4K0NA

Crystal structure of human clic1 c24a mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
QPQVELFVKAGSDGAKIGNAPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 1
publication title Crystal structure analysis of CLIC1 C24 mutants
rcsb
source organism Homo sapiens
total genus 77
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4k0nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k0nA01
3TKPA 3KJYA 4ECIA 2VLUA 4HU7A 2GSRA 3D6IA 4EUYA 2GDRA 4ECJA 1AQXA 1OE7A 6GSUA 1B9YC 1TW9A 4IKHA 2GLRA 4LA1A 2L59A 4MPGA 3GURA 3FR9A 3ZLPA 3RHCA 1EGRA 4IQAA 4ZBAA 1G6YA 2LQOA 4MZBA 3IPZA 2XPEA 4USSA 3OR5A 4GLTA 1ST9A 1WWJA 2VD1A 5IMAA 1GP1A 2HZEA 4NWYA 3Q6OA 4MA9A 1XPVA 4BA7A 4POMA 2NBSA 4XS4A 4MP4A 2GGTA 3ZVJD 3IK7A 5C00A 4GRFA 6GSYA 2A2SA 2C0FA 4GF0A 3RDWA 4IN0A 1K0MA 4ZL7A 2RM5A 7GSSA 1HNAA 2DIZA 2VM2A 4FYBA 2H6XA 1OC3A 1V98A 3C7MA 2VUPA 3BCIA 4L0UA 1GL8A 2LJAA 1MTCA 3EINA 1ACVA 3L4NA 4O5RA 3GRXA 5G1KA 3UVTA 3FHKA 3Q18A 3ZMKA 4WBJA 2PERA 1B48A 2L4QA 3H93A 4K6XA 3HZ8A 2YPMA 2BMXA 1MEKA 3GX8A 1UC7A 11GSA 3CTGA 5GAND 1B8XA 2JZTA 4X1UA 5IOXA 4IGJA 2PWJA 5DALA 1ZZYA 3KTBA 1X5DA 1XW5A 2HQTA 6GSTA 4KSMA 4K7NA 2MMAA 4X0XA 1R5PA 1Z9HA 1PKWA 5KN3A 4ZXGA 3IAM2 3KMNA 4PQIA 2FY6A 4AF2A 1B4PA 5ECLB 1ON4A 2ZNMA 3CBUA 3N5OA 2B1KA 1VRSD 2H0GA 1MD4A 5DDLA 2K6VA 3PGTA 3CSHA 2H0HA 3DRNA 1X9SB 3IC4A 3PH9A 4Q5RA 5A4VA 4D73B 4PQHA 4ZIJA 1GTIA 4MZWA 4PUFC 1O81A 1KTEA 1V40A 2IMFA 3I6AA 4ML1A 4RQXA 3TOUA 5DJMA 1X0RA 2PUKC 1FO5A 1OC8A 4EDYA 5B6MA 3A3TA 2AHEA 2LEGA 2F8AA 5J41A 5EPFA 2KP1A 5ECSA 1Z7RA 4HQZA 2GT6A 1A24A 3C1SA 1FB6A 3QCPA 5ECPB 2V6KA 4EKZA 5J4UA 3ME8A 3U5RE 1O7UA 1T00A 1U88A 3CRUA 2D2ZA 3VPQA 3HDCA 1F37A 4XTSA 2YZHA 4BWSA 3EU3A 2C3QA 4QL9A 2H1GA 1JZOA 2YOIA 4NV5A 3GUSA 2O85A 2BJXA 1DE2A 3I43A 2DMLA 4IHUA 2ON5A 3I9V2 3ZVJA 5IOWA 2HSMB 2DJKA 3F6DA 3GYKA 4KCEA 2F51A 2V41A 2RIIA 2YWNA 4HEA2 3UEMA 1OYJA 3TJJA 1OKDA 2HRFA 2WDUA 4EC0A 1H4OA 2FNOA 2WULA 1M2AA 5AIVA 4CHSA 1BYEA 3ZFBA 1ERVA 3GKKA 3DWVA 1AIUA 3G7YA 4TRXA 5JCGA 1QMVA 4TXVA 3HXSA 3US3A 5G1LA 1IYHA 3M1GA 2JACA 1I5GA 3TB2A 1SL0B 6GSWA 3LQ7A 1A0RP 4ULXA 1TRWA 2OBIA 2WGRA 2YWOA 4TR4A 5ECRB 3APQA 4G19A 1TJDA 2EIOA 3HD5A 4NXIA 1Z6MA 5AGYA 5C04A 2VLVA 2AB6A 2B5XA 4K7OA 3TDGA 4HDEA 1BG5A 4JU5A 4PURA 2HXKA 2GQMA 4I2TA 3TRPA 2ON7A 4PXOA 2IMIA 4GCIA 2V6OA 1W4VA 2GZYA 4JE1A 4ZBDA 1WRYA 1AXDA 1SJ6A 2L4CA 4EE0A 4HZ2A 4JZQA 4EVMA 1WIKA 3Q19A 2YJHA 1XWAA 5FWGA 4KH7A 1RQMA 2JZSA 3EYTA 4Z7XA 1AC1A 4F9ZA 3IOSA 2B5YA 4BVYA 4QL7A 1M7TA 3D22A 1EEJA 1M9BA 2HNLA 1XVWA 2IMKA 5H5QA 3ZREA 1GSSA 3GV1A 3H79A 3PPUA 1GSUA 3FEUA 3HZ4A 2WFCA 4XIHA 1OVNA 3TGZA 2DJ1A 3UOMA 2FWFA 3PR8A 2CZ3A 3KEBA 2M46A 3WGDA 1JHBA 3GSTA 2I1UA 2LRCA 1V2AA 1GULA 3WT1A 3UJ1A 4LL4B 5HFGA 4TW5A 4MJBA 1WPIA 2CT6A 4ZB6A 3F9UA 2NPBA 3DIEA 3IA1A 4DSQA 4KNDA 1GNWA 9GSSA 2E7PA 2DJJA 2YP6A 2IL3A 1TP9A 4MF5A 1TI3A 2N5FA 5G31A 1NSWA 1BQ7A 1QFNA 4IP6A 1FOVA 1U3AA 4YAPA 1AQVA 4GSTA 3TCOA 2LJKA 2CA8A 1Q4JA 2FUG2 4RUVA 1TU7A 5AIXA 3M0FA 4PGTA 1SD9A 4NHZA 4RI6A 2H74A 4J57E 1G0TA 5FHIA 4L0WA 5JWRB 2E2MA 4O92A 2VL9A 4I8BA 3V1WA 4EO3A 3F4TA 2ES7A 4MH3A 5KN0A 2TRXA 4PUAA 5HR1A 2VM1A 2X8HA 3W6GA 4OFMA 3M9KA 2DIYA 3HJMA 5J9BA 2CV4A 1X5EA 3LG6A 3IR4A 4HJMA 20GSA 1F3BA 2H72A 2YZUA 4EL1A 2TIRA 3IBHA 1R4WA 1M0UA 2RM6A 4GTUA 2H01A 1DUGA 1XOAA 1ZOFA 2H76A 1XWGA 1K3LA 1QGVA 1K0AA 5CRHA 1YY7A 3LSZA 13GSA 2GS3A 3DGQA 1M2BA 3CSIA 4BPYA 3UIWA 2X8GA 4GXZA 2JADA 2YANA 1PD21 2YCDA 5CREA 1THOA 2DLXA 3P7XA 4FH8A 1UA5A 3NZNA 4GQFA 1SKSB 2VCTA 4HZ4A 3O76A 1K0BA 1FVKA 3IDVA 5ABRA 3HVSA 4E8HA 1MDIA 2EIQA 5D9WA 2NDOA 5ECQB 5CRGA 3QAVA 1PSQA 3P2AA 4K0GA 3UBLA 5CNWA 4HS1A 4RI7A 3GTUA 3TKSC 1S3CA 4AJ7A 3GN3A 2H1DA 4TVEA 5HQPA 4KE3A 3CRTA 1J08A 1TU8A 3MDKA 1GNEA 2IMDA 4KB3A 3TUEA 3VWVA 6GSXA 3R2QA 3D5JA 1SYXA 2QKEA 5B7CA 3KMOA 4TXOA 4MZCA 5AN1A 3E0UA 3LXTA 2YN1A 4OMVA 5IMFA 4TN8A 2XC2A 2LS5A 5ECIB 2OE0A 2XHFA 4MJEA 18GSA 1GTAA 3F63A 3CMIA 4HQSA 3QMXA 3ZYWA 1E2YA 1U3IA 3EU4A 1YZXA 3CSJA 1YEPA 4N10A 2FGXA 4POBA 4KAEA 1SJIA 1UN2A 1PA3A 5INYA 3KH9A 1FHEA 4BWQA 2C1YA 2YJ7A 5B8BA 2NTOA 3HVVA 2WRTA 1V58A 5DCGA 1VGLA 1EGOA 2OE3A 3FW2A 4XS6A 3DXBA 3QDNA 3G7IA 1Z3EA 3ZRDA 5F0GA 4X43A 3TKSA 2GZZA 5DJLA 4BVXA 2J23A 4MPFA 1XWCA 1XFLA 2H71A 2MMZA 3FR3A 5A4UA 2LNTA 5L71A 2QSIA 2AAWA 5HR3A 3DVXA 4FYUA 1YDKA 3QPMA 4TOPA 4KF9A 4ZBBA 2E2GA 3VWUA 3GSSA 4L5OA 4KW6A 4CDOA 2HRKB 1VF3A 1GWCA 1EOHA 2KLXA 5DCHA 3EMPA 1M9AA 3ZIVA 3APOA 3UBKA 4PNFA 4MJCA 3UARA 4TR1B 2H6YA 2B6MA 3HVXA 3RHBA 1EP7A 3LWAA 4I6XA 5G5EA 3VI5A 2R6KA 2HRAA 2B1LA 5ELGA 3LEFA 1Z5YE 1GH2A 3QOUA 1BAYA 5G2ZA 1EP8A 4ZL9A 1X9MB 4KA0A 5CP1A 2OJLA 1TOFA 1F2EA 1V9WA 1GSQA 5IMVA 3HYPA 2B7JA 4ZB8A 1GTBA 1TTZA 22GSA 4HUAA 2R2JA 2CAIA 2FWGA 4GSSA 4ZL8A 5LD0A 3GHAA 3ZTLA 1AAZA 2MBTA 1PGTA 1B9XC 1OKTA 1XWBA 3O3TA 4WKWA 3LGCA 12GSA 1LU4A 4YQVA 1XOBA 2DSAA 2GT5A 2HZFA 1HNCA 4V1Ag 5DQYA 2H75A 3KD0A 8GSSA 5ID2B 2OA7A 5F07A 2YWIA 1H75A 3HJOA 1XW6A 1URMA 4IVFA 1SU9A 1U6TA 2GZPA 2IFQA 4CW9A 1FB0A 1K3OA 5ENUA 3DD3A 2LRTA 2PPTA 3ZITA 1I9DA 4OCFA 1RK4A 1T8EB 2AV4A 4QQ7A 2P5QA 2VLTA 1JZWA 4ID0A 3HHVA 1ERTA 3TJBA 2JL4A 3ZFLA 2FLSA 3EMXA 2VL2C 4GQCA 4IQ1A 1KEBA 5DAKB 1SK1A 3GIXA 2VAFA 2PVQA 1PL2A 3WGXA 1ZYQB 5J9CA 3VK9A 2H0IA 5AISA 2FWHA 3GL3A 3RAZA 1Z7PA 5G5FA 4EXJA 2L57A 2VO4A 5E59A 4V1Ap 2HYXA 3JCML 5IQYA 3VWXA 1PN9A 1XXUA 1MDKA 16GSA 2YWMA 3IK9A 4DSSB 1PKZA 2AJQB 4V2NA 1MDJA 1YEXA 2LNSA 4KCAA 4TR3A 1K0OA 1O8WA 1BJXA 4YQMA 1GUMA 4G0LA 3HCZA 1K0CA 4F2IA 5JCWA 10GSA 4I97A 3A5WA 4PX1A 1OC9B 3TRXA 1FW1A 4OO5A 2VIMA 3TJFA 5JWOB 2YNXA 1VF4A 1EZKA 2VL2A 4K1FA 2OKAA 2HRNA 1TK0B 4EF0A 4K8MA 3MNGA 3TRQA 1T4YA 4FIWA 1GLQA 2JSZA 3L9SA 2VD0A 3TOTA 2LJRA 1XCCA 2H70A 3TKQA 4XRDA 3ZL5A 5ECMB 4WF4A 19GSA 2WZ9A 2H66A 1SL2B 4WR5A 3QAWA 2H19A 2F8FA 4TKYA 5CAXA 3A2VA 1AUCA 1XVQA 4ZILA 4AJ8A 4ACSA 4JRRA 1C72A 3M8NA 1V57A 4D73A 1RW1A 3CTFA 2LUSA 2AYTA 2IIYA 2HZEB 4F0BA 2IN3A 4P3YB 1XW9A 2CVBA 4XS4B 1XWKA 2N5AA 1SKRB 4MABA 2WS2A 2HLSA 1LJRA 3ISOA 5HR2A 3A2XA 5D96A 1GSYA 4POLA 4DVCA 1JFUA 1ZCPA 3GNJA 2MBSA 1FG4A 5D8IA 4PNGA 2DJ2A 2P0GA 1BX9A 1FVJA 5J5NA 3J7Yb 3RPNA 1GUKA 5ECKB 2CVDA 2KUCA 4PTSA 5KN1A 2FA4A 5IMCA 1XIYA 5DBQA 4MCUA 2EC4A 5KEJA 2H1AA 2HSMA 2HT9A 2VOCA 3LYPA 2HFDA 4V2LA 3C1RA 3GFKA 3ZMLA 4G0IA 2WJUA 1ERWA 5ELAA 2VCQA 2LV3A 5CYYA 5DALB 4WETA 1YJ6A 3AY8A 5D9TA 3GL5A 4F82A 5HFKA 4NAXA 2LRNA 1F3AA 2DJ3A 2P5RA 3VFIA 1PX6A 4KDUA 2YV9A 5D9XA 5IMZA 4K2DA 2GTUA 2JZRA 5H5RA 3IC8A 1GSEA 1GRXA 4WEYA 5IPHA 3GX0A 2MMOA 3F4SA 4F03A 4MK3A 2GVPA 1T7PB 1SK2A 4IJIA 5LCZA 1TKDB 2Z9SA 3CXGA 1EOGA 2H73A 1DE1A 1AW9A 6GSSA 4JR6A 4DSSA 1IYIA 4AGSA 3GMFA 1Y25A 1ERUA 4MDCA 2RLIA 2WCIA 3LJRA 3P90A 4RQRA 1Y6EA 1QXHA 2LSTA 5CRWA 1F9MA 2BTOT 2A2RA 3L9UA 2AUVA 4FQUA 2H6ZA 4IP1A 4MF7A 3KP8A 1A23A 4ML6A 2K9FA 5F8BA 1ZL9A 4O32A 5JCUA 2DMMA 2CZ2A 5KN2A 2UZ8A 1FAAA 2I3YA 2QC7A 4ILFA 4KX4A 1PRXA 3IXRA 5HFIA 2JSYA 2H1BA 3GH9A 4HJ2A 3IRAA 3ZIJA 3FR6A 3HKRA 3ME7A 5CRDA 4N11A 1J0FA 1A0FA 3A2WA 2R3XA 3FYGA 1GSDA 2N5BA 4XRAA 4N0ZA 4WXTA 4DEJA 3G7JA 4OFNA 2CAQA 1GSFA 3IHQA 5A5KA 5COHA 1QQ2A 2O7KA 2C3NA 3RBTA 1G7OA 2WB9A 5B8AA 1Q98A 2K18A 4NPBA 1N2AA 1A2JA 4ECCA 6GSVA 1Z6NA 1HD2A 4ZB9A 2L6DA 3FZ4A 3WD6A 2G2QA 4GSNA 2PVOC 1S3DA 1X5CA 4FYCA 3BD2A 1VF2A 4G2EA 5LNKe 2C0DA 4POKA 2F9SA 1SKWB 3Q74A 4L8EA 1CQHA 4JR4A 4IJ3A 2CQ9A 4XS1A 3UMAA 1F6MC 2OACA 2EIRA 1T3BA 5DQSA 1XZOA 17GSA 1U87A 4AJ6A 3HA9A 3M3MA 1G7EA 2GSQA 3FZ5A 4LLRA 2K8VA 3W8SA 1S3AA 3QD9A 1YF1A 1ZMAA 1DSBA 2KP2A 3P8WA 4HOJA 1NW2A 1LBKA 1R5AA 4KSOA 1T4ZA 1TRVA 1ABAA 1GTUA 3FK8A 4MH2A 2FHEA 3FZ9A 2X8CA 1ML6A 3TKRA 5BMUA 2DJ0A 3ZZXA 2H8LA 4WBRD 4OO4A 3N9JA 4G0KA 5A4WA 4YH2A 5DVBA 4BVYB 2ZCTA 3E3EA 2IJYA 2RUFA 4I2UA 2IWTA 5EL8A 5HR0A 3FRCA 1HQOA 2OADA 2LQQA 4OD7A 4IELA 3BCKA 1BEDA 4IW9A 1M99A 2CX4A 3G9BA 2RUEA 3H8QA 4KUNA 4LL1B 2VCWA 4YAVA 1TI1A 3S9FA 1K0NA 1YKCA 4FO5A 4PQ1A 2GSSA 4J2FA 4F0CA 1O85A 3EURA 2L5OA 1PQNA 3VLNA 3L0HA 4NV2A 3J7Yk 1TDIA 4K7IA 3QFBC 1OAZA 4G10A 1A2MA 3D0ZA 2HSYA 2IMEA 2X99A 1QK8A 4L5LA 2I9HA 2DBCA 3CYNA 5D9VA 2VCXA 1WMJA 1WJKA 3APSA 3GKXA 1PL1A 2IPAA 1YQ1A 1X9WB 2FA8A 1OE8A 3FKFA 4NMUA 4MJAA 2QGVA 1N8JA 5FT3A 3LFLA 3WYWA 2J9HA 3EVIA 2C0EA 2NVLA 4NHWA 2XBQA 3F3QA 1QUWA 4ISDA 1KBNA 4KDYA 5GSSA 4KGIA 3FZAA 1NHYA 4K9ZA 2V1MA 1EWXA 2C80A 1TRUA 4OCEA 2P31A 3RPPA 1O73A 3D4TA 4I5QA 5IPGA 5G30A 2C8UA 1NM3A 2PGTA 1B4QA 3ERFA 5GSTA 1W89A 1R7HA 3KXOA 2A4VA 3DYRA 3EWLA 3VPTA 2M72A 2C0GA 2YV7A 1YKAA 1G6WA 2GQLA 5D73A 4EDZA 2PU9C 1TXXA 2PN8A 3UAPA 5GAPD 3R3EA 2XBIA 3C8EA 2PMTA 1A8YA 1EV4A 3H1NA 2L6CA 4V2MA 2HI7A 1TRSA 2GSTA 3WGEA 2H30A 1O6JA 3TKSE 3KIJA 4GWRA 3NIVA 3K8NA 4BL7B 4KDXA 1WOUA 2M80A 4ECBA 1WP0A 2V2GA 3MAKA 1PMTA 3DEXA 3MWHA 4MMMA 3NOFA 4MF6A 3QAGA 5H5SA 4IBPA 3U6VA 1A2LA 2GQKA 3KP9A 2HRKA 3F8UA 3BBYA 4K0NA 2I81A 3GKMA 3LORA 2REMA 1ILOA 3IE3A 2L5LA 4WF5A 1EV9A 3F4RA 3GTUB 1K3YA 2R5GA 3KGKA 4TR1A 2R37A 2MYGA 3C71A 4LMVA 3H4KA 1HYUA 3DKSA 3D4MA 3KM6A 1GLPA 1JZDA 3LYKA 4TXOB 4YQUA 3TJKA 3SWLA 2LTKA 5F05A 1SD8A 4WR4A 2TRCP 1J9BA 3E9JB 2HSHA 1THXA 1ZYEA 3WT2A 1M2DA 5ECOB 4Q5FA 1CQGA 3ERGA 5ECHB 3D21A 3ED3A 4MLYA 5IM9A 3EC3A 1ZGNA 4OWYA 3LXZA 2VCVA 2CX3A 1TK5B 4E8EA 1WE0A 5IMDA 5ID2A 5EY6A 4G9HA 3EE2A 3HY2A 3SBCA 2CVKA 3GH6A 1EEMA 5ECNB 3KH7A 3HJPA 1SJZA 3IAS2 4N0VA 3VWWA 2O8VB 1JLWA 4BVXB 5IIZA 2XPDA 3VURA 2DC5A 4H86A 5IO2A 2FD3A 2O87A 2B3SA 1MD3A 3QR6A 5B6NA 3MSZA 4JEDA 2X64A 1SENA 4HU9A 4DSRA 2O89A 2PBJA 2HSNB 5DAKA 4OFTA 5F06A 4Q5NA 3F3RA 1O8XA 1UVZA 2F3MA 3KTLA 2ZUPA 3F6FA 4O7HA 1YF0A 1USBA 1SK0A 2ALBA 3W8JA 2FCHA 1JLVA 3IV4A 5J3RA 1A8LA 5EVOA 4TR0A 2C3TA 3GKNA 1TK8B 3GA4A 1SL1B 3UVHA 5E4WA 2E0QA 1JZRA 2OE1A 3KZQA 2B7KA 1T1VA 5GZZB 1AQWA 2VL3A 3L78A 1HNBA 1E6BA 3I69A 1KNGA 2V32A 5JWQB 3FY7A 3TJGA 2MZCA 2OBKA 3VI7A 4N30A 4IS0A 1DBYA 3ERWA 3F0IA 5D93A 3L9VA 3BOAA 4JBBA 3KCMA 2KHPA 2LKUA 1SYRA 4LMWA 2FWEA 4HI7A 2HE3A 2VCZA 1K0DA 2I4AA 4XCSA 5IO0A 14GSA 1GUHA 2B5EA 1OC9A 2G0FA 4BL7A 5CO3A 2MMNA 3M9JA 3BJ5A 1VF1A 3C73A 3DMLA 2JU5A 4J56E 2K8SA 1PX7A 1NHOA 3QFAC 1XBSA 4XHMA 3PINA 2R4VA 1R26A 2C4JA 2KOKA 3DVWA 4Q5QA 3O6TA 3UL3A 2IFQB
