4FQU A;  5KN0 A;  2WRT A;  1Q4J A;  1MTC A;  4IN0 A;  2A2S A;  1BF5 A;  4PI0 C;  3G9B A;  1CQH A;  4HOJ A;  2LTK A;  2H1G A;  1SVM A;  3KCM A;  1KTE A;  5DAK A;  2KP1 A;  4ZL8 A;  5ID2 A;  1SK2 A;  4NWY A;  5IPG A;  2QC7 A;  2HSN B;  4O5R A;  2DJ0 A;  6GSV A;  1AW9 A;  1V9W A;  2OE1 A;  2V6O A;  3QAG A;  4ZB8 A;  2GQL A;  4HEA 2;  4Z7X A;  1K3L A;  6GSW A;  4EF0 A;  5KN1 A;  1TKD B;  3CYN A;  1BYE A;  4DSS B;  1T00 A;  1GNW A;  2WZ9 A;  1T4Z A;  3H4K A;  1SD9 A;  3ZRD A;  1TK5 B;  2GQK A;  1TXU A;  5EL8 A;  4JBB A;  2VL3 A;  4RI7 A;  3I69 A;  3IV4 A;  3TOT A;  1YKA A;  4NXI A;  22GS A;  1N8J A;  3EU4 A;  4OWY A;  4K0N A;  2KLX A;  2AJQ B;  4POL A;  2C8U A;  4IQ1 A;  3MAK A;  5INY A;  3APS A;  1AQW A;  2DIY A;  5BRT A;  1DSB A;  5A4W A;  1X9W B;  1BAY A;  1PX7 A;  3GA4 A;  5JCU A;  4EKZ A;  1EGO A;  1WP0 A;  1SD8 A;  2WW2 A;  1OKD A;  3TKP A;  2LUS A;  1ILO A;  2EFD A;  2NBS A;  1LBK A;  5ABR A;  2V2G A;  1Z9H A;  4IQA A;  2LEG A;  4A5P A;  2IME A;  4J56 E;  1G7O A;  1A23 A;  2O36 A;  4O5Q A;  1I5G A;  2BJX A;  2VL2 C;  4RI6 A;  1A24 A;  4IJ3 A;  2I81 A;  3L9V A;  1XCC A;  3ZML A;  2HYX A;  4EO3 A;  2O3E A;  4MZW A;  1M7T A;  3FW2 A;  2LJR A;  3FR9 A;  5EPF A;  1GSD A;  4HU9 A;  4LLR A;  4CY6 A;  1VRS D;  1JZW A;  4N11 A;  2HSM A;  3O6T A;  1VF4 A;  3LEF A;  5D73 A;  3TCO A;  1S3C A;  2X8H A;  2WZS A;  2O8V B;  4YQV A;  4LMV A;  2GZY A;  1XPV A;  3VWX A;  1K0A A;  3APO A;  4IVF A;  2VLT A;  2J23 A;  4O5U A;  2P5R A;  4GQF A;  2EC4 A;  2FY6 A;  2XBI A;  2B7J A;  4HQS A;  3HZ4 A;  2L5L A;  1GSS A;  2FA4 A;  4PGT A;  3ISO A;  2KUC A;  5DDL A;  2PVQ A;  1ERW A;  3TJG A;  3TKS C;  3C8E A;  5KOX A;  3VWV A;  2EFC A;  3TU3 B;  3P7X A;  2G0F A;  4EC0 A;  2RM6 A;  1K0B A;  2CA8 A;  1PN0 A;  5J3R A;  2R37 A;  1KBN A;  3KEB A;  14GS A;  1R5P A;  3KXO A;  4NV2 A;  4ML1 A;  5AIX A;  4GTU A;  4O7H A;  3M1G A;  5EY6 A;  2RM5 A;  2HSH A;  3HJO A;  2X4A A;  3HJP A;  1BJX A;  1JHB A;  3BOA A;  2MMA A;  2HQT A;  5G2Z A;  1K0M A;  1DUG A;  1SU9 A;  3N5O A;  1A2J A;  4I5Q A;  4PUF C;  1WPI A;  1PQN A;  2L59 A;  2PMT A;  1EWX A;  5IMZ A;  1U3I A;  3ZL5 A;  20GS A;  4ZIL A;  4CY8 A;  2H6X A;  4WEY A;  4MH2 A;  2H01 A;  4FYB A;  2VKZ G;  4YQU A;  2IMD A;  2RUF A;  2VCX A;  4GSS A;  5IMV A;  3D4M A;  5J4U A;  3BCI A;  5DAL B;  1Y25 A;  1O8W A;  1A2L A;  4KCA A;  1GSU A;  3M9J A;  3F3R A;  4K6X A;  4AJ6 A;  1UN2 A;  1XG8 A;  3NIV A;  2C1Y A;  1THO A;  4KND A;  2GTU A;  2HRK A;  4N10 A;  2LNT A;  4MPG A;  2HFD A;  2VCZ A;  4KDY A;  6GSY A;  1M3J A;  4TN8 A;  1SVL A;  2H70 A;  4K2D A;  2LRN A;  2YJ7 A;  1W4V A;  2YZU A;  4XS6 A;  3ZZX A;  2YOI A;  3F9U A;  5D93 A;  3KP8 A;  5HFK A;  2I4A A;  3L0H A;  5J4V A;  2ZUP A;  4FXY P;  3NZN A;  3F6D A;  2NVL A;  4CHS A;  3HD5 A;  4EDZ A;  2L5O A;  4QQ7 A;  2ALB A;  2HZE B;  3M0F A;  4AI6 A;  1GUK A;  5DBQ A;  3TB2 A;  1HYU A;  19GS A;  1PX6 A;  2YPM A;  2YWI A;  4XHM A;  5CRH A;  1T7P B;  3DVX A;  3GIX A;  3GN3 A;  4OFM A;  1GTA A;  1WWJ A;  4MP4 A;  2H72 A;  3CTF A;  2GQM A;  3FKF A;  3LFL A;  1U3A A;  1KNG A;  2WCI A;  1PFO A;  2QSI A;  4PQH A;  2WS2 A;  2IMF A;  1XW5 A;  1PKW A;  2DSA A;  1M2D A;  2L4C A;  3UAR A;  3C71 A;  1EZK A;  2XPD A;  2RUE A;  4P3Y B;  1ST9 A;  1XZO A;  4K7N A;  5IMF A;  3IC4 A;  1ERU A;  2L4Q A;  3DIE A;  4MH3 A;  1U87 A;  2TRX A;  3D6I A;  3FR3 A;  2OE0 A;  2R6K A;  3VPQ A;  2O85 A;  3A2X A;  1ON4 A;  1EEM A;  5HR1 A;  2OAD A;  4WXT A;  2LST A;  2ON5 A;  1FW1 A;  1Y1U A;  4AKI A;  2CAI A;  4HZ2 A;  2V6K A;  