4K0NA

Crystal structure of human clic1 c24a mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
QPQVELFVKAGSDGAKIGNAPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 1
publication title Crystal structure analysis of CLIC1 C24 mutants
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 77
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4k0nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k0nA01
4ZILA 5KEJA 1OC3A 4XHMA 1J9BA 4IJ3A 3IA1A 4JU5A 4POMA 5B8AA 4IKHA 4BA7A 4KNDA 5A5KA 3LSZA 4ZL9A 4O5RA 5DAKA 3CXGA 4KSMA 2JU5A 3L0HA 4EXJA 3M8NA 2CVBA 4ZB9A 5ELAA 1EV4A 3WT2A 1FG4A 4D73A 2FY6A 3R3EA 5ECPB 5D93A 2BJXA 3ME8A 1TW9A 2V6OA 3QCPA 1OE7A 3ED3A 3EMXA 3GN3A 2YZHA 1VRSD 1O85A 4F9ZA 5EY6A 2LRNA 1T7PB 3H4KA 1KTEA 5G5EA 3GSSA 2LRCA 3TKQA 4QQ7A 3TJFA 2LKUA 3UIWA 3ZIVA 4GXZA 1QQ2A 2JZSA 4JEDA 1SK1A 1ERVA 5ECIB 1SL2B 1HNAA 5ECNB 1DE1A 3CSIA 4LMWA 1YKAA 4ILFA 1GSDA 4KDXA 1JLVA 5ECRB 1XVQA 2WFCA 4GCIA 1X9WB 4OO5A 1M9AA 1FO5A 1T1VA 3US3A 1C72A 2JADA 2HZFA 4HQSA 3GKMA 14GSA 3F63A 5H5SA 1ZMAA 1A24A 4G19A 4KCEA 1PKWA 3VPTA 1OKTA 1K0OA 3L78A 3IBHA 2CAQA 5ECOB 2AUVA 1WRYA 5INYA 3EU3A 4O32A 1CQGA 4EDYA 2YN1A 3GUSA 2OBIA 1YKCA 3DKSA 2H75A 5DDLA 2DIZA 1SKWB 2PWJA 2EC4A 4I2UA 4K7OA 4N0VA 3KJYA 1V2AA 1SU9A 5KN1A 2IWTA 3P90A 4BL7A 2V41A 4K9ZA 2AHEA 3FR9A 3D4TA 2H71A 4I5QA 2G0FA 3FZ9A 1K0CA 2FWFA 2F51A 3LQ7A 1T4YA 3BJ5A 4HZ4A 2OADA 3GV1A 4MCUA 3TOUA 5DJMA 4RI7A 1MTCA 2DMMA 4DSSA 5CAXA 2A2RA 1EP7A 4DVCA 4GRFA 1GSUA 1X9MB 19GSA 1M7TA 2HRFA 1SKRB 2L5OA 4HEA2 3APOA 5B8BA 2CA8A 5G1LA 3CBUA 5CNWA 2LSTA 3TB2A 3TRXA 5AN1A 1OC9B 1GSFA 3FZ5A 3QAVA 1GLPA 5EPFA 2QC7A 1PQNA 3VWXA 1URMA 5EVOA 1HD2A 1XFLA 2A4VA 5F0GA 3ZLPA 3TJJA 3ZL5A 3I43A 4KSOA 3TJGA 5IOWA 2NTOA 2H1DA 2XPDA 2LRTA 1SYXA 5E4WA 1A0FA 1J0FA 1WJKA 1MEKA 1ERTA 1XWBA 1K0DA 3ZRDA 4KDYA 3HY2A 5IMAA 5IO0A 1U6TA 1ERUA 6GSVA 4FYUA 4MJBA 2C0GA 3CMIA 2WRTA 1HNCA 5AGYA 3UEMA 4N11A 3ZREA 5LNKe 3GL5A 3D0ZA 1ZYQB 4L0UA 3P8WA 3O3TA 2FLSA 2GT6A 1BEDA 2REMA 3QAGA 1F3BA 1GUMA 4Q5NA 3FW2A 3GH9A 4J57E 3CTFA 1ZOFA 4ZBBA 3F6DA 4Q5QA 2VUPA 4ULXA 4MA9A 3DEXA 3GNJA 3LXTA 4KE3A 3LEFA 2RM5A 5F8BA 4JBBA 3A2WA 3VLNA 4ZIJA 2H73A 4IP1A 5DAKB 4PNFA 1QK8A 5DCGA 1GSYA 5BMUA 1ERWA 4D73B 1UA5A 1S3AA 5IPGA 5GAND 4L5LA 2RUFA 2HQTA 4KB3A 1EV9A 2FWEA 4KX4A 4XS1A 3TUEA 4K2DA 4MZBA 4JE1A 4V1Ap 1B8XA 1TOFA 5HR1A 5J3RA 4K7IA 5CP1A 3Q18A 2K8SA 2LQQA 3HDCA 3TRPA 2C0FA 1KNGA 4IHUA 1GH2A 2VCVA 1M2DA 1O8XA 4G0KA 3E9JB 1MD4A 2XBIA 3Q6OA 3UVTA 1XIYA 4ID0A 5JCGA 3U6VA 4WF5A 1X0RA 2CV4A 1ABAA 4GSNA 3UARA 2YWNA 1OAZA 1GTIA 2GTUA 2H6XA 2H01A 2JZTA 5G31A 4O7HA 1HQOA 4Q5FA 3VK9A 2VD1A 3V1WA 1WMJA 4PQIA 4MPFA 1AC1A 1TP9A 4GQFA 1U87A 2JSZA 4TRXA 5B6NA 5COHA 5JWQB 2VL2C 3F4RA 4IJIA 1U3IA 3Q74A 2NPBA 5J9CA 2I4AA 3FEUA 1MDJA 2B5YA 1LBKA 2HT9A 1PSQA 5H5RA 1PL2A 4YAPA 4CW9A 2JL4A 1TRVA 4PUFC 1FB6A 3IC8A 3ZFBA 4LL1B 4BL7B 1GUKA 2VLTA 1JLWA 2YWOA 5IQYA 4BVYB 1KBNA 3QFAC 2HXKA 2L6DA 3RHCA 3F6FA 2OE3A 3GH6A 3E0UA 5DBQA 3W8JA 1FVKA 4DSSB 2GSQA 4KAEA 1GSSA 2HZEA 3HZ4A 1YQ1A 2OE0A 5AIVA 2O7KA 3QFBC 2ON5A 4WF4A 3L9UA 2J9HA 1SYRA 2H0HA 1GNEA 3H93A 3IXRA 5JCUA 1EOGA 1GLQA 4IW9A 4XIHA 1I5GA 4FYBA 3UBLA 2I1UA 2K8VA 2N5FA 3G7JA 3NOFA 1TK0B 4PUAA 3WGDA 4DSRA 3TOTA 2CX3A 5GSSA 4WXTA 4NAXA 12GSA 3DVWA 3KEBA 5DVBA 1CQHA 2IFQA 1TRUA 5ECKB 1EP8A 2FA8A 4OFNA 3IPZA 5IM9A 4X0XA 2PUKC 5ECHB 2E7PA 5JWOB 1XCCA 1VF3A 2HNLA 2DJ2A 1M0UA 4KH7A 4K7NA 3KH9A 4OO4A 1GRXA 1F6MC 1HNBA 3KH7A 2DBCA 2H70A 5JCWA 1PX7A 4V2MA 2GDRA 1B4QA 4MH3A 4NHZA 3QMXA 1XOBA 2LJRA 4ZB8A 3HA9A 4J2FA 1G7OA 3GL3A 1YJ6A 2CVKA 1QUWA 3D22A 3M9KA 4ZL8A 2R5GA 4IBPA 1N2AA 2GQLA 4MJCA 4I6XA 2VCXA 3LORA 3WGEA 3FR3A 3KGKA 1KEBA 5ECSA 4IS0A 3LXZA 3D4MA 3LG6A 5J9BA 3G7IA 1GTBA 3CTGA 2CZ3A 2L5LA 18GSA 1X5DA 1W89A 4PX1A 2B1LA 4MJAA 1TKDB 1QXHA 5G30A 4FO5A 3C8EA 3FYGA 1K0MA 2H19A 4CDOA 2H1GA 3EU4A 3ISOA 2YWMA 3TKSC 4JR4A 2GSTA 2HLSA 5IO2A 1Z3EA 3ERWA 2LJAA 4XRDA 3TKSA 4MH2A 1MD3A 3F4SA 2HRNA 2C80A 2V6KA 3IHQA 5F05A 2O8VB 3IAM2 2NDOA 3DXBA 1TJDA 4NWYA 4NV5A 3C7MA 3RPNA 1OVNA 4AJ7A 4EO3A 2EIRA 3IRAA 3PGTA 3ZMLA 4ZL7A 2GZPA 2K18A 3I69A 1XXUA 4TKYA 1JFUA 3KTBA 2WS2A 1WIKA 4KW6A 1PD21 2VCZA 1IYHA 3VI7A 4QL7A 1ZGNA 1TU7A 2RUEA 1PX6A 3RHBA 4MABA 5LD0A 2I9HA 1K3YA 3N9JA 3WGXA 2D2ZA 2HRKA 4F0BA 3BD2A 4RUVA 4NV2A 5B7CA 4J56E 3GFKA 3P7XA 4KF9A 2HRAA 2IMEA 3CSJA 2JACA 3ZITA 4PTSA 2YOIA 3UJ1A 2GZZA 2H0GA 2M80A 1QFNA 4TR3A 1OC8A 3PINA 1RK4A 3UBKA 3LYPA 10GSA 2VCTA 1IYIA 2DJ3A 3ZYWA 3S9FA 3KMNA 2LQOA 2X64A 4PQHA 3VWVA 1JZRA 5ECLB 2VCQA 4GSSA 1K0BA 3HYPA 2HZEB 5DALA 4Z7XA 4GSTA 1Q98A 2V1MA 2GLRA 3NIVA 2C4JA 4LL4B 1YF0A 3F8UA 1TDIA 1OYJA 3IC4A 3ZZXA 1K3OA 4MZCA 5D73A 4ZXGA 5HR2A 3L9SA 4XTSA 2NVLA 6GSUA 2LNSA 2R6KA 4TVEA 1JZDA 1XVWA 1R5PA 5IMCA 4BPYA 2YCDA 4I8BA 5GZZB 3EC3A 5GAPD 2F3MA 3ERGA 3FK8A 1N8JA 4TW5A 1AAZA 1F9MA 3LJRA 1XWAA 2HFDA 4GWRA 3IAS2 4PNGA 2MMZA 2AB6A 4JR6A 4POBA 2PMTA 1O7UA 3UMAA 4ZB6A 3VPQA 2TIRA 4YH2A 3CRTA 3GSTA 3VI5A 4TXOA 2MBSA 4ECIA 1THOA 2P5RA 4FIWA 1FVJA 2J23A 2MBTA 1UVZA 1Z6MA 4OFTA 1GP1A 2PERA 2CQ9A 4IELA 1SJ6A 1EEMA 2TRCP 2RIIA 2MMOA 3I6AA 3IE3A 5ELGA 2O89A 1DBYA 4TOPA 3GURA 2H6ZA 1M2AA 4EDZA 3RAZA 1XW6A 1TU8A 2IPAA 2GGTA 1FW1A 4V1Ag 1VF4A 2QGVA 3AY8A 2OA7A 1F2EA 3EYTA 1BJXA 4HJ2A 1JZWA 1Z9HA 2H72A 2IJYA 1ML6A 3M3MA 4MJEA 5ID2A 5D9XA 2I3YA 2VM1A 3KD0A 2IMDA 1ST9A 5CRDA 3TDGA 4RQXA 3DWVA 2HI7A 4HU9A 16GSA 3O76A 3BBYA 2KP2A 5D9WA 3G9BA 3BCIA 1EZKA 1NM3A 3ME7A 2FHEA 1Y25A 4TXVA 3CRUA 3HHVA 1EOHA 3C73A 1T3BA 3R2QA 2R3XA 2ALBA 3A5WA 3VFIA 1SD8A 1XWKA 3GA4A 4I97A 2VIMA 4PXOA 5HFGA 3RPPA 3ZTLA 5J41A 1VGLA 3QD9A 5AIXA 4MDCA 1ACVA 2EIOA 2PVQA 2O87A 3WD6A 1PL1A 1LU4A 1R4WA 1SJZA 2X8HA 4X43A 1WOUA 3DMLA 3TCOA 3TKSE 1K3LA 4YQVA 3HZ8A 4GQCA 2GSSA 4HOJA 1O73A 1TRWA 2KP1A 4NPBA 2YJ7A 8GSSA 4MF7A 3N5OA 3WT1A 1Y6EA 3EE2A 4POKA 2OKAA 4YQUA 5DCHA 4HJMA 4LA1A 1B4PA 2YWIA 4V2NA 2X8GA 5HFKA 4OD7A 2OBKA 1O8WA 2HSMA 4POLA 4TN8A 1G6WA 2L57A 4X1UA 2P31A 2VL2A 5H5QA 1AQWA 3L9VA 2GT5A 2L6CA 1OKDA 3IOSA 2KLXA 2WULA 2LS5A 1E2YA 5FHIA 2O85A 3LWAA 5DALB 2P0GA 1SJIA 3DVXA 2RLIA 4N10A 4MF6A 3TKPA 1GULA 2YP6A 3Q19A 3BOAA 2IMFA 1TI1A 2HSNB 3ZMKA 3D6IA 2PGTA 4F0CA 4XS4A 3HKRA 3APQA 4CHSA 1THXA 4E8EA 1YY7A 1YF1A 1NHOA 1FHEA 5F07A 2TRXA 1NSWA 1USBA 2CAIA 1XW5A 2XC2A 4OCEA 2B6MA 1XW9A 4BVXA 3EVIA 3ZIJA 1O6JA 2YJHA 2MMAA 4IVFA 4NHWA 4WBRD 3KP9A 2GZYA 2CVDA 4WBJA 1A0RP 2LJKA 3UAPA 1S3CA 4ML6A 4EUYA 5HR3A 1BAYA 1PMTA 4WR4A 5HFIA 3ZVJA 1DUGA 4TXOB 1AQXA 1G0TA 3F4TA 1EGRA 4WKWA 2E2MA 3VWUA 1DSBA 1Z5YE 2PVOC 3IR4A 1G6YA 1M2BA 2VL9A 6GSTA 11GSA 1GTAA 2H1BA 2VLVA 3F3RA 1AQVA 2YV9A 2C0EA 4ECBA 2BTOT 2MMNA 1BX9A 1AXDA 3RBTA 2RM6A 5KN3A 4MP4A 2YNXA 1GNWA 1PGTA 5FWGA 3EMPA 2H76A 4XS6A 3MAKA 1ZYEA 4YAVA 2H74A 2LV3A 2DIYA 4JRRA 3DIEA 3KMOA 5IMDA 2X8CA 2C3NA 2WJUA 2DMLA 5J5NA 4HDEA 4WEYA 3J7Yk 3TGZA 2ZUPA 1B48A 2H30A 1B9YC 2CX4A 2N5BA 3CSHA 1BG5A 3A2VA 5A4VA 3MNGA 4GTUA 2L4QA 2B5XA 3D5JA 2CT6A 2I81A 1GTUA 5ECMB 7GSSA 4TR1A 2FUG2 1Q4JA 3F3QA 2LEGA 1K0NA 3PH9A 4OMVA 2LNTA 3IV4A 4N30A 1T8EB 1XZOA 3VWWA 3LYKA 4NXIA 5D96A 1EWXA 1ZCPA 1U88A 1NHYA 2IL3A 1Z7RA 5FT3A 1ILOA 3M9JA 4ZBDA 1QMVA 2ON7A 2NBSA 3PR8A 4MMMA 3GKNA 2M46A 2F8AA 1FOVA 2AYTA 3FR6A 3ZFLA 3HJPA 3M0FA 3HXSA 1HYUA 4AJ6A 4G10A 4HUAA 4IQAA 2AJQB 2G2QA 3MWHA 5G2ZA 2XBQA 4HS1A 4H86A 4ECCA 4KUNA 3A3TA 3GIXA 2IIYA 1RQMA 4K6XA 3GHAA 2HSMB 2YPMA 1V40A 2JZRA 13GSA 4EVMA 5IIZA 1BQ7A 2DSAA 2IMIA 1MDIA 4K0GA 5A4WA 3F9UA 3PPUA 5B6MA 3DYRA 4TR4A 3W8SA 5CRGA 2FNOA 4PGTA 4ECJA 4MPGA 4OCFA 4OFMA 4WETA 1SK2A 3VURA 2B7KA 1YEXA 2ZCTA 5DQSA 1PN9A 3SWLA 5EL8A 1DE2A 3GTUA 4XS4B 1XWCA 5C00A 3DRNA 3WYWA 1WWJA 1SKSB 5ABRA 1SL1B 4OWYA 2HE3A 2IMKA 5DJLA 3TRQA 4IGJA 1A2JA 6GSSA 3NZNA 2JSYA 1EEJA 1J08A 4BVXB 2C8UA 1PA3A 1T4ZA 1UN2A 1H4OA 5KN2A 1QGVA 3K8NA 3TJBA 3ERFA 1LJRA 1OE8A 4BVYA 3HCZA 3L4NA 3KCMA 5D8IA 4V2LA 1T00A 2IFQB 3KM6A 4K8MA 1TTZA 4MLYA 3HJMA 4HU7A 4IP6A 4NMUA 3SBCA 3GX8A 3UOMA 2V32A 5IMVA 3IDVA 5CREA 3OR5A 4HZ2A 1XWGA 3FZ4A 5CYYA 4RI6A 4FYCA 3HVXA 3ZVJD 2FCHA 4E8HA 4G2EA 3DGQA 4GF0A 2HSHA 3GKKA 4HQZA 20GSA 2PPTA 4G0LA 1SK0A 1K0AA 4MZWA 4YQMA 5IMZA 2AV4A 2H6YA 2WB9A 4K0NA 3I9V2 5IOXA 2B5EA 5LCZA 1UC7A 2LUSA 4BWQA 2PU9C 2C3QA 3E3EA 2C0DA 1Z6NA 1VF2A 5G1KA 2FGXA 2L4CA 2R37A 1XBSA 2PN8A 3W6GA 1WP0A 3QAWA 2F9SA 2DJKA 4L8EA 2GSRA 3GX0A 1ON4A 1R7HA 4BWSA 5D9TA 2N5AA 3RDWA 4KDUA 1AUCA 1YZXA 3LFLA 1B9XC 2X99A 3GYKA 4P3YB 3C1RA 1YDKA 4EE0A 5C04A 4ML1A 2B7JA 4TR1B 1W4VA 2ES7A 4AF2A 3KXOA 2WZ9A 2HYXA 3KZQA 3QR6A 2LTKA 4JZQA 3G7YA 3P2AA 2A2SA 3QDNA 4N0ZA 3O6TA 2H66A 2VD0A 1SD9A 1AW9A 1V57A 4IQ1A 2YZUA 2K6VA 5DQYA 1PKZA 4IN0A 5GSTA 1SENA 3BCKA 3GMFA 2QSIA 2DC5A 1Z7PA 3EINA 17GSA 6GSWA 3GKXA 3KP8A 1H75A 2GS3A 2M72A 4USSA 5J4UA 1TK5B 3EURA 2DLXA 1NW2A 1YEPA 9GSSA 1GUHA 1X5CA 1JHBA 2FD3A 2VO4A 4PQ1A 4LMVA 4G0IA 4QL9A 2FA4A 3HVSA 1ZL9A 1A8LA 5HR0A 2EIQA 1E6BA 4KGIA 2HRKB 2E2GA 2XPEA 3MSZA 2VL3A 4ACSA 2FWHA 3U5RE 4G9HA 2B3SA 2DJ0A 1AIUA 3GRXA 5ECQB 1BYEA 2B1KA 2VAFA 2VCWA 2GQMA 3EWLA 3UL3A 1X9SB 4EL1A 6GSYA 3JCML 2Z9SA 2V2GA 1TK8B 3FKFA 2MZCA 1F37A 2MYGA 4L5OA 4MF5A 3HD5A 2P5QA 4LLRA 3KIJA 2L59A 2VOCA 3C71A 2XHFA 3GTUB 2C3TA 1SL0B 1EGOA 4EC0A 3A2XA 4F82A 2DJJA 2VM2A 4TR0A 1PRXA 3H79A 2C1YA 2GQKA 1XPVA 5KN0A 1A2MA 5CRWA 3HJOA 22GSA 4I2TA 2CZ2A 5E59A 2GVPA 4K1FA 3FHKA 3M1GA 3TJKA 2YV7A 2H1AA 5ENUA 2WDUA 2E0QA 2OACA 5D9VA 1MDKA 3IK9A 2BMXA 2OE1A 2UZ8A 3FRCA 1U3AA 2HSYA 4DSQA 4RQRA 2WGRA 5A4UA 4HI7A 1FB0A 1I9DA 2H8LA 1ZZYA 2H0IA 3HVVA 4F03A 1FAAA 1TRSA 4GLTA 1WPIA 5IPHA 5AISA 1O81A 1A23A 1GSQA 1GL8A 2F8FA 1S3DA 1V58A 1TI3A 1A8YA 2KUCA 4EKZA 4ZBAA 2ZNMA 1GWCA 4KA0A 2PBJA 5CO3A 4ISDA 5L71A 1TXXA 1G7EA 5IMFA 1V98A 3TKRA 4WR5A 3KTLA 5HQPA 1M99A 1GSEA 4AGSA 1OC9A 2IN3A 3QPMA 1X5EA 2VLUA 3IK7A 2DJ1A 3C1SA 5CRHA 3J7Yb 4KCAA 3DD3A 2K9FA 3H1NA 2R2JA 4XRAA 5G5FA 2AAWA 3FY7A 4Q5RA 3APSA 1A2LA 5JWRB 3D21A 4XCSA 1R5AA 1VF1A 1JZOA 3MDKA 1WE0A 1R26A 1XOAA 2WCIA 6GSXA 4PURA 5ID2B 2QKEA 4DEJA 4FH8A 4FQUA 2KOKA 4AJ8A 4F2IA 3UVHA 3FZAA 4EF0A 3LGCA 2FWGA 1F3AA 3QOUA 4L0WA 2KHPA 3F0IA 3H8QA 1M9BA 5F06A 1V9WA 2R4VA 3CYNA 4O92A 2YANA 2OJLA 4MK3A 1RW1A
