5DJLA

Structure of wt human glutathione transferase in complex with cisplatin in the presence of glutathione.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Glutathione transferase P1-1 can inactivate the anti-cancer drug cisplatin by a novel mechanism
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5djlA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5djlA01
1Z7RA 4YAPA 4HQSA 1E6BA 1F2EA 2DJKA 1Z3EA 2RM6A 5IOXA 4XRDA 2C0GA 3DD3A 4ECBA 2RIIA 2CX4A 4OO4A 1XVWA 4F0BA 2XPDA 1B8XA 2NDOA 1F3BA 2H1GA 3MSZA 1TKDB 9GSSA 5IMZA 2O85A 3KTBA 3EVIA 3I69A 3CTGA 2XHFA 4X43A 2YWMA 3TKRA 1JZOA 3CSJA 4EXJA 4O5RA 2O89A 1OYJA 5HR3A 3HZ4A 2C80A 3BBYA 3UL3A 3L0HA 1XIYA 4NXIA 3TJGA 1BAYA 3Q6OA 2H73A 1V40A 4BVYB 3KMOA 4QQ7A 4PNGA 1TK0B 1T7PB 3UBLA 1AQVA 4Q5RA 5C04A 2ZNMA 1OAZA 4QL9A 3J7Yk 1OKDA 5HFKA 3TJFA 2WCIA 4MJEA 5G5FA 3FEUA 1V98A 1O8XA 5DAKA 2IJYA 3TOTA 4NV2A 1M2BA 2MMAA 3F0IA 12GSA 2VL2C 2ALBA 2JZRA 3FW2A 5LCZA 1A8LA 3WGDA 1YJ6A 2HFDA 3I9V2 2LEGA 2D2ZA 3IDVA 4N0ZA 2LNSA 4ZL8A 4TVEA 3ZTLA 1VF4A 2V6OA 2MYGA 2X8HA 1K0OA 3ME8A 1PX7A 3ZRDA 4GSTA 5ECNB 2DMLA 3UIWA 5J3RA 4RI7A 3UBKA 2KHPA 3GKKA 5IO0A 5LD0A 3GMFA 1U3AA 3LGCA 3H93A 1PKWA 3VURA 3I43A 6GSVA 3ZYWA 4KE3A 1R5AA 1QUWA 4JEDA 2LSTA 5DALA 5KN0A 5DAKB 2DIYA 2GVPA 2IWTA 3IRAA 1MEKA 1WMJA 1JZWA 5EVOA 2LUSA 2OBIA 3O76A 1SKSB 4KGIA 1GTAA 1PA3A 5D9TA 4TOPA 1OC3A 3OR5A 2HZEA 5H5SA 1SU9A 3KH7A 2B1KA 5ECQB 2LRCA 5J9CA 3DGQA 2CA8A 3Q18A 2X8CA 3CSHA 4ZBBA 1MTCA 1K0DA 1SL1B 2LJRA 3P8WA 2ZUPA 3Q74A 1SK0A 3EMPA 3GNJA 2E2MA 3UEMA 5G31A 1MDKA 3HD5A 1B4PA 3W6GA 5CRWA 2FNOA 4K7OA 1X0RA 3HXSA 2C3TA 3ERGA 4EDZA 3C1SA 1FHEA 1NSWA 1YKAA 3DXBA 3TRPA 5DALB 2MZCA 5CAXA 1YY7A 4IKHA 4OFTA 2TRCP 1A2JA 1SJ6A 3PR8A 2MBTA 6GSTA 3ZMLA 1EGRA 4LMWA 3G7YA 4CDOA 2HZEB 4EDYA 3D0ZA 5DDLA 4CW9A 1B9YC 4TR4A 5B6NA 2C0FA 2WDUA 3UARA 1HNAA 1BEDA 1GSFA 3H4KA 3HZ8A 1VF1A 1FOVA 4KCEA 4E8EA 2F9SA 2EIRA 3F4RA 2HSYA 4IN0A 2R4VA 4G10A 1T4ZA 3FR3A 5H5QA 2H71A 1AW9A 3DKSA 3KD0A 16GSA 4IHUA 3QCPA 3GYKA 3F4TA 3RBTA 4XS1A 3EURA 3D4TA 1KNGA 1U87A 3KH9A 1HNCA 3GL5A 4RQRA 3EINA 1MDJA 1SK2A 4WBJA 1I5GA 3GIXA 2NPBA 1TRSA 3N5OA 2B3SA 5HR2A 3IBHA 4MZBA 4K6XA 4KB3A 2FWFA 5DJLA 3HKRA 3IOSA 3F4SA 2GT5A 5ELGA 3GKXA 1KBNA 3M3MA 3CXGA 3TGZA 2YP6A 3FR9A 4KCAA 2CZ2A 5IOWA 2G0FA 1EGOA 3L9UA 3KJYA 2RUEA 4PQHA 2VL2A 2F51A 2B5EA 2HXKA 4YH2A 3CTFA 1F3AA 4TN8A 4USSA 1N2AA 3GSTA 4XS6A 3TCOA 3APQA 3FRCA 2N5AA 2FY6A 4F9ZA 4P3YB 1E2YA 4MPFA 2H8LA 2DSAA 3LORA 4DVCA 1ABAA 3IK9A 5ENUA 2L4QA 3IAM2 3G9BA 2TRXA 1BYEA 3FY7A 5IO2A 2JZTA 2AYTA 4BPYA 2MMZA 5D8IA 4KSOA 4EC0A 2IFQA 1O73A 3DVWA 4JR6A 3ZVJA 1TRWA 1USBA 4GCIA 4XIHA 3W8SA 5DJMA 3GHAA 2X64A 1AIUA 11GSA 5KEJA 3KP9A 3KCMA 3GTUA 4ECCA 3GA4A 4LL1B 4FIWA 4IQAA 2VLTA 4J57E 4X0XA 3QOUA 4MABA 5D9XA 4POKA 6GSSA 5F05A 4EE0A 4N11A 3UVHA 2JZSA 1SD8A 1A0FA 3HJPA 1R5PA 4HJ2A 2ZCTA 2EIOA 1X5CA 2C1YA 2K18A 4HDEA 4I2TA 4LL4B 4POBA 5JWQB 1XZOA 2DIZA 1PGTA 1TXXA 5G1KA 2IFQB 4LA1A 2FCHA 1HYUA 4NV5A 5CRHA 4MJAA 2HSMA 5B8BA 2GGTA 2OKAA 4MH3A 1ZL9A 3SWLA 3C8EA 3Q19A 5G30A 4V2LA 1TU8A 2PVQA 2QSIA 1SYXA 4MH2A 4DEJA 1TW9A 3VFIA 4XTSA 3GTUB 2VUPA 4BVXA 3UAPA 2VL3A 4K7IA 3QD9A 4AJ7A 1B48A 4ZL9A 4TW5A 1EP7A 1O85A 2GSRA 2VD1A 5HR1A 2H6ZA 1Z5YE 1FW1A 4MDCA 2GS3A 3QFBC 2K8SA 5JCWA 4D73A 3ZL5A 1F37A 1BG5A 1V57A 3M9KA 3PINA 1TOFA 2K9FA 1PMTA 2DJJA 1WIKA 1PD21 1DUGA 2H30A 3GH6A 2HSMB 2R2JA 3GN3A 3TJBA 1Y25A 3ED3A 1JLVA 3PGTA 1HNBA 2C3QA 1EOGA 3MAKA 4EO3A 2XBQA 3D6IA 5GAND 3DWVA 1XWKA 3TDGA 4BVXB 1AQWA 4YQUA 1MDIA 4TR0A 2DC5A 1ERWA 4LMVA 3ZMKA 1SL0B 2NTOA 1OKTA 10GSA 1B4QA 2P5QA 3HYPA 4I2UA 3TOUA 4XCSA 5ECMB 3M1GA 3F6DA 1PSQA 5B7CA 2L5LA 2H6XA 4D73B 1X9MB 1GTBA 5GZZB 4K1FA 2DJ1A 4IBPA 5DQYA 2HRFA 2H75A 3IV4A 3E3EA 4V2MA 1MD4A 4Z7XA 2HZFA 4MLYA 5CRDA 1M99A 3LG6A 4F0CA 3R3EA 1VF2A 1K0BA 1U88A 1TP9A 3KTLA 5CYYA 2QC7A 1H75A 3ZZXA 3VI7A 2P5RA 4I6XA 5DQSA 2EIQA 1XXUA 3RHCA 1U3IA 5IMDA 5IPHA 5IMCA 2DJ3A 1EEJA 1O8WA 5DCGA 2LTKA 5G5EA 2OJLA 4CHSA 5JWOB 3ZREA 3F3QA 2WJUA 4GF0A 2F8FA 3A2WA 2FD3A 3HHVA 2MBSA 1XWCA 3MDKA 2REMA 2CVBA 1G0TA 4KA0A 4XS4A 3QAGA 1DBYA 3VWXA 2DMMA 2PMTA 2HRNA 4OWYA 3I6AA 2XPEA 1VF3A 1AUCA 1NHOA 5B8AA 1XPVA 2V41A 1CQHA 2V2GA 3M0FA 2HNLA 3ERFA 4V1Ag 4WEYA 2OE3A 3GX8A 4WETA 3L9SA 1GUKA 4ML1A 1S3AA 1FAAA 1LJRA 3TKSE 4IP1A 3G7IA 1T3BA 3WGXA 1Z6NA 4DSSA 2C3NA 1HD2A 5ECHB 2GZZA 4ML6A 2M80A 3H79A 4ISDA 3EWLA 4GQCA 3NIVA 5H5RA 4JRRA 3CBUA 4LLRA 4PQIA 4WR5A 1ML6A 3LEFA 2YWIA 4OFNA 2FA4A 4MJCA 2GQLA 4IVFA 5INYA 1EV9A 2R3XA 4GLTA 2WS2A 3DEXA 1BJXA 2A2RA 2GLRA 4FYCA 4MJBA 3A2VA 2RUFA 2OE1A 5D96A 1W4VA 1ZZYA 4DSSB 1K0NA 4POMA 1PL2A 2VIMA 4MCUA 3JCML 4GSNA 3GRXA 2YN1A 2B5XA 3RPPA 1GTIA 2AHEA 2I4AA 4PTSA 2LJAA 1X9WB 2BJXA 4GRFA 1H4OA 4IJIA 2L6CA 2I1UA 1EWXA 2OBKA 3FZ4A 5JWRB 4HS1A 1ST9A 1TRUA 1RW1A 3DMLA 4WKWA 3LXZA 3LWAA 3QR6A 2CVDA 4JBBA 4FO5A 4YAVA 1SL2B 5A4UA 2JSYA 2PVOC 2J23A 1YEXA 3AY8A 2VD0A 1A2LA 5E4WA 4MZWA 4XRAA 4NHWA 2VOCA 1OC8A 1GSUA 2E7PA 1RK4A 3KGKA 4PUAA 4KW6A 4KAEA 4OCEA 5ECIB 4K0GA 2B7KA 3HVSA 1AXDA 4FYUA 2AAWA 4ID0A 3VK9A 1GRXA 1KTEA 3LYKA 4ZBDA 1WPIA 2LV3A 1CQGA 3KP8A 4KF9A 2AB6A 2AUVA 4F82A 2IIYA 2R6KA 1JZDA 3ZITA 4IQ1A 4MF6A 4V1Ap 3FHKA 2WFCA 1GSEA 3D21A 3F8UA 4NPBA 20GSA 3F63A 1A0RP 4HUAA 1SKRB 5COHA 2EC4A 5HR0A 5D73A 5ECLB 1TJDA 2IMEA 1HQOA 1ZYQB 2PGTA 2CAIA 2HE3A 4EKZA 4ZILA 2H01A 3ZFLA 1OC9A 4TR3A 3CYNA 5FT3A 5ELAA 4Q5QA 1K3YA 1BX9A 2CVKA 1GWCA 2P31A 3HVVA 2PPTA 2IMIA 4G2EA 1OE7A 2CQ9A 1Q4JA 2HSNB 4MP4A 2GQMA 4IP6A 4AGSA 4JU5A 5IIZA 3H8QA 4I5QA 3GL3A 2JADA 3GKNA 2C0EA 4WR4A 3TKQA 4IS0A 4AJ8A 4TXVA 1YZXA 2VLUA 2VM2A 1I9DA 2P0GA 4GQFA 1F6MC 2E2GA 2PBJA 2JSZA 1EZKA 4J2FA 2OA7A 4FH8A 3FYGA 3FZAA 3G7JA 4ZBAA 4KX4A 2PU9C 3D4MA 1OC9B 6GSWA 2ON7A 4PX1A 2V32A 5IQYA 2GTUA 1K3OA 1NM3A 3FK8A 4GTUA 1YKCA 2FHEA 4RQXA 4HEA2 1ERTA 1G7EA 2C4JA 1A2MA 1MD3A 3VWWA 2X8GA 2HLSA 4GSSA 2J9HA 2NVLA 2KUCA 1M2DA 5CREA 5DBQA 3IC4A 4HU9A 3SBCA 4O32A 2CZ3A 3QAVA 3GURA 1Q98A 3WT2A 2KOKA 2YV7A 3ZFBA 2DBCA 1SYRA 3WYWA 3DIEA 3U5RE 2V6KA 5JCUA 2OADA 5IMVA 2L57A 1TK5B 2HRKA 5ABRA 4O7HA 1GSDA 2H0GA 3GSSA 3HJMA 5J9BA 2RM5A 5GSTA 4HZ2A 3EE2A 1AC1A 1AQXA 4JR4A 1ACVA 1Z9HA 5AIXA 3ERWA 5GAPD 1XBSA 4G9HA 1WJKA 5FHIA 3RHBA 3VWUA 5ECPB 2DJ2A 2WZ9A 5BMUA 1EOHA 3QAWA 1Z6MA 3RPNA 2LQQA 1FB6A 4N10A 4ZXGA 3S9FA 4ULXA 4K7NA 3APOA 3FR6A 22GSA 2WULA 4HZ4A 2BTOT 4PURA 3EYTA 3L4NA 2H74A 2H0HA 2HYXA 5ECRB 1XCCA 3LQ7A 4I8BA 3J7Yb 1A23A 1JFUA 1A24A 3RAZA 1WE0A 1R4WA 3BCKA 4NHZA 2E0QA 2HRAA 1QQ2A 2O7KA 2GZYA 2HRKB 2IN3A 3E0UA 1YF1A 1SENA 2GSTA 7GSSA 1WWJA 2H0IA 3KM6A 5AGYA 3HY2A 1WP0A 2YANA 1M2AA 3IC8A 3GX0A 2QGVA 3ME7A 2PN8A 3TJKA 2YWNA 4TRXA 1PL1A 1DSBA 2Z9SA 4HJMA 5EPFA 4ZL7A 1ZOFA 2LRNA 5IPGA 3APSA 4WXTA 1TTZA 3A3TA 4ACSA 2YJHA 1ZYEA 3IXRA 1IYHA 4BA7A 5ID2A 3BOAA 4TR1A 1GLPA 3UOMA 3TUEA 1XWAA 2VAFA 2YNXA 4NMUA 3KXOA 1GULA 1V58A 2I3YA 3H1NA 5F0GA 3TKSC 3R2QA 3VLNA 3QDNA 2KP1A 5J41A 3EC3A 1O7UA 1PX6A 4OFMA 2ON5A 3TRQA 2WB9A 2H6YA 14GSA 1XFLA 1VRSD 3P2AA 5KN3A 1GNEA 5FWGA 2YJ7A 4FQUA 2FA8A 4WF5A 1YDKA 3LSZA 3K8NA 2GDRA 1FO5A 3M8NA 3IA1A 3CRUA 4PQ1A 2UZ8A 3PH9A 2CAQA 3LFLA 1YF0A 2VCVA 3IK7A 4YQMA 4YQVA 19GSA 5ID2B 2I81A 4TR1B 1X5DA 5C00A 4X1UA 3IPZA 4BVYA 2IPAA 1THXA 2H70A 1FB0A 1RQMA 1T4YA 3DYRA 4JZQA 1T8EB 2L59A 5DVBA 3BD2A 1EP8A 4KDXA 2JACA 1SJZA 3HDCA 1K3LA 2XC2A 1DE2A 3FKFA 2XBIA 2M72A 4K8MA 3LXTA 2WRTA 4AF2A 1UN2A 4PGTA 13GSA 1R26A 4F03A 4G19A 1XW5A 2LQOA 5CO3A 3MWHA 3VI5A 1QGVA 2GZPA 2V1MA 4G0KA 4HQZA 4OMVA 3GFKA 1XW9A 4EL1A 1X9SB 1ZGNA 2YCDA 4HU7A 2IMDA 4L8EA 2PERA 1ERUA 4GWRA 2YOIA 1SD9A 4IJ3A 1J0FA 18GSA 2FWGA 1TDIA 5IM9A 4J56E 3A2XA 2LJKA 1QFNA 4WBRD 1PN9A 2M46A 2VL9A 2IL3A 1O6JA 4GXZA 5HQPA 4XS4B 4F2IA 3F3RA 2PUKC 2KP2A 1ZMAA 1V2AA 2OE0A 6GSXA 2PWJA 5CNWA 2R37A 3DRNA 1GTUA 4BL7A 5D9VA 1M0UA 2B7JA 3TJJA 1PRXA 1ON4A 2L6DA 4MK3A 1GLQA 5CP1A 3MNGA 3TB2A 3O3TA 4G0LA 3GH9A 2FWHA 4WF4A 4PNFA 1G7OA 4E8HA 1Z7PA 1EEMA 3UMAA 1U6TA 3GUSA 3QMXA 3L78A 4L5OA 2H1DA 4Q5NA 1TI3A 2VCZA 4N0VA 1BQ7A 4OO5A 2DLXA 4KH7A 2VLVA 1GH2A 1FVJA 3WGEA 2LS5A 1SJIA 3EU3A 3F6FA 5AISA 4EF0A 2QKEA 5ECOB 2HQTA 4O92A 2H1AA 2BMXA 1ILOA 2H19A 4BL7B 3TKSA 5A4WA 3WD6A 2RLIA 1XWBA 1TK8B 5KN1A 3FZ9A 2B1LA 3HVXA 1S3DA 2MMOA 4NAXA 5JCGA 5KN2A 3D5JA 2ES7A 2VCWA 1G6WA 2JU5A 3A5WA 2A4VA 2HT9A 2KLXA 3KEBA 4KUNA 2GQKA 1XOBA 2AJQB 5AN1A 1FG4A 4KDUA 5D93A 3ZVJD 3P7XA 4EVMA 4OD7A 2YV9A 3HCZA 2JL4A 3TKPA 1UC7A 3QFAC 1WRYA 1J08A 4K2DA 5GSSA 1F9MA 2X99A 3CRTA 4Q5FA 3IHQA 2VCXA 3BCIA 8GSSA 3HJOA 5IMAA 5ECSA 4V2NA 3US3A 2K6VA 4MPGA 4BWSA 4IGJA 3W8JA 2C8UA 2YWOA 1X5EA 1IYIA 4POLA 2NBSA 4L0UA 1G6YA 1J9BA 4NWYA 3KIJA 1JZRA 1Y6EA 3HA9A 1M7TA 1K0AA 3FZ5A 1B9XC 1GNWA 4ILFA 5A5KA 1QMVA 3L9VA 1URMA 1OE8A 2H66A 3C7MA 3IR4A 4RI6A 5LNKe 2VCQA 2YPMA 1YQ1A 2DJ0A 1O81A 3V1WA 4KDYA 3ZLPA 2I9HA 3C73A 3LYPA 1WOUA 3VPTA 2YZHA 6GSYA 4OCFA 4IELA 2FGXA 2VM1A 3PPUA 1PKZA 2A2SA 1ZCPA 4TKYA 4ZB9A 5AIVA 5DCHA 5F07A 2K8VA 1M9AA 5CRGA 1ERVA 2IMFA 3UJ1A 4DSRA 2GSSA 1AAZA 5F8BA 3C71A 2HSHA 2VCTA 4ZB8A 4ECIA 5IMFA 1UVZA 3ISOA 4I97A 2G2QA 4EUYA 4MZCA 1GSQA 5D9WA 3NZNA 4MF5A 3GV1A 1XW6A 4ZB6A 3CMIA 1EV4A 3P90A 1R7HA 1GSSA 1TI1A 3C1RA 3RDWA 5E59A 1T00A 1XVQA 1JHBA 2N5BA 3QPMA 5J4UA 1SK1A 1UA5A 1DE1A 4MMMA 4TXOA 4PUFC 3IAS2 3CSIA 1KEBA 1V9WA 1GSYA 2AV4A 2O8VB 3BJ5A 3M9JA 3KMNA 1K0CA 2F3MA 3F9UA 3NOFA 5EY6A 1W89A 3E9JB 4MF7A 3EMXA 1XWGA 1GL8A 1GP1A 4K9ZA 1QXHA 4JE1A 2B5YA 3D22A 4MA9A 2GT6A 3TRXA 3O6TA 2LNTA 2LRTA 4KSMA 5F06A 5L71A 2C0DA 1TU7A 4DSQA 5G1LA 2L5OA 5J5NA 2HI7A 17GSA 3LJRA 3GKMA 1LBKA 4QL7A 4K0NA 5G2ZA 3IE3A 2GSQA 2B6MA 1JLWA 1T1VA 4TXOB 4G0IA 1K0MA 4H86A 4HI7A 5HFGA 2R5GA 1GUHA 3VPQA 4HOJA 1VGLA 1M9BA 1OVNA 4BWQA 4IW9A 4RUVA 4L5LA 6GSUA 1YEPA 3DVXA 4XHMA 2CV4A 4ZIJA 1THOA 2L4CA 3ZIVA 5B6MA 3ZIJA 2WGRA 1SKWB 5ECKB 2VO4A 3KZQA 4AJ6A 2F8AA 1TRVA 4KNDA 1QK8A 2O87A 1A8YA 2H72A 4L0WA 1S3CA 5EL8A 2LKUA 2MMNA 2YZUA 1LU4A 1NHYA 1FVKA 4N30A 1N8JA 1XOAA 2H1BA 5HFIA 3EU4A 2OACA 4PXOA 5A4VA 2TIRA 2CX3A 2FLSA 4FYBA 3U6VA 2H76A 1NW2A 2N5FA 2IMKA 2FWEA 2FUG2 1GUMA 1PQNA 3UVTA 1C72A 3WT1A 2CT6A 3VWVA 4ECJA 3N9JA