4ZL7 A;  2WW0 A;  5J9C A;  2YAN A;  2IJY A;  2OT3 A;  5D9T A;  4BL7 A;  5JCW A;  4ZBA A;  1TTZ A;  2FD3 A;  1GSY A;  3EMP A;  1DBY A;  4CDO A;  9GSS A;  4FO5 A;  3GHA A;  3QPM A;  2H0H A;  4FH8 A;  4GST A;  5ECM B;  1YZX A;  4TXO B;  3LQ7 A;  1ZCP A;  1H75 A;  3WT1 A;  4XRD A;  4ML6 A;  5DVB A;  3PH9 A;  2HSY A;  2DKI A;  3FZ5 A;  2H30 A;  1SEN A;  2LJK A;  4EIQ A;  4MF7 A;  1TI3 A;  2R0G A;  5D8I A;  2A4H A;  5J4Y A;  2UZ8 A;  1USB A;  4XCS A;  3IDV A;  2HXK A;  2GSQ A;  4G0L A;  2YWN A;  4Z2U A;  1N25 A;  1O8X A;  2PWJ A;  2CVB A;  5DQY A;  4KSM A;  5B7C A;  3UEM A;  3D5J A;  3HVN A;  2TRC P;  3IR4 A;  1E6B A;  1X9S B;  2VUP A;  2MYG A;  1S3R A;  3DEX A;  4G10 A;  4JZQ A;  2M72 A;  4ULX A;  1PMT A;  2E7P A;  4XIH A;  4XS4 A;  5DAK B;  5CP1 A;  5ID2 B;  1OVN A;  3GFK A;  2MBS A;  2E2M A;  2P5Q A;  3A5W A;  2CZ3 A;  1S3D A;  2F3M A;  2H19 A;  1SL1 B;  4TKY A;  1Q98 A;  1JZO A;  4BVY B;  3MSZ A;  6GST A;  4DSQ A;  3FY7 A;  2LV3 A;  4O92 A;  5G5E A;  3ZVJ A;  4L0W A;  2ON7 A;  3UJ1 A;  4PHZ C;  4YQM A;  2VD1 A;  4POB A;  1GNE A;  2G2Q A;  1EEJ A;  4JR6 A;  3F4R A;  5BMU A;  4HI7 A;  5DJM A;  1TU7 A;  2LRT A;  4MF5 A;  3QAV A;  4EVM A;  4EE0 A;  3FHK A;  1SKS B;  3RGB C;  3RFR C;  1ERT A;  3HDC A;  1CQG A;  4WBR D;  1X5D A;  4OCF A;  1QQ2 A;  4MJA A;  4TXV A;  2F8A A;  5CRD A;  3HXS A;  4J57 E;  4QL9 A;  4ECJ A;  4GXZ A;  1OKT A;  3H8Q A;  1VF2 A;  2EIR A;  16GS A;  1ZOF A;  2YCD A;  4KH7 A;  4TOP A;  4WF5 A;  2B5Y A;  2VCV A;  4XS1 A;  4MZC A;  5B6N A;  1I9D A;  2F9S A;  4I97 A;  3E9J B;  4L0U A;  3I6A A;  2JAC A;  5C00 A;  1T8E B;  2DKH A;  5CRW A;  2YN1 A;  1NHY A;  4TR4 A;  5CNW A;  3M9K A;  3TJB A;  5F06 A;  3TKQ A;  2C0F A;  2HSM B;  2WB9 A;  2R0P A;  2H1L A;  2I3Y A;  1TJD A;  1THX A;  3CQF A;  3IHG A;  2WW1 A;  4PNG A;  1A2M A;  5CYY A;  3CXG A;  1SKW B;  1W89 A;  1GL8 A;  1XOB A;  1ZYP A;  5JWR B;  2R3X A;  1NSW A;  4IP1 A;  1EOG A;  1QUW A;  1HNC A;  4IGJ A;  2DJ3 A;  4GLT A;  4F0B A;  3G7Y A;  2C3Q A;  3CWG A;  3VI5 A;  3ME8 A;  6GSX A;  3C73 A;  4AJ8 A;  4XTS A;  1GUL A;  4BVY A;  1YF1 A;  5EVO A;  3SWL A;  2Z9S A;  1TRW A;  5G1L A;  1UC7 A;  2A2R A;  4G2E A;  1FAA A;  4BWS A;  3ERF A;  2ZNM A;  4KB3 A;  1GSQ A;  2KOK A;  5G31 A;  3HYP A;  4MLY A;  2XBQ A;  2R5G A;  3H1N A;  3A2V A;  4X4J A;  2TIR A;  2V1M A;  1J9B A;  1F3A A;  4O32 A;  5L71 A;  2M80 A;  2GZP A;  5GAN D;  1VF3 A;  4NHW A;  4YAP A;  2FWH A;  5ECI B;  5IM9 A;  3UOM A;  4IP6 A;  3EC3 A;  1FG4 A;  3DGQ A;  2VD0 A;  2WVY A;  3VWU A;  2LRC A;  2O87 A;  4PI2 C;  3VPT A;  3DVW A;  2H74 A;  2JZT A;  4QMK A;  5IIZ A;  2VCW A;  4K7O A;  4EUY A;  3UVH A;  1JZR A;  1K0O A;  3F3Q A;  1QGV A;  1WOU A;  4Z2T A;  4IBP A;  2FWF A;  4OMV A;  2H66 A;  4Q5F A;  5CAX A;  1OE7 A;  6GSU A;  1XWA A;  2LKU A;  1MD3 A;  1XFL A;  4DVC A;  2HRK B;  3GL3 A;  4JU5 A;  1FB6 A;  2MMZ A;  2RLI A;  4Q5R A;  3VK9 A;  1V57 A;  3GUS A;  2R4V A;  5KEJ A;  2BMX A;  3D0Z A;  2JAD A;  3R2Q A;  3ZFL A;  5KOW A;  3MNG A;  3ZIV A;  1X5E A;  5ELG A;  2E0Q A;  2IFQ A;  1XW6 A;  4L8E A;  1WJK A;  2JSZ A;  2MZC A;  1YY7 A;  2CX3 A;  2X8G A;  2UV8 G;  2JZR A;  3ZLP A;  5IO2 A;  3IXR A;  3CBU A;  3UMA A;  2OAC A;  2AHE A;  2LS5 A;  3UVT A;  2HT9 A;  3CMI A;  3L78 A;  4NMU A;  2YWM A;  1PD2 1;  3GRX A;  3Q18 A;  3QFB C;  4ZXG A;  1SJI A;  4AJ7 A;  2VIM A;  4LL4 B;  4W66 A;  1R5A A;  3Q74 A;  2CX4 A;  2AYT A;  2AB6 A;  1A8Y A;  3IAM 2;  3S9F A;  1M0U A;  2VAF A;  1Z5Y E;  2DIZ A;  3M3M A;  1AC1 A;  2V41 A;  1IYI A;  3UBL