chains in the Genus database with same CATH superfamily
4ZILA 5KEJA 2X4AA 1OC3A 4XHMA 1J9BA 4IJ3A 3IA1A 4JU5A 4POMA 5B8AA 4IKHA 4BA7A 4KNDA 5A5KA 1ZYNA 3LSZA 4ZL9A 4O5RA 5DAKA 3CXGA 4KSMA 2JU5A 3L0HA 4EXJA 3M8NA 2CVBA 4ZB9A 5ELAA 1EV4A 1TXUA 3WT2A 1FG4A 4D73A 2FY6A 3R3EA 5ECPB 5D93A 4MNNA 2BJXA 3ME8A 1TW9A 2V6OA 3QCPA 1OE7A 3ED3A 3EMXA 3GN3A 2YZHA 1VRSD 1O85A 4F9ZA 5EY6A 2O3EA 2LRNA 1T7PB 3H4KA 1KTEA 2EFCA 5G5EA 3GSSA 2LRCA 3TKQA 4QQ7A 3TJFA 2LKUA 3UIWA 3ZIVA 4GXZA 1QQ2A 2JZSA 4JEDA 1SK1A 1ERVA 5ECIB 1SL2B 1HNAA 4A5PA 5ECNB 1DE1A 4Z2RA 3CSIA 4LMWA 1YKAA 4ILFA 1GSDA 4KDXA 1JLVA 5ECRB 1XVQA 2WFCA 4GCIA 1X9WB 4OO5A 1M9AA 3MYDA 1FO5A 1T1VA 3US3A 1C72A 2JADA 2HZFA 4HQSA 3GKMA 14GSA 3F63A 3EPTA 5H5SA 1ZMAA 1A24A 4G19A 4KCEA 1PKWA 3VPTA 1OKTA 1K0OA 3L78A 3IBHA 2CAQA 2O36A 5ECOB 2AUVA 1WRYA 5INYA 3EU3A 4O32A 1CQGA 4EDYA 2YN1A 3GUSA 2OBIA 1YKCA 2WW0A 3DKSA 2H75A 5DDLA 2DIZA 1SKWB 2PWJA 2EC4A 4I2UA 4K7OA 4N0VA 3KJYA 1V2AA 1SU9A 5KN1A 2IWTA 3P90A 4BL7A 2V41A 4K9ZA 2AHEA 2WVZA 3FR9A 3D4TA 5A1NB 2H71A 4I5QA 2G0FA 3FZ9A 1K0CA 2FWFA 2F51A 4BIKA 2HSNA 3LQ7A 1T4YA 3BJ5A 4HZ4A 2OADA 3GV1A 4MCUA 3TOUA 5DJMA 4RI7A 1MTCA 2DMMA 4DSSA 5CAXA 2A2RA 1EP7A 4DVCA 4GRFA 1GSUA 1X9MB 19GSA 1M7TA 1SVLA 2HRFA 1SKRB 2L5OA 4HEA2 3APOA 5B8BA 2CA8A 5G1LA 3CBUA 5CNWA 2LSTA 3TB2A 3TRXA 5AN1A 1OC9B 1GSFA 2X49A 3FZ5A 3QAVA 1GLPA 3HVNA 5EPFA 2QC7A 1PQNA 3VWXA 1URMA 5EVOA 1HD2A 1XFLA 2A4VA 2WZSA 5F0GA 3ZLPA 3TJJA 3ZL5A 3I43A 4KSOA 3TJGA 5IOWA 2NTOA 2H1DA 2XPDA 2LRTA 1SYXA 5E4WA 1A0FA 1J0FA 1WJKA 1MEKA 1ERTA 1XWBA 2EFEA 1K0DA 3ZRDA 4KDYA 3HY2A 3LW9A 5IMAA 5IO0A 1U6TA 1I1IP 1ERUA 6GSVA 4FYUA 4MJBA 2C0GA 3CMIA 2WRTA 1HNCA 5AGYA 3UEMA 4N11A 3ZREA 5LNKe 3GL5A 3D0ZA 1ZYQB 4L0UA 3P8WA 3O3TA 2FLSA 2GT6A 1BEDA 2REMA 3QAGA 1F3BA 1GUMA 4Q5NA 3FW2A 3GH9A 4J57E 3CTFA 1ZOFA 4ZBBA 3F6DA 4Q5QA 2VUPA 4ULXA 4MA9A 3DEXA 3GNJA 3LXTA 4KE3A 3LEFA 2RM5A 5F8BA 4JBBA 3A2WA 3VLNA 4ZIJA 2H73A 4IP1A 5DAKB 4PNFA 1QK8A 5DCGA 1GSYA 5BMUA 1ERWA 4D73B 1UA5A 1S3AA 5IPGA 5GAND 4L5LA 2RUFA 2HQTA 4KB3A 1EV9A 2FWEA 4KX4A 4XS1A 3TUEA 4K2DA 4MZBA 4JE1A 4V1Ap 1B8XA 1TOFA 3IHGA 5HR1A 5J3RA 4K7IA 5CP1A 3Q18A 2K8SA 2LQQA 3HDCA 3TRPA 2C0FA 1KNGA 4IHUA 1GH2A 2VCVA 1M2DA 1O8XA 4G01A 4G0KA 3E9JB 1MD4A 2XBIA 3Q6OA 3UVTA 1XIYA 4ID0A 5JCGA 3U6VA 4WF5A 1X0RA 2CV4A 1ABAA 4GSNA 3UARA 2YWNA 1OAZA 1GTIA 2GTUA 2H6XA 2H01A 2JZTA 5G31A 4O7HA 1HQOA 2R0GA 4Q5FA 3VK9A 2VD1A 3V1WA 1WMJA 4PQIA 4ICYA 4MPFA 1AC1A 1TP9A 4GQFA 1U87A 2JSZA 4TRXA 5B6NA 4QMKA 5COHA 5JWQB 1YVLA 2VL2C 3F4RA 4IJIA 1U3IA 3Q74A 2NPBA 5J9CA 2I4AA 3FEUA 1MDJA 2B5YA 1LBKA 2HT9A 1PSQA 5H5RA 1PL2A 4YAPA 4CW9A 2JL4A 1TRVA 4PUFC 1FB6A 3IC8A 3ZFBA 4LL1B 4BL7B 2WW1A 1GUKA 2VLTA 1JLWA 2YWOA 5IQYA 4BVYB 1KBNA 3QFAC 2HXKA 2L6DA 3RHCA 3F6FA 2OE3A 4O5QA 3GH6A 3E0UA 5DBQA 3W8JA 1FVKA 4DSSB 2GSQA 4KAEA 1GSSA 2HZEA 3HZ4A 1YQ1A 2OE0A 5AIVA 2O7KA 3QFBC 2ON5A 4WF4A 3L9UA 2J9HA 1SYRA 2H0HA 1GNEA 3H93A 5A34A 3IXRA 5JCUA 1EOGA 1GLQA 4IW9A 4XIHA 1I5GA 4FYBA 3UBLA 2I1UA 2K8VA 2N5FA 3G7JA 1SVMA 3NOFA 1TK0B 4PUAA 3WGDA 4DSRA 3TOTA 2CX3A 5GSSA 4WXTA 4NAXA 12GSA 3DVWA 3KEBA 4YKFA 5DVBA 1CQHA 2IFQA 1TRUA 5ECKB 1EP8A 2FA8A 4OFNA 3IPZA 5IM9A 4X0XA 2PUKC 5ECHB 2E7PA 5JWOB 1XCCA 1VF3A 4O5UA 2HNLA 2DJ2A 1M0UA 4KH7A 4K7NA 3KH9A 4OO4A 1GRXA 1F6MC 1HNBA 3KH7A 1M3IA 2DBCA 2H70A 2VKZG 5JCWA 1PX7A 1BF5A 4V2MA 2GDRA 1B4QA 4MH3A 4NHZA 3QMXA 1XOBA 2LJRA 4ZB8A 3HA9A 4J2FA 1G7OA 4GDFA 3GL3A 1YJ6A 4K5SA 2CVKA 1QUWA 3D22A 3M9KA 4ZL8A 2R5GA 4IBPA 1N2AA 2GQLA 4MJCA 4I6XA 4PHZC 2VCXA 3LORA 4EIPA 3WGEA 3FR3A 3KGKA 1KEBA 5ECSA 4IS0A 3LXZA 3D4MA 3LG6A 5J9BA 3G7IA 1GTBA 3CTGA 2CZ3A 2L5LA 18GSA 3TU3B 5BMUB 1X5DA 2QA1A 1W89A 4PX1A 2B1LA 4MJAA 1TKDB 1QXHA 5G30A 4FO5A 3C8EA 3FYGA 1K0MA 2H19A 4CDOA 2H1GA 2UV8G 3EU4A 3ISOA 2YWMA 3TKSC 4JR4A 2GSTA 2HLSA 5IO2A 1Z3EA 3ERWA 2LJAA 1S4BP 4XRDA 3TKSA 4MH2A 1MD3A 4FXYP 3F4SA 2HRNA 2C80A 2V6KA 3IHQA 5F05A 2O8VB 3IAM2 2NDOA 3DXBA 1TJDA 4NWYA 4NV5A 3C7MA 3RPNA 1OVNA 4AJ7A 4EO3A 2EIRA 3IRAA 3PGTA 3ZMLA 4ZL7A 2GZPA 2K18A 3I69A 1XXUA 3CQFA 4TKYA 1JFUA 3KTBA 2WS2A 1WIKA 4KW6A 1PD21 2VCZA 1IYHA 3VI7A 4QL7A 1ZGNA 1TU7A 2DKIA 5A5HA 2RUEA 1PX6A 3RHBA 2WVXA 4MABA 5LD0A 2I9HA 1K3YA 3N9JA 3WGXA 2D2ZA 2HRKA 4F0BA 3BD2A 4RUVA 1ZYPA 4NV2A 5B7CA 4J56E 3GFKA 3P7XA 4KF9A 2HRAA 2IMEA 3CSJA 2JACA 3ZITA 4PTSA 2YOIA 3UJ1A 2GZZA 2H0GA 2M80A 1QFNA 4TR3A 1OC8A 3PINA 1RK4A 3UBKA 3LYPA 10GSA 2VCTA 1IYIA 2DJ3A 4E68A 3ZYWA 3S9FA 3KMNA 2LQOA 2X64A 4PQHA 3VWVA 3CWGA 1JZRA 5ECLB 2VCQA 4GSSA 4AI6A 1K0BA 3HYPA 2HZEB 5DALA 4Z7XA 4GSTA 1Q98A 2V1MA 2GLRA 3NIVA 3CHXC 2C4JA 4LL4B 1YF0A 3F8UA 1TDIA 1OYJA 3IC4A 5A34B 3ZZXA 1K3OA 4MZCA 5D73A 4ZXGA 5HR2A 3L9SA 4XTSA 2NVLA 6GSUA 2LNSA 2R6KA 4TVEA 1JZDA 1XVWA 1R5PA 5IMCA 4BPYA 4AKHA 2YCDA 4I8BA 5GZZB 3EC3A 5GAPD 2F3MA 3ERGA 3FK8A 1N8JA 4TW5A 1AAZA 1F9MA 3LJRA 1XWAA 2HFDA 4GWRA 3IAS2 4PNGA 2MMZA 2AB6A 4JR6A 4POBA 2PMTA 1O7UA 3UMAA 4ZB6A 3VPQA 2TIRA 4YH2A 3CRTA 3GSTA 3VI5A 4TXOA 2MBSA 4ECIA 1THOA 5KOWA 2P5RA 4FIWA 1FVJA 2J23A 2MBTA 1UVZA 1Z6MA 4OFTA 1GP1A 2PERA 2CQ9A 4IELA 1SJ6A 3MIXA 1EEMA 2TRCP 2RIIA 2MMOA 3I6AA 3IE3A 5ELGA 2O89A 1BG1A 1DBYA 4TOPA 3GURA 2H6ZA 1M2AA 4EDZA 3RAZA 1XW6A 1TU8A 2IPAA 2GGTA 1FW1A 4V1Ag 1VF4A 2QGVA 3AY8A 2OA7A 1F2EA 3EYTA 1BJXA 4HJ2A 1JZWA 1Z9HA 2H72A 2IJYA 1ML6A 3M3MA 4MJEA 5ID2A 5D9XA 2I3YA 2VM1A 3KD0A 2IMDA 1ST9A 5CRDA 3TDGA 4RQXA 3DWVA 2HI7A 4HU9A 16GSA 3O76A 3BBYA 2KP2A 5D9WA 3G9BA 3BCIA 1EZKA 1NM3A 3ME7A 2FHEA 1Y25A 4TXVA 3CRUA 3HHVA 1EOHA 3C73A 1T3BA 3R2QA 2R3XA 2ALBA 3A5WA 3VFIA 1SD8A 1XWKA 3GA4A 4I97A 2VIMA 4PXOA 5HFGA 5J4YA 3RPPA 3ZTLA 5J41A 1VGLA 3QD9A 5AIXA 4MDCA 1ACVA 2EIOA 2PVQA 2O87A 3WD6A 1PL1A 1LU4A 1R4WA 1SJZA 2X8HA 4X43A 1WOUA 3DMLA 3TCOA 4PI0C 3TKSE 1K3LA 5A5HB 4YQVA 3HZ8A 4GQCA 2WVXB 2GSSA 4HOJA 1O73A 1TRWA 2KP1A 4NPBA 2YJ7A 8GSSA 4MF7A 3N5OA 3WT1A 1Y6EA 3EE2A 4POKA 2OKAA 4YQUA 4HSCX 5DCHA 4HJMA 4LA1A 1B4PA 2YWIA 4V2NA 2X8GA 5HFKA 4OD7A 2OBKA 1O8WA 2HSMA 4POLA 4TN8A 1G6WA 2L57A 4X1UA 2P31A 2VL2A 5H5QA 1AQWA 3L9VA 2GT5A 2L6CA 1OKDA 3IOSA 5KOXA 2KLXA 2WULA 2LS5A 1E2YA 5FHIA 2O85A 3LWAA 5DALB 2P0GA 1SJIA 3DVXA 5J40A 2RLIA 4N10A 4MF6A 3TKPA 1GULA 2YP6A 3Q19A 3BOAA 2IMFA 1TI1A 2HSNB 3ZMKA 3D6IA 2PGTA 4F0CA 4XS4A 3HKRA 3APQA 2WW2A 4CHSA 1THXA 4E8EA 1YY7A 1YF1A 1NHOA 1FHEA 5F07A 2TRXA 1NSWA 1USBA 2CAIA 1XW5A 2XC2A 4OCEA 2B6MA 1XW9A 4BVXA 3EVIA 3ZIJA 1O6JA 2YJHA 2MMAA 4IVFA 4NHWA 4WBRD 3KP9A 2GZYA 2CVDA 5A1NA 4WBJA 1A0RP 2LJKA 3UAPA 1S3CA 4ML6A 4EUYA 5HR3A 1BAYA 1PMTA 4WR4A 3RGBC 5HFIA 3ZVJA 1DUGA 4TXOB 1AQXA 1G0TA 3F4TA 1EGRA 4WKWA 2E2MA 3VWUA 1DSBA 1Z5YE 2PVOC 3IR4A 1G6YA 1M2BA 2VL9A 6GSTA 11GSA 1GTAA 2H1BA 2VLVA 3F3RA 1AQVA 2YV9A 2C0EA 4ECBA 2BTOT 2MMNA 1BX9A 1AXDA 3RBTA 2RM6A 5KN3A 5J47A 4MP4A 2YNXA 1GNWA 1PGTA 5FWGA 3EMPA 2H76A 4XS6A 3MAKA 1ZYEA 4YAVA 2H74A 2LV3A 2DIYA 4JRRA 3DIEA 1YEWC 3KMOA 5IMDA 2X8CA 2C3NA 2WJUA 2DMLA 5J5NA 4HDEA 4WEYA 3J7Yk 3TGZA 2ZUPA 1B48A 2H30A 1B9YC 2CX4A 2N5BA 3CSHA 1BG5A 3A2VA 5A4VA 3MNGA 4GTUA 2L4QA 2B5XA 3D5JA 2CT6A 2I81A 1GTUA 5ECMB 7GSSA 4TR1A 2FUG2 1Q4JA 3F3QA 2LEGA 1K0NA 3PH9A 4OMVA 2LNTA 3IV4A 4N30A 1T8EB 1XZOA 3VWWA 3LYKA 4NXIA 5D96A 1EWXA 1ZCPA 4YKGA 1U88A 1NHYA 2IL3A 1Z7RA 5FT3A 1ILOA 3M9JA 4ZBDA 4ZB7A 2WW3A 4CY6A 1QMVA 2ON7A 2NBSA 3PR8A 4MMMA 3GKNA 2M46A 4PI2C 2F8AA 1FOVA 1Y1UA 2AYTA 2WVYA 3FR6A 3ZFLA 3HJPA 3M0FA 3HXSA 1N25A 1HYUA 4AJ6A 4G10A 4HUAA 4IQAA 2AJQB 2G2QA 3MWHA 5G2ZA 2XBQA 4HS1A 4H86A 4ECCA 4KUNA 3A3TA 3GIXA 2IIYA 1RQMA 4K6XA 3GHAA 2HSMB 2YPMA 1V40A 2R0CA 2JZRA 13GSA 4EVMA 5IIZA 1BQ7A 2DSAA 2IMIA 1MDIA 4K0GA 5A4WA 3F9UA 3PPUA 5B6MA 2O5VA 3DYRA 4TR4A 3W8SA 5CRGA 2FNOA 4PGTA 4ECJA 4MPGA 4OCFA 4OFMA 4WETA 1SK2A 3VURA 2B7KA 1YEXA 2ZCTA 5DQSA 1PN9A 2QA2A 3SWLA 5EL8A 1DE2A 3GTUA 4XS4B 1XWCA 3HMJG 2R0PA 5C00A 3DRNA 3WYWA 1WWJA 1SKSB 5ABRA 1SL1B 4OWYA 2HE3A 2IMKA 5DJLA 3TRQA 4IGJA 1A2JA 6GSSA 3NZNA 4AKIA 2JSYA 1EEJA 1J08A 4BVXB 2C8UA 1PA3A 1T4ZA 1UN2A 1H4OA 1SVOA 1QGVA 5KN2A 3K8NA 4AKGA 3TJBA 3ERFA 1LJRA 1OE8A 4BVYA 3HCZA 3L4NA 3KCMA 5D8IA 4V2LA 1T00A 2IFQB 3KM6A 4K8MA 1TTZA 4MLYA 3HJMA 4HU7A 4IP6A 4NMUA 2EFHA 3SBCA 3GX8A 3UOMA 2V32A 5IMVA 3IDVA 5CREA 3OR5A 4HZ2A 1XWGA 3FZ4A 5CYYA 4RI6A 4FYCA 3HVXA 3ZVJD 4Z2UA 2FCHA 4E8HA 4G2EA 3DGQA 4GF0A 2HSHA 3GKKA 4AKXB 4HQZA 20GSA 2PPTA 4G0LA 1SK0A 1K0AA 4MZWA 4YQMA 5IMZA 2AV4A 2H6YA 2WB9A 4K0NA 3I9V2 5IOXA 2B5EA 5LCZA 1UC7A 2LUSA 4BWQA 2PU9C 2C3QA 3E3EA 2C0DA 1Z6NA 1VF2A 5G1KA 2FGXA 2L4CA 2R37A 1XBSA 2PN8A 3W6GA 1WP0A 3QAWA 2F9SA 2DJKA 4L8EA 2GSRA 3GX0A 1ON4A 1R7HA 4BWSA 5D9TA 2N5AA 3RDWA 4KDUA 1AUCA 1YZXA 3LFLA 1B9XC 2X99A 3GYKA 4P3YB 3C1RA 1YDKA 4EE0A 5C04A 4ML1A 2B7JA 4TR1B 1W4VA 2ES7A 4AF2A 3KXOA 2WZ9A 2HYXA 3KZQA 2A4HA 1PN0A 3QR6A 2LTKA 4JZQA 3G7YA 3P2AA 2A2SA 3QDNA 2EFDA 2DKHA 4N0ZA 3O6TA 2H66A 2VD0A 1SD9A 1AW9A 1V57A 4IQ1A 2YZUA 2K6VA 5DQYA 1PKZA 4IN0A 5GSTA 1SENA 3BCKA 3GMFA 4EIQA 2QSIA 2DC5A 1Z7PA 3EINA 17GSA 4K2XA 6GSWA 3GKXA 3KP8A 1H75A 2GS3A 2M72A 4USSA 5J4UA 1TK5B 3EURA 2DLXA 1NW2A 1YEPA 9GSSA 1GUHA 1X5CA 1JHBA 2FD3A 