chains in the Genus database with same CATH superfamily
1Z7RA 4YAPA 4HQSA 1E6BA 1F2EA 2DJKA 1Z3EA 2RM6A 5IOXA 4XRDA 2C0GA 3DD3A 4ECBA 2RIIA 2CX4A 4OO4A 1XVWA 4F0BA 2XPDA 4AKHA 1B8XA 2NDOA 1F3BA 2H1GA 3MSZA 1TKDB 9GSSA 5IMZA 2O85A 3KTBA 3EVIA 3I69A 4MNNA 3CTGA 3CQFA 2XHFA 4X43A 2YWMA 3TKRA 1JZOA 3CSJA 4EXJA 4O5RA 2O89A 4X4JA 1OYJA 5HR3A 3HZ4A 2C80A 3BBYA 3UL3A 3L0HA 1XIYA 2A4HA 4NXIA 3TJGA 4K5RA 1BAYA 3Q6OA 2H73A 1V40A 4BVYB 3KMOA 4QQ7A 4PNGA 1TK0B 1T7PB 3UBLA 1AQVA 4Q5RA 5C04A 2ZNMA 1OAZA 4QL9A 3J7Yk 1OKDA 5HFKA 3TJFA 2WCIA 4MJEA 5G5FA 3FEUA 1V98A 1O8XA 5DAKA 2IJYA 3TOTA 4NV2A 1M2BA 2MMAA 3F0IA 12GSA 2VL2C 2ALBA 2JZRA 4YKFA 3FW2A 5LCZA 1A8LA 3WGDA 1YJ6A 2HFDA 3I9V2 2LEGA 2D2ZA 3IDVA 4N0ZA 2LNSA 4ZL8A 4TVEA 3ZTLA 1VF4A 2V6OA 2MYGA 2X8HA 1K0OA 3ME8A 1PX7A 3ZRDA 4GSTA 5ECNB 2DMLA 3UIWA 3CHXC 5J3RA 4RI7A 3UBKA 2KHPA 3GKKA 5IO0A 5LD0A 3GMFA 1U3AA 3LGCA 3H93A 1PKWA 3VURA 3I43A 6GSVA 3ZYWA 2EFCA 4KE3A 1R5AA 1QUWA 4JEDA 2LSTA 5DALA 5KN0A 5DAKB 2DIYA 2GVPA 2IWTA 3IRAA 1MEKA 1WMJA 1JZWA 5EVOA 2LUSA 2OBIA 3O76A 1SKSB 4KGIA 1GTAA 1PA3A 5D9TA 4TOPA 1OC3A 3OR5A 2EFDA 2HZEA 5H5SA 1SU9A 3KH7A 2B1KA 5ECQB 2LRCA 5J9CA 3DGQA 2CA8A 3Q18A 2X8CA 3CSHA 4ZBBA 1MTCA 1K0DA 1SL1B 2LJRA 3P8WA 2ZUPA 3Q74A 1SK0A 3EMPA 3GNJA 2E2MA 3UEMA 5G31A 1MDKA 3HD5A 1B4PA 3W6GA 5CRWA 2FNOA 4K7OA 1X0RA 3HXSA 2C3TA 3ERGA 4EDZA 3C1SA 1FHEA 1NSWA 1YKAA 3DXBA 3TRPA 5DALB 2MZCA 5CAXA 1YY7A 4IKHA 4OFTA 2DKIA 2TRCP 1A2JA 4Z2RA 1SJ6A 3PR8A 2MBTA 6GSTA 3ZMLA 2DKHA 1EGRA 4LMWA 3G7YA 4CDOA 2HZEB 4EDYA 3D0ZA 5DDLA 4CW9A 1B9YC 4TR4A 5B6NA 2C0FA 2HSNA 2WDUA 3UARA 1HNAA 1BEDA 1GSFA 2WW0A 3H4KA 3HZ8A 1VF1A 1FOVA 4KCEA 4E8EA 2F9SA 2EIRA 3F4RA 2HSYA 4IN0A 2R4VA 2OT3A 4G10A 1T4ZA 3FR3A 5H5QA 2H71A 1AW9A 3DKSA 3KD0A 16GSA 4IHUA 3QCPA 3GYKA 3F4TA 3RBTA 4XS1A 3EURA 3D4TA 1KNGA 1U87A 1YEWC 3KH9A 1HNCA 3GL5A 4RQRA 3EINA 1MDJA 1SK2A 4WBJA 1I5GA 3GIXA 2NPBA 1TRSA 3N5OA 2B3SA 4E68A 5HR2A 3IBHA 4MZBA 4K6XA 4KB3A 2FWFA 5DJLA 3HKRA 3IOSA 3F4SA 2GT5A 5ELGA 3GKXA 1KBNA 3M3MA 3CXGA 3TGZA 2YP6A 3FR9A 4KCAA 2CZ2A 5IOWA 2G0FA 1EGOA 1SVMA 2VL2A 3KJYA 2RUEA 4PQHA 3L9UA 2F51A 2B5EA 2HXKA 4YH2A 3CTFA 1F3AA 4TN8A 4USSA 1N2AA 3GSTA 4XS6A 3TCOA 3APQA 3FRCA 2N5AA 2FY6A 4F9ZA 4P3YB 1E2YA 4MPFA 2H8LA 2DSAA 3LORA 4DVCA 1ABAA 3IK9A 5ENUA 2L4QA 3IAM2 3G9BA 2TRXA 1BYEA 3FY7A 5IO2A 2JZTA 2O36A 2AYTA 4BPYA 2MMZA 1I1IP 5D8IA 4KSOA 4EC0A 4AI6A 2IFQA 1O73A 3DVWA 4JR6A 3ZVJA 1TRWA 1USBA 4GCIA 4XIHA 3W8SA 5DJMA 3GHAA 2X64A 1AIUA 11GSA 5KEJA 3MYDA 3KP9A 3KCMA 3GTUA 4ECCA 3GA4A 3LW9A 4LL1B 4FIWA 4IQAA 2VLTA 4J57E 4X0XA 3QOUA 4MABA 5D9XA 4POKA 6GSSA 5F05A 4EE0A 4N11A 3UVHA 2JZSA 1SD8A 1A0FA 3HJPA 1R5PA 4HJ2A 2ZCTA 2EIOA 1X5CA 1ZYPA 2C1YA 2K18A 4HDEA 4I2TA 4LL4B 4POBA 5JWQB 1XZOA 2DIZA 1PGTA 1TXXA 5G1KA 2IFQB 4LA1A 2FCHA 1HYUA 4NV5A 5CRHA 4MJAA 2HSMA 5B8BA 2GGTA 2OKAA 2WVXA 4MH3A 1ZL9A 3SWLA 3C8EA 3Q19A 5G30A 4V2LA 1S3RA 1TU8A 2PVQA 2QSIA 1SYXA 4MH2A 4DEJA 1TW9A 3VFIA 4XTSA 3GTUB 2VUPA 4BVXA 3UAPA 2VL3A 4K7IA 3QD9A 4AJ7A 1B48A 4ZL9A 4TW5A 1EP7A 1O85A 2GSRA 2VD1A 5HR1A 4GDFA 2H6ZA 1Z5YE 2R0GA 1FW1A 4MDCA 2GS3A 3QFBC 2K8SA 5JCWA 4D73A 3ZL5A 1F37A 1BG5A 1V57A 3M9KA 3PINA 1TOFA 2K9FA 4ZB7A 1PMTA 2DJJA 1WIKA 1YVLA 1PD21 1DUGA 2H30A 3GH6A 2HSMB 2R2JA 2WVXB 3GN3A 3TJBA 1Y25A 3ED3A 1JLVA 3PGTA 1HNBA 2C3QA 5A5HA 1EOGA 3MAKA 4EO3A 2XBQA 3D6IA 5GAND 3DWVA 1XWKA 3TDGA 4BVXB 1AQWA 4YQUA 4W66A 1MDIA 4TR0A 2DC5A 1ERWA 4LMVA 3ZMKA 1SL0B 2NTOA 1OKTA 10GSA 1B4QA 2P5QA 3HYPA 4I2UA 3TOUA 4XCSA 5ECMB 3M1GA 3F6DA 1PSQA 5B7CA 2L5LA 2H6XA 4D73B 1X9MB 1GTBA 5GZZB 4K1FA 2DJ1A 4IBPA 5BRTA 5DQYA 2HRFA 2H75A 3IV4A 5A1NB 3E3EA 4V2MA 1MD4A 4Z7XA 2HZFA 4MLYA 5CRDA 1M99A 3LG6A 4F0CA 3R3EA 1VF2A 1K0BA 1U88A 1TP9A 3KTLA 5CYYA 2QC7A 1H75A 5A5HB 3ZZXA 3VI7A 2P5RA 4I6XA 5DQSA 2EIQA 1XXUA 3RHCA 1U3IA 5IMDA 5IPHA 5IMCA 2DJ3A 1EEJA 1O8WA 5DCGA 2LTKA 5G5EA 2OJLA 4CHSA 5JWOB 1SVLA 3ZREA 3F3QA 2WJUA 4GF0A 2F8FA 3A2WA 2FD3A 3HHVA 2MBSA 1XWCA 3MDKA 2REMA 2CVBA 1G0TA 4KA0A 4XS4A 3QAGA 1DBYA 3VWXA 2DMMA 2PMTA 2HRNA 4OWYA 3I6AA 3FMWA 5A34A 2XPEA 1VF3A 5KOXA 1AUCA 1NHOA 5B8AA 1XPVA 2V41A 1CQHA 2V2GA 2HNLA 3M0FA 3ERFA 4V1Ag 4WEYA 2OE3A 3GX8A 4WETA 3L9SA 1GUKA 4ML1A 1S3AA 1FAAA 1LJRA 3TKSE 4IP1A 3G7IA 1T3BA 3WGXA 1Z6NA 4DSSA 2A2PA 2C3NA 1HD2A 5ECHB 2GZZA 4ML6A 2M80A 3H79A 4ISDA 3EWLA 4GQCA 3NIVA 5H5RA 4JRRA 3CBUA 4LLRA 4PQIA 4WR5A 1ML6A 3LEFA 2YWIA 4OFNA 2FA4A 4MJCA 2GQLA 4IVFA 5INYA 1EV9A 2R3XA 4GLTA 2WS2A 3DEXA 1BJXA 2A2RA 2GLRA 4FYCA 4MJBA 3A2VA 2RUFA 2OE1A 5D96A 1W4VA 1ZZYA 4DSSB 1K0NA 4POMA 1PL2A 2VIMA 4MCUA 3JCML 4GSNA 3GRXA 2YN1A 2B5XA 3RPPA 1GTIA 2AHEA 2I4AA 4PTSA 2LJAA 1X9WB 2BJXA 4GRFA 1H4OA 4IJIA 2L6CA 2I1UA 1EWXA 2OBKA 3FZ4A 5JWRB 4HS1A 1ST9A 1TRUA 1RW1A 3DMLA 4WKWA 3LXZA 3LWAA 3QR6A 2CVDA 4JBBA 4FO5A 4YAVA 1SL2B 5A4UA 2JSYA 2PVOC 2J23A 1YEXA 3AY8A 2VD0A 1A2LA 5E4WA 4MZWA 4XRAA 4NHWA 2VOCA 1OC8A 1GSUA 2E7PA 1RK4A 3KGKA 4PUAA 4KW6A 4O5UA 4KAEA 3MIXA 4OCEA 5ECIB 4K0GA 3EPTA 2B7KA 3HVSA 1AXDA 4FYUA 2AAWA 4ID0A 3VK9A 2VKZG 1GRXA 1KTEA 3LYKA 4ZBDA 1WPIA 2LV3A 1CQGA 3KP8A 4KF9A 2AB6A 2AUVA 4F82A 2IIYA 2R6KA 1JZDA 4A5PA 3ZITA 4IQ1A 4MF6A 4V1Ap 3FHKA 2WFCA 1GSEA 3D21A 3F8UA 4NPBA 20GSA 3F63A 1TXUA 1A0RP 4HUAA 1SKRB 5COHA 2EC4A 5HR0A 5D73A 5ECLB 1TJDA 2IMEA 1HQOA 1ZYQB 2PGTA 2CAIA 2HE3A 4EKZA 1XG8A 4ZILA 2H01A 3ZFLA 1OC9A 4TR3A 3CYNA 5FT3A 5ELAA 4Q5QA 1K3YA 1BX9A 2CVKA 1GWCA 2P31A 3HVVA 1SVOA 2PPTA 2IMIA 4G2EA 1OE7A 2CQ9A 1M3IA 1Q4JA 2HSNB 4MP4A 2GQMA 4IP6A 4AGSA 4QMKA 4JU5A 5IIZA 3H8QA 4I5QA 3GL3A 2JADA 5J40A 2O3EA 3GKNA 4G01A 2C0EA 4WR4A 3TKQA 4IS0A 4K2XA 4TXVA 4AJ8A 1YZXA 2VLUA 2VM2A 1I9DA 2P0GA 4GQFA 1F6MC 2E2GA 2PBJA 2JSZA 1EZKA 4J2FA 2OA7A 4FH8A 3FYGA 3FZAA 3G7JA 4ZBAA 4KX4A 2PU9C 3D4MA 1OC9B 6GSWA 2ON7A 4PX1A 2V32A 5IQYA 2GTUA 1K3OA 2X49A 1NM3A 2R0PA 3FK8A 4GTUA 1YKCA 2FHEA 4RQXA 4HEA2 1ERTA 1G7EA 2C4JA 1A2MA 1MD3A 3VWWA 4AKIA 2X8GA 2HLSA 4GSSA 2J9HA 2NVLA 2KUCA 3TU3B 1M2DA 5CREA 5DBQA 2WVZA 3IC4A 4HU9A 3SBCA 4O32A 2CZ3A 3QAVA 3GURA 1Q98A 3WT2A 2KOKA 2YV7A 3ZFBA 2DBCA 1SYRA 3WYWA 3DIEA 3U5RE 1PFOA 2V6KA 3HMJG 5JCUA 2OADA 5IMVA 2L57A 1TK5B 2HRKA 5ABRA 4O7HA 1GSDA 2H0GA 3GSSA 3HJMA 5J9BA 2RM5A 5GSTA 4HZ2A 3EE2A 1AC1A 1AQXA 4JR4A 1ACVA 1Z9HA 5AIXA 3ERWA 5GAPD 1XBSA 4G9HA 1WJKA 5FHIA 3RHBA 3VWUA 5ECPB 2DJ2A 2WZ9A 5BMUA 1EOHA 3QAWA 1Z6MA 3RPNA 2LQQA 1FB6A 4N10A 4ZXGA 3S9FA 4ULXA 4K7NA 3APOA 3FR6A 22GSA 2WULA 4HZ4A 2BTOT 4PURA 3EYTA 3L4NA 2H74A 2H0HA 2HYXA 5ECRB 1XCCA 3LQ7A 4I8BA 3J7Yb 1A23A 1JFUA 1A24A 3RAZA 1WE0A 1R4WA 3BCKA 4NHZA 2E0QA 2HRAA 1QQ2A 2O7KA 2GZYA 2HRKB 2IN3A 3E0UA 1YF1A 1SENA 2GSTA 7GSSA 1WWJA 2H0IA 3KM6A 5AGYA 3HY2A 1WP0A 2YANA 1M2AA 3IC8A 3GX0A 4EIPA 2QGVA 3ME7A 2PN8A 3TJKA 2YWNA 4TRXA 1PL1A 1DSBA 2Z9SA 4HJMA 5EPFA 4ZL7A 1ZOFA 2LRNA 5IPGA 3APSA 4WXTA 1TTZA 3A3TA 4ACSA 2YJHA 1ZYEA 3IXRA 1IYHA 4BA7A 5ID2A 3BOAA 4TR1A 1GLPA 3UOMA 3TUEA 1XWAA 2VAFA 2YNXA 4NMUA 3KXOA 1GULA 1V58A 2I3YA 3H1NA 5F0GA 3TKSC 3R2QA 3VLNA 1M3JA 3QDNA 2KP1A 5J41A 3EC3A 1O7UA 1PX6A 4OFMA 2ON5A 3TRQA 2WB9A 2H6YA 14GSA 1XFLA 3RFRC 1VRSD 3P2AA 5KN3A 1GNEA 5FWGA 2YJ7A 4EIQA 4O5QA 4FQUA 2FA8A 4WF5A 1YDKA 3LSZA 3K8NA 2GDRA 1FO5A 3M8NA 3IA1A 3CRUA 4PQ1A 2UZ8A 3PH9A 2CAQA 3LFLA 1YF0A 2VCVA 3IK7A 4YQMA 4YQVA 19GSA 5ID2B 2I81A 4HSCX 4TR1B 1X5DA 4AKXB 4X1UA 5C00A 3IPZA 4BVYA 2IPAA 1THXA 2H70A 1FB0A 1RQMA 1T4YA 3DYRA 4JZQA 1T8EB 2L59A 5DVBA 3BD2A 1EP8A 4KDXA 2JACA 1SJZA 3HDCA 1K3LA 2XC2A 1DE2A 3FKFA 2XBIA 2M72A 4K8MA 3LXTA 2WRTA 4AF2A 1UN2A 4PGTA 13GSA 1R26A 4F03A 4G19A 1XW5A 2LQOA 4CY8A 5CO3A 4FXYP 3MWHA 3VI5A 1QGVA 2GZPA 2V1MA 4N3ZA 2WW2A 4G0KA 4HQZA 4OMVA 3GFKA 3HVNA 1XW9A 4EL1A 1X9SB 1ZGNA 2YCDA 4HU7A 2IMDA 4L8EA 2PERA 1ERUA 4GWRA 2YOIA 1SD9A 4IJ3A 2QA2A 1J0FA 5KOWA 18GSA 2FWGA 1TDIA 5IM9A 4J56E 3A2XA 2LJKA 1QFNA 4WBRD 1PN9A 2M46A 2VL9A 2IL3A 4PI0C 1O6JA 4GXZA 5HQPA 4XS4B 4F2IA 3F3RA 2PUKC 2KP2A 1ZMAA 1V2AA 2OE0A 6GSXA 2PWJA 5CNWA 2H1LA 2R37A 5A34B 3DRNA 1GTUA 4BL7A 5D9VA 1M0UA 2B7JA 3TJJA 1PRXA 1ON4A 2L6DA 4MK3A 1GLQA 4K5SA 5CP1A 4PHZC 3MNGA 3TB2A 3O3TA 4G0LA 3GH9A 2FWHA 4WF4A 4PNFA 1G7OA 4E8HA 1Z7PA 1EEMA 3UMAA 1U6TA 2EFEA 3GUSA 3QMXA 3L78A 4L5OA 2H1DA 4Q5NA 1TI3A 2VCZA 4N0VA 1BQ7A 4OO5A 2DLXA 4KH7A 2VLVA 1GH2A 1FVJA 3WGEA 5J4YA 1FOHA 2LS5A 1SJIA 3EU3A 3F6FA 5AISA 4EF0A 2QKEA 5ECOB 2HQTA 4O92A 2H1AA 2BMXA 1ILOA 2H19A 4BL7B 3TKSA 4PI2C 5A4WA 3WD6A 2RLIA 1XWBA 1TK8B 5KN1A 3FZ9A 2B1LA 3HVXA 1S3DA 1N25A 2MMOA 4NAXA 5JCGA 5KN2A 3D5JA 2ES7A 2VCWA 1G6WA 2JU5A 5J47A 3A5WA 2A4VA 2HT9A 2KLXA 3KEBA 4CY6A 4KUNA 2GQKA 1XOBA 2AJQB 2WVYA 5AN1A 1FG4A 4KDUA 5D93A 3ZVJD 3P7XA 4EVMA 4OD7A 2YV9A 3HCZA 2JL4A 3TKPA 1UC7A 3QFAC 1WRYA 1J08A 1ZYNA 4K2DA 5GSSA 1F9MA 1S4BP 2X99A 3CRTA 4Q5FA 3IHQA 2VCXA 3BCIA 8GSSA 3HJOA 5IMAA 5ECSA 4V2NA 3US3A 2K6VA 4MPGA 2X4AA 4BWSA 4IGJA 3W8JA 2C8UA 2YWOA 1X5EA 1IYIA 4POLA 2NBSA 4L0UA 1G6YA 1J9BA 4NWYA 3KIJA 1JZRA 1Y6EA 3HA9A 1M7TA 1K0AA 3FZ5A 1B9XC 2WW1A 1GNWA 1BF5A 2WW3A 4ILFA 5A5KA 1QMVA 3L9VA 1URMA 1OE8A 2H66A 3C7MA 3IR4A 4RI6A 5LNKe 2VCQA 3CWGA 2YPMA 1YQ1A 2DJ0A 1O81A 3V1WA 4KDYA 3ZLPA 2I9HA 3C73A 3LYPA 1WOUA 3VPTA 2YZHA 2R0CA 6GSYA 4OCFA 4IELA 2FGXA 2VM1A 3PPUA 1PKZA 2A2SA 1ZCPA 4TKYA 4ZB9A 5AIVA 2EFHA 4YKGA 3A5IA 5DCHA 5F07A 2WZSA 2K8VA 1M9AA 5CRGA 1ERVA 2IMFA 4Z2TA 3UJ1A 4DSRA 2GSSA 1AAZA 5F8BA 3IHGA 3C71A 2HSHA 2VCTA 4ZB8A 4ECIA 5IMFA 1UVZA 3ISOA 4I97A 2G2QA 4EUYA 4MZCA 1GSQA 5D9WA 3NZNA 2O5VA 4MF5A 3GV1A 1XW6A 4ZB6A 3CMIA 1EV4A 4Z2UA 3P90A 1R7HA 1GSSA 1TI1A 3C1RA 3RDWA 5E59A 1T00A 1BG1A 1XVQA 1JHBA 2N5BA 3QPMA 5J4UA 1SK1A 1UA5A 1DE1A 4MMMA 4TXOA 4PUFC 3IAS2 3CSIA 2QA1A 3RGBC 1KEBA 1V9WA 1GSYA 2AV4A 2O8VB 3BJ5A 3M9JA 3KMNA 1K0CA 2F3MA 3F9UA 3NOFA 5EY6A 1W89A 1Y1UA 3E9JB 4MF7A 3EMXA 1XWGA 1GL8A 1GP1A 4BIKA 4K9ZA 1QXHA 5BMUB 4JE1A 2B5YA 3D22A 4MA9A 2GT6A 3TRXA 3O6TA 2LNTA 2LRTA 4KSMA 5F06A 5L71A 2C0DA 1TU7A 4DSQA 5G1LA 2L5OA 5J5NA 2HI7A 17GSA 3LJRA 3GKMA 1LBKA 4ICYA 4QL7A 4K0NA 5G2ZA 3IE3A 2GSQA 2B6MA 1JLWA 1T1VA 4TXOB 4G0IA 1K0MA 4H86A 4HI7A 5HFGA 2R5GA 1GUHA 3VPQA 4HOJA 1VGLA 1M9BA 1OVNA 4BWQA 4IW9A 4RUVA 4L5LA 6GSUA 1YEPA 3DVXA 4XHMA 2CV4A 5A1NA 4ZIJA 1THOA 2L4CA 3ZIVA 5B6MA 3ZIJA 2WGRA 1SKWB 5ECKB 2VO4A 1PN0A 3KZQA 4AJ6A 2F8AA 1TRVA 4KNDA 1QK8A 2O87A 1A8YA 2H72A 4L0WA 1S3CA 5EL8A 4AKGA 2LKUA 2MMNA 2YZUA 1LU4A 1NHYA 1FVKA 4N30A 1N8JA 1XOAA 2H1BA 5HFIA 3EU4A 2OACA 4PXOA 5A4VA 2TIRA 2CX3A 2FLSA 4FYBA 3U6VA 2H76A 1NW2A 2UV8G 2N5FA 2IMKA 2FWEA 2FUG2 1GUMA 1PQNA 3UVTA 1C72A 3WT1A 2CT6A 3VWVA 5J4VA 4ECJA 3N9JA
