5LCZA

Chimeric gst
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
195
Chain Sequence
AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYSEGILDLTEMITALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKPAMDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase A1,Glutathione S-transferase alpha
publication title Directed evolution of glutathione transferases towards a selective glutathione-binding site and improved oxidative stability.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 195
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5lczA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5lczA01
5EVOA 3C1SA 4XHMA 1J0FA 2P5RA 1GTUA 3L9SA 2XPDA 1QMVA 1Z7PA 4KDYA 10GSA 4MJBA 2V6KA 2YWOA 3PINA 2B6MA 2WJUA 1ZL9A 2OE0A 4YQVA 1PL2A 4F0CA 3DMLA 4ZL7A 2H74A 3VFIA 4G0KA 2HRAA 2JL4A 1SU9A 2F51A 1GUMA 13GSA 1XFLA 4EE0A 3GTUB 3E9JB 1RW1A 2LS5A 4F2IA 4EC0A 2IMKA 1YF0A 2L5OA 3GKXA 2F8FA 4GF0A 2WZ9A 4TRXA 2VL3A 4L5LA 4KCAA 1S3AA 3CTGA 3UIWA 2JZSA 5IMZA 3IXRA 5C00A 3QMXA 2H19A 2MMNA 3UBLA 2GQMA 1G0TA 2E2GA 2HYXA 1FB0A 2FCHA 4X1UA 2LJKA 2VCTA 1SL2B 4NHZA 4ZBAA 3L4NA 2HSHA 2OE3A 1GTBA 3KM6A 1O7UA 3KMOA 4MH2A 3ZMKA 2LRCA 3C73A 1Z3EA 4HI7A 2MZCA 1PGTA 5F06A 4KDXA 5FHIA 4WETA 3F4TA 4WF5A 1XW5A 3RBTA 3Q74A 3CMIA 2GVPA 3ZYWA 1DE2A 1GNWA 2X99A 1TU8A 5G1LA 1M9BA 4WBJA 5IO2A 3H4KA 2JU5A 3DKSA 3P90A 3H93A 4RQRA 3ZLPA 5L71A 5EPFA 1FW1A 5IMDA 5HR1A 3DYRA 3D22A 3IC4A 1B9XC 1K0AA 2D2ZA 2N5BA 4MDCA 3F6FA 3GA4A 4JRRA 2KP1A 3LWAA 4ILFA 1CQHA 4IS0A 1TJDA 2IIYA 2X8HA 1B4PA 2NBSA 2RM6A 4NWYA 3N9JA 4E8HA 1T4ZA 3CYNA 4BL7B 4USSA 4V1Ag 2M72A 1NW2A 3US3A 4ULXA 2R6KA 1FVJA 1GH2A 5LD0A 3UL3A 4KSMA 3U5RE 1JZDA 4TW5A 4KNDA 1XXUA 3FZ4A 1WOUA 2IPAA 1Z6MA 2O7KA 1FO5A 4MA9A 2OE1A 4KE3A 3A3TA 5JWRB 4FH8A 2HSMA 2CVBA 2VD0A 1E6BA 1O8XA 1SYRA 1BQ7A 1JZWA 3TKPA 4D73A 2DJ3A 4IKHA 4QL7A 1F3BA 2C8UA 2B5XA 3IRAA 3G7JA 1AUCA 2C80A 1ERVA 3UOMA 3GSSA 3IR4A 2M80A 1U87A 5A4WA 5EY6A 3PGTA 4ECBA 4LMWA 6GSTA 3WYWA 2NVLA 4NAXA 2EIRA 1DUGA 4JZQA 4BWSA 4IJIA 1V98A 4MPFA 1F9MA 1LJRA 1GSSA 1K0OA 2MBTA 3D0ZA 1ERWA 2L6DA 4PUAA 6GSWA 3QPMA 4MZBA 1OC3A 3DIEA 1A23A 4MF7A 3UARA 4ZBBA 1G7OA 4MH3A 2FWEA 2MYGA 3DWVA 1EEJA 4G9HA 5ECSA 19GSA 1XWBA 2B7KA 4GXZA 2AV4A 1V57A 1T00A 2B1KA 2Z9SA 4O92A 2MBSA 4EVMA 4K8MA 1GLPA 3WGDA 3FW2A 3IDVA 1SJ6A 2PVQA 3HKRA 4Q5NA 1RK4A 1S3DA 1AQWA 1V9WA 3Q19A 4IJ3A 2OBIA 2DMMA 3I9V2 2ON5A 2V1MA 4G2EA 2DJ2A 1FAAA 2H0HA 2MMZA 3J7Yb 2VM2A 3KD0A 2KOKA 4PNFA 1U88A 3C71A 5DAKB 1FB6A 1EOGA 1OC8A 1OC9B 2CVKA 2HRKB 2VCXA 4MMMA 5B8BA 2IL3A 2JSZA 3IPZA 2EIQA 2GZZA 1F6MC 5G5FA 3APOA 2FWGA 4MJAA 5CRDA 3PR8A 4NMUA 4BVXB 2C4JA 6GSUA 4BVYA 1PN9A 4IP6A 5FWGA 4TR4A 2O8VB 2DBCA 4PQIA 1ZOFA 3WT2A 5AIVA 1VF4A 3FY7A 2C0EA 1YY7A 3IHQA 4MPGA 1YEXA 4HU9A 22GSA 3LXTA 1ACVA 1VRSD 5CRWA 3HZ8A 1K0CA 1IYIA 3DVXA 5COHA 4ZXGA 8GSSA 3CRTA 5CAXA 2YJHA 3NOFA 1GUHA 2X64A 2VL9A 1M0UA 1EV4A 2K6VA 5ECMB 4HS1A 4LMVA 2JZTA 1QGVA 4BPYA 4AF2A 1W4VA 3ZITA 3GL3A 3FR6A 3GRXA 1K0NA 4TXVA 5A4VA 1SENA 3TRPA 3Q18A 3GYKA 2ZNMA 1M2BA 2WCIA 1A2MA 3CSHA 5IQYA 4MJCA 2V6OA 1AW9A 4YQUA 2VM1A 5INYA 2WS2A 1GP1A 2C1YA 1G6YA 3HXSA 3H79A 5D96A 2G2QA 1B4QA 3F4SA 2OADA 2RM5A 4POMA 3IE3A 1T4YA 2HRNA 4ZL8A 1TI3A 4K7NA 2MMAA 3HJPA 1K0MA 3ERGA 3QFBC 4NV5A 2FD3A 1TP9A 1QUWA 5IMFA 3HA9A 3LEFA 9GSSA 2HZEA 2OJLA 3V1WA 3TCOA 5DQSA 1X9MB 2K9FA 3HVVA 3O3TA 1YEPA 2L4QA 3BCIA 5AN1A 5ID2B 4JEDA 2R4VA 3KGKA 1X5DA 4V2LA 3ZIVA 3CSJA 1ZGNA 1CQGA 1GLQA 3I43A 1U3IA 3L0HA 5LNKe 1GRXA 1A24A 1PX7A 2LUSA 1TK5B 2H1BA 4G0LA 2I4AA 3D4TA 3ED3A 3P2AA 3GH9A 1EEMA 3TGZA 4Q5RA 3GNJA 2DLXA 2NPBA 1HD2A 1KNGA 2GTUA 4TR3A 4PNGA 2GLRA 1M2DA 1XVWA 2E2MA 1ABAA 4K9ZA 3ZL5A 2DC5A 4DSSB 2LNSA 4J2FA 2CV4A 2VLTA 2IMEA 5CRHA 4RI6A 5CNWA 1DE1A 1GSFA 2C3QA 1NHYA 5IOWA 4YQMA 3F9UA 4ZBDA 2H0IA 2H76A 2HT9A 1LBKA 1A8YA 1EP7A 12GSA 1T7PB 1USBA 3H1NA 4K2DA 1ILOA 4TXOA 3L9VA 2I81A 6GSXA 4KX4A 3VWXA 1SJIA 2HZFA 4N0ZA 2H1DA 1Y6EA 3VI7A 3HVXA 4TR0A 3HYPA 4IQAA 2H0GA 1OE7A 1TDIA 1OE8A 2NDOA 3G7IA 3QOUA 3F3RA 3W8JA 3ZIJA 1JZOA 2MMOA 1SK1A 1MEKA 5BMUA 3KTLA 4EXJA 3EMPA 3DGQA 3J7Yk 1XWCA 2AB6A 2VCWA 4G10A 3BJ5A 4IN0A 5ECKB 2ALBA 2UZ8A 4EUYA 2RIIA 3A5WA 2YOIA 3BD2A 2GZYA 4KSOA 4MLYA 3KIJA 3QAWA 2B5EA 4V2NA 1WP0A 5G5EA 5D73A 5HFKA 2CAQA 4ACSA 2VLVA 3GTUA 1BEDA 5EL8A 3CXGA 2FNOA 2CT6A 5CO3A 3TDGA 4MP4A 4WF4A 1V58A 2PMTA 1GSYA 5KEJA 4XS1A 1PL1A 3HY2A 5J9CA 1DBYA 2X8GA 5D9VA 2H75A 3ZFBA 1AC1A 4IQ1A 1DSBA 3GV1A 3UJ1A 5H5SA 1EOHA 3ME7A 1F3AA 3HZ4A 2XBIA 1PX6A 5D9TA 5DVBA 4GSSA 3VPTA 1XW6A 1YQ1A 4F03A 1TXXA 3GKNA 3ME8A 4K7IA 3PPUA 3H8QA 5G30A 4MF6A 4ZL9A 5HR0A 2HRFA 2AJQB 1SKRB 3TKSA 5ENUA 1B8XA 2YNXA 1GSQA 4GTUA 3EU4A 3TUEA 6GSSA 5J41A 1WE0A 1LU4A 3APQA 1THOA 2LJRA 1EGOA 2F9SA 1YF1A 1IYHA 1ERTA 2B7JA 3UAPA 4POBA 5IMAA 3D5JA 4TR1B 4XRDA 2J9HA 2ON7A 3M1GA 4WXTA 2QC7A 3GMFA 3IK7A 1SJZA 4L0UA 1R5PA 4O7HA 1O6JA 1QXHA 5GAPD 1XOBA 4HUAA 4N10A 3GUSA 3RPPA 1THXA 3D6IA 1V2AA 2GT6A 3GX0A 1ZMAA 2HXKA 4K0GA 4AJ7A 5IPHA 4IVFA 2H1GA 4NV2A 4DSRA 1PKZA 1XOAA 3ZRDA 2O87A 3BBYA 2LRNA 7GSSA 4IHUA 4ZIJA 2H6YA 1PA3A 2TRCP 3EYTA 1XW9A 3KEBA 3EURA 1EZKA 5DCGA 2NTOA 3ZVJD 2ES7A 5DALB 3IV4A 3KMNA 5CP1A 5HFIA 2CZ2A 4AJ8A 1SL1B 1MDJA 2GQKA 2CX4A 3OR5A 1TOFA 1X5CA 1X0RA 1I5GA 2I9HA 3UBKA 3VWWA 1TTZA 4LL4B 4XS4B 1Z7RA 1ON4A 4IGJA 4ZB9A 3TKSC 4PUFC 3RDWA 3WT1A 3M9JA 4IBPA 3EVIA 5F05A 5B6NA 4GLTA 1K3OA 1XIYA 5B6MA 5D9WA 2WDUA 4ID0A 3LJRA 3ZZXA 1K0BA 2H01A 4MK3A 1JLVA 2C3TA 1TW9A 1C72A 2GT5A 2YWIA 1JLWA 1JHBA 2LQQA 1GL8A 2AHEA 3LORA 2AAWA 3KZQA 4V1Ap 1K0DA 2CA8A 1T1VA 2FA8A 4J57E 1QQ2A 5JCUA 2LEGA 5GAND 4G0IA 1SKSB 3VK9A 2C3NA 1HNAA 2PERA 4I2UA 5KN1A 4XCSA 2CAIA 2YP6A 4HEA2 3VI5A 3ZTLA 2KLXA 2OACA 2YWNA 2B3SA 3HHVA 1SD8A 3TKSE 1UN2A 1F2EA 5DJMA 2EC4A 3G7YA 2XC2A 4ZILA 4POKA 2WRTA 2WB9A 4DSQA 4POLA 3WGXA 4V2MA 4IP1A 2HE3A 4F9ZA 4OO5A 1F37A 3LYKA 2P5QA 4TOPA 2L4CA 1OVNA 3KH9A 4NPBA 1E2YA 2VAFA 4KH7A 3F4RA 5J5NA 5DAKA 1ZYQB 2ZCTA 2OKAA 2H30A 1SK0A 2HRKA 4HDEA 2RUFA 2FGXA 2DSAA 2VOCA 2L5LA 1B9YC 4AJ6A 1GSUA 3SBCA 2XPEA 5ECLB 4ECCA 3R2QA 3NIVA 4BVXA 2C0DA 4PX1A 4CW9A 2HNLA 3R3EA 1GULA 5GZZB 4FYUA 6GSVA 2TRXA 4KAEA 4ECJA 4RUVA 1EWXA 1G6WA 1TRUA 4NXIA 4JR6A 1EP8A 2IN3A 2PN8A 3GKMA 1XWGA 3MNGA 4GSNA 1J9BA 2LSTA 3APSA 3M9KA 5ELGA 5FT3A 2PBJA 2HFDA 4EDZA 20GSA 1AXDA 2RLIA 5F8BA 1B48A 1SL0B 3EINA 5CRGA 4HQZA 5J3RA 4J56E 2GSRA 5C04A 2I1UA 4DEJA 3TOUA 1A2LA 4TKYA 2H8LA 1OKDA 2BMXA 5D9XA 1I9DA 4HJ2A 4RQXA 4PGTA 5H5QA 3RHBA 3TJBA 1H4OA 3L9UA 4KB3A 3FEUA 3C7MA 4Q5FA 3TJGA 3LFLA 1JZRA 4WKWA 2BJXA 4OCFA 4OFNA 1M9AA 1NM3A 2CX3A 1FOVA 2YN1A 2PVOC 2N5FA 4E8EA 3BOAA 1MDIA 2VIMA 2YWMA 2H71A 4GQFA 2HQTA 3NZNA 2F8AA 2A2RA 3QDNA 2GSSA 1A8LA 5D8IA 3JCML 2K8SA 16GSA 1AQVA 1XWKA 4GRFA 1VF1A 2IFQB 2CZ3A 4JE1A 2PU9C 4N0VA 4X0XA 2N5AA 1R7HA 5IIZA 1G7EA 3EE2A 3QCPA 2HSNB 3KJYA 2QKEA 3A2XA 3WD6A 2AYTA 4FQUA 1X9WB 2O85A 5ECRB 4MJEA 5B7CA 2FUG2 4AGSA 4TN8A 1BG5A 2KHPA 4K0NA 3O6TA 5JCGA 3P8WA 1BX9A 2LQOA 1SKWB 4OD7A 11GSA 3WGEA 4DSSA 1TU7A 3RAZA 3IA1A 3EC3A 1BYEA 4L8EA 2PGTA 3QFAC 3LYPA 2IMDA 1N8JA 3DEXA 1ST9A 1UC7A 4O32A 3A2WA 5A4UA 5IO0A 3W8SA 1JFUA 5IMVA 1GTAA 1TRVA 2CQ9A 2LNTA 2O89A 1YJ6A 3ZVJA 1TRWA 5H5RA 2VCZA 1YKAA 3KP8A 3IC8A 1O8WA 3RPNA 2VLUA 1GUKA 2VL2A 1XZOA 2VO4A 3GL5A 1UA5A 2PWJA 3RHCA 3ZFLA 1R26A 5AISA 3P7XA 4XIHA 1AAZA 2G0FA 3DVWA 4WBRD 4ML6A 5JWQB 5HFGA 3AY8A 4ZB6A 1NHOA 2H72A 2A4VA 1M99A 4OMVA 3FZAA 2R3XA 3VWUA 5IOXA 4I6XA 3ISOA 5ECIB 2YPMA 1Q4JA 3HJOA 3IAM2 3FK8A 2PUKC 2F3MA 5HR3A 3GIXA 3VLNA 2ZUPA 3EU3A 1OYJA 2GSQA 3FRCA 5F07A 4Z7XA 3N5OA 3CRUA 3G9BA 2QSIA 3TB2A 1K3LA 2FWFA 3UEMA 1SYXA 4PURA 1VF3A 1X5EA 4JR4A 3VURA 2H70A 1VF2A 4NHWA 1VGLA 4O5RA 2DJJA 4GWRA 2YV9A 4F82A 4BA7A 1V40A 2E7PA 4CDOA 5KN2A 1MD3A 3VWVA 3F3QA 5DQYA 3LG6A 1ZYEA 4WR5A 4Q5QA 2KUCA 5HR2A 1U3AA 3IOSA 2H66A 1MDKA 3FZ5A 4KDUA 4H86A 3GH6A 4X43A 3M0FA 5G1KA 4FYCA 5ECNB 2FLSA 2H6ZA 2IJYA 1GSDA 1M2AA 2GDRA 3LXZA 1TRSA 2HI7A 3C8EA 3D4MA 1A2JA 3VPQA 5JWOB 2WGRA 2VD1A 1AIUA 4LA1A 2LTKA 4HJMA 2L6CA 5ELAA 3GFKA 2VL2C 3GX8A 5E4WA 2K8VA 4QL9A 3M3MA 2DJ1A 5ECPB 2FY6A 3E3EA 1WWJA 4KUNA 4L0WA 3F8UA 3KCMA 1OAZA 1XCCA 4TR1A 2K18A 1WJKA 2GZPA 2WULA 3EWLA 3IAS2 3KH7A 4PTSA 4ECIA 1GTIA 1MD4A 2A2SA 1URMA 4KW6A 5AGYA 2HSMB 3KTBA 5AIXA 4D73B 4FIWA 2H1AA 2E0QA 2R37A 1YKCA 3TJFA 4ZB8A 3UVHA 3TKRA 3HDCA 2X8CA 4MCUA 2B5YA 1FVKA 5HQPA 3I6AA 4BL7A 5DDLA 2C0FA 2GS3A 5DCHA 1FHEA 4IW9A 3C1RA 3A2VA 1HNBA 3LGCA 1HQOA 1O85A 1PKWA 5CREA 5DJLA 4FYBA 5JCWA 2WFCA 4LL1B 4HZ4A 1ERUA 3S9FA 2OBKA 3EMXA 2BTOT 5DALA 2GSTA 4MABA 4YAVA 1R5AA 1Z5YE 2PPTA 4FO5A 1R4WA 3GKKA 3DD3A 6GSYA 1SD9A 4ISDA 3MWHA 1KEBA 3ZMLA 2LJAA 4HOJA 3TKQA 1T8EB 2IMIA 4XS4A 1EV9A 3I69A 2L59A 1WIKA 4GSTA 1S3CA 4XTSA 1AQXA 5CYYA 5GSTA 2KP2A 2EIOA 2V41A 2HSYA 3PH9A 2VCQA 3L78A 1XVQA 1TK0B 1XPVA 2FA4A 3FZ9A 1EGRA 2YZHA 4L5OA 4OWYA 4BWQA 2V2GA 3F0IA 3HCZA 3IBHA 5GSSA 4N30A 3TJKA 1GNEA 1A0RP 1NSWA 1Y25A 1MTCA 4CHSA 4EF0A 2DJKA 3MAKA 1ZCPA 3SWLA 4EL1A 3CSIA 2DIZA 4K7OA 4K1FA 4JU5A 1PQNA 3DXBA 2JSYA 1WRYA 3QR6A 5IPGA 3HD5A 1A0FA 4KGIA 1XBSA 2JACA 4XS6A 4G19A 2RUEA 1N2AA 3FKFA 5IM9A 1BJXA 4BVYB 3HVSA 4WEYA 1BAYA 4KF9A 5E59A 1H75A 4I8BA 2GQLA 3TRQA 3O76A 3LSZA 1QK8A 1K3YA 2QGVA 5ECHB 3QAVA 4PXOA 1OC9A 1TK8B 1PMTA 4HU7A 2LRTA 1XWAA 5F0GA 2GGTA 1HNCA 2V32A 1Z6NA 1FG4A 2DJ0A 1PRXA 14GSA 2YJ7A 4GQCA 2VCVA 3QD9A 2HLSA 2C0GA 1ML6A 2B1LA 4YAPA 4PQ1A 18GSA 2R2JA 2I3YA 2CVDA 2H73A 4EKZA 4QQ7A 4MZCA 3FHKA 5J9BA 3ZREA 1PD21 1O73A 1Z9HA 4WR4A 4YH2A 5A5KA 4I5QA 4I97A 5IMCA 2LV3A 4GCIA 3MDKA 1T3BA 5ABRA 3TJJA 3CTFA 5ECOB 2VUPA 2L57A 4OO4A 4EDYA 3GSTA 1SK2A 4N11A 2YCDA 3HJMA 2YANA 3Q6OA 3IK9A 1KTEA 2LKUA 1TKDB 2HZEB 4K6XA 1QFNA 4I2TA 3ERFA 5G2ZA 1ZZYA 1YDKA 4P3YB 4HQSA 2OA7A 3K8NA 4F0BA 3GURA 3TOTA 4OFMA 2FWHA 2YV7A 1WMJA 1O81A 2IWTA 4OCEA 1YZXA 3FR3A 4RI7A 1HYUA 1RQMA 17GSA 3GN3A 1J08A 1M7TA 3FR9A 4MF5A 2JZRA 4MZWA 5D93A 2TIRA 1TI1A 1UVZA 3UVTA 5ID2A 4PQHA 3KP9A 2JADA 1GWCA 3U6VA 3MSZA 3CBUA 3UMAA 2H6XA 2REMA 3BCKA 2IMFA 4KA0A 2M46A 1Q98A 2YZUA 1WPIA 3GHAA 3F6DA 4DVCA 5J4UA 3TRXA 5KN3A 1KBNA 1X9SB 2P31A 1GSEA 1OKTA 3M8NA 5LCZA 3E0UA 4LLRA 4ML1A 5KN0A 4OFTA 5B8AA 5DBQA 2R5GA 3FYGA 2IFQA 4KCEA 3KXOA 3LQ7A 3DRNA 4TXOB 3ERWA 1W89A 5G31A 3W6GA 2FHEA 3QAGA 5ECQB 4IELA 2P0GA 2DMLA 1U6TA 4XRAA 2J23A 1PSQA 2XBQA 2XHFA 2AUVA 3F63A 2DIYA 4TVEA 4HZ2A 4JBBA 4EO3A 3D21A
