5J41A

Glutathione s-transferase bound with hydrolyzed piperlongumine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glutathione S-transferase P
publication title Structural and Biochemical Analyses Reveal the Mechanism of Glutathione S-Transferase Pi 1 Inhibition by the Anti-cancer Compound Piperlongumine.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5j41A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5j41A01
3C73A 4WR4A 1NHYA 2NTOA 2ZNMA 3CSHA 1EOHA 3I9V2 3GSTA 2YCDA 3HA9A 1EV9A 2VM2A 4KGIA 1TRUA 4EC0A 5B6NA 3UEMA 3VI7A 2DIZA 3HJPA 2LJAA 3KH7A 3JCML 4KB3A 3KP9A 4BA7A 1ILOA 5ID2A 3TUEA 3WGDA 1ML6A 1A0FA 4LL1B 3EMXA 4PNFA 1O85A 1OC3A 4ML6A 3U5RE 4I2TA 2H76A 2GLRA 2H6XA 2OACA 1V2AA 20GSA 2ZCTA 1TK8B 3GV1A 2K9FA 5KN0A 1T4ZA 4HUAA 5ELGA 2UZ8A 3PPUA 1Z7PA 1JLVA 3IA1A 4LLRA 2H1GA 3FK8A 3KMNA 5G2ZA 3C7MA 5ECIB 2PWJA 3IK7A 1YF0A 4ZB6A 2AHEA 1O6JA 1GRXA 2C8UA 3W6GA 1T00A 1VF2A 4HU9A 5FT3A 5G1LA 3M9JA 4PUFC 1YEXA 2L57A 5GAND 3DRNA 5G5FA 3GKKA 2FHEA 5B7CA 3TKSC 4IS0A 1DE1A 2QC7A 1EEMA 4NV5A 3GA4A 2CQ9A 1EGRA 2VLTA 2HSMB 4NHWA 3CRTA 5G30A 1LBKA 4L5OA 2H1BA 4O5RA 3FZ9A 5J41A 1GP1A 2C4JA 3HJMA 2CA8A 4BWSA 5IMZA 1XW6A 3TJGA 4GSNA 1S3AA 5KN3A 4KDXA 2HZEA 3ZL5A 4EF0A 3P8WA 4IVFA 3IAM2 4HU7A 3WT2A 6GSTA 2N5BA 4G0KA 2RUEA 5AN1A 4DVCA 3GX8A 4WKWA 4ZIJA 1ZOFA 2DIYA 5LD0A 3FYGA 3A2VA 3PGTA 3NOFA 2H66A 5DAKB 2V41A 2HSMA 3GURA 2KOKA 2H75A 1J08A 5ECOB 1XCCA 5H5RA 3VURA 3FZ5A 4ZBAA 4K0GA 9GSSA 5FWGA 3DWVA 1TI1A 1AC1A 1ON4A 1VRSD 3RPPA 4XS1A 3RBTA 1QUWA 1J0FA 5IMAA 3ZLPA 3ZFBA 3QAVA 1TRSA 4NMUA 1SD9A 2VL2C 4NAXA 3O76A 4GRFA 3TGZA 2HI7A 3TKPA 4AJ8A 3GFKA 3G7IA 5DJLA 3L0HA 1A2MA 4TR3A 1FB6A 3LYPA 5DAKA 3OR5A 3GX0A 2PERA 5GZZB 4XS4B 3HJOA 2LTKA 1GULA 4CHSA 1BYEA 3F8UA 5GAPD 3C1SA 5ABRA 3EURA 1UVZA 2CT6A 4JEDA 3BCIA 4V2MA 4G0IA 4O7HA 3FHKA 1XVQA 3VLNA 4BVYB 4YH2A 4PGTA 3QFAC 4KCAA 1FB0A 3GRXA 2H6ZA 1FG4A 2ALBA 4IP1A 2X8CA 4MK3A 1Z3EA 4XS4A 1EP8A 5ECRB 2OE3A 1IYHA 4FQUA 1PA3A 1XW9A 4K7IA 