chains in the Genus database with same CATH topology
1Z7RA 4YAPA 4HQSA 1E6BA 1F2EA 2DJKA 1Z3EA 2RM6A 5IOXA 4XRDA 2C0GA 3DD3A 4ECBA 2RIIA 2CX4A 4OO4A 1XVWA 4F0BA 2XPDA 4AKHA 1B8XA 2NDOA 1F3BA 2H1GA 3MSZA 1TKDB 9GSSA 5IMZA 2O85A 3KTBA 3EVIA 3I69A 4MNNA 3CTGA 2XHFA 4X43A 2YWMA 3TKRA 1JZOA 3CSJA 4EXJA 4O5RA 2O89A 4X4JA 1OYJA 5HR3A 3HZ4A 2C80A 3BBYA 3UL3A 3L0HA 1XIYA 2A4HA 4NXIA 3TJGA 4K5RA 1BAYA 3Q6OA 2H73A 1V40A 4BVYB 3KMOA 4QQ7A 4PNGA 1TK0B 1T7PB 3UBLA 1AQVA 4Q5RA 5C04A 2ZNMA 1OAZA 4QL9A 3J7Yk 1OKDA 5HFKA 3TJFA 2WCIA 4MJEA 5G5FA 3FEUA 1V98A 1O8XA 5DAKA 2IJYA 3TOTA 4NV2A 1M2BA 2MMAA 3F0IA 12GSA 2VL2C 2ALBA 2JZRA 4YKFA 3FW2A 5LCZA 1A8LA 3WGDA 1YJ6A 2HFDA 3I9V2 2LEGA 2D2ZA 3IDVA 4N0ZA 2LNSA 4ZL8A 4TVEA 3ZTLA 1VF4A 2V6OA 2MYGA 2X8HA 1K0OA 3ME8A 1PX7A 3ZRDA 4GSTA 5ECNB 2DMLA 3UIWA 5J3RA 4RI7A 3UBKA 2KHPA 3GKKA 5IO0A 5LD0A 3GMFA 1U3AA 3LGCA 3H93A 1PKWA 3VURA 3I43A 6GSVA 3ZYWA 2EFCA 4KE3A 1R5AA 1QUWA 4JEDA 2LSTA 5DALA 5KN0A 5DAKB 2DIYA 2GVPA 2IWTA 3IRAA 1MEKA 1WMJA 1JZWA 5EVOA 2LUSA 2OBIA 3O76A 1SKSB 4KGIA 1GTAA 1PA3A 5D9TA 4TOPA 1OC3A 3OR5A 2EFDA 2HZEA 5H5SA 1SU9A 3KH7A 2B1KA 5ECQB 2LRCA 5J9CA 3DGQA 2CA8A 3Q18A 2X8CA 3CSHA 4ZBBA 1MTCA 1K0DA 1SL1B 2LJRA 3P8WA 2ZUPA 3Q74A 1SK0A 3EMPA 3GNJA 2E2MA 3UEMA 5G31A 1MDKA 3HD5A 1B4PA 3W6GA 5CRWA 2FNOA 4K7OA 1X0RA 3HXSA 2C3TA 3ERGA 4EDZA 3C1SA 1FHEA 1NSWA 1YKAA 3DXBA 3TRPA 5DALB 2MZCA 5CAXA 1YY7A 4IKHA 4OFTA 2DKIA 2TRCP 1A2JA 4Z2RA 1SJ6A 3PR8A 2MBTA 6GSTA 3ZMLA 2DKHA 1EGRA 4LMWA 3G7YA 4CDOA 2HZEB 4EDYA 3D0ZA 5DDLA 4CW9A 1B9YC 4TR4A 5B6NA 2C0FA 2HSNA 2WDUA 3UARA 1HNAA 1BEDA 1GSFA 3H4KA 3HZ8A 1VF1A 1FOVA 4KCEA 4E8EA 2F9SA 2EIRA 3F4RA 2HSYA 4IN0A 2R4VA 2OT3A 4G10A 1T4ZA 3FR3A 5H5QA 2H71A 1AW9A 3DKSA 3KD0A 16GSA 4IHUA 3QCPA 3GYKA 3F4TA 3RBTA 4XS1A 3EURA 3D4TA 1KNGA 1U87A 3KH9A 1HNCA 3GL5A 4RQRA 3EINA 1MDJA 1SK2A 4WBJA 1I5GA 3GIXA 2NPBA 1TRSA 3N5OA 2B3SA 4E68A 5HR2A 3IBHA 4MZBA 4K6XA 4KB3A 2FWFA 5DJLA 3HKRA 3IOSA 3F4SA 2GT5A 5ELGA 3GKXA 1KBNA 3M3MA 3CXGA 3TGZA 2YP6A 3FR9A 4KCAA 2CZ2A 5IOWA 2G0FA 1EGOA 1SVMA 3L9UA 2VL2A 3KJYA 4PQHA 2RUEA 2F51A 2B5EA 2HXKA 4YH2A 3CTFA 1F3AA 4TN8A 4USSA 1N2AA 3GSTA 4XS6A 3TCOA 3APQA 3FRCA 2N5AA 2FY6A 4F9ZA 4P3YB 1E2YA 4MPFA 2H8LA 2DSAA 3LORA 4DVCA 1ABAA 3IK9A 5ENUA 2L4QA 3IAM2 3G9BA 2TRXA 1BYEA 3FY7A 5IO2A 2JZTA 2AYTA 4BPYA 2MMZA 5D8IA 4KSOA 4EC0A 4AI6A 2IFQA 1O73A 3DVWA 4JR6A 3ZVJA 1TRWA 1USBA 4GCIA 4XIHA 3W8SA 5DJMA 3GHAA 2X64A 1AIUA 11GSA 5KEJA 3MYDA 3KP9A 3KCMA 3GTUA 4ECCA 3GA4A 3LW9A 4LL1B 4FIWA 4IQAA 2VLTA 4J57E 4X0XA 3QOUA 4MABA 5D9XA 4POKA 6GSSA 5F05A 4EE0A 4N11A 3UVHA 2JZSA 1SD8A 1A0FA 3HJPA 1R5PA 4HJ2A 2ZCTA 2EIOA 1X5CA 1ZYPA 2C1YA 2K18A 4HDEA 4I2TA 4LL4B 4POBA 5JWQB 1XZOA 2DIZA 1PGTA 1TXXA 5G1KA 2IFQB 4LA1A 2FCHA 1HYUA 4NV5A 5CRHA 4MJAA 2HSMA 5B8BA 2GGTA 2OKAA 4MH3A 1ZL9A 3SWLA 3C8EA 3Q19A 5G30A 4V2LA 1TU8A 2PVQA 2QSIA 1SYXA 4MH2A 4DEJA 1TW9A 3VFIA 4XTSA 3GTUB 2VUPA 4BVXA 3UAPA 2VL3A 4K7IA 3QD9A 4AJ7A 1B48A 4ZL9A 4TW5A 1EP7A 1O85A 2GSRA 2VD1A 5HR1A 4GDFA 2H6ZA 1Z5YE 2R0GA 1FW1A 4MDCA 2GS3A 3QFBC 2K8SA 5JCWA 4D73A 3ZL5A 1F37A 1BG5A 1V57A 3M9KA 3PINA 1TOFA 2K9FA 4ZB7A 1PMTA 2DJJA 1WIKA 1YVLA 1PD21 1DUGA 2H30A 3GH6A 2HSMB 2R2JA 3GN3A 3TJBA 1Y25A 3ED3A 1JLVA 3PGTA 1HNBA 2C3QA 5A5HA 1EOGA 3MAKA 4EO3A 2XBQA 3D6IA 5GAND 3DWVA 1XWKA 3TDGA 4BVXB 1AQWA 4YQUA 4W66A 1MDIA 4TR0A 2DC5A 1ERWA 4LMVA 3ZMKA 1SL0B 2NTOA 1OKTA 10GSA 1B4QA 2P5QA 3HYPA 4I2UA 3TOUA 4XCSA 5ECMB 3M1GA 3F6DA 1PSQA 5B7CA 2L5LA 2H6XA 4D73B 1X9MB 1GTBA 5GZZB 4K1FA 2DJ1A 4IBPA 5BRTA 5DQYA 2HRFA 2H75A 3IV4A 5A1NB 3E3EA 4V2MA 1MD4A 4Z7XA 2HZFA 4MLYA 5CRDA 1M99A 3LG6A 4F0CA 3R3EA 1VF2A 1K0BA 1U88A 1TP9A 3KTLA 5CYYA 2QC7A 1H75A 5A5HB 3ZZXA 3VI7A 2P5RA 4I6XA 5DQSA 2EIQA 1XXUA 3RHCA 1U3IA 5IMDA 5IPHA 5IMCA 2DJ3A 1EEJA 1O8WA 5DCGA 2LTKA 5G5EA 2OJLA 4CHSA 5JWOB 1SVLA 3ZREA 3F3QA 2WJUA 4GF0A 2F8FA 3A2WA 2FD3A 3HHVA 2MBSA 1XWCA 3MDKA 2REMA 2CVBA 1G0TA 4KA0A 4XS4A 3QAGA 1DBYA 3VWXA 2DMMA 2PMTA 2HRNA 4OWYA 3I6AA 3FMWA 5A34A 2XPEA 1VF3A 5KOXA 1AUCA 1NHOA 5B8AA 1XPVA 2V41A 1CQHA 2V2GA 3M0FA 2HNLA 3ERFA 4V1Ag 4WEYA 2OE3A 3GX8A 4WETA 3L9SA 1GUKA 4ML1A 1S3AA 1FAAA 1LJRA 3TKSE 4IP1A 3G7IA 1T3BA 3WGXA 1Z6NA 4DSSA 2A2PA 2C3NA 1HD2A 5ECHB 2GZZA 4ML6A 2M80A 3H79A 4ISDA 3EWLA 4GQCA 3NIVA 5H5RA 4JRRA 3CBUA 4LLRA 4PQIA 4WR5A 1ML6A 3LEFA 2YWIA 4OFNA 2FA4A 4MJCA 2GQLA 4IVFA 5INYA 1EV9A 2R3XA 4GLTA 2WS2A 3DEXA 1BJXA 2A2RA 2GLRA 4FYCA 4MJBA 3A2VA 2RUFA 2OE1A 5D96A 1W4VA 1ZZYA 4DSSB 1K0NA 4POMA 1PL2A 2VIMA 4MCUA 3JCML 4GSNA 3GRXA 2YN1A 2B5XA 3RPPA 1GTIA 2AHEA 2I4AA 4PTSA 2LJAA 1X9WB 2BJXA 4GRFA 1H4OA 4IJIA 2L6CA 2I1UA 1EWXA 2OBKA 3FZ4A 5JWRB 4HS1A 1ST9A 1TRUA 1RW1A 3DMLA 4WKWA 3LXZA 3LWAA 3QR6A 2CVDA 4JBBA 4FO5A 4YAVA 1SL2B 5A4UA 2JSYA 2PVOC 2J23A 1YEXA 3AY8A 2VD0A 1A2LA 5E4WA 4MZWA 4XRAA 4NHWA 2VOCA 1OC8A 1GSUA 2E7PA 1RK4A 3KGKA 4PUAA 4KW6A 4O5UA 4KAEA 3MIXA 4OCEA 5ECIB 4K0GA 3EPTA 2B7KA 3HVSA 1AXDA 4FYUA 2AAWA 4ID0A 3VK9A 2VKZG 1GRXA 1KTEA 3LYKA 4ZBDA 1WPIA 2LV3A 1CQGA 3KP8A 4KF9A 2AB6A 2AUVA 4F82A 2IIYA 2R6KA 1JZDA 4A5PA 3ZITA 4IQ1A 4MF6A 4V1Ap 3FHKA 2WFCA 1GSEA 3D21A 3F8UA 4NPBA 20GSA 3F63A 1TXUA 1A0RP 4HUAA 1SKRB 5COHA 2EC4A 5HR0A 5D73A 5ECLB 1TJDA 2IMEA 1HQOA 1ZYQB 2PGTA 2CAIA 2HE3A 4EKZA 4ZILA 2H01A 3ZFLA 1OC9A 4TR3A 3CYNA 5FT3A 5ELAA 4Q5QA 1K3YA 1BX9A 2CVKA 1GWCA 2P31A 3HVVA 1SVOA 2PPTA 2IMIA 4G2EA 1OE7A 2CQ9A 1Q4JA 2HSNB 4MP4A 2GQMA 4IP6A 4AGSA 4QMKA 4JU5A 5IIZA 3H8QA 4I5QA 3GL3A 2JADA 5J40A 3GKNA 4G01A 2C0EA 4WR4A 3TKQA 4IS0A 4K2XA 4TXVA 4AJ8A 1YZXA 2VLUA 2VM2A 1I9DA 2P0GA 4GQFA 1F6MC 2E2GA 2PBJA 2JSZA 1EZKA 4J2FA 2OA7A 4FH8A 3FYGA 3FZAA 3G7JA 4ZBAA 4KX4A 2PU9C 3D4MA 1OC9B 6GSWA 2ON7A 4PX1A 2V32A 5IQYA 2GTUA 1K3OA 2X49A 1NM3A 2R0PA 3FK8A 4GTUA 1YKCA 2FHEA 4RQXA 4HEA2 1ERTA 1G7EA 2C4JA 1A2MA 1MD3A 3VWWA 4AKIA 2X8GA 2HLSA 4GSSA 2J9HA 2NVLA 2KUCA 3TU3B 1M2DA 5CREA 5DBQA 3IC4A 4HU9A 3SBCA 4O32A 2CZ3A 3QAVA 3GURA 1Q98A 3WT2A 2KOKA 2YV7A 3ZFBA 2DBCA 1SYRA 3WYWA 3DIEA 3U5RE 2V6KA 3HMJG 5JCUA 2OADA 5IMVA 2L57A 1TK5B 2HRKA 5ABRA 4O7HA 1GSDA 2H0GA 3GSSA 3HJMA 5J9BA 2RM5A 5GSTA 4HZ2A 3EE2A 1AC1A 1AQXA 4JR4A 1ACVA 1Z9HA 5AIXA 3ERWA 5GAPD 1XBSA 4G9HA 1WJKA 5FHIA 3RHBA 3VWUA 5ECPB 2DJ2A 2WZ9A 5BMUA 1EOHA 3QAWA 1Z6MA 3RPNA 2LQQA 1FB6A 4N10A 4ZXGA 3S9FA 4ULXA 4K7NA 3APOA 3FR6A 22GSA 2WULA 4HZ4A 2BTOT 4PURA 3EYTA 3L4NA 2H74A 2H0HA 2HYXA 5ECRB 1XCCA 3LQ7A 4I8BA 3J7Yb 1A23A 1JFUA 1A24A 3RAZA 1WE0A 1R4WA 3BCKA 4NHZA 2E0QA 2HRAA 1QQ2A 2O7KA 2GZYA 2HRKB 2IN3A 3E0UA 1YF1A 1SENA 2GSTA 7GSSA 1WWJA 2H0IA 3KM6A 5AGYA 3HY2A 1WP0A 2YANA 1M2AA 3IC8A 3GX0A 4EIPA 2QGVA 3ME7A 2PN8A 3TJKA 2YWNA 4TRXA 1PL1A 1DSBA 2Z9SA 4HJMA 5EPFA 4ZL7A 1ZOFA 2LRNA 5IPGA 3APSA 4WXTA 1TTZA 3A3TA 4ACSA 2YJHA 1ZYEA 3IXRA 1IYHA 4BA7A 5ID2A 3BOAA 4TR1A 1GLPA 3UOMA 3TUEA 1XWAA 2VAFA 2YNXA 4NMUA 3KXOA 1GULA 1V58A 2I3YA 3H1NA 5F0GA 3TKSC 3R2QA 3VLNA 3QDNA 2KP1A 5J41A 3EC3A 1O7UA 1PX6A 4OFMA 2ON5A 3TRQA 2WB9A 2H6YA 14GSA 1XFLA 1VRSD 3P2AA 5KN3A 1GNEA 5FWGA 2YJ7A 4EIQA 4O5QA 4FQUA 2FA8A 4WF5A 1YDKA 3LSZA 3K8NA 2GDRA 1FO5A 3M8NA 3IA1A 3CRUA 4PQ1A 2UZ8A 3PH9A 2CAQA 3LFLA 1YF0A 2VCVA 3IK7A 4YQMA 4YQVA 19GSA 5ID2B 2I81A 4TR1B 1X5DA 4AKXB 4X1UA 5C00A 3IPZA 4BVYA 2IPAA 1THXA 2H70A 1FB0A 1RQMA 1T4YA 3DYRA 4JZQA 1T8EB 2L59A 5DVBA 3BD2A 1EP8A 4KDXA 2JACA 1SJZA 3HDCA 1K3LA 2XC2A 1DE2A 3FKFA 2XBIA 2M72A 4K8MA 3LXTA 2WRTA 4AF2A 1UN2A 4PGTA 13GSA 1R26A 4F03A 4G19A 1XW5A 2LQOA 4CY8A 5CO3A 3MWHA 3VI5A 1QGVA 2GZPA 2V1MA 4N3ZA 4G0KA 4HQZA 4OMVA 3GFKA 1XW9A 4EL1A 1X9SB 1ZGNA 2YCDA 4HU7A 2IMDA 4L8EA 2PERA 1ERUA 4GWRA 2YOIA 1SD9A 4IJ3A 2QA2A 1J0FA 5KOWA 18GSA 2FWGA 1TDIA 5IM9A 4J56E 3A2XA 2LJKA 1QFNA 4WBRD 1PN9A 2M46A 2VL9A 2IL3A 1O6JA 4GXZA 5HQPA 4XS4B 4F2IA 3F3RA 2PUKC 2KP2A 1ZMAA 1V2AA 2OE0A 6GSXA 2PWJA 5CNWA 2H1LA 2R37A 5A34B 3DRNA 1GTUA 4BL7A 5D9VA 1M0UA 2B7JA 3TJJA 1PRXA 1ON4A 2L6DA 4MK3A 1GLQA 4K5SA 5CP1A 3MNGA 3TB2A 3O3TA 4G0LA 3GH9A 2FWHA 4WF4A 4PNFA 1G7OA 4E8HA 1Z7PA 1EEMA 3UMAA 1U6TA 2EFEA 3GUSA 3QMXA 3L78A 4L5OA 2H1DA 4Q5NA 1TI3A 2VCZA 4N0VA 1BQ7A 4OO5A 2DLXA 4KH7A 2VLVA 1GH2A 1FVJA 3WGEA 5J4YA 1FOHA 2LS5A 1SJIA 3EU3A 3F6FA 5AISA 4EF0A 2QKEA 5ECOB 2HQTA 4O92A 