chains in the Genus database with same CATH superfamily
3TKPA 3KJYA 4ECIA 2VLUA 4HU7A 2GSRA 3D6IA 4EUYA 2GDRA 4ECJA 1AQXA 1Y1UA 1OE7A 6GSUA 3IHGA 1B9YC 1TW9A 4IKHA 2GLRA 4LA1A 2L59A 4MPGA 3GURA 3FR9A 3ZLPA 3RHCA 1EGRA 4IQAA 4ZBAA 1G6YA 2LQOA 4MZBA 3IPZA 2XPEA 4USSA 3OR5A 4GLTA 1ST9A 1WWJA 3TU3B 2VD1A 5IMAA 1GP1A 2HZEA 4NWYA 5A5HA 3Q6OA 4MA9A 1XPVA 4BA7A 4POMA 1SVOA 2NBSA 4XS4A 4MP4A 2GGTA 3ZVJD 3IK7A 5C00A 4GRFA 6GSYA 2A2SA 2C0FA 4GF0A 3RDWA 4IN0A 1K0MA 4ZL7A 2RM5A 7GSSA 1HNAA 2DIZA 2VM2A 4FYBA 2H6XA 5KOXA 1OC3A 1V98A 3C7MA 2VUPA 3BCIA 4L0UA 1ZYNA 1GL8A 2LJAA 1MTCA 3EINA 1ACVA 3L4NA 4O5RA 3GRXA 5G1KA 3UVTA 3FHKA 3Q18A 3ZMKA 4WBJA 2PERA 1B48A 2L4QA 3H93A 4K6XA 3HZ8A 2YPMA 2BMXA 1MEKA 3GX8A 1UC7A 11GSA 3CTGA 4MNNA 5GAND 1B8XA 2JZTA 4X1UA 5IOXA 4IGJA 2PWJA 5DALA 1ZZYA 3KTBA 1X5DA 1XW5A 2HQTA 6GSTA 4KSMA 4K7NA 2MMAA 4X0XA 1R5PA 1Z9HA 1PKWA 5KN3A 4ZXGA 3IAM2 3KMNA 4PQIA 2FY6A 4AF2A 1B4PA 5ECLB 1BF5A 1ON4A 2ZNMA 4Z2UA 3CBUA 3N5OA 2B1KA 1VRSD 2H0GA 1MD4A 5DDLA 2K6VA 3PGTA 3CSHA 2H0HA 3DRNA 1X9SB 3IC4A 3PH9A 4Q5RA 5A4VA 2WVXA 4D73B 4PQHA 4ZIJA 1GTIA 4MZWA 4PUFC 1O81A 1KTEA 1V40A 2IMFA 3I6AA 4ML1A 4RQXA 3TOUA 5DJMA 1X0RA 2PUKC 1FO5A 1OC8A 4EDYA 5B6MA 3A3TA 4CY8A 2AHEA 2LEGA 2F8AA 5J41A 5EPFA 2KP1A 5ECSA 1Z7RA 4HQZA 2GT6A 1A24A 3C1SA 1FB6A 3QCPA 5ECPB 2V6KA 4EKZA 5J4UA 3ME8A 3U5RE 1O7UA 1T00A 1U88A 3CRUA 2D2ZA 3VPQA 3HDCA 1F37A 4XTSA 2YZHA 4BWSA 3EU3A 2C3QA 4QL9A 2H1GA 1JZOA 2YOIA 4AI6A 4NV5A 3GUSA 2O85A 2BJXA 1DE2A 3I43A 2DMLA 4IHUA 2ON5A 3I9V2 3ZVJA 5IOWA 2HSMB 2DJKA 3F6DA 4G01A 3GYKA 4KCEA 4Z2RA 2F51A 2V41A 2RIIA 2YWNA 4HEA2 3UEMA 1OYJA 3TJJA 5A1NB 1OKDA 2HRFA 2WDUA 4EC0A 1H4OA 2FNOA 2WULA 1M2AA 5AIVA 4CHSA 5BRTA 1BYEA 3ZFBA 1ERVA 3GKKA 3DWVA 2UV8G 1AIUA 3G7YA 2A2PA 4TRXA 5JCGA 1QMVA 4TXVA 3HXSA 3US3A 5G1LA 1IYHA 3M1GA 2JACA 1I5GA 3TB2A 1SL0B 6GSWA 3LQ7A 1A0RP 4ULXA 1TRWA 2OBIA 2WGRA 2YWOA 4TR4A 5ECRB 3APQA 4G19A 1TJDA 2EIOA 3HD5A 4NXIA 1Z6MA 4QMKA 5AGYA 5C04A 2VLVA 2AB6A 2B5XA 4K7OA 3TDGA 4HDEA 1BG5A 4JU5A 4PURA 2HXKA 2GQMA 4I2TA 3TRPA 2ON7A 4PXOA 2IMIA 4GCIA 2V6OA 1W4VA 2GZYA 4JE1A 4ZBDA 1WRYA 4PI0C 1AXDA 1SJ6A 2L4CA 4EE0A 4HZ2A 4JZQA 4EVMA 1WIKA 3Q19A 2YJHA 1XWAA 4K2XA 5FWGA 4KH7A 1RQMA 2JZSA 3EYTA 4Z7XA 1AC1A 4F9ZA 3IOSA 2B5YA 4BVYA 4QL7A 1M7TA 3RGBC 3D22A 1EEJA 1M9BA 2HNLA 1XVWA 2IMKA 5H5QA 3ZREA 1GSSA 3GV1A 3H79A 3PPUA 1GSUA 3FEUA 3HZ4A 2WFCA 4XIHA 1OVNA 3TGZA 2DJ1A 3UOMA 2FWFA 3PR8A 2CZ3A 3KEBA 2M46A 3WGDA 1JHBA 3GSTA 2I1UA 2LRCA 1V2AA 1GULA 3WT1A 3UJ1A 4LL4B 5HFGA 4TW5A 4MJBA 1WPIA 2CT6A 4ZB6A 3F9UA 2NPBA 3DIEA 3IA1A 4DSQA 4KNDA 1GNWA 9GSSA 2E7PA 2DJJA 2YP6A 2IL3A 1TP9A 4MF5A 1TI3A 2N5FA 5G31A 1NSWA 1BQ7A 1QFNA 4IP6A 1FOVA 1U3AA 4YAPA 1AQVA 4GSTA 3TCOA 2LJKA 2CA8A 2WZSA 1Q4JA 2FUG2 4RUVA 1TU7A 5AIXA 3M0FA 4PGTA 1SD9A 4NHZA 4RI6A 2H74A 4J57E 1G0TA 5FHIA 4L0WA 5JWRB 2E2MA 4O92A 2VL9A 3CHXC 2H1LA 4I8BA 4N3ZA 3V1WA 2EFDA 4EO3A 3F4TA 2ES7A 4MH3A 5KN0A 2TRXA 4PUAA 5HR1A 2VM1A 2X8HA 1S4BP 3W6GA 4OFMA 3M9KA 2DIYA 3HJMA 5BMUB 5J9BA 2CV4A 1X5EA 3LG6A 3IR4A 5A34B 4HJMA 20GSA 1F3BA 4EIQA 2H72A 2YZUA 4EL1A 2TIRA 3IBHA 2QA1A 1R4WA 1M0UA 2RM6A 4GTUA 2H01A 1DUGA 1XOAA 1ZOFA 2H76A 1XWGA 1K3LA 1QGVA 1K0AA 4AKHA 5CRHA 1YY7A 3LSZA 13GSA 2GS3A 3DGQA 1M2BA 3CSIA 4BPYA 3UIWA 2X8GA 4GXZA 2JADA 2YANA 1PD21 2YCDA 5CREA 1THOA 2DLXA 4PHZC 3P7XA 2WW2A 4FH8A 1UA5A 3NZNA 4GQFA 1SKSB 2VCTA 4HZ4A 3O76A 1K0BA 1FVKA 4ICYA 3IDVA 5ABRA 3HVSA 4E8HA 1MDIA 2EIQA 5D9WA 2NDOA 5ECQB 5CRGA 3QAVA 1PSQA 3P2AA 4K0GA 3UBLA 5CNWA 4HS1A 4RI7A 3GTUA 3TKSC 1S3CA 4HSCX 3GN3A 4AJ7A 2H1DA 4TVEA 5HQPA 4KE3A 3CRTA 1J08A 1TU8A 3MDKA 1GNEA 2IMDA 4KB3A 3TUEA 3VWVA 6GSXA 3R2QA 3D5JA 1SYXA 2QKEA 3MYDA 5B7CA 3KMOA 4TXOA 4MZCA 3RFRC 5AN1A 3E0UA 3LXTA 2YN1A 4OMVA 5IMFA 4TN8A 2XC2A 2LS5A 5ECIB 2OE0A 2XHFA 4MJEA 18GSA 1GTAA 3F63A 3CMIA 4HQSA 3QMXA 4YKFA 2WVZA 3ZYWA 1E2YA 1U3IA 3EU4A 1YZXA 3CSJA 1YEPA 4N10A 2FGXA 4POBA 4KAEA 1SJIA 1UN2A 1PA3A 5INYA 3KH9A 2WW3A 1FHEA 4BWQA 2C1YA 2YJ7A 5B8BA 2NTOA 3HVVA 2WRTA 1V58A 5DCGA 1VGLA 1EGOA 2OE3A 3FW2A 4XS6A 3DXBA 3QDNA 3G7IA 1Z3EA 3ZRDA 5F0GA 4X43A 3TKSA 2GZZA 5DJLA 4BVXA 2J23A 4MPFA 1XWCA 1XFLA 2H71A 2MMZA 3FR3A 5A4UA 2EFEA 3EPTA 2LNTA 5L71A 2QSIA 2AAWA 5HR3A 3DVXA 4FYUA 2HSNA 1YDKA 3QPMA 1N25A 4TOPA 4KF9A 4ZBBA 2E2GA 4E68A 3VWUA 3GSSA 4L5OA 4KW6A 4CDOA 2HRKB 1VF3A 1GWCA 1EOHA 2KLXA 5DCHA 3EMPA 1M9AA 3ZIVA 3APOA 3UBKA 4PNFA 4MJCA 1M3JA 3UARA 4TR1B 2H6YA 2B6MA 3HVXA 3RHBA 1EP7A 3LWAA 4I6XA 5G5EA 3VI5A 2R6KA 2HRAA 5J4YA 5ELGA 2B1LA 3LEFA 1Z5YE 1GH2A 3QOUA 1BAYA 4O5UA 5G2ZA 1EP8A 4ZL9A 1X9MB 4KA0A 5CP1A 2OJLA 1TOFA 1F2EA 1I1IP 1V9WA 1GSQA 5IMVA 3HYPA 2B7JA 4ZB8A 1GTBA 1TTZA 22GSA 4HUAA 3MIXA 2R2JA 2CAIA 2FWGA 4GSSA 4ZL8A 5LD0A 3GHAA 3ZTLA 1AAZA 2MBTA 1PGTA 1B9XC 1OKTA 1XWBA 3O3TA 4WKWA 3LGCA 2X4AA 12GSA 1LU4A 4YQVA 1XOBA 2DSAA 2GT5A 2HZFA 1HNCA 4V1Ag 5DQYA 2H75A 3KD0A 8GSSA 5ID2B 2OA7A 5F07A 2YWIA 1H75A 3HJOA 1XW6A 1URMA 4IVFA 1SU9A 1U6TA 2GZPA 2IFQA 4CW9A 1FB0A 1K3OA 5ENUA 3DD3A 2LRTA 2PPTA 3HVNA 3ZITA 1I9DA 4OCFA 1RK4A 1T8EB 2AV4A 4QQ7A 2P5QA 2VLTA 1JZWA 4ID0A 3HHVA 1ERTA 3TJBA 2JL4A 3ZFLA 2FLSA 3EMXA 2VL2C 4GQCA 4IQ1A 1KEBA 5DAKB 1SK1A 3GIXA 2VAFA 2PVQA 1PL2A 3WGXA 1ZYQB 5J9CA 3VK9A 2H0IA 5AISA 2FWHA 3GL3A 3RAZA 1Z7PA 5G5FA 4EXJA 2L57A 2VO4A 5E59A 4V1Ap 2HYXA 3JCML 5IQYA 3VWXA 1PN9A 1XXUA 1MDKA 16GSA 2YWMA 3IK9A 4DSSB 1PKZA 2AJQB 4V2NA 1MDJA 1YEXA 2LNSA 4KCAA 4TR3A 1K0OA 1O8WA 5J47A 1BJXA 4YQMA 1GUMA 4G0LA 3HCZA 1K0CA 4F2IA 5JCWA 10GSA 4I97A 3A5WA 4PX1A 1OC9B 3TRXA 1FW1A 4OO5A 2VIMA 3TJFA 5JWOB 2YNXA 1VF4A 1EZKA 2VL2A 4K1FA 2OKAA 2HRNA 1TK0B 5J4VA 4EF0A 4K8MA 3MNGA 3TRQA 1T4YA 4FIWA 1GLQA 2JSZA 3L9SA 2VD0A 3TOTA 2LJRA 1XCCA 2H70A 3TKQA 4XRDA 3ZL5A 5ECMB 4WF4A 19GSA 2WZ9A 2H66A 1SL2B 4WR5A 4AKGA 3QAWA 2H19A 2F8FA 4TKYA 5CAXA 3A2VA 1AUCA 1XVQA 4ZILA 4AJ8A 4ACSA 4JRRA 1C72A 3M8NA 1V57A 4D73A 1RW1A 3CTFA 1XG8A 2WW1A 2LUSA 2AYTA 4AKXB 2IIYA 2HZEB 4F0BA 2IN3A 4P3YB 1S3RA 1XW9A 2CVBA 4XS4B 1XWKA 2N5AA 1SKRB 4MABA 2WS2A 2HLSA 1LJRA 2X49A 3ISOA 5HR2A 3A2XA 5D96A 1GSYA 4POLA 4DVCA 1JFUA 1ZCPA 3GNJA 2MBSA 1FG4A 5D8IA 4PNGA 2DJ2A 2P0GA 1BX9A 1FVJA 5J5NA 3J7Yb 3RPNA 1GUKA 5ECKB 4EIPA 1ZYPA 2CVDA 2KUCA 4PTSA 5KN1A 2FA4A 5IMCA 1XIYA 5DBQA 4MCUA 2EC4A 4GDFA 5KEJA 2H1AA 2HSMA 2HT9A 2VOCA 3LYPA 2HFDA 4V2LA 3C1RA 3GFKA 3ZMLA 4G0IA 2WJUA 1ERWA 5ELAA 2VCQA 2LV3A 5CYYA 5DALB 4WETA 1YJ6A 3AY8A 5D9TA 5A1NA 3GL5A 4F82A 5HFKA 4NAXA 2LRNA 1F3AA 2DJ3A 2P5RA 3VFIA 1PX6A 4KDUA 2YV9A 5D9XA 5IMZA 2GTUA 4K2DA 2JZRA 5H5RA 3IC8A 1GSEA 1GRXA 4WEYA 5IPHA 3GX0A 2MMOA 3F4SA 4F03A 4MK3A 2GVPA 1T7PB 1SK2A 4IJIA 5LCZA 1TKDB 2Z9SA 3CXGA 1EOGA 2H73A 2WVXB 1DE1A 1AW9A 2R0GA 6GSSA 1BG1A 4JR6A 4DSSA 1IYIA 4AGSA 3GMFA 1Y25A 1ERUA 4MDCA 2RLIA 2WCIA 3LJRA 3P90A 4RQRA 1Y6EA 1QXHA 2LSTA 5CRWA 1F9MA 2BTOT 2A2RA 3L9UA 2R0CA 2AUVA 4FQUA 2H6ZA 4A5PA 4IP1A 4MF7A 3KP8A 1A23A 4ML6A 2K9FA 5F8BA 1ZL9A 2R0PA 4O32A 5JCUA 2DMMA 2CZ2A 5KN2A 2UZ8A 1FAAA 2I3YA 2QC7A 4ILFA 4KX4A 1PRXA 3IXRA 5HFIA 2JSYA 2H1BA 3GH9A 4HJ2A 3IRAA 3ZIJA 3FR6A 3HKRA 3ME7A 5CRDA 4N11A 1J0FA 1A0FA 4O5QA 3A2WA 2R3XA 3FYGA 1GSDA 2N5BA 4XRAA 4N0ZA 1SVLA 4WXTA 4DEJA 3G7JA 4OFNA 2CAQA 1GSFA 3IHQA 5A5KA 5COHA 1QQ2A 3HMJG 2O7KA 3LW9A 2C3NA 3RBTA 1G7OA 4PI2C 2WB9A 3CQFA 1Q98A 2K18A 4NPBA 5B8AA 1N2AA 2VKZG 1A2JA 4ECCA 6GSVA 1Z6NA 1HD2A 4ZB9A 2L6DA 3FZ4A 3WD6A 2G2QA 4GSNA 2PVOC 1S3DA 1X5CA 4FYCA 3BD2A 1VF2A 4G2EA 5LNKe 2C0DA 4POKA 2F9SA 1SKWB 3Q74A 4L8EA 1CQHA 4JR4A 4IJ3A 2CQ9A 4XS1A 3UMAA 1F6MC 2OACA 2EIRA 1T3BA 5DQSA 1XZOA 17GSA 1U87A 4AJ6A 4CY6A 3HA9A 3M3MA 1G7EA 2GSQA 1SVMA 3FZ5A 4LLRA 4BIKA 2K8VA 3W8SA 1S3AA 3QD9A 4K5RA 1YF1A 1ZMAA 1DSBA 4W66A 2KP2A 3P8WA 4HOJA 1NW2A 1LBKA 1R5AA 4KSOA 1T4ZA 1TRVA 1ABAA 1GTUA 3FK8A 4MH2A 2FHEA 3FZ9A 2X8CA 1ML6A 3TKRA 5BMUA 2DJ0A 5A34A 3ZZXA 2O36A 2H8LA 4WBRD 4OO4A 3N9JA 4G0KA 4X4JA 5A4WA 4YH2A 5DVBA 4BVYB 2ZCTA 3E3EA 2IJYA 2RUFA 4I2UA 2IWTA 5EL8A 5HR0A 3FRCA 1HQOA 2OADA 2LQQA 4OD7A 4IELA 3BCKA 1BEDA 4IW9A 1M99A 2CX4A 3G9BA 2RUEA 3H8QA 4KUNA 4LL1B 2VCWA 4YAVA 1TI1A 3S9FA 1K0NA 1TXUA 1YKCA 4FO5A 4PQ1A 2GSSA 4J2FA 4F0CA 1O85A 3EURA 2L5OA 1PQNA 3VLNA 3L0HA 4NV2A 3J7Yk 1TDIA 4K7IA 3QFBC 1OAZA 4G10A 1A2MA 3D0ZA 2HSYA 2IMEA 2X99A 1QK8A 4L5LA 2I9HA 2DBCA 3CYNA 5D9VA 2VCXA 1WMJA 1WJKA 3APSA 3GKXA 1PL1A 2IPAA 1YQ1A 3A5IA 1X9WB 2FA8A 1OE8A 3FKFA 4NMUA 4MJAA 2QGVA 1N8JA 5KOWA 5FT3A 2O3EA 3LFLA 3WYWA 2J9HA 3EVIA 2C0EA 2NVLA 4NHWA 2XBQA 3F3QA 1QUWA 4ISDA 1KBNA 4KDYA 5GSSA 4KGIA 3FZAA 1NHYA 4K9ZA 2V1MA 1EWXA 2C80A 1TRUA 4OCEA 2P31A 3RPPA 1O73A 3D4TA 4I5QA 5IPGA 5G30A 2C8UA 1NM3A 2PGTA 1B4QA 3ERFA 5GSTA 1W89A 1R7HA 3KXOA 2A4VA 3DYRA 3EWLA 3VPTA 2M72A 2C0GA 2YV7A 1YKAA 1G6WA 2GQLA 5D73A 4EDZA 2PU9C 1TXXA 2PN8A 3UAPA 5GAPD 3R3EA 2XBIA 3C8EA 2OT3A 2PMTA 1A8YA 1EV4A 3H1NA 2L6CA 4V2MA 2HI7A 1TRSA 2GSTA 3WGEA 2H30A 1O6JA 3TKSE 3KIJA 4GWRA 3NIVA 3K8NA 4BL7B 4KDXA 1WOUA 2M80A 4ECBA 1M3IA 1YEWC 1WP0A 2V2GA 3MAKA 1PMTA 3DEXA 2WW0A 3MWHA 4K5SA 4MMMA 3NOFA 4MF6A 3QAGA 2DKHA 2DKIA 5H5SA 4IBPA 1FOHA 3U6VA 1A2LA 2GQKA 3KP9A 2HRKA 