chains in the Genus database with same CATH superfamily
5EVOA 3C1SA 4XHMA 1J0FA 2P5RA 1GTUA 3L9SA 2XPDA 1QMVA 1Z7PA 4KDYA 10GSA 4MJBA 2V6KA 2EFHA 2YWOA 5A5HB 3PINA 2B6MA 2WJUA 1ZL9A 2OE0A 4YQVA 1PL2A 2R0GA 4F0CA 3DMLA 4ZL7A 2H74A 3VFIA 4G0KA 2HRAA 2JL4A 1SU9A 2F51A 1GUMA 13GSA 1XFLA 4EE0A 3GTUB 3E9JB 1RW1A 2LS5A 4F2IA 4EC0A 2IMKA 1YF0A 2L5OA 3GKXA 2F8FA 4GF0A 2WZ9A 4TRXA 2VL3A 2WVYA 4L5LA 4KCAA 3RGBC 1S3AA 3CTGA 3UIWA 2JZSA 5IMZA 3IXRA 5C00A 3QMXA 2H19A 2MMNA 3UBLA 2GQMA 1G0TA 2E2GA 2HYXA 1FB0A 2FCHA 4X1UA 2LJKA 2VCTA 1SL2B 4NHZA 4ZBAA 3L4NA 2HSHA 2OE3A 1GTBA 3KM6A 1O7UA 3KMOA 4MH2A 3ZMKA 2LRCA 3C73A 1Z3EA 1YVLA 4HI7A 2MZCA 1PGTA 5F06A 4KDXA 5FHIA 4WETA 3F4TA 4WF5A 1XW5A 3RBTA 3Q74A 3CMIA 2GVPA 3ZYWA 1DE2A 1GNWA 2X99A 1TU8A 5G1LA 1M9BA 4WBJA 5IO2A 3H4KA 2JU5A 3DKSA 4AKGA 3P90A 3H93A 4RQRA 3ZLPA 5L71A 5EPFA 1FW1A 5IMDA 5HR1A 3DYRA 3MIXA 3D22A 3IC4A 1B9XC 3LW9A 1K0AA 2D2ZA 2N5BA 4MDCA 3F6FA 3GA4A 4JRRA 2KP1A 3LWAA 4ILFA 1CQHA 4IS0A 1TJDA 2IIYA 2X8HA 1B4PA 2NBSA 2RM6A 4NWYA 3N9JA 4E8HA 1T4ZA 3CYNA 4BL7B 4USSA 4V1Ag 2M72A 1NW2A 3US3A 4ULXA 2R6KA 1FVJA 1GH2A 5LD0A 3UL3A 4KSMA 3U5RE 1JZDA 4TW5A 4KNDA 1XG8A 1XXUA 3FZ4A 1WOUA 2IPAA 1Z6MA 2O7KA 1FO5A 4MA9A 2OE1A 4KE3A 4N3ZA 3A3TA 5JWRB 4FH8A 2HSMA 2CVBA 2VD0A 1E6BA 1O8XA 1SYRA 1BQ7A 1JZWA 3TKPA 4D73A 2DJ3A 4IKHA 4QL7A 1F3BA 2C8UA 2O5VA 2B5XA 3IRAA 3G7JA 1AUCA 2C80A 1ERVA 3UOMA 1SVOA 3GSSA 3IR4A 2M80A 1U87A 5A4WA 5EY6A 3PGTA 4ECBA 4LMWA 6GSTA 3WYWA 2NVLA 4NAXA 2EIRA 4AKIA 1DUGA 4JZQA 4BWSA 4IJIA 1V98A 4MPFA 5KOXA 1F9MA 1LJRA 1GSSA 1K0OA 2MBTA 3D0ZA 1ERWA 2L6DA 4PUAA 6GSWA 3QPMA 4MZBA 1OC3A 3DIEA 1A23A 2WW0A 4MF7A 3UARA 4ZBBA 1G7OA 2WVXB 4MH3A 2FWEA 2MYGA 3DWVA 1EEJA 4G9HA 5ECSA 4EIQA 19GSA 1ZYPA 1XWBA 2B7KA 4GXZA 2AV4A 1V57A 1T00A 2B1KA 2Z9SA 4O92A 2MBSA 4EVMA 4K8MA 1GLPA 3WGDA 3FW2A 1FOHA 3IDVA 1SJ6A 2PVQA 3HKRA 4Q5NA 1RK4A 1S3DA 1AQWA 1V9WA 3Q19A 4IJ3A 2OBIA 2DMMA 3I9V2 2ON5A 2V1MA 4G2EA 2DJ2A 1FAAA 2H0HA 2MMZA 1PFOA 3J7Yb 2VM2A 3KD0A 2KOKA 4PNFA 1U88A 3C71A 5DAKB 1FB6A 1EOGA 1OC8A 1OC9B 2CVKA 2HRKB 2VCXA 4MMMA 5B8BA 2IL3A 2JSZA 3IPZA 2EIQA 2GZZA 1F6MC 5G5FA 3APOA 2FWGA 4MJAA 4W66A 5CRDA 3PR8A 4NMUA 4BVXB 2C4JA 6GSUA 4BVYA 1PN9A 4IP6A 5FWGA 4TR4A 2O8VB 2DBCA 4PQIA 1ZOFA 3WT2A 5AIVA 1VF4A 3FY7A 2C0EA 1YY7A 3IHQA 4MPGA 1YEXA 4HU9A 22GSA 3LXTA 1ACVA 1VRSD 5CRWA 3HZ8A 1K0CA 1IYIA 3DVXA 5COHA 4ZXGA 8GSSA 3CRTA 5CAXA 2YJHA 3NOFA 1GUHA 2X64A 2VL9A 1M0UA 1EV4A 2K6VA 5ECMB 4HS1A 4LMVA 2JZTA 1QGVA 4BPYA 4AF2A 1W4VA 3ZITA 2QA2A 3GL3A 3FR6A 3GRXA 1K0NA 4TXVA 5A4VA 4AKXB 1SENA 3TRPA 3Q18A 3GYKA 2ZNMA 1M2BA 2WCIA 1A2MA 3CSHA 5IQYA 4MJCA 2V6OA 1AW9A 4YQUA 2VM1A 5INYA 2WW3A 2WS2A 1GP1A 2C1YA 1G6YA 3HXSA 5BRTA 3H79A 5D96A 2G2QA 1B4QA 3F4SA 2OADA 2RM5A 4POMA 3IE3A 1T4YA 2HRNA 4ZL8A 4G01A 2QA1A 1TI3A 4K7NA 2MMAA 3HJPA 1K0MA 3ERGA 3QFBC 4NV5A 2FD3A 1TP9A 1QUWA 5IMFA 4QMKA 5J40A 3HA9A 3LEFA 9GSSA 2HZEA 2OJLA 3V1WA 3TCOA 5DQSA 1X9MB 2K9FA 3HVVA 3O3TA 1YEPA 2L4QA 3BCIA 5AN1A 5ID2B 4JEDA 2R4VA 3KGKA 1X5DA 4V2LA 3ZIVA 3CSJA 1ZGNA 1CQGA 1GLQA 3I43A 1U3IA 3L0HA 5LNKe 4E68A 1GRXA 1A24A 1PX7A 2LUSA 1TK5B 2A4HA 2H1BA 4G0LA 2I4AA 3D4TA 3ED3A 3P2AA 3GH9A 1EEMA 3TGZA 4Q5RA 3GNJA 2DLXA 2NPBA 1HD2A 1KNGA 2GTUA 4TR3A 4PNGA 2GLRA 1M2DA 1XVWA 2E2MA 1ABAA 4K9ZA 3ZL5A 2DC5A 4DSSB 2LNSA 4J2FA 2CV4A 2VLTA 2IMEA 5CRHA 1M3JA 4RI6A 5CNWA 1DE1A 1GSFA 2DKHA 2C3QA 1NHYA 5IOWA 4YQMA 3F9UA 2HSNA 1M3IA 4ZBDA 2H0IA 2H76A 2HT9A 1LBKA 1A8YA 1EP7A 12GSA 1T7PB 1USBA 3H1NA 4K2DA 1ILOA 4TXOA 3L9VA 3A5IA 2I81A 6GSXA 4KX4A 3VWXA 1SJIA 2HZFA 4N0ZA 2H1DA 4PHZC 1Y6EA 3VI7A 3HVXA 4O5UA 4BIKA 4TR0A 3HYPA 4IQAA 2H0GA 1OE7A 1TDIA 1OE8A 2NDOA 3G7IA 3QOUA 3F3RA 3W8JA 3ZIJA 1JZOA 2MMOA 1SK1A 1MEKA 5BMUA 3KTLA 4EXJA 3EMPA 3DGQA 3J7Yk 1XWCA 2AB6A 2VCWA 4G10A 3BJ5A 4IN0A 5ECKB 2WW1A 2ALBA 2UZ8A 5A5HA 4EUYA 2RIIA 3A5WA 2YOIA 3BD2A 2GZYA 4KSOA 4MLYA 3KIJA 4A5PA 3QAWA 2B5EA 4V2NA 1WP0A 5G5EA 5D73A 5HFKA 2CAQA 4ACSA 4EIPA 2VLVA 3GTUA 1BEDA 5EL8A 3CXGA 2FNOA 2CT6A 5CO3A 3TDGA 4MP4A 4WF4A 1V58A 2PMTA 1GSYA 5KEJA 4XS1A 1PL1A 3HY2A 5J9CA 1DBYA 2X8GA 5D9VA 2H75A 3ZFBA 1AC1A 4IQ1A 1DSBA 3GV1A 3UJ1A 5H5SA 1EOHA 3ME7A 1F3AA 3HZ4A 3RFRC 2XBIA 1PX6A 5D9TA 5DVBA 4GSSA 3VPTA 1XW6A 1YQ1A 4F03A 1TXXA 3GKNA 3PPUA 3ME8A 4K7IA 3H8QA 5G30A 4MF6A 4ZL9A 5HR0A 2HRFA 2AJQB 1SKRB 5J47A 3TKSA 5ENUA 1B8XA 4PI0C 2YNXA 1GSQA 4GTUA 3EU4A 3TUEA 6GSSA 5J41A 1WE0A 1LU4A 3APQA 1THOA 2LJRA 1EGOA 2F9SA 1YF1A 1IYHA 1ERTA 2B7JA 3UAPA 4POBA 5IMAA 3D5JA 4TR1B 4XRDA 4CY8A 2J9HA 2ON7A 3M1GA 4WXTA 2X4AA 2QC7A 3GMFA 3IK7A 1SJZA 4L0UA 1R5PA 4O7HA 1O6JA 4Z2UA 1QXHA 5GAPD 1XOBA 4HUAA 4N10A 3GUSA 3RPPA 1THXA 3D6IA 5J4YA 1V2AA 2GT6A 3GX0A 1ZMAA 2HXKA 4K0GA 4AJ7A 5IPHA 4IVFA 2H1GA 4NV2A 4DSRA 1PKZA 1XOAA 3ZRDA 2O87A 3BBYA 2LRNA 7GSSA 4IHUA 4ZIJA 2H6YA 1PA3A 2TRCP 3EYTA 5A34B 1XW9A 3KEBA 3EURA 1EZKA 5DCGA 2NTOA 3ZVJD 5A1NB 2ES7A 5DALB 3IV4A 3KMNA 5CP1A 5HFIA 2CZ2A 4AJ8A 1SL1B 1MDJA 2GQKA 2CX4A 3OR5A 1TOFA 1X5CA 5KOWA 1X0RA 1I5GA 2I9HA 3UBKA 3VWWA 1TTZA 4LL4B 4XS4B 1Z7RA 1ON4A 4IGJA 4ZB9A 3TKSC 4PUFC 3RDWA 3WT1A 3M9JA 4IBPA 3EVIA 5F05A 4K5SA 5B6NA 4CY6A 4GLTA 1K3OA 1XIYA 5B6MA 5D9WA 2WDUA 4ID0A 3LJRA 3ZZXA 1K0BA 2H01A 4MK3A 1JLVA 2C3TA 1TW9A 2WW2A 1C72A 2GT5A 2YWIA 1JLWA 1JHBA 2LQQA 1GL8A 2AHEA 3LORA 2AAWA 3KZQA 4V1Ap 1K0DA 4K5RA 2CA8A 1T1VA 2FA8A 4PI2C 4J57E 1QQ2A 3IHGA 5JCUA 2LEGA 2WVXA 5GAND 4G0IA 1BF5A 1SKSB 1SVLA 3VK9A 2C3NA 1HNAA 2PERA 4I2UA 5KN1A 4XCSA 2CAIA 2YP6A 4HEA2 3VI5A 3ZTLA 2KLXA 2OACA 2YWNA 2B3SA 3HHVA 1SD8A 3TKSE 1UN2A 1F2EA 5DJMA 2EC4A 3G7YA 2XC2A 4ZILA 4POKA 2WRTA 2WB9A 4DSQA 4POLA 3WGXA 4V2MA 5J4VA 4IP1A 2HE3A 4F9ZA 4OO5A 1F37A 3LYKA 2P5QA 4TOPA 2L4CA 1OVNA 3KH9A 4NPBA 2EFEA 1E2YA 2VAFA 2OT3A 4KH7A 3F4RA 5J5NA 5DAKA 1ZYQB 2ZCTA 2OKAA 2H30A 1SK0A 2HRKA 4HDEA 2RUFA 2FGXA 2DSAA 2VOCA 2L5LA 1B9YC 4AJ6A 1GSUA 3SBCA 2XPEA 5ECLB 4ECCA 3R2QA 3NIVA 4BVXA 2C0DA 4PX1A 4CW9A 2HNLA 3R3EA 1GULA 5GZZB 4FYUA 6GSVA 2TRXA 4KAEA 4ECJA 4RUVA 1EWXA 1G6WA 1TRUA 4NXIA 4JR6A 1EP8A 2IN3A 2PN8A 3GKMA 1XWGA 3MNGA 4GSNA 2O3EA 1J9BA 2LSTA 3APSA 3M9KA 5ELGA 5FT3A 3HMJG 2PBJA 2HFDA 4EDZA 20GSA 1AXDA 2RLIA 5F8BA 1B48A 1SL0B 3EINA 5CRGA 4HQZA 5J3RA 4J56E 2GSRA 5C04A 2I1UA 4DEJA 3TOUA 1A2LA 4TKYA 2H8LA 1OKDA 4ICYA 2BMXA 5D9XA 1I9DA 4HJ2A 4RQXA 4ZB7A 4PGTA 5H5QA 3RHBA 3TJBA 1H4OA 3L9UA 4KB3A 3FEUA 3C7MA 4Q5FA 3TJGA 3LFLA 1JZRA 4YKGA 4WKWA 2BJXA 4OCFA 4MNNA 1ZYNA 4OFNA 1M9AA 1YEWC 1NM3A 2CX3A 1FOVA 2YN1A 2PVOC 2N5FA 4E8EA 3BOAA 1MDIA 2VIMA 2YWMA 2H71A 4GQFA 2HQTA 3NZNA 2F8AA 2A2RA 3QDNA 2GSSA 1A8LA 5D8IA 3JCML 2K8SA 16GSA 1AQVA 1XWKA 4GRFA 1VF1A 2IFQB 2CZ3A 4JE1A 2PU9C 4N0VA 4X0XA 2N5AA 1R7HA 5IIZA 1G7EA 1PN0A 3EE2A 3QCPA 2HSNB 3KJYA 2QKEA 3A2XA 3WD6A 4GDFA 2AYTA 4FQUA 1X9WB 2O85A 5ECRB 4MJEA 5B7CA 2FUG2 4AGSA 4TN8A 1BG5A 4X4JA 2KHPA 4K0NA 3O6TA 5JCGA 2DKIA 3P8WA 1BX9A 2LQOA 1SKWB 4OD7A 11GSA 3WGEA 4DSSA 1TU7A 3RAZA 3CHXC 3IA1A 3EC3A 1BYEA 2EFCA 4L8EA 2PGTA 3QFAC 3LYPA 2IMDA 1N8JA 3DEXA 1ST9A 1UC7A 2UV8G 4O32A 3A2WA 5A4UA 5IO0A 3W8SA 1JFUA 5IMVA 1GTAA 1TRVA 2CQ9A 2LNTA 2O89A 5BMUB 1YJ6A 3ZVJA 1TRWA 5H5RA 2VCZA 1YKAA 3KP8A 3IC8A 1O8WA 3RPNA 2VLUA 1GUKA 2VL2A 1XZOA 2VO4A 3GL5A 3HVNA 1UA5A 2PWJA 2X49A 3RHCA 3ZFLA 1R26A 5AISA 3P7XA 4XIHA 1AAZA 2G0FA 3DVWA 4WBRD 4ML6A 5JWQB 5HFGA 3AY8A 4ZB6A 1NHOA 2H72A 2A4VA 1M99A 4OMVA 3FZAA 2R3XA 3VWUA 5IOXA 1TXUA 4I6XA 3ISOA 5ECIB 2YPMA 1Q4JA 3HJOA 3IAM2 3FK8A 2PUKC 2F3MA 5HR3A 3GIXA 3VLNA 2ZUPA 3EU3A 1OYJA 2GSQA 3FRCA 5F07A 4Z7XA 3N5OA 3CRUA 3G9BA 2QSIA 3TB2A 1K3LA 2WZSA 3FMWA 2FWFA 3UEMA 1SYXA 4PURA 1VF3A 1X5EA 3VURA 4JR4A 2H70A 1VF2A 4NHWA 1VGLA 4O5RA 2DJJA 4GWRA 2YV9A 4F82A 4BA7A 1V40A 2E7PA 4CDOA 5KN2A 1MD3A 3VWVA 3F3QA 5DQYA 3LG6A 1ZYEA 4WR5A 4Q5QA 2KUCA 5HR2A 1U3AA 3IOSA 2H66A 1MDKA 3FZ5A 4KDUA 4H86A 3CWGA 3GH6A 4X43A 3M0FA 5G1KA 4FYCA 5ECNB 2FLSA 2H6ZA 2IJYA 1GSDA 1M2AA 2GDRA 3LXZA 1TRSA 2HI7A 3C8EA 3D4MA 1A2JA 3VPQA 5JWOB 2WGRA 3EPTA 2VD1A 1AIUA 4LA1A 2LTKA 4HJMA 2L6CA 5ELAA 3GFKA 2VL2C 3GX8A 5E4WA 2K8VA 4QL9A 3M3MA 2DJ1A 5ECPB 2FY6A 3E3EA 1WWJA 4KUNA 4L0WA 3F8UA 3KCMA 1OAZA 1XCCA 4TR1A 2K18A 1WJKA 2GZPA 2WULA 3EWLA 3IAS2 3KH7A 4PTSA 4ECIA 1GTIA 1MD4A 2A2SA 1URMA 4KW6A 5AGYA 2HSMB 3KTBA 5AIXA 2R0PA 4D73B 4FIWA 2H1AA 2E0QA 2R37A 1YKCA 3TJFA 4ZB8A 3UVHA 3TKRA 3HDCA 2VKZG 2X8CA 4MCUA 2B5YA 1FVKA 5HQPA 3I6AA 4BL7A 5DDLA 2C0FA 2GS3A 5DCHA 1FHEA 4IW9A 3C1RA 3A2VA 1HNBA 3LGCA 1HQOA 1O85A 1PKWA 5CREA 5DJLA 5A34A 4FYBA 1BG1A 5JCWA 2WFCA 4LL1B 4HZ4A 4HSCX 1ERUA 3S9FA 2OBKA 3EMXA 2BTOT 5A1NA 5DALA 2GSTA 4MABA 4YAVA 1R5AA 1Z5YE 2PPTA 2H1LA 4FO5A 1R4WA 3GKKA 4YKFA 3DD3A 6GSYA 1SD9A 4ISDA 3MWHA 1KEBA 3ZMLA 2LJAA 4HOJA 3TKQA 1T8EB 2IMIA 4XS4A 1EV9A 3I69A 2L59A 1WIKA 4GSTA 1S3CA 4XTSA 1AQXA 5CYYA 5GSTA 2KP2A 2EIOA 2V41A 2HSYA 3PH9A 2VCQA 3L78A 1XVQA 1TK0B 1XPVA 2FA4A 3FZ9A 1EGRA 2YZHA 4L5OA 4OWYA 4BWQA 2V2GA 3F0IA 3HCZA 