2VO4A 4PQ1A 4LMVA 4G0IA 4QL9A 2FA4A 3HVSA 1ZL9A 1A8LA 5HR0A 2EIQA 1E6BA 4KGIA 1PFOA 2HRKB 2E2GA 2XPEA 3MSZA 2VL3A 4ACSA 2FWHA 4K5RA 3U5RE 3FMWA 3A5IA 4G9HA 2B3SA 3GRXA 2H1LA 1AIUA 5ECQB 2DJ0A 1BYEA 2B1KA 2VAFA 2OT3A 2VCWA 2GQMA 3EWLA 3UL3A 1X9SB 4EL1A 6GSYA 3JCML 2Z9SA 2V2GA 1TK8B 3FKFA 2MZCA 1FOHA 1F37A 2MYGA 4L5OA 4MF5A 3HD5A 2P5QA 4LLRA 3KIJA 2L59A 2VOCA 5J4VA 3C71A 2XHFA 3GTUB 2C3TA 1SL0B 1EGOA 4EC0A 3A2XA 4N3ZA 4F82A 2DJJA 2VM2A 4TR0A 1PRXA 3H79A 2C1YA 2GQKA 1XPVA 5KN0A 1A2MA 5CRWA 3HJOA 22GSA 4I2TA 2CZ2A 4Z2TA 5E59A 2GVPA 4K1FA 3FHKA 2A2PA 5BRTA 3M1GA 3TJKA 2YV7A 2H1AA 4X4JA 5ENUA 2WDUA 2E0QA 2OACA 5D9VA 1MDKA 3IK9A 2BMXA 2OE1A 2UZ8A 3FRCA 1U3AA 2HSYA 4DSQA 4RQRA 2WGRA 1S3RA 5A4UA 4HI7A 1FB0A 1I9DA 2H8LA 1ZZYA 2H0IA 3HVVA 4F03A 1FAAA 1TRSA 4GLTA 1WPIA 5IPHA 5AISA 1O81A 1A23A 1GSQA 1GL8A 2F8FA 1S3DA 1V58A 1TI3A 1A8YA 2KUCA 4EKZA 4ZBAA 2ZNMA 4W66A 1GWCA 4KA0A 2PBJA 5CO3A 4ISDA 5L71A 1TXXA 1G7EA 5IMFA 1V98A 3TKRA 4WR5A 3KTLA 5HQPA 1M99A 1GSEA 4AGSA 1OC9A 2IN3A 3QPMA 1X5EA 2VLUA 3IK7A 2DJ1A 3C1SA 5CRHA 3J7Yb 4KCAA 3DD3A 2K9FA 3H1NA 2R2JA 4XRAA 5G5FA 2AAWA 3FY7A 4Q5RA 3APSA 1A2LA 5JWRB 3D21A 4XCSA 1R5AA 1VF1A 1JZOA 3MDKA 1WE0A 1R26A 1XOAA 2WCIA 6GSXA 4PURA 5ID2B 2QKEA 4DEJA 4FH8A 4FQUA 2KOKA 4AJ8A 4F2IA 3UVHA 3FZAA 4EF0A 3LGCA 2FWGA 1F3AA 3QOUA 4L0WA 3RFRC 2KHPA 3F0IA 3H8QA 1M9BA 5F06A 1XG8A 1M3JA 1V9WA 2R4VA 3CYNA 4O92A 4CY8A 2YANA 2OJLA 4MK3A 1RW1A
chains in the Genus database with same CATH topology
4ZILA 5KEJA 2X4AA 1OC3A 4XHMA 1J9BA 4IJ3A 3IA1A 4JU5A 4POMA 5B8AA 4IKHA 4BA7A 4KNDA 5A5KA 1ZYNA 3LSZA 4ZL9A 4O5RA 5DAKA 3CXGA 4KSMA 2JU5A 3L0HA 4EXJA 3M8NA 2CVBA 4ZB9A 5ELAA 1EV4A 1TXUA 3WT2A 1FG4A 4D73A 2FY6A 3R3EA 5ECPB 5D93A 4MNNA 2BJXA 3ME8A 1TW9A 2V6OA 3QCPA 1OE7A 3ED3A 3EMXA 3GN3A 2YZHA 1VRSD 1O85A 4F9ZA 5EY6A 2LRNA 1T7PB 3H4KA 1KTEA 2EFCA 5G5EA 3GSSA 2LRCA 3TKQA 4QQ7A 3TJFA 2LKUA 3UIWA 3ZIVA 4GXZA 1QQ2A 2JZSA 4JEDA 1SK1A 1ERVA 5ECIB 1SL2B 1HNAA 4A5PA 5ECNB 1DE1A 4Z2RA 3CSIA 4LMWA 1YKAA 4ILFA 1GSDA 4KDXA 1JLVA 5ECRB 1XVQA 2WFCA 4GCIA 1X9WB 4OO5A 1M9AA 3MYDA 1FO5A 1T1VA 3US3A 1C72A 2JADA 2HZFA 4HQSA 3GKMA 14GSA 3F63A 3EPTA 5H5SA 1ZMAA 1A24A 4G19A 4KCEA 1PKWA 3VPTA 1OKTA 1K0OA 3L78A 3IBHA 2CAQA 5ECOB 2AUVA 1WRYA 5INYA 3EU3A 4O32A 1CQGA 4EDYA 2YN1A 3GUSA 2OBIA 1YKCA 3DKSA 2H75A 5DDLA 2DIZA 1SKWB 2PWJA 2EC4A 4I2UA 4K7OA 4N0VA 3KJYA 1V2AA 1SU9A 5KN1A 2IWTA 3P90A 4BL7A 2V41A 4K9ZA 2AHEA 3FR9A 3D4TA 5A1NB 2H71A 4I5QA 2G0FA 3FZ9A 1K0CA 2FWFA 2F51A 2HSNA 3LQ7A 1T4YA 3BJ5A 4HZ4A 2OADA 3GV1A 4MCUA 3TOUA 5DJMA 4RI7A 1MTCA 2DMMA 4DSSA 5CAXA 2A2RA 1EP7A 4DVCA 4GRFA 1GSUA 1X9MB 19GSA 1M7TA 1SVLA 2HRFA 1SKRB 2L5OA 4HEA2 3APOA 5B8BA 2CA8A 5G1LA 3CBUA 5CNWA 2LSTA 3TB2A 3TRXA 5AN1A 1OC9B 1GSFA 2X49A 3FZ5A 3QAVA 1GLPA 5EPFA 2QC7A 1PQNA 3VWXA 1URMA 5EVOA 1HD2A 1XFLA 2A4VA 5F0GA 3ZLPA 3TJJA 3ZL5A 3I43A 4KSOA 3TJGA 5IOWA 2NTOA 2H1DA 2XPDA 2LRTA 1SYXA 5E4WA 1A0FA 1J0FA 1WJKA 1MEKA 1ERTA 1XWBA 2EFEA 1K0DA 3ZRDA 4KDYA 3HY2A 3LW9A 5IMAA 5IO0A 1U6TA 1ERUA 6GSVA 4FYUA 4MJBA 2C0GA 3CMIA 2WRTA 1HNCA 5AGYA 3UEMA 4N11A 3ZREA 5LNKe 3GL5A 3D0ZA 1ZYQB 4L0UA 3P8WA 3O3TA 2FLSA 2GT6A 1BEDA 2REMA 3QAGA 1F3BA 1GUMA 4Q5NA 3FW2A 3GH9A 4J57E 3CTFA 1ZOFA 4ZBBA 3F6DA 4Q5QA 2VUPA 4ULXA 4MA9A 3DEXA 3GNJA 3LXTA 4KE3A 3LEFA 2RM5A 5F8BA 4JBBA 3A2WA 3VLNA 4ZIJA 2H73A 4IP1A 5DAKB 4PNFA 1QK8A 5DCGA 1GSYA 5BMUA 1ERWA 4D73B 1UA5A 1S3AA 5IPGA 5GAND 4L5LA 2RUFA 2HQTA 4KB3A 1EV9A 2FWEA 4KX4A 4XS1A 3TUEA 4K2DA 4MZBA 4JE1A 4V1Ap 1B8XA 1TOFA 3IHGA 5HR1A 5J3RA 4K7IA 5CP1A 3Q18A 2K8SA 2LQQA 3HDCA 3TRPA 2C0FA 1KNGA 4IHUA 1GH2A 2VCVA 1M2DA 1O8XA 4G01A 4G0KA 3E9JB 1MD4A 2XBIA 3Q6OA 3UVTA 1XIYA 4ID0A 5JCGA 3U6VA 4WF5A 1X0RA 2CV4A 1ABAA 4GSNA 3UARA 2YWNA 1OAZA 1GTIA 2GTUA 2H6XA 2H01A 2JZTA 5G31A 4O7HA 1HQOA 2R0GA 4Q5FA 3VK9A 2VD1A 3V1WA 1WMJA 4PQIA 4ICYA 4MPFA 1AC1A 1TP9A 4GQFA 1U87A 2JSZA 4TRXA 5B6NA 4QMKA 5COHA 5JWQB 1YVLA 2VL2C 3F4RA 4IJIA 1U3IA 3Q74A 2NPBA 5J9CA 2I4AA 3FEUA 1MDJA 2B5YA 1LBKA 2HT9A 1PSQA 5H5RA 1PL2A 4YAPA 4CW9A 2JL4A 1TRVA 4PUFC 1FB6A 3IC8A 3ZFBA 4LL1B 4BL7B 1GUKA 2VLTA 1JLWA 2YWOA 5IQYA 4BVYB 1KBNA 3QFAC 2HXKA 2L6DA 3RHCA 3F6FA 2OE3A 4O5QA 3GH6A 3E0UA 5DBQA 3W8JA 1FVKA 4DSSB 2GSQA 4KAEA 1GSSA 2HZEA 3HZ4A 1YQ1A 2OE0A 5AIVA 2O7KA 3QFBC 2ON5A 4WF4A 3L9UA 2J9HA 1SYRA 2H0HA 1GNEA 3H93A 5A34A 3IXRA 5JCUA 1EOGA 1GLQA 4IW9A 4XIHA 1I5GA 4FYBA 3UBLA 2I1UA 2K8VA 2N5FA 3G7JA 1SVMA 3NOFA 1TK0B 4PUAA 3WGDA 4DSRA 3TOTA 2CX3A 5GSSA 4WXTA 4NAXA 12GSA 3DVWA 3KEBA 4YKFA 5DVBA 1CQHA 2IFQA 1TRUA 5ECKB 1EP8A 2FA8A 4OFNA 3IPZA 5IM9A 4X0XA 2PUKC 5ECHB 2E7PA 5JWOB 1XCCA 1VF3A 4O5UA 2HNLA 2DJ2A 1M0UA 4KH7A 4K7NA 3KH9A 4OO4A 1GRXA 1F6MC 1HNBA 3KH7A 2DBCA 2H70A 2VKZG 5JCWA 1PX7A 1BF5A 4V2MA 2GDRA 1B4QA 4MH3A 4NHZA 3QMXA 1XOBA 2LJRA 4ZB8A 3HA9A 4J2FA 1G7OA 4GDFA 3GL3A 1YJ6A 4K5SA 2CVKA 1QUWA 3D22A 3M9KA 4ZL8A 2R5GA 4IBPA 1N2AA 2GQLA 4MJCA 4I6XA 2VCXA 3LORA 4EIPA 3WGEA 3FR3A 3KGKA 1KEBA 5ECSA 4IS0A 3LXZA 3D4MA 3LG6A 5J9BA 3G7IA 1GTBA 3CTGA 2CZ3A 2L5LA 18GSA 3TU3B 5BMUB 1X5DA 2QA1A 1W89A 4PX1A 2B1LA 4MJAA 1TKDB 1QXHA 5G30A 4FO5A 3C8EA 3FYGA 1K0MA 2H19A 4CDOA 2H1GA 2UV8G 3EU4A 3ISOA 2YWMA 3TKSC 4JR4A 2GSTA 2HLSA 5IO2A 1Z3EA 3ERWA 2LJAA 4XRDA 3TKSA 4MH2A 1MD3A 3F4SA 2HRNA 2C80A 2V6KA 3IHQA 5F05A 2O8VB 3IAM2 2NDOA 3DXBA 1TJDA 4NWYA 4NV5A 3C7MA 3RPNA 1OVNA 4AJ7A 4EO3A 2EIRA 3IRAA 3PGTA 3ZMLA 4ZL7A 2GZPA 2K18A 3I69A 1XXUA 4TKYA 1JFUA 3KTBA 2WS2A 1WIKA 4KW6A 1PD21 2VCZA 1IYHA 3VI7A 4QL7A 1ZGNA 1TU7A 2DKIA 5A5HA 2RUEA 1PX6A 3RHBA 4MABA 5LD0A 2I9HA 1K3YA 3N9JA 3WGXA 2D2ZA 2HRKA 4F0BA 3BD2A 4RUVA 1ZYPA 4NV2A 5B7CA 4J56E 3GFKA 3P7XA 4KF9A 2HRAA 2IMEA 3CSJA 2JACA 3ZITA 4PTSA 2YOIA 3UJ1A 2GZZA 2H0GA 2M80A 1QFNA 4TR3A 1OC8A 3PINA 1RK4A 3UBKA 3LYPA 10GSA 2VCTA 1IYIA 2DJ3A 4E68A 3ZYWA 3S9FA 3KMNA 2LQOA 2X64A 4PQHA 3VWVA 3CWGA 1JZRA 5ECLB 2VCQA 4GSSA 4AI6A 1K0BA 3HYPA 2HZEB 5DALA 4Z7XA 4GSTA 1Q98A 2V1MA 2GLRA 3NIVA 2C4JA 4LL4B 1YF0A 3F8UA 1TDIA 1OYJA 3IC4A 5A34B 3ZZXA 1K3OA 4MZCA 5D73A 4ZXGA 5HR2A 3L9SA 4XTSA 2NVLA 6GSUA 2LNSA 2R6KA 4TVEA 1JZDA 1XVWA 1R5PA 5IMCA 4BPYA 4AKHA 2YCDA 4I8BA 5GZZB 3EC3A 5GAPD 2F3MA 3ERGA 3FK8A 1N8JA 4TW5A 1AAZA 1F9MA 3LJRA 1XWAA 2HFDA 4GWRA 3IAS2 4PNGA 2MMZA 2AB6A 4JR6A 4POBA 2PMTA 1O7UA 3UMAA 4ZB6A 3VPQA 2TIRA 4YH2A 3CRTA 3GSTA 3VI5A 4TXOA 2MBSA 4ECIA 1THOA 5KOWA 2P5RA 4FIWA 1FVJA 2J23A 2MBTA 1UVZA 1Z6MA 4OFTA 1GP1A 2PERA 2CQ9A 4IELA 1SJ6A 3MIXA 1EEMA 2TRCP 2RIIA 2MMOA 3I6AA 3IE3A 5ELGA 2O89A 1BG1A 1DBYA 4TOPA 3GURA 2H6ZA 1M2AA 4EDZA 3RAZA 1XW6A 1TU8A 2IPAA 2GGTA 1FW1A 4V1Ag 1VF4A 2QGVA 3AY8A 2OA7A 1F2EA 3EYTA 1BJXA 4HJ2A 1JZWA 1Z9HA 2H72A 2IJYA 1ML6A 3M3MA 4MJEA 5ID2A 5D9XA 2I3YA 2VM1A 3KD0A 2IMDA 1ST9A 5CRDA 3TDGA 4RQXA 3DWVA 2HI7A 4HU9A 16GSA 3O76A 3BBYA 2KP2A 5D9WA 3G9BA 3BCIA 1EZKA 1NM3A 3ME7A 2FHEA 1Y25A 4TXVA 3CRUA 3HHVA 1EOHA 3C73A 1T3BA 3R2QA 2R3XA 2ALBA 3A5WA 3VFIA 1SD8A 1XWKA 3GA4A 4I97A 2VIMA 4PXOA 5HFGA 5J4YA 3RPPA 3ZTLA 5J41A 1VGLA 3QD9A 5AIXA 4MDCA 1ACVA 2EIOA 2PVQA 2O87A 3WD6A 1PL1A 1LU4A 1R4WA 1SJZA 2X8HA 4X43A 1WOUA 3DMLA 3TCOA 3TKSE 1K3LA 5A5HB 4YQVA 3HZ8A 4GQCA 2GSSA 4HOJA 1O73A 1TRWA 2KP1A 4NPBA 2YJ7A 8GSSA 4MF7A 3N5OA 3WT1A 1Y6EA 3EE2A 4POKA 2OKAA 4YQUA 5DCHA 4HJMA 4LA1A 1B4PA 2YWIA 4V2NA 2X8GA 5HFKA 4OD7A 2OBKA 1O8WA 2HSMA 4POLA 4TN8A 1G6WA 2L57A 4X1UA 2P31A 2VL2A 5H5QA 1AQWA 3L9VA 2GT5A 2L6CA 1OKDA 3IOSA 5KOXA 2KLXA 2WULA 2LS5A 1E2YA 5FHIA 2O85A 3LWAA 5DALB 2P0GA 1SJIA 3DVXA 5J40A 2RLIA 4N10A 4MF6A 3TKPA 1GULA 2YP6A 3Q19A 3BOAA 2IMFA 1TI1A 2HSNB 3ZMKA 3D6IA 2PGTA 4F0CA 4XS4A 3HKRA 3APQA 4CHSA 1THXA 4E8EA 1YY7A 1YF1A 1NHOA 1FHEA 5F07A 2TRXA 1NSWA 1USBA 2CAIA 1XW5A 2XC2A 4OCEA 2B6MA 1XW9A 4BVXA 3EVIA 3ZIJA 1O6JA 2YJHA 2MMAA 4IVFA 4NHWA 4WBRD 3KP9A 2GZYA 2CVDA 5A1NA 4WBJA 1A0RP 2LJKA 3UAPA 1S3CA 4ML6A 4EUYA 5HR3A 1BAYA 1PMTA 4WR4A 5HFIA 3ZVJA 1DUGA 4TXOB 1AQXA 1G0TA 3F4TA 1EGRA 4WKWA 2E2MA 3VWUA 1DSBA 1Z5YE 2PVOC 3IR4A 1G6YA 1M2BA 2VL9A 6GSTA 11GSA 1GTAA 2H1BA 2VLVA 3F3RA 1AQVA 2YV9A 2C0EA 4ECBA 2BTOT 2MMNA 1BX9A 1AXDA 3RBTA 2RM6A 5KN3A 5J47A 4MP4A 2YNXA 1GNWA 1PGTA 5FWGA 3EMPA 2H76A 4XS6A 3MAKA 1ZYEA 4YAVA 2H74A 2LV3A 2DIYA 4JRRA 3DIEA 3KMOA 5IMDA 2X8CA 2C3NA 2WJUA 2DMLA 5J5NA 4HDEA 4WEYA 3J7Yk 3TGZA 2ZUPA 1B48A 2H30A 1B9YC 2CX4A 2N5BA 3CSHA 1BG5A 3A2VA 5A4VA 3MNGA 4GTUA 2L4QA 2B5XA 3D5JA 2CT6A 2I81A 1GTUA 5ECMB 7GSSA 4TR1A 2FUG2 1Q4JA 3F3QA 2LEGA 1K0NA 3PH9A 4OMVA 2LNTA 3IV4A 4N30A 1T8EB 1XZOA 3VWWA 3LYKA 4NXIA 5D96A 1EWXA 1ZCPA 4YKGA 1U88A 1NHYA 2IL3A 1Z7RA 5FT3A 1ILOA 3M9JA 4ZBDA 4ZB7A 4CY6A 1QMVA 2ON7A 2NBSA 3PR8A 4MMMA 3GKNA 2M46A 2F8AA 1FOVA 1Y1UA 2AYTA 3FR6A 3ZFLA 3HJPA 3M0FA 3HXSA 1N25A 1HYUA 4AJ6A 4G10A 4HUAA 4IQAA 2AJQB 2G2QA 3MWHA 5G2ZA 2XBQA 4HS1A 4H86A 4ECCA 4KUNA 3A3TA 3GIXA 2IIYA 1RQMA 4K6XA 3GHAA 2HSMB 2YPMA 1V40A 2R0CA 2JZRA 13GSA 4EVMA 5IIZA 1BQ7A 2DSAA 2IMIA 1MDIA 4K0GA 5A4WA 3F9UA 3PPUA 5B6MA 2O5VA 3DYRA 4TR4A 3W8SA 5CRGA 2FNOA 4PGTA 4ECJA 4MPGA 4OCFA 4OFMA 4WETA 1SK2A 3VURA 2B7KA 1YEXA 2ZCTA 5DQSA 1PN9A 2QA2A 3SWLA 5EL8A 1DE2A 3GTUA 4XS4B 1XWCA 3HMJG 2R0PA 5C00A 3DRNA 3WYWA 1WWJA 1SKSB 5ABRA 1SL1B 4OWYA 2HE3A 2IMKA 5DJLA 3TRQA 4IGJA 1A2JA 6GSSA 3NZNA 4AKIA 2JSYA 1EEJA 1J08A 4BVXB 2C8UA 1PA3A 1T4ZA 1UN2A 1H4OA 1SVOA 1QGVA 5KN2A 3K8NA 4AKGA 3TJBA 3ERFA 1LJRA 1OE8A 4BVYA 3HCZA 3L4NA 3KCMA 5D8IA 4V2LA 1T00A 2IFQB 3KM6A 4K8MA 1TTZA 4MLYA 3HJMA 4HU7A 4IP6A 4NMUA 2EFHA 3SBCA 3GX8A 3UOMA 2V32A 5IMVA 3IDVA 5CREA 3OR5A 4HZ2A 1XWGA 3FZ4A 5CYYA 4RI6A 4FYCA 3HVXA 3ZVJD 4Z2UA 2FCHA 4E8HA 4G2EA 3DGQA 4GF0A 2HSHA 3GKKA 4AKXB 4HQZA 20GSA 2PPTA 4G0LA 