3F8UA 3BBYA 4K0NA 2I81A 3GKMA 3LORA 2REMA 1ILOA 3IE3A 2L5LA 4WF5A 1EV9A 3F4RA 3GTUB 1K3YA 2R5GA 3KGKA 4YKGA 4TR1A 2R37A 2MYGA 3C71A 4LMVA 3H4KA 1HYUA 3DKSA 3D4MA 3CWGA 3KM6A 1GLPA 2EFHA 1JZDA 3LYKA 4TXOB 4YQUA 3TJKA 3SWLA 2LTKA 5F05A 5A5HB 1SD8A 4WR4A 2TRCP 1J9BA 3E9JB 2HSHA 1THXA 1ZYEA 3WT2A 1M2DA 5ECOB 4Q5FA 1CQGA 3ERGA 5ECHB 2A4HA 3D21A 3ED3A 4MLYA 5IM9A 3EC3A 2WVYA 2QA2A 1ZGNA 4OWYA 3LXZA 2VCVA 5J40A 2CX3A 1TK5B 4E8EA 1WE0A 5IMDA 5ID2A 5EY6A 4G9HA 3EE2A 3HY2A 3SBCA 2CVKA 3GH6A 1EEMA 5ECNB 2EFCA 3KH7A 3HJPA 1YVLA 1SJZA 3IAS2 4N0VA 3VWWA 2O8VB 1JLWA 4BVXB 5IIZA 2XPDA 3VURA 2DC5A 4Z2TA 4H86A 5IO2A 1PFOA 2FD3A 2O87A 2B3SA 1MD3A 3QR6A 5B6NA 3MSZA 4JEDA 2X64A 1SENA 4HU9A 4DSRA 2O89A 2PBJA 2HSNB 2O5VA 5DAKA 4OFTA 5F06A 4Q5NA 3F3RA 1O8XA 1UVZA 2F3MA 3KTLA 2ZUPA 4AKIA 3F6FA 4O7HA 1YF0A 1USBA 1SK0A 2ALBA 3W8JA 2FCHA 1JLVA 3IV4A 5J3RA 1A8LA 5EVOA 4TR0A 2C3TA 3GKNA 1TK8B 3GA4A 1SL1B 3UVHA 5E4WA 2E0QA 1JZRA 2OE1A 3KZQA 2B7KA 1T1VA 5GZZB 1AQWA 2VL3A 3L78A 1HNBA 1E6BA 3I69A 1KNGA 2V32A 5JWQB 3FY7A 3TJGA 2MZCA 2OBKA 3VI7A 4N30A 4IS0A 1DBYA 3ERWA 3F0IA 5D93A 3L9VA 3BOAA 4ZB7A 4JBBA 3KCMA 2KHPA 2LKUA 1SYRA 4FXYP 4LMWA 2FWEA 4HI7A 2HE3A 2VCZA 1K0DA 2I4AA 3FMWA 4XCSA 5IO0A 14GSA 1GUHA 2B5EA 1PN0A 1OC9A 2G0FA 4BL7A 5CO3A 2MMNA 3M9JA 3BJ5A 1VF1A 3C73A 3DMLA 2JU5A 4J56E 2K8SA 1PX7A 1NHOA 3QFAC 1XBSA 4XHMA 3PINA 2R4VA 1R26A 2C4JA 2KOKA 3DVWA 4Q5QA 3O6TA 3UL3A 2IFQB
chains in the Genus database with same CATH topology
3TKPA 3KJYA 4ECIA 2VLUA 4HU7A 2GSRA 3D6IA 4EUYA 2GDRA 4ECJA 1AQXA 1Y1UA 1OE7A 6GSUA 3IHGA 1B9YC 1TW9A 4IKHA 2GLRA 4LA1A 2L59A 4MPGA 3GURA 3FR9A 3ZLPA 3RHCA 1EGRA 4IQAA 4ZBAA 1G6YA 2LQOA 4MZBA 3IPZA 2XPEA 4USSA 3OR5A 4GLTA 1ST9A 1WWJA 3TU3B 2VD1A 5IMAA 1GP1A 2HZEA 4NWYA 5A5HA 3Q6OA 4MA9A 1XPVA 4BA7A 4POMA 1SVOA 2NBSA 4XS4A 4MP4A 2GGTA 3ZVJD 3IK7A 5C00A 4GRFA 6GSYA 2A2SA 2C0FA 4GF0A 3RDWA 4IN0A 1K0MA 4ZL7A 2RM5A 7GSSA 1HNAA 2DIZA 2VM2A 4FYBA 2H6XA 5KOXA 1OC3A 1V98A 3C7MA 2VUPA 3BCIA 4L0UA 1ZYNA 1GL8A 2LJAA 1MTCA 3EINA 1ACVA 3L4NA 4O5RA 3GRXA 5G1KA 3UVTA 3FHKA 3Q18A 3ZMKA 4WBJA 2PERA 1B48A 2L4QA 3H93A 4K6XA 3HZ8A 2YPMA 2BMXA 1MEKA 3GX8A 1UC7A 11GSA 3CTGA 4MNNA 5GAND 1B8XA 2JZTA 4X1UA 5IOXA 4IGJA 2PWJA 5DALA 1ZZYA 3KTBA 1X5DA 1XW5A 2HQTA 6GSTA 4KSMA 4K7NA 2MMAA 4X0XA 1R5PA 1Z9HA 1PKWA 5KN3A 4ZXGA 3IAM2 3KMNA 4PQIA 2FY6A 4AF2A 1B4PA 5ECLB 1BF5A 1ON4A 2ZNMA 4Z2UA 3CBUA 3N5OA 2B1KA 1VRSD 2H0GA 1MD4A 5DDLA 2K6VA 3PGTA 3CSHA 2H0HA 3DRNA 1X9SB 3IC4A 3PH9A 4Q5RA 5A4VA 4D73B 4PQHA 4ZIJA 1GTIA 4MZWA 4PUFC 1O81A 1KTEA 1V40A 2IMFA 3I6AA 4ML1A 4RQXA 3TOUA 5DJMA 1X0RA 2PUKC 1FO5A 1OC8A 4EDYA 5B6MA 3A3TA 4CY8A 2AHEA 2LEGA 2F8AA 5J41A 5EPFA 2KP1A 5ECSA 1Z7RA 4HQZA 2GT6A 1A24A 3C1SA 1FB6A 3QCPA 5ECPB 2V6KA 4EKZA 5J4UA 3ME8A 3U5RE 1O7UA 1T00A 1U88A 3CRUA 2D2ZA 3VPQA 3HDCA 1F37A 4XTSA 2YZHA 4BWSA 3EU3A 2C3QA 4QL9A 2H1GA 1JZOA 2YOIA 4AI6A 4NV5A 3GUSA 2O85A 2BJXA 1DE2A 3I43A 2DMLA 4IHUA 2ON5A 3I9V2 3ZVJA 5IOWA 2HSMB 2DJKA 3F6DA 4G01A 3GYKA 4KCEA 4Z2RA 2F51A 2V41A 2RIIA 2YWNA 4HEA2 3UEMA 1OYJA 3TJJA 5A1NB 1OKDA 2HRFA 2WDUA 4EC0A 1H4OA 2FNOA 2WULA 1M2AA 5AIVA 4CHSA 5BRTA 1BYEA 3ZFBA 1ERVA 3GKKA 3DWVA 2UV8G 1AIUA 3G7YA 2A2PA 4TRXA 5JCGA 1QMVA 4TXVA 3HXSA 3US3A 5G1LA 1IYHA 3M1GA 2JACA 1I5GA 3TB2A 1SL0B 6GSWA 3LQ7A 1A0RP 4ULXA 1TRWA 2OBIA 2WGRA 2YWOA 4TR4A 5ECRB 3APQA 4G19A 1TJDA 2EIOA 3HD5A 4NXIA 1Z6MA 4QMKA 5AGYA 5C04A 2VLVA 2AB6A 2B5XA 4K7OA 3TDGA 4HDEA 1BG5A 4JU5A 4PURA 2HXKA 2GQMA 4I2TA 3TRPA 2ON7A 4PXOA 2IMIA 4GCIA 2V6OA 1W4VA 2GZYA 4JE1A 4ZBDA 1WRYA 1AXDA 1SJ6A 2L4CA 4EE0A 4HZ2A 4JZQA 4EVMA 1WIKA 3Q19A 2YJHA 1XWAA 4K2XA 5FWGA 4KH7A 1RQMA 2JZSA 3EYTA 4Z7XA 1AC1A 4F9ZA 3IOSA 2B5YA 4BVYA 4QL7A 1M7TA 3D22A 1EEJA 1M9BA 2HNLA 1XVWA 2IMKA 5H5QA 3ZREA 1GSSA 3GV1A 3H79A 3PPUA 1GSUA 3FEUA 3HZ4A 2WFCA 4XIHA 1OVNA 3TGZA 2DJ1A 3UOMA 2FWFA 3PR8A 2CZ3A 3KEBA 2M46A 3WGDA 1JHBA 3GSTA 2I1UA 2LRCA 1V2AA 1GULA 3WT1A 3UJ1A 4LL4B 5HFGA 4TW5A 4MJBA 1WPIA 2CT6A 4ZB6A 3F9UA 2NPBA 3DIEA 3IA1A 4DSQA 4KNDA 1GNWA 9GSSA 2E7PA 2DJJA 2YP6A 2IL3A 1TP9A 4MF5A 1TI3A 2N5FA 5G31A 1NSWA 1BQ7A 1QFNA 4IP6A 1FOVA 1U3AA 4YAPA 1AQVA 4GSTA 3TCOA 2LJKA 2CA8A 1Q4JA 2FUG2 4RUVA 1TU7A 5AIXA 3M0FA 4PGTA 1SD9A 4NHZA 4RI6A 2H74A 4J57E 1G0TA 5FHIA 4L0WA 5JWRB 2E2MA 4O92A 2VL9A 2H1LA 4I8BA 4N3ZA 3V1WA 2EFDA 4EO3A 3F4TA 2ES7A 4MH3A 5KN0A 2TRXA 4PUAA 5HR1A 2VM1A 2X8HA 3W6GA 4OFMA 3M9KA 2DIYA 3HJMA 5BMUB 5J9BA 2CV4A 1X5EA 3LG6A 3IR4A 5A34B 4HJMA 20GSA 1F3BA 4EIQA 2H72A 2YZUA 4EL1A 2TIRA 3IBHA 2QA1A 1R4WA 1M0UA 2RM6A 4GTUA 2H01A 1DUGA 1XOAA 1ZOFA 2H76A 1XWGA 1K3LA 1QGVA 1K0AA 4AKHA 5CRHA 1YY7A 3LSZA 13GSA 2GS3A 3DGQA 1M2BA 3CSIA 4BPYA 3UIWA 2X8GA 4GXZA 2JADA 2YANA 1PD21 2YCDA 5CREA 1THOA 2DLXA 3P7XA 4FH8A 1UA5A 3NZNA 4GQFA 1SKSB 2VCTA 4HZ4A 3O76A 1K0BA 1FVKA 4ICYA 3IDVA 5ABRA 3HVSA 4E8HA 1MDIA 2EIQA 5D9WA 2NDOA 5ECQB 5CRGA 3QAVA 1PSQA 3P2AA 4K0GA 3UBLA 5CNWA 4HS1A 4RI7A 3GTUA 3TKSC 1S3CA 4AJ7A 3GN3A 2H1DA 4TVEA 5HQPA 4KE3A 3CRTA 1J08A 1TU8A 3MDKA 1GNEA 2IMDA 4KB3A 3TUEA 3VWVA 6GSXA 3R2QA 3D5JA 1SYXA 2QKEA 3MYDA 5B7CA 3KMOA 4TXOA 4MZCA 5AN1A 3E0UA 3LXTA 2YN1A 4OMVA 5IMFA 4TN8A 2XC2A 2LS5A 5ECIB 2OE0A 2XHFA 4MJEA 18GSA 1GTAA 3F63A 3CMIA 4HQSA 3QMXA 4YKFA 3ZYWA 1E2YA 1U3IA 3EU4A 1YZXA 3CSJA 1YEPA 4N10A 2FGXA 4POBA 4KAEA 1SJIA 1UN2A 1PA3A 5INYA 3KH9A 1FHEA 4BWQA 2C1YA 2YJ7A 5B8BA 2NTOA 3HVVA 2WRTA 1V58A 5DCGA 1VGLA 1EGOA 2OE3A 3FW2A 4XS6A 3DXBA 3QDNA 3G7IA 1Z3EA 3ZRDA 5F0GA 4X43A 3TKSA 2GZZA 5DJLA 4BVXA 2J23A 4MPFA 1XWCA 1XFLA 2H71A 2MMZA 3FR3A 5A4UA 2EFEA 3EPTA 2LNTA 5L71A 2QSIA 2AAWA 5HR3A 3DVXA 4FYUA 2HSNA 1YDKA 3QPMA 1N25A 4TOPA 4KF9A 4ZBBA 2E2GA 4E68A 3VWUA 3GSSA 4L5OA 4KW6A 4CDOA 2HRKB 1VF3A 1GWCA 1EOHA 2KLXA 5DCHA 3EMPA 1M9AA 3ZIVA 3APOA 3UBKA 4PNFA 4MJCA 3UARA 4TR1B 2H6YA 2B6MA 3HVXA 3RHBA 1EP7A 3LWAA 4I6XA 5G5EA 3VI5A 2R6KA 2HRAA 3LEFA 5J4YA 5ELGA 2B1LA 1Z5YE 1GH2A 3QOUA 1BAYA 4O5UA 5G2ZA 1EP8A 4ZL9A 1X9MB 4KA0A 5CP1A 2OJLA 1TOFA 1F2EA 1V9WA 1GSQA 5IMVA 3HYPA 2B7JA 4ZB8A 1GTBA 1TTZA 22GSA 4HUAA 3MIXA 2R2JA 2CAIA 2FWGA 4GSSA 4ZL8A 5LD0A 3GHAA 3ZTLA 1AAZA 2MBTA 1PGTA 1B9XC 1OKTA 1XWBA 3O3TA 4WKWA 3LGCA 2X4AA 12GSA 1LU4A 4YQVA 1XOBA 2DSAA 2GT5A 2HZFA 1HNCA 4V1Ag 5DQYA 2H75A 3KD0A 8GSSA 5ID2B 2OA7A 5F07A 2YWIA 1H75A 3HJOA 1XW6A 1URMA 4IVFA 1SU9A 1U6TA 2GZPA 2IFQA 4CW9A 1FB0A 1K3OA 5ENUA 3DD3A 2LRTA 2PPTA 3ZITA 1I9DA 4OCFA 1RK4A 1T8EB 2AV4A 4QQ7A 2P5QA 2VLTA 1JZWA 4ID0A 3HHVA 1ERTA 3TJBA 2JL4A 3ZFLA 2FLSA 3EMXA 2VL2C 4GQCA 4IQ1A 1KEBA 5DAKB 1SK1A 3GIXA 2VAFA 2PVQA 1PL2A 3WGXA 1ZYQB 5J9CA 3VK9A 2H0IA 5AISA 2FWHA 3GL3A 3RAZA 1Z7PA 5G5FA 4EXJA 2L57A 2VO4A 5E59A 4V1Ap 2HYXA 3JCML 5IQYA 3VWXA 1PN9A 1XXUA 1MDKA 16GSA 2YWMA 3IK9A 4DSSB 1PKZA 2AJQB 4V2NA 1MDJA 1YEXA 2LNSA 4KCAA 4TR3A 1K0OA 1O8WA 5J47A 1BJXA 4YQMA 1GUMA 4G0LA 3HCZA 1K0CA 4F2IA 5JCWA 10GSA 4I97A 3A5WA 4PX1A 1OC9B 3TRXA 1FW1A 4OO5A 2VIMA 3TJFA 5JWOB 2YNXA 1VF4A 1EZKA 2VL2A 4K1FA 2OKAA 2HRNA 1TK0B 5J4VA 4EF0A 4K8MA 3MNGA 3TRQA 1T4YA 4FIWA 1GLQA 2JSZA 3L9SA 2VD0A 3TOTA 2LJRA 1XCCA 2H70A 3TKQA 4XRDA 3ZL5A 5ECMB 4WF4A 19GSA 2WZ9A 2H66A 1SL2B 4WR5A 4AKGA 3QAWA 2H19A 2F8FA 4TKYA 5CAXA 3A2VA 1AUCA 1XVQA 4ZILA 4AJ8A 4ACSA 4JRRA 1C72A 3M8NA 1V57A 4D73A 1RW1A 3CTFA 2LUSA 2AYTA 4AKXB 2IIYA 2HZEB 4F0BA 2IN3A 4P3YB 1XW9A 2CVBA 4XS4B 1XWKA 2N5AA 1SKRB 4MABA 2WS2A 2HLSA 1LJRA 2X49A 3ISOA 5HR2A 3A2XA 5D96A 1GSYA 4POLA 4DVCA 1JFUA 1ZCPA 3GNJA 2MBSA 1FG4A 5D8IA 4PNGA 2DJ2A 2P0GA 1BX9A 1FVJA 5J5NA 3J7Yb 3RPNA 1GUKA 5ECKB 4EIPA 1ZYPA 2CVDA 2KUCA 4PTSA 5KN1A 2FA4A 5IMCA 1XIYA 5DBQA 4MCUA 2EC4A 4GDFA 5KEJA 2H1AA 2HSMA 2HT9A 2VOCA 3LYPA 2HFDA 4V2LA 3C1RA 3GFKA 3ZMLA 4G0IA 2WJUA 1ERWA 5ELAA 2VCQA 2LV3A 5CYYA 5DALB 4WETA 1YJ6A 3AY8A 5D9TA 5A1NA 3GL5A 4F82A 5HFKA 4NAXA 2LRNA 1F3AA 2DJ3A 2P5RA 3VFIA 1PX6A 4KDUA 2YV9A 5D9XA 5IMZA 2GTUA 4K2DA 2JZRA 5H5RA 3IC8A 1GSEA 1GRXA 4WEYA 5IPHA 3GX0A 2MMOA 3F4SA 4F03A 4MK3A 2GVPA 1T7PB 1SK2A 4IJIA 5LCZA 1TKDB 2Z9SA 3CXGA 1EOGA 2H73A 1DE1A 1AW9A 2R0GA 6GSSA 1BG1A 4JR6A 4DSSA 1IYIA 4AGSA 3GMFA 1Y25A 1ERUA 4MDCA 2RLIA 2WCIA 3LJRA 3P90A 4RQRA 1Y6EA 1QXHA 2LSTA 5CRWA 1F9MA 2BTOT 2A2RA 3L9UA 2R0CA 2AUVA 4FQUA 2H6ZA 4A5PA 4IP1A 4MF7A 3KP8A 1A23A 4ML6A 2K9FA 5F8BA 1ZL9A 2R0PA 4O32A 5JCUA 2DMMA 2CZ2A 5KN2A 2UZ8A 1FAAA 2I3YA 2QC7A 4ILFA 4KX4A 1PRXA 3IXRA 5HFIA 2JSYA 2H1BA 3GH9A 4HJ2A 3IRAA 3ZIJA 3FR6A 3HKRA 3ME7A 5CRDA 4N11A 1J0FA 1A0FA 4O5QA 3A2WA 2R3XA 3FYGA 1GSDA 2N5BA 4XRAA 4N0ZA 1SVLA 4WXTA 4DEJA 3G7JA 4OFNA 2CAQA 1GSFA 3IHQA 5A5KA 5COHA 1QQ2A 3HMJG 2O7KA 3LW9A 2C3NA 3RBTA 1G7OA 2WB9A 5B8AA 1Q98A 2K18A 4NPBA 1N2AA 2VKZG 1A2JA 4ECCA 6GSVA 1Z6NA 1HD2A 4ZB9A 2L6DA 3FZ4A 3WD6A 2G2QA 4GSNA 2PVOC 1S3DA 1X5CA 4FYCA 3BD2A 1VF2A 4G2EA 5LNKe 2C0DA 4POKA 2F9SA 1SKWB 3Q74A 4L8EA 1CQHA 4JR4A 4IJ3A 2CQ9A 4XS1A 3UMAA 1F6MC 2OACA 2EIRA 1T3BA 5DQSA 1XZOA 17GSA 1U87A 4AJ6A 4CY6A 3HA9A 3M3MA 1G7EA 2GSQA 1SVMA 3FZ5A 4LLRA 2K8VA 3W8SA 1S3AA 3QD9A 4K5RA 1YF1A 1ZMAA 1DSBA 4W66A 2KP2A 3P8WA 4HOJA 1NW2A 1LBKA 1R5AA 4KSOA 1T4ZA 1TRVA 1ABAA 1GTUA 3FK8A 4MH2A 2FHEA 3FZ9A 2X8CA 1ML6A 3TKRA 5BMUA 2DJ0A 5A34A 3ZZXA 2H8LA 4WBRD 4OO4A 3N9JA 4G0KA 4X4JA 5A4WA 4YH2A 5DVBA 4BVYB 2ZCTA 3E3EA 2IJYA 2RUFA 4I2UA 2IWTA 5EL8A 5HR0A 3FRCA 1HQOA 2OADA 2LQQA 4OD7A 4IELA 3BCKA 1BEDA 4IW9A 1M99A 2CX4A 3G9BA 2RUEA 3H8QA 4KUNA 4LL1B 2VCWA 4YAVA 1TI1A 3S9FA 1K0NA 1TXUA 1YKCA 4FO5A 4PQ1A 2GSSA 4J2FA 4F0CA 1O85A 3EURA 2L5OA 1PQNA 3VLNA 3L0HA 4NV2A 3J7Yk 1TDIA 4K7IA 3QFBC 1OAZA 4G10A 1A2MA 3D0ZA 2HSYA 2IMEA 2X99A 1QK8A 4L5LA 2I9HA 2DBCA 3CYNA 5D9VA 2VCXA 1WMJA 1WJKA 3APSA 3GKXA 1PL1A 