2H1AA 2BMXA 1ILOA 2H19A 4BL7B 3TKSA 5A4WA 3WD6A 2RLIA 1XWBA 1TK8B 5KN1A 3FZ9A 2B1LA 3HVXA 1S3DA 1N25A 2MMOA 4NAXA 5JCGA 5KN2A 3D5JA 2ES7A 2VCWA 1G6WA 2JU5A 5J47A 3A5WA 2A4VA 2HT9A 2KLXA 3KEBA 4CY6A 4KUNA 2GQKA 1XOBA 2AJQB 5AN1A 1FG4A 4KDUA 5D93A 3ZVJD 3P7XA 4EVMA 4OD7A 2YV9A 3HCZA 2JL4A 3TKPA 1UC7A 3QFAC 1WRYA 1J08A 1ZYNA 4K2DA 5GSSA 1F9MA 2X99A 3CRTA 4Q5FA 3IHQA 2VCXA 3BCIA 8GSSA 3HJOA 5IMAA 5ECSA 4V2NA 3US3A 2K6VA 4MPGA 2X4AA 4BWSA 4IGJA 3W8JA 2C8UA 2YWOA 1X5EA 1IYIA 4POLA 2NBSA 4L0UA 1G6YA 1J9BA 4NWYA 3KIJA 1JZRA 1Y6EA 3HA9A 1M7TA 1K0AA 3FZ5A 1B9XC 1GNWA 1BF5A 4ILFA 5A5KA 1QMVA 3L9VA 1URMA 1OE8A 2H66A 3C7MA 3IR4A 4RI6A 5LNKe 2VCQA 3CWGA 2YPMA 1YQ1A 2DJ0A 1O81A 3V1WA 4KDYA 3ZLPA 2I9HA 3C73A 3LYPA 1WOUA 3VPTA 2YZHA 2R0CA 6GSYA 4OCFA 4IELA 2FGXA 2VM1A 3PPUA 1PKZA 2A2SA 1ZCPA 4TKYA 4ZB9A 5AIVA 2EFHA 4YKGA 3A5IA 5DCHA 5F07A 2K8VA 1M9AA 5CRGA 1ERVA 2IMFA 4Z2TA 3UJ1A 4DSRA 2GSSA 1AAZA 5F8BA 3IHGA 3C71A 2HSHA 2VCTA 4ZB8A 4ECIA 5IMFA 1UVZA 3ISOA 4I97A 2G2QA 4EUYA 4MZCA 1GSQA 5D9WA 3NZNA 2O5VA 4MF5A 3GV1A 1XW6A 4ZB6A 3CMIA 1EV4A 4Z2UA 3P90A 1R7HA 1GSSA 1TI1A 3C1RA 3RDWA 5E59A 1T00A 1BG1A 1XVQA 1JHBA 2N5BA 3QPMA 5J4UA 1SK1A 1UA5A 1DE1A 4MMMA 4TXOA 4PUFC 3IAS2 3CSIA 2QA1A 1KEBA 1V9WA 1GSYA 2AV4A 2O8VB 3BJ5A 3M9JA 3KMNA 1K0CA 2F3MA 3F9UA 3NOFA 5EY6A 1W89A 1Y1UA 3E9JB 4MF7A 3EMXA 1XWGA 1GL8A 1GP1A 4K9ZA 1QXHA 5BMUB 4JE1A 2B5YA 3D22A 4MA9A 2GT6A 3TRXA 3O6TA 2LNTA 2LRTA 4KSMA 5F06A 5L71A 2C0DA 1TU7A 4DSQA 5G1LA 2L5OA 5J5NA 2HI7A 17GSA 3LJRA 3GKMA 1LBKA 4ICYA 4QL7A 4K0NA 5G2ZA 3IE3A 2GSQA 2B6MA 1JLWA 1T1VA 4TXOB 4G0IA 1K0MA 4H86A 4HI7A 5HFGA 2R5GA 1GUHA 3VPQA 4HOJA 1VGLA 1M9BA 1OVNA 4BWQA 4IW9A 4RUVA 4L5LA 6GSUA 1YEPA 3DVXA 4XHMA 2CV4A 5A1NA 4ZIJA 1THOA 2L4CA 3ZIVA 5B6MA 3ZIJA 2WGRA 1SKWB 5ECKB 2VO4A 1PN0A 3KZQA 4AJ6A 2F8AA 1TRVA 4KNDA 1QK8A 2O87A 1A8YA 2H72A 4L0WA 1S3CA 5EL8A 4AKGA 2LKUA 2MMNA 2YZUA 1LU4A 1NHYA 1FVKA 4N30A 1N8JA 1XOAA 2H1BA 5HFIA 3EU4A 2OACA 4PXOA 5A4VA 2TIRA 2CX3A 2FLSA 4FYBA 3U6VA 2H76A 1NW2A 2UV8G 2N5FA 2IMKA 2FWEA 2FUG2 1GUMA 1PQNA 3UVTA 1C72A 3WT1A 2CT6A 3VWVA 5J4VA 4ECJA 3N9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7R A;  4YAP A;  4HQS A;  1E6B A;  1F2E A;  2DJK A;  1Z3E A;  2RM6 A;  5IOX A;  4XRD A;  2C0G A;  3DD3 A;  4ECB A;  2RII A;  2CX4 A;  4OO4 A;  1XVW A;  4F0B A;  2XPD A;  1B8X A;  2NDO A;  1F3B A;  2H1G A;  3MSZ A;  1TKD B;  9GSS A;  5IMZ A;  2O85 A;  3KTB A;  3EVI A;  3I69 A;  3CTG A;  2XHF A;  4X43 A;  2YWM A;  3TKR A;  1JZO A;  3CSJ A;  4EXJ A;  4O5R A;  2O89 A;  1OYJ A;  5HR3 A;  3HZ4 A;  2C80 A;  3BBY A;  3UL3 A;  3L0H A;  1XIY A;  4NXI A;  3TJG A;  1BAY A;  3Q6O A;  2H73 A;  1V40 A;  4BVY B;  3KMO A;  4QQ7 A;  4PNG A;  1TK0 B;  1T7P B;  3UBL A;  1AQV A;  4Q5R A;  5C04 A;  2ZNM A;  1OAZ A;  4QL9 A;  3J7Y k;  1OKD A;  5HFK A;  3TJF A;  2WCI A;  4MJE A;  5G5F A;  3FEU A;  1V98 A;  1O8X A;  5DAK A;  2IJY A;  3TOT A;  4NV2 A;  1M2B A;  2MMA A;  3F0I A;  12GS A;  2VL2 C;  2ALB A;  2JZR A;  3FW2 A;  5LCZ A;  1A8L A;  3WGD A;  1YJ6 A;  2HFD A;  3I9V 2;  2LEG A;  2D2Z A;  3IDV A;  4N0Z A;  2LNS A;  4ZL8 A;  4TVE A;  3ZTL A;  1VF4 A;  2V6O A;  2MYG A;  2X8H A;  1K0O A;  3ME8 A;  1PX7 A;  3ZRD A;  4GST A;  5ECN B;  2DML A;  3UIW A;  5J3R A;  4RI7 A;  3UBK A;  2KHP A;  3GKK A;  5IO0 A;  5LD0 A;  3GMF A;  1U3A A;  3LGC A;  3H93 A;  1PKW A;  3VUR A;  3I43 A;  6GSV A;  3ZYW A;  4KE3 A;  1R5A A;  1QUW A;  4JED A;  2LST A;  5DAL A;  5KN0 A;  5DAK B;  2DIY A;  2GVP A;  2IWT A;  3IRA A;  1MEK A;  1WMJ A;  1JZW A;  5EVO A;  2LUS A;  2OBI A;  3O76 A;  1SKS B;  4KGI A;  1GTA A;  1PA3 A;  5D9T A;  4TOP A;  1OC3 A;  3OR5 A;  2HZE A;  5H5S A;  1SU9 A;  3KH7 A;  2B1K A;  5ECQ B;  2LRC A;  5J9C A;  3DGQ A;  2CA8 A;  3Q18 A;  2X8C A;  3CSH A;  4ZBB A;  1MTC A;  1K0D A;  1SL1 B;  2LJR A;  3P8W A;  2ZUP A;  3Q74 A;  1SK0 A;  3EMP A;  3GNJ A;  2E2M A;  3UEM A;  5G31 A;  1MDK A;  3HD5 A;  1B4P A;  3W6G A;  5CRW A;  2FNO A;  4K7O A;  1X0R A;  3HXS A;  2C3T A;  3ERG A;  4EDZ A;  3C1S A;  1FHE A;  1NSW A;  1YKA A;  3DXB A;  3TRP A;  5DAL B;  2MZC A;  5CAX A;  1YY7 A;  4IKH A;  4OFT A;  2TRC P;  1A2J A;  1SJ6 A;  3PR8 A;  2MBT A;  6GST A;  3ZML A;  1EGR A;  4LMW A;  3G7Y A;  4CDO A;  2HZE B;  4EDY A;  3D0Z A;  5DDL A;  4CW9 A;  1B9Y C;  4TR4 A;  5B6N A;  2C0F A;  2WDU A;  3UAR A;  1HNA A;  1BED A;  1GSF A;  3H4K A;  3HZ8 A;  1VF1 A;  1FOV A;  4KCE A;  4E8E A;  2F9S A;  2EIR A;  3F4R A;  2HSY A;  4IN0 A;  2R4V A;  4G10 A;  1T4Z A;  3FR3 A;  5H5Q A;  2H71 A;  1AW9 A;  3DKS A;  3KD0 A;  16GS A;  4IHU A;  3QCP A;  3GYK A;  3F4T A;  3RBT A;  4XS1 A;  3EUR A;  3D4T A;  1KNG A;  1U87 A;  3KH9 A;  1HNC A;  3GL5 A;  4RQR A;  3EIN A;  1MDJ A;  1SK2 A;  4WBJ A;  1I5G A;  3GIX A;  2NPB A;  1TRS A;  3N5O A;  2B3S A;  5HR2 A;  3IBH A;  4MZB A;  4K6X A;  4KB3 A;  2FWF A;  5DJL A;  3HKR A;  3IOS A;  3F4S A;  2GT5 A;  5ELG A;  3GKX A;  1KBN A;  3M3M A;  3CXG A;  3TGZ A;  2YP6 A;  3FR9 A;  4KCA A;  2CZ2 A;  5IOW A;  2G0F A;  1EGO A;  3L9U A;  3KJY A;  2RUE A;  4PQH A;  2VL2 A;  2F51 A;  2B5E A;  2HXK A;  4YH2 A;  3CTF A;  1F3A A;  4TN8 A;  4USS A;  1N2A A;  3GST A;  4XS6 A;  3TCO A;  3APQ A;  3FRC A;  2N5A A;  2FY6 A;  4F9Z A;  4P3Y B;  1E2Y A;  4MPF A;  2H8L A;  2DSA A;  3LOR A;  4DVC A;  1ABA A;  3IK9 A;  5ENU A;  2L4Q A;  3IAM 2;  3G9B A;  2TRX A;  1BYE A;  3FY7 A;  5IO2 A;  2JZT A;  2AYT A;  4BPY A;  2MMZ A;  5D8I A;  4KSO A;  4EC0 A;  2IFQ A;  1O73 A;  3DVW A;  4JR6 A;  3ZVJ A;  1TRW A;  1USB A;  4GCI A;  4XIH A;  3W8S A;  5DJM A;  3GHA A;  2X64 A;  1AIU A;  11GS A;  5KEJ A;  3KP9 A;  3KCM A;  3GTU A;  4ECC A;  3GA4 A;  4LL1 B;  4FIW A;  4IQA A;  2VLT A;  4J57 E;  4X0X A;  3QOU A;  4MAB A;  5D9X A;  4POK A;  6GSS A;  5F05 A;  4EE0 A;  4N11 A;  3UVH A;  2JZS A;  1SD8 A;  1A0F A;  3HJP A;  1R5P A;  4HJ2 A;  2ZCT A;  2EIO A;  1X5C A;  2C1Y A;  2K18 A;  4HDE A;  4I2T A;  4LL4 B;  4POB A;  5JWQ B;  1XZO A;  2DIZ A;  1PGT A;  1TXX A;  5G1K A;  2IFQ B;  4LA1 A;  2FCH A;  1HYU A;  4NV5 A;  5CRH A;  4MJA A;  2HSM A;  5B8B A;  2GGT A;  2OKA A;  4MH3 A;  1ZL9 A;  3SWL A;  3C8E A;  3Q19 A;  5G30 A;  4V2L A;  1TU8 A;  2PVQ A;  2QSI A;  1SYX A;  4MH2 A;  4DEJ A;  1TW9 A;  3VFI A;  4XTS A;  3GTU B;  2VUP A;  4BVX A;  3UAP A;  2VL3 A;  4K7I A;  3QD9 A;  4AJ7 A;  1B48 A;  4ZL9 A;  4TW5 A;  1EP7 A;  1O85 A;  2GSR A;  2VD1 A;  5HR1 A;  2H6Z A;  1Z5Y E;  1FW1 A;  4MDC A;  2GS3 A;  3QFB C;  2K8S A;  5JCW A;  4D73 A;  3ZL5 A;  1F37 A;  1BG5 A;  1V57 A;  3M9K A;  3PIN A;  1TOF A;  2K9F A;  1PMT A;  2DJJ A;  1WIK A;  1PD2 1;  1DUG A;  2H30 A;  3GH6 A;  2HSM B;  2R2J A;  3GN3 A;  3TJB A;  1Y25 A;  3ED3 A;  1JLV A;  3PGT A;  1HNB A;  2C3Q A;  1EOG A;  3MAK A;  4EO3 A;  2XBQ A;  3D6I A;  5GAN D;  3DWV A;  1XWK A;  3TDG A;  4BVX B;  1AQW A;  4YQU A;  1MDI A;  4TR0 A;  2DC5 A;  1ERW A;  4LMV A;  3ZMK A;  1SL0 B;  2NTO A;  1OKT A;  10GS A;  1B4Q A;  2P5Q A;  3HYP A;  4I2U A;  3TOU A;  4XCS A;  5ECM B;  3M1G A;  3F6D A;  1PSQ A;  5B7C A;  2L5L A;  2H6X A;  4D73 B;  1X9M B;  1GTB A;  5GZZ B;  4K1F A;  2DJ1 A;  4IBP A;  5DQY A;  2HRF A;  2H75 A;  3IV4 A;  3E3E A;  4V2M A;  1MD4 A;  4Z7X A;  2HZF A;  4MLY A;  5CRD A;  1M99 A;  3LG6 A;  4F0C A;  3R3E A;  1VF2 A;  1K0B A;  1U88 A;  1TP9 A;  3KTL A;  5CYY A;  2QC7 A;  1H75 A;  3ZZX A;  3VI7 A;  2P5R A;  4I6X A;  5DQS A;  2EIQ A;  1XXU A;  3RHC A;  1U3I A;  5IMD A;  5IPH A;  5IMC A;  2DJ3 A;  1EEJ A;  1O8W A;  5DCG A;  2LTK A;  5G5E A;  2OJL A;  4CHS A;  5JWO B;  3ZRE A;  3F3Q A;  2WJU A;  4GF0 A;  2F8F A;  3A2W A;  2FD3 A;  3HHV A;  2MBS A;  1XWC A;  3MDK A;  2REM A;  2CVB A;  1G0T A;  4KA0 A;  4XS4 A;  3QAG A;  1DBY A;  3VWX A;  2DMM A;  2PMT A;  2HRN A;  4OWY A;  3I6A A;  2XPE A;  1VF3 A;  1AUC A;  1NHO A;  5B8A A;  1XPV A;  2V41 A;  1CQH A;  2V2G A;  3M0F A;  2HNL A;  3ERF A;  4V1A g;  4WEY A;  2OE3 A;  3GX8 A;  4WET A;  3L9S A;  1GUK A;  4ML1 A;  1S3A A;  1FAA A;  1LJR A;  3TKS E;  4IP1 A;  3G7I A;  1T3B A;  3WGX A;  1Z6N A;  4DSS A;  2C3N A;  1HD2 A;  5ECH B;  2GZZ A;  4ML6 A;  2M80 A;  3H79 A;  4ISD A;  3EWL A;  4GQC A;  3NIV A;  5H5R A;  4JRR A;  3CBU A;  4LLR A;  4PQI A;  4WR5 A;  1ML6 A;  3LEF A;  2YWI A;  4OFN A;  2FA4 A;  4MJC A;  2GQL A;  4IVF A;  5INY A;  1EV9 A;  2R3X A;  4GLT A;  2WS2 A;  3DEX A;  1BJX A;  2A2R A;  2GLR A;  4FYC A;  4MJB A;  3A2V A;  2RUF A;  2OE1 A;  5D96 A;  1W4V A;  1ZZY A;  4DSS B;  1K0N A;  4POM A;  1PL2 A;  2VIM A;  4MCU A;  3JCM L;  4GSN A;  3GRX A;  2YN1 A;  2B5X A;  3RPP A;  1GTI A;  2AHE A;  2I4A A;  4PTS A;  2LJA A;  1X9W B;  2BJX A;  4GRF A;  1H4O A;  4IJI A;  2L6C A;  2I1U A;  1EWX A;  2OBK A;  3FZ4 A;  5JWR B;  4HS1 A;  1ST9 A;  1TRU A;  1RW1 A;  3DML A;  4WKW A;  3LXZ A;  3LWA A;  3QR6 A;  2CVD A;  4JBB A;  4FO5 A;  4YAV A;  1SL2 B;  5A4U A;  2JSY A;  2PVO C;  2J23 A;  1YEX A;  3AY8 A;  2VD0 A;  1A2L A;  5E4W A;  4MZW A;  4XRA A;  4NHW A;  2VOC A;  1OC8 A;  1GSU A;  2E7P A;  1RK4 A;  3KGK A;  4PUA A;  4KW6 A;  4KAE A;  4OCE A;  5ECI B;  4K0G A;  2B7K A;  3HVS A;  1AXD A;  4FYU A;  2AAW A;  4ID0 A;  3VK9 A;  1GRX A;  1KTE A;  3LYK A;  4ZBD A;  1WPI A;  2LV3 A;  1CQG A;  3KP8 A;  4KF9 A;  2AB6 A;  2AUV A;  4F82 A;  2IIY A;  2R6K A;  1JZD A;  3ZIT A;  4IQ1 A;  4MF6 A;  4V1A p;  3FHK A;  2WFC A;  1GSE A;  3D21 A;  3F8U A;  4NPB A;  20GS A;  3F63 A;  1A0R P;  4HUA A;  1SKR B;  5COH A;  2EC4 A;  5HR0 A;  5D73 A;  5ECL B;  1TJD A;  2IME A;  1HQO A;  1ZYQ B;  2PGT