1SK0A 1K0AA 4MZWA 4YQMA 5IMZA 2AV4A 2H6YA 2WB9A 4K0NA 3I9V2 5IOXA 2B5EA 5LCZA 1UC7A 2LUSA 4BWQA 2PU9C 2C3QA 3E3EA 2C0DA 1Z6NA 1VF2A 5G1KA 2FGXA 2L4CA 2R37A 1XBSA 2PN8A 3W6GA 1WP0A 3QAWA 2F9SA 2DJKA 4L8EA 2GSRA 3GX0A 1ON4A 1R7HA 4BWSA 5D9TA 2N5AA 3RDWA 4KDUA 1AUCA 1YZXA 3LFLA 1B9XC 2X99A 3GYKA 4P3YB 3C1RA 1YDKA 4EE0A 5C04A 4ML1A 2B7JA 4TR1B 1W4VA 2ES7A 4AF2A 3KXOA 2WZ9A 2HYXA 3KZQA 2A4HA 1PN0A 3QR6A 2LTKA 4JZQA 3G7YA 3P2AA 2A2SA 3QDNA 2EFDA 2DKHA 4N0ZA 3O6TA 2H66A 2VD0A 1SD9A 1AW9A 1V57A 4IQ1A 2YZUA 2K6VA 5DQYA 1PKZA 4IN0A 5GSTA 1SENA 3BCKA 3GMFA 4EIQA 2QSIA 2DC5A 1Z7PA 3EINA 17GSA 4K2XA 6GSWA 3GKXA 3KP8A 1H75A 2GS3A 2M72A 4USSA 5J4UA 1TK5B 3EURA 2DLXA 1NW2A 1YEPA 9GSSA 1GUHA 1X5CA 1JHBA 2FD3A 2VO4A 4PQ1A 4LMVA 4G0IA 4QL9A 2FA4A 3HVSA 1ZL9A 1A8LA 5HR0A 2EIQA 1E6BA 4KGIA 2HRKB 2E2GA 2XPEA 3MSZA 2VL3A 4ACSA 2FWHA 4K5RA 3U5RE 3FMWA 3A5IA 4G9HA 2B3SA 3GRXA 2H1LA 1AIUA 5ECQB 2DJ0A 1BYEA 2B1KA 2VAFA 2OT3A 2VCWA 2GQMA 3EWLA 3UL3A 1X9SB 4EL1A 6GSYA 3JCML 2Z9SA 2V2GA 1TK8B 3FKFA 2MZCA 1FOHA 1F37A 2MYGA 4L5OA 4MF5A 3HD5A 2P5QA 4LLRA 3KIJA 2L59A 2VOCA 5J4VA 3C71A 2XHFA 3GTUB 2C3TA 1SL0B 1EGOA 4EC0A 3A2XA 4N3ZA 4F82A 2DJJA 2VM2A 4TR0A 1PRXA 3H79A 2C1YA 2GQKA 1XPVA 5KN0A 1A2MA 5CRWA 3HJOA 22GSA 4I2TA 2CZ2A 4Z2TA 5E59A 2GVPA 4K1FA 3FHKA 2A2PA 5BRTA 3M1GA 3TJKA 2YV7A 2H1AA 4X4JA 5ENUA 2WDUA 2E0QA 2OACA 5D9VA 1MDKA 3IK9A 2BMXA 2OE1A 2UZ8A 3FRCA 1U3AA 2HSYA 4DSQA 4RQRA 2WGRA 5A4UA 4HI7A 1FB0A 1I9DA 2H8LA 1ZZYA 2H0IA 3HVVA 4F03A 1FAAA 1TRSA 4GLTA 1WPIA 5IPHA 5AISA 1O81A 1A23A 1GSQA 1GL8A 2F8FA 1S3DA 1V58A 1TI3A 1A8YA 2KUCA 4EKZA 4ZBAA 2ZNMA 4W66A 1GWCA 4KA0A 2PBJA 5CO3A 4ISDA 5L71A 1TXXA 1G7EA 5IMFA 1V98A 3TKRA 4WR5A 3KTLA 5HQPA 1M99A 1GSEA 4AGSA 1OC9A 2IN3A 3QPMA 1X5EA 2VLUA 3IK7A 2DJ1A 3C1SA 5CRHA 3J7Yb 4KCAA 3DD3A 2K9FA 3H1NA 2R2JA 4XRAA 5G5FA 2AAWA 3FY7A 4Q5RA 3APSA 1A2LA 5JWRB 3D21A 4XCSA 1R5AA 1VF1A 1JZOA 3MDKA 1WE0A 1R26A 1XOAA 2WCIA 6GSXA 4PURA 5ID2B 2QKEA 4DEJA 4FH8A 4FQUA 2KOKA 4AJ8A 4F2IA 3UVHA 3FZAA 4EF0A 3LGCA 2FWGA 1F3AA 3QOUA 4L0WA 2KHPA 3F0IA 3H8QA 1M9BA 5F06A 1V9WA 2R4VA 3CYNA 4O92A 4CY8A 2YANA 2OJLA 4MK3A 1RW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZIL A;  5KEJ A;  1OC3 A;  4XHM A;  1J9B A;  4IJ3 A;  3IA1 A;  4JU5 A;  4POM A;  5B8A A;  4IKH A;  4BA7 A;  4KND A;  5A5K A;  3LSZ A;  4ZL9 A;  4O5R A;  5DAK A;  3CXG A;  4KSM A;  2JU5 A;  3L0H A;  4EXJ A;  3M8N A;  2CVB A;  4ZB9 A;  5ELA A;  1EV4 A;  3WT2 A;  1FG4 A;  4D73 A;  2FY6 A;  3R3E A;  5ECP B;  5D93 A;  2BJX A;  3ME8 A;  1TW9 A;  2V6O A;  3QCP A;  1OE7 A;  3ED3 A;  3EMX A;  3GN3 A;  2YZH A;  1VRS D;  1O85 A;  4F9Z A;  5EY6 A;  2LRN A;  1T7P B;  3H4K A;  1KTE A;  5G5E A;  3GSS A;  2LRC A;  3TKQ A;  4QQ7 A;  3TJF A;  2LKU A;  3UIW A;  3ZIV A;  4GXZ A;  1QQ2 A;  2JZS A;  4JED A;  1SK1 A;  1ERV A;  5ECI B;  1SL2 B;  1HNA A;  5ECN B;  1DE1 A;  3CSI A;  4LMW A;  1YKA A;  4ILF A;  1GSD A;  4KDX A;  1JLV A;  5ECR B;  1XVQ A;  2WFC A;  4GCI A;  1X9W B;  4OO5 A;  1M9A A;  1FO5 A;  1T1V A;  3US3 A;  1C72 A;  2JAD A;  2HZF A;  4HQS A;  3GKM A;  14GS A;  3F63 A;  5H5S A;  1ZMA A;  1A24 A;  4G19 A;  4KCE A;  1PKW A;  3VPT A;  1OKT A;  1K0O A;  3L78 A;  3IBH A;  2CAQ A;  5ECO B;  2AUV A;  1WRY A;  5INY A;  3EU3 A;  4O32 A;  1CQG A;  4EDY A;  2YN1 A;  3GUS A;  2OBI A;  1YKC A;  3DKS A;  2H75 A;  5DDL A;  2DIZ A;  1SKW B;  2PWJ A;  2EC4 A;  4I2U A;  4K7O A;  4N0V A;  3KJY A;  1V2A A;  1SU9 A;  5KN1 A;  2IWT A;  3P90 A;  4BL7 A;  2V41 A;  4K9Z A;  2AHE A;  3FR9 A;  3D4T A;  2H71 A;  4I5Q A;  2G0F A;  3FZ9 A;  1K0C A;  2FWF A;  2F51 A;  3LQ7 A;  1T4Y A;  3BJ5 A;  4HZ4 A;  2OAD A;  3GV1 A;  4MCU A;  3TOU A;  5DJM A;  4RI7 A;  1MTC A;  2DMM A;  4DSS A;  5CAX A;  2A2R A;  1EP7 A;  4DVC A;  4GRF A;  1GSU A;  1X9M B;  19GS A;  1M7T A;  2HRF A;  1SKR B;  2L5O A;  4HEA 2;  3APO A;  5B8B A;  2CA8 A;  5G1L A;  3CBU A;  5CNW A;  2LST A;  3TB2 A;  3TRX A;  5AN1 A;  1OC9 B;  1GSF A;  3FZ5 A;  3QAV A;  1GLP A;  5EPF A;  2QC7 A;  1PQN A;  3VWX A;  1URM A;  5EVO A;  1HD2 A;  1XFL A;  2A4V A;  5F0G A;  3ZLP A;  3TJJ A;  3ZL5 A;  3I43 A;  4KSO A;  3TJG A;  5IOW A;  2NTO A;  2H1D A;  2XPD A;  2LRT A;  1SYX A;  5E4W A;  1A0F A;  1J0F A;  1WJK A;  1MEK A;  1ERT A;  1XWB A;  1K0D A;  3ZRD A;  4KDY A;  3HY2 A;  5IMA A;  5IO0 A;  1U6T A;  1ERU A;  6GSV A;  4FYU A;  4MJB A;  2C0G A;  3CMI A;  2WRT A;  1HNC A;  5AGY A;  3UEM A;  4N11 A;  3ZRE A;  5LNK e;  3GL5 A;  3D0Z A;  1ZYQ B;  4L0U A;  3P8W A;  3O3T A;  2FLS A;  2GT6 A;  1BED A;  2REM A;  3QAG A;  1F3B A;  1GUM A;  4Q5N A;  3FW2 A;  3GH9 A;  4J57 E;  3CTF A;  1ZOF A;  4ZBB A;  3F6D A;  4Q5Q A;  2VUP A;  4ULX A;  4MA9 A;  3DEX A;  3GNJ A;  3LXT A;  4KE3 A;  3LEF A;  2RM5 A;  5F8B A;  4JBB A;  3A2W A;  3VLN A;  4ZIJ A;  2H73 A;  4IP1 A;  5DAK B;  4PNF A;  1QK8 A;  5DCG A;  1GSY A;  5BMU A;  1ERW A;  4D73 B;  1UA5 A;  1S3A A;  5IPG A;  5GAN D;  4L5L A;  2RUF A;  2HQT A;  4KB3 A;  1EV9 A;  2FWE A;  4KX4 A;  4XS1 A;  3TUE A;  4K2D A;  4MZB A;  4JE1 A;  4V1A p;  1B8X A;  1TOF A;  5HR1 A;  5J3R A;  4K7I A;  5CP1 A;  3Q18 A;  2K8S A;  2LQQ A;  3HDC A;  3TRP A;  2C0F A;  1KNG A;  4IHU A;  1GH2 A;  2VCV A;  1M2D A;  1O8X A;  4G0K A;  3E9J B;  1MD4 A;  2XBI A;  3Q6O A;  3UVT A;  1XIY A;  4ID0 A;  5JCG A;  3U6V A;  4WF5 A;  1X0R A;  2CV4 A;  1ABA A;  4GSN A;  3UAR A;  2YWN A;  1OAZ A;  1GTI A;  2GTU A;  2H6X A;  2H01 A;  2JZT A;  5G31 A;  4O7H A;  1HQO A;  4Q5F A;  3VK9 A;  2VD1 A;  3V1W A;  1WMJ A;  4PQI A;  4MPF A;  1AC1 A;  1TP9 A;  4GQF A;  1U87 A;  2JSZ A;  4TRX A;  5B6N A;  5COH A;  5JWQ B;  2VL2 C;  3F4R A;  4IJI A;  1U3I A;  3Q74 A;  2NPB A;  5J9C A;  2I4A A;  3FEU A;  1MDJ A;  2B5Y A;  1LBK A;  2HT9 A;  1PSQ A;  5H5R A;  1PL2 A;  4YAP A;  4CW9 A;  2JL4 A;  1TRV A;  4PUF C;  1FB6 A;  3IC8 A;  3ZFB A;  4LL1 B;  4BL7 B;  1GUK A;  2VLT A;  1JLW A;  2YWO A;  5IQY A;  4BVY B;  1KBN A;  3QFA C;  2HXK A;  2L6D A;  3RHC A;  3F6F A;  2OE3 A;  3GH6 A;  3E0U A;  5DBQ A;  3W8J A;  1FVK A;  4DSS B;  2GSQ A;  4KAE A;  1GSS A;  2HZE A;  3HZ4 A;  1YQ1 A;  2OE0 A;  5AIV A;  2O7K A;  3QFB C;  2ON5 A;  4WF4 A;  3L9U A;  2J9H A;  1SYR A;  2H0H A;  1GNE A;  3H93 A;  3IXR A;  5JCU A;  1EOG A;  1GLQ A;  4IW9 A;  4XIH A;  1I5G A;  4FYB A;  3UBL A;  2I1U A;  2K8V A;  2N5F A;  3G7J A;  3NOF A;  1TK0 B;  4PUA A;  3WGD A;  4DSR A;  3TOT A;  2CX3 A;  5GSS A;  4WXT A;  4NAX A;  12GS A;  3DVW A;  3KEB A;  5DVB A;  1CQH A;  2IFQ A;  1TRU A;  5ECK B;  1EP8 A;  2FA8 A;  4OFN A;  3IPZ A;  5IM9 A;  4X0X A;  2PUK C;  5ECH B;  2E7P A;  5JWO B;  1XCC A;  1VF3 A;  2HNL A;  2DJ2 A;  1M0U A;  4KH7 A;  4K7N A;  3KH9 A;  4OO4 A;  1GRX A;  1F6M C;  1HNB A;  3KH7 A;  2DBC A;  2H70 A;  5JCW A;  1PX7 A;  4V2M A;  2GDR A;  1B4Q A;  4MH3 A;  4NHZ A;  3QMX A;  1XOB A;  2LJR A;  4ZB8 A;  3HA9 A;  4J2F A;  1G7O A;  3GL3 A;  1YJ6 A;  2CVK A;  1QUW A;  3D22 A;  3M9K A;  4ZL8 A;  2R5G A;  4IBP A;  1N2A A;  2GQL A;  4MJC A;  4I6X A;  2VCX A;  3LOR A;  3WGE A;  3FR3 A;  3KGK A;  1KEB A;  5ECS A;  4IS0 A;  3LXZ A;  3D4M A;  3LG6 A;  5J9B A;  3G7I A;  1GTB A;  3CTG A;  2CZ3 A;  2L5L A;  18GS A;  1X5D A;  1W89 A;  4PX1 A;  2B1L A;  4MJA A;  1TKD B;  1QXH A;  5G30 A;  4FO5 A;  3C8E A;  3FYG A;  1K0M A;  2H19 A;  4CDO A;  2H1G A;  3EU4 A;  3ISO A;  2YWM A;  3TKS C;  4JR4 A;  2GST A;  2HLS A;  5IO2 A;  1Z3E A;  3ERW A;  2LJA A;  4XRD A;  3TKS A;  4MH2 A;  1MD3 A;  3F4S A;  2HRN A;  2C80 A;  2V6K A;  3IHQ A;  5F05 A;  2O8V B;  3IAM 2;  2NDO A;  3DXB A;  1TJD A;  4NWY A;  4NV5 A;  3C7M A;  3RPN A;  1OVN A;  4AJ7 A;  4EO3 A;  2EIR A;  3IRA A;  3PGT A;  3ZML A;  4ZL7 A;  2GZP A;  2K18 A;  3I69 A;  1XXU A;  4TKY A;  1JFU A;  3KTB A;  2WS2 A;  1WIK A;  4KW6 A;  1PD2 1;  2VCZ A;  1IYH A;  3VI7 A;  4QL7 A;  1ZGN A;  1TU7 A;  2RUE A;  1PX6 A;  3RHB A;  4MAB A;  5LD0 A;  2I9H A;  1K3Y A;  3N9J A;  3WGX A;  2D2Z A;  2HRK A;  4F0B A;  3BD2 A;  4RUV A;  4NV2 A;  5B7C A;  4J56 E;  3GFK A;  3P7X A;  4KF9 A;  2HRA A;  2IME A;  3CSJ A;  2JAC A;  3ZIT A;  4PTS A;  2YOI A;  3UJ1 A;  2GZZ A;  2H0G A;  2M80 A;  1QFN A;  4TR3 A;  1OC8 A;  3PIN A;  1RK4 A;  3UBK A;  3LYP A;  10GS A;  2VCT A;  1IYI A;  2DJ3 A;  3ZYW A;  3S9F A;  3KMN A;  2LQO A;  2X64 A;  4PQH A;  3VWV A;  1JZR A;  5ECL B;  2VCQ A;  4GSS A;  1K0B A;  3HYP A;  2HZE B;  5DAL A;  4Z7X A;  4GST A;  1Q98 A;  2V1M A;  2GLR A;  3NIV A;  2C4J A;  4LL4 B;  1YF0 A;  3F8U A;  1TDI A;  1OYJ A;  3IC4 A;  3ZZX A;  1K3O A;  4MZC A;  5D73 A;  4ZXG A;  5HR2 A;  3L9S A;  4XTS A;  2NVL A;  6GSU A;  2LNS A;  2R6K A;  4TVE A;  1JZD A;  1XVW A;  1R5P A;  5IMC A;  4BPY A;  2YCD A;  4I8B A;  5GZZ B;  3EC3 A;  5GAP D;  2F3M A;  3ERG A;  3FK8 A;  1N8J A;  4TW5 A;  1AAZ A;  1F9M A;  3LJR A;  1XWA A;  2HFD A;  4GWR A;  3IAS 2;  4PNG A;  2MMZ A;  2AB6 A;  4JR6 A;  4POB A;  2PMT A;  1O7U A;  3UMA A;  4ZB6 A;  3VPQ A;  2TIR A;  4YH2 A;  3CRT A;  3GST A;  3VI5 A;  4TXO A;  2MBS A;  4ECI A;  1THO A;  2P5R A;  4FIW A;  1FVJ A;  2J23 A;  2MBT A;  1UVZ A;  1Z6M A;  4OFT A;  1GP1 A;  2PER A;  2CQ9 A;  4IEL A;  1SJ6 A;  1EEM A;  2TRC P;  2RII A;  2MMO A;  3I6A A;  3IE3 A;  5ELG A;  2O89 A;  1DBY A;  4TOP A;  3GUR A;  2H6Z A;  1M2A A;  4EDZ A;  3RAZ A;  1XW6 A;  1TU8 A;  2IPA A;  2GGT A;  1FW1 A;  4V1A g;  1VF4 A;  2QGV A;  3AY8 A;  2OA7 A;  1F2E A;  3EYT A;  1BJX A;  4HJ2 A;  1JZW A;  1Z9H A;  2H72 A;  2IJY A;  1ML6 A;  3M3M A;  4MJE A;  5ID2 A;  5D9X A;  2I3Y A;  2VM1 A;  3KD0 A;  2IMD A;  