2IPAA 1YQ1A 3A5IA 1X9WB 2FA8A 1OE8A 3FKFA 4NMUA 4MJAA 2QGVA 1N8JA 5KOWA 5FT3A 3LFLA 3WYWA 2J9HA 3EVIA 2C0EA 2NVLA 4NHWA 2XBQA 3F3QA 1QUWA 4ISDA 1KBNA 4KDYA 5GSSA 4KGIA 3FZAA 1NHYA 4K9ZA 2V1MA 1EWXA 2C80A 1TRUA 4OCEA 2P31A 3RPPA 1O73A 3D4TA 4I5QA 5IPGA 5G30A 2C8UA 1NM3A 2PGTA 1B4QA 3ERFA 5GSTA 1W89A 1R7HA 3KXOA 2A4VA 3DYRA 3EWLA 3VPTA 2M72A 2C0GA 2YV7A 1YKAA 1G6WA 2GQLA 5D73A 4EDZA 2PU9C 1TXXA 2PN8A 3UAPA 5GAPD 3R3EA 2XBIA 3C8EA 2OT3A 2PMTA 1A8YA 1EV4A 3H1NA 2L6CA 4V2MA 2HI7A 1TRSA 2GSTA 3WGEA 2H30A 1O6JA 3TKSE 3KIJA 4GWRA 3NIVA 3K8NA 4BL7B 4KDXA 1WOUA 2M80A 4ECBA 1WP0A 2V2GA 3MAKA 1PMTA 3DEXA 3MWHA 4K5SA 4MMMA 3NOFA 4MF6A 3QAGA 2DKHA 2DKIA 5H5SA 4IBPA 1FOHA 3U6VA 1A2LA 2GQKA 3KP9A 2HRKA 3F8UA 3BBYA 4K0NA 2I81A 3GKMA 3LORA 2REMA 1ILOA 3IE3A 2L5LA 4WF5A 1EV9A 3F4RA 3GTUB 1K3YA 2R5GA 3KGKA 4YKGA 4TR1A 2R37A 2MYGA 3C71A 4LMVA 3H4KA 1HYUA 3DKSA 3D4MA 3CWGA 3KM6A 1GLPA 2EFHA 1JZDA 3LYKA 4TXOB 4YQUA 3TJKA 3SWLA 2LTKA 5F05A 5A5HB 1SD8A 4WR4A 2TRCP 1J9BA 3E9JB 2HSHA 1THXA 1ZYEA 3WT2A 1M2DA 5ECOB 4Q5FA 1CQGA 3ERGA 5ECHB 2A4HA 3D21A 3ED3A 4MLYA 5IM9A 3EC3A 2QA2A 1ZGNA 4OWYA 3LXZA 2VCVA 5J40A 2CX3A 1TK5B 4E8EA 1WE0A 5IMDA 5ID2A 5EY6A 4G9HA 3EE2A 3HY2A 3SBCA 2CVKA 3GH6A 1EEMA 5ECNB 2EFCA 3KH7A 3HJPA 1YVLA 1SJZA 3IAS2 4N0VA 3VWWA 2O8VB 1JLWA 4BVXB 5IIZA 2XPDA 3VURA 2DC5A 4Z2TA 4H86A 5IO2A 2FD3A 2O87A 2B3SA 1MD3A 3QR6A 5B6NA 3MSZA 4JEDA 2X64A 1SENA 4HU9A 4DSRA 2O89A 2PBJA 2HSNB 2O5VA 5DAKA 4OFTA 5F06A 4Q5NA 3F3RA 1O8XA 1UVZA 2F3MA 3KTLA 2ZUPA 4AKIA 3F6FA 4O7HA 1YF0A 1USBA 1SK0A 2ALBA 3W8JA 2FCHA 1JLVA 3IV4A 5J3RA 1A8LA 5EVOA 4TR0A 2C3TA 3GKNA 1TK8B 3GA4A 1SL1B 3UVHA 5E4WA 2E0QA 1JZRA 2OE1A 3KZQA 2B7KA 1T1VA 5GZZB 1AQWA 2VL3A 3L78A 1HNBA 1E6BA 3I69A 1KNGA 2V32A 5JWQB 3FY7A 3TJGA 2MZCA 2OBKA 3VI7A 4N30A 4IS0A 1DBYA 3ERWA 3F0IA 5D93A 3L9VA 3BOAA 4ZB7A 4JBBA 3KCMA 2KHPA 2LKUA 1SYRA 4LMWA 2FWEA 4HI7A 2HE3A 2VCZA 1K0DA 2I4AA 3FMWA 4XCSA 5IO0A 14GSA 1GUHA 2B5EA 1PN0A 1OC9A 2G0FA 4BL7A 5CO3A 2MMNA 3M9JA 3BJ5A 1VF1A 3C73A 3DMLA 2JU5A 4J56E 2K8SA 1PX7A 1NHOA 3QFAC 1XBSA 4XHMA 3PINA 2R4VA 1R26A 2C4JA 2KOKA 3DVWA 4Q5QA 3O6TA 3UL3A 2IFQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TKP A;  3KJY A;  4ECI A;  2VLU A;  4HU7 A;  2GSR A;  3D6I A;  4EUY A;  2GDR A;  4ECJ A;  1AQX A;  1OE7 A;  6GSU A;  1B9Y C;  1TW9 A;  4IKH A;  2GLR A;  4LA1 A;  2L59 A;  4MPG A;  3GUR A;  3FR9 A;  3ZLP A;  3RHC A;  1EGR A;  4IQA A;  4ZBA A;  1G6Y A;  2LQO A;  4MZB A;  3IPZ A;  2XPE A;  4USS A;  3OR5 A;  4GLT A;  1ST9 A;  1WWJ A;  2VD1 A;  5IMA A;  1GP1 A;  2HZE A;  4NWY A;  3Q6O A;  4MA9 A;  1XPV A;  4BA7 A;  4POM A;  2NBS A;  4XS4 A;  4MP4 A;  2GGT A;  3ZVJ D;  3IK7 A;  5C00 A;  4GRF A;  6GSY A;  2A2S A;  2C0F A;  4GF0 A;  3RDW A;  4IN0 A;  1K0M A;  4ZL7 A;  2RM5 A;  7GSS A;  1HNA A;  2DIZ A;  2VM2 A;  4FYB A;  2H6X A;  1OC3 A;  1V98 A;  3C7M A;  2VUP A;  3BCI A;  4L0U A;  1GL8 A;  2LJA A;  1MTC A;  3EIN A;  1ACV A;  3L4N A;  4O5R A;  3GRX A;  5G1K A;  3UVT A;  3FHK A;  3Q18 A;  3ZMK A;  4WBJ A;  2PER A;  1B48 A;  2L4Q A;  3H93 A;  4K6X A;  3HZ8 A;  2YPM A;  2BMX A;  1MEK A;  3GX8 A;  1UC7 A;  11GS A;  3CTG A;  5GAN D;  1B8X A;  2JZT A;  4X1U A;  5IOX A;  4IGJ A;  2PWJ A;  5DAL A;  1ZZY A;  3KTB A;  1X5D A;  1XW5 A;  2HQT A;  6GST A;  4KSM A;  4K7N A;  2MMA A;  4X0X A;  1R5P A;  1Z9H A;  1PKW A;  5KN3 A;  4ZXG A;  3IAM 2;  3KMN A;  4PQI A;  2FY6 A;  4AF2 A;  1B4P A;  5ECL B;  1ON4 A;  2ZNM A;  3CBU A;  3N5O A;  2B1K A;  1VRS D;  2H0G A;  1MD4 A;  5DDL A;  2K6V A;  3PGT A;  3CSH A;  2H0H A;  3DRN A;  1X9S B;  3IC4 A;  3PH9 A;  4Q5R A;  5A4V A;  4D73 B;  4PQH A;  4ZIJ A;  1GTI A;  4MZW A;  4PUF C;  1O81 A;  1KTE A;  1V40 A;  2IMF A;  3I6A A;  4ML1 A;  4RQX A;  3TOU A;  5DJM A;  1X0R A;  2PUK C;  1FO5 A;  1OC8 A;  4EDY A;  5B6M A;  3A3T A;  2AHE A;  2LEG A;  2F8A A;  5J41 A;  5EPF A;  2KP1 A;  5ECS A;  1Z7R A;  4HQZ A;  2GT6 A;  1A24 A;  3C1S A;  1FB6 A;  3QCP A;  5ECP B;  2V6K A;  4EKZ A;  5J4U A;  3ME8 A;  3U5R E;  1O7U A;  1T00 A;  1U88 A;  3CRU A;  2D2Z A;  3VPQ A;  3HDC A;  1F37 A;  4XTS A;  2YZH A;  4BWS A;  3EU3 A;  2C3Q A;  4QL9 A;  2H1G A;  1JZO A;  2YOI A;  4NV5 A;  3GUS A;  2O85 A;  2BJX A;  1DE2 A;  3I43 A;  2DML A;  4IHU A;  2ON5 A;  3I9V 2;  3ZVJ A;  5IOW A;  2HSM B;  2DJK A;  3F6D A;  3GYK A;  4KCE A;  2F51 A;  2V41 A;  2RII A;  2YWN A;  4HEA 2;  3UEM A;  1OYJ A;  3TJJ A;  1OKD A;  2HRF A;  2WDU A;  4EC0 A;  1H4O A;  2FNO A;  2WUL A;  1M2A A;  5AIV A;  4CHS A;  1BYE A;  3ZFB A;  1ERV A;  3GKK A;  3DWV A;  1AIU A;  3G7Y A;  4TRX A;  5JCG A;  1QMV A;  4TXV A;  3HXS A;  3US3 A;  5G1L A;  1IYH A;  3M1G A;  2JAC A;  1I5G A;  3TB2 A;  1SL0 B;  6GSW A;  3LQ7 A;  1A0R P;  4ULX A;  1TRW A;  2OBI A;  2WGR A;  2YWO A;  4TR4 A;  5ECR B;  3APQ A;  4G19 A;  1TJD A;  2EIO A;  3HD5 A;  4NXI A;  1Z6M A;  5AGY A;  5C04 A;  2VLV A;  2AB6 A;  2B5X A;  4K7O A;  3TDG A;  4HDE A;  1BG5 A;  4JU5 A;  4PUR A;  2HXK A;  2GQM A;  4I2T A;  3TRP A;  2ON7 A;  4PXO A;  2IMI A;  4GCI A;  2V6O A;  1W4V A;  2GZY A;  4JE1 A;  4ZBD A;  1WRY A;  1AXD A;  1SJ6 A;  2L4C A;  4EE0 A;  4HZ2 A;  4JZQ A;  4EVM A;  1WIK A;  3Q19 A;  2YJH A;  1XWA A;  5FWG A;  4KH7 A;  1RQM A;  2JZS A;  3EYT A;  4Z7X A;  1AC1 A;  4F9Z A;  3IOS A;  2B5Y A;  4BVY A;  4QL7 A;  1M7T A;  3D22 A;  1EEJ A;  1M9B A;  2HNL A;  1XVW A;  2IMK A;  5H5Q A;  3ZRE A;  1GSS A;  3GV1 A;  3H79 A;  3PPU A;  1GSU A;  3FEU A;  3HZ4 A;  2WFC A;  4XIH A;  1OVN A;  3TGZ A;  2DJ1 A;  3UOM A;  2FWF A;  3PR8 A;  2CZ3 A;  3KEB A;  2M46 A;  3WGD A;  1JHB A;  3GST A;  2I1U A;  2LRC A;  1V2A A;  1GUL A;  3WT1 A;  3UJ1 A;  4LL4 B;  5HFG A;  4TW5 A;  4MJB A;  1WPI A;  2CT6 A;  4ZB6 A;  3F9U A;  2NPB A;  3DIE A;  3IA1 A;  4DSQ A;  4KND A;  1GNW A;  9GSS A;  2E7P A;  2DJJ A;  2YP6 A;  2IL3 A;  1TP9 A;  4MF5 A;  1TI3 A;  2N5F A;  5G31 A;  1NSW A;  1BQ7 A;  1QFN A;  4IP6 A;  1FOV A;  1U3A A;  4YAP A;  1AQV A;  4GST A;  3TCO A;  2LJK A;  2CA8 A;  1Q4J A;  2FUG 2;  4RUV A;  1TU7 A;  5AIX A;  3M0F A;  4PGT A;  1SD9 A;  4NHZ A;  4RI6 A;  2H74 A;  4J57 E;  1G0T A;  5FHI A;  4L0W A;  5JWR B;  2E2M A;  4O92 A;  2VL9 A;  4I8B A;  3V1W A;  4EO3 A;  3F4T A;  2ES7 A;  4MH3 A;  5KN0 A;  2TRX A;  4PUA A;  5HR1 A;  2VM1 A;  2X8H A;  3W6G A;  4OFM A;  3M9K A;  2DIY A;  3HJM A;  5J9B A;  2CV4 A;  1X5E A;  3LG6 A;  3IR4 A;  4HJM A;  20GS A;  1F3B A;  2H72 A;  2YZU A;  4EL1 A;  2TIR A;  3IBH A;  1R4W A;  1M0U A;  2RM6 A;  4GTU A;  2H01 A;  1DUG A;  1XOA A;  1ZOF A;  2H76 A;  1XWG A;  1K3L A;  1QGV A;  1K0A A;  5CRH A;  1YY7 A;  3LSZ A;  13GS A;  2GS3 A;  3DGQ A;  1M2B A;  3CSI A;  4BPY A;  3UIW A;  2X8G A;  4GXZ A;  2JAD A;  2YAN A;  1PD2 1;  2YCD A;  5CRE A;  1THO A;  2DLX A;  3P7X A;  4FH8 A;  1UA5 A;  3NZN A;  4GQF A;  1SKS B;  2VCT A;  4HZ4 A;  3O76 A;  1K0B A;  1FVK A;  3IDV A;  5ABR A;  3HVS A;  4E8H A;  1MDI A;  2EIQ A;  5D9W A;  2NDO A;  5ECQ B;  5CRG A;  3QAV A;  1PSQ A;  3P2A A;  4K0G A;  3UBL A;  5CNW A;  4HS1 A;  4RI7 A;  3GTU A;  3TKS C;  1S3C A;  4AJ7 A;  3GN3 A;  2H1D A;  4TVE A;  5HQP A;  4KE3 A;  3CRT A;  1J08 A;  1TU8 A;  3MDK A;  1GNE A;  2IMD A;  4KB3 A;  3TUE A;  3VWV A;  6GSX A;  3R2Q A;  3D5J A;  1SYX A;  2QKE A;  5B7C A;  3KMO A;  4TXO A;  4MZC A;  5AN1 A;  3E0U A;  3LXT A;  2YN1 A;  4OMV A;  5IMF A;  4TN8 A;  2XC2 A;  2LS5 A;  5ECI B;  2OE0 A;  2XHF A;  4MJE A;  18GS A;  1GTA A;  3F63 A;  3CMI A;  4HQS A;  3QMX A;  3ZYW A;  1E2Y A;  1U3I A;  3EU4 A;  1YZX A;  3CSJ A;  1YEP A;  4N10 A;  2FGX A;  4POB A;  4KAE A;  1SJI A;  1UN2 A;  1PA3 A;  5INY A;  3KH9 A;  1FHE A;  4BWQ A;  2C1Y A;  2YJ7 A;  5B8B A;  2NTO A;  3HVV A;  2WRT A;  1V58 A;  5DCG A;  1VGL A;  1EGO A;  2OE3 A;  3FW2 A;  4XS6 A;  3DXB A;  3QDN A;  3G7I A;  1Z3E A;  3ZRD A;  5F0G A;  4X43 A;  3TKS A;  2GZZ A;  5DJL A;  4BVX A;  2J23 A;  4MPF A;  1XWC A;  1XFL A;  2H71 A;  2MMZ A;  3FR3 A;  5A4U A;  2LNT A;  5L71 A;  2QSI A;  2AAW A;  5HR3 A;  3DVX A;  4FYU A;  1YDK A;  3QPM A;  4TOP A;  4KF9 A;  4ZBB A;  2E2G A;  3VWU A;  3GSS A;  4L5O A;  4KW6 A;  4CDO A;  2HRK B;  1VF3 A;  1GWC A;  1EOH A;  2KLX A;  5DCH A;  3EMP A;  1M9A A;  3ZIV A;  3APO A;  3UBK A;  4PNF A;  4MJC A;  3UAR A;  4TR1 B;  2H6Y A;  2B6M A;  3HVX A;  3RHB A;  1EP7 A;  3LWA A;  4I6X A;  5G5E A;  3VI5 A;  2R6K A;  2HRA A;  2B1L A;  5ELG A;  3LEF A;  1Z5Y E;  1GH2 A;  3QOU A;  1BAY A;  5G2Z A;  1EP8 A;  4ZL9 A;  1X9M B;  4KA0 A;  5CP1 A;  2OJL A;  1TOF A;  1F2E A;  1V9W A;  1GSQ A;  5IMV A;  3HYP A;  2B7J A;  4ZB8 A;  1GTB A;  1TTZ A;  22GS A;  4HUA A;  2R2J A;  2CAI A;  2FWG A;  4GSS A;  4ZL8 A;  5LD0 A;  3GHA A;  3ZTL A;  1AAZ A;  2MBT A;  1PGT A;  1B9X C;  1OKT A;  1XWB A;  3O3T A;  4WKW A;  3LGC A;  12GS A;  1LU4 A;  4YQV A;  1XOB A;  2DSA A;  2GT5 A;  2HZF A;  1HNC A;  4V1A g;  5DQY A;  2H75 A;  3KD0 A;  8GSS A;  5ID2 B;  2OA7 A;  5F07 A;  2YWI A;  1H75 A;  3HJO A;  1XW6 A;  1URM A;  4IVF A;  1SU9 A;  1U6T A;  2GZP A;  2IFQ A;  4CW9 A;  1FB0 A;  1K3O A;  5ENU A;  3DD3 A;  2LRT A;  2PPT A;  3ZIT A;  1I9D A;  4OCF A;  1RK4 A;  1T8E B;  2AV4 A;  4QQ7 A;  2P5Q A;  2VLT A;  1JZW A;  4ID0 A;  3HHV A;  1ERT A;  3TJB A;  2JL4 A;  3ZFL A;  2FLS A;  3EMX A;  2VL2 C;  4GQC A;  4IQ1 A;  1KEB A;  5DAK B;  1SK1 A;  3GIX A;  2VAF A;  2PVQ A;  1PL2 A;  3WGX A;  1ZYQ B;  5J9C A;  3VK9 A;  2H0I A;  5AIS A;  2FWH A;  3GL3 A;  3RAZ A;  1Z7P A;  5G5F A;  4EXJ A;  2L57 A;  2VO4 A;  5E59 A;  4V1A p;  2HYX A;  3JCM L;  5IQY A;  3VWX