5IM9A 1UC7A 1TK5B 5EVOA 2IL3A 1SKWB 5INYA 17GSA 1PL2A 3G9BA 2LNTA 1FAAA 4AF2A 2PN8A 1SYRA 4JRRA 3H93A 4EXJA 2VD1A 2HYXA 4BVYA 2MBTA 4HS1A 1X9WB 5F07A 3UVTA 1F37A 4AJ6A 3ZRDA 3TOUA 1NW2A 2L4CA 1BG5A 5CO3A 5HQPA 4PUAA 5FHIA 5IOXA 1E2YA 3QPMA 4OO4A 4ZB8A 5H5QA 6GSSA 1X5DA 4LL4B 5D9VA 1WPIA 1XWKA 4IQAA 1H75A 1K0CA 1OKDA 3WGEA 1B8XA 4P3YB 5IO2A 1XOAA 2P31A 3LQ7A 1OAZA 1OE8A 3GL3A 4WF5A 1GWCA 3RAZA 2LKUA 2QSIA 4E8EA 3LYKA 3S9FA 1F3BA 1SJ6A 4NPBA 3U6VA 5D9TA 1LJRA 4OFTA 1A8YA 3AY8A 4IJ3A 4TR4A 1BJXA 1A2LA 3NIVA 4D73B 4NWYA 4MF5A 3GMFA 1OVNA 4N0ZA 2PPTA 3UL3A 1TRWA 2N5AA 3A2XA 3EWLA 1XBSA 1YY7A 5CREA 4OO5A 3Q6OA 4NXIA 2GZPA 1M0UA 3ZMKA 4L8EA 4Q5FA 3P90A 5CRGA 3HD5A 4ZL7A 2MMOA 4EDZA 3F9UA 2OA7A 2P5RA 2HSNB 5HR3A 3HVSA 1X9SB 2X8HA 1F2EA 1PQNA 4MCUA 1EWXA 5A5KA 4D73A 1ZMAA 5A4UA 4HQSA 4ILFA 1YQ1A 1K3OA 3M3MA 3Q19A 1KTEA 2B7KA 1PN9A 4YQVA 1EGOA 1F6MC 3FEUA 2LNSA 1Z7RA 1GH2A 1M9AA 3F4RA 1T7PB 4HJ2A 5J4UA 4JE1A 1JZRA 3KD0A 3IXRA 1JZWA 3IBHA 4KCEA 4DSSB 2GZZA 3IPZA 2B1KA 3G7YA 4XHMA 1ERUA 4G10A 4POBA 1GTAA 2N5FA 1A0RP 1OC9A 1NHOA 3LG6A 4KAEA 3FRCA 5ECQB 1ACVA 1URMA 4FO5A 2XPEA 1V40A 5JCGA 2KHPA 3GH6A 2E2MA 4MF7A 3F4TA 4GTUA 1G6WA 3W8JA 1AAZA 1FVKA 2FWEA 1XZOA 1GUHA 3F4SA 4MZCA 5IMFA 2YOIA 1UN2A 1Q98A 2O7KA 4MMMA 2ON5A 5E4WA 5F06A 1V57A 2K8SA 2I81A 3CBUA 2CX3A 3GTUB 1B9YC 5IPGA 2I9HA 3HVXA 4GWRA 5H5SA 1T8EB 5D9XA 1O7UA 4JBBA 2YWMA 1SU9A 1UA5A 2C0EA 3CSIA 2VD0A 2IFQA 2CVKA 2DBCA 2JSZA 3TKSE 2H74A 6GSYA 1EEJA 1TXXA 4TN8A 3KIJA 1KEBA 3KH9A 5IPHA 2FA4A 1RQMA 2GQMA 1MDKA 2H0IA 2XHFA 2LRCA 3GHAA 3FZAA 5B6MA 2IPAA 2LQQA 5D9WA 4YAVA 2C3TA 1HD2A 2F51A 3IR4A 3CYNA 3IOSA 2DJ1A 3LORA 4IQ1A 3TRPA 4PX1A 4DEJA 1TK0B 3BD2A 1BQ7A 3H79A 4I5QA 3GIXA 5DQSA 3FW2A 1A24A 3LWAA 4HOJA 3D5JA 3EU3A 2FWGA 1M9BA 4WEYA 1XFLA 2I3YA 3BCKA 4NV2A 3TJBA 2DSAA 2L6DA 5JCWA 1RW1A 5HR0A 2H0HA 2KUCA 1OKTA 5A4VA 2HSHA 2VIMA 1ZL9A 3QFBC 3M1GA 3KTLA 4EL1A 1DSBA 3VWWA 5HR2A 3FZ4A 3CSJA 2REMA 3IDVA 4F0BA 1GNEA 1WE0A 2TRCP 1ST9A 2V6KA 2L4QA 