A;  3EU3 A;  1G0T A;  4KGI A;  3WGX A;  3IBH A;  4USS A;  3ZVJ D;  3QR6 A;  4I2U A;  4POK A;  5ECO B;  2KHP A;  4ZIJ A;  3KIJ A;  2DJ1 A;  2V32 A;  5D9V A;  4E8H A;  1EV9 A;  1FVK A;  3BCK A;  4AKG A;  2WGR A;  4KX4 A;  5C04 A;  3TJK A;  3FZ9 A;  4YKF A;  3GX8 A;  4WKW A;  5H5R A;  1TOF A;  4NAX A;  4BL7 B;  4ACS A;  5HR3 A;  1YEW C;  4OO4 A;  1EGR A;  2CVK A;  4MA9 A;  2C0G A;  4KDU A;  2JSY A;  4MMM A;  1OC8 A;  3IK7 A;  2K6V A;  1X5C A;  1FVJ A;  3ME7 A;  5IO0 A;  4F82 A;  4HQZ A;  4WBJ A;  4ICY A;  2OBK A;  2HE3 A;  5A5K A;  1V58 A;  2H8L A;  5DJL A;  3DD3 A;  1F2E A;  1RW1 A;  1A0R P;  3WGE A;  1TRU A;  1Y6E A;  2C0D A;  2MMO A;  1AXD A;  2J9H A;  3TOU A;  3KMO A;  4IW9 A;  1AIU A;  3IOS A;  1BG5 A;  1AQX A;  2BTO T;  2FWG A;  2C3N A;  4HU7 A;  4F0C A;  5HFG A;  2IL3 A;  1XWG A;  2M46 A;  3TKS E;  3HCZ A;  3ZYW A;  1C72 A;  4OCE A;  2FUG 2;  3GTU B;  3L9U A;  3W6G A;  3GKM A;  4XS4 B;  2C80 A;  1M9B A;  1M99 A;  4BWQ A;  4HSC X;  2FWE A;  4KE3 A;  2FCH A;  5LD0 A;  1R4W A;  1M2B A;  4KDX A;  4GWR A;  1LU4 A;  2IIY A;  3ED3 A;  2B1L A;  3FMW A;  1ZMA A;  4GF0 A;  3J7Y k;  3A3T A;  3PR8 A;  1J08 A;  4MDC A;  4V2M A;  1EV4 A;  3Q6O A;  2P31 A;  4I8B A;  4TVE A;  5J9B A;  5HQP A;  3LSZ A;  3HA9 A;  4IEL A;  1S4B P;  1K3Y A;  2GVP A;  1TK0 B;  4TR3 A;  5BMU B;  1YQ1 A;  4KA0 A;  1I1I P;  2YP6 A;  1ZGN A;  3LW9 A;  4G19 A;  5A4U A;  3MDK A;  5J5N A;  2IN3 A;  3CSI A;  2GZZ A;  2YNX A;  2C0E A;  1YDK A;  2A4V A;  2H71 A;  1PRX A;  2FHE A;  1SJ6 A;  1TRV A;  2LQQ A;  3I9V 2;  4BVX A;  3E0U A;  2DC5 A;  3EVI A;  1LJR A;  2GT5 A;  3IHQ A;  3CRU A;  13GS A;  2H1A A;  3O76 A;  1R7H A;  2WUL A;  3LXT A;  2XHF A;  5GSS A;  2FLS A;  2WFC A;  4AF2 A;  1GTB A;  1G6Y A;  3HVV A;  4OD7 A;  2VCT A;  4N0V A;  3MIX A;  3TGZ A;  5AGY A;  3AY8 A;  2LQO A;  3WGD A;  5F0G A;  3LG6 A;  2DML A;  5F05 A;  4WF4 A;  4I2T A;  5FT3 A;  5IMA A;  2B6M A;  4ZB7 A;  4BA7 A;  4L5L A;  4EIP A;  2HLS A;  2HNL A;  1YEP A;  1U6T A;  1MDK A;  1JLV A;  3A5I A;  4HDE A;  2EIQ A;  2HRA A;  4J2F A;  3L9S A;  1A8L A;  3DWV A;  3M8N A;  2GST A;  2L57 A;  3VLN A;  3U5R E;  1SVO A;  4EXJ A;  2N5F A;  1V40 A;  1Z6M A;  5AN1 A;  1ZYN A;  2DMM A;  1B48 A;  3GTU A;  4D73 A;  5CO3 A;  1YJ6 A;  3HZ8 A;  3LYK A;  1DE1 A;  2HRF A;  4RQR A;  1TRS A;  3LXZ A;  3UIW A;  1HQO A;  1OE8 A;  5A5H A;  1K0N A;  3RBT A;  4N3Z A;  3EYT A;  1OC9 A;  2K8V A;  2R0C A;  1ZYE A;  1GRX A;  2YJH A;  2O7K A;  1WIK A;  4GSN A;  2WVX A;  2B3S A;  3EUR A;  1ERV A;  3BD2 A;  5F07 A;  1HNA A;  3WYW A;  2VL2 A;  3GYK A;  4PNF A;  1R26 A;  1YEX A;  5ELA A;  4V1A p;  5CRG A;  12GS A;  4MPF A;  4BIK A;  3EIN A;  1RQM A;  3WT2 A;  2GT6 A;  2H6Z A;  3W8S A;  4KCE A;  3VFI A;  3TJJ A;  3IC8 A;  3KJY A;  3CSH A;  11GS A;  2F51 A;  4EL1 A;  5DQS A;  3RPP A;  4JED A;  2L6C A;  1OC3 A;  7GSS A;  3K8N A;  4G0I A;  1ABA A;  3WD6 A;  5J40 A;  4MK3 A;  3Q19 A;  1GP1 A;  1NM3 A;  3TRX A;  4K2X A;  2QGV A;  2DJK A;  1FOH A;  4LMW A;  3QAW A;  1E2Y A;  4ZL9 A;  1PN9 A;  3PPU A;  2B5E A;  4LA1 A;  2GSR A;  5B6M A;  1SL2 B;  2EFE A;  4HS1 A;  3FYG A;  4KUN A;  2DJJ A;  1XWB A;  2X8C A;  2A2P A;  4GRF A;  1F3B A;  4V2N A;  3SBC A;  2N5A A;  2PER A;  2IFQ B;  4WET A;  2K18 A;  3G7I A;  2VLV A;  4IJI A;  4Q5N A;  1F9M A;  1M2A A;  3RAZ A;  3ZIT A;  4AKH A;  2GLR A;  3LGC A;  2D2Z A;  1ACV A;  2YV9 A;  4ID0 A;  5A34 A;  5HFI A;  3V1W A;  3F4T A;  1MDI A;  1WRY A;  3QFA C;  4HUA A;  5H5Q A;  4PUA A;  2LJA A;  4MJB A;  10GS A;  1FO5 A;  2MMN A;  4ECI