A;  2CAI A;  2HE3 A;  4EKZ A;  4ZIL A;  2H01 A;  3ZFL A;  1OC9 A;  4TR3 A;  3CYN A;  5FT3 A;  5ELA A;  4Q5Q A;  1K3Y A;  1BX9 A;  2CVK A;  1GWC A;  2P31 A;  3HVV A;  2PPT A;  2IMI A;  4G2E A;  1OE7 A;  2CQ9 A;  1Q4J A;  2HSN B;  4MP4 A;  2GQM A;  4IP6 A;  4AGS A;  4JU5 A;  5IIZ A;  3H8Q A;  4I5Q A;  3GL3 A;  2JAD A;  3GKN A;  2C0E A;  4WR4 A;  3TKQ A;  4IS0 A;  4AJ8 A;  4TXV A;  1YZX A;  2VLU A;  2VM2 A;  1I9D A;  2P0G A;  4GQF A;  1F6M C;  2E2G A;  2PBJ A;  2JSZ A;  1EZK A;  4J2F A;  2OA7 A;  4FH8 A;  3FYG A;  3FZA A;  3G7J A;  4ZBA A;  4KX4 A;  2PU9 C;  3D4M A;  1OC9 B;  6GSW A;  2ON7 A;  4PX1 A;  2V32 A;  5IQY A;  2GTU A;  1K3O A;  1NM3 A;  3FK8 A;  4GTU A;  1YKC A;  2FHE A;  4RQX A;  4HEA 2;  1ERT A;  1G7E A;  2C4J A;  1A2M A;  1MD3 A;  3VWW A;  2X8G A;  2HLS A;  4GSS A;  2J9H A;  2NVL A;  2KUC A;  1M2D A;  5CRE A;  5DBQ A;  3IC4 A;  4HU9 A;  3SBC A;  4O32 A;  2CZ3 A;  3QAV A;  3GUR A;  1Q98 A;  3WT2 A;  2KOK A;  2YV7 A;  3ZFB A;  2DBC A;  1SYR A;  3WYW A;  3DIE A;  3U5R E;  2V6K A;  5JCU A;  2OAD A;  5IMV A;  2L57 A;  1TK5 B;  2HRK A;  5ABR A;  4O7H A;  1GSD A;  2H0G A;  3GSS A;  3HJM A;  5J9B A;  2RM5 A;  5GST A;  4HZ2 A;  3EE2 A;  1AC1 A;  1AQX A;  4JR4 A;  1ACV A;  1Z9H A;  5AIX A;  3ERW A;  5GAP D;  1XBS A;  4G9H A;  1WJK A;  5FHI A;  3RHB A;  3VWU A;  5ECP B;  2DJ2 A;  2WZ9 A;  5BMU A;  1EOH A;  3QAW A;  1Z6M A;  3RPN A;  2LQQ A;  1FB6 A;  4N10 A;  4ZXG A;  3S9F A;  4ULX A;  4K7N A;  3APO A;  3FR6 A;  22GS A;  2WUL A;  4HZ4 A;  2BTO T;  4PUR A;  3EYT A;  3L4N A;  2H74 A;  2H0H A;  2HYX A;  5ECR B;  1XCC A;  3LQ7 A;  4I8B A;  3J7Y b;  1A23 A;  1JFU A;  1A24 A;  3RAZ A;  1WE0 A;  1R4W A;  3BCK A;  4NHZ A;  2E0Q A;  2HRA A;  1QQ2 A;  2O7K A;  2GZY A;  2HRK B;  2IN3 A;  3E0U A;  1YF1 A;  1SEN A;  2GST A;  7GSS A;  1WWJ A;  2H0I A;  3KM6 A;  5AGY A;  3HY2 A;  1WP0 A;  2YAN A;  1M2A A;  3IC8 A;  3GX0 A;  2QGV A;  3ME7 A;  2PN8 A;  3TJK A;  2YWN A;  4TRX A;  1PL1 A;  1DSB A;  2Z9S A;  4HJM A;  5EPF A;  4ZL7 A;  1ZOF A;  2LRN A;  5IPG A;  3APS A;  4WXT A;  1TTZ A;  3A3T A;  4ACS A;  2YJH A;  1ZYE A;  3IXR A;  1IYH A;  4BA7 A;  5ID2 A;  3BOA A;  4TR1 A;  1GLP A;  3UOM A;  3TUE A;  1XWA A;  2VAF A;  2YNX A;  4NMU A;  3KXO A;  1GUL A;  1V58 A;  2I3Y A;  3H1N A;  5F0G A;  3TKS C;  3R2Q A;  3VLN A;  3QDN A;  2KP1 A;  5J41 A;  3EC3 A;  1O7U A;  1PX6 A;  4OFM A;  2ON5 A;  3TRQ A;  2WB9 A;  2H6Y A;  14GS A;  1XFL A;  1VRS D;  3P2A A;  5KN3 A;  1GNE A;  5FWG A;  2YJ7 A;  4FQU A;  2FA8 A;  4WF5 A;  1YDK A;  3LSZ A;  3K8N A;  2GDR A;  1FO5 A;  3M8N A;  3IA1 A;  3CRU A;  4PQ1 A;  2UZ8 A;  3PH9 A;  2CAQ A;  3LFL A;  1YF0 A;  2VCV A;  3IK7 A;  4YQM A;  4YQV A;  19GS A;  5ID2 B;  2I81 A;  4TR1 B;  1X5D A;  5C00 A;  4X1U A;  3IPZ A;  4BVY A;  2IPA A;  1THX A;  2H70 A;  1FB0 A;  1RQM A;  1T4Y A;  3DYR A;  4JZQ A;  1T8E B;  2L59 A;  5DVB A;  3BD2 A;  1EP8 A;  4KDX A;  2JAC A;  1SJZ A;  3HDC A;  1K3L A;  2XC2 A;  1DE2 A;  3FKF A;  2XBI A;  2M72 A;  4K8M A;  3LXT A;  2WRT A;  4AF2 A;  1UN2 A;  4PGT A;  13GS A;  1R26 A;  4F03 A;  4G19 A;  1XW5 A;  2LQO A;  5CO3 A;  3MWH A;  3VI5 A;  1QGV A;  2GZP A;  2V1M A;  4G0K A;  4HQZ A;  4OMV A;  3GFK A;  1XW9 A;  4EL1 A;  1X9S B;  1ZGN A;  2YCD A;  4HU7 A;  2IMD A;  4L8E A;  2PER A;  1ERU A;  4GWR A;  2YOI A;  1SD9 A;  4IJ3 A;  1J0F A;  18GS A;  2FWG A;  1TDI A;  5IM9 A;  4J56 E;  3A2X A;  2LJK A;  1QFN A;  4WBR D;  1PN9 A;  2M46 A;  2VL9 A;  2IL3 A;  1O6J A;  4GXZ A;  5HQP A;  4XS4 B;  4F2I A;  3F3R A;  2PUK C;  2KP2 A;  1ZMA A;  1V2A A;  2OE0 A;  6GSX A;  2PWJ A;  5CNW A;  2R37 A;  3DRN A;  1GTU A;  4BL7 A;  5D9V A;  1M0U A;  2B7J A;  3TJJ A;  1PRX A;  1ON4 A;  2L6D A;  4MK3 A;  1GLQ A;  5CP1 A;  3MNG A;  3TB2 A;  3O3T A;  4G0L A;  3GH9 A;  2FWH A;  4WF4 A;  4PNF A;  1G7O A;  4E8H A;  1Z7P A;  1EEM A;  3UMA A;  1U6T A;  3GUS A;  3QMX A;  3L78 A;  4L5O A;  2H1D A;  4Q5N A;  1TI3 A;  2VCZ A;  4N0V A;  1BQ7 A;  4OO5 A;  2DLX A;  4KH7 A;  2VLV A;  1GH2 A;  1FVJ A;  3WGE A;  2LS5 A;  1SJI A;  3EU3 A;  3F6F A;  5AIS A;  4EF0 A;  2QKE A;  5ECO B;  2HQT A;  4O92 A;  2H1A A;  2BMX A;  1ILO A;  2H19 A;  4BL7 B;  3TKS A;  5A4W A;  3WD6 A;  2RLI A;  1XWB A;  1TK8 B;  5KN1 A;  3FZ9 A;  2B1L A;  3HVX A;  1S3D A;  2MMO A;  4NAX A;  5JCG A;  5KN2 A;  3D5J A;  2ES7 A;  2VCW A;  1G6W A;  2JU5 A;  3A5W A;  2A4V A;  2HT9 A;  2KLX A;  3KEB A;  4KUN A;  2GQK A;  1XOB A;  2AJQ B;  5AN1 A;  1FG4 A;  4KDU A;  5D93 A;  3ZVJ D;  3P7X A;  4EVM A;  4OD7 A;  2YV9 A;  3HCZ A;  2JL4 A;  3TKP A;  1UC7 A;  3QFA C;  1WRY A;  1J08 A;  4K2D A;  5GSS A;  1F9M A;  2X99 A;  3CRT A;  4Q5F A;  3IHQ A;  2VCX A;  3BCI A;  8GSS A;  3HJO A;  5IMA A;  5ECS A;  4V2N A;  3US3 A;  2K6V A;  4MPG A;  4BWS A;  4IGJ A;  3W8J A;  2C8U A;  2YWO A;  1X5E A;  1IYI A;  4POL A;  2NBS A;  4L0U A;  1G6Y A;  1J9B A;  4NWY A;  3KIJ A;  1JZR A;  1Y6E A;  3HA9 A;  1M7T A;  1K0A A;  3FZ5 A;  1B9X C;  1GNW A;  4ILF A;  5A5K A;  1QMV A;  3L9V A;  1URM A;  1OE8 A;  2H66 A;  3C7M A;  3IR4 A;  4RI6 A;  5LNK e;  2VCQ A;  2YPM A;  1YQ1 A;  2DJ0 A;  1O81 A;  3V1W A;  4KDY A;  3ZLP A;  2I9H A;  3C73 A;  3LYP A;  1WOU A;  3VPT A;  2YZH A;  6GSY A;  4OCF A;  4IEL A;  2FGX A;  2VM1 A;  3PPU A;  1PKZ A;  2A2S A;  1ZCP A;  4TKY A;  4ZB9 A;  5AIV A;  5DCH A;  5F07 A;  2K8V A;  1M9A A;  5CRG A;  1ERV A;  2IMF A;  3UJ1 A;  4DSR A;  2GSS A;  1AAZ A;  5F8B A;  3C71 A;  2HSH A;  2VCT A;  4ZB8 A;  4ECI A;  5IMF A;  1UVZ A;  3ISO A;  4I97 A;  2G2Q A;  4EUY A;  4MZC A;  1GSQ A;  5D9W A;  3NZN A;  4MF5 A;  3GV1 A;  1XW6 A;  4ZB6 A;  3CMI A;  1EV4 A;  3P90 A;  1R7H A;  1GSS A;  1TI1 A;  3C1R A;  3RDW A;  5E59 A;  1T00 A;  1XVQ A;  1JHB A;  2N5B A;  3QPM A;  5J4U A;  1SK1 A;  1UA5 A;  1DE1 A;  4MMM A;  4TXO A;  4PUF C;  3IAS 2;  3CSI A;  1KEB A;  1V9W A;  1GSY A;  2AV4 A;  2O8V B;  3BJ5 A;  3M9J A;  3KMN A;  1K0C A;  2F3M A;  3F9U A;  3NOF A;  5EY6 A;  1W89 A;  3E9J B;  4MF7 A;  3EMX A;  1XWG A;  1GL8 A;  1GP1 A;  4K9Z A;  1QXH A;  4JE1 A;  2B5Y A;  3D22 A;  4MA9 A;  2GT6 A;  3TRX A;  3O6T A;  2LNT A;  2LRT A;  4KSM A;  5F06 A;  5L71 A;  2C0D A;  1TU7 A;  4DSQ A;  5G1L A;  2L5O A;  5J5N A;  2HI7 A;  17GS A;  3LJR A;  3GKM A;  1LBK A;  4QL7 A;  4K0N A;  5G2Z A;  3IE3 A;  2GSQ A;  2B6M A;  1JLW A;  1T1V A;  4TXO B;  4G0I A;  1K0M A;  4H86 A;  4HI7 A;  5HFG A;  2R5G A;  1GUH A;  3VPQ A;  4HOJ A;  1VGL A;  1M9B A;  1OVN A;  4BWQ A;  4IW9 A;  4RUV A;  4L5L A;  6GSU A;  1YEP A;  3DVX A;  4XHM A;  2CV4 A;  4ZIJ A;  1THO A;  2L4C A;  3ZIV A;  5B6M A;  3ZIJ A;  2WGR A;  1SKW B;  5ECK B;  2VO4 A;  3KZQ A;  4AJ6 A;  2F8A A;  1TRV A;  4KND A;  1QK8 A;  2O87 A;  1A8Y A;  2H72 A;  4L0W A;  1S3C A;  5EL8 A;  2LKU A;  2MMN A;  2YZU A;  1LU4 A;  1NHY A;  1FVK A;  4N30 A;  1N8J A;  1XOA A;  2H1B A;  5HFI A;  3EU4 A;  2OAC A;  4PXO A;  5A4V A;  2TIR A;  2CX3 A;  2FLS A;  4FYB A;  3U6V A;  2H76 A;  1NW2 A;  2N5F A;  2IMK A;  2FWE A;  2FUG 2;  1GUM A;  1PQN A;  3UVT A;  1C72 A;  3WT1 A;  2CT6 A;  3VWV A;  4ECJ A;  3N9J A; 
#chains in the Genus database with same CATH topology
 1Z7R A;  4YAP A;  4HQS A;  1E6B A;  1F2E A;  2DJK A;  1Z3E A;  2RM6 A;  5IOX A;  4XRD A;  2C0G A;  3DD3 A;  4ECB A;  2RII A;  2CX4 A;  4OO4 A;  1XVW A;  4F0B A;  2XPD A;  4AKH A;  1B8X A;  2NDO A;  1F3B A;  2H1G A;  3MSZ A;  1TKD B;  9GSS A;  5IMZ A;  2O85 A;  3KTB A;  3EVI A;  3I69 A;  4MNN A;  3CTG A;  3CQF A;  2XHF A;  4X43 A;  2YWM A;  3TKR A;  1JZO A;  3CSJ A;  4EXJ A;  4O5R A;  2O89 A;  4X4J A;  1OYJ A;  5HR3 A;  3HZ4 A;  2C80 A;  3BBY A;  3UL3 A;  3L0H A;  1XIY A;  2A4H A;  4NXI A;  3TJG A;  4K5R A;  1BAY A;  3Q6O A;  2H73 A;  1V40 A;  4BVY B;  3KMO A;  4QQ7 A;  4PNG A;  1TK0 B;  1T7P B;  3UBL A;  1AQV A;  4Q5R A;  5C04 A;  2ZNM A;  1OAZ A;  4QL9 A;  3J7Y k;  1OKD A;  5HFK A;  3TJF A;  2WCI A;  4MJE A;  5G5F A;  3FEU A;  1V98 A;  1O8X A;  5DAK A;  2IJY A;  3TOT A;  4NV2 A;  1M2B A;  2MMA A;  3F0I A;  12GS A;  2VL2 C;  2ALB A;  2JZR A;  4YKF A;  3FW2 A;  5LCZ A;  1A8L A;  3WGD A;  1YJ6 A;  2HFD A;  3I9V 2;  2LEG A;  2D2Z A;  3IDV A;  4N0Z A;  2LNS A;  4ZL8 A;  4TVE A;  3ZTL A;  1VF4 A;  2V6O A;  2MYG A;  2X8H A;  1K0O A;  3ME8 A;  1PX7 A;  3ZRD A;  4GST A;  5ECN B;  2DML A;  3UIW A;  3CHX C;  5J3R A;  4RI7 A;  3UBK A;  2KHP A;  3GKK A;  5IO0 A;  5LD0 A;  3GMF A;  1U3A A;  3LGC A;  3H93 A;  1PKW A;  3VUR A;  3I43 A;  6GSV A;  3ZYW A;  2EFC A;  4KE3 A;  1R5A A;  1QUW A;  4JED A;  2LST A;  5DAL A;  5KN0 A;  5DAK B;  2DIY A;  2GVP A;  2IWT A;  3IRA A;  1MEK A;  1WMJ A;  1JZW A;  5EVO A;  2LUS A;  2OBI A;  3O76 A;  1SKS B;  4KGI A;  1GTA A;  1PA3 A;  5D9T A;  4TOP A;  1OC3 A;  3OR5 A;  2EFD A;  2HZE A;  5H5S A;  1SU9 A;  3KH7 A;  2B1K A;  5ECQ B;  2LRC A;  5J9C A;  3DGQ A;  2CA8 A;  3Q18 A;  2X8C A;  3CSH A;  4ZBB A;  1MTC A;  1K0D A;  1SL1 B;  2LJR A;  3P8W A;  2ZUP A;  3Q74 A;  1SK0 A;  3EMP A;  3GNJ A;  2E2M A;  3UEM A;  5G31 A;  1MDK A;  3HD5 A;  1B4P A;  3W6G A;  5CRW A;  2FNO A;  4K7O A;  1X0R A;  3HXS A;  2C3T A;  3ERG A;  4EDZ A;  3C1S A;  1FHE A;  1NSW A;  1YKA A;  3DXB A;  3TRP A;  5DAL B;  2MZC A;  5CAX A;  1YY7 A;  4IKH A;  4OFT A;  2DKI A;  2TRC P;  1A2J A;  4Z2R A;  1SJ6 A;  3PR8 A;  2MBT A;  6GST A;  3ZML A;  2DKH A;  1EGR A;  4LMW A;  3G7Y A;  4CDO A;  2HZE B;  4EDY A;  3D0Z A;  5DDL A;  4CW9 A;  1B9Y C;  4TR4 A;  5B6N A;  2C0F A;  2HSN A;  2WDU A;  3UAR A;  1HNA A;  1BED A;  1GSF A;  2WW0 A;  3H4K A;  