4PNGA 6GSWA 2B5YA 4MZWA 1Z5YE 1Y25A 3DIEA 4K8MA 3CMIA 2WB9A 4FYUA 2H73A 5CNWA 5L71A 1DUGA 2FCHA 4O32A 2L5OA 4ULXA 3ERFA 3KM6A 2ZUPA 5CYYA 2YPMA 2G2QA 2YNXA 2AUVA 5J9CA 5IQYA 4WR5A 3R2QA 4KH7A 3GKMA 2VLVA 2O8VB 3LEFA 3WD6A 1M7TA 2X8GA 2RIIA 4USSA 4BL7B 2IMDA 1NM3A 2AYTA 1VF1A 4ECBA 4EO3A 4LA1A 4TXOB 2FNOA 4POMA 1AW9A 3KMOA 3BOAA 4CW9A 3L9SA 2EIRA 2LRNA 3D0ZA 4H86A 2PBJA 3KEBA 1I9DA 5J5NA 3H1NA 2F9SA 2YV9A 4RI7A 1DE2A 2VO4A 3RPNA 1M2DA 5KN2A 4MABA 1XWBA 2BTOT 3FKFA 1I5GA 4BL7A 2GZYA 2RLIA 2GS3A 4F9ZA 4TXOA 2A4VA 3GSSA 1N2AA 1T3BA 1TDIA 2KP1A 3WGXA 3I6AA 5F0GA 1V9WA 1EV4A 5E59A 3DYRA 2VL3A 1XXUA 2VAFA 3VI5A 5ELAA 4TR1B 2VL9A 4HZ4A 2YV7A 1E6BA 1SJIA 4ISDA 3ZVJD 1R26A 1T1VA 18GSA 1PD21 2M80A 2XBQA 3C8EA 1GSFA 2HRKB 2VCVA 4PXOA 1JZOA 2LJRA 1CQGA 5EL8A 4BWQA 3WYWA 2FLSA 1XOBA 1GSEA 1U88A 3H4KA 1A2JA 2P0GA 2WCIA 4TR1A 4ML1A 5HFIA 5ECKB 1SL1B 3UVHA 4YQMA 3ERWA 2C3QA 2FA8A 1M2AA 2D2ZA 1LU4A 4I6XA 1FO5A 1PX7A 5DQYA 2HRKA 2NDOA 2H30A 2Z9SA 4F03A 2PVOC 4GSSA 2V2GA 5DVBA 2AAWA 1XPVA 3EE2A 2HE3A 4AGSA 3J7Yb 4JZQA 22GSA 2CV4A 3F63A 2IMIA 3APOA 19GSA 2PGTA 3APQA 1OYJA 2C0DA 4Q5RA 2YWIA 3EC3A 3ME8A 4CDOA 2H6YA 2M72A 6GSUA 2VUPA 3KP8A 1GSDA 4FYBA 2CAIA 1TW9A 2O85A 2PMTA 3ISOA 1G7OA 5CAXA 1WIKA 4I97A 4HJMA 4K1FA 3IRAA 1HNBA 3MAKA 3QDNA 3C1RA 4XCSA 5LNKe 2YANA 1SK1A 3EINA 3H8QA 2WJUA 3KXOA 1TJDA 3ERGA 2O87A 1M2BA 3A3TA 3GKNA 5AISA 2ON7A 1DBYA 4OWYA 2V6OA 4GSTA 3HZ4A 4Z7XA 2WRTA 3QOUA 3LGCA 4Q5QA 2L59A 1GUKA 2P5QA 1K0OA 3M8NA 4POLA 1GLQA 2DJ2A 5HR1A 1K0AA 2IMFA 2A2RA 1MDJA 2GGTA 1T4YA 4QL7A 2HXKA 4PQ1A 2C0GA 4KX4A 1K0DA 3R3EA 1TOFA 2BJXA 1THOA 2JACA 4MJEA 1YF1A 2WZ9A 5EPFA 2VCQA 5JWQB 4AJ7A 2TIRA 4RQRA 4V1Ag 4LMVA 1ZGNA 3HY2A 1USBA 4QQ7A 4PTSA 1YDKA 3QAWA 4IBPA 3ZREA 1GNWA 1PKWA 3TJFA 4ACSA 1X5EA 4HZ2A 2HFDA 4F82A 1W4VA 5F8BA 4IJIA 2DJ3A 1SL0B 10GSA 4IELA 1MTCA 4HDEA 5AGYA 4GCIA 4ZL9A 1A23A 4TRXA 2LS5A 3MSZA 2JU5A 12GSA 1X5CA 11GSA 4PQIA 3UAPA 5COHA 3CTFA 3I69A 1Z6NA 5G1KA 1SYXA 1TU8A 1X0RA 2K6VA 