A;  3P8W A;  5G30 A;  2OA7 A;  3GX0 A;  4N30 A;  5ECR B;  3TRP A;  2FGX A;  2FNO A;  2C4J A;  5B8A A;  1JFU A;  3TDG A;  4K9Z A;  5E4W A;  2OBI A;  1Z6N A;  3EWL A;  1BX9 A;  3MYD A;  1A0F A;  2WW3 A;  3EE2 A;  5F8B A;  1K3O A;  2X99 A;  2P0G A;  1ZYQ B;  5IOX A;  1B4Q A;  2C3T A;  5GAP D;  3ZMK A;  3LWA A;  3HHV A;  2PBJ A;  1WMJ A;  2PN8 A;  1S3A A;  1TK8 B;  1T4Y A;  1B4P A;  2K8S A;  1FHE A;  1QK8 A;  3FRC A;  3G7J A;  1F6M C;  4OFT A;  2FA8 A;  1AAZ A;  1IYH A;  2IWT A;  2AUV A;  3MWH A;  3HJM A;  1HD2 A;  2O89 A;  3FZA A;  2RII A;  6GSS A;  3R3E A;  1M3I A;  3TRQ A;  2KP2 A;  3P2A A;  1URM A;  4JRR A;  3F6F A;  2GSS A;  3ZFB A;  4WR5 A;  2H0G A;  4ZBB A;  1MEK A;  3KMN A;  5DCH A;  4OO5 A;  4ILF A;  3ERG A;  2CV4 A;  4X1U A;  4JE1 A;  5ENU A;  5ECL B;  4AKX B;  4PQI A;  3KD0 A;  2QKE A;  3U6V A;  3C7M A;  5GST A;  3ZTL A;  1TXX A;  1KEB A;  1JLW A;  2R2J A;  3TJF A;  5JWO B;  1XW9 A;  2L6D A;  5A1N A;  1MDJ A;  4E8E A;  3D22 A;  1SK0 A;  2B1K A;  4TR1 A;  2E2G A;  1ML6 A;  4NHZ A;  4MAB A;  1XOA A;  1PSQ A;  1SJZ A;  2ZCT A;  4FIW A;  4PQ1 A;  5HR0 A;  1H4O A;  4X43 A;  3HKR A;  3D21 A;  3GH6 A;  3KTB A;  1U88 A;  3I43 A;  1EP8 A;  4QL7 A;  3DKS A;  3IAS 2;  5FWG A;  3FZ4 A;  3F4S A;  4IS0 A;  1GUH A;  1B9Y C;  1PL2 A;  4F03 A;  4POM A;  3QCP A;  3KZQ A;  5AIS A;  5G1K A;  1O73 A;  4G0K A;  1Z3E A;  4TRX A;  4HJ2 A;  2HSN A;  4ZB6 A;  5KN3 A;  4GDF A;  1JZD A;  2CVD A;  5JWQ B;  4K5R A;  4E68 A;  2QA1 A;  4CW9 A;  3CTG A;  4KF9 A;  1BG1 A;  2JL4 A;  4V2L A;  3HMJ G;  2YV7 A;  4KAE A;  3EMX A;  1GTU A;  4DSS A;  1J0F A;  4BVX B;  5ECQ B;  1AQV A;  5HR2 A;  2HRN A;  5G5F A;  2CAQ A;  5ECP B;  2H76 A;  5FHI A;  3F0I A;  3LOR A;  1TU8 A;  4YKG A;  2N5B A;  8GSS A;  1EP7 A;  2VO4 A;  5A4V A;  3VWW A;  1TDI A;  18GS A;  1O81 A;  4NV5 A;  2H0I A;  2H1B A;  4Q5Q A;  3UAP A;  5GZZ B;  2X49 A;  3VUR A;  3EPT A;  4PXO A;  5J47 A;  3LJR A;  4K5S A;  2OJL A;  1UVZ A;  1PGT A;  4F2I A;  2AAW A;  4ZB9 A;  1XVW A;  5E59 A;  1SYR A;  5IOW A;  1V98 A;  3H93 A;  1F37 A;  1T1V A;  2YZH A;  3ERW A;  4PUR A;  2VOC A;  2IMI A;  4RUV A;  4D73 B;  1NHO A;  3QOU A;  1FB0 A;  4YAV A;  3CRT A;  4H86 A;  5D9X A;  5CRE A;  2NTO A;  2EIO A;  3KTL A;  4I6X A;  1N2A A;  5ECH B;  5A5H B;  2EFH A;  1FOV A;  1OC9 B;  4FYU A;  1G6W A;  4IHU A;  1O7U A;  3H79 A;  3GMF A;  3ZIJ A;  1XWC A;  2WVX B;  5ECS A;  2VM2 A;  4PX1 A;  3KM6 A;  2WDU A;  1TW9 A;  4MJE A;  2PVO C; 
#chains in the Genus database with same CATH homology
 5D9W A;  3US3 A;  2H75 A;  1NW2 A;  3L4N A;  3CSJ A;  4JR4 A;  1QFN A;  3PGT A;  3KH7 A;  2H1D A;  1O6J A;  5KN2 A;  3J7Y b;  3RHC A;  2PUK C;  1SKR B;  4EDY A;  1OAZ A;  2H73 A;  2GDR A;  2DLX A;  2OKA A;  3UBK A;  1XXU A;  5B8B A;  2DBC A;  1GWC A;  4ECB A;  3HY2 A;  3BBY A;  3GKX A;  2IMK A;  5AIV A;  2XPE A;  1XWK A;  3GL5 A;  4WR4 A;  1XBS A;  17GS A;  3APQ A;  3FEU A;  4MCU A;  4MNN A;  4RQX A;  5DCG A;  2GS3 A;  4FYC A;  3C1R A;  4G01 A;  1BQ7 A;  5COH A;  1VF1 A;  5D96 A;  1GLP A;  2JU5 A;  3JCM L;  1GSE A;  4KW6 A;  3E3E A;  4K8M A;  1Z7R A;  3OR5 A;  2CT6 A;  4K0G A;  1T3B A;  4X0X A;  3N9J A;  2DJ2 A;  1X9M B;  2GGT A;  4IKH A;  3HVS A;  3GNJ A;  2IPA A;  1PA3 A;  1ZZY A;  1QMV A;  4PTS A;  4KSO A;  4K7I A;  3GKN A;  5DAL A;  5ECK B;  1X0R A;  2LNS A;  5IPH A;  1HNB A;  3QD9 A;  3DRN A;  2PPT A;  4AGS A;  5JCG A;  2I1U A;  4ECC A;  4NPB A;  1RK4 A;  3RHB A;  5A34 B;  5LCZ A;  3QMX A;  4F9Z A;  4L5O A;  3RDW A;  1O85 A;  1V2A A;  4Z2R A;  1K0C A;  