3IBHA 5GSSA 4N30A 3TJKA 1GNEA 1A0RP 1NSWA 1Y25A 1MTCA 4CHSA 4K2XA 4EF0A 2DJKA 3MAKA 1ZCPA 3SWLA 4EL1A 2EFDA 3CSIA 2DIZA 4K7OA 4K1FA 3MYDA 4JU5A 1PQNA 3DXBA 2JSYA 2R0CA 1WRYA 3QR6A 5IPGA 3HD5A 1A0FA 4KGIA 1XBSA 2JACA 4XS6A 4G19A 2RUEA 1N2AA 3FKFA 5IM9A 1BJXA 4BVYB 3HVSA 4WEYA 1BAYA 4KF9A 5E59A 1H75A 4I8BA 2GQLA 3TRQA 3O76A 3LSZA 1QK8A 1K3YA 2QGVA 1N25A 4FXYP 5ECHB 3QAVA 4PXOA 1OC9A 1TK8B 1PMTA 4HU7A 2LRTA 1XWAA 5F0GA 2GGTA 1HNCA 2V32A 1Z6NA 1FG4A 2DJ0A 1PRXA 14GSA 2YJ7A 4GQCA 2VCVA 4O5QA 3QD9A 2HLSA 2C0GA 1ML6A 2B1LA 4YAPA 4PQ1A 18GSA 2R2JA 2I3YA 2CVDA 2H73A 4EKZA 4QQ7A 4MZCA 3FHKA 5J9BA 3ZREA 1PD21 1O73A 1Z9HA 4WR4A 4YH2A 5A5KA 4I5QA 4I97A 5IMCA 2LV3A 4GCIA 1S4BP 3MDKA 1T3BA 5ABRA 3CQFA 3TJJA 3CTFA 5ECOB 2VUPA 2L57A 4OO4A 4EDYA 3GSTA 1SK2A 4N11A 2YCDA 3HJMA 2YANA 3Q6OA 3IK9A 1KTEA 3TU3B 2LKUA 1TKDB 2HZEB 4K6XA 1QFNA 4I2TA 3ERFA 1I1IP 5G2ZA 2WVZA 1ZZYA 1YDKA 2A2PA 4Z2RA 4P3YB 4HQSA 2OA7A 3K8NA 4F0BA 3GURA 3TOTA 4OFMA 2FWHA 2YV7A 1WMJA 1O81A 2IWTA 4OCEA 1YZXA 3FR3A 4RI7A 1HYUA 1RQMA 17GSA 3GN3A 1J08A 1M7TA 3FR9A 2O36A 4MF5A 2JZRA 4MZWA 5D93A 2TIRA 1TI1A 1UVZA 4AI6A 3UVTA 5ID2A 4PQHA 3KP9A 2JADA 1GWCA 3U6VA 3MSZA 3CBUA 3UMAA 2H6XA 2REMA 3BCKA 2IMFA 4KA0A 2M46A 1Q98A 2YZUA 1WPIA 3GHAA 3F6DA 4DVCA 5J4UA 3TRXA 5KN3A 1KBNA 1X9SB 2P31A 1GSEA 1OKTA 3M8NA 5LCZA 3E0UA 4LLRA 4ML1A 5KN0A 4OFTA 1S3RA 5B8AA 5DBQA 2R5GA 3FYGA 2IFQA 4KCEA 3KXOA 3LQ7A 4AKHA 3DRNA 4TXOB 3ERWA 1W89A 5G31A 3W6GA 2FHEA 3QAGA 5ECQB 4IELA 2P0GA 2DMLA 1U6TA 4XRAA 2J23A 1SVMA 1PSQA 2XBQA 2XHFA 2AUVA 3F63A 2DIYA 4TVEA 4HZ2A 4JBBA 4EO3A 4Z2TA 3D21A 1Y1UA
chains in the Genus database with same CATH topology
5EVOA 3C1SA 4XHMA 1J0FA 2P5RA 1GTUA 3L9SA 2XPDA 1QMVA 1Z7PA 4KDYA 10GSA 4MJBA 2V6KA 2EFHA 2YWOA 5A5HB 3PINA 2B6MA 2WJUA 1ZL9A 2OE0A 4YQVA 1PL2A 2R0GA 4F0CA 3DMLA 4ZL7A 2H74A 3VFIA 4G0KA 2HRAA 2JL4A 1SU9A 2F51A 1GUMA 13GSA 1XFLA 4EE0A 3GTUB 3E9JB 1RW1A 2LS5A 4F2IA 4EC0A 2IMKA 1YF0A 2L5OA 3GKXA 2F8FA 4GF0A 2WZ9A 4TRXA 2VL3A 4L5LA 4KCAA 1S3AA 3CTGA 3UIWA 2JZSA 5IMZA 3IXRA 5C00A 3QMXA 2H19A 2MMNA 3UBLA 2GQMA 1G0TA 2E2GA 2HYXA 1FB0A 2FCHA 4X1UA 2LJKA 2VCTA 1SL2B 4NHZA 4ZBAA 3L4NA 2HSHA 2OE3A 1GTBA 3KM6A 1O7UA 3KMOA 4MH2A 3ZMKA 2LRCA 3C73A 1Z3EA 1YVLA 4HI7A 2MZCA 1PGTA 5F06A 4KDXA 5FHIA 4WETA 3F4TA 4WF5A 1XW5A 3RBTA 3Q74A 3CMIA 2GVPA 3ZYWA 1DE2A 1GNWA 2X99A 1TU8A 5G1LA 1M9BA 4WBJA 5IO2A 3H4KA 2JU5A 3DKSA 4AKGA 3P90A 3H93A 4RQRA 3ZLPA 5L71A 5EPFA 1FW1A 5IMDA 5HR1A 3DYRA 3MIXA 3D22A 3IC4A 1B9XC 3LW9A 1K0AA 2D2ZA 2N5BA 4MDCA 3F6FA 3GA4A 4JRRA 2KP1A 3LWAA 4ILFA 1CQHA 4IS0A 1TJDA 2IIYA 2X8HA 1B4PA 2NBSA 2RM6A 4NWYA 3N9JA 4E8HA 1T4ZA 3CYNA 4BL7B 4USSA 4V1Ag 2M72A 1NW2A 3US3A 4ULXA 2R6KA 1FVJA 1GH2A 5LD0A 3UL3A 4KSMA 3U5RE 1JZDA 4TW5A 4KNDA 1XXUA 3FZ4A 1WOUA 2IPAA 1Z6MA 2O7KA 1FO5A 4MA9A 2OE1A 4KE3A 4N3ZA 3A3TA 5JWRB 4FH8A 2HSMA 2CVBA 2VD0A 1E6BA 1O8XA 1SYRA 1BQ7A 1JZWA 3TKPA 4D73A 2DJ3A 4IKHA 4QL7A 1F3BA 2C8UA 2O5VA 2B5XA 3IRAA 3G7JA 1AUCA 2C80A 1ERVA 3UOMA 1SVOA 3GSSA 3IR4A 2M80A 1U87A 5A4WA 5EY6A 3PGTA 4ECBA 4LMWA 6GSTA 3WYWA 2NVLA 4NAXA 2EIRA 4AKIA 1DUGA 4JZQA 4BWSA 4IJIA 1V98A 4MPFA 5KOXA 1F9MA 1LJRA 1GSSA 1K0OA 2MBTA 3D0ZA 1ERWA 2L6DA 4PUAA 6GSWA 3QPMA 4MZBA 1OC3A 3DIEA 1A23A 4MF7A 3UARA 4ZBBA 1G7OA 4MH3A 2FWEA 2MYGA 3DWVA 1EEJA 4G9HA 5ECSA 4EIQA 19GSA 1ZYPA 1XWBA 2B7KA 4GXZA 2AV4A 1V57A 1T00A 2B1KA 2Z9SA 4O92A 2MBSA 4EVMA 4K8MA 1GLPA 3WGDA 3FW2A 1FOHA 3IDVA 1SJ6A 2PVQA 3HKRA 4Q5NA 1RK4A 1S3DA 1AQWA 1V9WA 3Q19A 4IJ3A 2OBIA 2DMMA 3I9V2 2ON5A 2V1MA 4G2EA 2DJ2A 1FAAA 2H0HA 2MMZA 3J7Yb 2VM2A 3KD0A 2KOKA 4PNFA 1U88A 3C71A 5DAKB 1FB6A 1EOGA 1OC8A 1OC9B 2CVKA 2HRKB 2VCXA 4MMMA 5B8BA 2IL3A 2JSZA 3IPZA 2EIQA 2GZZA 1F6MC 5G5FA 3APOA 2FWGA 4MJAA 4W66A 5CRDA 3PR8A 4NMUA 4BVXB 2C4JA 6GSUA 4BVYA 1PN9A 4IP6A 5FWGA 4TR4A 2O8VB 2DBCA 4PQIA 1ZOFA 3WT2A 5AIVA 1VF4A 3FY7A 2C0EA 1YY7A 3IHQA 4MPGA 1YEXA 4HU9A 22GSA 3LXTA 1ACVA 1VRSD 5CRWA 3HZ8A 1K0CA 1IYIA 3DVXA 5COHA 4ZXGA 8GSSA 3CRTA 5CAXA 2YJHA 3NOFA 1GUHA 2X64A 2VL9A 1M0UA 1EV4A 2K6VA 5ECMB 4HS1A 4LMVA 2JZTA 1QGVA 4BPYA 4AF2A 1W4VA 3ZITA 2QA2A 3GL3A 3FR6A 3GRXA 1K0NA 4TXVA 5A4VA 4AKXB 1SENA 3TRPA 3Q18A 3GYKA 2ZNMA 1M2BA 2WCIA 1A2MA 3CSHA 5IQYA 4MJCA 2V6OA 1AW9A 4YQUA 2VM1A 5INYA 2WS2A 1GP1A 2C1YA 1G6YA 3HXSA 5BRTA 3H79A 5D96A 2G2QA 1B4QA 3F4SA 2OADA 2RM5A 4POMA 3IE3A 1T4YA 2HRNA 4ZL8A 4G01A 2QA1A 1TI3A 4K7NA 2MMAA 3HJPA 1K0MA 3ERGA 3QFBC 4NV5A 2FD3A 1TP9A 1QUWA 5IMFA 4QMKA 5J40A 3HA9A 3LEFA 9GSSA 2HZEA 2OJLA 3V1WA 3TCOA 5DQSA 1X9MB 2K9FA 3HVVA 3O3TA 1YEPA 2L4QA 3BCIA 5AN1A 5ID2B 4JEDA 2R4VA 3KGKA 1X5DA 4V2LA 3ZIVA 3CSJA 1ZGNA 1CQGA 1GLQA 3I43A 1U3IA 3L0HA 5LNKe 4E68A 1GRXA 1A24A 1PX7A 2LUSA 1TK5B 2A4HA 2H1BA 4G0LA 2I4AA 3D4TA 3ED3A 3P2AA 3GH9A 1EEMA 3TGZA 4Q5RA 3GNJA 2DLXA 2NPBA 1HD2A 1KNGA 2GTUA 4TR3A 4PNGA 2GLRA 1M2DA 1XVWA 2E2MA 1ABAA 4K9ZA 3ZL5A 2DC5A 4DSSB 2LNSA 4J2FA 2CV4A 2VLTA 2IMEA 5CRHA 4RI6A 5CNWA 1DE1A 1GSFA 2DKHA 2C3QA 1NHYA 5IOWA 4YQMA 3F9UA 2HSNA 4ZBDA 2H0IA 2H76A 2HT9A 1LBKA 1A8YA 1EP7A 12GSA 1T7PB 1USBA 3H1NA 4K2DA 1ILOA 4TXOA 3L9VA 3A5IA 2I81A 6GSXA 4KX4A 3VWXA 1SJIA 2HZFA 4N0ZA 2H1DA 1Y6EA 3VI7A 3HVXA 4O5UA 4TR0A 3HYPA 4IQAA 2H0GA 1OE7A 1TDIA 1OE8A 2NDOA 3G7IA 3QOUA 3F3RA 3W8JA 3ZIJA 1JZOA 2MMOA 1SK1A 1MEKA 5BMUA 3KTLA 4EXJA 3EMPA 3DGQA 3J7Yk 1XWCA 2AB6A 2VCWA 4G10A 3BJ5A 4IN0A 5ECKB 2ALBA 2UZ8A 5A5HA 4EUYA 2RIIA 3A5WA 2YOIA 3BD2A 2GZYA 4KSOA 4MLYA 3KIJA 4A5PA 3QAWA 2B5EA 4V2NA 1WP0A 5G5EA 5D73A 5HFKA 2CAQA 4ACSA 4EIPA 2VLVA 3GTUA 1BEDA 5EL8A 3CXGA 2FNOA 2CT6A 5CO3A 3TDGA 4MP4A 4WF4A 1V58A 2PMTA 1GSYA 5KEJA 4XS1A 1PL1A 3HY2A 5J9CA 1DBYA 2X8GA 5D9VA 2H75A 3ZFBA 1AC1A 4IQ1A 1DSBA 3GV1A 3UJ1A 5H5SA 1EOHA 3ME7A 1F3AA 3HZ4A 2XBIA 1PX6A 5D9TA 5DVBA 4GSSA 3VPTA 1XW6A 1YQ1A 4F03A 1TXXA 3GKNA 3ME8A 3PPUA 4K7IA 3H8QA 5G30A 4MF6A 4ZL9A 5HR0A 2HRFA 2AJQB 1SKRB 5J47A 3TKSA 5ENUA 1B8XA 2YNXA 1GSQA 4GTUA 3EU4A 3TUEA 6GSSA 5J41A 1WE0A 1LU4A 3APQA 1THOA 2LJRA 1EGOA 2F9SA 1YF1A 1IYHA 1ERTA 2B7JA 3UAPA 4POBA 5IMAA 3D5JA 4TR1B 4XRDA 4CY8A 2J9HA 2ON7A 3M1GA 4WXTA 2X4AA 2QC7A 3GMFA 3IK7A 1SJZA 4L0UA 1R5PA 4O7HA 1O6JA 4Z2UA 1QXHA 5GAPD 1XOBA 4HUAA 4N10A 3GUSA 3RPPA 1THXA 3D6IA 5J4YA 1V2AA 2GT6A 3GX0A 1ZMAA 2HXKA 4K0GA 4AJ7A 5IPHA 4IVFA 2H1GA 4NV2A 4DSRA 1PKZA 1XOAA 3ZRDA 2O87A 3BBYA 2LRNA 7GSSA 4IHUA 4ZIJA 2H6YA 1PA3A 2TRCP 3EYTA 5A34B 1XW9A 3KEBA 3EURA 1EZKA 5DCGA 2NTOA 3ZVJD 5A1NB 2ES7A 5DALB 3IV4A 3KMNA 5CP1A 5HFIA 2CZ2A 4AJ8A 1SL1B 1MDJA 2GQKA 2CX4A 3OR5A 1TOFA 1X5CA 5KOWA 1X0RA 1I5GA 2I9HA 3UBKA 3VWWA 1TTZA 4LL4B 4XS4B 1Z7RA 1ON4A 4IGJA 4ZB9A 3TKSC 4PUFC 3RDWA 3WT1A 3M9JA 4IBPA 3EVIA 5F05A 4K5SA 5B6NA 4CY6A 4GLTA 1K3OA 1XIYA 5B6MA 5D9WA 2WDUA 4ID0A 3LJRA 3ZZXA 1K0BA 2H01A 4MK3A 1JLVA 2C3TA 1TW9A 1C72A 2GT5A 2YWIA 1JLWA 1JHBA 2LQQA 1GL8A 2AHEA 3LORA 2AAWA 3KZQA 4V1Ap 1K0DA 4K5RA 2CA8A 1T1VA 2FA8A 4J57E 1QQ2A 3IHGA 5JCUA 2LEGA 5GAND 4G0IA 1BF5A 1SKSB 1SVLA 3VK9A 2C3NA 1HNAA 2PERA 4I2UA 5KN1A 4XCSA 2CAIA 2YP6A 4HEA2 3VI5A 3ZTLA 2KLXA 2OACA 2YWNA 2B3SA 3HHVA 1SD8A 3TKSE 1UN2A 1F2EA 5DJMA 2EC4A 3G7YA 2XC2A 4ZILA 4POKA 2WRTA 2WB9A 4DSQA 4POLA 3WGXA 4V2MA 5J4VA 4IP1A 2HE3A 4F9ZA 4OO5A 1F37A 3LYKA 2P5QA 4TOPA 2L4CA 1OVNA 3KH9A 4NPBA 2EFEA 1E2YA 2VAFA 2OT3A 4KH7A 3F4RA 5J5NA 5DAKA 1ZYQB 2ZCTA 2OKAA 2H30A 1SK0A 2HRKA 4HDEA 2RUFA 2FGXA 2DSAA 2VOCA 2L5LA 1B9YC 4AJ6A 1GSUA 3SBCA 2XPEA 5ECLB 4ECCA 3R2QA 3NIVA 4BVXA 2C0DA 4PX1A 4CW9A 2HNLA 3R3EA 1GULA 5GZZB 4FYUA 6GSVA 2TRXA 4KAEA 4ECJA 4RUVA 1EWXA 1G6WA 1TRUA 4NXIA 4JR6A 1EP8A 2IN3A 2PN8A 3GKMA 1XWGA 3MNGA 4GSNA 1J9BA 2LSTA 3APSA 3M9KA 5ELGA 5FT3A 3HMJG 2PBJA 2HFDA 4EDZA 20GSA 1AXDA 2RLIA 5F8BA 1B48A 1SL0B 3EINA 5CRGA 4HQZA 5J3RA 4J56E 2GSRA 5C04A 2I1UA 4DEJA 3TOUA 1A2LA 4TKYA 2H8LA 1OKDA 4ICYA 2BMXA 5D9XA 1I9DA 4HJ2A 4RQXA 4ZB7A 4PGTA 5H5QA 3RHBA 3TJBA 1H4OA 3L9UA 4KB3A 3FEUA 3C7MA 4Q5FA 3TJGA 3LFLA 1JZRA 4YKGA 4WKWA 2BJXA 4OCFA 4MNNA 1ZYNA 4OFNA 1M9AA 1NM3A 2CX3A 1FOVA 2YN1A 2PVOC 2N5FA 4E8EA 3BOAA 1MDIA 2VIMA 2YWMA 2H71A 4GQFA 2HQTA 3NZNA 2F8AA 2A2RA 3QDNA 2GSSA 1A8LA 5D8IA 3JCML 2K8SA 16GSA 1AQVA 1XWKA 4GRFA 1VF1A 2IFQB 2CZ3A 4JE1A 2PU9C 4N0VA 4X0XA 2N5AA 1R7HA 5IIZA 1G7EA 1PN0A 3EE2A 3QCPA 2HSNB 3KJYA 2QKEA 3A2XA 3WD6A 4GDFA 2AYTA 4FQUA 1X9WB 2O85A 5ECRB 4MJEA 5B7CA 2FUG2 4AGSA 4TN8A 1BG5A 4X4JA 2KHPA 4K0NA 3O6TA 5JCGA 2DKIA 3P8WA 1BX9A 2LQOA 1SKWB 4OD7A 11GSA 3WGEA 4DSSA 1TU7A 3RAZA 3IA1A 3EC3A 1BYEA 2EFCA 4L8EA 2PGTA 3QFAC 3LYPA 2IMDA 1N8JA 3DEXA 1ST9A 1UC7A 2UV8G 4O32A 3A2WA 5A4UA 5IO0A 3W8SA 1JFUA 5IMVA 1GTAA 1TRVA 2CQ9A 2LNTA 2O89A 5BMUB 1YJ6A 3ZVJA 1TRWA 5H5RA 2VCZA 1YKAA 3KP8A 3IC8A 1O8WA 3RPNA 2VLUA 1GUKA 2VL2A 1XZOA 2VO4A 3GL5A 1UA5A 2PWJA 2X49A 3RHCA 3ZFLA 1R26A 5AISA 3P7XA 4XIHA 1AAZA 2G0FA 3DVWA 4WBRD 4ML6A 5JWQB 5HFGA 3AY8A 4ZB6A 1NHOA 2H72A 2A4VA 1M99A 4OMVA 3FZAA 2R3XA 3VWUA 5IOXA 1TXUA 4I6XA 3ISOA 5ECIB 2YPMA 1Q4JA 3HJOA 3IAM2 3FK8A 2PUKC 2F3MA 5HR3A 3GIXA 3VLNA 2ZUPA 3EU3A 1OYJA 2GSQA 3FRCA 5F07A 4Z7XA 3N5OA 3CRUA 3G9BA 2QSIA 3TB2A 1K3LA 3FMWA 2FWFA 3UEMA 1SYXA 4PURA 1VF3A 1X5EA 3VURA 4JR4A 2H70A 1VF2A 4NHWA 1VGLA 4O5RA 2DJJA 4GWRA 2YV9A 4F82A 4BA7A 1V40A 2E7PA 4CDOA 5KN2A 1MD3A 3VWVA 3F3QA 5DQYA 3LG6A 1ZYEA 4WR5A 4Q5QA 2KUCA 5HR2A 1U3AA 3IOSA 2H66A 1MDKA 3FZ5A 4KDUA 4H86A 3CWGA 3GH6A 4X43A 3M0FA 5G1KA 4FYCA 5ECNB 2FLSA 2H6ZA 2IJYA 1GSDA 1M2AA 2GDRA 3LXZA 1TRSA 2HI7A 3C8EA 3D4MA 1A2JA 3VPQA 5JWOB 2WGRA 3EPTA 2VD1A 1AIUA 4LA1A 2LTKA 4HJMA 2L6CA 5ELAA 3GFKA 2VL2C 3GX8A 5E4WA 2K8VA 4QL9A 3M3MA 2DJ1A 5ECPB 2FY6A 3E3EA 1WWJA 4KUNA 4L0WA 3F8UA 3KCMA 1OAZA 1XCCA 4TR1A 2K18A 1WJKA 2GZPA 2WULA 3EWLA 3IAS2 