1ST9 A;  5CRD A;  3TDG A;  4RQX A;  3DWV A;  2HI7 A;  4HU9 A;  16GS A;  3O76 A;  3BBY A;  2KP2 A;  5D9W A;  3G9B A;  3BCI A;  1EZK A;  1NM3 A;  3ME7 A;  2FHE A;  1Y25 A;  4TXV A;  3CRU A;  3HHV A;  1EOH A;  3C73 A;  1T3B A;  3R2Q A;  2R3X A;  2ALB A;  3A5W A;  3VFI A;  1SD8 A;  1XWK A;  3GA4 A;  4I97 A;  2VIM A;  4PXO A;  5HFG A;  3RPP A;  3ZTL A;  5J41 A;  1VGL A;  3QD9 A;  5AIX A;  4MDC A;  1ACV A;  2EIO A;  2PVQ A;  2O87 A;  3WD6 A;  1PL1 A;  1LU4 A;  1R4W A;  1SJZ A;  2X8H A;  4X43 A;  1WOU A;  3DML A;  3TCO A;  3TKS E;  1K3L A;  4YQV A;  3HZ8 A;  4GQC A;  2GSS A;  4HOJ A;  1O73 A;  1TRW A;  2KP1 A;  4NPB A;  2YJ7 A;  8GSS A;  4MF7 A;  3N5O A;  3WT1 A;  1Y6E A;  3EE2 A;  4POK A;  2OKA A;  4YQU A;  5DCH A;  4HJM A;  4LA1 A;  1B4P A;  2YWI A;  4V2N A;  2X8G A;  5HFK A;  4OD7 A;  2OBK A;  1O8W A;  2HSM A;  4POL A;  4TN8 A;  1G6W A;  2L57 A;  4X1U A;  2P31 A;  2VL2 A;  5H5Q A;  1AQW A;  3L9V A;  2GT5 A;  2L6C A;  1OKD A;  3IOS A;  2KLX A;  2WUL A;  2LS5 A;  1E2Y A;  5FHI A;  2O85 A;  3LWA A;  5DAL B;  2P0G A;  1SJI A;  3DVX A;  2RLI A;  4N10 A;  4MF6 A;  3TKP A;  1GUL A;  2YP6 A;  3Q19 A;  3BOA A;  2IMF A;  1TI1 A;  2HSN B;  3ZMK A;  3D6I A;  2PGT A;  4F0C A;  4XS4 A;  3HKR A;  3APQ A;  4CHS A;  1THX A;  4E8E A;  1YY7 A;  1YF1 A;  1NHO A;  1FHE A;  5F07 A;  2TRX A;  1NSW A;  1USB A;  2CAI A;  1XW5 A;  2XC2 A;  4OCE A;  2B6M A;  1XW9 A;  4BVX A;  3EVI A;  3ZIJ A;  1O6J A;  2YJH A;  2MMA A;  4IVF A;  4NHW A;  4WBR D;  3KP9 A;  2GZY A;  2CVD A;  4WBJ A;  1A0R P;  2LJK A;  3UAP A;  1S3C A;  4ML6 A;  4EUY A;  5HR3 A;  1BAY A;  1PMT A;  4WR4 A;  5HFI A;  3ZVJ A;  1DUG A;  4TXO B;  1AQX A;  1G0T A;  3F4T A;  1EGR A;  4WKW A;  2E2M A;  3VWU A;  1DSB A;  1Z5Y E;  2PVO C;  3IR4 A;  1G6Y A;  1M2B A;  2VL9 A;  6GST A;  11GS A;  1GTA A;  2H1B A;  2VLV A;  3F3R A;  1AQV A;  2YV9 A;  2C0E A;  4ECB A;  2BTO T;  2MMN A;  1BX9 A;  1AXD A;  3RBT A;  2RM6 A;  5KN3 A;  4MP4 A;  2YNX A;  1GNW A;  1PGT A;  5FWG A;  3EMP A;  2H76 A;  4XS6 A;  3MAK A;  1ZYE A;  4YAV A;  2H74 A;  2LV3 A;  2DIY A;  4JRR A;  3DIE A;  3KMO A;  5IMD A;  2X8C A;  2C3N A;  2WJU A;  2DML A;  5J5N A;  4HDE A;  4WEY A;  3J7Y k;  3TGZ A;  2ZUP A;  1B48 A;  2H30 A;  1B9Y C;  2CX4 A;  2N5B A;  3CSH A;  1BG5 A;  3A2V A;  5A4V A;  3MNG A;  4GTU A;  2L4Q A;  2B5X A;  3D5J A;  2CT6 A;  2I81 A;  1GTU A;  5ECM B;  7GSS A;  4TR1 A;  2FUG 2;  1Q4J A;  3F3Q A;  2LEG A;  1K0N A;  3PH9 A;  4OMV A;  2LNT A;  3IV4 A;  4N30 A;  1T8E B;  1XZO A;  3VWW A;  3LYK A;  4NXI A;  5D96 A;  1EWX A;  1ZCP A;  1U88 A;  1NHY A;  2IL3 A;  1Z7R A;  5FT3 A;  1ILO A;  3M9J A;  4ZBD A;  1QMV A;  2ON7 A;  2NBS A;  3PR8 A;  4MMM A;  3GKN A;  2M46 A;  2F8A A;  1FOV A;  2AYT A;  3FR6 A;  3ZFL A;  3HJP A;  3M0F A;  3HXS A;  1HYU A;  4AJ6 A;  4G10 A;  4HUA A;  4IQA A;  2AJQ B;  2G2Q A;  3MWH A;  5G2Z A;  2XBQ A;  4HS1 A;  4H86 A;  4ECC A;  4KUN A;  3A3T A;  3GIX A;  2IIY A;  1RQM A;  4K6X A;  3GHA A;  2HSM B;  2YPM A;  1V40 A;  2JZR A;  13GS A;  4EVM A;  5IIZ A;  1BQ7 A;  2DSA A;  2IMI A;  1MDI A;  4K0G A;  5A4W A;  3F9U A;  3PPU A;  5B6M A;  3DYR A;  4TR4 A;  3W8S A;  5CRG A;  2FNO A;  4PGT A;  4ECJ A;  4MPG A;  4OCF A;  4OFM A;  4WET A;  1SK2 A;  3VUR A;  2B7K A;  1YEX A;  2ZCT A;  5DQS A;  1PN9 A;  3SWL A;  5EL8 A;  1DE2 A;  3GTU A;  4XS4 B;  1XWC A;  5C00 A;  3DRN A;  3WYW A;  1WWJ A;  1SKS B;  5ABR A;  1SL1 B;  4OWY A;  2HE3 A;  2IMK A;  5DJL A;  3TRQ A;  4IGJ A;  1A2J A;  6GSS A;  3NZN A;  2JSY A;  1EEJ A;  1J08 A;  4BVX B;  2C8U A;  1PA3 A;  1T4Z A;  1UN2 A;  1H4O A;  5KN2 A;  1QGV A;  3K8N A;  3TJB A;  3ERF A;  1LJR A;  1OE8 A;  4BVY A;  3HCZ A;  3L4N A;  3KCM A;  5D8I A;  4V2L A;  1T00 A;  2IFQ B;  3KM6 A;  4K8M A;  1TTZ A;  4MLY A;  3HJM A;  4HU7 A;  4IP6 A;  4NMU A;  3SBC A;  3GX8 A;  3UOM A;  2V32 A;  5IMV A;  3IDV A;  5CRE A;  3OR5 A;  4HZ2 A;  1XWG A;  3FZ4 A;  5CYY A;  4RI6 A;  4FYC A;  3HVX A;  3ZVJ D;  2FCH A;  4E8H A;  4G2E A;  3DGQ A;  4GF0 A;  2HSH A;  3GKK A;  4HQZ A;  20GS A;  2PPT A;  4G0L A;  1SK0 A;  1K0A A;  4MZW A;  4YQM A;  5IMZ A;  2AV4 A;  2H6Y A;  2WB9 A;  4K0N A;  3I9V 2;  5IOX A;  2B5E A;  5LCZ A;  1UC7 A;  2LUS A;  4BWQ A;  2PU9 C;  2C3Q A;  3E3E A;  2C0D A;  1Z6N A;  1VF2 A;  5G1K A;  2FGX A;  2L4C A;  2R37 A;  1XBS A;  2PN8 A;  3W6G A;  1WP0 A;  3QAW A;  2F9S A;  2DJK A;  4L8E A;  2GSR A;  3GX0 A;  1ON4 A;  1R7H A;  4BWS A;  5D9T A;  2N5A A;  3RDW A;  4KDU A;  1AUC A;  1YZX A;  3LFL A;  1B9X C;  2X99 A;  3GYK A;  4P3Y B;  3C1R A;  1YDK A;  4EE0 A;  5C04 A;  4ML1 A;  2B7J A;  4TR1 B;  1W4V A;  2ES7 A;  4AF2 A;  3KXO A;  2WZ9 A;  2HYX A;  3KZQ A;  3QR6 A;  2LTK A;  4JZQ A;  3G7Y A;  3P2A A;  2A2S A;  3QDN A;  4N0Z A;  3O6T A;  2H66 A;  2VD0 A;  1SD9 A;  1AW9 A;  1V57 A;  4IQ1 A;  2YZU A;  2K6V A;  5DQY A;  1PKZ A;  4IN0 A;  5GST A;  1SEN A;  3BCK A;  3GMF A;  2QSI A;  2DC5 A;  1Z7P A;  3EIN A;  17GS A;  6GSW A;  3GKX A;  3KP8 A;  1H75 A;  2GS3 A;  2M72 A;  4USS A;  5J4U A;  1TK5 B;  3EUR A;  2DLX A;  1NW2 A;  1YEP A;  9GSS A;  1GUH A;  1X5C A;  1JHB A;  2FD3 A;  2VO4 A;  4PQ1 A;  4LMV A;  4G0I A;  4QL9 A;  2FA4 A;  3HVS A;  1ZL9 A;  1A8L A;  5HR0 A;  2EIQ A;  1E6B A;  4KGI A;  2HRK B;  2E2G A;  2XPE A;  3MSZ A;  2VL3 A;  4ACS A;  2FWH A;  3U5R E;  4G9H A;  2B3S A;  2DJ0 A;  1AIU A;  3GRX A;  5ECQ B;  1BYE A;  2B1K A;  2VAF A;  2VCW A;  2GQM A;  3EWL A;  3UL3 A;  1X9S B;  4EL1 A;  6GSY A;  3JCM L;  2Z9S A;  2V2G A;  1TK8 B;  3FKF A;  2MZC A;  1F37 A;  2MYG A;  4L5O A;  4MF5 A;  3HD5 A;  2P5Q A;  4LLR A;  3KIJ A;  2L59 A;  2VOC A;  3C71 A;  2XHF A;  3GTU B;  2C3T A;  1SL0 B;  1EGO A;  4EC0 A;  3A2X A;  4F82 A;  2DJJ A;  2VM2 A;  4TR0 A;  1PRX A;  3H79 A;  2C1Y A;  2GQK A;  1XPV A;  5KN0 A;  1A2M A;  5CRW A;  3HJO A;  22GS A;  4I2T A;  2CZ2 A;  5E59 A;  2GVP A;  4K1F A;  3FHK A;  3M1G A;  3TJK A;  2YV7 A;  2H1A A;  5ENU A;  2WDU A;  2E0Q A;  2OAC A;  5D9V A;  1MDK A;  3IK9 A;  2BMX A;  2OE1 A;  2UZ8 A;  3FRC A;  1U3A A;  2HSY A;  4DSQ A;  4RQR A;  2WGR A;  5A4U A;  4HI7 A;  1FB0 A;  1I9D A;  2H8L A;  1ZZY A;  2H0I A;  3HVV A;  4F03 A;  1FAA A;  1TRS A;  4GLT A;  1WPI A;  5IPH A;  5AIS A;  1O81 A;  1A23 A;  1GSQ A;  1GL8 A;  2F8F A;  1S3D A;  1V58 A;  1TI3 A;  1A8Y A;  2KUC A;  4EKZ A;  4ZBA A;  2ZNM A;  1GWC A;  4KA0 A;  2PBJ A;  5CO3 A;  4ISD A;  5L71 A;  1TXX A;  1G7E A;  5IMF A;  1V98 A;  3TKR A;  4WR5 A;  3KTL A;  5HQP A;  1M99 A;  1GSE A;  4AGS A;  1OC9 A;  2IN3 A;  3QPM A;  1X5E A;  2VLU A;  3IK7 A;  2DJ1 A;  3C1S A;  5CRH A;  3J7Y b;  4KCA A;  3DD3 A;  2K9F A;  3H1N A;  2R2J A;  4XRA A;  5G5F A;  2AAW A;  3FY7 A;  4Q5R A;  3APS A;  1A2L A;  5JWR B;  3D21 A;  4XCS A;  1R5A A;  1VF1 A;  1JZO A;  3MDK A;  1WE0 A;  1R26 A;  1XOA A;  2WCI A;  6GSX A;  4PUR A;  5ID2 B;  2QKE A;  4DEJ A;  4FH8 A;  4FQU A;  2KOK A;  4AJ8 A;  4F2I A;  3UVH A;  3FZA A;  4EF0 A;  3LGC A;  2FWG A;  1F3A A;  3QOU A;  4L0W A;  2KHP A;  3F0I A;  3H8Q A;  1M9B A;  5F06 A;  1V9W A;  2R4V A;  3CYN A;  4O92 A;  2YAN A;  2OJL A;  4MK3 A;  1RW1 A; 
#chains in the Genus database with same CATH topology
 4ZIL A;  5KEJ A;  2X4A A;  1OC3 A;  4XHM A;  1J9B A;  4IJ3 A;  3IA1 A;  4JU5 A;  4POM A;  5B8A A;  4IKH A;  4BA7 A;  4KND A;  5A5K A;  1ZYN A;  3LSZ A;  4ZL9 A;  4O5R A;  5DAK A;  3CXG A;  4KSM A;  2JU5 A;  3L0H A;  4EXJ A;  3M8N A;  2CVB A;  4ZB9 A;  5ELA A;  1EV4 A;  1TXU A;  3WT2 A;  1FG4 A;  4D73 A;  2FY6 A;  3R3E A;  5ECP B;  5D93 A;  4MNN A;  2BJX A;  3ME8 A;  1TW9 A;  2V6O A;  3QCP A;  1OE7 A;  3ED3 A;  3EMX A;  3GN3 A;  2YZH A;  1VRS D;  1O85 A;  4F9Z A;  5EY6 A;  2O3E A;  2LRN A;  1T7P B;  3H4K A;  1KTE A;  2EFC A;  5G5E A;  3GSS A;  2LRC A;  3TKQ A;  4QQ7 A;  3TJF A;  2LKU A;  3UIW A;  3ZIV A;  4GXZ A;  1QQ2 A;  2JZS A;  4JED A;  1SK1 A;  1ERV A;  5ECI B;  1SL2 B;  1HNA A;  4A5P A;  5ECN B;  1DE1 A;  4Z2R A;  3CSI A;  4LMW A;  1YKA A;  4ILF A;  1GSD A;  4KDX A;  1JLV A;  5ECR B;  1XVQ A;  2WFC A;  4GCI A;  1X9W B;  4OO5 A;  1M9A A;  3MYD A;  1FO5 A;  1T1V A;  3US3 A;  1C72 A;  2JAD A;  2HZF A;  4HQS A;  3GKM A;  14GS A;  3F63 A;  3EPT A;  5H5S A;  1ZMA A;  1A24 A;  4G19 A;  4KCE A;  1PKW A;  3VPT A;  1OKT A;  1K0O A;  3L78 A;  3IBH A;  2CAQ A;  2O36 A;  5ECO B;  2AUV A;  1WRY A;  5INY A;  3EU3 A;  4O32 A;  1CQG A;  4EDY A;  2YN1 A;  3GUS A;  2OBI A;  1YKC A;  2WW0 A;  3DKS A;  2H75 A;  5DDL A;  2DIZ A;  1SKW B;  2PWJ A;  2EC4 A;  4I2U A;  4K7O A;  4N0V A;  3KJY A;  1V2A A;  1SU9 A;  5KN1 A;  2IWT A;  3P90 A;  4BL7 A;  2V41 A;  4K9Z A;  2AHE A;  2WVZ A;  3FR9 A;  3D4T A;  5A1N B;  2H71 A;  4I5Q A;  2G0F A;  3FZ9 A;  1K0C A;  2FWF A;  2F51 A;  4BIK A;  2HSN A;  3LQ7 A;  1T4Y A;  3BJ5 A;  4HZ4 A;  2OAD A;  3GV1 A;  4MCU A;  3TOU A;  5DJM A;  4RI7 A;  1MTC A;  2DMM A;  4DSS A;  5CAX A;  2A2R A;  1EP7 A;  4DVC A;  4GRF A;  1GSU A;  1X9M B;  19GS A;  1M7T A;  1SVL A;  2HRF A;  1SKR B;  2L5O A;  4HEA 2;  3APO A;  5B8B A;  2CA8 A;  5G1L A;  3CBU A;  5CNW A;  2LST A;  3TB2 A;  3TRX A;  5AN1 A;  1OC9 B;  1GSF A;  2X49 A;  3FZ5 A;  3QAV A;  1GLP A;  3HVN A;  5EPF A;  2QC7 A;  1PQN A;  3VWX A;  1URM A;  5EVO A;  1HD2 A;  1XFL A;  2A4V A;  2WZS A;  5F0G A;  3ZLP A;  3TJJ A;  3ZL5 A;  3I43 A;  4KSO A;  3TJG A;  5IOW A;  2NTO A;  2H1D A;  2XPD A;  2LRT A;  1SYX A;  5E4W A;  1A0F A;  1J0F A;  1WJK A;  1MEK A;  1ERT A;  1XWB A;  2EFE A;  1K0D A;  3ZRD A;  4KDY A;  3HY2 A;  3LW9 A;  5IMA A;  5IO0 A;  1U6T A;  1I1I