3DML A;  3GUR A;  3IPZ A;  4TW5 A;  1YKC A;  3PIN A;  1YF0 A;  4DEJ A;  1VGL A;  3TKR A;  4TR0 A;  2HZE A;  4MJC A;  4V1A g;  3GV1 A;  5J41 A;  2QA2 A;  5IMD A;  5H5S A;  3LYP A;  2K9F A;  3F63 A;  3GKK A;  5ECN B;  2B5X A;  1GUM A;  2REM A;  2MBT A;  1QXH A;  2B7K A;  2PGT A;  1TP9 A;  3BJ5 A;  2WJU A;  2JZS A;  1UA5 A;  4ZBD A;  3FK8 A;  3GH9 A;  3IRA A;  2X64 A;  4G9H A;  5IQY A;  2O5V A;  4N0Z A;  4XRA A;  4YH2 A;  1K0D A;  3HVX A;  4LL1 B;  3ZRE A;  1XIY A;  1DE2 A;  3KH9 A;  2PU9 C;  3KP9 A;  1XVQ A;  2HZF A;  3FR6 A;  2I9H A;  2VLU A;  3DXB A;  1YVL A;  3TUE A;  3IA1 A;  1EOH A;  3C1S A;  1SK1 A;  1M9A A;  1SYX A;  3UL3 A;  1G7E A;  5IMC A;  1GH2 A;  1GTI A;  3P90 A;  4DSR A;  4ISD A;  1OYJ A;  2NDO A;  2NPB A;  3IE3 A;  3O3T A;  4GCI A;  1GLQ A;  3GSS A;  3TKS A;  1B9X C;  2CQ9 A;  1WE0 A;  3W8J A;  2VCQ A;  4HJM A;  1TI1 A;  1MD4 A;  3A2W A;  4MZB A;  2VM1 A;  3F8U A;  2OE3 A;  2YWO A;  5LNK e;  1SL0 B;  1PL1 A;  4TXO A;  3RPN A;  4BPY A;  2ES7 A;  1BED A;  4K1F A;  2VL9 A;  5A1N B;  1AUC A;  3KGK A;  2AV4 A;  4GQC A;  1B8X A;  2XC2 A;  3QDN A;  2CZ2 A;  1ZL9 A;  3VI7 A;  4TR1 B;  1Z7P A;  3NOF A;  2H6Y A;  3GST A;  3D4T A;  1PKZ A;  1GSF A;  2HI7 A;  2F8F A;  4MF6 A;  4OFN A;  3IK9 A;  4HZ4 A;  3DYR A;  4FQU A;  5KN0 A;  2WRT A;  1Q4J A;  1MTC A;  4IN0 A;  2A2S A;  1BF5 A;  3G9B A;  1CQH A;  4HOJ A;  2LTK A;  2H1G A;  1SVM A;  3KCM A;  1KTE A;  5DAK A;  2KP1 A;  4ZL8 A;  5ID2 A;  1SK2 A;  4NWY A;  5IPG A;  2QC7 A;  2HSN B;  4O5R A;  2DJ0 A;  6GSV A;  1AW9 A;  1V9W A;  2OE1 A;  2V6O A;  3QAG A;  4ZB8 A;  2GQL A;  4HEA 2;  4Z7X A;  1K3L A;  6GSW A;  4EF0 A;  5KN1 A;  1TKD B;  3CYN A;  1BYE A;  4DSS B;  1T00 A;  1GNW A;  2WZ9 A;  1T4Z A;  3H4K A;  1SD9 A;  3ZRD A;  1TK5 B;  2GQK A;  1TXU A;  5EL8 A;  4JBB A;  2VL3 A;  4RI7 A;  3I69 A;  3IV4 A;  3TOT A;  1YKA A;  4NXI A;  22GS A;  1N8J A;  3EU4 A;  4OWY A;  4K0N A;  2KLX A;  2AJQ B;  4POL A;  2C8U A;  4IQ1 A;  3MAK A;  5INY A;  3APS A;  1AQW A;  2DIY A;  5BRT A;  1DSB A;  5A4W A;  1X9W B;  1BAY A;  1PX7 A;  3GA4 A;  5JCU A;  4EKZ A;  1EGO A;  1WP0 A;  1SD8 A;  1OKD A;  3TKP A;  2LUS A;  1ILO A;  2EFD A;  2NBS A;  1LBK A;  5ABR A;  2V2G A;  1Z9H A;  4IQA A;  2LEG A;  4A5P A;  2IME A;  4J56 E;  1G7O A;  1A23 A;  4O5Q A;  1I5G A;  2BJX A;  2VL2 C;  4RI6 A;  1A24 A;  4IJ3 A;  2I81 A;  3L9V A;  1XCC A;  3ZML A;  2HYX A;  4EO3 A;  4MZW A;  1M7T A;  3FW2 A;  2LJR A;  3FR9 A;  5EPF A;  1GSD A;  4HU9 A;  4LLR A;  4CY6 A;  1VRS D;  1JZW A;  4N11 A;  2HSM A;  3O6T A;  1VF4 A;  3LEF A;  5D73 A;  3TCO A;  1S3C A;  2X8H A;  2O8V B;  4YQV A;  4LMV A;  2GZY A;  1XPV A;  3VWX A;  1K0A A;  3APO A;  4IVF A;  2VLT A;  2J23 A;  4O5U A;  2P5R A;  4GQF A;  2EC4 A;  2FY6 A;  2XBI A;  2B7J A;  4HQS A;  3HZ4 A;  2L5L A;  1GSS A;  2FA4 A;  4PGT A;  3ISO A;  2KUC A;  5DDL A;  2PVQ A;  1ERW A;  3TJG A;  3TKS C;  3C8E A;  5KOX A;  3VWV A;  2EFC A;  3TU3 B;  3P7X A;  2G0F A;  4EC0 A;  2RM6 A;  1K0B A;  2CA8 A;  1PN0 A;  5J3R A;  2R37 A;  1KBN A;  3KEB A;  14GS A;  1R5P A;  3KXO A;  4NV2 A;  4ML1 A;  5AIX A;  4GTU A;  4O7H A;  3M1G A;  5EY6 A;  2RM5 A;  2HSH A;  3HJO A;  2X4A A;  3HJP A;  1BJX A;  1JHB A;  3BOA A;  2MMA A;  2HQT A;  5G2Z A;  1K0M A;  1DUG A;  1SU9 A;  3N5O A;  1A2J A;  4I5Q A;  4PUF C;  1WPI A;  1PQN A;  2L59 A;  2PMT A;  1EWX A;  5IMZ A;  1U3I A;  3ZL5 A;  20GS A;  4ZIL A;  4CY8 A;  2H6X A;  4WEY A;  4MH2 A;  2H01 A;  4FYB A;  2VKZ G;  4YQU A;  2IMD A;  2RUF A;  2VCX A;  4GSS A;  5IMV A;  3D4M A;  5J4U A;  