A;  1PN9 A;  1XXU A;  1MDK A;  16GS A;  2YWM A;  3IK9 A;  4DSS B;  1PKZ A;  2AJQ B;  4V2N A;  1MDJ A;  1YEX A;  2LNS A;  4KCA A;  4TR3 A;  1K0O A;  1O8W A;  1BJX A;  4YQM A;  1GUM A;  4G0L A;  3HCZ A;  1K0C A;  4F2I A;  5JCW A;  10GS A;  4I97 A;  3A5W A;  4PX1 A;  1OC9 B;  3TRX A;  1FW1 A;  4OO5 A;  2VIM A;  3TJF A;  5JWO B;  2YNX A;  1VF4 A;  1EZK A;  2VL2 A;  4K1F A;  2OKA A;  2HRN A;  1TK0 B;  4EF0 A;  4K8M A;  3MNG A;  3TRQ A;  1T4Y A;  4FIW A;  1GLQ A;  2JSZ A;  3L9S A;  2VD0 A;  3TOT A;  2LJR A;  1XCC A;  2H70 A;  3TKQ A;  4XRD A;  3ZL5 A;  5ECM B;  4WF4 A;  19GS A;  2WZ9 A;  2H66 A;  1SL2 B;  4WR5 A;  3QAW A;  2H19 A;  2F8F A;  4TKY A;  5CAX A;  3A2V A;  1AUC A;  1XVQ A;  4ZIL A;  4AJ8 A;  4ACS A;  4JRR A;  1C72 A;  3M8N A;  1V57 A;  4D73 A;  1RW1 A;  3CTF A;  2LUS A;  2AYT A;  2IIY A;  2HZE B;  4F0B A;  2IN3 A;  4P3Y B;  1XW9 A;  2CVB A;  4XS4 B;  1XWK A;  2N5A A;  1SKR B;  4MAB A;  2WS2 A;  2HLS A;  1LJR A;  3ISO A;  5HR2 A;  3A2X A;  5D96 A;  1GSY A;  4POL A;  4DVC A;  1JFU A;  1ZCP A;  3GNJ A;  2MBS A;  1FG4 A;  5D8I A;  4PNG A;  2DJ2 A;  2P0G A;  1BX9 A;  1FVJ A;  5J5N A;  3J7Y b;  3RPN A;  1GUK A;  5ECK B;  2CVD A;  2KUC A;  4PTS A;  5KN1 A;  2FA4 A;  5IMC A;  1XIY A;  5DBQ A;  4MCU A;  2EC4 A;  5KEJ A;  2H1A A;  2HSM A;  2HT9 A;  2VOC A;  3LYP A;  2HFD A;  4V2L A;  3C1R A;  3GFK A;  3ZML A;  4G0I A;  2WJU A;  1ERW A;  5ELA A;  2VCQ A;  2LV3 A;  5CYY A;  5DAL B;  4WET A;  1YJ6 A;  3AY8 A;  5D9T A;  3GL5 A;  4F82 A;  5HFK A;  4NAX A;  2LRN A;  1F3A A;  2DJ3 A;  2P5R A;  3VFI A;  1PX6 A;  4KDU A;  2YV9 A;  5D9X A;  5IMZ A;  4K2D A;  2GTU A;  2JZR A;  5H5R A;  3IC8 A;  1GSE A;  1GRX A;  4WEY A;  5IPH A;  3GX0 A;  2MMO A;  3F4S A;  4F03 A;  4MK3 A;  2GVP A;  1T7P B;  1SK2 A;  4IJI A;  5LCZ A;  1TKD B;  2Z9S A;  3CXG A;  1EOG A;  2H73 A;  1DE1 A;  1AW9 A;  6GSS A;  4JR6 A;  4DSS A;  1IYI A;  4AGS A;  3GMF A;  1Y25 A;  1ERU A;  4MDC A;  2RLI A;  2WCI A;  3LJR A;  3P90 A;  4RQR A;  1Y6E A;  1QXH A;  2LST A;  5CRW A;  1F9M A;  2BTO T;  2A2R A;  3L9U A;  2AUV A;  4FQU A;  2H6Z A;  4IP1 A;  4MF7 A;  3KP8 A;  1A23 A;  4ML6 A;  2K9F A;  5F8B A;  1ZL9 A;  4O32 A;  5JCU A;  2DMM A;  2CZ2 A;  5KN2 A;  2UZ8 A;  1FAA A;  2I3Y A;  2QC7 A;  4ILF A;  4KX4 A;  1PRX A;  3IXR A;  5HFI A;  2JSY A;  2H1B A;  3GH9 A;  4HJ2 A;  3IRA A;  3ZIJ A;  3FR6 A;  3HKR A;  3ME7 A;  5CRD A;  4N11 A;  1J0F A;  1A0F A;  3A2W A;  2R3X A;  3FYG A;  1GSD A;  2N5B A;  4XRA A;  4N0Z A;  4WXT A;  4DEJ A;  3G7J A;  4OFN A;  2CAQ A;  1GSF A;  3IHQ A;  5A5K A;  5COH A;  1QQ2 A;  2O7K A;  2C3N A;  3RBT A;  1G7O A;  2WB9 A;  5B8A A;  1Q98 A;  2K18 A;  4NPB A;  1N2A A;  1A2J A;  4ECC A;  6GSV A;  1Z6N A;  1HD2 A;  4ZB9 A;  2L6D A;  3FZ4 A;  3WD6 A;  2G2Q A;  4GSN A;  2PVO C;  1S3D A;  1X5C A;  4FYC A;  3BD2 A;  1VF2 A;  4G2E A;  5LNK e;  2C0D A;  4POK A;  2F9S A;  1SKW B;  3Q74 A;  4L8E A;  1CQH A;  4JR4 A;  4IJ3 A;  2CQ9 A;  4XS1 A;  3UMA A;  1F6M C;  2OAC A;  2EIR A;  1T3B A;  5DQS A;  1XZO A;  17GS A;  1U87 A;  4AJ6 A;  3HA9 A;  3M3M A;  1G7E A;  2GSQ A;  3FZ5 A;  4LLR A;  2K8V A;  3W8S A;  1S3A A;  3QD9 A;  1YF1 A;  1ZMA A;  1DSB A;  2KP2 A;  3P8W A;  4HOJ A;  1NW2 A;  1LBK A;  1R5A A;  4KSO A;  1T4Z A;  1TRV A;  1ABA A;  1GTU A;  3FK8 A;  4MH2 A;  2FHE A;  3FZ9 A;  2X8C A;  1ML6 A;  3TKR A;  5BMU A;  2DJ0 A;  3ZZX A;  2H8L A;  4WBR D;  4OO4 A;  3N9J A;  4G0K A;  5A4W A;  4YH2 A;  5DVB A;  4BVY B;  2ZCT A;  3E3E A;  2IJY A;  2RUF A;  4I2U A;  2IWT A;  5EL8 A;  5HR0 A;  3FRC A;  1HQO A;  2OAD A;  2LQQ A;  4OD7 A;  4IEL A;  3BCK A;  1BED A;  4IW9 A;  1M99 A;  2CX4 A;  3G9B A;  2RUE A;  3H8Q A;  4KUN A;  4LL1 B;  2VCW A;  4YAV A;  1TI1 A;  3S9F A;  1K0N A;  1YKC A;  4FO5 A;  4PQ1 A;  2GSS A;  4J2F A;  4F0C A;  1O85 A;  3EUR A;  2L5O A;  1PQN A;  3VLN A;  3L0H A;  4NV2 A;  3J7Y k;  1TDI A;  4K7I A;  3QFB C;  1OAZ A;  4G10 A;  1A2M A;  3D0Z A;  2HSY A;  2IME A;  2X99 A;  1QK8 A;  4L5L A;  2I9H A;  2DBC A;  3CYN A;  5D9V A;  2VCX A;  1WMJ A;  1WJK A;  3APS A;  3GKX A;  1PL1 A;  2IPA A;  1YQ1 A;  1X9W B;  2FA8 A;  1OE8 A;  3FKF A;  4NMU A;  4MJA A;  2QGV A;  1N8J A;  5FT3 A;  3LFL A;  3WYW A;  2J9H A;  3EVI A;  2C0E A;  2NVL A;  4NHW A;  2XBQ A;  3F3Q A;  1QUW A;  4ISD A;  1KBN A;  4KDY A;  5GSS A;  4KGI A;  3FZA A;  1NHY A;  4K9Z A;  2V1M A;  1EWX A;  2C80 A;  1TRU A;  4OCE A;  2P31 A;  3RPP A;  1O73 A;  3D4T A;  4I5Q A;  5IPG A;  5G30 A;  2C8U A;  1NM3 A;  2PGT A;  1B4Q A;  3ERF A;  5GST A;  1W89 A;  1R7H A;  3KXO A;  2A4V A;  3DYR A;  3EWL A;  3VPT A;  2M72 A;  2C0G A;  2YV7 A;  1YKA A;  1G6W A;  2GQL A;  5D73 A;  4EDZ A;  2PU9 C;  1TXX A;  2PN8 A;  3UAP A;  5GAP D;  3R3E A;  2XBI A;  3C8E A;  2PMT A;  1A8Y A;  1EV4 A;  3H1N A;  2L6C A;  4V2M A;  2HI7 A;  1TRS A;  2GST A;  3WGE A;  2H30 A;  1O6J A;  3TKS E;  3KIJ A;  4GWR A;  3NIV A;  3K8N A;  4BL7 B;  4KDX A;  1WOU A;  2M80 A;  4ECB A;  1WP0 A;  2V2G A;  3MAK A;  1PMT A;  3DEX A;  3MWH A;  4MMM A;  3NOF A;  4MF6 A;  3QAG A;  5H5S A;  4IBP A;  3U6V A;  1A2L A;  2GQK A;  3KP9 A;  2HRK A;  3F8U A;  3BBY A;  4K0N A;  2I81 A;  3GKM A;  3LOR A;  2REM A;  1ILO A;  3IE3 A;  2L5L A;  4WF5 A;  1EV9 A;  3F4R A;  3GTU B;  1K3Y A;  2R5G A;  3KGK A;  4TR1 A;  2R37 A;  2MYG A;  3C71 A;  4LMV A;  3H4K A;  1HYU A;  3DKS A;  3D4M A;  3KM6 A;  1GLP A;  1JZD A;  3LYK A;  4TXO B;  4YQU A;  3TJK A;  3SWL A;  2LTK A;  5F05 A;  1SD8 A;  4WR4 A;  2TRC P;  1J9B A;  3E9J B;  2HSH A;  1THX A;  1ZYE A;  3WT2 A;  1M2D A;  5ECO B;  4Q5F A;  1CQG A;  3ERG A;  5ECH B;  3D21 A;  3ED3 A;  4MLY A;  5IM9 A;  3EC3 A;  1ZGN A;  4OWY A;  3LXZ A;  2VCV A;  2CX3 A;  1TK5 B;  4E8E A;  1WE0 A;  5IMD A;  5ID2 A;  5EY6 A;  4G9H A;  3EE2 A;  3HY2 A;  3SBC A;  2CVK A;  3GH6 A;  1EEM A;  5ECN B;  3KH7 A;  3HJP A;  1SJZ A;  3IAS 2;  4N0V A;  3VWW A;  2O8V B;  1JLW A;  4BVX B;  5IIZ A;  2XPD A;  3VUR A;  2DC5 A;  4H86 A;  5IO2 A;  2FD3 A;  2O87 A;  2B3S A;  1MD3 A;  3QR6 A;  5B6N A;  3MSZ A;  4JED A;  2X64 A;  1SEN A;  4HU9 A;  4DSR A;  2O89 A;  2PBJ A;  2HSN B;  5DAK A;  4OFT A;  5F06 A;  4Q5N A;  3F3R A;  1O8X A;  1UVZ A;  2F3M A;  3KTL A;  2ZUP A;  3F6F A;  4O7H A;  1YF0 A;  1USB A;  1SK0 A;  2ALB A;  3W8J A;  2FCH A;  1JLV A;  3IV4 A;  5J3R A;  1A8L A;  5EVO A;  4TR0 A;  2C3T A;  3GKN A;  1TK8 B;  3GA4 A;  1SL1 B;  3UVH A;  5E4W A;  2E0Q A;  1JZR A;  2OE1 A;  3KZQ A;  2B7K A;  1T1V A;  5GZZ B;  1AQW A;  2VL3 A;  3L78 A;  1HNB A;  1E6B A;  3I69 A;  1KNG A;  2V32 A;  5JWQ B;  3FY7 A;  3TJG A;  2MZC A;  2OBK A;  3VI7 A;  4N30 A;  4IS0 A;  1DBY A;  3ERW A;  3F0I A;  5D93 A;  3L9V A;  3BOA A;  4JBB A;  3KCM A;  2KHP A;  2LKU A;  1SYR A;  4LMW A;  2FWE A;  4HI7 A;  2HE3 A;  2VCZ A;  1K0D A;  2I4A A;  4XCS A;  5IO0 A;  14GS A;  1GUH A;  2B5E A;  1OC9 A;  2G0F A;  4BL7 A;  5CO3 A;  2MMN A;  3M9J A;  3BJ5 A;  1VF1 A;  3C73 A;  3DML A;  2JU5 A;  4J56 E;  2K8S A;  1PX7 A;  1NHO A;  3QFA C;  1XBS A;  4XHM A;  3PIN A;  2R4V A;  1R26 A;  2C4J A;  2KOK A;  3DVW A;  4Q5Q A;  3O6T A;  3UL3 A;  2IFQ B; 
#chains in the Genus database with same CATH topology
 3TKP A;  3KJY A;  4ECI A;  2VLU A;  4HU7 A;  2GSR A;  3D6I A;  4EUY A;  2GDR A;  4ECJ A;  1AQX A;  1Y1U A;  1OE7 A;  6GSU A;  3IHG A;  1B9Y C;  1TW9 A;  4IKH A;  2GLR A;  4LA1 A;  2L59 A;  4MPG A;  3GUR A;  3FR9 A;  3ZLP A;  3RHC A;  1EGR A;  4IQA A;  4ZBA A;  1G6Y A;  2LQO A;  4MZB A;  3IPZ A;  2XPE A;  4USS A;  3OR5 A;  4GLT A;  1ST9 A;  1WWJ A;  3TU3 B;  2VD1 A;  5IMA A;  1GP1 A;  2HZE A;  4NWY A;  5A5H A;  3Q6O A;  4MA9 A;  1XPV A;  4BA7 A;  4POM A;  1SVO A;  2NBS A;  4XS4 A;  4MP4 A;  2GGT A;  3ZVJ D;  3IK7 A;  5C00 A;  4GRF A;  6GSY A;  2A2S A;  2C0F A;  4GF0 A;  3RDW A;  4IN0 A;  1K0M A;  4ZL7 A;  2RM5 A;  7GSS A;  1HNA A;  2DIZ A;  2VM2 A;  4FYB A;  2H6X A;  5KOX A;  1OC3 A;  1V98 A;  3C7M A;  2VUP A;  3BCI A;  4L0U A;  1ZYN A;  1GL8 A;  2LJA A;  1MTC A;  3EIN A;  1ACV A;  3L4N A;  4O5R A;  3GRX A;  5G1K A;  3UVT A;  3FHK A;  3Q18 A;  3ZMK A;  4WBJ A;  2PER A;  1B48 A;  2L4Q A;  3H93 A;  4K6X A;  3HZ8 A;  2YPM A;  2BMX A;  1MEK A;  3GX8 A;  1UC7 A;  11GS A;  3CTG A;  4MNN A;  5GAN D;  1B8X A;  2JZT A;  4X1U A;  5IOX A;  4IGJ A;  2PWJ A;  5DAL A;  1ZZY A;  3KTB A;  1X5D A;  1XW5 A;  2HQT A;  6GST A;  4KSM A;  4K7N A;  2MMA A;  4X0X A;  1R5P A;  1Z9H A;  1PKW A;  5KN3 A;  4ZXG A;  3IAM 2;  3KMN A;  4PQI A;  2FY6 A;  4AF2 A;  1B4P A;  5ECL B;  1BF5 A;  1ON4 A;  2ZNM A;  4Z2U A;  3CBU A;  3N5O A;  2B1K A;  1VRS D;  2H0G A;  1MD4 A;  5DDL A;  2K6V A;  3PGT A;  3CSH A;  2H0H A;  3DRN A;  1X9S B;  3IC4 A;  3PH9 A;  4Q5R A;  5A4V A;  2WVX A;  4D73 B;  4PQH A;  4ZIJ A;  1GTI A;  4MZW A;  4PUF C;  1O81 A;  1KTE A;  1V40 A;  2IMF A;  3I6A A;  4ML1 A;  4RQX A;  3TOU A;  5DJM A;  1X0R A;  2PUK C;  1FO5 A;  1OC8 A;  4EDY A;  5B6M A;  3A3T A;  4CY8 A;  2AHE A;  2LEG A;  2F8A A;  5J41 A;  5EPF A;  2KP1 A;  5ECS A;  1Z7R A;  4HQZ A;  2GT6 A;  1A24 A;  3C1S A;  1FB6 A;  3QCP A;  5ECP B;  2V6K A;  4EKZ A;  5J4U A;  3ME8 A;  3U5R E;  1O7U A;  1T00 A;  1U88 A;  3CRU A;  2D2Z A;  3VPQ A;  3HDC A;  1F37 A;  4XTS A;  2YZH A;  4BWS A;  3EU3 A;  2C3Q A;  4QL9 A;  2H1G A;  1JZO A;  2YOI A;  4AI6 A;  4NV5 A;  3GUS A;  2O85 A;  2BJX A;  1DE2 A;  3I43 A;  2DML A;  4IHU A;  2ON5 A;  3I9V 2;  3ZVJ A;  5IOW A;  2HSM B;  2DJK A;  3F6D A;  4G01 A;  3GYK A;  4KCE A;  4Z2R A;  2F51 A;  2V41 A;  2RII A;  2YWN A;  4HEA 2;  3UEM A;  1OYJ A;  