4POKA 4XIHA 2PU9C 3DVXA 1WWJA 1AQVA 4KUNA 3HDCA 2YWNA 1SKSB 3D22A 1ABAA 3D4MA 3A2WA 2F8FA 7GSSA 2HRAA 1PKZA 2YP6A 2DJJA 4TKYA 2XPDA 4WF4A 2FY6A 1GSQA 5D93A 4EUYA 3ZVJA 4JU5A 1TP9A 1ZYEA 1OE7A 1TI3A 3HCZA 4K0NA 2MBSA 3FR6A 4ECJA 1R7HA 3GYKA 2OE0A 4NHZA 3D4TA 2GT6A 2NVLA 5D73A 3VPQA 1TTZA 4KSOA 4PURA 4DSSA 3TRQA 3DMLA 2DMLA 5D8IA 4KW6A 3V1WA 4V1Ap 2XC2A 2TRXA 2X64A 2YN1A 3DGQA 3HZ8A 3VWUA 5DALB 4J2FA 5B8AA 3DVWA 4KSMA 4KNDA 2MMNA 3E9JB 2IMKA 1XVWA 1X9MB 3ZTLA 4EVMA 3PR8A 1Q4JA 4XRAA 3QCPA 3IAS2 2OBKA 2QKEA 1PRXA 2MMAA 3CRUA 1QXHA 3O3TA 5AIXA 2GSSA 4OD7A 6GSXA 3VWXA 4GXZA 2C80A 2JSYA 4EDYA 5GSTA 3F6DA 2B1LA 2MYGA 3GTUA 4ECIA 2JADA 2R6KA 1HYUA 2K18A 5AIVA 2H1DA 2HSYA 4G2EA 2GVPA 3J7Yk 1K0BA 1JFUA 3LJRA 1PMTA 1O8WA 1H4OA 5IO0A 2HQTA 2HRFA 1K0NA 4WETA 5ID2B 3L9UA 4GLTA 3SWLA 1AQWA 3GN3A 2WULA 3FR9A 3GNJA 1MD3A 3UMAA 3IK9A 4WBRD 1GSUA 4MJCA 3DEXA 1ZZYA 2H01A 2C0FA 1JLWA 2R4VA 2HNLA 2F8AA 1MD4A 2PVQA 2YWOA 2FWHA 8GSSA 3PH9A 16GSA 4BVXB 2WGRA 1FOVA 4QL9A 4DSQA 4MP4A 1YEPA 5IOWA 5IMVA 4EKZA 2DC5A 3A5WA 3UJ1A 3M0FA 3DKSA 4MDCA 2GSRA 2RUFA 2H1AA 1YZXA 2DJ0A 2HLSA 2GT5A 1GL8A 1OC8A 3TKRA 4J57E 1SKRB 1GSYA 4X43A 1M99A 5C00A 1SJZA 1QFNA 4TXVA 1K3YA 2HT9A 4L0WA 2L5LA 1AIUA 3HHVA 1U87A 1GTBA 4FYCA 2VCTA 3RHBA 3HXSA 3EMPA 1EOGA 4BVXA 5CRHA 2AB6A 4GF0A 2XBIA 5F05A 3KGKA 3EVIA 1VF3A 3IE3A 2C1YA 4OFMA 3IV4A 2OE1A 2F3MA 3P2AA 5J9BA 2WS2A 4MZBA 1V98A 4TW5A 1G0TA 3SBCA 1QMVA 2FGXA 1WRYA 4XRDA 5EY6A 2CX4A 5DDLA 1FHEA 2IJYA 2HZEB 4HI7A 1WMJA 5HFKA 4RQXA 1MEKA 3TKSA 4KDUA 1SK0A 3WT1A 3QR6A 3IC4A 3I43A 3LFLA 4G19A 4X0XA 1WOUA 4BPYA 4WXTA 3E3EA 1XWCA 1ERTA 1EP7A 4N11A 2OKAA 1SK2A 2KP2A 2GSQA 2B3SA 1THXA 3ME7A 4HQZA 3UBKA 2H72A 1XWAA 1AXDA 1K0MA 3QMXA 2R3XA 4JR6A 1R4WA 2K8VA 2VM1A 3MDKA 3TJKA 4L0UA 1Y6EA 2JZRA 3MWHA 4LMWA 5ECSA 5ECPB 5ECHB 4K7NA 4TOPA 1A8LA 4IGJA 4WBJA 2YZUA 1GSSA 3UARA 13GSA 4O92A 4HEA2 1B9XC 4MA9A 2EIOA 2OBIA 4RI6A 4OCFA 4ID0A 3GUSA 5KN1A 4ZL8A 4ECCA 4PQHA 2WDUA 2VL2A 1VGLA 4GQFA 2YJ7A 