P;  1ERU A;  6GSV A;  4FYU A;  4MJB A;  2C0G A;  3CMI A;  2WRT A;  1HNC A;  5AGY A;  3UEM A;  4N11 A;  3ZRE A;  5LNK e;  3GL5 A;  3D0Z A;  1ZYQ B;  4L0U A;  3P8W A;  3O3T A;  2FLS A;  2GT6 A;  1BED A;  2REM A;  3QAG A;  1F3B A;  1GUM A;  4Q5N A;  3FW2 A;  3GH9 A;  4J57 E;  3CTF A;  1ZOF A;  4ZBB A;  3F6D A;  4Q5Q A;  2VUP A;  4ULX A;  4MA9 A;  3DEX A;  3GNJ A;  3LXT A;  4KE3 A;  3LEF A;  2RM5 A;  5F8B A;  4JBB A;  3A2W A;  3VLN A;  4ZIJ A;  2H73 A;  4IP1 A;  5DAK B;  4PNF A;  1QK8 A;  5DCG A;  1GSY A;  5BMU A;  1ERW A;  4D73 B;  1UA5 A;  1S3A A;  5IPG A;  5GAN D;  4L5L A;  2RUF A;  2HQT A;  4KB3 A;  1EV9 A;  2FWE A;  4KX4 A;  4XS1 A;  3TUE A;  4K2D A;  4MZB A;  4JE1 A;  4V1A p;  1B8X A;  1TOF A;  3IHG A;  5HR1 A;  5J3R A;  4K7I A;  5CP1 A;  3Q18 A;  2K8S A;  2LQQ A;  3HDC A;  3TRP A;  2C0F A;  1KNG A;  4IHU A;  1GH2 A;  2VCV A;  1M2D A;  1O8X A;  4G01 A;  4G0K A;  3E9J B;  1MD4 A;  2XBI A;  3Q6O A;  3UVT A;  1XIY A;  4ID0 A;  5JCG A;  3U6V A;  4WF5 A;  1X0R A;  2CV4 A;  1ABA A;  4GSN A;  3UAR A;  2YWN A;  1OAZ A;  1GTI A;  2GTU A;  2H6X A;  2H01 A;  2JZT A;  5G31 A;  4O7H A;  1HQO A;  2R0G A;  4Q5F A;  3VK9 A;  2VD1 A;  3V1W A;  1WMJ A;  4PQI A;  4ICY A;  4MPF A;  1AC1 A;  1TP9 A;  4GQF A;  1U87 A;  2JSZ A;  4TRX A;  5B6N A;  4QMK A;  5COH A;  5JWQ B;  1YVL A;  2VL2 C;  3F4R A;  4IJI A;  1U3I A;  3Q74 A;  2NPB A;  5J9C A;  2I4A A;  3FEU A;  1MDJ A;  2B5Y A;  1LBK A;  2HT9 A;  1PSQ A;  5H5R A;  1PL2 A;  4YAP A;  4CW9 A;  2JL4 A;  1TRV A;  4PUF C;  1FB6 A;  3IC8 A;  3ZFB A;  4LL1 B;  4BL7 B;  2WW1 A;  1GUK A;  2VLT A;  1JLW A;  2YWO A;  5IQY A;  4BVY B;  1KBN A;  3QFA C;  2HXK A;  2L6D A;  3RHC A;  3F6F A;  2OE3 A;  4O5Q A;  3GH6 A;  3E0U A;  5DBQ A;  3W8J A;  1FVK A;  4DSS B;  2GSQ A;  4KAE A;  1GSS A;  2HZE A;  3HZ4 A;  1YQ1 A;  2OE0 A;  5AIV A;  2O7K A;  3QFB C;  2ON5 A;  4WF4 A;  3L9U A;  2J9H A;  1SYR A;  2H0H A;  1GNE A;  3H93 A;  5A34 A;  3IXR A;  5JCU A;  1EOG A;  1GLQ A;  4IW9 A;  4XIH A;  1I5G A;  4FYB A;  3UBL A;  2I1U A;  2K8V A;  2N5F A;  3G7J A;  1SVM A;  3NOF A;  1TK0 B;  4PUA A;  3WGD A;  4DSR A;  3TOT A;  2CX3 A;  5GSS A;  4WXT A;  4NAX A;  12GS A;  3DVW A;  3KEB A;  4YKF A;  5DVB A;  1CQH A;  2IFQ A;  1TRU A;  5ECK B;  1EP8 A;  2FA8 A;  4OFN A;  3IPZ A;  5IM9 A;  4X0X A;  2PUK C;  5ECH B;  2E7P A;  5JWO B;  1XCC A;  1VF3 A;  4O5U A;  2HNL A;  2DJ2 A;  1M0U A;  4KH7 A;  4K7N A;  3KH9 A;  4OO4 A;  1GRX A;  1F6M C;  1HNB A;  3KH7 A;  1M3I A;  2DBC A;  2H70 A;  2VKZ G;  5JCW A;  1PX7 A;  1BF5 A;  4V2M A;  2GDR A;  1B4Q A;  4MH3 A;  4NHZ A;  3QMX A;  1XOB A;  2LJR A;  4ZB8 A;  3HA9 A;  4J2F A;  1G7O A;  4GDF A;  3GL3 A;  1YJ6 A;  4K5S A;  2CVK A;  1QUW A;  3D22 A;  3M9K A;  4ZL8 A;  2R5G A;  4IBP A;  1N2A A;  2GQL A;  4MJC A;  4I6X A;  4PHZ C;  2VCX A;  3LOR A;  4EIP A;  3WGE A;  3FR3 A;  3KGK A;  1KEB A;  5ECS A;  4IS0 A;  3LXZ A;  3D4M A;  3LG6 A;  5J9B A;  3G7I A;  1GTB A;  3CTG A;  2CZ3 A;  2L5L A;  18GS A;  3TU3 B;  5BMU B;  1X5D A;  2QA1 A;  1W89 A;  4PX1 A;  2B1L A;  4MJA A;  1TKD B;  1QXH A;  5G30 A;  4FO5 A;  3C8E A;  3FYG A;  1K0M A;  2H19 A;  4CDO A;  2H1G A;  2UV8 G;  3EU4 A;  3ISO A;  2YWM A;  3TKS C;  4JR4 A;  2GST A;  2HLS A;  5IO2 A;  1Z3E A;  3ERW A;  2LJA A;  1S4B P;  4XRD A;  3TKS A;  4MH2 A;  1MD3 A;  4FXY P;  3F4S A;  2HRN A;  2C80 A;  2V6K A;  3IHQ A;  5F05 A;  2O8V B;  3IAM 2;  2NDO A;  3DXB A;  1TJD A;  4NWY A;  4NV5 A;  3C7M A;  3RPN A;  1OVN A;  4AJ7 A;  4EO3 A;  2EIR A;  3IRA A;  3PGT A;  3ZML A;  4ZL7 A;  2GZP A;  2K18 A;  3I69 A;  1XXU A;  3CQF A;  4TKY A;  1JFU A;  3KTB A;  2WS2 A;  1WIK A;  4KW6 A;  1PD2 1;  2VCZ A;  1IYH A;  3VI7 A;  4QL7 A;  1ZGN A;  1TU7 A;  2DKI A;  5A5H A;  2RUE A;  1PX6 A;  3RHB A;  2WVX A;  4MAB A;  5LD0 A;  2I9H A;  1K3Y A;  3N9J A;  3WGX A;  2D2Z A;  2HRK A;  4F0B A;  3BD2 A;  4RUV A;  1ZYP A;  4NV2 A;  5B7C A;  4J56 E;  3GFK A;  3P7X A;  4KF9 A;  2HRA A;  2IME A;  3CSJ A;  2JAC A;  3ZIT A;  4PTS A;  2YOI A;  3UJ1 A;  2GZZ A;  2H0G A;  2M80 A;  1QFN A;  4TR3 A;  1OC8 A;  3PIN A;  1RK4 A;  3UBK A;  3LYP A;  10GS A;  2VCT A;  1IYI A;  2DJ3 A;  4E68 A;  3ZYW A;  3S9F A;  3KMN A;  2LQO A;  2X64 A;  4PQH A;  3VWV A;  3CWG A;  1JZR A;  5ECL B;  2VCQ A;  4GSS A;  4AI6 A;  1K0B A;  3HYP A;  2HZE B;  5DAL A;  4Z7X A;  4GST A;  1Q98 A;  2V1M A;  2GLR A;  3NIV A;  3CHX C;  2C4J A;  4LL4 B;  1YF0 A;  3F8U A;  1TDI A;  1OYJ A;  3IC4 A;  5A34 B;  3ZZX A;  1K3O A;  4MZC A;  5D73 A;  4ZXG A;  5HR2 A;  3L9S A;  4XTS A;  2NVL A;  6GSU A;  2LNS A;  2R6K A;  4TVE A;  1JZD A;  1XVW A;  1R5P A;  5IMC A;  4BPY A;  4AKH A;  2YCD A;  4I8B A;  5GZZ B;  3EC3 A;  5GAP D;  2F3M A;  3ERG A;  3FK8 A;  1N8J A;  4TW5 A;  1AAZ A;  1F9M A;  3LJR A;  1XWA A;  2HFD A;  4GWR A;  3IAS 2;  4PNG A;  2MMZ A;  2AB6 A;  4JR6 A;  4POB A;  2PMT A;  1O7U A;  3UMA A;  4ZB6 A;  3VPQ A;  2TIR A;  4YH2 A;  3CRT A;  3GST A;  3VI5 A;  4TXO A;  2MBS A;  4ECI A;  1THO A;  5KOW A;  2P5R A;  4FIW A;  1FVJ A;  2J23 A;  2MBT A;  1UVZ A;  1Z6M A;  4OFT A;  1GP1 A;  2PER A;  2CQ9 A;  4IEL A;  1SJ6 A;  3MIX A;  1EEM A;  2TRC P;  2RII A;  2MMO A;  3I6A A;  3IE3 A;  5ELG A;  2O89 A;  1BG1 A;  1DBY A;  4TOP A;  3GUR A;  2H6Z A;  1M2A A;  4EDZ A;  3RAZ A;  1XW6 A;  1TU8 A;  2IPA A;  2GGT A;  1FW1 A;  4V1A g;  1VF4 A;  2QGV A;  3AY8 A;  2OA7 A;  1F2E A;  3EYT A;  1BJX A;  4HJ2 A;  1JZW A;  1Z9H A;  2H72 A;  2IJY A;  1ML6 A;  3M3M A;  4MJE A;  5ID2 A;  5D9X A;  2I3Y A;  2VM1 A;  3KD0 A;  2IMD A;  1ST9 A;  5CRD A;  3TDG A;  4RQX A;  3DWV A;  2HI7 A;  4HU9 A;  16GS A;  3O76 A;  3BBY A;  2KP2 A;  5D9W A;  3G9B A;  3BCI A;  1EZK A;  1NM3 A;  3ME7 A;  2FHE A;  1Y25 A;  4TXV A;  3CRU A;  3HHV A;  1EOH A;  3C73 A;  1T3B A;  3R2Q A;  2R3X A;  2ALB A;  3A5W A;  3VFI A;  1SD8 A;  1XWK A;  3GA4 A;  4I97 A;  2VIM A;  4PXO A;  5HFG A;  5J4Y A;  3RPP A;  3ZTL A;  5J41 A;  1VGL A;  3QD9 A;  5AIX A;  4MDC A;  1ACV A;  2EIO A;  2PVQ A;  2O87 A;  3WD6 A;  1PL1 A;  1LU4 A;  1R4W A;  1SJZ A;  2X8H A;  4X43 A;  1WOU A;  3DML A;  3TCO A;  4PI0 C;  3TKS E;  1K3L A;  5A5H B;  4YQV A;  3HZ8 A;  4GQC A;  2WVX B;  2GSS A;  4HOJ A;  1O73 A;  1TRW A;  2KP1 A;  4NPB A;  2YJ7 A;  8GSS A;  4MF7 A;  3N5O A;  3WT1 A;  1Y6E A;  3EE2 A;  4POK A;  2OKA A;  4YQU A;  4HSC X;  5DCH A;  4HJM A;  4LA1 A;  1B4P A;  2YWI A;  4V2N A;  2X8G A;  5HFK A;  4OD7 A;  2OBK A;  1O8W A;  2HSM A;  4POL A;  4TN8 A;  1G6W A;  2L57 A;  4X1U A;  2P31 A;  2VL2 A;  5H5Q A;  1AQW A;  3L9V A;  2GT5 A;  2L6C A;  1OKD A;  3IOS A;  5KOX A;  2KLX A;  2WUL A;  2LS5 A;  1E2Y A;  5FHI A;  2O85 A;  3LWA A;  5DAL B;  2P0G A;  1SJI A;  3DVX A;  5J40 A;  2RLI A;  4N10 A;  4MF6 A;  3TKP A;  1GUL A;  2YP6 A;  3Q19 A;  3BOA A;  2IMF A;  1TI1 A;  2HSN B;  3ZMK A;  3D6I A;  2PGT A;  4F0C A;  4XS4 A;  3HKR A;  3APQ A;  2WW2 A;  4CHS A;  1THX A;  4E8E A;  1YY7 A;  1YF1 A;  1NHO A;  1FHE A;  5F07 A;  2TRX A;  1NSW A;  1USB A;  2CAI A;  1XW5 A;  2XC2 A;  4OCE A;  2B6M A;  1XW9 A;  4BVX A;  3EVI A;  3ZIJ A;  1O6J A;  2YJH A;  2MMA A;  4IVF A;  4NHW A;  4WBR D;  3KP9 A;  2GZY A;  2CVD A;  5A1N A;  4WBJ A;  1A0R P;  2LJK A;  3UAP A;  1S3C A;  4ML6 A;  4EUY A;  5HR3 A;  1BAY A;  1PMT A;  4WR4 A;  3RGB C;  5HFI A;  3ZVJ A;  1DUG A;  4TXO B;  1AQX A;  1G0T A;  3F4T A;  1EGR A;  4WKW A;  2E2M A;  3VWU A;  1DSB A;  1Z5Y E;  2PVO C;  3IR4 A;  1G6Y A;  1M2B A;  2VL9 A;  6GST A;  11GS A;  1GTA A;  2H1B A;  2VLV A;  3F3R A;  1AQV A;  2YV9 A;  2C0E A;  4ECB A;  2BTO T;  2MMN A;  1BX9 A;  1AXD A;  3RBT A;  2RM6 A;  5KN3 A;  5J47 A;  4MP4 A;  2YNX A;  1GNW A;  1PGT A;  5FWG A;  3EMP A;  2H76 A;  4XS6 A;  3MAK A;  1ZYE A;  4YAV A;  2H74 A;  2LV3 A;  2DIY A;  4JRR A;  3DIE A;  1YEW C;  3KMO A;  5IMD A;  2X8C A;  2C3N A;  2WJU A;  2DML A;  5J5N A;  4HDE A;  4WEY A;  3J7Y k;  3TGZ A;  2ZUP A;  1B48 A;  2H30 A;  1B9Y C;  2CX4 A;  2N5B A;  3CSH A;  1BG5 A;  3A2V A;  5A4V A;  3MNG A;  4GTU A;  2L4Q A;  2B5X A;  3D5J A;  2CT6 A;  2I81 A;  1GTU A;  5ECM B;  7GSS A;  4TR1 A;  2FUG 2;  1Q4J A;  3F3Q A;  2LEG A;  1K0N A;  3PH9 A;  4OMV A;  2LNT A;  3IV4 A;  4N30 A;  1T8E B;  1XZO A;  3VWW A;  3LYK A;  4NXI A;  5D96 A;  1EWX A;  1ZCP A;  4YKG A;  1U88 A;  1NHY A;  2IL3 A;  1Z7R A;  5FT3 A;  1ILO A;  3M9J A;  4ZBD A;  4ZB7 A;  2WW3 A;  4CY6 A;  1QMV A;  2ON7 A;  2NBS A;  3PR8 A;  4MMM A;  3GKN A;  2M46 A;  4PI2 C;  2F8A A;  1FOV A;  1Y1U A;  2AYT A;  2WVY A;  3FR6 A;  3ZFL A;  3HJP A;  3M0F A;  3HXS A;  1N25 A;  1HYU A;  4AJ6 A;  4G10 A;  4HUA A;  4IQA A;  2AJQ B;  2G2Q A;  3MWH A;  5G2Z A;  2XBQ A;  4HS1 A;  4H86 A;  4ECC A;  4KUN A;  3A3T A;  3GIX A;  2IIY A;  1RQM A;  4K6X A;  3GHA A;  2HSM B;  2YPM A;  1V40 A;  2R0C A;  2JZR A;  13GS A;  4EVM A;  5IIZ A;  1BQ7 A;  2DSA A;  2IMI A;  1MDI A;  4K0G A;  5A4W A;  3F9U A;  3PPU A;  5B6M A;  2O5V A;  3DYR A;  4TR4 A;  3W8S A;  5CRG A;  2FNO A;  4PGT A;  4ECJ A;  4MPG A;  4OCF A;  4OFM A;  4WET A;  1SK2 A;  3VUR A;  2B7K A;  1YEX A;  2ZCT A;  5DQS A;  1PN9 A;  2QA2 A;  3SWL A;  5EL8 A;  1DE2 A;  3GTU A;  4XS4 B;  1XWC A;  3HMJ G;  2R0P A;  5C00 A;  3DRN A;  3WYW A;  1WWJ A;  1SKS B;  5ABR A;  1SL1 B;  4OWY A;  2HE3 A;  2IMK A;  5DJL A;  3TRQ A;  4IGJ A;  1A2J A;  6GSS A;  3NZN A;  4AKI A;  2JSY A;  1EEJ A;  1J08 A;  4BVX B;  2C8U A;  1PA3 A;  1T4Z A;  1UN2 A;  1H4O A;  1SVO A;  1QGV A;  5KN2 A;  3K8N A;  4AKG A;  3TJB A;  3ERF A;  1LJR A;  1OE8 A;  4BVY A;  3HCZ A;  3L4N A;  