3BCI A;  5DAL B;  1Y25 A;  1O8W A;  1A2L A;  4KCA A;  1GSU A;  3M9J A;  3F3R A;  4K6X A;  4AJ6 A;  1UN2 A;  3NIV A;  2C1Y A;  1THO A;  4KND A;  2GTU A;  2HRK A;  4N10 A;  2LNT A;  4MPG A;  2HFD A;  2VCZ A;  4KDY A;  6GSY A;  4TN8 A;  1SVL A;  2H70 A;  4K2D A;  2LRN A;  2YJ7 A;  1W4V A;  2YZU A;  4XS6 A;  3ZZX A;  2YOI A;  3F9U A;  5D93 A;  3KP8 A;  5HFK A;  2I4A A;  3L0H A;  5J4V A;  2ZUP A;  3NZN A;  3F6D A;  2NVL A;  4CHS A;  3HD5 A;  4EDZ A;  2L5O A;  4QQ7 A;  2ALB A;  2HZE B;  3M0F A;  4AI6 A;  1GUK A;  5DBQ A;  3TB2 A;  1HYU A;  19GS A;  1PX6 A;  2YPM A;  2YWI A;  4XHM A;  5CRH A;  1T7P B;  3DVX A;  3GIX A;  3GN3 A;  4OFM A;  1GTA A;  1WWJ A;  4MP4 A;  2H72 A;  3CTF A;  2GQM A;  3FKF A;  3LFL A;  1U3A A;  1KNG A;  2WCI A;  2QSI A;  4PQH A;  2WS2 A;  2IMF A;  1XW5 A;  1PKW A;  2DSA A;  1M2D A;  2L4C A;  3UAR A;  3C71 A;  1EZK A;  2XPD A;  2RUE A;  4P3Y B;  1ST9 A;  1XZO A;  4K7N A;  5IMF A;  3IC4 A;  1ERU A;  2L4Q A;  3DIE A;  4MH3 A;  1U87 A;  2TRX A;  3D6I A;  3FR3 A;  2OE0 A;  2R6K A;  3VPQ A;  2O85 A;  3A2X A;  1ON4 A;  1EEM A;  5HR1 A;  2OAD A;  4WXT A;  2LST A;  2ON5 A;  1FW1 A;  1Y1U A;  4AKI A;  2CAI A;  4HZ2 A;  2V6K A;  4ZL7 A;  5J9C A;  2YAN A;  2IJY A;  2OT3 A;  5D9T A;  4BL7 A;  5JCW A;  4ZBA A;  1TTZ A;  2FD3 A;  1GSY A;  3EMP A;  1DBY A;  4CDO A;  9GSS A;  4FO5 A;  3GHA A;  3QPM A;  2H0H A;  4FH8 A;  4GST A;  5ECM B;  1YZX A;  4TXO B;  3LQ7 A;  1ZCP A;  1H75 A;  3WT1 A;  4XRD A;  4ML6 A;  5DVB A;  3PH9 A;  2HSY A;  2DKI A;  3FZ5 A;  2H30 A;  1SEN A;  2LJK A;  4EIQ A;  4MF7 A;  1TI3 A;  2R0G A;  5D8I A;  2A4H A;  5J4Y A;  2UZ8 A;  1USB A;  4XCS A;  3IDV A;  2HXK A;  2GSQ A;  4G0L A;  2YWN A;  4Z2U A;  1N25 A;  1O8X A;  2PWJ A;  2CVB A;  5DQY A;  4KSM A;  5B7C A;  3UEM A;  3D5J A;  2TRC P;  3IR4 A;  1E6B A;  1X9S B;  2VUP A;  2MYG A;  3DEX A;  4G10 A;  4JZQ A;  2M72 A;  4ULX A;  1PMT A;  2E7P A;  4XIH A;  4XS4 A;  5DAK B;  5CP1 A;  5ID2 B;  1OVN A;  3GFK A;  2MBS A;  2E2M A;  2P5Q A;  3A5W A;  2CZ3 A;  1S3D A;  2F3M A;  2H19 A;  1SL1 B;  4TKY A;  1Q98 A;  1JZO A;  4BVY B;  3MSZ A;  6GST A;  4DSQ A;  3FY7 A;  2LV3 A;  4O92 A;  5G5E A;  3ZVJ A;  4L0W A;  2ON7 A;  3UJ1 A;  4YQM A;  2VD1 A;  4POB A;  1GNE A;  2G2Q A;  1EEJ A;  4JR6 A;  3F4R A;  5BMU A;  4HI7 A;  5DJM A;  1TU7 A;  2LRT A;  4MF5 A;  3QAV A;  4EVM A;  4EE0 A;  3FHK A;  1SKS B;  1ERT A;  3HDC A;  1CQG A;  4WBR D;  1X5D A;  4OCF A;  1QQ2 A;  4MJA A;  4TXV A;  2F8A A;  5CRD A;  3HXS A;  4J57 E;  4QL9 A;  4ECJ A;  4GXZ A;  1OKT A;  3H8Q A;  1VF2 A;  2EIR A;  16GS A;  1ZOF A;  2YCD A;  4KH7 A;  4TOP A;  4WF5 A;  2B5Y A;  2VCV A;  4XS1 A;  4MZC A;  5B6N A;  1I9D A;  2F9S A;  4I97 A;  3E9J B;  4L0U A;  3I6A A;  2JAC A;  5C00 A;  1T8E B;  2DKH A;  5CRW A;  2YN1 A;  1NHY A;  4TR4 A;  5CNW A;  3M9K A;  3TJB A;  5F06 A;  3TKQ A;  2C0F A;  2HSM B;  2WB9 A;  2R0P A;  2H1L A;  2I3Y A;  1TJD A;  1THX A;  3IHG A;  4PNG A;  1A2M A;  5CYY A;  3CXG A;  1SKW B;  1W89 A;  1GL8 A;  1XOB A;  1ZYP A;  5JWR B;  2R3X A;  1NSW A;  4IP1 A;  1EOG A;  1QUW A;  1HNC A;  4IGJ A;  2DJ3 A;  4GLT A;  4F0B A;  3G7Y A;  2C3Q A;  3CWG A;  3VI5 A;  3ME8 A;  6GSX A;  3C73 A;  4AJ8 A;  4XTS A;  1GUL A;  4BVY A;  1YF1 A;  5EVO A;  3SWL A;  2Z9S A;  1TRW A;  5G1L A;  1UC7 A;  2A2R A;  4G2E A;  1FAA A;  4BWS A;  3ERF A;  2ZNM A;  4KB3 A;  1GSQ A;  2KOK A;  5G31 A;  3HYP A;  4MLY A;  2XBQ A;  2R5G A;  3H1N A;  3A2V A;  4X4J A;  2TIR A;  2V1M A;  1J9B A;  1F3A A;  4O32 A;  5L71 A;  2M80 A;  2GZP A;  5GAN D;  1VF3 A;  