3KH7A 4PTSA 4ECIA 1GTIA 1MD4A 2A2SA 1URMA 4KW6A 5AGYA 2HSMB 3KTBA 5AIXA 2R0PA 4D73B 4FIWA 2H1AA 2E0QA 2R37A 1YKCA 3TJFA 4ZB8A 3UVHA 3TKRA 3HDCA 2VKZG 2X8CA 4MCUA 2B5YA 1FVKA 5HQPA 3I6AA 4BL7A 5DDLA 2C0FA 2GS3A 5DCHA 1FHEA 4IW9A 3C1RA 3A2VA 1HNBA 3LGCA 1HQOA 1O85A 1PKWA 5CREA 5DJLA 5A34A 4FYBA 1BG1A 5JCWA 2WFCA 4LL1B 4HZ4A 1ERUA 3S9FA 2OBKA 3EMXA 2BTOT 5A1NA 5DALA 2GSTA 4MABA 4YAVA 1R5AA 1Z5YE 2PPTA 2H1LA 4FO5A 1R4WA 3GKKA 4YKFA 3DD3A 6GSYA 1SD9A 4ISDA 3MWHA 1KEBA 3ZMLA 2LJAA 4HOJA 3TKQA 1T8EB 2IMIA 4XS4A 1EV9A 3I69A 2L59A 1WIKA 4GSTA 1S3CA 4XTSA 1AQXA 5CYYA 5GSTA 2KP2A 2EIOA 2V41A 2HSYA 3PH9A 2VCQA 3L78A 1XVQA 1TK0B 1XPVA 2FA4A 3FZ9A 1EGRA 2YZHA 4L5OA 4OWYA 4BWQA 2V2GA 3F0IA 3HCZA 3IBHA 5GSSA 4N30A 3TJKA 1GNEA 1A0RP 1NSWA 1Y25A 1MTCA 4CHSA 4K2XA 4EF0A 2DJKA 3MAKA 1ZCPA 3SWLA 4EL1A 2EFDA 3CSIA 2DIZA 4K7OA 4K1FA 3MYDA 4JU5A 1PQNA 3DXBA 2JSYA 2R0CA 1WRYA 3QR6A 5IPGA 3HD5A 1A0FA 4KGIA 1XBSA 2JACA 4XS6A 4G19A 2RUEA 1N2AA 3FKFA 5IM9A 1BJXA 4BVYB 3HVSA 4WEYA 1BAYA 4KF9A 5E59A 1H75A 4I8BA 2GQLA 3TRQA 3O76A 3LSZA 1QK8A 1K3YA 2QGVA 1N25A 5ECHB 3QAVA 4PXOA 1OC9A 1TK8B 1PMTA 4HU7A 2LRTA 1XWAA 5F0GA 2GGTA 1HNCA 2V32A 1Z6NA 1FG4A 2DJ0A 1PRXA 14GSA 2YJ7A 4GQCA 2VCVA 4O5QA 3QD9A 2HLSA 2C0GA 1ML6A 2B1LA 4YAPA 4PQ1A 18GSA 2R2JA 2I3YA 2CVDA 2H73A 4EKZA 4QQ7A 4MZCA 3FHKA 5J9BA 3ZREA 1PD21 1O73A 1Z9HA 4WR4A 4YH2A 5A5KA 4I5QA 4I97A 5IMCA 2LV3A 4GCIA 3MDKA 1T3BA 5ABRA 3TJJA 3CTFA 5ECOB 2VUPA 2L57A 4OO4A 4EDYA 3GSTA 1SK2A 4N11A 2YCDA 3HJMA 2YANA 3Q6OA 3IK9A 1KTEA 3TU3B 2LKUA 1TKDB 2HZEB 4K6XA 1QFNA 4I2TA 3ERFA 5G2ZA 1ZZYA 1YDKA 2A2PA 4Z2RA 4P3YB 4HQSA 2OA7A 3K8NA 4F0BA 3GURA 3TOTA 4OFMA 2FWHA 2YV7A 1WMJA 1O81A 2IWTA 4OCEA 1YZXA 3FR3A 4RI7A 1HYUA 1RQMA 17GSA 3GN3A 1J08A 1M7TA 3FR9A 4MF5A 2JZRA 4MZWA 5D93A 2TIRA 1TI1A 1UVZA 4AI6A 3UVTA 5ID2A 4PQHA 3KP9A 2JADA 1GWCA 3U6VA 3MSZA 3CBUA 3UMAA 2H6XA 2REMA 3BCKA 2IMFA 4KA0A 2M46A 1Q98A 2YZUA 1WPIA 3GHAA 3F6DA 4DVCA 5J4UA 3TRXA 5KN3A 1KBNA 1X9SB 2P31A 1GSEA 1OKTA 3M8NA 5LCZA 3E0UA 4LLRA 4ML1A 5KN0A 4OFTA 5B8AA 5DBQA 2R5GA 3FYGA 2IFQA 4KCEA 3KXOA 3LQ7A 4AKHA 3DRNA 4TXOB 3ERWA 1W89A 5G31A 3W6GA 2FHEA 3QAGA 5ECQB 4IELA 2P0GA 2DMLA 1U6TA 4XRAA 2J23A 1SVMA 1PSQA 2XBQA 2XHFA 2AUVA 3F63A 2DIYA 4TVEA 4HZ2A 4JBBA 4EO3A 4Z2TA 3D21A 1Y1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVO A;  3C1S A;  4XHM A;  1J0F A;  2P5R A;  1GTU A;  3L9S A;  2XPD A;  1QMV A;  1Z7P A;  4KDY A;  10GS A;  4MJB A;  2V6K A;  2YWO A;  3PIN A;  2B6M A;  2WJU A;  1ZL9 A;  2OE0 A;  4YQV A;  1PL2 A;  4F0C A;  3DML A;  4ZL7 A;  2H74 A;  3VFI A;  4G0K A;  2HRA A;  2JL4 A;  1SU9 A;  2F51 A;  1GUM A;  13GS A;  1XFL A;  4EE0 A;  3GTU B;  3E9J B;  1RW1 A;  2LS5 A;  4F2I A;  4EC0 A;  2IMK A;  1YF0 A;  2L5O A;  3GKX A;  2F8F A;  4GF0 A;  2WZ9 A;  4TRX A;  2VL3 A;  4L5L A;  4KCA A;  1S3A A;  3CTG A;  3UIW A;  2JZS A;  5IMZ A;  3IXR A;  5C00 A;  3QMX A;  2H19 A;  2MMN A;  3UBL A;  2GQM A;  1G0T A;  2E2G A;  2HYX A;  1FB0 A;  2FCH A;  4X1U A;  2LJK A;  2VCT A;  1SL2 B;  4NHZ A;  4ZBA A;  3L4N A;  2HSH A;  2OE3 A;  1GTB A;  3KM6 A;  1O7U A;  3KMO A;  4MH2 A;  3ZMK A;  2LRC A;  3C73 A;  1Z3E A;  4HI7 A;  2MZC A;  1PGT A;  5F06 A;  4KDX A;  5FHI A;  4WET A;  3F4T A;  4WF5 A;  1XW5 A;  3RBT A;  3Q74 A;  3CMI A;  2GVP A;  3ZYW A;  1DE2 A;  1GNW A;  2X99 A;  1TU8 A;  5G1L A;  1M9B A;  4WBJ A;  5IO2 A;  3H4K A;  2JU5 A;  3DKS A;  3P90 A;  3H93 A;  4RQR A;  3ZLP A;  5L71 A;  5EPF A;  1FW1 A;  5IMD A;  5HR1 A;  3DYR A;  3D22 A;  3IC4 A;  1B9X C;  1K0A A;  2D2Z A;  2N5B A;  4MDC A;  3F6F A;  3GA4 A;  4JRR A;  2KP1 A;  3LWA A;  4ILF A;  1CQH A;  4IS0 A;  1TJD A;  2IIY A;  2X8H A;  1B4P A;  2NBS A;  2RM6 A;  4NWY A;  3N9J A;  4E8H A;  1T4Z A;  3CYN A;  4BL7 B;  4USS A;  4V1A g;  2M72 A;  1NW2 A;  3US3 A;  4ULX A;  2R6K A;  1FVJ A;  1GH2 A;  5LD0 A;  3UL3 A;  4KSM A;  3U5R E;  1JZD A;  4TW5 A;  4KND A;  1XXU A;  3FZ4 A;  1WOU A;  2IPA A;  1Z6M A;  2O7K A;  1FO5 A;  4MA9 A;  2OE1 A;  4KE3 A;  3A3T A;  5JWR B;  4FH8 A;  2HSM A;  2CVB A;  2VD0 A;  1E6B A;  1O8X A;  1SYR A;  1BQ7 A;  1JZW A;  3TKP A;  4D73 A;  2DJ3 A;  4IKH A;  4QL7 A;  1F3B A;  2C8U A;  2B5X A;  3IRA A;  3G7J A;  1AUC A;  2C80 A;  1ERV A;  3UOM A;  3GSS A;  3IR4 A;  2M80 A;  1U87 A;  5A4W A;  5EY6 A;  3PGT A;  4ECB A;  4LMW A;  6GST A;  3WYW A;  2NVL A;  4NAX A;  2EIR A;  1DUG A;  4JZQ A;  4BWS A;  4IJI A;  1V98 A;  4MPF A;  1F9M A;  1LJR A;  1GSS A;  1K0O A;  2MBT A;  3D0Z A;  1ERW A;  2L6D A;  4PUA A;  6GSW A;  3QPM A;  4MZB A;  1OC3 A;  3DIE A;  1A23 A;  4MF7 A;  3UAR A;  4ZBB A;  1G7O A;  4MH3 A;  2FWE A;  2MYG A;  3DWV A;  1EEJ A;  4G9H A;  5ECS A;  19GS A;  1XWB A;  2B7K A;  4GXZ A;  2AV4 A;  1V57 A;  1T00 A;  2B1K A;  2Z9S A;  4O92 A;  2MBS A;  4EVM A;  4K8M A;  1GLP A;  3WGD A;  3FW2 A;  3IDV A;  1SJ6 A;  2PVQ A;  3HKR A;  4Q5N A;  1RK4 A;  1S3D A;  1AQW A;  1V9W A;  3Q19 A;  4IJ3 A;  2OBI A;  2DMM A;  3I9V 2;  2ON5 A;  2V1M A;  4G2E A;  2DJ2 A;  1FAA A;  2H0H A;  2MMZ A;  3J7Y b;  2VM2 A;  3KD0 A;  2KOK A;  4PNF A;  1U88 A;  3C71 A;  5DAK B;  1FB6 A;  1EOG A;  1OC8 A;  1OC9 B;  2CVK A;  2HRK B;  2VCX A;  4MMM A;  5B8B A;  2IL3 A;  2JSZ A;  3IPZ A;  2EIQ A;  2GZZ A;  1F6M C;  5G5F A;  3APO A;  2FWG A;  4MJA A;  5CRD A;  3PR8 A;  4NMU A;  4BVX B;  2C4J A;  6GSU A;  4BVY A;  1PN9 A;  4IP6 A;  5FWG A;  4TR4 A;  2O8V B;  2DBC A;  4PQI A;  1ZOF A;  3WT2 A;  5AIV A;  1VF4 A;  3FY7 A;  2C0E A;  1YY7 A;  3IHQ A;  4MPG A;  1YEX A;  4HU9 A;  22GS A;  3LXT A;  1ACV A;  1VRS D;  5CRW A;  3HZ8 A;  1K0C A;  1IYI A;  3DVX A;  5COH A;  4ZXG A;  8GSS A;  3CRT A;  5CAX A;  2YJH A;  3NOF A;  1GUH A;  2X64 A;  2VL9 A;  1M0U A;  1EV4 A;  2K6V A;  5ECM B;  4HS1 A;  4LMV A;  2JZT A;  1QGV A;  4BPY A;  4AF2 A;  1W4V A;  3ZIT A;  3GL3 A;  3FR6 A;  3GRX A;  1K0N A;  4TXV A;  5A4V A;  1SEN A;  3TRP A;  3Q18 A;  3GYK A;  2ZNM A;  1M2B A;  2WCI A;  1A2M A;  3CSH A;  5IQY A;  4MJC A;  2V6O A;  1AW9 A;  4YQU A;  2VM1 A;  5INY A;  2WS2 A;  1GP1 A;  2C1Y A;  1G6Y A;  3HXS A;  3H79 A;  5D96 A;  2G2Q A;  1B4Q A;  3F4S A;  2OAD A;  2RM5 A;  4POM A;  3IE3 A;  1T4Y A;  2HRN A;  4ZL8 A;  1TI3 A;  4K7N A;  2MMA A;  3HJP A;  1K0M A;  3ERG A;  3QFB C;  4NV5 A;  2FD3 A;  1TP9 A;  1QUW A;  5IMF A;  3HA9 A;  3LEF A;  9GSS A;  2HZE A;  2OJL A;  3V1W A;  3TCO A;  5DQS A;  1X9M B;  2K9F A;  3HVV A;  3O3T A;  1YEP A;  2L4Q A;  3BCI A;  5AN1 A;  5ID2 B;  4JED A;  2R4V A;  3KGK A;  1X5D A;  4V2L A;  3ZIV A;  3CSJ A;  1ZGN A;  1CQG A;  1GLQ A;  3I43 A;  1U3I A;  3L0H A;  5LNK e;  1GRX A;  1A24 A;  1PX7 A;  2LUS A;  1TK5 B;  2H1B A;  4G0L A;  2I4A A;  3D4T A;  3ED3 A;  3P2A A;  3GH9 A;  1EEM A;  3TGZ A;  4Q5R A;  3GNJ A;  2DLX A;  2NPB A;  1HD2 A;  1KNG A;  2GTU A;  4TR3 A;  4PNG A;  2GLR A;  1M2D A;  1XVW A;  2E2M A;  1ABA A;  4K9Z A;  3ZL5 A;  2DC5 A;  4DSS B;  2LNS A;  4J2F A;  2CV4 A;  2VLT A;  2IME A;  5CRH A;  4RI6 A;  5CNW A;  1DE1 A;  1GSF A;  2C3Q A;  1NHY A;  5IOW A;  4YQM A;  3F9U A;  4ZBD A;  2H0I A;  2H76 A;  2HT9 A;  1LBK A;  1A8Y A;  1EP7 A;  12GS A;  1T7P B;  1USB A;  3H1N A;  4K2D A;  1ILO A;  4TXO A;  3L9V A;  2I81 A;  6GSX A;  4KX4 A;  3VWX A;  1SJI A;  2HZF A;  4N0Z A;  2H1D A;  1Y6E A;  3VI7 A;  3HVX A;  4TR0 A;  3HYP A;  4IQA A;  2H0G A;  1OE7 A;  1TDI A;  1OE8 A;  2NDO A;  3G7I A;  3QOU A;  3F3R A;  3W8J A;  3ZIJ A;  1JZO A;  2MMO A;  1SK1 A;  1MEK A;  5BMU A;  3KTL A;  4EXJ A;  3EMP A;  3DGQ A;  3J7Y k;  1XWC A;  2AB6 A;  2VCW A;  4G10 A;  3BJ5 A;  4IN0 A;  5ECK B;  2ALB A;  2UZ8 A;  4EUY A;  2RII A;  3A5W A;  2YOI A;  3BD2 A;  2GZY A;  4KSO A;  4MLY A;  3KIJ A;  3QAW A;  2B5E A;  4V2N A;  1WP0 A;  5G5E A;  5D73 A;  5HFK A;  2CAQ A;  4ACS A;  2VLV A;  3GTU A;  1BED A;  5EL8 A;  3CXG A;  2FNO A;  2CT6 A;  5CO3 A;  3TDG A;  4MP4 A;  4WF4 A;  1V58 A;  2PMT A;  1GSY A;  5KEJ A;  4XS1 A;  1PL1 A;  3HY2 A;  5J9C A;  1DBY A;  2X8G A;  5D9V A;  2H75 A;  3ZFB A;  1AC1 A;  4IQ1 A;  1DSB A;  3GV1 A;  3UJ1 A;  5H5S A;  1EOH A;  3ME7 A;  1F3A A;  3HZ4 A;  2XBI A;  1PX6 A;  5D9T A;  5DVB A;  4GSS A;  3VPT A;  1XW6 A;  1YQ1 A;  4F03 A;  1TXX A;  3GKN A;  3ME8 A;  4K7I A;  3PPU A;  3H8Q A;  5G30 A;  4MF6 A;  4ZL9 A;  5HR0 A;  2HRF A;  2AJQ B;  1SKR B;  3TKS A;  5ENU A;  1B8X A;  2YNX A;  1GSQ A;  4GTU A;  3EU4 A;  3TUE A;  6GSS A;  5J41 A;  1WE0 A;  1LU4 A;  3APQ A;  1THO A;  2LJR A;  1EGO A;  2F9S A;  1YF1 A;  1IYH A;  1ERT A;  2B7J A;  3UAP A;  4POB A;  5IMA A;  3D5J A;  4TR1 B;  4XRD A;  2J9H A;  2ON7 A;  3M1G A;  4WXT A;  2QC7 A;  3GMF A;  3IK7 A;  1SJZ A;  4L0U A;  1R5P A;  4O7H A;  1O6J A;  1QXH A;  5GAP D;  1XOB A;  4HUA A;  4N10 A;  3GUS A;  3RPP A;  1THX A;  3D6I A;  1V2A A;  2GT6 A;  3GX0 A;  1ZMA A;  2HXK A;  4K0G A;  4AJ7 A;  5IPH A;  4IVF A;  2H1G A;  4NV2 A;  4DSR A;  1PKZ A;  1XOA A;  3ZRD A;  2O87 A;  3BBY A;  2LRN A;  7GSS A;  4IHU A;  4ZIJ A;  2H6Y A;  1PA3 A;  2TRC P;  3EYT A;  1XW9 A;  3KEB A;  3EUR A;  1EZK A;  5DCG A;  2NTO A;  3ZVJ D;  2ES7 A;  5DAL B;  3IV4 A;  3KMN A;  5CP1 A;  5HFI A;  2CZ2 A;  4AJ8 A;  1SL1 B;  1MDJ A;  2GQK A;  2CX4 A;  3OR5 A;  1TOF A;  1X5C A;  1X0R A;  1I5G A;  2I9H A;  3UBK A;  3VWW A;  1TTZ A;  4LL4 B;  4XS4 B;  1Z7R A;  1ON4 A;  4IGJ A;  4ZB9 A;  3TKS C;  4PUF C;  3RDW A;  3WT1 A;  3M9J A;  4IBP A;  3EVI A;  5F05 A;  5B6N A;  4GLT A;  1K3O A;  1XIY A;  5B6M A;  5D9W A;  2WDU A;  4ID0 A;  3LJR A;  3ZZX A;  1K0B A;  2H01 A;  4MK3 A;  1JLV A;  2C3T A;  1TW9 A;  1C72 A;  2GT5 A;  2YWI A;  1JLW A;  1JHB