3HZ8 A;  1VF1 A;  1FOV A;  4KCE A;  4E8E A;  2F9S A;  2EIR A;  3F4R A;  2HSY A;  4IN0 A;  2R4V A;  2OT3 A;  4G10 A;  1T4Z A;  3FR3 A;  5H5Q A;  2H71 A;  1AW9 A;  3DKS A;  3KD0 A;  16GS A;  4IHU A;  3QCP A;  3GYK A;  3F4T A;  3RBT A;  4XS1 A;  3EUR A;  3D4T A;  1KNG A;  1U87 A;  1YEW C;  3KH9 A;  1HNC A;  3GL5 A;  4RQR A;  3EIN A;  1MDJ A;  1SK2 A;  4WBJ A;  1I5G A;  3GIX A;  2NPB A;  1TRS A;  3N5O A;  2B3S A;  4E68 A;  5HR2 A;  3IBH A;  4MZB A;  4K6X A;  4KB3 A;  2FWF A;  5DJL A;  3HKR A;  3IOS A;  3F4S A;  2GT5 A;  5ELG A;  3GKX A;  1KBN A;  3M3M A;  3CXG A;  3TGZ A;  2YP6 A;  3FR9 A;  4KCA A;  2CZ2 A;  5IOW A;  2G0F A;  1EGO A;  1SVM A;  2VL2 A;  3KJY A;  2RUE A;  4PQH A;  3L9U A;  2F51 A;  2B5E A;  2HXK A;  4YH2 A;  3CTF A;  1F3A A;  4TN8 A;  4USS A;  1N2A A;  3GST A;  4XS6 A;  3TCO A;  3APQ A;  3FRC A;  2N5A A;  2FY6 A;  4F9Z A;  4P3Y B;  1E2Y A;  4MPF A;  2H8L A;  2DSA A;  3LOR A;  4DVC A;  1ABA A;  3IK9 A;  5ENU A;  2L4Q A;  3IAM 2;  3G9B A;  2TRX A;  1BYE A;  3FY7 A;  5IO2 A;  2JZT A;  2O36 A;  2AYT A;  4BPY A;  2MMZ A;  1I1I P;  5D8I A;  4KSO A;  4EC0 A;  4AI6 A;  2IFQ A;  1O73 A;  3DVW A;  4JR6 A;  3ZVJ A;  1TRW A;  1USB A;  4GCI A;  4XIH A;  3W8S A;  5DJM A;  3GHA A;  2X64 A;  1AIU A;  11GS A;  5KEJ A;  3MYD A;  3KP9 A;  3KCM A;  3GTU A;  4ECC A;  3GA4 A;  3LW9 A;  4LL1 B;  4FIW A;  4IQA A;  2VLT A;  4J57 E;  4X0X A;  3QOU A;  4MAB A;  5D9X A;  4POK A;  6GSS A;  5F05 A;  4EE0 A;  4N11 A;  3UVH A;  2JZS A;  1SD8 A;  1A0F A;  3HJP A;  1R5P A;  4HJ2 A;  2ZCT A;  2EIO A;  1X5C A;  1ZYP A;  2C1Y A;  2K18 A;  4HDE A;  4I2T A;  4LL4 B;  4POB A;  5JWQ B;  1XZO A;  2DIZ A;  1PGT A;  1TXX A;  5G1K A;  2IFQ B;  4LA1 A;  2FCH A;  1HYU A;  4NV5 A;  5CRH A;  4MJA A;  2HSM A;  5B8B A;  2GGT A;  2OKA A;  2WVX A;  4MH3 A;  1ZL9 A;  3SWL A;  3C8E A;  3Q19 A;  5G30 A;  4V2L A;  1S3R A;  1TU8 A;  2PVQ A;  2QSI A;  1SYX A;  4MH2 A;  4DEJ A;  1TW9 A;  3VFI A;  4XTS A;  3GTU B;  2VUP A;  4BVX A;  3UAP A;  2VL3 A;  4K7I A;  3QD9 A;  4AJ7 A;  1B48 A;  4ZL9 A;  4TW5 A;  1EP7 A;  1O85 A;  2GSR A;  2VD1 A;  5HR1 A;  4GDF A;  2H6Z A;  1Z5Y E;  2R0G A;  1FW1 A;  4MDC A;  2GS3 A;  3QFB C;  2K8S A;  5JCW A;  4D73 A;  3ZL5 A;  1F37 A;  1BG5 A;  1V57 A;  3M9K A;  3PIN A;  1TOF A;  2K9F A;  4ZB7 A;  1PMT A;  2DJJ A;  1WIK A;  1YVL A;  1PD2 1;  1DUG A;  2H30 A;  3GH6 A;  2HSM B;  2R2J A;  2WVX B;  3GN3 A;  3TJB A;  1Y25 A;  3ED3 A;  1JLV A;  3PGT A;  1HNB A;  2C3Q A;  5A5H A;  1EOG A;  3MAK A;  4EO3 A;  2XBQ A;  3D6I A;  5GAN D;  3DWV A;  1XWK A;  3TDG A;  4BVX B;  1AQW A;  4YQU A;  4W66 A;  1MDI A;  4TR0 A;  2DC5 A;  1ERW A;  4LMV A;  3ZMK A;  1SL0 B;  2NTO A;  1OKT A;  10GS A;  1B4Q A;  2P5Q A;  3HYP A;  4I2U A;  3TOU A;  4XCS A;  5ECM B;  3M1G A;  3F6D A;  1PSQ A;  5B7C A;  2L5L A;  2H6X A;  4D73 B;  1X9M B;  1GTB A;  5GZZ B;  4K1F A;  2DJ1 A;  4IBP A;  5BRT A;  5DQY A;  2HRF A;  2H75 A;  3IV4 A;  5A1N B;  3E3E A;  4V2M A;  1MD4 A;  4Z7X A;  2HZF A;  4MLY A;  5CRD A;  1M99 A;  3LG6 A;  4F0C A;  3R3E A;  1VF2 A;  1K0B A;  1U88 A;  1TP9 A;  3KTL A;  5CYY A;  2QC7 A;  1H75 A;  5A5H B;  3ZZX A;  3VI7 A;  2P5R A;  4I6X A;  5DQS A;  2EIQ A;  1XXU A;  3RHC A;  1U3I A;  5IMD A;  5IPH A;  5IMC A;  2DJ3 A;  1EEJ A;  1O8W A;  5DCG A;  2LTK A;  5G5E A;  2OJL A;  4CHS A;  5JWO B;  1SVL A;  3ZRE A;  3F3Q A;  2WJU A;  4GF0 A;  2F8F A;  3A2W A;  2FD3 A;  3HHV A;  2MBS A;  1XWC A;  3MDK A;  2REM A;  2CVB A;  1G0T A;  4KA0 A;  4XS4 A;  3QAG A;  1DBY A;  3VWX A;  2DMM A;  2PMT A;  2HRN A;  4OWY A;  3I6A A;  3FMW A;  5A34 A;  2XPE A;  1VF3 A;  5KOX A;  1AUC A;  1NHO A;  5B8A A;  1XPV A;  2V41 A;  1CQH A;  2V2G A;  2HNL A;  3M0F A;  3ERF A;  4V1A g;  4WEY A;  2OE3 A;  3GX8 A;  4WET A;  3L9S A;  1GUK A;  4ML1 A;  1S3A A;  1FAA A;  1LJR A;  3TKS E;  4IP1 A;  3G7I A;  1T3B A;  3WGX A;  1Z6N A;  4DSS A;  2A2P A;  2C3N A;  1HD2 A;  5ECH B;  2GZZ A;  4ML6 A;  2M80 A;  3H79 A;  4ISD A;  3EWL A;  4GQC A;  3NIV A;  5H5R A;  4JRR A;  3CBU A;  4LLR A;  4PQI A;  4WR5 A;  1ML6 A;  3LEF A;  2YWI A;  4OFN A;  2FA4 A;  4MJC A;  2GQL A;  4IVF A;  5INY A;  1EV9 A;  2R3X A;  4GLT A;  2WS2 A;  3DEX A;  1BJX A;  2A2R A;  2GLR A;  4FYC A;  4MJB A;  3A2V A;  2RUF A;  2OE1 A;  5D96 A;  1W4V A;  1ZZY A;  4DSS B;  1K0N A;  4POM A;  1PL2 A;  2VIM A;  4MCU A;  3JCM L;  4GSN A;  3GRX A;  2YN1 A;  2B5X A;  3RPP A;  1GTI A;  2AHE A;  2I4A A;  4PTS A;  2LJA A;  1X9W B;  2BJX A;  4GRF A;  1H4O A;  4IJI A;  2L6C A;  2I1U A;  1EWX A;  2OBK A;  3FZ4 A;  5JWR B;  4HS1 A;  1ST9 A;  1TRU A;  1RW1 A;  3DML A;  4WKW A;  3LXZ A;  3LWA A;  3QR6 A;  2CVD A;  4JBB A;  4FO5 A;  4YAV A;  1SL2 B;  5A4U A;  2JSY A;  2PVO C;  2J23 A;  1YEX A;  3AY8 A;  2VD0 A;  1A2L A;  5E4W A;  4MZW A;  4XRA A;  4NHW A;  2VOC A;  1OC8 A;  1GSU A;  2E7P A;  1RK4 A;  3KGK A;  4PUA A;  4KW6 A;  4O5U A;  4KAE A;  3MIX A;  4OCE A;  5ECI B;  4K0G A;  3EPT A;  2B7K A;  3HVS A;  1AXD A;  4FYU A;  2AAW A;  4ID0 A;  3VK9 A;  2VKZ G;  1GRX A;  1KTE A;  3LYK A;  4ZBD A;  1WPI A;  2LV3 A;  1CQG A;  3KP8 A;  4KF9 A;  2AB6 A;  2AUV A;  4F82 A;  2IIY A;  2R6K A;  1JZD A;  4A5P A;  3ZIT A;  4IQ1 A;  4MF6 A;  4V1A p;  3FHK A;  2WFC A;  1GSE A;  3D21 A;  3F8U A;  4NPB A;  20GS A;  3F63 A;  1TXU A;  1A0R P;  4HUA A;  1SKR B;  5COH A;  2EC4 A;  5HR0 A;  5D73 A;  5ECL B;  1TJD A;  2IME A;  1HQO A;  1ZYQ B;  2PGT A;  2CAI A;  2HE3 A;  4EKZ A;  1XG8 A;  4ZIL A;  2H01 A;  3ZFL A;  1OC9 A;  4TR3 A;  3CYN A;  5FT3 A;  5ELA A;  4Q5Q A;  1K3Y A;  1BX9 A;  2CVK A;  1GWC A;  2P31 A;  3HVV A;  1SVO A;  2PPT A;  2IMI A;  4G2E A;  1OE7 A;  2CQ9 A;  1M3I A;  1Q4J A;  2HSN B;  4MP4 A;  2GQM A;  4IP6 A;  4AGS A;  4QMK A;  4JU5 A;  5IIZ A;  3H8Q A;  4I5Q A;  3GL3 A;  2JAD A;  5J40 A;  2O3E A;  3GKN A;  4G01 A;  2C0E A;  4WR4 A;  3TKQ A;  4IS0 A;  4K2X A;  4TXV A;  4AJ8 A;  1YZX A;  2VLU A;  2VM2 A;  1I9D A;  2P0G A;  4GQF A;  1F6M C;  2E2G A;  2PBJ A;  2JSZ A;  1EZK A;  4J2F A;  2OA7 A;  4FH8 A;  3FYG A;  3FZA A;  3G7J A;  4ZBA A;  4KX4 A;  2PU9 C;  3D4M A;  1OC9 B;  6GSW A;  2ON7 A;  4PX1 A;  2V32 A;  5IQY A;  2GTU A;  1K3O A;  2X49 A;  1NM3 A;  2R0P A;  3FK8 A;  4GTU A;  1YKC A;  2FHE A;  4RQX A;  4HEA 2;  1ERT A;  1G7E A;  2C4J A;  1A2M A;  1MD3 A;  3VWW A;  4AKI A;  2X8G A;  2HLS A;  4GSS A;  2J9H A;  2NVL A;  2KUC A;  3TU3 B;  1M2D A;  5CRE A;  5DBQ A;  2WVZ A;  3IC4 A;  4HU9 A;  3SBC A;  4O32 A;  2CZ3 A;  3QAV A;  3GUR A;  1Q98 A;  3WT2 A;  2KOK A;  2YV7 A;  3ZFB A;  2DBC A;  1SYR A;  3WYW A;  3DIE A;  3U5R E;  1PFO A;  2V6K A;  3HMJ G;  5JCU A;  2OAD A;  5IMV A;  2L57 A;  1TK5 B;  2HRK A;  5ABR A;  4O7H A;  1GSD A;  2H0G A;  3GSS A;  3HJM A;  5J9B A;  2RM5 A;  5GST A;  4HZ2 A;  3EE2 A;  1AC1 A;  1AQX A;  4JR4 A;  1ACV A;  1Z9H A;  5AIX A;  3ERW A;  5GAP D;  1XBS A;  4G9H A;  1WJK A;  5FHI A;  3RHB A;  3VWU A;  5ECP B;  2DJ2 A;  2WZ9 A;  5BMU A;  1EOH A;  3QAW A;  1Z6M A;  3RPN A;  2LQQ A;  1FB6 A;  4N10 A;  4ZXG A;  3S9F A;  4ULX A;  4K7N A;  3APO A;  3FR6 A;  22GS A;  2WUL A;  4HZ4 A;  2BTO T;  4PUR A;  3EYT A;  3L4N A;  2H74 A;  2H0H A;  2HYX A;  5ECR B;  1XCC A;  3LQ7 A;  4I8B A;  3J7Y b;  1A23 A;  1JFU A;  1A24 A;  3RAZ A;  1WE0 A;  1R4W A;  3BCK A;  4NHZ A;  2E0Q A;  2HRA A;  1QQ2 A;  2O7K A;  2GZY A;  2HRK B;  2IN3 A;  3E0U A;  1YF1 A;  1SEN A;  2GST A;  7GSS A;  1WWJ A;  2H0I A;  3KM6 A;  5AGY A;  3HY2 A;  1WP0 A;  2YAN A;  1M2A A;  3IC8 A;  3GX0 A;  4EIP A;  2QGV A;  3ME7 A;  2PN8 A;  3TJK A;  2YWN A;  4TRX A;  1PL1 A;  1DSB A;  2Z9S A;  4HJM A;  5EPF A;  4ZL7 A;  1ZOF A;  2LRN A;  5IPG A;  3APS A;  4WXT A;  1TTZ A;  3A3T A;  4ACS A;  2YJH A;  1ZYE A;  3IXR A;  1IYH A;  4BA7 A;  5ID2 A;  3BOA A;  4TR1 A;  1GLP A;  3UOM A;  3TUE A;  1XWA A;  2VAF A;  2YNX A;  4NMU A;  3KXO A;  1GUL A;  1V58 A;  2I3Y A;  3H1N A;  5F0G A;  3TKS C;  3R2Q A;  3VLN A;  1M3J A;  3QDN A;  2KP1 A;  5J41 A;  3EC3 A;  1O7U A;  1PX6 A;  4OFM A;  2ON5 A;  3TRQ A;  2WB9 A;  2H6Y A;  14GS A;  1XFL A;  3RFR C;  1VRS D;  3P2A A;  5KN3 A;  1GNE A;  5FWG A;  2YJ7 A;  4EIQ A;  4O5Q A;  4FQU A;  2FA8 A;  4WF5 A;  1YDK A;  3LSZ A;  3K8N A;  2GDR A;  1FO5 A;  3M8N A;  3IA1 A;  3CRU A;  4PQ1 A;  2UZ8 A;  3PH9 A;  2CAQ A;  3LFL A;  1YF0 A;  2VCV A;  3IK7 A;  4YQM A;  4YQV A;  19GS A;  5ID2 B;  2I81 A;  4HSC X;  4TR1 B;  1X5D A;  4AKX B;  4X1U A;  5C00 A;  3IPZ A;  4BVY A;  2IPA A;  1THX A;  2H70 A;  1FB0 A;  1RQM A;  1T4Y A;  3DYR A;  4JZQ A;  1T8E B;  2L59 A;  5DVB A;  3BD2 A;  1EP8 A;  4KDX A;  2JAC A;  1SJZ A;  3HDC A;  1K3L A;  2XC2 A;  1DE2 A;  3FKF A;  2XBI A;  2M72 A;  4K8M A;  3LXT A;  2WRT A;  4AF2 A;  1UN2 A;  4PGT A;  13GS A;  1R26 A;  4F03 A;  4G19 A;  1XW5 A;  2LQO A;  4CY8 A;  5CO3 A;  4FXY P;  3MWH A;  3VI5 A;  1QGV A;  2GZP A;  2V1M A;  4N3Z A;  2WW2 A;  4G0K A;  4HQZ A;  4OMV A;  3GFK A;  3HVN A;  1XW9 A;  4EL1 A;  1X9S B;  1ZGN A;  2YCD A;  4HU7 A;  2IMD A;  4L8E A;  2PER A;  1ERU A;  4GWR A;  2YOI A;  1SD9 A;  4IJ3 A;  2QA2 A;  1J0F A;  5KOW A;  18GS A;  2FWG A;  1TDI A;  5IM9 A;  4J56 E;  3A2X A;  2LJK A;  1QFN A;  4WBR D;  1PN9 A;  2M46 A;  2VL9 A;  2IL3 A;  4PI0 C;  1O6J A;  4GXZ A;  5HQP A;  4XS4 B;  4F2I A;  3F3R A;  2PUK C;  2KP2 A;  1ZMA A;  1V2A A;  2OE0 A;  6GSX A;  2PWJ A;  5CNW A;  2H1L A;  2R37 A;  5A34 B;  3DRN A;  1GTU A;  4BL7 A;  5D9V A;  1M0U A;  2B7J A;  3TJJ A;  1PRX A;  1ON4 A;  2L6D A;  4MK3 A;  1GLQ A;  4K5S A;  5CP1 A;  4PHZ C;  3MNG A;  