3ZMLA 3BJ5A 1Z6MA 1QQ2A 3UBLA 3D6IA 3L9VA 3MNGA 4XTSA 3VFIA 1PL1A 4KE3A 3ZFLA 3GH9A 2NBSA 5DCGA 1YKCA 3UOMA 2H70A 4TR0A 2NPBA 4L5LA 2RM6A 4IKHA 5CP1A 4TVEA 2R5GA 3M9KA 3ZITA 5B8BA 5DCHA 5ECLB 1KBNA 1ERWA 3EU4A 2IWTA 2GSTA 3CXGA 2GTUA 3QAGA 1PX6A 1QGVA 5IMCA 1GTUA 2AV4A 1C72A 3LXTA 3Q74A 2E0QA 1ZYQB 2EC4A 3TOTA 2V32A 2AJQB 3C71A 3PINA 5JWOB 2A2SA 1W89A 2LQOA 5G31A 1EZKA 5C04A 4MJBA 3HYPA 3G7JA 4K7OA 2JZSA 3CTGA 2H0GA 1KNGA 1G6YA 1S3CA 3RDWA 4I8BA 4MLYA 2FD3A 2X99A 4OMVA 5A4WA 4KA0A 2B5EA 2M46A 2V1MA 1XW5A 5D96A 3ED3A 3RHCA 2MZCA 2KLXA 1O73A 2HZFA 1QK8A 2LJKA 5GSSA 2B7JA 4MH2A 1V58A 3KZQA 5G5EA 3D21A 2RM5A 3VWVA 3APSA 2H71A 2R37A 2BMXA 4RUVA 4G0LA 4FIWA 5JWRB 3ZIJA 3TCOA 1R5AA 4IP6A 2YZHA 3IC8A 1S3DA 4MF6A 3ZIVA 2J23A 1GUMA 1AQXA 5IIZA 3NZNA 1N8JA 1O8XA 2VCXA 3O6TA 2VCZA 1J9BA 2HRNA 4J56E 3US3A 2VLUA 4YAPA 14GSA 3TJJA 1GTIA 1WP0A 2DLXA 3HVVA 1BEDA 1YJ6A 2O89A 2GQLA 2LSTA 1SENA 4YQUA 4ZILA 1NSWA 3UIWA 1JZDA 2C3NA 2CVDA 5KEJA 3K8NA 4OCEA 2CAQA 4F0CA 3QD9A 3HKRA 2LV3A 1WJKA 4MJAA 3KJYA 6GSVA 3F6FA 2E2GA 1GLPA 4V2NA 3L4NA 1O81A 4ZBDA 4GQCA 2GDRA 1G7EA 4FH8A 1F3AA 1JHBA 1XWGA 2VCWA 3Q18A 5ECMB 1U6TA 4KDYA 3TRXA 1HNAA 2DJKA 3N5OA 1OC9B 3DD3A 2H19A 5J3RA 4MPGA 2IN3A 5HFGA 5DJMA 4ZB9A 2OADA 2EIQA 4K2DA 4E8HA 1BAYA 1U3IA 3N9JA 2CZ2A 5IMDA 2J9HA 1B4QA 4K9ZA 1TRVA 3W8SA 4DSRA 1K3LA 2R2JA 2LRTA 1TKDB 3DXBA 2B5XA 1AUCA 2CZ3A 3FY7A 4K6XA 2IMEA 3F3RA 1YKAA 1SL2B 4MPFA 4ZBBA 2ES7A 1ZCPA 2GQKA 4MH3A 3ZYWA 2IFQB 3P7XA 2G0FA 2LUSA 4IW9A 4I2UA 4G9HA 3F0IA 1CQHA 3BBYA 2FUG2 2PUKC 1R5PA 1SD8A 5JCUA 4F2IA 2IIYA 2JZTA 3L78A 1BX9A 5LCZA 1HQOA 4V2LA 5ECNB 3TB2A 1IYIA 1FVJA 1B48A 2E7PA 3VK9A 4IN0A 4N10A 2YJHA 1PGTA 2JL4A 2OJLA 1XIYA 2B6MA 3KCMA 1ERVA 3FR3A 1U3AA 1PSQA 2H8LA 2VOCA 1MDIA 2LEGA 4KF9A 3KTBA 1VF4A 3VPTA 2FWFA 5BMUA 3EYTA 2I1UA 1Z9HA 4OFNA 3ZZXA 5DBQA 5ENUA 5DALA 3TDGA 2L6CA 3TKQA 1HNCA 4N0VA 2QGVA 1RK4A 4Q5NA 2I4AA 3LSZA 2WFCA 1FW1A 1TU7A 4XS6A 1B4PA 3GKXA 4JR4A 2MMZA 4IHUA 3LXZA 3IHQA 5CRDA 4N30A 3GL5A 5CRWA 1F9MA 2DMMA 4ZXGA 4EE0A 3F3QA 2CVBA 3E0UA 4X1UA