A;  2LQQ A;  1GL8 A;  2AHE A;  3LOR A;  2AAW A;  3KZQ A;  4V1A p;  1K0D A;  2CA8 A;  1T1V A;  2FA8 A;  4J57 E;  1QQ2 A;  5JCU A;  2LEG A;  5GAN D;  4G0I A;  1SKS B;  3VK9 A;  2C3N A;  1HNA A;  2PER A;  4I2U A;  5KN1 A;  4XCS A;  2CAI A;  2YP6 A;  4HEA 2;  3VI5 A;  3ZTL A;  2KLX A;  2OAC A;  2YWN A;  2B3S A;  3HHV A;  1SD8 A;  3TKS E;  1UN2 A;  1F2E A;  5DJM A;  2EC4 A;  3G7Y A;  2XC2 A;  4ZIL A;  4POK A;  2WRT A;  2WB9 A;  4DSQ A;  4POL A;  3WGX A;  4V2M A;  4IP1 A;  2HE3 A;  4F9Z A;  4OO5 A;  1F37 A;  3LYK A;  2P5Q A;  4TOP A;  2L4C A;  1OVN A;  3KH9 A;  4NPB A;  1E2Y A;  2VAF A;  4KH7 A;  3F4R A;  5J5N A;  5DAK A;  1ZYQ B;  2ZCT A;  2OKA A;  2H30 A;  1SK0 A;  2HRK A;  4HDE A;  2RUF A;  2FGX A;  2DSA A;  2VOC A;  2L5L A;  1B9Y C;  4AJ6 A;  1GSU A;  3SBC A;  2XPE A;  5ECL B;  4ECC A;  3R2Q A;  3NIV A;  4BVX A;  2C0D A;  4PX1 A;  4CW9 A;  2HNL A;  3R3E A;  1GUL A;  5GZZ B;  4FYU A;  6GSV A;  2TRX A;  4KAE A;  4ECJ A;  4RUV A;  1EWX A;  1G6W A;  1TRU A;  4NXI A;  4JR6 A;  1EP8 A;  2IN3 A;  2PN8 A;  3GKM A;  1XWG A;  3MNG A;  4GSN A;  1J9B A;  2LST A;  3APS A;  3M9K A;  5ELG A;  5FT3 A;  2PBJ A;  2HFD A;  4EDZ A;  20GS A;  1AXD A;  2RLI A;  5F8B A;  1B48 A;  1SL0 B;  3EIN A;  5CRG A;  4HQZ A;  5J3R A;  4J56 E;  2GSR A;  5C04 A;  2I1U A;  4DEJ A;  3TOU A;  1A2L A;  4TKY A;  2H8L A;  1OKD A;  2BMX A;  5D9X A;  1I9D A;  4HJ2 A;  4RQX A;  4PGT A;  5H5Q A;  3RHB A;  3TJB A;  1H4O A;  3L9U A;  4KB3 A;  3FEU A;  3C7M A;  4Q5F A;  3TJG A;  3LFL A;  1JZR A;  4WKW A;  2BJX A;  4OCF A;  4OFN A;  1M9A A;  1NM3 A;  2CX3 A;  1FOV A;  2YN1 A;  2PVO C;  2N5F A;  4E8E A;  3BOA A;  1MDI A;  2VIM A;  2YWM A;  2H71 A;  4GQF A;  2HQT A;  3NZN A;  2F8A A;  2A2R A;  3QDN A;  2GSS A;  1A8L A;  5D8I A;  3JCM L;  2K8S A;  16GS A;  1AQV A;  1XWK A;  4GRF A;  1VF1 A;  2IFQ B;  2CZ3 A;  4JE1 A;  2PU9 C;  4N0V A;  4X0X A;  2N5A A;  1R7H A;  5IIZ A;  1G7E A;  3EE2 A;  3QCP A;  2HSN B;  3KJY A;  2QKE A;  3A2X A;  3WD6 A;  2AYT A;  4FQU A;  1X9W B;  2O85 A;  5ECR B;  4MJE A;  5B7C A;  2FUG 2;  4AGS A;  4TN8 A;  1BG5 A;  2KHP A;  4K0N A;  3O6T A;  5JCG A;  3P8W A;  1BX9 A;  2LQO A;  1SKW B;  4OD7 A;  11GS A;  3WGE A;  4DSS A;  1TU7 A;  3RAZ A;  3IA1 A;  3EC3 A;  1BYE A;  4L8E A;  2PGT A;  3QFA C;  3LYP A;  2IMD A;  1N8J A;  3DEX A;  1ST9 A;  1UC7 A;  4O32 A;  3A2W A;  5A4U A;  5IO0 A;  3W8S A;  1JFU A;  5IMV A;  1GTA A;  1TRV A;  2CQ9 A;  2LNT A;  2O89 A;  1YJ6 A;  3ZVJ A;  1TRW A;  5H5R A;  2VCZ A;  1YKA A;  3KP8 A;  3IC8 A;  1O8W A;  3RPN A;  2VLU A;  1GUK A;  2VL2 A;  1XZO A;  2VO4 A;  3GL5 A;  1UA5 A;  2PWJ A;  3RHC A;  3ZFL A;  1R26 A;  5AIS A;  3P7X A;  4XIH A;  1AAZ A;  2G0F A;  3DVW A;  4WBR D;  4ML6 A;  5JWQ B;  5HFG A;  3AY8 A;  4ZB6 A;  1NHO A;  2H72 A;  2A4V A;  1M99 A;  4OMV A;  3FZA A;  2R3X A;  3VWU A;  5IOX A;  4I6X A;  3ISO A;  5ECI B;  2YPM A;  1Q4J A;  3HJO A;  3IAM 2;  3FK8 A;  2PUK C;  2F3M A;  5HR3 A;  3GIX A;  3VLN A;  2ZUP A;  3EU3 A;  1OYJ A;  2GSQ A;  3FRC A;  5F07 A;  4Z7X A;  3N5O A;  3CRU A;  3G9B A;  2QSI A;  3TB2 A;  1K3L A;  2FWF A;  3UEM A;  1SYX A;  4PUR A;  1VF3 A;  1X5E A;  4JR4 A;  3VUR A;  2H70 A;  1VF2 A;  4NHW A;  1VGL A;  4O5R A;  2DJJ A;  4GWR A;  2YV9 A;  4F82 A;  4BA7 A;  1V40 A;  2E7P A;  4CDO A;  5KN2 A;  1MD3 A;  3VWV A;  3F3Q A;  5DQY A;  3LG6 A;  1ZYE A;  4WR5 A;  4Q5Q A;  2KUC A;  5HR2 A;  1U3A A;  3IOS A;  2H66 A;  1MDK A;  3FZ5 A;  4KDU A;  4H86 A;  3GH6 A;  4X43 A;  3M0F A;  5G1K A;  4FYC A;  5ECN B;  2FLS A;  2H6Z A;  2IJY A;  1GSD A;  1M2A A;  2GDR A;  3LXZ A;  1TRS A;  2HI7 A;  3C8E A;  3D4M A;  1A2J A;  3VPQ A;  5JWO B;  2WGR A;  2VD1 A;  1AIU A;  4LA1 A;  2LTK A;  4HJM A;  2L6C A;  5ELA A;  3GFK A;  2VL2 C;  3GX8 A;  5E4W A;  2K8V A;  4QL9 A;  3M3M A;  2DJ1 A;  5ECP B;  2FY6 A;  3E3E A;  1WWJ A;  4KUN A;  4L0W A;  3F8U A;  3KCM A;  1OAZ A;  1XCC A;  4TR1 A;  2K18 A;  1WJK A;  2GZP A;  2WUL A;  3EWL A;  3IAS 2;  3KH7 A;  4PTS A;  4ECI A;  1GTI A;  1MD4 A;  2A2S A;  1URM A;  4KW6 A;  5AGY A;  2HSM B;  3KTB A;  5AIX A;  4D73 B;  4FIW A;  2H1A A;  2E0Q A;  2R37 A;  1YKC A;  3TJF A;  4ZB8 A;  3UVH A;  3TKR A;  3HDC A;  2X8C A;  4MCU A;  2B5Y A;  1FVK A;  5HQP A;  3I6A A;  4BL7 A;  5DDL A;  2C0F A;  2GS3 A;  5DCH A;  1FHE A;  4IW9 A;  3C1R A;  3A2V A;  1HNB A;  3LGC A;  1HQO A;  1O85 A;  1PKW A;  5CRE A;  5DJL A;  4FYB A;  5JCW A;  2WFC A;  4LL1 B;  4HZ4 A;  1ERU A;  3S9F A;  2OBK A;  3EMX A;  2BTO T;  5DAL A;  2GST A;  4MAB A;  4YAV A;  1R5A A;  1Z5Y E;  2PPT A;  4FO5 A;  1R4W A;  3GKK A;  3DD3 A;  6GSY A;  1SD9 A;  4ISD A;  3MWH A;  1KEB A;  3ZML A;  2LJA A;  4HOJ A;  3TKQ A;  1T8E B;  2IMI A;  4XS4 A;  1EV9 A;  3I69 A;  2L59 A;  1WIK A;  4GST A;  1S3C A;  4XTS A;  1AQX A;  5CYY A;  5GST A;  2KP2 A;  2EIO A;  2V41 A;  2HSY A;  3PH9 A;  2VCQ A;  3L78 A;  1XVQ A;  1TK0 B;  1XPV A;  2FA4 A;  3FZ9 A;  1EGR A;  2YZH A;  4L5O A;  4OWY A;  4BWQ A;  2V2G A;  3F0I A;  3HCZ A;  3IBH A;  5GSS A;  4N30 A;  3TJK A;  1GNE A;  1A0R P;  1NSW A;  1Y25 A;  1MTC A;  4CHS A;  4EF0 A;  2DJK A;  3MAK A;  1ZCP A;  3SWL A;  4EL1 A;  3CSI A;  2DIZ A;  4K7O A;  4K1F A;  4JU5 A;  1PQN A;  3DXB A;  2JSY A;  1WRY A;  3QR6 A;  5IPG A;  3HD5 A;  1A0F A;  4KGI A;  1XBS A;  2JAC A;  4XS6 A;  4G19 A;  2RUE A;  1N2A A;  3FKF A;  5IM9 A;  1BJX A;  4BVY B;  3HVS A;  4WEY A;  1BAY A;  4KF9 A;  5E59 A;  1H75 A;  4I8B A;  2GQL A;  3TRQ A;  3O76 A;  3LSZ A;  1QK8 A;  1K3Y A;  2QGV A;  5ECH B;  3QAV A;  4PXO A;  1OC9 A;  1TK8 B;  1PMT A;  4HU7 A;  2LRT A;  1XWA A;  5F0G A;  2GGT A;  1HNC A;  2V32 A;  1Z6N A;  1FG4 A;  2DJ0 A;  1PRX A;  14GS A;  2YJ7 A;  4GQC A;  2VCV A;  3QD9 A;  2HLS A;  2C0G A;  1ML6 A;  2B1L A;  4YAP A;  4PQ1 A;  18GS A;  2R2J A;  2I3Y A;  2CVD A;  2H73 A;  4EKZ A;  4QQ7 A;  4MZC A;  3FHK A;  5J9B A;  3ZRE A;  1PD2 1;  1O73 A;  1Z9H A;  4WR4 A;  4YH2 A;  5A5K A;  4I5Q A;  4I97 A;  5IMC A;  2LV3 A;  4GCI A;  3MDK A;  1T3B A;  5ABR A;  3TJJ A;  3CTF A;  5ECO B;  2VUP A;  2L57 A;  4OO4 A;  4EDY A;  3GST A;  1SK2 A;  4N11 A;  2YCD A;  3HJM A;  2YAN A;  3Q6O A;  3IK9 A;  1KTE A;  2LKU A;  1TKD B;  2HZE B;  4K6X A;  1QFN A;  4I2T A;  3ERF A;  5G2Z A;  1ZZY A;  1YDK A;  4P3Y B;  4HQS A;  2OA7 A;  3K8N A;  4F0B A;  3GUR A;  3TOT A;  4OFM A;  2FWH A;  2YV7 A;  1WMJ A;  1O81 A;  2IWT A;  4OCE A;  1YZX A;  3FR3 A;  4RI7 A;  1HYU A;  1RQM A;  17GS A;  3GN3 A;  1J08 A;  1M7T A;  3FR9 A;  4MF5 A;  2JZR A;  4MZW A;  5D93 A;  2TIR A;  1TI1 A;  1UVZ A;  3UVT A;  5ID2 A;  4PQH A;  3KP9 A;  2JAD A;  1GWC A;  3U6V A;  3MSZ A;  3CBU A;  3UMA A;  2H6X A;  2REM A;  3BCK A;  2IMF A;  4KA0 A;  2M46 A;  1Q98 A;  2YZU A;  1WPI A;  3GHA A;  3F6D A;  4DVC A;  5J4U A;  3TRX A;  5KN3 A;  1KBN A;  1X9S B;  2P31 A;  1GSE A;  1OKT A;  3M8N A;  5LCZ A;  3E0U A;  4LLR A;  4ML1 A;  5KN0 A;  4OFT A;  5B8A A;  5DBQ A;  2R5G A;  3FYG A;  2IFQ A;  4KCE A;  3KXO A;  3LQ7 A;  3DRN A;  4TXO B;  3ERW A;  1W89 A;  5G31 A;  3W6G A;  2FHE A;  3QAG A;  5ECQ B;  4IEL A;  2P0G A;  2DML A;  1U6T A;  4XRA A;  2J23 A;  1PSQ A;  2XBQ A;  2XHF A;  2AUV A;  3F63 A;  2DIY A;  4TVE A;  4HZ2 A;  4JBB A;  4EO3 A;  3D21 A; 
#chains in the Genus database with same CATH topology
 5EVO A;  3C1S A;  4XHM A;  1J0F A;  2P5R A;  1GTU A;  3L9S A;  2XPD A;  1QMV A;  1Z7P A;  4KDY A;  10GS A;  4MJB A;  2V6K A;  2EFH A;  2YWO A;  5A5H B;  3PIN A;  2B6M A;  2WJU A;  1ZL9 A;  2OE0 A;  4YQV A;  1PL2 A;  2R0G A;  4F0C A;  3DML A;  4ZL7 A;  2H74 A;  3VFI A;  4G0K A;  2HRA A;  2JL4 A;  1SU9 A;  2F51 A;  1GUM A;  13GS A;  1XFL A;  4EE0 A;  3GTU B;  3E9J B;  1RW1 A;  2LS5 A;  4F2I A;  4EC0 A;  2IMK A;  1YF0 A;  2L5O A;  3GKX A;  2F8F A;  4GF0 A;  2WZ9 A;  4TRX A;  2VL3 A;  2WVY A;  4L5L A;  4KCA A;  3RGB C;  1S3A A;  3CTG A;  3UIW A;  2JZS A;  5IMZ A;  3IXR A;  5C00 A;  3QMX A;  2H19 A;  2MMN A;  3UBL A;  2GQM A;  1G0T A;  2E2G A;  2HYX A;  1FB0 A;  2FCH A;  4X1U A;  2LJK A;  2VCT A;  1SL2 B;  4NHZ A;  4ZBA A;  3L4N A;  2HSH A;  2OE3 A;  1GTB A;  3KM6 A;  1O7U A;  3KMO A;  4MH2 A;  3ZMK A;  2LRC A;  3C73 A;  1Z3E A;  1YVL A;  4HI7 A;  2MZC A;  1PGT A;  5F06 A;  4KDX A;  5FHI A;  4WET A;  3F4T A;  4WF5 A;  1XW5 A;  3RBT A;  3Q74 A;  3CMI A;  2GVP A;  3ZYW A;  1DE2 A;  1GNW A;  2X99 A;  1TU8 A;  5G1L A;  1M9B A;  4WBJ A;  5IO2 A;  3H4K A;  2JU5 A;  3DKS A;  4AKG A;  3P90 A;  3H93 A;  4RQR A;  3ZLP A;  5L71 A;  5EPF A;  1FW1 A;  5IMD A;  5HR1 A;  3DYR A;  3MIX A;  3D22 A;  3IC4 A;  1B9X C;  3LW9 A;  1K0A A;  2D2Z A;  2N5B A;  4MDC A;  3F6F A;  3GA4 A;  4JRR A;  2KP1 A;  3LWA A;  4ILF A;  1CQH A;  4IS0 A;  1TJD A;  2IIY A;  2X8H A;  1B4P A;  2NBS A;  2RM6 A;  4NWY A;  3N9J A;  4E8H A;  1T4Z A;  3CYN A;  4BL7 B;  4USS A;  4V1A g;  2M72 A;  1NW2 A;  3US3 A;  4ULX A;  2R6K A;  1FVJ A;  1GH2 A;  5LD0 A;  3UL3 A;  4KSM A;  3U5R E;  1JZD A;  4TW5 A;  4KND A;  1XG8 A;  1XXU A;  3FZ4 A;  1WOU A;  2IPA A;  1Z6M A;  2O7K A;  1FO5 A;  4MA9 A;  2OE1 A;  4KE3 A;  4N3Z A;  3A3T A;  5JWR B;  4FH8 A;  2HSM A;  2CVB A;  2VD0 A;  1E6B A;  1O8X A;  1SYR A;  1BQ7 A;  1JZW A;  3TKP A;  4D73 A;  2DJ3 A;  4IKH A;  4QL7 A;  1F3B A;  2C8U A;  2O5V A;  2B5X A;  3IRA A;  3G7J A;  1AUC A;  2C80 A;  1ERV A;  3UOM A;  1SVO A;  3GSS A;  3IR4 A;  2M80 A;  1U87 A;  5A4W A;  5EY6 A;  3PGT A;  4ECB A;  4LMW A;  6GST A;  3WYW A;  2NVL A;  4NAX A;  2EIR A;  4AKI A;  1DUG A;  4JZQ A;  4BWS A;  4IJI A;  1V98 A;  4MPF A;  5KOX A;  1F9M A;  1LJR A;  1GSS A;  1K0O