3TB2 A;  3O3T A;  4G0L A;  3GH9 A;  2FWH A;  4WF4 A;  4PNF A;  1G7O A;  4E8H A;  1Z7P A;  1EEM A;  3UMA A;  1U6T A;  2EFE A;  3GUS A;  3QMX A;  3L78 A;  4L5O A;  2H1D A;  4Q5N A;  1TI3 A;  2VCZ A;  4N0V A;  1BQ7 A;  4OO5 A;  2DLX A;  4KH7 A;  2VLV A;  1GH2 A;  1FVJ A;  3WGE A;  5J4Y A;  1FOH A;  2LS5 A;  1SJI A;  3EU3 A;  3F6F A;  5AIS A;  4EF0 A;  2QKE A;  5ECO B;  2HQT A;  4O92 A;  2H1A A;  2BMX A;  1ILO A;  2H19 A;  4BL7 B;  3TKS A;  4PI2 C;  5A4W A;  3WD6 A;  2RLI A;  1XWB A;  1TK8 B;  5KN1 A;  3FZ9 A;  2B1L A;  3HVX A;  1S3D A;  1N25 A;  2MMO A;  4NAX A;  5JCG A;  5KN2 A;  3D5J A;  2ES7 A;  2VCW A;  1G6W A;  2JU5 A;  5J47 A;  3A5W A;  2A4V A;  2HT9 A;  2KLX A;  3KEB A;  4CY6 A;  4KUN A;  2GQK A;  1XOB A;  2AJQ B;  2WVY A;  5AN1 A;  1FG4 A;  4KDU A;  5D93 A;  3ZVJ D;  3P7X A;  4EVM A;  4OD7 A;  2YV9 A;  3HCZ A;  2JL4 A;  3TKP A;  1UC7 A;  3QFA C;  1WRY A;  1J08 A;  1ZYN A;  4K2D A;  5GSS A;  1F9M A;  1S4B P;  2X99 A;  3CRT A;  4Q5F A;  3IHQ A;  2VCX A;  3BCI A;  8GSS A;  3HJO A;  5IMA A;  5ECS A;  4V2N A;  3US3 A;  2K6V A;  4MPG A;  2X4A A;  4BWS A;  4IGJ A;  3W8J A;  2C8U A;  2YWO A;  1X5E A;  1IYI A;  4POL A;  2NBS A;  4L0U A;  1G6Y A;  1J9B A;  4NWY A;  3KIJ A;  1JZR A;  1Y6E A;  3HA9 A;  1M7T A;  1K0A A;  3FZ5 A;  1B9X C;  2WW1 A;  1GNW A;  1BF5 A;  2WW3 A;  4ILF A;  5A5K A;  1QMV A;  3L9V A;  1URM A;  1OE8 A;  2H66 A;  3C7M A;  3IR4 A;  4RI6 A;  5LNK e;  2VCQ A;  3CWG A;  2YPM A;  1YQ1 A;  2DJ0 A;  1O81 A;  3V1W A;  4KDY A;  3ZLP A;  2I9H A;  3C73 A;  3LYP A;  1WOU A;  3VPT A;  2YZH A;  2R0C A;  6GSY A;  4OCF A;  4IEL A;  2FGX A;  2VM1 A;  3PPU A;  1PKZ A;  2A2S A;  1ZCP A;  4TKY A;  4ZB9 A;  5AIV A;  2EFH A;  4YKG A;  3A5I A;  5DCH A;  5F07 A;  2WZS A;  2K8V A;  1M9A A;  5CRG A;  1ERV A;  2IMF A;  4Z2T A;  3UJ1 A;  4DSR A;  2GSS A;  1AAZ A;  5F8B A;  3IHG A;  3C71 A;  2HSH A;  2VCT A;  4ZB8 A;  4ECI A;  5IMF A;  1UVZ A;  3ISO A;  4I97 A;  2G2Q A;  4EUY A;  4MZC A;  1GSQ A;  5D9W A;  3NZN A;  2O5V A;  4MF5 A;  3GV1 A;  1XW6 A;  4ZB6 A;  3CMI A;  1EV4 A;  4Z2U A;  3P90 A;  1R7H A;  1GSS A;  1TI1 A;  3C1R A;  3RDW A;  5E59 A;  1T00 A;  1BG1 A;  1XVQ A;  1JHB A;  2N5B A;  3QPM A;  5J4U A;  1SK1 A;  1UA5 A;  1DE1 A;  4MMM A;  4TXO A;  4PUF C;  3IAS 2;  3CSI A;  2QA1 A;  3RGB C;  1KEB A;  1V9W A;  1GSY A;  2AV4 A;  2O8V B;  3BJ5 A;  3M9J A;  3KMN A;  1K0C A;  2F3M A;  3F9U A;  3NOF A;  5EY6 A;  1W89 A;  1Y1U A;  3E9J B;  4MF7 A;  3EMX A;  1XWG A;  1GL8 A;  1GP1 A;  4BIK A;  4K9Z A;  1QXH A;  5BMU B;  4JE1 A;  2B5Y A;  3D22 A;  4MA9 A;  2GT6 A;  3TRX A;  3O6T A;  2LNT A;  2LRT A;  4KSM A;  5F06 A;  5L71 A;  2C0D A;  1TU7 A;  4DSQ A;  5G1L A;  2L5O A;  5J5N A;  2HI7 A;  17GS A;  3LJR A;  3GKM A;  1LBK A;  4ICY A;  4QL7 A;  4K0N A;  5G2Z A;  3IE3 A;  2GSQ A;  2B6M A;  1JLW A;  1T1V A;  4TXO B;  4G0I A;  1K0M A;  4H86 A;  4HI7 A;  5HFG A;  2R5G A;  1GUH A;  3VPQ A;  4HOJ A;  1VGL A;  1M9B A;  1OVN A;  4BWQ A;  4IW9 A;  4RUV A;  4L5L A;  6GSU A;  1YEP A;  3DVX A;  4XHM A;  2CV4 A;  5A1N A;  4ZIJ A;  1THO A;  2L4C A;  3ZIV A;  5B6M A;  3ZIJ A;  2WGR A;  1SKW B;  5ECK B;  2VO4 A;  1PN0 A;  3KZQ A;  4AJ6 A;  2F8A A;  1TRV A;  4KND A;  1QK8 A;  2O87 A;  1A8Y A;  2H72 A;  4L0W A;  1S3C A;  5EL8 A;  4AKG A;  2LKU A;  2MMN A;  2YZU A;  1LU4 A;  1NHY A;  1FVK A;  4N30 A;  1N8J A;  1XOA A;  2H1B A;  5HFI A;  3EU4 A;  2OAC A;  4PXO A;  5A4V A;  2TIR A;  2CX3 A;  2FLS A;  4FYB A;  3U6V A;  2H76 A;  1NW2 A;  2UV8 G;  2N5F A;  2IMK A;  2FWE A;  2FUG 2;  1GUM A;  1PQN A;  3UVT A;  1C72 A;  3WT1 A;  2CT6 A;  3VWV A;  5J4V A;  4ECJ A;  3N9J A; 
#chains in the Genus database with same CATH homology
 1Z7R A;  4YAP A;  4HQS A;  1E6B A;  1F2E A;  2DJK A;  1Z3E A;  2RM6 A;  5IOX A;  4XRD A;  2C0G A;  3DD3 A;  4ECB A;  2RII A;  2CX4 A;  4OO4 A;  1XVW A;  4F0B A;  2XPD A;  4AKH A;  1B8X A;  2NDO A;  1F3B A;  2H1G A;  3MSZ A;  1TKD B;  9GSS A;  5IMZ A;  2O85 A;  3KTB A;  3EVI A;  3I69 A;  4MNN A;  3CTG A;  2XHF A;  4X43 A;  2YWM A;  3TKR A;  1JZO A;  3CSJ A;  4EXJ A;  4O5R A;  2O89 A;  4X4J A;  1OYJ A;  5HR3 A;  3HZ4 A;  2C80 A;  3BBY A;  3UL3 A;  3L0H A;  1XIY A;  2A4H A;  4NXI A;  3TJG A;  4K5R A;  1BAY A;  3Q6O A;  2H73 A;  1V40 A;  4BVY B;  3KMO A;  4QQ7 A;  4PNG A;  1TK0 B;  1T7P B;  3UBL A;  1AQV A;  4Q5R A;  5C04 A;  2ZNM A;  1OAZ A;  4QL9 A;  3J7Y k;  1OKD A;  5HFK A;  3TJF A;  2WCI A;  4MJE A;  5G5F A;  3FEU A;  1V98 A;  1O8X A;  5DAK A;  2IJY A;  3TOT A;  4NV2 A;  1M2B A;  2MMA A;  3F0I A;  12GS A;  2VL2 C;  2ALB A;  2JZR A;  4YKF A;  3FW2 A;  5LCZ A;  1A8L A;  3WGD A;  1YJ6 A;  2HFD A;  3I9V 2;  2LEG A;  2D2Z A;  3IDV A;  4N0Z A;  2LNS A;  4ZL8 A;  4TVE A;  3ZTL A;  1VF4 A;  2V6O A;  2MYG A;  2X8H A;  1K0O A;  3ME8 A;  1PX7 A;  3ZRD A;  4GST A;  5ECN B;  2DML A;  3UIW A;  5J3R A;  4RI7 A;  3UBK A;  2KHP A;  3GKK A;  5IO0 A;  5LD0 A;  3GMF A;  1U3A A;  3LGC A;  3H93 A;  1PKW A;  3VUR A;  3I43 A;  6GSV A;  3ZYW A;  2EFC A;  4KE3 A;  1R5A A;  1QUW A;  4JED A;  2LST A;  5DAL A;  5KN0 A;  5DAK B;  2DIY A;  2GVP A;  2IWT A;  3IRA A;  1MEK A;  1WMJ A;  1JZW A;  5EVO A;  2LUS A;  2OBI A;  3O76 A;  1SKS B;  4KGI A;  1GTA A;  1PA3 A;  5D9T A;  4TOP A;  1OC3 A;  3OR5 A;  2EFD A;  2HZE A;  5H5S A;  1SU9 A;  3KH7 A;  2B1K A;  5ECQ B;  2LRC A;  5J9C A;  3DGQ A;  2CA8 A;  3Q18 A;  2X8C A;  3CSH A;  4ZBB A;  1MTC A;  1K0D A;  1SL1 B;  2LJR A;  3P8W A;  2ZUP A;  3Q74 A;  1SK0 A;  3EMP A;  3GNJ A;  2E2M A;  3UEM A;  5G31 A;  1MDK A;  3HD5 A;  1B4P A;  3W6G A;  5CRW A;  2FNO A;  4K7O A;  1X0R A;  3HXS A;  2C3T A;  3ERG A;  4EDZ A;  3C1S A;  1FHE A;  1NSW A;  1YKA A;  3DXB A;  3TRP A;  5DAL B;  2MZC A;  5CAX A;  1YY7 A;  4IKH A;  4OFT A;  2DKI A;  2TRC P;  1A2J A;  4Z2R A;  1SJ6 A;  3PR8 A;  2MBT A;  6GST A;  3ZML A;  2DKH A;  1EGR A;  4LMW A;  3G7Y A;  4CDO A;  2HZE B;  4EDY A;  3D0Z A;  5DDL A;  4CW9 A;  1B9Y C;  4TR4 A;  5B6N A;  2C0F A;  2HSN A;  2WDU A;  3UAR A;  1HNA A;  1BED A;  1GSF A;  3H4K A;  3HZ8 A;  1VF1 A;  1FOV A;  4KCE A;  4E8E A;  2F9S A;  2EIR A;  3F4R A;  2HSY A;  4IN0 A;  2R4V A;  2OT3 A;  4G10 A;  1T4Z A;  3FR3 A;  5H5Q A;  2H71 A;  1AW9 A;  3DKS A;  3KD0 A;  16GS A;  4IHU A;  3QCP A;  3GYK A;  3F4T A;  3RBT A;  4XS1 A;  3EUR A;  3D4T A;  1KNG A;  1U87 A;  3KH9 A;  1HNC A;  3GL5 A;  4RQR A;  3EIN A;  1MDJ A;  1SK2 A;  4WBJ A;  1I5G A;  3GIX A;  2NPB A;  1TRS A;  3N5O A;  2B3S A;  4E68 A;  5HR2 A;  3IBH A;  4MZB A;  4K6X A;  4KB3 A;  2FWF A;  5DJL A;  3HKR A;  3IOS A;  3F4S A;  2GT5 A;  5ELG A;  3GKX A;  1KBN A;  3M3M A;  3CXG A;  3TGZ A;  2YP6 A;  3FR9 A;  4KCA A;  2CZ2 A;  5IOW A;  2G0F A;  1EGO A;  1SVM A;  3L9U A;  2VL2 A;  3KJY A;  4PQH A;  2RUE A;  2F51 A;  2B5E A;  2HXK A;  4YH2 A;  3CTF A;  1F3A A;  4TN8 A;  4USS A;  1N2A A;  3GST A;  4XS6 A;  3TCO A;  3APQ A;  3FRC A;  2N5A A;  2FY6 A;  4F9Z A;  4P3Y B;  1E2Y A;  4MPF A;  2H8L A;  2DSA A;  3LOR A;  4DVC A;  1ABA A;  3IK9 A;  5ENU A;  2L4Q A;  3IAM 2;  3G9B A;  2TRX A;  1BYE A;  3FY7 A;  5IO2 A;  2JZT A;  2AYT A;  4BPY A;  2MMZ A;  5D8I A;  4KSO A;  4EC0 A;  4AI6 A;  2IFQ A;  1O73 A;  3DVW A;  4JR6 A;  3ZVJ A;  1TRW A;  1USB A;  4GCI A;  4XIH A;  3W8S A;  5DJM A;  3GHA A;  2X64 A;  1AIU A;  11GS A;  5KEJ A;  3MYD A;  3KP9 A;  3KCM A;  3GTU A;  4ECC A;  3GA4 A;  3LW9 A;  4LL1 B;  4FIW A;  4IQA A;  2VLT A;  4J57 E;  4X0X A;  3QOU A;  4MAB A;  5D9X A;  4POK A;  6GSS A;  5F05 A;  4EE0 A;  4N11 A;  3UVH A;  2JZS A;  1SD8 A;  1A0F A;  3HJP A;  1R5P A;  4HJ2 A;  2ZCT A;  2EIO A;  1X5C A;  1ZYP A;  2C1Y A;  2K18 A;  4HDE A;  4I2T A;  4LL4 B;  4POB A;  5JWQ B;  1XZO A;  2DIZ A;  1PGT A;  1TXX A;  5G1K A;  2IFQ B;  4LA1 A;  2FCH A;  1HYU A;  4NV5 A;  5CRH A;  4MJA A;  2HSM A;  5B8B A;  2GGT A;  2OKA A;  4MH3 A;  1ZL9 A;  3SWL A;  3C8E A;  3Q19 A;  5G30 A;  4V2L A;  1TU8 A;  2PVQ A;  2QSI A;  1SYX A;  4MH2 A;  4DEJ A;  1TW9 A;  3VFI A;  4XTS A;  3GTU B;  2VUP A;  4BVX A;  3UAP A;  2VL3 A;  4K7I A;  3QD9 A;  4AJ7 A;  1B48 A;  4ZL9 A;  4TW5 A;  1EP7 A;  1O85 A;  2GSR A;  2VD1 A;  5HR1 A;  4GDF A;  2H6Z A;  1Z5Y E;  2R0G A;  1FW1 A;  4MDC A;  2GS3 A;  3QFB C;  2K8S A;  5JCW A;  4D73 A;  3ZL5 A;  1F37 A;  1BG5 A;  1V57 A;  3M9K A;  3PIN A;  1TOF A;  2K9F A;  4ZB7 A;  1PMT A;  2DJJ A;  1WIK A;  1YVL A;  1PD2 1;  1DUG A;  2H30 A;  3GH6 A;  2HSM B;  2R2J A;  3GN3 A;  3TJB A;  1Y25 A;  3ED3 A;  1JLV A;  3PGT A;  1HNB A;  2C3Q A;  5A5H A;  1EOG A;  3MAK A;  4EO3 A;  2XBQ A;  3D6I A;  5GAN D;  3DWV A;  1XWK A;  3TDG A;  4BVX B;  1AQW A;  4YQU A;  4W66 A;  1MDI A;  4TR0 A;  2DC5 A;  1ERW A;  4LMV A;  3ZMK A;  1SL0 B;  2NTO A;  1OKT A;  10GS A;  1B4Q A;  2P5Q A;  3HYP A;  4I2U A;  3TOU A;  4XCS A;  5ECM B;  3M1G A;  3F6D A;  1PSQ A;  5B7C A;  2L5L A;  2H6X A;  4D73 B;  1X9M B;  1GTB A;  5GZZ B;  4K1F A;  2DJ1 A;  4IBP A;  5BRT A;  5DQY A;  2HRF A;  2H75 A;  3IV4 A;  5A1N B;  3E3E A;  4V2M A;  1MD4 A;  4Z7X A;  2HZF A;  4MLY A;  5CRD A;  1M99 A;  3LG6 A;  4F0C A;  3R3E A;  1VF2 A;  1K0B A;  1U88 A;  1TP9 A;  3KTL A;  5CYY A;  2QC7 A;  1H75 A;  5A5H B;  3ZZX A;  3VI7 A;  2P5R A;  4I6X A;  5DQS A;  2EIQ A;  1XXU A;  3RHC A;  1U3I A;  5IMD A;  5IPH A;  5IMC A;  2DJ3 A;  1EEJ A;  1O8W A;  5DCG A;  2LTK A;  5G5E A;  2OJL A;  4CHS A;  5JWO B;  1SVL A;  3ZRE A;  3F3Q A;  2WJU A;  4GF0 A;  2F8F A;  3A2W A;  2FD3 A;  3HHV A;  2MBS A;  1XWC A;  3MDK A;  2REM A;  2CVB A;  1G0T A;  4KA0 A;  4XS4 