chains in the Genus database with same CATH superfamily
3C73A 4WR4A 1NHYA 2NTOA 2ZNMA 3CSHA 1EOHA 3I9V2 3GSTA 2YCDA 3HA9A 1EV9A 2VM2A 4KGIA 1TRUA 4EC0A 5B6NA 3UEMA 3VI7A 2DIZA 3HJPA 2LJAA 3KH7A 3JCML 4KB3A 3KP9A 4BA7A 1ILOA 5ID2A 3TUEA 3WGDA 1ML6A 1A0FA 4LL1B 3EMXA 4PNFA 1O85A 1OC3A 4ML6A 3U5RE 4I2TA 2H76A 2GLRA 2H6XA 2OACA 1V2AA 20GSA 2ZCTA 1TK8B 3GV1A 2K9FA 5KN0A 1T4ZA 4HUAA 5ELGA 2UZ8A 3PPUA 1Z7PA 1JLVA 3IA1A 4LLRA 2H1GA 3FK8A 3KMNA 5G2ZA 3C7MA 5ECIB 2EFHA 2PWJA 3IK7A 1YF0A 4ZB6A 2AHEA 1O6JA 1GRXA 2C8UA 3W6GA 1T00A 1VF2A 4N3ZA 4HU9A 5FT3A 5G1LA 3M9JA 4PUFC 3TU3B 1YEXA 2L57A 5GAND 3DRNA 2DKIA 5G5FA 3GKKA 2FHEA 5B7CA 3TKSC 4IS0A 1DE1A 2QC7A 1EEMA 4NV5A 3GA4A 2CQ9A 1EGRA 2VLTA 2HSMB 4NHWA 3CRTA 2A2PA 5G30A 1LBKA 4L5OA 2H1BA 4O5RA 3FZ9A 5J41A 1GP1A 2C4JA 3HJMA 2CA8A 4BWSA 5IMZA 1XW6A 3TJGA 4GSNA 1S3AA 5KN3A 4KDXA 2HZEA 3ZL5A 4EF0A 3P8WA 4IVFA 3IAM2 4HU7A 3WT2A 3MIXA 6GSTA 2N5BA 4G0KA 2RUEA 5AN1A 4DVCA 3GX8A 4WKWA 4ZIJA 1ZOFA 2DIYA 5LD0A 3FYGA 3A2VA 3PGTA 3NOFA 2OT3A 2H66A 5DAKB 2V41A 2HSMA 3GURA 2KOKA 2H75A 1J08A 1ZYNA 5ECOB 1XCCA 5H5RA 3VURA 3FZ5A 4ZBAA 4K0GA 9GSSA 5FWGA 3DWVA 1TI1A 1AC1A 1ON4A 1VRSD 3RPPA 4XS1A 3RBTA 1QUWA 1J0FA 4CY6A 3ZLPA 5IMAA 3ZFBA 3QAVA 1TRSA 4NMUA 1SD9A 2VL2C 4NAXA 3O76A 4GRFA 3TGZA 2HI7A 3TKPA 4AJ8A 3GFKA 3G7IA 5DJLA 3L0HA 1A2MA 4TR3A 1FB6A 3LYPA 5DAKA 3OR5A 3GX0A 2PERA 5GZZB 4XS4B 3HJOA 1SVLA 2LTKA 1GULA 4CHSA 1BYEA 3F8UA 5GAPD 3C1SA 5ABRA 3EURA 1UVZA 2CT6A 4JEDA 1FOHA 3BCIA 4V2MA 2VKZG 4G0IA 4O7HA 3FHKA 1XVQA 1TXUA 3VLNA 4BVYB 4YH2A 4PGTA 3QFAC 4KCAA 4FXYP 1FB0A 3GRXA 2H6ZA 1FG4A 2ALBA 4IP1A 2X8CA 4MK3A 1Z3EA 4XS4A 1EP8A 5ECRB 2OE3A 1IYHA 4FQUA 1PA3A 1XW9A 4K7IA 5IM9A 1UC7A 1TK5B 5EVOA 2IL3A 1SKWB 5INYA 17GSA 1PL2A 3G9BA 2LNTA 1FAAA 4AF2A 2PN8A 1SYRA 4JRRA 3H93A 4EXJA 2VD1A 2HYXA 4BVYA 2MBTA 4HS1A 1X9WB 5F07A 3UVTA 1F37A 4AJ6A 3ZRDA 3TOUA 1NW2A 2L4CA 1BG5A 5CO3A 5HQPA 4PUAA 5FHIA 5IOXA 1E2YA 