3KCM A;  5D8I A;  4V2L A;  1T00 A;  2IFQ B;  3KM6 A;  4K8M A;  1TTZ A;  4MLY A;  3HJM A;  4HU7 A;  4IP6 A;  4NMU A;  2EFH A;  3SBC A;  3GX8 A;  3UOM A;  2V32 A;  5IMV A;  3IDV A;  5CRE A;  3OR5 A;  4HZ2 A;  1XWG A;  3FZ4 A;  5CYY A;  4RI6 A;  4FYC A;  3HVX A;  3ZVJ D;  4Z2U A;  2FCH A;  4E8H A;  4G2E A;  3DGQ A;  4GF0 A;  2HSH A;  3GKK A;  4AKX B;  4HQZ A;  20GS A;  2PPT A;  4G0L A;  1SK0 A;  1K0A A;  4MZW A;  4YQM A;  5IMZ A;  2AV4 A;  2H6Y A;  2WB9 A;  4K0N A;  3I9V 2;  5IOX A;  2B5E A;  5LCZ A;  1UC7 A;  2LUS A;  4BWQ A;  2PU9 C;  2C3Q A;  3E3E A;  2C0D A;  1Z6N A;  1VF2 A;  5G1K A;  2FGX A;  2L4C A;  2R37 A;  1XBS A;  2PN8 A;  3W6G A;  1WP0 A;  3QAW A;  2F9S A;  2DJK A;  4L8E A;  2GSR A;  3GX0 A;  1ON4 A;  1R7H A;  4BWS A;  5D9T A;  2N5A A;  3RDW A;  4KDU A;  1AUC A;  1YZX A;  3LFL A;  1B9X C;  2X99 A;  3GYK A;  4P3Y B;  3C1R A;  1YDK A;  4EE0 A;  5C04 A;  4ML1 A;  2B7J A;  4TR1 B;  1W4V A;  2ES7 A;  4AF2 A;  3KXO A;  2WZ9 A;  2HYX A;  3KZQ A;  2A4H A;  1PN0 A;  3QR6 A;  2LTK A;  4JZQ A;  3G7Y A;  3P2A A;  2A2S A;  3QDN A;  2EFD A;  2DKH A;  4N0Z A;  3O6T A;  2H66 A;  2VD0 A;  1SD9 A;  1AW9 A;  1V57 A;  4IQ1 A;  2YZU A;  2K6V A;  5DQY A;  1PKZ A;  4IN0 A;  5GST A;  1SEN A;  3BCK A;  3GMF A;  4EIQ A;  2QSI A;  2DC5 A;  1Z7P A;  3EIN A;  17GS A;  4K2X A;  6GSW A;  3GKX A;  3KP8 A;  1H75 A;  2GS3 A;  2M72 A;  4USS A;  5J4U A;  1TK5 B;  3EUR A;  2DLX A;  1NW2 A;  1YEP A;  9GSS A;  1GUH A;  1X5C A;  1JHB A;  2FD3 A;  2VO4 A;  4PQ1 A;  4LMV A;  4G0I A;  4QL9 A;  2FA4 A;  3HVS A;  1ZL9 A;  1A8L A;  5HR0 A;  2EIQ A;  1E6B A;  4KGI A;  1PFO A;  2HRK B;  2E2G A;  2XPE A;  3MSZ A;  2VL3 A;  4ACS A;  2FWH A;  4K5R A;  3U5R E;  3FMW A;  3A5I A;  4G9H A;  2B3S A;  3GRX A;  2H1L A;  1AIU A;  5ECQ B;  2DJ0 A;  1BYE A;  2B1K A;  2VAF A;  2OT3 A;  2VCW A;  2GQM A;  3EWL A;  3UL3 A;  1X9S B;  4EL1 A;  6GSY A;  3JCM L;  2Z9S A;  2V2G A;  1TK8 B;  3FKF A;  2MZC A;  1FOH A;  1F37 A;  2MYG A;  4L5O A;  4MF5 A;  3HD5 A;  2P5Q A;  4LLR A;  3KIJ A;  2L59 A;  2VOC A;  5J4V A;  3C71 A;  2XHF A;  3GTU B;  2C3T A;  1SL0 B;  1EGO A;  4EC0 A;  3A2X A;  4N3Z A;  4F82 A;  2DJJ A;  2VM2 A;  4TR0 A;  1PRX A;  3H79 A;  2C1Y A;  2GQK A;  1XPV A;  5KN0 A;  1A2M A;  5CRW A;  3HJO A;  22GS A;  4I2T A;  2CZ2 A;  4Z2T A;  5E59 A;  2GVP A;  4K1F A;  3FHK A;  2A2P A;  5BRT A;  3M1G A;  3TJK A;  2YV7 A;  2H1A A;  4X4J A;  5ENU A;  2WDU A;  2E0Q A;  2OAC A;  5D9V A;  1MDK A;  3IK9 A;  2BMX A;  2OE1 A;  2UZ8 A;  3FRC A;  1U3A A;  2HSY A;  4DSQ A;  4RQR A;  2WGR A;  1S3R A;  5A4U A;  4HI7 A;  1FB0 A;  1I9D A;  2H8L A;  1ZZY A;  2H0I A;  3HVV A;  4F03 A;  1FAA A;  1TRS A;  4GLT A;  1WPI A;  5IPH A;  5AIS A;  1O81 A;  1A23 A;  1GSQ A;  1GL8 A;  2F8F A;  1S3D A;  1V58 A;  1TI3 A;  1A8Y A;  2KUC A;  4EKZ A;  4ZBA A;  2ZNM A;  4W66 A;  1GWC A;  4KA0 A;  2PBJ A;  5CO3 A;  4ISD A;  5L71 A;  1TXX A;  1G7E A;  5IMF A;  1V98 A;  3TKR A;  4WR5 A;  3KTL A;  5HQP A;  1M99 A;  1GSE A;  4AGS A;  1OC9 A;  2IN3 A;  3QPM A;  1X5E A;  2VLU A;  3IK7 A;  2DJ1 A;  3C1S A;  5CRH A;  3J7Y b;  4KCA A;  3DD3 A;  2K9F A;  3H1N A;  2R2J A;  4XRA A;  5G5F A;  2AAW A;  3FY7 A;  4Q5R A;  3APS A;  1A2L A;  5JWR B;  3D21 A;  4XCS A;  1R5A A;  1VF1 A;  1JZO A;  3MDK A;  1WE0 A;  1R26 A;  1XOA A;  2WCI A;  6GSX A;  4PUR A;  5ID2 B;  2QKE A;  4DEJ A;  4FH8 A;  4FQU A;  2KOK A;  4AJ8 A;  4F2I A;  3UVH A;  3FZA A;  4EF0 A;  3LGC A;  2FWG A;  1F3A A;  3QOU A;  4L0W A;  3RFR C;  2KHP A;  3F0I A;  3H8Q A;  1M9B A;  5F06 A;  1XG8 A;  1M3J A;  1V9W A;  2R4V A;  3CYN A;  4O92 A;  4CY8 A;  2YAN A;  2OJL A;  4MK3 A;  1RW1 A; 
#chains in the Genus database with same CATH homology
 4ZIL A;  5KEJ A;  2X4A A;  1OC3 A;  4XHM A;  1J9B A;  4IJ3 A;  3IA1 A;  4JU5 A;  4POM A;  5B8A A;  4IKH A;  4BA7 A;  4KND A;  5A5K A;  1ZYN A;  3LSZ A;  4ZL9 A;  4O5R A;  5DAK A;  3CXG A;  4KSM A;  2JU5 A;  3L0H A;  4EXJ A;  3M8N A;  2CVB A;  4ZB9 A;  5ELA A;  1EV4 A;  1TXU A;  3WT2 A;  1FG4 A;  4D73 A;  2FY6 A;  3R3E A;  5ECP B;  5D93 A;  4MNN A;  2BJX A;  3ME8 A;  1TW9 A;  2V6O A;  3QCP A;  1OE7 A;  3ED3 A;  3EMX A;  3GN3 A;  2YZH A;  1VRS D;  1O85 A;  4F9Z A;  5EY6 A;  2LRN A;  1T7P B;  3H4K A;  1KTE A;  2EFC A;  5G5E A;  3GSS A;  2LRC A;  3TKQ A;  4QQ7 A;  3TJF A;  2LKU A;  3UIW A;  3ZIV A;  4GXZ A;  1QQ2 A;  2JZS A;  4JED A;  1SK1 A;  1ERV A;  5ECI B;  1SL2 B;  1HNA A;  4A5P A;  5ECN B;  1DE1 A;  4Z2R A;  3CSI A;  4LMW A;  1YKA A;  4ILF A;  1GSD A;  4KDX A;  1JLV A;  5ECR B;  1XVQ A;  2WFC A;  4GCI A;  1X9W B;  4OO5 A;  1M9A A;  3MYD A;  1FO5 A;  1T1V A;  3US3 A;  1C72 A;  2JAD A;  2HZF A;  4HQS A;  3GKM A;  14GS A;  3F63 A;  3EPT A;  5H5S A;  1ZMA A;  1A24 A;  4G19 A;  4KCE A;  1PKW A;  3VPT A;  1OKT A;  1K0O A;  3L78 A;  3IBH A;  2CAQ A;  5ECO B;  2AUV A;  1WRY A;  5INY A;  3EU3 A;  4O32 A;  1CQG A;  4EDY A;  2YN1 A;  3GUS A;  2OBI A;  1YKC A;  3DKS A;  2H75 A;  5DDL A;  2DIZ A;  1SKW B;  2PWJ A;  2EC4 A;  4I2U A;  4K7O A;  4N0V A;  3KJY A;  1V2A A;  1SU9 A;  5KN1 A;  2IWT A;  3P90 A;  4BL7 A;  2V41 A;  4K9Z A;  2AHE A;  3FR9 A;  3D4T A;  5A1N B;  2H71 A;  4I5Q A;  2G0F A;  3FZ9 A;  1K0C A;  2FWF A;  2F51 A;  2HSN A;  3LQ7 A;  1T4Y A;  3BJ5 A;  4HZ4 A;  2OAD A;  3GV1 A;  4MCU A;  3TOU A;  5DJM A;  4RI7 A;  1MTC A;  2DMM A;  4DSS A;  5CAX A;  2A2R A;  1EP7 A;  4DVC A;  4GRF A;  1GSU A;  1X9M B;  19GS A;  1M7T A;  1SVL A;  2HRF A;  1SKR B;  2L5O A;  4HEA 2;  3APO A;  5B8B A;  2CA8 A;  5G1L A;  3CBU A;  5CNW A;  2LST A;  3TB2 A;  3TRX A;  5AN1 A;  1OC9 B;  1GSF A;  2X49 A;  3FZ5 A;  3QAV A;  1GLP A;  5EPF A;  2QC7 A;  1PQN A;  3VWX A;  1URM A;  5EVO A;  1HD2 A;  1XFL A;  2A4V A;  5F0G A;  3ZLP A;  3TJJ A;  3ZL5 A;  3I43 A;  4KSO A;  3TJG A;  5IOW A;  2NTO A;  2H1D A;  2XPD A;  2LRT A;  1SYX A;  5E4W A;  1A0F A;  1J0F A;  1WJK A;  1MEK A;  1ERT A;  1XWB A;  2EFE A;  1K0D A;  3ZRD A;  4KDY A;  3HY2 A;  3LW9 A;  5IMA A;  5IO0 A;  1U6T A;  1ERU A;  6GSV A;  4FYU A;  4MJB A;  2C0G A;  3CMI A;  2WRT A;  1HNC A;  5AGY A;  3UEM A;  4N11 A;  3ZRE A;  5LNK e;  3GL5 A;  3D0Z A;  1ZYQ B;  4L0U A;  3P8W A;  3O3T A;  2FLS A;  2GT6 A;  1BED A;  2REM A;  3QAG A;  1F3B A;  1GUM A;  4Q5N A;  3FW2 A;  3GH9 A;  4J57 E;  3CTF A;  1ZOF A;  4ZBB A;  3F6D A;  4Q5Q A;  2VUP A;  4ULX A;  4MA9 A;  3DEX A;  3GNJ A;  3LXT A;  4KE3 A;  3LEF A;  2RM5 A;  5F8B A;  4JBB A;  3A2W A;  3VLN A;  4ZIJ A;  2H73 A;  4IP1 A;  5DAK B;  4PNF A;  1QK8 A;  5DCG A;  1GSY A;  5BMU A;  1ERW A;  4D73 B;  1UA5 A;  1S3A A;  5IPG A;  5GAN D;  4L5L A;  2RUF A;  2HQT A;  4KB3 A;  1EV9 A;  2FWE A;  4KX4 A;  4XS1 A;  3TUE A;  4K2D A;  4MZB A;  4JE1 A;  4V1A p;  1B8X A;  1TOF A;  3IHG A;  5HR1 A;  5J3R A;  4K7I A;  5CP1 A;  3Q18 A;  2K8S A;  2LQQ A;  3HDC A;  3TRP A;  2C0F A;  1KNG A;  4IHU A;  1GH2 A;  2VCV A;  1M2D A;  1O8X A;  4G01 A;  4G0K A;  3E9J B;  1MD4 A;  2XBI A;  3Q6O A;  3UVT A;  1XIY A;  4ID0 A;  5JCG A;  3U6V A;  4WF5 A;  1X0R A;  2CV4 A;  1ABA A;  4GSN A;  3UAR A;  2YWN A;  1OAZ A;  1GTI A;  2GTU A;  2H6X A;  2H01 A;  2JZT A;  5G31 A;  4O7H A;  1HQO A;  2R0G A;  4Q5F A;  3VK9 A;  2VD1 A;  3V1W A;  1WMJ A;  4PQI A;  4ICY A;  4MPF A;  1AC1 A;  1TP9 A;  4GQF A;  1U87 A;  2JSZ A;  4TRX A;  5B6N A;  4QMK A;  5COH A;  5JWQ B;  1YVL A;  2VL2 C;  3F4R A;  4IJI A;  1U3I A;  3Q74 A;  2NPB A;  5J9C A;  2I4A A;  3FEU A;  1MDJ A;  2B5Y A;  1LBK A;  2HT9 A;  1PSQ A;  5H5R A;  1PL2 A;  4YAP A;  4CW9 A;  2JL4 A;  1TRV A;  4PUF C;  1FB6 A;  3IC8 A;  3ZFB A;  4LL1 B;  4BL7 B;  1GUK A;  2VLT A;  1JLW A;  2YWO A;  5IQY A;  4BVY B;  1KBN A;  3QFA C;  2HXK A;  2L6D A;  3RHC A;  3F6F A;  2OE3 A;  4O5Q A;  3GH6 A;  3E0U A;  5DBQ A;  3W8J A;  1FVK A;  4DSS B;  2GSQ A;  4KAE A;  1GSS A;  2HZE A;  3HZ4 A;  1YQ1 A;  2OE0 A;  5AIV A;  2O7K A;  3QFB C;  2ON5 A;  4WF4 A;  3L9U A;  2J9H A;  1SYR A;  2H0H A;  1GNE A;  3H93 A;  5A34 A;  3IXR A;  5JCU A;  1EOG A;  1GLQ A;  4IW9 A;  4XIH A;  1I5G A;  4FYB A;  3UBL A;  2I1U A;  2K8V A;  2N5F A;  3G7J A;  1SVM A;  3NOF A;  1TK0 B;  4PUA A;  3WGD A;  4DSR A;  3TOT A;  2CX3 A;  5GSS A;  4WXT A;  4NAX A;  12GS A;  3DVW A;  3KEB A;  4YKF A;  5DVB A;  1CQH A;  2IFQ A;  1TRU A;  5ECK B;  1EP8 A;  2FA8 A;  4OFN A;  3IPZ A;  5IM9 A;  4X0X A;  2PUK C;  5ECH B;  2E7P A;  5JWO B;  1XCC A;  1VF3 A;  4O5U A;  2HNL A;  2DJ2 A;  1M0U A;  4KH7 A;  4K7N A;  3KH9 A;  4OO4 A;  1GRX A;  1F6M C;  1HNB A;  3KH7 A;  2DBC A;  2H70 A;  2VKZ G;  5JCW A;  1PX7 A;  1BF5 A;  4V2M A;  2GDR A;  1B4Q A;  4MH3 A;  4NHZ A;  3QMX A;  1XOB A;  2LJR A;  4ZB8 A;  3HA9 A;  4J2F A;  1G7O A;  4GDF A;  3GL3 A;  1YJ6 A;  4K5S A;  2CVK A;  1QUW A;  3D22 A;  3M9K A;  4ZL8 A;  2R5G A;  4IBP A;  1N2A A;  2GQL A;  4MJC A;  4I6X A;  2VCX A;  3LOR A;  4EIP A;  3WGE A;  3FR3 A;  3KGK A;  1KEB A;  5ECS A;  4IS0 A;  3LXZ A;  3D4M A;  3LG6 A;  5J9B A;  3G7I A;  1GTB A;  3CTG A;  2CZ3 A;  2L5L A;  18GS A;  3TU3 B;  5BMU B;  1X5D A;  2QA1 A;  1W89 A;  4PX1 A;  2B1L A;  4MJA A;  1TKD B;  1QXH A;  5G30 A;  4FO5 A;  3C8E A;  3FYG A;  1K0M A;  2H19 A;  4CDO A;  2H1G A;  2UV8 G;  3EU4 A;  3ISO A;  2YWM A;  3TKS C;  4JR4 A;  2GST A;  2HLS A;  5IO2 A;  1Z3E A;  3ERW A;  2LJA A;  4XRD A;  3TKS A;  4MH2 A;  1MD3 A;  3F4S A;  2HRN A;  2C80 A;  2V6K A;  3IHQ A;  5F05 A;  2O8V B;  3IAM 2;  2NDO A;  3DXB A;  1TJD A;  4NWY A;  4NV5 A;  3C7M A;  3RPN A;  1OVN A;  4AJ7 A;  4EO3 A;  2EIR A;  3IRA A;  3PGT A;  3ZML A;  