4NHW A;  4YAP A;  2FWH A;  5ECI B;  5IM9 A;  3UOM A;  4IP6 A;  3EC3 A;  1FG4 A;  3DGQ A;  2VD0 A;  3VWU A;  2LRC A;  2O87 A;  3VPT A;  3DVW A;  2H74 A;  2JZT A;  4QMK A;  5IIZ A;  2VCW A;  4K7O A;  4EUY A;  3UVH A;  1JZR A;  1K0O A;  3F3Q A;  1QGV A;  1WOU A;  4Z2T A;  4IBP A;  2FWF A;  4OMV A;  2H66 A;  4Q5F A;  5CAX A;  1OE7 A;  6GSU A;  1XWA A;  2LKU A;  1MD3 A;  1XFL A;  4DVC A;  2HRK B;  3GL3 A;  4JU5 A;  1FB6 A;  2MMZ A;  2RLI A;  4Q5R A;  3VK9 A;  1V57 A;  3GUS A;  2R4V A;  5KEJ A;  2BMX A;  3D0Z A;  2JAD A;  3R2Q A;  3ZFL A;  5KOW A;  3MNG A;  3ZIV A;  1X5E A;  5ELG A;  2E0Q A;  2IFQ A;  1XW6 A;  4L8E A;  1WJK A;  2JSZ A;  2MZC A;  1YY7 A;  2CX3 A;  2X8G A;  2UV8 G;  2JZR A;  3ZLP A;  5IO2 A;  3IXR A;  3CBU A;  3UMA A;  2OAC A;  2AHE A;  2LS5 A;  3UVT A;  2HT9 A;  3CMI A;  3L78 A;  4NMU A;  2YWM A;  1PD2 1;  3GRX A;  3Q18 A;  3QFB C;  4ZXG A;  1SJI A;  4AJ7 A;  2VIM A;  4LL4 B;  4W66 A;  1R5A A;  3Q74 A;  2CX4 A;  2AYT A;  2AB6 A;  1A8Y A;  3IAM 2;  3S9F A;  1M0U A;  2VAF A;  1Z5Y E;  2DIZ A;  3M3M A;  1AC1 A;  2V41 A;  1IYI A;  3UBL A;  3EU3 A;  1G0T A;  4KGI A;  3WGX A;  3IBH A;  4USS A;  3ZVJ D;  3QR6 A;  4I2U A;  4POK A;  5ECO B;  2KHP A;  4ZIJ A;  3KIJ A;  2DJ1 A;  2V32 A;  5D9V A;  4E8H A;  1EV9 A;  1FVK A;  3BCK A;  4AKG A;  2WGR A;  4KX4 A;  5C04 A;  3TJK A;  3FZ9 A;  4YKF A;  3GX8 A;  4WKW A;  5H5R A;  1TOF A;  4NAX A;  4BL7 B;  4ACS A;  5HR3 A;  4OO4 A;  1EGR A;  2CVK A;  4MA9 A;  2C0G A;  4KDU A;  2JSY A;  4MMM A;  1OC8 A;  3IK7 A;  2K6V A;  1X5C A;  1FVJ A;  3ME7 A;  5IO0 A;  4F82 A;  4HQZ A;  4WBJ A;  4ICY A;  2OBK A;  2HE3 A;  5A5K A;  1V58 A;  2H8L A;  5DJL A;  3DD3 A;  1F2E A;  1RW1 A;  1A0R P;  3WGE A;  1TRU A;  1Y6E A;  2C0D A;  2MMO A;  1AXD A;  2J9H A;  3TOU A;  3KMO A;  4IW9 A;  1AIU A;  3IOS A;  1BG5 A;  1AQX A;  2BTO T;  2FWG A;  2C3N A;  4HU7 A;  4F0C A;  5HFG A;  2IL3 A;  1XWG A;  2M46 A;  3TKS E;  3HCZ A;  3ZYW A;  1C72 A;  4OCE A;  2FUG 2;  3GTU B;  3L9U A;  3W6G A;  3GKM A;  4XS4 B;  2C80 A;  1M9B A;  1M99 A;  4BWQ A;  2FWE A;  4KE3 A;  2FCH A;  5LD0 A;  1R4W A;  1M2B A;  4KDX A;  4GWR A;  1LU4 A;  2IIY A;  3ED3 A;  2B1L A;  3FMW A;  1ZMA A;  4GF0 A;  3J7Y k;  3A3T A;  3PR8 A;  1J08 A;  4MDC A;  4V2M A;  1EV4 A;  3Q6O A;  2P31 A;  4I8B A;  4TVE A;  5J9B A;  5HQP A;  3LSZ A;  3HA9 A;  4IEL A;  1K3Y A;  2GVP A;  1TK0 B;  4TR3 A;  5BMU B;  1YQ1 A;  4KA0 A;  2YP6 A;  1ZGN A;  3LW9 A;  4G19 A;  5A4U A;  3MDK A;  5J5N A;  2IN3 A;  3CSI A;  2GZZ A;  2YNX A;  2C0E A;  1YDK A;  2A4V A;  2H71 A;  1PRX A;  2FHE A;  1SJ6 A;  1TRV A;  2LQQ A;  3I9V 2;  4BVX A;  3E0U A;  2DC5 A;  3EVI A;  1LJR A;  2GT5 A;  3IHQ A;  3CRU A;  13GS A;  2H1A A;  3O76 A;  1R7H A;  2WUL A;  3LXT A;  2XHF A;  5GSS A;  2FLS A;  2WFC A;  4AF2 A;  1GTB A;  1G6Y A;  3HVV A;  4OD7 A;  2VCT A;  3MIX A;  4N0V A;  3TGZ A;  5AGY A;  3AY8 A;  2LQO A;  3WGD A;  5F0G A;  3LG6 A;  2DML A;  5F05 A;  4WF4 A;  4I2T A;  5FT3 A;  5IMA A;  2B6M A;  4ZB7 A;  4BA7 A;  4L5L A;  4EIP A;  2HLS A;  2HNL A;  1YEP A;  1U6T A;  1MDK A;  1JLV A;  3A5I A;  4HDE A;  2EIQ A;  2HRA A;  4J2F A;  3L9S A;  1A8L A;  3DWV A;  3M8N A;  2GST A;  2L57 A;  3VLN A;  3U5R E;  1SVO A;  4EXJ A;  2N5F A;  1V40 A;  1Z6M A;  5AN1 A;  1ZYN A;  2DMM A;  1B48 A;  3GTU A;  4D73 A;  5CO3 A;  1YJ6 A;  3HZ8 A;  3LYK A;  1DE1 A;  2HRF A;  4RQR A;  1TRS A;  3LXZ A;  3UIW A;  1HQO A;  1OE8 A;  5A5H A;  1K0N A;  3RBT A;  4N3Z A;  3EYT A;  1OC9 A;  2K8V A;  2R0C A;  1ZYE A;  1GRX A;  2YJH A;  2O7K A;  1WIK A;  