3TJJ A;  5A1N B;  1OKD A;  2HRF A;  2WDU A;  4EC0 A;  1H4O A;  2FNO A;  2WUL A;  1M2A A;  5AIV A;  4CHS A;  5BRT A;  1BYE A;  3ZFB A;  1ERV A;  3GKK A;  3DWV A;  2UV8 G;  1AIU A;  3G7Y A;  2A2P A;  4TRX A;  5JCG A;  1QMV A;  4TXV A;  3HXS A;  3US3 A;  5G1L A;  1IYH A;  3M1G A;  2JAC A;  1I5G A;  3TB2 A;  1SL0 B;  6GSW A;  3LQ7 A;  1A0R P;  4ULX A;  1TRW A;  2OBI A;  2WGR A;  2YWO A;  4TR4 A;  5ECR B;  3APQ A;  4G19 A;  1TJD A;  2EIO A;  3HD5 A;  4NXI A;  1Z6M A;  4QMK A;  5AGY A;  5C04 A;  2VLV A;  2AB6 A;  2B5X A;  4K7O A;  3TDG A;  4HDE A;  1BG5 A;  4JU5 A;  4PUR A;  2HXK A;  2GQM A;  4I2T A;  3TRP A;  2ON7 A;  4PXO A;  2IMI A;  4GCI A;  2V6O A;  1W4V A;  2GZY A;  4JE1 A;  4ZBD A;  1WRY A;  4PI0 C;  1AXD A;  1SJ6 A;  2L4C A;  4EE0 A;  4HZ2 A;  4JZQ A;  4EVM A;  1WIK A;  3Q19 A;  2YJH A;  1XWA A;  4K2X A;  5FWG A;  4KH7 A;  1RQM A;  2JZS A;  3EYT A;  4Z7X A;  1AC1 A;  4F9Z A;  3IOS A;  2B5Y A;  4BVY A;  4QL7 A;  1M7T A;  3RGB C;  3D22 A;  1EEJ A;  1M9B A;  2HNL A;  1XVW A;  2IMK A;  5H5Q A;  3ZRE A;  1GSS A;  3GV1 A;  3H79 A;  3PPU A;  1GSU A;  3FEU A;  3HZ4 A;  2WFC A;  4XIH A;  1OVN A;  3TGZ A;  2DJ1 A;  3UOM A;  2FWF A;  3PR8 A;  2CZ3 A;  3KEB A;  2M46 A;  3WGD A;  1JHB A;  3GST A;  2I1U A;  2LRC A;  1V2A A;  1GUL A;  3WT1 A;  3UJ1 A;  4LL4 B;  5HFG A;  4TW5 A;  4MJB A;  1WPI A;  2CT6 A;  4ZB6 A;  3F9U A;  2NPB A;  3DIE A;  3IA1 A;  4DSQ A;  4KND A;  1GNW A;  9GSS A;  2E7P A;  2DJJ A;  2YP6 A;  2IL3 A;  1TP9 A;  4MF5 A;  1TI3 A;  2N5F A;  5G31 A;  1NSW A;  1BQ7 A;  1QFN A;  4IP6 A;  1FOV A;  1U3A A;  4YAP A;  1AQV A;  4GST A;  3TCO A;  2LJK A;  2CA8 A;  2WZS A;  1Q4J A;  2FUG 2;  4RUV A;  1TU7 A;  5AIX A;  3M0F A;  4PGT A;  1SD9 A;  4NHZ A;  4RI6 A;  2H74 A;  4J57 E;  1G0T A;  5FHI A;  4L0W A;  5JWR B;  2E2M A;  4O92 A;  2VL9 A;  3CHX C;  2H1L A;  4I8B A;  4N3Z A;  3V1W A;  2EFD A;  4EO3 A;  3F4T A;  2ES7 A;  4MH3 A;  5KN0 A;  2TRX A;  4PUA A;  5HR1 A;  2VM1 A;  2X8H A;  1S4B P;  3W6G A;  4OFM A;  3M9K A;  2DIY A;  3HJM A;  5BMU B;  5J9B A;  2CV4 A;  1X5E A;  3LG6 A;  3IR4 A;  5A34 B;  4HJM A;  20GS A;  1F3B A;  4EIQ A;  2H72 A;  2YZU A;  4EL1 A;  2TIR A;  3IBH A;  2QA1 A;  1R4W A;  1M0U A;  2RM6 A;  4GTU A;  2H01 A;  1DUG A;  1XOA A;  1ZOF A;  2H76 A;  1XWG A;  1K3L A;  1QGV A;  1K0A A;  4AKH A;  5CRH A;  1YY7 A;  3LSZ A;  13GS A;  2GS3 A;  3DGQ A;  1M2B A;  3CSI A;  4BPY A;  3UIW A;  2X8G A;  4GXZ A;  2JAD A;  2YAN A;  1PD2 1;  2YCD A;  5CRE A;  1THO A;  2DLX A;  4PHZ C;  3P7X A;  2WW2 A;  4FH8 A;  1UA5 A;  3NZN A;  4GQF A;  1SKS B;  2VCT A;  4HZ4 A;  3O76 A;  1K0B A;  1FVK A;  4ICY A;  3IDV A;  5ABR A;  3HVS A;  4E8H A;  1MDI A;  2EIQ A;  5D9W A;  2NDO A;  5ECQ B;  5CRG A;  3QAV A;  1PSQ A;  3P2A A;  4K0G A;  3UBL A;  5CNW A;  4HS1 A;  4RI7 A;  3GTU A;  3TKS C;  1S3C A;  4HSC X;  3GN3 A;  4AJ7 A;  2H1D A;  4TVE A;  5HQP A;  4KE3 A;  3CRT A;  1J08 A;  1TU8 A;  3MDK A;  1GNE A;  2IMD A;  4KB3 A;  3TUE A;  3VWV A;  6GSX A;  3R2Q A;  3D5J A;  1SYX A;  2QKE A;  3MYD A;  5B7C A;  3KMO A;  4TXO A;  4MZC A;  3RFR C;  5AN1 A;  3E0U A;  3LXT A;  2YN1 A;  4OMV A;  5IMF A;  4TN8 A;  2XC2 A;  2LS5 A;  5ECI B;  2OE0 A;  2XHF A;  4MJE A;  18GS A;  1GTA A;  3F63 A;  3CMI A;  4HQS A;  3QMX A;  4YKF A;  2WVZ A;  3ZYW A;  1E2Y A;  1U3I A;  3EU4 A;  1YZX A;  3CSJ A;  1YEP A;  4N10 A;  2FGX A;  4POB A;  4KAE A;  1SJI A;  1UN2 A;  1PA3 A;  5INY A;  3KH9 A;  2WW3 A;  1FHE A;  4BWQ A;  2C1Y A;  2YJ7 A;  5B8B A;  2NTO A;  3HVV A;  2WRT A;  1V58 A;  5DCG A;  1VGL A;  1EGO A;  2OE3 A;  3FW2 A;  4XS6 A;  3DXB A;  3QDN A;  3G7I A;  1Z3E A;  3ZRD A;  5F0G A;  4X43 A;  3TKS A;  2GZZ A;  5DJL A;  4BVX A;  2J23 A;  4MPF A;  1XWC A;  1XFL A;  2H71 A;  2MMZ A;  3FR3 A;  5A4U A;  2EFE A;  3EPT A;  2LNT A;  5L71 A;  2QSI A;  2AAW A;  5HR3 A;  3DVX A;  4FYU A;  2HSN A;  1YDK A;  3QPM A;  1N25 A;  4TOP A;  4KF9 A;  4ZBB A;  2E2G A;  4E68 A;  3VWU A;  3GSS A;  4L5O A;  4KW6 A;  4CDO A;  2HRK B;  1VF3 A;  1GWC A;  1EOH A;  2KLX A;  5DCH A;  3EMP A;  1M9A A;  3ZIV A;  3APO A;  3UBK A;  4PNF A;  4MJC A;  1M3J A;  3UAR A;  4TR1 B;  2H6Y A;  2B6M A;  3HVX A;  3RHB A;  1EP7 A;  3LWA A;  4I6X A;  5G5E A;  3VI5 A;  2R6K A;  2HRA A;  5J4Y A;  5ELG A;  2B1L A;  3LEF A;  1Z5Y E;  1GH2 A;  3QOU A;  1BAY A;  4O5U A;  5G2Z A;  1EP8 A;  4ZL9 A;  1X9M B;  4KA0 A;  5CP1 A;  2OJL A;  1TOF A;  1F2E A;  1I1I P;  1V9W A;  1GSQ A;  5IMV A;  3HYP A;  2B7J A;  4ZB8 A;  1GTB A;  1TTZ A;  22GS A;  4HUA A;  3MIX A;  2R2J A;  2CAI A;  2FWG A;  4GSS A;  4ZL8 A;  5LD0 A;  3GHA A;  3ZTL A;  1AAZ A;  2MBT A;  1PGT A;  1B9X C;  1OKT A;  1XWB A;  3O3T A;  4WKW A;  3LGC A;  2X4A A;  12GS A;  1LU4 A;  4YQV A;  1XOB A;  2DSA A;  2GT5 A;  2HZF A;  1HNC A;  4V1A g;  5DQY A;  2H75 A;  3KD0 A;  8GSS A;  5ID2 B;  2OA7 A;  5F07 A;  2YWI A;  1H75 A;  3HJO A;  1XW6 A;  1URM A;  4IVF A;  1SU9 A;  1U6T A;  2GZP A;  2IFQ A;  4CW9 A;  1FB0 A;  1K3O A;  5ENU A;  3DD3 A;  2LRT A;  2PPT A;  3HVN A;  3ZIT A;  1I9D A;  4OCF A;  1RK4 A;  1T8E B;  2AV4 A;  4QQ7 A;  2P5Q A;  2VLT A;  1JZW A;  4ID0 A;  3HHV A;  1ERT A;  3TJB A;  2JL4 A;  3ZFL A;  2FLS A;  3EMX A;  2VL2 C;  4GQC A;  4IQ1 A;  1KEB A;  5DAK B;  1SK1 A;  3GIX A;  2VAF A;  2PVQ A;  1PL2 A;  3WGX A;  1ZYQ B;  5J9C A;  3VK9 A;  2H0I A;  5AIS A;  2FWH A;  3GL3 A;  3RAZ A;  1Z7P A;  5G5F A;  4EXJ A;  2L57 A;  2VO4 A;  5E59 A;  4V1A p;  2HYX A;  3JCM L;  5IQY A;  3VWX A;  1PN9 A;  1XXU A;  1MDK A;  16GS A;  2YWM A;  3IK9 A;  4DSS B;  1PKZ A;  2AJQ B;  4V2N A;  1MDJ A;  1YEX A;  2LNS A;  4KCA A;  4TR3 A;  1K0O A;  1O8W A;  5J47 A;  1BJX A;  4YQM A;  1GUM A;  4G0L A;  3HCZ A;  1K0C A;  4F2I A;  5JCW A;  10GS A;  4I97 A;  3A5W A;  4PX1 A;  1OC9 B;  3TRX A;  1FW1 A;  4OO5 A;  2VIM A;  3TJF A;  5JWO B;  2YNX A;  1VF4 A;  1EZK A;  2VL2 A;  4K1F A;  2OKA A;  2HRN A;  1TK0 B;  5J4V A;  4EF0 A;  4K8M A;  3MNG A;  3TRQ A;  1T4Y A;  4FIW A;  1GLQ A;  2JSZ A;  3L9S A;  2VD0 A;  3TOT A;  2LJR A;  1XCC A;  2H70 A;  3TKQ A;  4XRD A;  3ZL5 A;  5ECM B;  4WF4 A;  19GS A;  2WZ9 A;  2H66 A;  1SL2 B;  4WR5 A;  4AKG A;  3QAW A;  2H19 A;  2F8F A;  4TKY A;  5CAX A;  3A2V A;  1AUC A;  1XVQ A;  4ZIL A;  4AJ8 A;  4ACS A;  4JRR A;  1C72 A;  3M8N A;  1V57 A;  4D73 A;  1RW1 A;  3CTF A;  1XG8 A;  2WW1 A;  2LUS A;  2AYT A;  4AKX B;  2IIY A;  2HZE B;  4F0B A;  2IN3 A;  4P3Y B;  1S3R A;  1XW9 A;  2CVB A;  4XS4 B;  1XWK A;  2N5A A;  1SKR B;  4MAB A;  2WS2 A;  2HLS A;  1LJR A;  2X49 A;  3ISO A;  5HR2 A;  3A2X A;  5D96 A;  1GSY A;  4POL A;  4DVC A;  1JFU A;  1ZCP A;  3GNJ A;  2MBS A;  1FG4 A;  5D8I A;  4PNG A;  2DJ2 A;  2P0G A;  1BX9 A;  1FVJ A;  5J5N A;  3J7Y b;  3RPN A;  1GUK A;  5ECK B;  4EIP A;  1ZYP A;  2CVD A;  2KUC A;  4PTS A;  5KN1 A;  2FA4 A;  5IMC A;  1XIY A;  5DBQ A;  4MCU A;  2EC4 A;  4GDF A;  5KEJ A;  2H1A A;  2HSM A;  2HT9 A;  2VOC A;  3LYP A;  2HFD A;  4V2L A;  3C1R A;  3GFK A;  3ZML A;  4G0I A;  2WJU A;  1ERW A;  5ELA A;  2VCQ A;  2LV3 A;  5CYY A;  5DAL B;  4WET A;  1YJ6 A;  3AY8 A;  5D9T A;  5A1N A;  3GL5 A;  4F82 A;  5HFK A;  4NAX A;  2LRN A;  1F3A A;  2DJ3 A;  2P5R A;  3VFI A;  1PX6 A;  4KDU A;  2YV9 A;  5D9X A;  5IMZ A;  2GTU A;  4K2D A;  2JZR A;  5H5R A;  3IC8 A;  1GSE A;  1GRX A;  4WEY A;  5IPH A;  3GX0 A;  2MMO A;  3F4S A;  4F03 A;  4MK3 A;  2GVP A;  1T7P B;  1SK2 A;  4IJI A;  5LCZ A;  1TKD B;  2Z9S A;  3CXG A;  1EOG A;  2H73 A;  2WVX B;  1DE1 A;  1AW9 A;  2R0G A;  6GSS A;  1BG1 A;  4JR6 A;  4DSS A;  1IYI A;  4AGS A;  3GMF A;  1Y25 A;  1ERU A;  4MDC A;  2RLI A;  2WCI A;  3LJR A;  3P90 A;  4RQR A;  1Y6E A;  1QXH A;  2LST A;  5CRW A;  1F9M A;  2BTO T;  2A2R A;  3L9U A;  2R0C A;  2AUV A;  4FQU A;  2H6Z A;  4A5P A;  4IP1 A;  4MF7 A;  3KP8 A;  1A23 A;  4ML6 A;  2K9F A;  5F8B A;  1ZL9 A;  2R0P A;  4O32 A;  5JCU A;  2DMM A;  2CZ2 A;  5KN2 A;  2UZ8 A;  1FAA A;  2I3Y A;  2QC7 A;  4ILF A;  4KX4 A;  1PRX A;  3IXR A;  5HFI A;  2JSY A;  2H1B A;  3GH9 A;  4HJ2 A;  3IRA A;  3ZIJ A;  3FR6 A;  3HKR A;  3ME7 A;  5CRD A;  4N11 A;  1J0F A;  1A0F A;  4O5Q A;  3A2W A;  2R3X A;  3FYG A;  1GSD A;  2N5B A;  4XRA A;  4N0Z A;  1SVL A;  4WXT A;  4DEJ A;  3G7J A;  4OFN A;  2CAQ A;  1GSF A;  3IHQ A;  5A5K A;  5COH A;  1QQ2 A;  3HMJ G;  2O7K A;  3LW9 A;  2C3N A;  3RBT A;  1G7O A;  4PI2 C;  2WB9 A;  3CQF A;  1Q98 A;  2K18 A;  4NPB A;  5B8A A;  1N2A A;  2VKZ G;  1A2J A;  4ECC A;  6GSV A;  1Z6N A;  1HD2 A;  4ZB9 A;  2L6D A;  3FZ4 A;  3WD6 A;  2G2Q A;  4GSN A;  2PVO C;  1S3D A;  1X5C A;  4FYC A;  3BD2 A;  1VF2 A;  4G2E A;  5LNK e;  2C0D A;  4POK A;  2F9S A;  1SKW B;  3Q74 A;  4L8E A;  1CQH A;  4JR4 A;  4IJ3 A;  2CQ9 A;  4XS1 A;  3UMA A;  1F6M C;  2OAC A;  2EIR A;  1T3B A;  5DQS A;  1XZO A;  17GS A;  1U87 A;  4AJ6 A;  4CY6 A;  3HA9 A;  3M3M A;  1G7E A;  2GSQ A;  1SVM A;  3FZ5 A;  4LLR A;  4BIK A;  2K8V A;  3W8S A;  1S3A A;  3QD9 A;  4K5R A;  1YF1 A;  1ZMA A;  1DSB A;  4W66 A;  2KP2 A;  3P8W A;  4HOJ A;  1NW2 A;  1LBK A;  1R5A A;  4KSO A;  1T4Z A;  1TRV A;  1ABA A;  1GTU A;  3FK8 A;  4MH2 A;  2FHE A;  3FZ9 A;  2X8C A;  1ML6 A;  3TKR A;  5BMU A;  2DJ0 A;  5A34 A;  3ZZX A;  2O36 A;  2H8L A;  4WBR D;  4OO4 A;  3N9J A;  4G0K A;  4X4J A;  5A4W A;  4YH2 A;  5DVB A;  4BVY B;  2ZCT A;  3E3E A;  2IJY A;  2RUF A;  4I2U A;  2IWT A;  5EL8 A;  5HR0 A;  3FRC A;  1HQO A;  2OAD A;  2LQQ A;  4OD7 A;  4IEL A;  3BCK A;  1BED A;  4IW9 A;  1M99 A;  2CX4 A;  3G9B A;  2RUE A;  3H8Q A;  4KUN A;  4LL1 B;  2VCW A;  