4ZL7 A;  2GZP A;  2K18 A;  3I69 A;  1XXU A;  4TKY A;  1JFU A;  3KTB A;  2WS2 A;  1WIK A;  4KW6 A;  1PD2 1;  2VCZ A;  1IYH A;  3VI7 A;  4QL7 A;  1ZGN A;  1TU7 A;  2DKI A;  5A5H A;  2RUE A;  1PX6 A;  3RHB A;  4MAB A;  5LD0 A;  2I9H A;  1K3Y A;  3N9J A;  3WGX A;  2D2Z A;  2HRK A;  4F0B A;  3BD2 A;  4RUV A;  1ZYP A;  4NV2 A;  5B7C A;  4J56 E;  3GFK A;  3P7X A;  4KF9 A;  2HRA A;  2IME A;  3CSJ A;  2JAC A;  3ZIT A;  4PTS A;  2YOI A;  3UJ1 A;  2GZZ A;  2H0G A;  2M80 A;  1QFN A;  4TR3 A;  1OC8 A;  3PIN A;  1RK4 A;  3UBK A;  3LYP A;  10GS A;  2VCT A;  1IYI A;  2DJ3 A;  4E68 A;  3ZYW A;  3S9F A;  3KMN A;  2LQO A;  2X64 A;  4PQH A;  3VWV A;  3CWG A;  1JZR A;  5ECL B;  2VCQ A;  4GSS A;  4AI6 A;  1K0B A;  3HYP A;  2HZE B;  5DAL A;  4Z7X A;  4GST A;  1Q98 A;  2V1M A;  2GLR A;  3NIV A;  2C4J A;  4LL4 B;  1YF0 A;  3F8U A;  1TDI A;  1OYJ A;  3IC4 A;  5A34 B;  3ZZX A;  1K3O A;  4MZC A;  5D73 A;  4ZXG A;  5HR2 A;  3L9S A;  4XTS A;  2NVL A;  6GSU A;  2LNS A;  2R6K A;  4TVE A;  1JZD A;  1XVW A;  1R5P A;  5IMC A;  4BPY A;  4AKH A;  2YCD A;  4I8B A;  5GZZ B;  3EC3 A;  5GAP D;  2F3M A;  3ERG A;  3FK8 A;  1N8J A;  4TW5 A;  1AAZ A;  1F9M A;  3LJR A;  1XWA A;  2HFD A;  4GWR A;  3IAS 2;  4PNG A;  2MMZ A;  2AB6 A;  4JR6 A;  4POB A;  2PMT A;  1O7U A;  3UMA A;  4ZB6 A;  3VPQ A;  2TIR A;  4YH2 A;  3CRT A;  3GST A;  3VI5 A;  4TXO A;  2MBS A;  4ECI A;  1THO A;  5KOW A;  2P5R A;  4FIW A;  1FVJ A;  2J23 A;  2MBT A;  1UVZ A;  1Z6M A;  4OFT A;  1GP1 A;  2PER A;  2CQ9 A;  4IEL A;  1SJ6 A;  3MIX A;  1EEM A;  2TRC P;  2RII A;  2MMO A;  3I6A A;  3IE3 A;  5ELG A;  2O89 A;  1BG1 A;  1DBY A;  4TOP A;  3GUR A;  2H6Z A;  1M2A A;  4EDZ A;  3RAZ A;  1XW6 A;  1TU8 A;  2IPA A;  2GGT A;  1FW1 A;  4V1A g;  1VF4 A;  2QGV A;  3AY8 A;  2OA7 A;  1F2E A;  3EYT A;  1BJX A;  4HJ2 A;  1JZW A;  1Z9H A;  2H72 A;  2IJY A;  1ML6 A;  3M3M A;  4MJE A;  5ID2 A;  5D9X A;  2I3Y A;  2VM1 A;  3KD0 A;  2IMD A;  1ST9 A;  5CRD A;  3TDG A;  4RQX A;  3DWV A;  2HI7 A;  4HU9 A;  16GS A;  3O76 A;  3BBY A;  2KP2 A;  5D9W A;  3G9B A;  3BCI A;  1EZK A;  1NM3 A;  3ME7 A;  2FHE A;  1Y25 A;  4TXV A;  3CRU A;  3HHV A;  1EOH A;  3C73 A;  1T3B A;  3R2Q A;  2R3X A;  2ALB A;  3A5W A;  3VFI A;  1SD8 A;  1XWK A;  3GA4 A;  4I97 A;  2VIM A;  4PXO A;  5HFG A;  5J4Y A;  3RPP A;  3ZTL A;  5J41 A;  1VGL A;  3QD9 A;  5AIX A;  4MDC A;  1ACV A;  2EIO A;  2PVQ A;  2O87 A;  3WD6 A;  1PL1 A;  1LU4 A;  1R4W A;  1SJZ A;  2X8H A;  4X43 A;  1WOU A;  3DML A;  3TCO A;  3TKS E;  1K3L A;  5A5H B;  4YQV A;  3HZ8 A;  4GQC A;  2GSS A;  4HOJ A;  1O73 A;  1TRW A;  2KP1 A;  4NPB A;  2YJ7 A;  8GSS A;  4MF7 A;  3N5O A;  3WT1 A;  1Y6E A;  3EE2 A;  4POK A;  2OKA A;  4YQU A;  5DCH A;  4HJM A;  4LA1 A;  1B4P A;  2YWI A;  4V2N A;  2X8G A;  5HFK A;  4OD7 A;  2OBK A;  1O8W A;  2HSM A;  4POL A;  4TN8 A;  1G6W A;  2L57 A;  4X1U A;  2P31 A;  2VL2 A;  5H5Q A;  1AQW A;  3L9V A;  2GT5 A;  2L6C A;  1OKD A;  3IOS A;  5KOX A;  2KLX A;  2WUL A;  2LS5 A;  1E2Y A;  5FHI A;  2O85 A;  3LWA A;  5DAL B;  2P0G A;  1SJI A;  3DVX A;  5J40 A;  2RLI A;  4N10 A;  4MF6 A;  3TKP A;  1GUL A;  2YP6 A;  3Q19 A;  3BOA A;  2IMF A;  1TI1 A;  2HSN B;  3ZMK A;  3D6I A;  2PGT A;  4F0C A;  4XS4 A;  3HKR A;  3APQ A;  4CHS A;  1THX A;  4E8E A;  1YY7 A;  1YF1 A;  1NHO A;  1FHE A;  5F07 A;  2TRX A;  1NSW A;  1USB A;  2CAI A;  1XW5 A;  2XC2 A;  4OCE A;  2B6M A;  1XW9 A;  4BVX A;  3EVI A;  3ZIJ A;  1O6J A;  2YJH A;  2MMA A;  4IVF A;  4NHW A;  4WBR D;  3KP9 A;  2GZY A;  2CVD A;  5A1N A;  4WBJ A;  1A0R P;  2LJK A;  3UAP A;  1S3C A;  4ML6 A;  4EUY A;  5HR3 A;  1BAY A;  1PMT A;  4WR4 A;  5HFI A;  3ZVJ A;  1DUG A;  4TXO B;  1AQX A;  1G0T A;  3F4T A;  1EGR A;  4WKW A;  2E2M A;  3VWU A;  1DSB A;  1Z5Y E;  2PVO C;  3IR4 A;  1G6Y A;  1M2B A;  2VL9 A;  6GST A;  11GS A;  1GTA A;  2H1B A;  2VLV A;  3F3R A;  1AQV A;  2YV9 A;  2C0E A;  4ECB A;  2BTO T;  2MMN A;  1BX9 A;  1AXD A;  3RBT A;  2RM6 A;  5KN3 A;  5J47 A;  4MP4 A;  2YNX A;  1GNW A;  1PGT A;  5FWG A;  3EMP A;  2H76 A;  4XS6 A;  3MAK A;  1ZYE A;  4YAV A;  2H74 A;  2LV3 A;  2DIY A;  4JRR A;  3DIE A;  3KMO A;  5IMD A;  2X8C A;  2C3N A;  2WJU A;  2DML A;  5J5N A;  4HDE A;  4WEY A;  3J7Y k;  3TGZ A;  2ZUP A;  1B48 A;  2H30 A;  1B9Y C;  2CX4 A;  2N5B A;  3CSH A;  1BG5 A;  3A2V A;  5A4V A;  3MNG A;  4GTU A;  2L4Q A;  2B5X A;  3D5J A;  2CT6 A;  2I81 A;  1GTU A;  5ECM B;  7GSS A;  4TR1 A;  2FUG 2;  1Q4J A;  3F3Q A;  2LEG A;  1K0N A;  3PH9 A;  4OMV A;  2LNT A;  3IV4 A;  4N30 A;  1T8E B;  1XZO A;  3VWW A;  3LYK A;  4NXI A;  5D96 A;  1EWX A;  1ZCP A;  4YKG A;  1U88 A;  1NHY A;  2IL3 A;  1Z7R A;  5FT3 A;  1ILO A;  3M9J A;  4ZBD A;  4ZB7 A;  4CY6 A;  1QMV A;  2ON7 A;  2NBS A;  3PR8 A;  4MMM A;  3GKN A;  2M46 A;  2F8A A;  1FOV A;  1Y1U A;  2AYT A;  3FR6 A;  3ZFL A;  3HJP A;  3M0F A;  3HXS A;  1N25 A;  1HYU A;  4AJ6 A;  4G10 A;  4HUA A;  4IQA A;  2AJQ B;  2G2Q A;  3MWH A;  5G2Z A;  2XBQ A;  4HS1 A;  4H86 A;  4ECC A;  4KUN A;  3A3T A;  3GIX A;  2IIY A;  1RQM A;  4K6X A;  3GHA A;  2HSM B;  2YPM A;  1V40 A;  2R0C A;  2JZR A;  13GS A;  4EVM A;  5IIZ A;  1BQ7 A;  2DSA A;  2IMI A;  1MDI A;  4K0G A;  5A4W A;  3F9U A;  3PPU A;  5B6M A;  2O5V A;  3DYR A;  4TR4 A;  3W8S A;  5CRG A;  2FNO A;  4PGT A;  4ECJ A;  4MPG A;  4OCF A;  4OFM A;  4WET A;  1SK2 A;  3VUR A;  2B7K A;  1YEX A;  2ZCT A;  5DQS A;  1PN9 A;  2QA2 A;  3SWL A;  5EL8 A;  1DE2 A;  3GTU A;  4XS4 B;  1XWC A;  3HMJ G;  2R0P A;  5C00 A;  3DRN A;  3WYW A;  1WWJ A;  1SKS B;  5ABR A;  1SL1 B;  4OWY A;  2HE3 A;  2IMK A;  5DJL A;  3TRQ A;  4IGJ A;  1A2J A;  6GSS A;  3NZN A;  4AKI A;  2JSY A;  1EEJ A;  1J08 A;  4BVX B;  2C8U A;  1PA3 A;  1T4Z A;  1UN2 A;  1H4O A;  1SVO A;  1QGV A;  5KN2 A;  3K8N A;  4AKG A;  3TJB A;  3ERF A;  1LJR A;  1OE8 A;  4BVY A;  3HCZ A;  3L4N A;  3KCM A;  5D8I A;  4V2L A;  1T00 A;  2IFQ B;  3KM6 A;  4K8M A;  1TTZ A;  4MLY A;  3HJM A;  4HU7 A;  4IP6 A;  4NMU A;  2EFH A;  3SBC A;  3GX8 A;  3UOM A;  2V32 A;  5IMV A;  3IDV A;  5CRE A;  3OR5 A;  4HZ2 A;  1XWG A;  3FZ4 A;  5CYY A;  4RI6 A;  4FYC A;  3HVX A;  3ZVJ D;  4Z2U A;  2FCH A;  4E8H A;  4G2E A;  3DGQ A;  4GF0 A;  2HSH A;  3GKK A;  4AKX B;  4HQZ A;  20GS A;  2PPT A;  4G0L A;  1SK0 A;  1K0A A;  4MZW A;  4YQM A;  5IMZ A;  2AV4 A;  2H6Y A;  2WB9 A;  4K0N A;  3I9V 2;  5IOX A;  2B5E A;  5LCZ A;  1UC7 A;  2LUS A;  4BWQ A;  2PU9 C;  2C3Q A;  3E3E A;  2C0D A;  1Z6N A;  1VF2 A;  5G1K A;  2FGX A;  2L4C A;  2R37 A;  1XBS A;  2PN8 A;  3W6G A;  1WP0 A;  3QAW A;  2F9S A;  2DJK A;  4L8E A;  2GSR A;  3GX0 A;  1ON4 A;  1R7H A;  4BWS A;  5D9T A;  2N5A A;  3RDW A;  4KDU A;  1AUC A;  1YZX A;  3LFL A;  1B9X C;  2X99 A;  3GYK A;  4P3Y B;  3C1R A;  1YDK A;  4EE0 A;  5C04 A;  4ML1 A;  2B7J A;  4TR1 B;  1W4V A;  2ES7 A;  4AF2 A;  3KXO A;  2WZ9 A;  2HYX A;  3KZQ A;  2A4H A;  1PN0 A;  3QR6 A;  2LTK A;  4JZQ A;  3G7Y A;  3P2A A;  2A2S A;  3QDN A;  2EFD A;  2DKH A;  4N0Z A;  3O6T A;  2H66 A;  2VD0 A;  1SD9 A;  1AW9 A;  1V57 A;  4IQ1 A;  2YZU A;  2K6V A;  5DQY A;  1PKZ A;  4IN0 A;  5GST A;  1SEN A;  3BCK A;  3GMF A;  4EIQ A;  2QSI A;  2DC5 A;  1Z7P A;  3EIN A;  17GS A;  4K2X A;  6GSW A;  3GKX A;  3KP8 A;  1H75 A;  2GS3 A;  2M72 A;  4USS A;  5J4U A;  1TK5 B;  3EUR A;  2DLX A;  1NW2 A;  1YEP A;  9GSS A;  1GUH A;  1X5C A;  1JHB A;  2FD3 A;  2VO4 A;  4PQ1 A;  4LMV A;  4G0I A;  4QL9 A;  2FA4 A;  3HVS A;  1ZL9 A;  1A8L A;  5HR0 A;  2EIQ A;  1E6B A;  4KGI A;  2HRK B;  2E2G A;  2XPE A;  3MSZ A;  2VL3 A;  4ACS A;  2FWH A;  4K5R A;  3U5R E;  3FMW A;  3A5I A;  4G9H A;  2B3S A;  3GRX A;  2H1L A;  1AIU A;  5ECQ B;  2DJ0 A;  1BYE A;  2B1K A;  2VAF A;  2OT3 A;  2VCW A;  2GQM A;  3EWL A;  3UL3 A;  1X9S B;  4EL1 A;  6GSY A;  3JCM L;  2Z9S A;  2V2G A;  1TK8 B;  3FKF A;  2MZC A;  1FOH A;  1F37 A;  2MYG A;  4L5O A;  4MF5 A;  3HD5 A;  2P5Q A;  4LLR A;  3KIJ A;  2L59 A;  2VOC A;  5J4V A;  3C71 A;  2XHF A;  3GTU B;  2C3T A;  1SL0 B;  1EGO A;  4EC0 A;  3A2X A;  4N3Z A;  4F82 A;  2DJJ A;  2VM2 A;  4TR0 A;  1PRX A;  3H79 A;  2C1Y A;  2GQK A;  1XPV A;  5KN0 A;  1A2M A;  5CRW A;  3HJO A;  22GS A;  4I2T A;  2CZ2 A;  4Z2T A;  5E59 A;  2GVP A;  4K1F A;  3FHK A;  2A2P A;  5BRT A;  3M1G A;  3TJK A;  2YV7 A;  2H1A A;  4X4J A;  5ENU A;  2WDU A;  2E0Q A;  2OAC A;  5D9V A;  1MDK A;  3IK9 A;  2BMX A;  2OE1 A;  2UZ8 A;  3FRC A;  1U3A A;  2HSY A;  4DSQ A;  4RQR A;  2WGR A;  5A4U A;  4HI7 A;  1FB0 A;  1I9D A;  2H8L A;  1ZZY A;  2H0I A;  3HVV A;  4F03 A;  1FAA A;  1TRS A;  4GLT A;  1WPI A;  5IPH A;  5AIS A;  1O81 A;  1A23 A;  1GSQ A;  1GL8 A;  2F8F A;  1S3D A;  1V58 A;  1TI3 A;  1A8Y A;  2KUC A;  4EKZ A;  4ZBA A;  2ZNM A;  4W66 A;  1GWC A;  4KA0 A;  2PBJ A;  5CO3 A;  4ISD A;  5L71 A;  1TXX A;  1G7E A;  5IMF A;  1V98 A;  3TKR A;  4WR5 A;  3KTL A;  5HQP A;  1M99 A;  1GSE A;  4AGS A;  1OC9 A;  2IN3 A;  3QPM A;  1X5E A;  2VLU A;  3IK7 A;  2DJ1 A;  3C1S A;  5CRH A;  3J7Y b;  4KCA A;  3DD3 A;  2K9F A;  3H1N A;  2R2J A;  4XRA A;  5G5F A;  2AAW A;  3FY7 A;  4Q5R A;  3APS A;  1A2L A;  5JWR B;  3D21 A;  4XCS A;  1R5A A;  1VF1 A;  1JZO A;  3MDK A;  1WE0 A;  1R26 A;  1XOA A;  2WCI A;  6GSX A;  4PUR A;  5ID2 B;  2QKE A;  4DEJ A;  4FH8 A;  4FQU A;  2KOK A;  4AJ8 A;  4F2I A;  3UVH A;  3FZA A;  4EF0 A;  3LGC A;  2FWG A;  1F3A A;  3QOU A;  4L0W A;  2KHP A;  3F0I A;  3H8Q A;  1M9B A;  5F06 A;  1V9W A;  2R4V A;  3CYN A;  4O92 A;  4CY8 A;  2YAN A;  2OJL A;  4MK3 A;  1RW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...