A;  3QAG A;  1DBY A;  3VWX A;  2DMM A;  2PMT A;  2HRN A;  4OWY A;  3I6A A;  3FMW A;  5A34 A;  2XPE A;  1VF3 A;  5KOX A;  1AUC A;  1NHO A;  5B8A A;  1XPV A;  2V41 A;  1CQH A;  2V2G A;  3M0F A;  2HNL A;  3ERF A;  4V1A g;  4WEY A;  2OE3 A;  3GX8 A;  4WET A;  3L9S A;  1GUK A;  4ML1 A;  1S3A A;  1FAA A;  1LJR A;  3TKS E;  4IP1 A;  3G7I A;  1T3B A;  3WGX A;  1Z6N A;  4DSS A;  2A2P A;  2C3N A;  1HD2 A;  5ECH B;  2GZZ A;  4ML6 A;  2M80 A;  3H79 A;  4ISD A;  3EWL A;  4GQC A;  3NIV A;  5H5R A;  4JRR A;  3CBU A;  4LLR A;  4PQI A;  4WR5 A;  1ML6 A;  3LEF A;  2YWI A;  4OFN A;  2FA4 A;  4MJC A;  2GQL A;  4IVF A;  5INY A;  1EV9 A;  2R3X A;  4GLT A;  2WS2 A;  3DEX A;  1BJX A;  2A2R A;  2GLR A;  4FYC A;  4MJB A;  3A2V A;  2RUF A;  2OE1 A;  5D96 A;  1W4V A;  1ZZY A;  4DSS B;  1K0N A;  4POM A;  1PL2 A;  2VIM A;  4MCU A;  3JCM L;  4GSN A;  3GRX A;  2YN1 A;  2B5X A;  3RPP A;  1GTI A;  2AHE A;  2I4A A;  4PTS A;  2LJA A;  1X9W B;  2BJX A;  4GRF A;  1H4O A;  4IJI A;  2L6C A;  2I1U A;  1EWX A;  2OBK A;  3FZ4 A;  5JWR B;  4HS1 A;  1ST9 A;  1TRU A;  1RW1 A;  3DML A;  4WKW A;  3LXZ A;  3LWA A;  3QR6 A;  2CVD A;  4JBB A;  4FO5 A;  4YAV A;  1SL2 B;  5A4U A;  2JSY A;  2PVO C;  2J23 A;  1YEX A;  3AY8 A;  2VD0 A;  1A2L A;  5E4W A;  4MZW A;  4XRA A;  4NHW A;  2VOC A;  1OC8 A;  1GSU A;  2E7P A;  1RK4 A;  3KGK A;  4PUA A;  4KW6 A;  4O5U A;  4KAE A;  3MIX A;  4OCE A;  5ECI B;  4K0G A;  3EPT A;  2B7K A;  3HVS A;  1AXD A;  4FYU A;  2AAW A;  4ID0 A;  3VK9 A;  2VKZ G;  1GRX A;  1KTE A;  3LYK A;  4ZBD A;  1WPI A;  2LV3 A;  1CQG A;  3KP8 A;  4KF9 A;  2AB6 A;  2AUV A;  4F82 A;  2IIY A;  2R6K A;  1JZD A;  4A5P A;  3ZIT A;  4IQ1 A;  4MF6 A;  4V1A p;  3FHK A;  2WFC A;  1GSE A;  3D21 A;  3F8U A;  4NPB A;  20GS A;  3F63 A;  1TXU A;  1A0R P;  4HUA A;  1SKR B;  5COH A;  2EC4 A;  5HR0 A;  5D73 A;  5ECL B;  1TJD A;  2IME A;  1HQO A;  1ZYQ B;  2PGT A;  2CAI A;  2HE3 A;  4EKZ A;  4ZIL A;  2H01 A;  3ZFL A;  1OC9 A;  4TR3 A;  3CYN A;  5FT3 A;  5ELA A;  4Q5Q A;  1K3Y A;  1BX9 A;  2CVK A;  1GWC A;  2P31 A;  3HVV A;  1SVO A;  2PPT A;  2IMI A;  4G2E A;  1OE7 A;  2CQ9 A;  1Q4J A;  2HSN B;  4MP4 A;  2GQM A;  4IP6 A;  4AGS A;  4QMK A;  4JU5 A;  5IIZ A;  3H8Q A;  4I5Q A;  3GL3 A;  2JAD A;  5J40 A;  3GKN A;  4G01 A;  2C0E A;  4WR4 A;  3TKQ A;  4IS0 A;  4K2X A;  4TXV A;  4AJ8 A;  1YZX A;  2VLU A;  2VM2 A;  1I9D A;  2P0G A;  4GQF A;  1F6M C;  2E2G A;  2PBJ A;  2JSZ A;  1EZK A;  4J2F A;  2OA7 A;  4FH8 A;  3FYG A;  3FZA A;  3G7J A;  4ZBA A;  4KX4 A;  2PU9 C;  3D4M A;  1OC9 B;  6GSW A;  2ON7 A;  4PX1 A;  2V32 A;  5IQY A;  2GTU A;  1K3O A;  2X49 A;  1NM3 A;  2R0P A;  3FK8 A;  4GTU A;  1YKC A;  2FHE A;  4RQX A;  4HEA 2;  1ERT A;  1G7E A;  2C4J A;  1A2M A;  1MD3 A;  3VWW A;  4AKI A;  2X8G A;  2HLS A;  4GSS A;  2J9H A;  2NVL A;  2KUC A;  3TU3 B;  1M2D A;  5CRE A;  5DBQ A;  3IC4 A;  4HU9 A;  3SBC A;  4O32 A;  2CZ3 A;  3QAV A;  3GUR A;  1Q98 A;  3WT2 A;  2KOK A;  2YV7 A;  3ZFB A;  2DBC A;  1SYR A;  3WYW A;  3DIE A;  3U5R E;  2V6K A;  3HMJ G;  5JCU A;  2OAD A;  5IMV A;  2L57 A;  1TK5 B;  2HRK A;  5ABR A;  4O7H A;  1GSD A;  2H0G A;  3GSS A;  3HJM A;  5J9B A;  2RM5 A;  5GST A;  4HZ2 A;  3EE2 A;  1AC1 A;  1AQX A;  4JR4 A;  1ACV A;  1Z9H A;  5AIX A;  3ERW A;  5GAP D;  1XBS A;  4G9H A;  1WJK A;  5FHI A;  3RHB A;  3VWU A;  5ECP B;  2DJ2 A;  2WZ9 A;  5BMU A;  1EOH A;  3QAW A;  1Z6M A;  3RPN A;  2LQQ A;  1FB6 A;  4N10 A;  4ZXG A;  3S9F A;  4ULX A;  4K7N A;  3APO A;  3FR6 A;  22GS A;  2WUL A;  4HZ4 A;  2BTO T;  4PUR A;  3EYT A;  3L4N A;  2H74 A;  2H0H A;  2HYX A;  5ECR B;  1XCC A;  3LQ7 A;  4I8B A;  3J7Y b;  1A23 A;  1JFU A;  1A24 A;  3RAZ A;  1WE0 A;  1R4W A;  3BCK A;  4NHZ A;  2E0Q A;  2HRA A;  1QQ2 A;  2O7K A;  2GZY A;  2HRK B;  2IN3 A;  3E0U A;  1YF1 A;  1SEN A;  2GST A;  7GSS A;  1WWJ A;  2H0I A;  3KM6 A;  5AGY A;  3HY2 A;  1WP0 A;  2YAN A;  1M2A A;  3IC8 A;  3GX0 A;  4EIP A;  2QGV A;  3ME7 A;  2PN8 A;  3TJK A;  2YWN A;  4TRX A;  1PL1 A;  1DSB A;  2Z9S A;  4HJM A;  5EPF A;  4ZL7 A;  1ZOF A;  2LRN A;  5IPG A;  3APS A;  4WXT A;  1TTZ A;  3A3T A;  4ACS A;  2YJH A;  1ZYE A;  3IXR A;  1IYH A;  4BA7 A;  5ID2 A;  3BOA A;  4TR1 A;  1GLP A;  3UOM A;  3TUE A;  1XWA A;  2VAF A;  2YNX A;  4NMU A;  3KXO A;  1GUL A;  1V58 A;  2I3Y A;  3H1N A;  5F0G A;  3TKS C;  3R2Q A;  3VLN A;  3QDN A;  2KP1 A;  5J41 A;  3EC3 A;  1O7U A;  1PX6 A;  4OFM A;  2ON5 A;  3TRQ A;  2WB9 A;  2H6Y A;  14GS A;  1XFL A;  1VRS D;  3P2A A;  5KN3 A;  1GNE A;  5FWG A;  2YJ7 A;  4EIQ A;  4O5Q A;  4FQU A;  2FA8 A;  4WF5 A;  1YDK A;  3LSZ A;  3K8N A;  2GDR A;  1FO5 A;  3M8N A;  3IA1 A;  3CRU A;  4PQ1 A;  2UZ8 A;  3PH9 A;  2CAQ A;  3LFL A;  1YF0 A;  2VCV A;  3IK7 A;  4YQM A;  4YQV A;  19GS A;  5ID2 B;  2I81 A;  4TR1 B;  1X5D A;  4AKX B;  4X1U A;  5C00 A;  3IPZ A;  4BVY A;  2IPA A;  1THX A;  2H70 A;  1FB0 A;  1RQM A;  1T4Y A;  3DYR A;  4JZQ A;  1T8E B;  2L59 A;  5DVB A;  3BD2 A;  1EP8 A;  4KDX A;  2JAC A;  1SJZ A;  3HDC A;  1K3L A;  2XC2 A;  1DE2 A;  3FKF A;  2XBI A;  2M72 A;  4K8M A;  3LXT A;  2WRT A;  4AF2 A;  1UN2 A;  4PGT A;  13GS A;  1R26 A;  4F03 A;  4G19 A;  1XW5 A;  2LQO A;  4CY8 A;  5CO3 A;  3MWH A;  3VI5 A;  1QGV A;  2GZP A;  2V1M A;  4N3Z A;  4G0K A;  4HQZ A;  4OMV A;  3GFK A;  1XW9 A;  4EL1 A;  1X9S B;  1ZGN A;  2YCD A;  4HU7 A;  2IMD A;  4L8E A;  2PER A;  1ERU A;  4GWR A;  2YOI A;  1SD9 A;  4IJ3 A;  2QA2 A;  1J0F A;  5KOW A;  18GS A;  2FWG A;  1TDI A;  5IM9 A;  4J56 E;  3A2X A;  2LJK A;  1QFN A;  4WBR D;  1PN9 A;  2M46 A;  2VL9 A;  2IL3 A;  1O6J A;  4GXZ A;  5HQP A;  4XS4 B;  4F2I A;  3F3R A;  2PUK C;  2KP2 A;  1ZMA A;  1V2A A;  2OE0 A;  6GSX A;  2PWJ A;  5CNW A;  2H1L A;  2R37 A;  5A34 B;  3DRN A;  1GTU A;  4BL7 A;  5D9V A;  1M0U A;  2B7J A;  3TJJ A;  1PRX A;  1ON4 A;  2L6D A;  4MK3 A;  1GLQ A;  4K5S A;  5CP1 A;  3MNG A;  3TB2 A;  3O3T A;  4G0L A;  3GH9 A;  2FWH A;  4WF4 A;  4PNF A;  1G7O A;  4E8H A;  1Z7P A;  1EEM A;  3UMA A;  1U6T A;  2EFE A;  3GUS A;  3QMX A;  3L78 A;  4L5O A;  2H1D A;  4Q5N A;  1TI3 A;  2VCZ A;  4N0V A;  1BQ7 A;  4OO5 A;  2DLX A;  4KH7 A;  2VLV A;  1GH2 A;  1FVJ A;  3WGE A;  5J4Y A;  1FOH A;  2LS5 A;  1SJI A;  3EU3 A;  3F6F A;  5AIS A;  4EF0 A;  2QKE A;  5ECO B;  2HQT A;  4O92 A;  2H1A A;  2BMX A;  1ILO A;  2H19 A;  4BL7 B;  3TKS A;  5A4W A;  3WD6 A;  2RLI A;  1XWB A;  1TK8 B;  5KN1 A;  3FZ9 A;  2B1L A;  3HVX A;  1S3D A;  1N25 A;  2MMO A;  4NAX A;  5JCG A;  5KN2 A;  3D5J A;  2ES7 A;  2VCW A;  1G6W A;  2JU5 A;  5J47 A;  3A5W A;  2A4V A;  2HT9 A;  2KLX A;  3KEB A;  4CY6 A;  4KUN A;  2GQK A;  1XOB A;  2AJQ B;  5AN1 A;  1FG4 A;  4KDU A;  5D93 A;  3ZVJ D;  3P7X A;  4EVM A;  4OD7 A;  2YV9 A;  3HCZ A;  2JL4 A;  3TKP A;  1UC7 A;  3QFA C;  1WRY A;  1J08 A;  1ZYN A;  4K2D A;  5GSS A;  1F9M A;  2X99 A;  3CRT A;  4Q5F A;  3IHQ A;  2VCX A;  3BCI A;  8GSS A;  3HJO A;  5IMA A;  5ECS A;  4V2N A;  3US3 A;  2K6V A;  4MPG A;  2X4A A;  4BWS A;  4IGJ A;  3W8J A;  2C8U A;  2YWO A;  1X5E A;  1IYI A;  4POL A;  2NBS A;  4L0U A;  1G6Y A;  1J9B A;  4NWY A;  3KIJ A;  1JZR A;  1Y6E A;  3HA9 A;  1M7T A;  1K0A A;  3FZ5 A;  1B9X C;  1GNW A;  1BF5 A;  4ILF A;  5A5K A;  1QMV A;  3L9V A;  1URM A;  1OE8 A;  2H66 A;  3C7M A;  3IR4 A;  4RI6 A;  5LNK e;  2VCQ A;  3CWG A;  2YPM A;  1YQ1 A;  2DJ0 A;  1O81 A;  3V1W A;  4KDY A;  3ZLP A;  2I9H A;  3C73 A;  3LYP A;  1WOU A;  3VPT A;  2YZH A;  2R0C A;  6GSY A;  4OCF A;  4IEL A;  2FGX A;  2VM1 A;  3PPU A;  1PKZ A;  2A2S A;  1ZCP A;  4TKY A;  4ZB9 A;  5AIV A;  2EFH A;  4YKG A;  3A5I A;  5DCH A;  5F07 A;  2K8V A;  1M9A A;  5CRG A;  1ERV A;  2IMF A;  4Z2T A;  3UJ1 A;  4DSR A;  2GSS A;  1AAZ A;  5F8B A;  3IHG A;  3C71 A;  2HSH A;  2VCT A;  4ZB8 A;  4ECI A;  5IMF A;  1UVZ A;  3ISO A;  4I97 A;  2G2Q A;  4EUY A;  4MZC A;  1GSQ A;  5D9W A;  3NZN A;  2O5V A;  4MF5 A;  3GV1 A;  1XW6 A;  4ZB6 A;  3CMI A;  1EV4 A;  4Z2U A;  3P90 A;  1R7H A;  1GSS A;  1TI1 A;  3C1R A;  3RDW A;  5E59 A;  1T00 A;  1BG1 A;  1XVQ A;  1JHB A;  2N5B A;  3QPM A;  5J4U A;  1SK1 A;  1UA5 A;  1DE1 A;  4MMM A;  4TXO A;  4PUF C;  3IAS 2;  3CSI A;  2QA1 A;  1KEB A;  1V9W A;  1GSY A;  2AV4 A;  2O8V B;  3BJ5 A;  3M9J A;  3KMN A;  1K0C A;  2F3M A;  3F9U A;  3NOF A;  5EY6 A;  1W89 A;  1Y1U A;  3E9J B;  4MF7 A;  3EMX A;  1XWG A;  1GL8 A;  1GP1 A;  4K9Z A;  1QXH A;  5BMU B;  4JE1 A;  2B5Y A;  3D22 A;  4MA9 A;  2GT6 A;  3TRX A;  3O6T A;  2LNT A;  2LRT A;  4KSM A;  5F06 A;  5L71 A;  2C0D A;  1TU7 A;  4DSQ A;  5G1L A;  2L5O A;  5J5N A;  2HI7 A;  17GS A;  3LJR A;  3GKM A;  1LBK A;  4ICY A;  4QL7 A;  4K0N A;  5G2Z A;  3IE3 A;  2GSQ A;  2B6M A;  1JLW A;  1T1V A;  4TXO B;  4G0I A;  1K0M A;  4H86 A;  4HI7 A;  5HFG A;  2R5G A;  1GUH A;  3VPQ A;  4HOJ A;  1VGL A;  1M9B A;  1OVN A;  4BWQ A;  4IW9 A;  4RUV A;  4L5L A;  6GSU A;  1YEP A;  3DVX A;  4XHM A;  2CV4 A;  5A1N A;  4ZIJ A;  1THO A;  2L4C A;  3ZIV A;  5B6M A;  3ZIJ A;  2WGR A;  1SKW B;  5ECK B;  2VO4 A;  1PN0 A;  3KZQ A;  4AJ6 A;  2F8A A;  1TRV A;  4KND A;  1QK8 A;  2O87 A;  1A8Y A;  2H72 A;  4L0W A;  1S3C A;  5EL8 A;  4AKG A;  2LKU A;  2MMN A;  2YZU A;  1LU4 A;  1NHY A;  1FVK A;  4N30 A;  1N8J A;  1XOA A;  2H1B A;  5HFI A;  3EU4 A;  2OAC A;  4PXO A;  5A4V A;  2TIR A;  2CX3 A;  2FLS A;  4FYB A;  3U6V A;  2H76 A;  1NW2 A;  2UV8 G;  2N5F A;  2IMK A;  2FWE A;  2FUG 2;  1GUM A;  1PQN A;  3UVT A;  1C72 A;  3WT1 A;  2CT6 A;  3VWV A;  5J4V A;  4ECJ A;  3N9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...