4GSN A;  2B3S A;  3EUR A;  1ERV A;  3BD2 A;  5F07 A;  1HNA A;  3WYW A;  2VL2 A;  3GYK A;  4PNF A;  1R26 A;  1YEX A;  5ELA A;  4V1A p;  5CRG A;  12GS A;  4MPF A;  3EIN A;  1RQM A;  3WT2 A;  2GT6 A;  2H6Z A;  3W8S A;  4KCE A;  3VFI A;  3TJJ A;  3IC8 A;  3KJY A;  3CSH A;  11GS A;  2F51 A;  4EL1 A;  5DQS A;  3RPP A;  4JED A;  2L6C A;  1OC3 A;  7GSS A;  3K8N A;  4G0I A;  1ABA A;  3WD6 A;  5J40 A;  4MK3 A;  3Q19 A;  1GP1 A;  1NM3 A;  3TRX A;  4K2X A;  2QGV A;  2DJK A;  1FOH A;  4LMW A;  3QAW A;  1E2Y A;  4ZL9 A;  1PN9 A;  3PPU A;  2B5E A;  4LA1 A;  2GSR A;  5B6M A;  1SL2 B;  2EFE A;  4HS1 A;  3FYG A;  4KUN A;  2DJJ A;  1XWB A;  2X8C A;  2A2P A;  4GRF A;  1F3B A;  4V2N A;  3SBC A;  2N5A A;  2PER A;  2IFQ B;  4WET A;  2K18 A;  3G7I A;  2VLV A;  4IJI A;  4Q5N A;  1F9M A;  1M2A A;  3RAZ A;  3ZIT A;  4AKH A;  2GLR A;  3LGC A;  2D2Z A;  1ACV A;  2YV9 A;  4ID0 A;  5A34 A;  5HFI A;  3V1W A;  3F4T A;  1MDI A;  1WRY A;  3QFA C;  4HUA A;  5H5Q A;  4PUA A;  2LJA A;  4MJB A;  10GS A;  1FO5 A;  2MMN A;  4ECI A;  3P8W A;  5G30 A;  2OA7 A;  3GX0 A;  4N30 A;  5ECR B;  3TRP A;  2FGX A;  2FNO A;  2C4J A;  5B8A A;  1JFU A;  3TDG A;  4K9Z A;  5E4W A;  2OBI A;  1Z6N A;  3EWL A;  1BX9 A;  3MYD A;  1A0F A;  3EE2 A;  5F8B A;  1K3O A;  2X99 A;  2P0G A;  1ZYQ B;  5IOX A;  1B4Q A;  2C3T A;  5GAP D;  3ZMK A;  3LWA A;  3HHV A;  2PBJ A;  1WMJ A;  2PN8 A;  1S3A A;  1TK8 B;  1T4Y A;  1B4P A;  2K8S A;  1FHE A;  1QK8 A;  3FRC A;  3G7J A;  1F6M C;  4OFT A;  2FA8 A;  1AAZ A;  1IYH A;  2IWT A;  2AUV A;  3MWH A;  3HJM A;  1HD2 A;  2O89 A;  3FZA A;  2RII A;  6GSS A;  3R3E A;  3TRQ A;  2KP2 A;  3P2A A;  1URM A;  4JRR A;  3F6F A;  2GSS A;  3ZFB A;  4WR5 A;  2H0G A;  4ZBB A;  1MEK A;  3KMN A;  5DCH A;  4OO5 A;  4ILF A;  3ERG A;  2CV4 A;  4X1U A;  4JE1 A;  5ENU A;  5ECL B;  4AKX B;  4PQI A;  3KD0 A;  2QKE A;  3U6V A;  3C7M A;  5GST A;  3ZTL A;  1TXX A;  1KEB A;  1JLW A;  2R2J A;  3TJF A;  5JWO B;  1XW9 A;  2L6D A;  5A1N A;  1MDJ A;  4E8E A;  3D22 A;  1SK0 A;  2B1K A;  4TR1 A;  2E2G A;  1ML6 A;  4NHZ A;  4MAB A;  1XOA A;  1PSQ A;  1SJZ A;  2ZCT A;  4FIW A;  4PQ1 A;  5HR0 A;  1H4O A;  4X43 A;  3HKR A;  3D21 A;  3GH6 A;  3KTB A;  1U88 A;  3I43 A;  1EP8 A;  4QL7 A;  3DKS A;  3IAS 2;  5FWG A;  3FZ4 A;  3F4S A;  4IS0 A;  1GUH A;  1B9Y C;  1PL2 A;  4F03 A;  4POM A;  3QCP A;  3KZQ A;  5AIS A;  5G1K A;  1O73 A;  4G0K A;  1Z3E A;  4TRX A;  4HJ2 A;  2HSN A;  4ZB6 A;  5KN3 A;  4GDF A;  1JZD A;  2CVD A;  5JWQ B;  4K5R A;  4E68 A;  2QA1 A;  4CW9 A;  3CTG A;  4KF9 A;  1BG1 A;  2JL4 A;  4V2L A;  3HMJ G;  2YV7 A;  4KAE A;  3EMX A;  1GTU A;  4DSS A;  1J0F A;  4BVX B;  5ECQ B;  1AQV A;  5HR2 A;  2HRN A;  5G5F A;  2CAQ A;  5ECP B;  2H76 A;  5FHI A;  3F0I A;  3LOR A;  1TU8 A;  4YKG A;  2N5B A;  8GSS A;  1EP7 A;  2VO4 A;  5A4V A;  3VWW A;  1TDI A;  18GS A;  1O81 A;  4NV5 A;  2H0I A;  2H1B A;  4Q5Q A;  3UAP A;  5GZZ B;  2X49 A;  3VUR A;  3EPT A;  4PXO A;  5J47 A;  3LJR A;  4K5S A;  2OJL A;  1UVZ A;  1PGT A;  4F2I A;  2AAW A;  4ZB9 A;  1XVW A;  5E59 A;  1SYR A;  5IOW A;  1V98 A;  3H93 A;  1F37 A;  1T1V A;  2YZH A;  3ERW A;  4PUR A;  2VOC A;  2IMI A;  4RUV A;  4D73 B;  1NHO A;  3QOU A;  1FB0 A;  4YAV A;  3CRT A;  4H86 A;  5D9X A;  5CRE A;  2NTO A;  2EIO A;  3KTL A;  4I6X A;  1N2A A;  5ECH B;  5A5H B;  2EFH A;  1FOV A;  1OC9 B;  4FYU A;  1G6W A;  4IHU A;  1O7U A;  3H79 A;  3GMF A;  3ZIJ A;  1XWC A;  5ECS A;  2VM2 A;  4PX1 A;  3KM6 A;  2WDU A;  1TW9 A;  4MJE A;  2PVO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...