3QPMA 4OO4A 2WZSA 4ZB8A 5H5QA 3CHXC 6GSSA 1SVOA 1X5DA 4LL4B 4K5RA 5D9VA 1WPIA 1XWKA 4IQAA 1H75A 1K0CA 1OKDA 3WGEA 1B8XA 4P3YB 5IO2A 1XOAA 2P31A 3LQ7A 1OAZA 4GDFA 1OE8A 2R0PA 3GL3A 4WF5A 1GWCA 3RAZA 2LKUA 2QSIA 4E8EA 3LYKA 3S9FA 1F3BA 1SJ6A 4NPBA 2A4HA 3U6VA 5D9TA 1LJRA 4OFTA 1A8YA 3AY8A 4IJ3A 4TR4A 1BJXA 1A2LA 3NIVA 4D73B 4NWYA 4MF5A 3GMFA 1OVNA 4N0ZA 2PPTA 3UL3A 1TRWA 2N5AA 3A2XA 3EWLA 2WW0A 1XBSA 1YY7A 5CREA 4OO5A 3Q6OA 4NXIA 2GZPA 1M0UA 3ZMKA 4L8EA 4Q5FA 3P90A 5CRGA 3HD5A 4ZL7A 2MMOA 4EDZA 3F9UA 2OA7A 2P5RA 2HSNB 5HR3A 3HVSA 1X9SB 2X8HA 1F2EA 1PQNA 4MCUA 1EWXA 5A5KA 4D73A 4YKGA 1ZMAA 5A4UA 4HQSA 4ILFA 1YQ1A 1K3OA 3M3MA 3Q19A 1KTEA 2B7KA 1PN9A 4YQVA 1EGOA 1F6MC 3FEUA 2LNSA 1Z7RA 1GH2A 1M9AA 3F4RA 1T7PB 4HJ2A 5J4UA 4JE1A 1JZRA 3KD0A 3IXRA 1JZWA 2HSNA 3IBHA 4KCEA 4DSSB 2GZZA 3IPZA 2B1KA 3G7YA 4XHMA 1ERUA 4G10A 4POBA 1GTAA 2N5FA 1A0RP 1OC9A 1NHOA 3LG6A 4KAEA 3FRCA 5ECQB 1ACVA 1URMA 4FO5A 2XPEA 1V40A 5JCGA 2KHPA 3GH6A 2E2MA 4MF7A 3F4TA 4GTUA 1G6WA 3W8JA 1AAZA 1FVKA 2DKHA 2FWEA 1XZOA 1GUHA 3F4SA 4MZCA 5IMFA 2YOIA 1UN2A 1Q98A 2O7KA 4MMMA 2ON5A 5E4WA 5F06A 1V57A 2K8SA 2I81A 3CBUA 2CX3A 3GTUB 1B9YC 5IPGA 2I9HA 3HVXA 4GWRA 5H5SA 1T8EB 5D9XA 1O7UA 4JBBA 2YWMA 1SU9A 1UA5A 5KOXA 2C0EA 4PI2C 3CSIA 1SVMA 2VD0A 2IFQA 2CVKA 2DBCA 2JSZA 3TKSE 2H74A 6GSYA 1EEJA 1TXXA 4TN8A 3KIJA 1KEBA 3KH9A 5IPHA 2FA4A 1RQMA 2GQMA 2H0IA 1MDKA 3HMJG 2LRCA 2XHFA 3GHAA 3FZAA 5B6MA 2IPAA 2LQQA 2WVXB 5D9WA 4YAVA 2C3TA 1HD2A 2F51A 4CY8A 3IR4A 3CYNA 3IOSA 2DJ1A 3LORA 4IQ1A 3TRPA 4PX1A 4DEJA 1TK0B 3BD2A 1BQ7A 3H79A 4I5QA 3GIXA 5DQSA 3FW2A 1A24A 3LWAA 4HOJA 3D5JA 3EU3A 2FWGA 5KOWA 1M9BA 4WEYA 1XFLA 2I3YA 3BCKA 4NV2A 3TJBA 2DSAA 2L6DA 5JCWA 2QA2A 1RW1A 5HR0A 2H0HA 2KUCA 1OKTA 5A4VA 2HSHA 2WVXA 2VIMA 1ZL9A 3QFBC 3M1GA 3KTLA 4EL1A 1DSBA 3VWWA 5HR2A 3FZ4A 3CSJA 2REMA 3IDVA 4F0BA 1GNEA 1WE0A 4O5UA 2TRCP 1ST9A 2V6KA 2L4QA 4PNGA 6GSWA 2B5YA 4MZWA 1Z5YE 1Y25A 3DIEA 4K8MA 3CMIA 2WB9A 4FYUA 4AKGA 2H73A 5CNWA 3A5IA 1DUGA 5L71A 