A;  2MBT A;  3D0Z A;  1ERW A;  2L6D A;  4PUA A;  6GSW A;  3QPM A;  4MZB A;  1OC3 A;  3DIE A;  1A23 A;  2WW0 A;  4MF7 A;  3UAR A;  4ZBB A;  1G7O A;  2WVX B;  4MH3 A;  2FWE A;  2MYG A;  3DWV A;  1EEJ A;  4G9H A;  5ECS A;  4EIQ A;  19GS A;  1ZYP A;  1XWB A;  2B7K A;  4GXZ A;  2AV4 A;  1V57 A;  1T00 A;  2B1K A;  2Z9S A;  4O92 A;  2MBS A;  4EVM A;  4K8M A;  1GLP A;  3WGD A;  3FW2 A;  1FOH A;  3IDV A;  1SJ6 A;  2PVQ A;  3HKR A;  4Q5N A;  1RK4 A;  1S3D A;  1AQW A;  1V9W A;  3Q19 A;  4IJ3 A;  2OBI A;  2DMM A;  3I9V 2;  2ON5 A;  2V1M A;  4G2E A;  2DJ2 A;  1FAA A;  2H0H A;  2MMZ A;  1PFO A;  3J7Y b;  2VM2 A;  3KD0 A;  2KOK A;  4PNF A;  1U88 A;  3C71 A;  5DAK B;  1FB6 A;  1EOG A;  1OC8 A;  1OC9 B;  2CVK A;  2HRK B;  2VCX A;  4MMM A;  5B8B A;  2IL3 A;  2JSZ A;  3IPZ A;  2EIQ A;  2GZZ A;  1F6M C;  5G5F A;  3APO A;  2FWG A;  4MJA A;  4W66 A;  5CRD A;  3PR8 A;  4NMU A;  4BVX B;  2C4J A;  6GSU A;  4BVY A;  1PN9 A;  4IP6 A;  5FWG A;  4TR4 A;  2O8V B;  2DBC A;  4PQI A;  1ZOF A;  3WT2 A;  5AIV A;  1VF4 A;  3FY7 A;  2C0E A;  1YY7 A;  3IHQ A;  4MPG A;  1YEX A;  4HU9 A;  22GS A;  3LXT A;  1ACV A;  1VRS D;  5CRW A;  3HZ8 A;  1K0C A;  1IYI A;  3DVX A;  5COH A;  4ZXG A;  8GSS A;  3CRT A;  5CAX A;  2YJH A;  3NOF A;  1GUH A;  2X64 A;  2VL9 A;  1M0U A;  1EV4 A;  2K6V A;  5ECM B;  4HS1 A;  4LMV A;  2JZT A;  1QGV A;  4BPY A;  4AF2 A;  1W4V A;  3ZIT A;  2QA2 A;  3GL3 A;  3FR6 A;  3GRX A;  1K0N A;  4TXV A;  5A4V A;  4AKX B;  1SEN A;  3TRP A;  3Q18 A;  3GYK A;  2ZNM A;  1M2B A;  2WCI A;  1A2M A;  3CSH A;  5IQY A;  4MJC A;  2V6O A;  1AW9 A;  4YQU A;  2VM1 A;  5INY A;  2WW3 A;  2WS2 A;  1GP1 A;  2C1Y A;  1G6Y A;  3HXS A;  5BRT A;  3H79 A;  5D96 A;  2G2Q A;  1B4Q A;  3F4S A;  2OAD A;  2RM5 A;  4POM A;  3IE3 A;  1T4Y A;  2HRN A;  4ZL8 A;  4G01 A;  2QA1 A;  1TI3 A;  4K7N A;  2MMA A;  3HJP A;  1K0M A;  3ERG A;  3QFB C;  4NV5 A;  2FD3 A;  1TP9 A;  1QUW A;  5IMF A;  4QMK A;  5J40 A;  3HA9 A;  3LEF A;  9GSS A;  2HZE A;  2OJL A;  3V1W A;  3TCO A;  5DQS A;  1X9M B;  2K9F A;  3HVV A;  3O3T A;  1YEP A;  2L4Q A;  3BCI A;  5AN1 A;  5ID2 B;  4JED A;  2R4V A;  3KGK A;  1X5D A;  4V2L A;  3ZIV A;  3CSJ A;  1ZGN A;  1CQG A;  1GLQ A;  3I43 A;  1U3I A;  3L0H A;  5LNK e;  4E68 A;  1GRX A;  1A24 A;  1PX7 A;  2LUS A;  1TK5 B;  2A4H A;  2H1B A;  4G0L A;  2I4A A;  3D4T A;  3ED3 A;  3P2A A;  3GH9 A;  1EEM A;  3TGZ A;  4Q5R A;  3GNJ A;  2DLX A;  2NPB A;  1HD2 A;  1KNG A;  2GTU A;  4TR3 A;  4PNG A;  2GLR A;  1M2D A;  1XVW A;  2E2M A;  1ABA A;  4K9Z A;  3ZL5 A;  2DC5 A;  4DSS B;  2LNS A;  4J2F A;  2CV4 A;  2VLT A;  2IME A;  5CRH A;  1M3J A;  4RI6 A;  5CNW A;  1DE1 A;  1GSF A;  2DKH A;  2C3Q A;  1NHY A;  5IOW A;  4YQM A;  3F9U A;  2HSN A;  1M3I A;  4ZBD A;  2H0I A;  2H76 A;  2HT9 A;  1LBK A;  1A8Y A;  1EP7 A;  12GS A;  1T7P B;  1USB A;  3H1N A;  4K2D A;  1ILO A;  4TXO A;  3L9V A;  3A5I A;  2I81 A;  6GSX A;  4KX4 A;  3VWX A;  1SJI A;  2HZF A;  4N0Z A;  2H1D A;  4PHZ C;  1Y6E A;  3VI7 A;  3HVX A;  4O5U A;  4BIK A;  4TR0 A;  3HYP A;  4IQA A;  2H0G A;  1OE7 A;  1TDI A;  1OE8 A;  2NDO A;  3G7I A;  3QOU A;  3F3R A;  3W8J A;  3ZIJ A;  1JZO A;  2MMO A;  1SK1 A;  1MEK A;  5BMU A;  3KTL A;  4EXJ A;  3EMP A;  3DGQ A;  3J7Y k;  1XWC A;  2AB6 A;  2VCW A;  4G10 A;  3BJ5 A;  4IN0 A;  5ECK B;  2WW1 A;  2ALB A;  2UZ8 A;  5A5H A;  4EUY A;  2RII A;  3A5W A;  2YOI A;  3BD2 A;  2GZY A;  4KSO A;  4MLY A;  3KIJ A;  4A5P A;  3QAW A;  2B5E A;  4V2N A;  1WP0 A;  5G5E A;  5D73 A;  5HFK A;  2CAQ A;  4ACS A;  4EIP A;  2VLV A;  3GTU A;  1BED A;  5EL8 A;  3CXG A;  2FNO A;  2CT6 A;  5CO3 A;  3TDG A;  4MP4 A;  4WF4 A;  1V58 A;  2PMT A;  1GSY A;  5KEJ A;  4XS1 A;  1PL1 A;  3HY2 A;  5J9C A;  1DBY A;  2X8G A;  5D9V A;  2H75 A;  3ZFB A;  1AC1 A;  4IQ1 A;  1DSB A;  3GV1 A;  3UJ1 A;  5H5S A;  1EOH A;  3ME7 A;  1F3A A;  3HZ4 A;  3RFR C;  2XBI A;  1PX6 A;  5D9T A;  5DVB A;  4GSS A;  3VPT A;  1XW6 A;  1YQ1 A;  4F03 A;  1TXX A;  3GKN A;  3PPU A;  3ME8 A;  4K7I A;  3H8Q A;  5G30 A;  4MF6 A;  4ZL9 A;  5HR0 A;  2HRF A;  2AJQ B;  1SKR B;  5J47 A;  3TKS A;  5ENU A;  1B8X A;  4PI0 C;  2YNX A;  1GSQ A;  4GTU A;  3EU4 A;  3TUE A;  6GSS A;  5J41 A;  1WE0 A;  1LU4 A;  3APQ A;  1THO A;  2LJR A;  1EGO A;  2F9S A;  1YF1 A;  1IYH A;  1ERT A;  2B7J A;  3UAP A;  4POB A;  5IMA A;  3D5J A;  4TR1 B;  4XRD A;  4CY8 A;  2J9H A;  2ON7 A;  3M1G A;  4WXT A;  2X4A A;  2QC7 A;  3GMF A;  3IK7 A;  1SJZ A;  4L0U A;  1R5P A;  4O7H A;  1O6J A;  4Z2U A;  1QXH A;  5GAP D;  1XOB A;  4HUA A;  4N10 A;  3GUS A;  3RPP A;  1THX A;  3D6I A;  5J4Y A;  1V2A A;  2GT6 A;  3GX0 A;  1ZMA A;  2HXK A;  4K0G A;  4AJ7 A;  5IPH A;  4IVF A;  2H1G A;  4NV2 A;  4DSR A;  1PKZ A;  1XOA A;  3ZRD A;  2O87 A;  3BBY A;  2LRN A;  7GSS A;  4IHU A;  4ZIJ A;  2H6Y A;  1PA3 A;  2TRC P;  3EYT A;  5A34 B;  1XW9 A;  3KEB A;  3EUR A;  1EZK A;  5DCG A;  2NTO A;  3ZVJ D;  5A1N B;  2ES7 A;  5DAL B;  3IV4 A;  3KMN A;  5CP1 A;  5HFI A;  2CZ2 A;  4AJ8 A;  1SL1 B;  1MDJ A;  2GQK A;  2CX4 A;  3OR5 A;  1TOF A;  1X5C A;  5KOW A;  1X0R A;  1I5G A;  2I9H A;  3UBK A;  3VWW A;  1TTZ A;  4LL4 B;  4XS4 B;  1Z7R A;  1ON4 A;  4IGJ A;  4ZB9 A;  3TKS C;  4PUF C;  3RDW A;  3WT1 A;  3M9J A;  4IBP A;  3EVI A;  5F05 A;  4K5S A;  5B6N A;  4CY6 A;  4GLT A;  1K3O A;  1XIY A;  5B6M A;  5D9W A;  2WDU A;  4ID0 A;  3LJR A;  3ZZX A;  1K0B A;  2H01 A;  4MK3 A;  1JLV A;  2C3T A;  1TW9 A;  2WW2 A;  1C72 A;  2GT5 A;  2YWI A;  1JLW A;  1JHB A;  2LQQ A;  1GL8 A;  2AHE A;  3LOR A;  2AAW A;  3KZQ A;  4V1A p;  1K0D A;  4K5R A;  2CA8 A;  1T1V A;  2FA8 A;  4PI2 C;  4J57 E;  1QQ2 A;  3IHG A;  5JCU A;  2LEG A;  2WVX A;  5GAN D;  4G0I A;  1BF5 A;  1SKS B;  1SVL A;  3VK9 A;  2C3N A;  1HNA A;  2PER A;  4I2U A;  5KN1 A;  4XCS A;  2CAI A;  2YP6 A;  4HEA 2;  3VI5 A;  3ZTL A;  2KLX A;  2OAC A;  2YWN A;  2B3S A;  3HHV A;  1SD8 A;  3TKS E;  1UN2 A;  1F2E A;  5DJM A;  2EC4 A;  3G7Y A;  2XC2 A;  4ZIL A;  4POK A;  2WRT A;  2WB9 A;  4DSQ A;  4POL A;  3WGX A;  4V2M A;  5J4V A;  4IP1 A;  2HE3 A;  4F9Z A;  4OO5 A;  1F37 A;  3LYK A;  2P5Q A;  4TOP A;  2L4C A;  1OVN A;  3KH9 A;  4NPB A;  2EFE A;  1E2Y A;  2VAF A;  2OT3 A;  4KH7 A;  3F4R A;  5J5N A;  5DAK A;  1ZYQ B;  2ZCT A;  2OKA A;  2H30 A;  1SK0 A;  2HRK A;  4HDE A;  2RUF A;  2FGX A;  2DSA A;  2VOC A;  2L5L A;  1B9Y C;  4AJ6 A;  1GSU A;  3SBC A;  2XPE A;  5ECL B;  4ECC A;  3R2Q A;  3NIV A;  4BVX A;  2C0D A;  4PX1 A;  4CW9 A;  2HNL A;  3R3E A;  1GUL A;  5GZZ B;  4FYU A;  6GSV A;  2TRX A;  4KAE A;  4ECJ A;  4RUV A;  1EWX A;  1G6W A;  1TRU A;  4NXI A;  4JR6 A;  1EP8 A;  2IN3 A;  2PN8 A;  3GKM A;  1XWG A;  3MNG A;  4GSN A;  2O3E A;  1J9B A;  2LST A;  3APS A;  3M9K A;  5ELG A;  5FT3 A;  3HMJ G;  2PBJ A;  2HFD A;  4EDZ A;  20GS A;  1AXD A;  2RLI A;  5F8B A;  1B48 A;  1SL0 B;  3EIN A;  5CRG A;  4HQZ A;  5J3R A;  4J56 E;  2GSR A;  5C04 A;  2I1U A;  4DEJ A;  3TOU A;  1A2L A;  4TKY A;  2H8L A;  1OKD A;  4ICY A;  2BMX A;  5D9X A;  1I9D A;  4HJ2 A;  4RQX A;  4ZB7 A;  4PGT A;  5H5Q A;  3RHB A;  3TJB A;  1H4O A;  3L9U A;  4KB3 A;  3FEU A;  3C7M A;  4Q5F A;  3TJG A;  3LFL A;  1JZR A;  4YKG A;  4WKW A;  2BJX A;  4OCF A;  4MNN A;  1ZYN A;  4OFN A;  1M9A A;  1YEW C;  1NM3 A;  2CX3 A;  1FOV A;  2YN1 A;  2PVO C;  2N5F A;  4E8E A;  3BOA A;  1MDI A;  2VIM A;  2YWM A;  2H71 A;  4GQF A;  2HQT A;  3NZN A;  2F8A A;  2A2R A;  3QDN A;  2GSS A;  1A8L A;  5D8I A;  3JCM L;  2K8S A;  16GS A;  1AQV A;  1XWK A;  4GRF A;  1VF1 A;  2IFQ B;  2CZ3 A;  4JE1 A;  2PU9 C;  4N0V A;  4X0X A;  2N5A A;  1R7H A;  5IIZ A;  1G7E A;  1PN0 A;  3EE2 A;  3QCP A;  2HSN B;  3KJY A;  2QKE A;  3A2X A;  3WD6 A;  4GDF A;  2AYT A;  4FQU A;  1X9W B;  2O85 A;  5ECR B;  4MJE A;  5B7C A;  2FUG 2;  4AGS A;  4TN8 A;  1BG5 A;  4X4J A;  2KHP A;  4K0N A;  3O6T A;  5JCG A;  2DKI A;  3P8W A;  1BX9 A;  2LQO A;  1SKW B;  4OD7 A;  11GS A;  3WGE A;  4DSS A;  1TU7 A;  3RAZ A;  3CHX C;  3IA1 A;  3EC3 A;  1BYE A;  2EFC A;  4L8E A;  2PGT A;  3QFA C;  3LYP A;  2IMD A;  1N8J A;  3DEX A;  1ST9 A;  1UC7 A;  2UV8 G;  4O32 A;  3A2W A;  5A4U A;  5IO0 A;  3W8S A;  1JFU A;  5IMV A;  1GTA A;  1TRV A;  2CQ9 A;  2LNT A;  2O89 A;  5BMU B;  1YJ6 A;  3ZVJ A;  1TRW A;  5H5R A;  2VCZ A;  1YKA A;  3KP8 A;  3IC8 A;  1O8W A;  3RPN A;  2VLU A;  1GUK A;  2VL2 A;  1XZO A;  2VO4 A;  3GL5 A;  3HVN A;  1UA5 A;  2PWJ A;  2X49 A;  3RHC A;  3ZFL A;  1R26 A;  5AIS A;  3P7X A;  4XIH A;  1AAZ A;  2G0F A;  3DVW A;  4WBR D;  4ML6 A;  5JWQ B;  5HFG A;  3AY8 A;  4ZB6 A;  1NHO A;  2H72 A;  2A4V A;  1M99 A;  4OMV A;  3FZA A;  2R3X A;  3VWU A;  5IOX A;  1TXU A;  4I6X A;  3ISO A;  5ECI B;  2YPM A;  1Q4J A;  3HJO A;  3IAM 2;  3FK8 A;  2PUK C;  2F3M A;  5HR3 A;  3GIX A;  3VLN A;  2ZUP A;  3EU3 A;  1OYJ A;  2GSQ A;  3FRC A;  5F07 A;  4Z7X A;  3N5O A;  3CRU A;  3G9B A;  2QSI A;  3TB2 A;  1K3L A;  2WZS A;  3FMW A;  2FWF A;  3UEM A;  1SYX A;  4PUR A;  1VF3 A;  1X5E A;  3VUR A;  4JR4 A;  2H70 A;  1VF2 A;  4NHW A;  1VGL A;  4O5R A;  2DJJ A;  4GWR A;  2YV9 A;  4F82 A;  4BA7 A;  1V40 A;  2E7P A;  4CDO A;  5KN2 A;  1MD3 A;  3VWV A;  3F3Q A;  5DQY A;  3LG6 A;  1ZYE A;  4WR5 A;  4Q5Q A;  2KUC A;  5HR2 A;  1U3A A;  3IOS A;  2H66 A;  1MDK A;  3FZ5 A;  4KDU A;  4H86 A;  3CWG A;  3GH6 A;  4X43 A;  3M0F A;  5G1K A;  4FYC A;  5ECN B;  2FLS A;  2H6Z A;  2IJY A;  1GSD A;  1M2A A;  2GDR A;  3LXZ A;  1TRS A;  2HI7 A;  3C8E A;  3D4M A;  1A2J A;  3VPQ A;  5JWO B;  2WGR A;  3EPT A;  2VD1 A;  1AIU A;  4LA1 A;  2LTK A;  4HJM A;  2L6C A;  5ELA A;  3GFK A;  2VL2 C;  