4YAV A;  1TI1 A;  3S9F A;  1K0N A;  1TXU A;  1YKC A;  4FO5 A;  4PQ1 A;  2GSS A;  4J2F A;  4F0C A;  1O85 A;  3EUR A;  2L5O A;  1PQN A;  3VLN A;  3L0H A;  4NV2 A;  3J7Y k;  1TDI A;  4K7I A;  3QFB C;  1OAZ A;  4G10 A;  1A2M A;  3D0Z A;  2HSY A;  2IME A;  2X99 A;  1QK8 A;  4L5L A;  2I9H A;  2DBC A;  3CYN A;  5D9V A;  2VCX A;  1WMJ A;  1WJK A;  3APS A;  3GKX A;  1PL1 A;  2IPA A;  1YQ1 A;  3A5I A;  1X9W B;  2FA8 A;  1OE8 A;  3FKF A;  4NMU A;  4MJA A;  2QGV A;  1N8J A;  5KOW A;  5FT3 A;  2O3E A;  3LFL A;  3WYW A;  2J9H A;  3EVI A;  2C0E A;  2NVL A;  4NHW A;  2XBQ A;  3F3Q A;  1QUW A;  4ISD A;  1KBN A;  4KDY A;  5GSS A;  4KGI A;  3FZA A;  1NHY A;  4K9Z A;  2V1M A;  1EWX A;  2C80 A;  1TRU A;  4OCE A;  2P31 A;  3RPP A;  1O73 A;  3D4T A;  4I5Q A;  5IPG A;  5G30 A;  2C8U A;  1NM3 A;  2PGT A;  1B4Q A;  3ERF A;  5GST A;  1W89 A;  1R7H A;  3KXO A;  2A4V A;  3DYR A;  3EWL A;  3VPT A;  2M72 A;  2C0G A;  2YV7 A;  1YKA A;  1G6W A;  2GQL A;  5D73 A;  4EDZ A;  2PU9 C;  1TXX A;  2PN8 A;  3UAP A;  5GAP D;  3R3E A;  2XBI A;  3C8E A;  2OT3 A;  2PMT A;  1A8Y A;  1EV4 A;  3H1N A;  2L6C A;  4V2M A;  2HI7 A;  1TRS A;  2GST A;  3WGE A;  2H30 A;  1O6J A;  3TKS E;  3KIJ A;  4GWR A;  3NIV A;  3K8N A;  4BL7 B;  4KDX A;  1WOU A;  2M80 A;  4ECB A;  1M3I A;  1YEW C;  1WP0 A;  2V2G A;  3MAK A;  1PMT A;  3DEX A;  2WW0 A;  3MWH A;  4K5S A;  4MMM A;  3NOF A;  4MF6 A;  3QAG A;  2DKH A;  2DKI A;  5H5S A;  4IBP A;  1FOH A;  3U6V A;  1A2L A;  2GQK A;  3KP9 A;  2HRK A;  3F8U A;  3BBY A;  4K0N A;  2I81 A;  3GKM A;  3LOR A;  2REM A;  1ILO A;  3IE3 A;  2L5L A;  4WF5 A;  1EV9 A;  3F4R A;  3GTU B;  1K3Y A;  2R5G A;  3KGK A;  4YKG A;  4TR1 A;  2R37 A;  2MYG A;  3C71 A;  4LMV A;  3H4K A;  1HYU A;  3DKS A;  3D4M A;  3CWG A;  3KM6 A;  1GLP A;  2EFH A;  1JZD A;  3LYK A;  4TXO B;  4YQU A;  3TJK A;  3SWL A;  2LTK A;  5F05 A;  5A5H B;  1SD8 A;  4WR4 A;  2TRC P;  1J9B A;  3E9J B;  2HSH A;  1THX A;  1ZYE A;  3WT2 A;  1M2D A;  5ECO B;  4Q5F A;  1CQG A;  3ERG A;  5ECH B;  2A4H A;  3D21 A;  3ED3 A;  4MLY A;  5IM9 A;  3EC3 A;  2WVY A;  2QA2 A;  1ZGN A;  4OWY A;  3LXZ A;  2VCV A;  5J40 A;  2CX3 A;  1TK5 B;  4E8E A;  1WE0 A;  5IMD A;  5ID2 A;  5EY6 A;  4G9H A;  3EE2 A;  3HY2 A;  3SBC A;  2CVK A;  3GH6 A;  1EEM A;  5ECN B;  2EFC A;  3KH7 A;  3HJP A;  1YVL A;  1SJZ A;  3IAS 2;  4N0V A;  3VWW A;  2O8V B;  1JLW A;  4BVX B;  5IIZ A;  2XPD A;  3VUR A;  2DC5 A;  4Z2T A;  4H86 A;  5IO2 A;  1PFO A;  2FD3 A;  2O87 A;  2B3S A;  1MD3 A;  3QR6 A;  5B6N A;  3MSZ A;  4JED A;  2X64 A;  1SEN A;  4HU9 A;  4DSR A;  2O89 A;  2PBJ A;  2HSN B;  2O5V A;  5DAK A;  4OFT A;  5F06 A;  4Q5N A;  3F3R A;  1O8X A;  1UVZ A;  2F3M A;  3KTL A;  2ZUP A;  4AKI A;  3F6F A;  4O7H A;  1YF0 A;  1USB A;  1SK0 A;  2ALB A;  3W8J A;  2FCH A;  1JLV A;  3IV4 A;  5J3R A;  1A8L A;  5EVO A;  4TR0 A;  2C3T A;  3GKN A;  1TK8 B;  3GA4 A;  1SL1 B;  3UVH A;  5E4W A;  2E0Q A;  1JZR A;  2OE1 A;  3KZQ A;  2B7K A;  1T1V A;  5GZZ B;  1AQW A;  2VL3 A;  3L78 A;  1HNB A;  1E6B A;  3I69 A;  1KNG A;  2V32 A;  5JWQ B;  3FY7 A;  3TJG A;  2MZC A;  2OBK A;  3VI7 A;  4N30 A;  4IS0 A;  1DBY A;  3ERW A;  3F0I A;  5D93 A;  3L9V A;  3BOA A;  4ZB7 A;  4JBB A;  3KCM A;  2KHP A;  2LKU A;  1SYR A;  4FXY P;  4LMW A;  2FWE A;  4HI7 A;  2HE3 A;  2VCZ A;  1K0D A;  2I4A A;  3FMW A;  4XCS A;  5IO0 A;  14GS A;  1GUH A;  2B5E A;  1PN0 A;  1OC9 A;  2G0F A;  4BL7 A;  5CO3 A;  2MMN A;  3M9J A;  3BJ5 A;  1VF1 A;  3C73 A;  3DML A;  2JU5 A;  4J56 E;  2K8S A;  1PX7 A;  1NHO A;  3QFA C;  1XBS A;  4XHM A;  3PIN A;  2R4V A;  1R26 A;  2C4J A;  2KOK A;  3DVW A;  4Q5Q A;  3O6T A;  3UL3 A;  2IFQ B; 
#chains in the Genus database with same CATH homology
 3TKP A;  3KJY A;  4ECI A;  2VLU A;  4HU7 A;  2GSR A;  3D6I A;  4EUY A;  2GDR A;  4ECJ A;  1AQX A;  1Y1U A;  1OE7 A;  6GSU A;  3IHG A;  1B9Y C;  1TW9 A;  4IKH A;  2GLR A;  4LA1 A;  2L59 A;  4MPG A;  3GUR A;  3FR9 A;  3ZLP A;  3RHC A;  1EGR A;  4IQA A;  4ZBA A;  1G6Y A;  2LQO A;  4MZB A;  3IPZ A;  2XPE A;  4USS A;  3OR5 A;  4GLT A;  1ST9 A;  1WWJ A;  3TU3 B;  2VD1 A;  5IMA A;  1GP1 A;  2HZE A;  4NWY A;  5A5H A;  3Q6O A;  4MA9 A;  1XPV A;  4BA7 A;  4POM A;  1SVO A;  2NBS A;  4XS4 A;  4MP4 A;  2GGT A;  3ZVJ D;  3IK7 A;  5C00 A;  4GRF A;  6GSY A;  2A2S A;  2C0F A;  4GF0 A;  3RDW A;  4IN0 A;  1K0M A;  4ZL7 A;  2RM5 A;  7GSS A;  1HNA A;  2DIZ A;  2VM2 A;  4FYB A;  2H6X A;  5KOX A;  1OC3 A;  1V98 A;  3C7M A;  2VUP A;  3BCI A;  4L0U A;  1ZYN A;  1GL8 A;  2LJA A;  1MTC A;  3EIN A;  1ACV A;  3L4N A;  4O5R A;  3GRX A;  5G1K A;  3UVT A;  3FHK A;  3Q18 A;  3ZMK A;  4WBJ A;  2PER A;  1B48 A;  2L4Q A;  3H93 A;  4K6X A;  3HZ8 A;  2YPM A;  2BMX A;  1MEK A;  3GX8 A;  1UC7 A;  11GS A;  3CTG A;  4MNN A;  5GAN D;  1B8X A;  2JZT A;  4X1U A;  5IOX A;  4IGJ A;  2PWJ A;  5DAL A;  1ZZY A;  3KTB A;  1X5D A;  1XW5 A;  2HQT A;  6GST A;  4KSM A;  4K7N A;  2MMA A;  4X0X A;  1R5P A;  1Z9H A;  1PKW A;  5KN3 A;  4ZXG A;  3IAM 2;  3KMN A;  4PQI A;  2FY6 A;  4AF2 A;  1B4P A;  5ECL B;  1BF5 A;  1ON4 A;  2ZNM A;  4Z2U A;  3CBU A;  3N5O A;  2B1K A;  1VRS D;  2H0G A;  1MD4 A;  5DDL A;  2K6V A;  3PGT A;  3CSH A;  2H0H A;  3DRN A;  1X9S B;  3IC4 A;  3PH9 A;  4Q5R A;  5A4V A;  4D73 B;  4PQH A;  4ZIJ A;  1GTI A;  4MZW A;  4PUF C;  1O81 A;  1KTE A;  1V40 A;  2IMF A;  3I6A A;  4ML1 A;  4RQX A;  3TOU A;  5DJM A;  1X0R A;  2PUK C;  1FO5 A;  1OC8 A;  4EDY A;  5B6M A;  3A3T A;  4CY8 A;  2AHE A;  2LEG A;  2F8A A;  5J41 A;  5EPF A;  2KP1 A;  5ECS A;  1Z7R A;  4HQZ A;  2GT6 A;  1A24 A;  3C1S A;  1FB6 A;  3QCP A;  5ECP B;  2V6K A;  4EKZ A;  5J4U A;  3ME8 A;  3U5R E;  1O7U A;  1T00 A;  1U88 A;  3CRU A;  2D2Z A;  3VPQ A;  3HDC A;  1F37 A;  4XTS A;  2YZH A;  4BWS A;  3EU3 A;  2C3Q A;  4QL9 A;  2H1G A;  1JZO A;  2YOI A;  4AI6 A;  4NV5 A;  3GUS A;  2O85 A;  2BJX A;  1DE2 A;  3I43 A;  2DML A;  4IHU A;  2ON5 A;  3I9V 2;  3ZVJ A;  5IOW A;  2HSM B;  2DJK A;  3F6D A;  4G01 A;  3GYK A;  4KCE A;  4Z2R A;  2F51 A;  2V41 A;  2RII A;  2YWN A;  4HEA 2;  3UEM A;  1OYJ A;  3TJJ A;  5A1N B;  1OKD A;  2HRF A;  2WDU A;  4EC0 A;  1H4O A;  2FNO A;  2WUL A;  1M2A A;  5AIV A;  4CHS A;  5BRT A;  1BYE A;  3ZFB A;  1ERV A;  3GKK A;  3DWV A;  2UV8 G;  1AIU A;  3G7Y A;  2A2P A;  4TRX A;  5JCG A;  1QMV A;  4TXV A;  3HXS A;  3US3 A;  5G1L A;  1IYH A;  3M1G A;  2JAC A;  1I5G A;  3TB2 A;  1SL0 B;  6GSW A;  3LQ7 A;  1A0R P;  4ULX A;  1TRW A;  2OBI A;  2WGR A;  2YWO A;  4TR4 A;  5ECR B;  3APQ A;  4G19 A;  1TJD A;  2EIO A;  3HD5 A;  4NXI A;  1Z6M A;  4QMK A;  5AGY A;  5C04 A;  2VLV A;  2AB6 A;  2B5X A;  4K7O A;  3TDG A;  4HDE A;  1BG5 A;  4JU5 A;  4PUR A;  2HXK A;  2GQM A;  4I2T A;  3TRP A;  2ON7 A;  4PXO A;  2IMI A;  4GCI A;  2V6O A;  1W4V A;  2GZY A;  4JE1 A;  4ZBD A;  1WRY A;  1AXD A;  1SJ6 A;  2L4C A;  4EE0 A;  4HZ2 A;  4JZQ A;  4EVM A;  1WIK A;  3Q19 A;  2YJH A;  1XWA A;  4K2X A;  5FWG A;  4KH7 A;  1RQM A;  2JZS A;  3EYT A;  4Z7X A;  1AC1 A;  4F9Z A;  3IOS A;  2B5Y A;  4BVY A;  4QL7 A;  1M7T A;  3D22 A;  1EEJ A;  1M9B A;  2HNL A;  1XVW A;  2IMK A;  5H5Q A;  3ZRE A;  1GSS A;  3GV1 A;  3H79 A;  3PPU A;  1GSU A;  3FEU A;  3HZ4 A;  2WFC A;  4XIH A;  1OVN A;  3TGZ A;  2DJ1 A;  3UOM A;  2FWF A;  3PR8 A;  2CZ3 A;  3KEB A;  2M46 A;  3WGD A;  1JHB A;  3GST A;  2I1U A;  2LRC A;  1V2A A;  1GUL A;  3WT1 A;  3UJ1 A;  4LL4 B;  5HFG A;  4TW5 A;  4MJB A;  1WPI A;  2CT6 A;  4ZB6 A;  3F9U A;  2NPB A;  3DIE A;  3IA1 A;  4DSQ A;  4KND A;  1GNW A;  9GSS A;  2E7P A;  2DJJ A;  2YP6 A;  2IL3 A;  1TP9 A;  4MF5 A;  1TI3 A;  2N5F A;  5G31 A;  1NSW A;  1BQ7 A;  1QFN A;  4IP6 A;  1FOV A;  1U3A A;  4YAP A;  1AQV A;  4GST A;  3TCO A;  2LJK A;  2CA8 A;  1Q4J A;  2FUG 2;  4RUV A;  1TU7 A;  5AIX A;  3M0F A;  4PGT A;  1SD9 A;  4NHZ A;  4RI6 A;  2H74 A;  4J57 E;  1G0T A;  5FHI A;  4L0W A;  5JWR B;  2E2M A;  4O92 A;  2VL9 A;  2H1L A;  4I8B A;  4N3Z A;  3V1W A;  2EFD A;  4EO3 A;  3F4T A;  2ES7 A;  4MH3 A;  5KN0 A;  2TRX A;  4PUA A;  5HR1 A;  2VM1 A;  2X8H A;  3W6G A;  4OFM A;  3M9K A;  2DIY A;  3HJM A;  5BMU B;  5J9B A;  2CV4 A;  1X5E A;  3LG6 A;  3IR4 A;  5A34 B;  4HJM A;  20GS A;  1F3B A;  4EIQ A;  2H72 A;  2YZU A;  4EL1 A;  2TIR A;  3IBH A;  2QA1 A;  1R4W A;  1M0U A;  2RM6 A;  4GTU A;  2H01 A;  1DUG A;  1XOA A;  1ZOF A;  2H76 A;  1XWG A;  1K3L A;  1QGV A;  1K0A A;  4AKH A;  5CRH A;  1YY7 A;  3LSZ A;  13GS A;  2GS3 A;  3DGQ A;  1M2B A;  3CSI A;  4BPY A;  3UIW A;  2X8G A;  4GXZ A;  2JAD A;  2YAN A;  1PD2 1;  2YCD A;  5CRE A;  1THO A;  2DLX A;  3P7X A;  4FH8 A;  1UA5 A;  3NZN A;  4GQF A;  1SKS B;  2VCT A;  4HZ4 A;  3O76 A;  1K0B A;  1FVK A;  4ICY A;  3IDV A;  5ABR A;  3HVS A;  4E8H A;  1MDI A;  2EIQ A;  5D9W A;  2NDO A;  5ECQ B;  5CRG A;  3QAV A;  1PSQ A;  3P2A A;  4K0G A;  3UBL A;  5CNW A;  4HS1 A;  4RI7 A;  3GTU A;  3TKS C;  1S3C A;  4AJ7 A;  3GN3 A;  2H1D A;  4TVE A;  5HQP A;  4KE3 A;  3CRT A;  1J08 A;  1TU8 A;  3MDK A;  1GNE A;  2IMD A;  4KB3 A;  3TUE A;  3VWV A;  6GSX A;  3R2Q A;  3D5J A;  1SYX A;  2QKE A;  3MYD A;  5B7C A;  3KMO A;  4TXO A;  4MZC A;  5AN1 A;  3E0U A;  3LXT A;  2YN1 A;  4OMV A;  5IMF A;  4TN8 A;  2XC2 A;  2LS5 A;  5ECI B;  2OE0 A;  2XHF A;  4MJE A;  18GS A;  1GTA A;  3F63 A;  3CMI A;  4HQS A;  3QMX A;  4YKF A;  3ZYW A;  1E2Y A;  1U3I A;  3EU4 A;  1YZX A;  3CSJ A;  1YEP A;  4N10 A;  2FGX A;  4POB A;  4KAE A;  1SJI A;  1UN2 A;  1PA3 A;  5INY A;  3KH9 A;  1FHE A;  4BWQ A;  2C1Y A;  2YJ7 A;  5B8B A;  2NTO A;  3HVV A;  2WRT A;  1V58 