3GX8 A;  5E4W A;  2K8V A;  4QL9 A;  3M3M A;  2DJ1 A;  5ECP B;  2FY6 A;  3E3E A;  1WWJ A;  4KUN A;  4L0W A;  3F8U A;  3KCM A;  1OAZ A;  1XCC A;  4TR1 A;  2K18 A;  1WJK A;  2GZP A;  2WUL A;  3EWL A;  3IAS 2;  3KH7 A;  4PTS A;  4ECI A;  1GTI A;  1MD4 A;  2A2S A;  1URM A;  4KW6 A;  5AGY A;  2HSM B;  3KTB A;  5AIX A;  2R0P A;  4D73 B;  4FIW A;  2H1A A;  2E0Q A;  2R37 A;  1YKC A;  3TJF A;  4ZB8 A;  3UVH A;  3TKR A;  3HDC A;  2VKZ G;  2X8C A;  4MCU A;  2B5Y A;  1FVK A;  5HQP A;  3I6A A;  4BL7 A;  5DDL A;  2C0F A;  2GS3 A;  5DCH A;  1FHE A;  4IW9 A;  3C1R A;  3A2V A;  1HNB A;  3LGC A;  1HQO A;  1O85 A;  1PKW A;  5CRE A;  5DJL A;  5A34 A;  4FYB A;  1BG1 A;  5JCW A;  2WFC A;  4LL1 B;  4HZ4 A;  4HSC X;  1ERU A;  3S9F A;  2OBK A;  3EMX A;  2BTO T;  5A1N A;  5DAL A;  2GST A;  4MAB A;  4YAV A;  1R5A A;  1Z5Y E;  2PPT A;  2H1L A;  4FO5 A;  1R4W A;  3GKK A;  4YKF A;  3DD3 A;  6GSY A;  1SD9 A;  4ISD A;  3MWH A;  1KEB A;  3ZML A;  2LJA A;  4HOJ A;  3TKQ A;  1T8E B;  2IMI A;  4XS4 A;  1EV9 A;  3I69 A;  2L59 A;  1WIK A;  4GST A;  1S3C A;  4XTS A;  1AQX A;  5CYY A;  5GST A;  2KP2 A;  2EIO A;  2V41 A;  2HSY A;  3PH9 A;  2VCQ A;  3L78 A;  1XVQ A;  1TK0 B;  1XPV A;  2FA4 A;  3FZ9 A;  1EGR A;  2YZH A;  4L5O A;  4OWY A;  4BWQ A;  2V2G A;  3F0I A;  3HCZ A;  3IBH A;  5GSS A;  4N30 A;  3TJK A;  1GNE A;  1A0R P;  1NSW A;  1Y25 A;  1MTC A;  4CHS A;  4K2X A;  4EF0 A;  2DJK A;  3MAK A;  1ZCP A;  3SWL A;  4EL1 A;  2EFD A;  3CSI A;  2DIZ A;  4K7O A;  4K1F A;  3MYD A;  4JU5 A;  1PQN A;  3DXB A;  2JSY A;  2R0C A;  1WRY A;  3QR6 A;  5IPG A;  3HD5 A;  1A0F A;  4KGI A;  1XBS A;  2JAC A;  4XS6 A;  4G19 A;  2RUE A;  1N2A A;  3FKF A;  5IM9 A;  1BJX A;  4BVY B;  3HVS A;  4WEY A;  1BAY A;  4KF9 A;  5E59 A;  1H75 A;  4I8B A;  2GQL A;  3TRQ A;  3O76 A;  3LSZ A;  1QK8 A;  1K3Y A;  2QGV A;  1N25 A;  4FXY P;  5ECH B;  3QAV A;  4PXO A;  1OC9 A;  1TK8 B;  1PMT A;  4HU7 A;  2LRT A;  1XWA A;  5F0G A;  2GGT A;  1HNC A;  2V32 A;  1Z6N A;  1FG4 A;  2DJ0 A;  1PRX A;  14GS A;  2YJ7 A;  4GQC A;  2VCV A;  4O5Q A;  3QD9 A;  2HLS A;  2C0G A;  1ML6 A;  2B1L A;  4YAP A;  4PQ1 A;  18GS A;  2R2J A;  2I3Y A;  2CVD A;  2H73 A;  4EKZ A;  4QQ7 A;  4MZC A;  3FHK A;  5J9B A;  3ZRE A;  1PD2 1;  1O73 A;  1Z9H A;  4WR4 A;  4YH2 A;  5A5K A;  4I5Q A;  4I97 A;  5IMC A;  2LV3 A;  4GCI A;  1S4B P;  3MDK A;  1T3B A;  5ABR A;  3CQF A;  3TJJ A;  3CTF A;  5ECO B;  2VUP A;  2L57 A;  4OO4 A;  4EDY A;  3GST A;  1SK2 A;  4N11 A;  2YCD A;  3HJM A;  2YAN A;  3Q6O A;  3IK9 A;  1KTE A;  3TU3 B;  2LKU A;  1TKD B;  2HZE B;  4K6X A;  1QFN A;  4I2T A;  3ERF A;  1I1I P;  5G2Z A;  2WVZ A;  1ZZY A;  1YDK A;  2A2P A;  4Z2R A;  4P3Y B;  4HQS A;  2OA7 A;  3K8N A;  4F0B A;  3GUR A;  3TOT A;  4OFM A;  2FWH A;  2YV7 A;  1WMJ A;  1O81 A;  2IWT A;  4OCE A;  1YZX A;  3FR3 A;  4RI7 A;  1HYU A;  1RQM A;  17GS A;  3GN3 A;  1J08 A;  1M7T A;  3FR9 A;  2O36 A;  4MF5 A;  2JZR A;  4MZW A;  5D93 A;  2TIR A;  1TI1 A;  1UVZ A;  4AI6 A;  3UVT A;  5ID2 A;  4PQH A;  3KP9 A;  2JAD A;  1GWC A;  3U6V A;  3MSZ A;  3CBU A;  3UMA A;  2H6X A;  2REM A;  3BCK A;  2IMF A;  4KA0 A;  2M46 A;  1Q98 A;  2YZU A;  1WPI A;  3GHA A;  3F6D A;  4DVC A;  5J4U A;  3TRX A;  5KN3 A;  1KBN A;  1X9S B;  2P31 A;  1GSE A;  1OKT A;  3M8N A;  5LCZ A;  3E0U A;  4LLR A;  4ML1 A;  5KN0 A;  4OFT A;  1S3R A;  5B8A A;  5DBQ A;  2R5G A;  3FYG A;  2IFQ A;  4KCE A;  3KXO A;  3LQ7 A;  4AKH A;  3DRN A;  4TXO B;  3ERW A;  1W89 A;  5G31 A;  3W6G A;  2FHE A;  3QAG A;  5ECQ B;  4IEL A;  2P0G A;  2DML A;  1U6T A;  4XRA A;  2J23 A;  1SVM A;  1PSQ A;  2XBQ A;  2XHF A;  2AUV A;  3F63 A;  2DIY A;  4TVE A;  4HZ2 A;  4JBB A;  4EO3 A;  4Z2T A;  3D21 A;  1Y1U A; 
#chains in the Genus database with same CATH homology
 5EVO A;  3C1S A;  4XHM A;  1J0F A;  2P5R A;  1GTU A;  3L9S A;  2XPD A;  1QMV A;  1Z7P A;  4KDY A;  10GS A;  4MJB A;  2V6K A;  2EFH A;  2YWO A;  5A5H B;  3PIN A;  2B6M A;  2WJU A;  1ZL9 A;  2OE0 A;  4YQV A;  1PL2 A;  2R0G A;  4F0C A;  3DML A;  4ZL7 A;  2H74 A;  3VFI A;  4G0K A;  2HRA A;  2JL4 A;  1SU9 A;  2F51 A;  1GUM A;  13GS A;  1XFL A;  4EE0 A;  3GTU B;  3E9J B;  1RW1 A;  2LS5 A;  4F2I A;  4EC0 A;  2IMK A;  1YF0 A;  2L5O A;  3GKX A;  2F8F A;  4GF0 A;  2WZ9 A;  4TRX A;  2VL3 A;  4L5L A;  4KCA A;  1S3A A;  3CTG A;  3UIW A;  2JZS A;  5IMZ A;  3IXR A;  5C00 A;  3QMX A;  2H19 A;  2MMN A;  3UBL A;  2GQM A;  1G0T A;  2E2G A;  2HYX A;  1FB0 A;  2FCH A;  4X1U A;  2LJK A;  2VCT A;  1SL2 B;  4NHZ A;  4ZBA A;  3L4N A;  2HSH A;  2OE3 A;  1GTB A;  3KM6 A;  1O7U A;  3KMO A;  4MH2 A;  3ZMK A;  2LRC A;  3C73 A;  1Z3E A;  1YVL A;  4HI7 A;  2MZC A;  1PGT A;  5F06 A;  4KDX A;  5FHI A;  4WET A;  3F4T A;  4WF5 A;  1XW5 A;  3RBT A;  3Q74 A;  3CMI A;  2GVP A;  3ZYW A;  1DE2 A;  1GNW A;  2X99 A;  1TU8 A;  5G1L A;  1M9B A;  4WBJ A;  5IO2 A;  3H4K A;  2JU5 A;  3DKS A;  4AKG A;  3P90 A;  3H93 A;  4RQR A;  3ZLP A;  5L71 A;  5EPF A;  1FW1 A;  5IMD A;  5HR1 A;  3DYR A;  3MIX A;  3D22 A;  3IC4 A;  1B9X C;  3LW9 A;  1K0A A;  2D2Z A;  2N5B A;  4MDC A;  3F6F A;  3GA4 A;  4JRR A;  2KP1 A;  3LWA A;  4ILF A;  1CQH A;  4IS0 A;  1TJD A;  2IIY A;  2X8H A;  1B4P A;  2NBS A;  2RM6 A;  4NWY A;  3N9J A;  4E8H A;  1T4Z A;  3CYN A;  4BL7 B;  4USS A;  4V1A g;  2M72 A;  1NW2 A;  3US3 A;  4ULX A;  2R6K A;  1FVJ A;  1GH2 A;  5LD0 A;  3UL3 A;  4KSM A;  3U5R E;  1JZD A;  4TW5 A;  4KND A;  1XXU A;  3FZ4 A;  1WOU A;  2IPA A;  1Z6M A;  2O7K A;  1FO5 A;  4MA9 A;  2OE1 A;  4KE3 A;  4N3Z A;  3A3T A;  5JWR B;  4FH8 A;  2HSM A;  2CVB A;  2VD0 A;  1E6B A;  1O8X A;  1SYR A;  1BQ7 A;  1JZW A;  3TKP A;  4D73 A;  2DJ3 A;  4IKH A;  4QL7 A;  1F3B A;  2C8U A;  2O5V A;  2B5X A;  3IRA A;  3G7J A;  1AUC A;  2C80 A;  1ERV A;  3UOM A;  1SVO A;  3GSS A;  3IR4 A;  2M80 A;  1U87 A;  5A4W A;  5EY6 A;  3PGT A;  4ECB A;  4LMW A;  6GST A;  3WYW A;  2NVL A;  4NAX A;  2EIR A;  4AKI A;  1DUG A;  4JZQ A;  4BWS A;  4IJI A;  1V98 A;  4MPF A;  5KOX A;  1F9M A;  1LJR A;  1GSS A;  1K0O A;  2MBT A;  3D0Z A;  1ERW A;  2L6D A;  4PUA A;  6GSW A;  3QPM A;  4MZB A;  1OC3 A;  3DIE A;  1A23 A;  4MF7 A;  3UAR A;  4ZBB A;  1G7O A;  4MH3 A;  2FWE A;  2MYG A;  3DWV A;  1EEJ A;  4G9H A;  5ECS A;  4EIQ A;  19GS A;  1ZYP A;  1XWB A;  2B7K A;  4GXZ A;  2AV4 A;  1V57 A;  1T00 A;  2B1K A;  2Z9S A;  4O92 A;  2MBS A;  4EVM A;  4K8M A;  1GLP A;  3WGD A;  3FW2 A;  1FOH A;  3IDV A;  1SJ6 A;  2PVQ A;  3HKR A;  4Q5N A;  1RK4 A;  1S3D A;  1AQW A;  1V9W A;  3Q19 A;  4IJ3 A;  2OBI A;  2DMM A;  3I9V 2;  2ON5 A;  2V1M A;  4G2E A;  2DJ2 A;  1FAA A;  2H0H A;  2MMZ A;  3J7Y b;  2VM2 A;  3KD0 A;  2KOK A;  4PNF A;  1U88 A;  3C71 A;  5DAK B;  1FB6 A;  1EOG A;  1OC8 A;  1OC9 B;  2CVK A;  2HRK B;  2VCX A;  4MMM A;  5B8B A;  2IL3 A;  2JSZ A;  3IPZ A;  2EIQ A;  2GZZ A;  1F6M C;  5G5F A;  3APO A;  2FWG A;  4MJA A;  4W66 A;  5CRD A;  3PR8 A;  4NMU A;  4BVX B;  2C4J A;  6GSU A;  4BVY A;  1PN9 A;  4IP6 A;  5FWG A;  4TR4 A;  2O8V B;  2DBC A;  4PQI A;  1ZOF A;  3WT2 A;  5AIV A;  1VF4 A;  3FY7 A;  2C0E A;  1YY7 A;  3IHQ A;  4MPG A;  1YEX A;  4HU9 A;  22GS A;  3LXT A;  1ACV A;  1VRS D;  5CRW A;  3HZ8 A;  1K0C A;  1IYI A;  3DVX A;  5COH A;  4ZXG A;  8GSS A;  3CRT A;  5CAX A;  2YJH A;  3NOF A;  1GUH A;  2X64 A;  2VL9 A;  1M0U A;  1EV4 A;  2K6V A;  5ECM B;  4HS1 A;  4LMV A;  2JZT A;  1QGV A;  4BPY A;  4AF2 A;  1W4V A;  3ZIT A;  2QA2 A;  3GL3 A;  3FR6 A;  3GRX A;  1K0N A;  4TXV A;  5A4V A;  4AKX B;  1SEN A;  3TRP A;  3Q18 A;  3GYK A;  2ZNM A;  1M2B A;  2WCI A;  1A2M A;  3CSH A;  5IQY A;  4MJC A;  2V6O A;  1AW9 A;  4YQU A;  2VM1 A;  5INY A;  2WS2 A;  1GP1 A;  2C1Y A;  1G6Y A;  3HXS A;  5BRT A;  3H79 A;  5D96 A;  2G2Q A;  1B4Q A;  3F4S A;  2OAD A;  2RM5 A;  4POM A;  3IE3 A;  1T4Y A;  2HRN A;  4ZL8 A;  4G01 A;  2QA1 A;  1TI3 A;  4K7N A;  2MMA A;  3HJP A;  1K0M A;  3ERG A;  3QFB C;  4NV5 A;  2FD3 A;  1TP9 A;  1QUW A;  5IMF A;  4QMK A;  5J40 A;  3HA9 A;  3LEF A;  9GSS A;  2HZE A;  2OJL A;  3V1W A;  3TCO A;  5DQS A;  1X9M B;  2K9F A;  3HVV A;  3O3T A;  1YEP A;  2L4Q A;  3BCI A;  5AN1 A;  5ID2 B;  4JED A;  2R4V A;  3KGK A;  1X5D A;  4V2L A;  3ZIV A;  3CSJ A;  1ZGN A;  1CQG A;  1GLQ A;  3I43 A;  1U3I A;  3L0H A;  5LNK e;  4E68 A;  1GRX A;  1A24 A;  1PX7 A;  2LUS A;  1TK5 B;  2A4H A;  2H1B A;  4G0L A;  2I4A A;  3D4T A;  3ED3 A;  3P2A A;  3GH9 A;  1EEM A;  3TGZ A;  4Q5R A;  3GNJ A;  2DLX A;  2NPB A;  1HD2 A;  1KNG A;  2GTU A;  4TR3 A;  4PNG A;  2GLR A;  1M2D A;  1XVW A;  2E2M A;  1ABA A;  4K9Z A;  3ZL5 A;  2DC5 A;  4DSS B;  2LNS A;  4J2F A;  2CV4 A;  2VLT A;  2IME A;  5CRH A;  4RI6 A;  5CNW A;  1DE1 A;  1GSF A;  2DKH A;  2C3Q A;  1NHY A;  5IOW A;  4YQM A;  3F9U A;  2HSN A;  4ZBD A;  2H0I A;  2H76 A;  2HT9 A;  1LBK A;  1A8Y A;  1EP7 A;  12GS A;  1T7P B;  1USB A;  3H1N A;  4K2D A;  1ILO A;  4TXO A;  3L9V A;  3A5I A;  2I81 A;  6GSX A;  4KX4 A;  3VWX A;  1SJI A;  2HZF A;  4N0Z A;  2H1D A;  1Y6E A;  3VI7 A;  3HVX A;  4O5U A;  4TR0 A;  3HYP A;  4IQA A;  2H0G A;  1OE7 A;  1TDI A;  1OE8 A;  2NDO A;  3G7I A;  3QOU A;  3F3R A;  3W8J A;  3ZIJ A;  1JZO A;  2MMO A;  1SK1 A;  1MEK A;  5BMU A;  3KTL A;  4EXJ A;  3EMP A;  3DGQ A;  3J7Y k;  1XWC A;  2AB6 A;  2VCW A;  4G10 A;  3BJ5 A;  4IN0 A;  5ECK B;  2ALB A;  2UZ8 A;  5A5H A;  4EUY A;  2RII A;  3A5W A;  2YOI A;  3BD2 A;  2GZY A;  4KSO A;  4MLY A;  3KIJ A;  4A5P A;  3QAW A;  2B5E A;  4V2N A;  1WP0 A;  5G5E A;  5D73 A;  5HFK A;  2CAQ A;  4ACS A;  4EIP A;  2VLV A;  3GTU A;  1BED A;  5EL8 A;  3CXG A;  2FNO A;  2CT6 A;  5CO3 A;  3TDG A;  4MP4 A;  4WF4 A;  1V58 A;  2PMT A;  1GSY A;  5KEJ A;  4XS1 A;  1PL1 A;  3HY2 A;  5J9C A;  1DBY A;  2X8G A;  5D9V A;  2H75 A;  3ZFB A;  1AC1 A;  4IQ1 A;  1DSB A;  3GV1 A;  3UJ1 A;  5H5S A;  1EOH A;  3ME7 A;  1F3A A;  3HZ4 A;  2XBI A;  1PX6 A;  5D9T A;  5DVB A;  4GSS A;  3VPT A;  1XW6 A;  1YQ1 A;  4F03 A;  1TXX A;  3GKN A;  3ME8 A;  3PPU A;  4K7I A;  3H8Q A;  5G30 A;  4MF6 A;  4ZL9 A;  5HR0 A;  2HRF A;  2AJQ B;  1SKR B;  5J47 A;  3TKS A;  5ENU A;  1B8X A;  2YNX A;  1GSQ A;  4GTU A;  3EU4 A;  3TUE A;  6GSS A;  5J41 A;  1WE0 A;  1LU4 A;  3APQ A;  1THO A;  2LJR A;  1EGO A;  2F9S A;  1YF1 A;  1IYH A;  1ERT A;  2B7J A;  3UAP A;  4POB A;  5IMA A;  3D5J A;  4TR1 B;  4XRD A;  4CY8 A;  2J9H A;  2ON7 A;  3M1G A;  4WXT A;  2X4A A;  2QC7 A;  3GMF A;  3IK7 A;  1SJZ A;  4L0U A;  1R5P A;  4O7H A;  1O6J A;  4Z2U A;  1QXH A;  5GAP D;  1XOB A;  4HUA A;  4N10 A;  3GUS A;  3RPP A;  1THX A;  3D6I A;  5J4Y A;  1V2A A;  2GT6 A;  3GX0 A;  1ZMA A;  2HXK A;  4K0G A;  4AJ7 A;  5IPH A;  4IVF A;  2H1G A;  4NV2 A;  4DSR A;  1PKZ A;  1XOA A;  3ZRD A;  2O87 A;  3BBY A;  2LRN A;  7GSS A;  4IHU A;  4ZIJ A;  2H6Y A;  1PA3 A;  2TRC P;  3EYT A;  5A34 B;  1XW9 A;  3KEB A;  3EUR A;  1EZK A;  5DCG A;  2NTO A;  3ZVJ D;  5A1N B;  2ES7 A;  5DAL B;  3IV4 A;  3KMN A;  5CP1 A;  5HFI A;  2CZ2 A;  4AJ8 A;  1SL1 B;  1MDJ A;  2GQK A;  2CX4 A;  3OR5 A;  1TOF A;  1X5C A;  5KOW A;  1X0R A;  1I5G A;  2I9H A;  3UBK A;  3VWW A;  1TTZ A;  4LL4 B;  4XS4 B;  1Z7R A;  1ON4 A;  4IGJ A;  4ZB9 A;  3TKS C;  4PUF C;  3RDW A;  3WT1 A;  3M9J A;  4IBP A;  3EVI A;  5F05 A;  4K5S A;  5B6N A;  4CY6 A;  4GLT A;  1K3O A;  1XIY A;  5B6M A;  5D9W A;  2WDU A;  4ID0 A;  3LJR A;  3ZZX A;  1K0B A;  2H01 A;  4MK3 A;  1JLV A;  2C3T A;  1TW9 A;  1C72 A;  2GT5 A;  2YWI A;  1JLW A;  1JHB A;  2LQQ A;  1GL8 A;  2AHE A;  3LOR A;  2AAW A;  3KZQ A;  4V1A p;  1K0D A;  4K5R A;  2CA8 A;  1T1V A;  2FA8 A;  4J57 E;  1QQ2 A;  3IHG A;  5JCU A;  2LEG A;  5GAN D;  4G0I A;  1BF5 A;  1SKS B;  1SVL A;  3VK9 A;  2C3N A;  1HNA A;  2PER A;  4I2U A;  5KN1 A;  4XCS A;  2CAI A;  2YP6 A;  4HEA 2;  3VI5 A;  3ZTL A;  2KLX A;  2OAC A;  2YWN A;  2B3S A;  3HHV A;  1SD8 A;  3TKS E;  1UN2 A;  1F2E A;  5DJM A;  2EC4 A;  3G7Y A;  2XC2 A;  4ZIL A;  4POK A;  2WRT A;  2WB9 A;  4DSQ A;  4POL A;  3WGX A;  4V2M A;  5J4V A;  4IP1 A;  2HE3 A;  4F9Z A;  4OO5 A;  1F37 A;  3LYK A;  2P5Q A;  4TOP A;  2L4C A;  1OVN A;  3KH9 A;  4NPB A;  2EFE A;  1E2Y A;  2VAF A;  2OT3 A;  4KH7 A;  3F4R A;  5J5N A;  5DAK A;  1ZYQ B;  2ZCT A;  2OKA A;  2H30 A;  1SK0 A;  2HRK A;  4HDE A;  2RUF A;  2FGX A;  2DSA A;  2VOC A;  2L5L A;  1B9Y C;  4AJ6 A;  1GSU A;  3SBC A;  2XPE A;  5ECL B;  4ECC A;  3R2Q A;  3NIV A;  4BVX A;  2C0D A;  4PX1 A;  4CW9 A;  2HNL A;  3R3E A;  1GUL A;  5GZZ B;  4FYU A;  6GSV A;  2TRX A;  4KAE A;  4ECJ A;  4RUV A;  1EWX A;  1G6W A;  1TRU A;  4NXI A;  4JR6 A;  1EP8 A;  2IN3 A;  2PN8 A;  3GKM A;  1XWG A;  3MNG A;  4GSN A;  1J9B A;  2LST A;  3APS A;  3M9K A;  5ELG A;  5FT3 A;  3HMJ G;  2PBJ A;  2HFD A;  4EDZ A;  20GS A;  1AXD A;  2RLI A;  5F8B A;  1B48 A;  1SL0 B;  3EIN A;  5CRG A;  4HQZ A;  5J3R A;  4J56 E;  2GSR A;  5C04 A;  2I1U A;  4DEJ A;  3TOU A;  1A2L A;  4TKY A;  2H8L A;  1OKD A;  4ICY A;  2BMX A;  5D9X A;  1I9D A;  4HJ2 A;  4RQX A;  4ZB7 A;  4PGT A;  5H5Q A;  3RHB A;  3TJB A;  1H4O A;  3L9U A;  4KB3 A;  3FEU A;  3C7M A;  4Q5F A;  3TJG A;  3LFL A;  1JZR A;  4YKG A;  4WKW A;  2BJX A;  4OCF A;  4MNN A;  1ZYN A;  4OFN A;  1M9A A;  1NM3 A;  2CX3 A;  1FOV A;  2YN1 A;  2PVO C;  2N5F A;  4E8E A;  3BOA A;  1MDI A;  2VIM A;  2YWM A;  2H71 A;  4GQF A;  2HQT A;  3NZN A;  2F8A A;  2A2R A;  3QDN A;  2GSS A;  1A8L A;  5D8I A;  3JCM L;  2K8S A;  16GS A;  1AQV A;  1XWK A;  4GRF A;  1VF1 A;  2IFQ B;  2CZ3 A;  4JE1 A;  2PU9 C;  4N0V A;  4X0X A;  2N5A A;  1R7H A;  5IIZ A;  1G7E A;  1PN0 A;  3EE2 A;  3QCP A;  2HSN B;  3KJY A;  2QKE A;  3A2X A;  3WD6 A;  4GDF A;  2AYT A;  4FQU A;  1X9W B;  2O85 A;  5ECR B;  4MJE A;  5B7C A;  2FUG 2;  4AGS A;  4TN8 A;  1BG5 A;  4X4J A;  2KHP A;  4K0N A;  3O6T A;  5JCG A;  2DKI A;  3P8W A;  1BX9 A;  2LQO A;  1SKW B;  4OD7 A;  11GS A;  3WGE A;  4DSS A;  1TU7 A;  3RAZ A;  3IA1 A;  3EC3 A;  1BYE A;  2EFC A;  4L8E A;  2PGT A;  3QFA C;  3LYP A;  2IMD A;  1N8J A;  3DEX A;  1ST9 A;  1UC7 A;  2UV8 G;  4O32 A;  3A2W A;  5A4U A;  5IO0 A;  3W8S A;  1JFU A;  5IMV A;  1GTA A;  1TRV A;  2CQ9 A;  2LNT A;  2O89 A;  5BMU B;  1YJ6 A;  3ZVJ A;  1TRW A;  5H5R A;  2VCZ A;  1YKA A;  3KP8 A;  3IC8 A;  1O8W A;  3RPN A;  2VLU A;  1GUK A;  2VL2 A;  1XZO A;  2VO4 A;  3GL5 A;  1UA5 A;  2PWJ A;  2X49 A;  3RHC A;  3ZFL A;  1R26 A;  5AIS A;  3P7X A;  4XIH A;  1AAZ A;  2G0F A;  3DVW A;  4WBR D;  4ML6 A;  5JWQ B;  5HFG A;  3AY8 A;  4ZB6 A;  1NHO A;  2H72 A;  2A4V A;  1M99 A;  4OMV A;  3FZA A;  2R3X A;  3VWU A;  5IOX A;  1TXU A;  4I6X A;  3ISO A;  5ECI B;  2YPM A;  1Q4J A;  3HJO A;  3IAM 2;  3FK8 A;  2PUK C;  2F3M A;  5HR3 A;  3GIX A;  3VLN A;  2ZUP A;  3EU3 A;  1OYJ A;  2GSQ A;  3FRC A;  5F07 A;  4Z7X A;  3N5O A;  3CRU A;  3G9B A;  2QSI A;  3TB2 A;  1K3L A;  3FMW A;  2FWF A;  3UEM A;  1SYX A;  4PUR A;  1VF3 A;  1X5E A;  3VUR A;  4JR4 A;  2H70 A;  1VF2 A;  4NHW A;  1VGL A;  4O5R A;  2DJJ A;  4GWR A;  2YV9 A;  4F82 A;  4BA7 A;  1V40 A;  2E7P A;  4CDO A;  5KN2 A;  1MD3 A;  3VWV A;  3F3Q A;  5DQY A;  3LG6 A;  1ZYE A;  4WR5 A;  4Q5Q A;  2KUC A;  5HR2 A;  1U3A A;  3IOS A;  2H66 A;  1MDK A;  3FZ5 A;  4KDU A;  4H86 A;  3CWG A;  3GH6 A;  4X43 A;  3M0F A;  5G1K A;  4FYC A;  5ECN B;  2FLS A;  2H6Z A;  2IJY A;  1GSD A;  1M2A A;  2GDR A;  3LXZ A;  1TRS A;  2HI7 A;  3C8E A;  3D4M A;  1A2J A;  3VPQ A;  5JWO B;  2WGR A;  3EPT A;  2VD1 A;  1AIU A;  4LA1 A;  2LTK A;  4HJM A;  2L6C A;  5ELA A;  3GFK A;  2VL2 C;  3GX8 A;  5E4W A;  2K8V A;  4QL9 A;  3M3M A;  2DJ1 A;  5ECP B;  2FY6 A;  3E3E A;  1WWJ A;  4KUN A;  4L0W A;  3F8U A;  3KCM A;  1OAZ A;  1XCC A;  4TR1 A;  2K18 A;  1WJK A;  2GZP A;  2WUL A;  3EWL A;  3IAS 2;  3KH7 A;  4PTS A;  4ECI A;  1GTI A;  1MD4 A;  2A2S A;  1URM A;  4KW6 A;  5AGY A;  2HSM B;  3KTB A;  5AIX A;  2R0P A;  4D73 B;  4FIW A;  2H1A A;  2E0Q A;  2R37 A;  1YKC A;  3TJF A;  4ZB8 A;  3UVH A;  3TKR A;  3HDC A;  2VKZ G;  2X8C A;  4MCU A;  2B5Y A;  1FVK A;  5HQP A;  3I6A A;  4BL7 A;  5DDL A;  2C0F A;  2GS3 A;  5DCH A;  1FHE A;  4IW9 A;  3C1R A;  3A2V A;  1HNB A;  3LGC A;  1HQO A;  1O85 A;  1PKW A;  5CRE A;  5DJL A;  5A34 A;  4FYB A;  1BG1 A;  5JCW A;  2WFC A;  4LL1 B;  4HZ4 A;  1ERU A;  3S9F A;  2OBK A;  3EMX A;  2BTO T;  5A1N A;  5DAL A;  2GST A;  4MAB A;  4YAV A;  1R5A A;  1Z5Y E;  2PPT A;  2H1L A;  4FO5 A;  1R4W A;  3GKK A;  4YKF A;  3DD3 A;  6GSY A;  1SD9 A;  4ISD A;  3MWH A;  1KEB A;  3ZML A;  2LJA A;  4HOJ A;  3TKQ A;  1T8E B;  2IMI A;  4XS4 A;  1EV9 A;  3I69 A;  2L59 A;  1WIK A;  4GST A;  1S3C A;  4XTS A;  1AQX A;  5CYY A;  5GST A;  2KP2 A;  2EIO A;  2V41 A;  2HSY A;  3PH9 A;  2VCQ A;  3L78 A;  1XVQ A;  1TK0 B;  1XPV A;  2FA4 A;  3FZ9 A;  1EGR A;  2YZH A;  4L5O A;  4OWY A;  4BWQ A;  2V2G A;  3F0I A;  3HCZ A;  3IBH A;  5GSS A;  4N30 A;  3TJK A;  1GNE A;  1A0R P;  1NSW A;  1Y25 A;  1MTC A;  4CHS A;  4K2X A;  4EF0 A;  2DJK A;  3MAK A;  1ZCP A;  3SWL A;  4EL1 A;  2EFD A;  3CSI A;  2DIZ A;  4K7O A;  4K1F A;  3MYD A;  4JU5 A;  1PQN A;  3DXB A;  2JSY A;  2R0C A;  1WRY A;  3QR6 A;  5IPG A;  3HD5 A;  1A0F A;  4KGI A;  1XBS A;  2JAC A;  4XS6 A;  4G19 A;  2RUE A;  1N2A A;  3FKF A;  5IM9 A;  1BJX A;  4BVY B;  3HVS A;  4WEY A;  1BAY A;  4KF9 A;  5E59 A;  1H75 A;  4I8B A;  2GQL A;  3TRQ A;  3O76 A;  3LSZ A;  1QK8 A;  1K3Y A;  2QGV A;  1N25 A;  5ECH B;  3QAV A;  4PXO A;  1OC9 A;  1TK8 B;  1PMT A;  4HU7 A;  2LRT A;  1XWA A;  5F0G A;  2GGT A;  1HNC A;  2V32 A;  1Z6N A;  1FG4 A;  2DJ0 A;  1PRX A;  14GS A;  2YJ7 A;  4GQC A;  2VCV A;  4O5Q A;  3QD9 A;  2HLS A;  2C0G A;  1ML6 A;  2B1L A;  4YAP A;  4PQ1 A;  18GS A;  2R2J A;  2I3Y A;  2CVD A;  2H73 A;  4EKZ A;  4QQ7 A;  4MZC A;  3FHK A;  5J9B A;  3ZRE A;  1PD2 1;  1O73 A;  1Z9H A;  4WR4 A;  4YH2 A;  5A5K A;  4I5Q A;  4I97 A;  5IMC A;  2LV3 A;  4GCI A;  3MDK A;  1T3B A;  5ABR A;  3TJJ A;  3CTF A;  5ECO B;  2VUP A;  2L57 A;  4OO4 A;  4EDY A;  3GST A;  1SK2 A;  4N11 A;  2YCD A;  3HJM A;  2YAN A;  3Q6O A;  3IK9 A;  1KTE A;  3TU3 B;  2LKU A;  1TKD B;  2HZE B;  4K6X A;  1QFN A;  4I2T A;  3ERF A;  5G2Z A;  1ZZY A;  1YDK A;  2A2P A;  4Z2R A;  4P3Y B;  4HQS A;  2OA7 A;  3K8N A;  4F0B A;  3GUR A;  3TOT A;  4OFM A;  2FWH A;  2YV7 A;  1WMJ A;  1O81 A;  2IWT A;  4OCE A;  1YZX A;  3FR3 A;  4RI7 A;  1HYU A;  1RQM A;  17GS A;  3GN3 A;  1J08 A;  1M7T A;  3FR9 A;  4MF5 A;  2JZR A;  4MZW A;  5D93 A;  2TIR A;  1TI1 A;  1UVZ A;  4AI6 A;  3UVT A;  5ID2 A;  4PQH A;  3KP9 A;  2JAD A;  1GWC A;  3U6V A;  3MSZ A;  3CBU A;  3UMA A;  2H6X A;  2REM A;  3BCK A;  2IMF A;  4KA0 A;  2M46 A;  1Q98 A;  2YZU A;  1WPI A;  3GHA A;  3F6D A;  4DVC A;  5J4U A;  3TRX A;  5KN3 A;  1KBN A;  1X9S B;  2P31 A;  1GSE A;  1OKT A;  3M8N A;  5LCZ A;  3E0U A;  4LLR A;  4ML1 A;  5KN0 A;  4OFT A;  5B8A A;  5DBQ A;  2R5G A;  3FYG A;  2IFQ A;  4KCE A;  3KXO A;  3LQ7 A;  4AKH A;  3DRN A;  4TXO B;  3ERW A;  1W89 A;  5G31 A;  3W6G A;  2FHE A;  3QAG A;  5ECQ B;  4IEL A;  2P0G A;  2DML A;  1U6T A;  4XRA A;  2J23 A;  1SVM A;  1PSQ A;  2XBQ A;  2XHF A;  2AUV A;  3F63 A;  2DIY A;  4TVE A;  4HZ2 A;  4JBB A;  4EO3 A;  4Z2T A;  3D21 A;  1Y1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...