A;  5DCG A;  1VGL A;  1EGO A;  2OE3 A;  3FW2 A;  4XS6 A;  3DXB A;  3QDN A;  3G7I A;  1Z3E A;  3ZRD A;  5F0G A;  4X43 A;  3TKS A;  2GZZ A;  5DJL A;  4BVX A;  2J23 A;  4MPF A;  1XWC A;  1XFL A;  2H71 A;  2MMZ A;  3FR3 A;  5A4U A;  2EFE A;  3EPT A;  2LNT A;  5L71 A;  2QSI A;  2AAW A;  5HR3 A;  3DVX A;  4FYU A;  2HSN A;  1YDK A;  3QPM A;  1N25 A;  4TOP A;  4KF9 A;  4ZBB A;  2E2G A;  4E68 A;  3VWU A;  3GSS A;  4L5O A;  4KW6 A;  4CDO A;  2HRK B;  1VF3 A;  1GWC A;  1EOH A;  2KLX A;  5DCH A;  3EMP A;  1M9A A;  3ZIV A;  3APO A;  3UBK A;  4PNF A;  4MJC A;  3UAR A;  4TR1 B;  2H6Y A;  2B6M A;  3HVX A;  3RHB A;  1EP7 A;  3LWA A;  4I6X A;  5G5E A;  3VI5 A;  2R6K A;  2HRA A;  3LEF A;  5J4Y A;  5ELG A;  2B1L A;  1Z5Y E;  1GH2 A;  3QOU A;  1BAY A;  4O5U A;  5G2Z A;  1EP8 A;  4ZL9 A;  1X9M B;  4KA0 A;  5CP1 A;  2OJL A;  1TOF A;  1F2E A;  1V9W A;  1GSQ A;  5IMV A;  3HYP A;  2B7J A;  4ZB8 A;  1GTB A;  1TTZ A;  22GS A;  4HUA A;  3MIX A;  2R2J A;  2CAI A;  2FWG A;  4GSS A;  4ZL8 A;  5LD0 A;  3GHA A;  3ZTL A;  1AAZ A;  2MBT A;  1PGT A;  1B9X C;  1OKT A;  1XWB A;  3O3T A;  4WKW A;  3LGC A;  2X4A A;  12GS A;  1LU4 A;  4YQV A;  1XOB A;  2DSA A;  2GT5 A;  2HZF A;  1HNC A;  4V1A g;  5DQY A;  2H75 A;  3KD0 A;  8GSS A;  5ID2 B;  2OA7 A;  5F07 A;  2YWI A;  1H75 A;  3HJO A;  1XW6 A;  1URM A;  4IVF A;  1SU9 A;  1U6T A;  2GZP A;  2IFQ A;  4CW9 A;  1FB0 A;  1K3O A;  5ENU A;  3DD3 A;  2LRT A;  2PPT A;  3ZIT A;  1I9D A;  4OCF A;  1RK4 A;  1T8E B;  2AV4 A;  4QQ7 A;  2P5Q A;  2VLT A;  1JZW A;  4ID0 A;  3HHV A;  1ERT A;  3TJB A;  2JL4 A;  3ZFL A;  2FLS A;  3EMX A;  2VL2 C;  4GQC A;  4IQ1 A;  1KEB A;  5DAK B;  1SK1 A;  3GIX A;  2VAF A;  2PVQ A;  1PL2 A;  3WGX A;  1ZYQ B;  5J9C A;  3VK9 A;  2H0I A;  5AIS A;  2FWH A;  3GL3 A;  3RAZ A;  1Z7P A;  5G5F A;  4EXJ A;  2L57 A;  2VO4 A;  5E59 A;  4V1A p;  2HYX A;  3JCM L;  5IQY A;  3VWX A;  1PN9 A;  1XXU A;  1MDK A;  16GS A;  2YWM A;  3IK9 A;  4DSS B;  1PKZ A;  2AJQ B;  4V2N A;  1MDJ A;  1YEX A;  2LNS A;  4KCA A;  4TR3 A;  1K0O A;  1O8W A;  5J47 A;  1BJX A;  4YQM A;  1GUM A;  4G0L A;  3HCZ A;  1K0C A;  4F2I A;  5JCW A;  10GS A;  4I97 A;  3A5W A;  4PX1 A;  1OC9 B;  3TRX A;  1FW1 A;  4OO5 A;  2VIM A;  3TJF A;  5JWO B;  2YNX A;  1VF4 A;  1EZK A;  2VL2 A;  4K1F A;  2OKA A;  2HRN A;  1TK0 B;  5J4V A;  4EF0 A;  4K8M A;  3MNG A;  3TRQ A;  1T4Y A;  4FIW A;  1GLQ A;  2JSZ A;  3L9S A;  2VD0 A;  3TOT A;  2LJR A;  1XCC A;  2H70 A;  3TKQ A;  4XRD A;  3ZL5 A;  5ECM B;  4WF4 A;  19GS A;  2WZ9 A;  2H66 A;  1SL2 B;  4WR5 A;  4AKG A;  3QAW A;  2H19 A;  2F8F A;  4TKY A;  5CAX A;  3A2V A;  1AUC A;  1XVQ A;  4ZIL A;  4AJ8 A;  4ACS A;  4JRR A;  1C72 A;  3M8N A;  1V57 A;  4D73 A;  1RW1 A;  3CTF A;  2LUS A;  2AYT A;  4AKX B;  2IIY A;  2HZE B;  4F0B A;  2IN3 A;  4P3Y B;  1XW9 A;  2CVB A;  4XS4 B;  1XWK A;  2N5A A;  1SKR B;  4MAB A;  2WS2 A;  2HLS A;  1LJR A;  2X49 A;  3ISO A;  5HR2 A;  3A2X A;  5D96 A;  1GSY A;  4POL A;  4DVC A;  1JFU A;  1ZCP A;  3GNJ A;  2MBS A;  1FG4 A;  5D8I A;  4PNG A;  2DJ2 A;  2P0G A;  1BX9 A;  1FVJ A;  5J5N A;  3J7Y b;  3RPN A;  1GUK A;  5ECK B;  4EIP A;  1ZYP A;  2CVD A;  2KUC A;  4PTS A;  5KN1 A;  2FA4 A;  5IMC A;  1XIY A;  5DBQ A;  4MCU A;  2EC4 A;  4GDF A;  5KEJ A;  2H1A A;  2HSM A;  2HT9 A;  2VOC A;  3LYP A;  2HFD A;  4V2L A;  3C1R A;  3GFK A;  3ZML A;  4G0I A;  2WJU A;  1ERW A;  5ELA A;  2VCQ A;  2LV3 A;  5CYY A;  5DAL B;  4WET A;  1YJ6 A;  3AY8 A;  5D9T A;  5A1N A;  3GL5 A;  4F82 A;  5HFK A;  4NAX A;  2LRN A;  1F3A A;  2DJ3 A;  2P5R A;  3VFI A;  1PX6 A;  4KDU A;  2YV9 A;  5D9X A;  5IMZ A;  2GTU A;  4K2D A;  2JZR A;  5H5R A;  3IC8 A;  1GSE A;  1GRX A;  4WEY A;  5IPH A;  3GX0 A;  2MMO A;  3F4S A;  4F03 A;  4MK3 A;  2GVP A;  1T7P B;  1SK2 A;  4IJI A;  5LCZ A;  1TKD B;  2Z9S A;  3CXG A;  1EOG A;  2H73 A;  1DE1 A;  1AW9 A;  2R0G A;  6GSS A;  1BG1 A;  4JR6 A;  4DSS A;  1IYI A;  4AGS A;  3GMF A;  1Y25 A;  1ERU A;  4MDC A;  2RLI A;  2WCI A;  3LJR A;  3P90 A;  4RQR A;  1Y6E A;  1QXH A;  2LST A;  5CRW A;  1F9M A;  2BTO T;  2A2R A;  3L9U A;  2R0C A;  2AUV A;  4FQU A;  2H6Z A;  4A5P A;  4IP1 A;  4MF7 A;  3KP8 A;  1A23 A;  4ML6 A;  2K9F A;  5F8B A;  1ZL9 A;  2R0P A;  4O32 A;  5JCU A;  2DMM A;  2CZ2 A;  5KN2 A;  2UZ8 A;  1FAA A;  2I3Y A;  2QC7 A;  4ILF A;  4KX4 A;  1PRX A;  3IXR A;  5HFI A;  2JSY A;  2H1B A;  3GH9 A;  4HJ2 A;  3IRA A;  3ZIJ A;  3FR6 A;  3HKR A;  3ME7 A;  5CRD A;  4N11 A;  1J0F A;  1A0F A;  4O5Q A;  3A2W A;  2R3X A;  3FYG A;  1GSD A;  2N5B A;  4XRA A;  4N0Z A;  1SVL A;  4WXT A;  4DEJ A;  3G7J A;  4OFN A;  2CAQ A;  1GSF A;  3IHQ A;  5A5K A;  5COH A;  1QQ2 A;  3HMJ G;  2O7K A;  3LW9 A;  2C3N A;  3RBT A;  1G7O A;  2WB9 A;  5B8A A;  1Q98 A;  2K18 A;  4NPB A;  1N2A A;  2VKZ G;  1A2J A;  4ECC A;  6GSV A;  1Z6N A;  1HD2 A;  4ZB9 A;  2L6D A;  3FZ4 A;  3WD6 A;  2G2Q A;  4GSN A;  2PVO C;  1S3D A;  1X5C A;  4FYC A;  3BD2 A;  1VF2 A;  4G2E A;  5LNK e;  2C0D A;  4POK A;  2F9S A;  1SKW B;  3Q74 A;  4L8E A;  1CQH A;  4JR4 A;  4IJ3 A;  2CQ9 A;  4XS1 A;  3UMA A;  1F6M C;  2OAC A;  2EIR A;  1T3B A;  5DQS A;  1XZO A;  17GS A;  1U87 A;  4AJ6 A;  4CY6 A;  3HA9 A;  3M3M A;  1G7E A;  2GSQ A;  1SVM A;  3FZ5 A;  4LLR A;  2K8V A;  3W8S A;  1S3A A;  3QD9 A;  4K5R A;  1YF1 A;  1ZMA A;  1DSB A;  4W66 A;  2KP2 A;  3P8W A;  4HOJ A;  1NW2 A;  1LBK A;  1R5A A;  4KSO A;  1T4Z A;  1TRV A;  1ABA A;  1GTU A;  3FK8 A;  4MH2 A;  2FHE A;  3FZ9 A;  2X8C A;  1ML6 A;  3TKR A;  5BMU A;  2DJ0 A;  5A34 A;  3ZZX A;  2H8L A;  4WBR D;  4OO4 A;  3N9J A;  4G0K A;  4X4J A;  5A4W A;  4YH2 A;  5DVB A;  4BVY B;  2ZCT A;  3E3E A;  2IJY A;  2RUF A;  4I2U A;  2IWT A;  5EL8 A;  5HR0 A;  3FRC A;  1HQO A;  2OAD A;  2LQQ A;  4OD7 A;  4IEL A;  3BCK A;  1BED A;  4IW9 A;  1M99 A;  2CX4 A;  3G9B A;  2RUE A;  3H8Q A;  4KUN A;  4LL1 B;  2VCW A;  4YAV A;  1TI1 A;  3S9F A;  1K0N A;  1TXU A;  1YKC A;  4FO5 A;  4PQ1 A;  2GSS A;  4J2F A;  4F0C A;  1O85 A;  3EUR A;  2L5O A;  1PQN A;  3VLN A;  3L0H A;  4NV2 A;  3J7Y k;  1TDI A;  4K7I A;  3QFB C;  1OAZ A;  4G10 A;  1A2M A;  3D0Z A;  2HSY A;  2IME A;  2X99 A;  1QK8 A;  4L5L A;  2I9H A;  2DBC A;  3CYN A;  5D9V A;  2VCX A;  1WMJ A;  1WJK A;  3APS A;  3GKX A;  1PL1 A;  2IPA A;  1YQ1 A;  3A5I A;  1X9W B;  2FA8 A;  1OE8 A;  3FKF A;  4NMU A;  4MJA A;  2QGV A;  1N8J A;  5KOW A;  5FT3 A;  3LFL A;  3WYW A;  2J9H A;  3EVI A;  2C0E A;  2NVL A;  4NHW A;  2XBQ A;  3F3Q A;  1QUW A;  4ISD A;  1KBN A;  4KDY A;  5GSS A;  4KGI A;  3FZA A;  1NHY A;  4K9Z A;  2V1M A;  1EWX A;  2C80 A;  1TRU A;  4OCE A;  2P31 A;  3RPP A;  1O73 A;  3D4T A;  4I5Q A;  5IPG A;  5G30 A;  2C8U A;  1NM3 A;  2PGT A;  1B4Q A;  3ERF A;  5GST A;  1W89 A;  1R7H A;  3KXO A;  2A4V A;  3DYR A;  3EWL A;  3VPT A;  2M72 A;  2C0G A;  2YV7 A;  1YKA A;  1G6W A;  2GQL A;  5D73 A;  4EDZ A;  2PU9 C;  1TXX A;  2PN8 A;  3UAP A;  5GAP D;  3R3E A;  2XBI A;  3C8E A;  2OT3 A;  2PMT A;  1A8Y A;  1EV4 A;  3H1N A;  2L6C A;  4V2M A;  2HI7 A;  1TRS A;  2GST A;  3WGE A;  2H30 A;  1O6J A;  3TKS E;  3KIJ A;  4GWR A;  3NIV A;  3K8N A;  4BL7 B;  4KDX A;  1WOU A;  2M80 A;  4ECB A;  1WP0 A;  2V2G A;  3MAK A;  1PMT A;  3DEX A;  3MWH A;  4K5S A;  4MMM A;  3NOF A;  4MF6 A;  3QAG A;  2DKH A;  2DKI A;  5H5S A;  4IBP A;  1FOH A;  3U6V A;  1A2L A;  2GQK A;  3KP9 A;  2HRK A;  3F8U A;  3BBY A;  4K0N A;  2I81 A;  3GKM A;  3LOR A;  2REM A;  1ILO A;  3IE3 A;  2L5L A;  4WF5 A;  1EV9 A;  3F4R A;  3GTU B;  1K3Y A;  2R5G A;  3KGK A;  4YKG A;  4TR1 A;  2R37 A;  2MYG A;  3C71 A;  4LMV A;  3H4K A;  1HYU A;  3DKS A;  3D4M A;  3CWG A;  3KM6 A;  1GLP A;  2EFH A;  1JZD A;  3LYK A;  4TXO B;  4YQU A;  3TJK A;  3SWL A;  2LTK A;  5F05 A;  5A5H B;  1SD8 A;  4WR4 A;  2TRC P;  1J9B A;  3E9J B;  2HSH A;  1THX A;  1ZYE A;  3WT2 A;  1M2D A;  5ECO B;  4Q5F A;  1CQG A;  3ERG A;  5ECH B;  2A4H A;  3D21 A;  3ED3 A;  4MLY A;  5IM9 A;  3EC3 A;  2QA2 A;  1ZGN A;  4OWY A;  3LXZ A;  2VCV A;  5J40 A;  2CX3 A;  1TK5 B;  4E8E A;  1WE0 A;  5IMD A;  5ID2 A;  5EY6 A;  4G9H A;  3EE2 A;  3HY2 A;  3SBC A;  2CVK A;  3GH6 A;  1EEM A;  5ECN B;  2EFC A;  3KH7 A;  3HJP A;  1YVL A;  1SJZ A;  3IAS 2;  4N0V A;  3VWW A;  2O8V B;  1JLW A;  4BVX B;  5IIZ A;  2XPD A;  3VUR A;  2DC5 A;  4Z2T A;  4H86 A;  5IO2 A;  2FD3 A;  2O87 A;  2B3S A;  1MD3 A;  3QR6 A;  5B6N A;  3MSZ A;  4JED A;  2X64 A;  1SEN A;  4HU9 A;  4DSR A;  2O89 A;  2PBJ A;  2HSN B;  2O5V A;  5DAK A;  4OFT A;  5F06 A;  4Q5N A;  3F3R A;  1O8X A;  1UVZ A;  2F3M A;  3KTL A;  2ZUP A;  4AKI A;  3F6F A;  4O7H A;  1YF0 A;  1USB A;  1SK0 A;  2ALB A;  3W8J A;  2FCH A;  1JLV A;  3IV4 A;  5J3R A;  1A8L A;  5EVO A;  4TR0 A;  2C3T A;  3GKN A;  1TK8 B;  3GA4 A;  1SL1 B;  3UVH A;  5E4W A;  2E0Q A;  1JZR A;  2OE1 A;  3KZQ A;  2B7K A;  1T1V A;  5GZZ B;  1AQW A;  2VL3 A;  3L78 A;  1HNB A;  1E6B A;  3I69 A;  1KNG A;  2V32 A;  5JWQ B;  3FY7 A;  3TJG A;  2MZC A;  2OBK A;  3VI7 A;  4N30 A;  4IS0 A;  1DBY A;  3ERW A;  3F0I A;  5D93 A;  3L9V A;  3BOA A;  4ZB7 A;  4JBB A;  3KCM A;  2KHP A;  2LKU A;  1SYR A;  4LMW A;  2FWE A;  4HI7 A;  2HE3 A;  2VCZ A;  1K0D A;  2I4A A;  3FMW A;  4XCS A;  5IO0 A;  14GS A;  1GUH A;  2B5E A;  1PN0 A;  1OC9 A;  2G0F A;  4BL7 A;  5CO3 A;  2MMN A;  3M9J A;  3BJ5 A;  1VF1 A;  3C73 A;  3DML A;  2JU5 A;  4J56 E;  2K8S A;  1PX7 A;  1NHO A;  3QFA C;  1XBS A;  4XHM A;  3PIN A;  2R4V A;  1R26 A;  2C4J A;  2KOK A;  3DVW A;  4Q5Q A;  3O6T A;  3UL3 A;  2IFQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...