5A5HB 2FCHA 4O32A 1PN0A 2L5OA 4ULXA 3ERFA 3KM6A 2ZUPA 3EPTA 5CYYA 2UV8G 4E68A 2YPMA 2G2QA 2YNXA 2AUVA 5J9CA 5IQYA 4WR5A 3R2QA 4KH7A 5J47A 3GKMA 2VLVA 2O8VB 3LEFA 3WD6A 1M7TA 2X8GA 2RIIA 4USSA 4BL7B 2IMDA 1NM3A 2AYTA 1VF1A 4ECBA 4EO3A 5A5HA 4A5PA 4LA1A 4TXOB 2FNOA 4POMA 1AW9A 3KMOA 3BOAA 4CW9A 3L9SA 2EIRA 2LRNA 3D0ZA 4H86A 2PBJA 3KEBA 1I9DA 5J5NA 3H1NA 2F9SA 2YV9A 4RI7A 1DE2A 2VO4A 3RPNA 2X4AA 1M2DA 5KN2A 4MABA 1XWBA 2BTOT 3FKFA 1I5GA 4BL7A 2GZYA 2RLIA 2GS3A 4F9ZA 4TXOA 2A4VA 3GSSA 1N2AA 1T3BA 1TDIA 2KP1A 3WGXA 3I6AA 5F0GA 1V9WA 1EV4A 5E59A 3DYRA 2VL3A 4AI6A 1XXUA 2VAFA 3VI5A 5ELAA 4TR1B 2VL9A 4HZ4A 2YV7A 1E6BA 1SJIA 4ISDA 3ZVJD 1R26A 1T1VA 18GSA 1PD21 2M80A 2XBQA 3C8EA 1GSFA 2HRKB 2VCVA 4PXOA 4K2XA 1JZOA 2LJRA 1CQGA 5EL8A 4BWQA 3WYWA 2FLSA 1XOBA 1GSEA 1U88A 3H4KA 4MNNA 1A2JA 2P0GA 2WCIA 4EIPA 4TR1A 4ML1A 5HFIA 5ECKB 1SL1B 3UVHA 4PI0C 4YQMA 3ERWA 2C3QA 2FA8A 1M2AA 2D2ZA 1LU4A 4I6XA 1FO5A 1PX7A 5DQYA 2HRKA 2NDOA 2H30A 2Z9SA 4F03A 4O5QA 2PVOC 4GSSA 2V2GA 5DVBA 2AAWA 1XPVA 3EE2A 2HE3A 4AGSA 3J7Yb 4JZQA 22GSA 2CV4A 3F63A 2IMIA 3APOA 19GSA 2PGTA 3APQA 1OYJA 2C0DA 4Q5RA 2YWIA 3EC3A 3ME8A 4CDOA 2H6YA 2M72A 6GSUA 2VUPA 3KP8A 1GSDA 2O36A 4FYBA 2CAIA 1TW9A 2O85A 2PMTA 3ISOA 1G7OA 5CAXA 1WIKA 4I97A 4HJMA 4K1FA 3IRAA 1HNBA 3MAKA 3QDNA 3C1RA 4XCSA 4EIQA 3RGBC 5LNKe 2YANA 1SK1A 3EINA 3H8QA 2WJUA 3KXOA 1TJDA 3ERGA 2O87A 1M2BA 3A3TA 3GKNA 5AISA 2ON7A 1DBYA 4OWYA 2V6OA 4GSTA 3HZ4A 4Z7XA 1ZYPA 2WRTA 3QOUA 3LGCA 1M3IA 4Q5QA 2L59A 1GUKA 2P5QA 1K0OA 3M8NA 4POLA 2R0GA 1GLQA 2DJ2A 5HR1A 1K0AA 2IMFA 2H1LA 2A2RA 1MDJA 2GGTA 1T4YA 4QL7A 2HXKA 4PQ1A 2C0GA 4KX4A 1K0DA 3R3EA 1TOFA 2BJXA 1THOA 2JACA 4MJEA 1YF1A 2WZ9A 5EPFA 4Z2RA 2VCQA 5JWQB 4AJ7A 2TIRA 4RQRA 3IHGA 4V1Ag 4LMVA 1ZGNA 3HY2A 1USBA 4QQ7A 4PTSA 1YDKA 3QAWA 4IBPA 3ZREA 1GNWA 1PKWA 3TJFA 4ACSA 1X5EA 4HZ2A 2HFDA 4F82A 1W4VA 5F8BA 4IJIA 2DJ3A 1SL0B 10GSA 4IELA 1MTCA 4HDEA 5AGYA 4GCIA 4ZL9A 1A23A 4TRXA 2LS5A 3MSZA 2JU5A 12GSA 1X5CA 11GSA 4PQIA 3UAPA 5COHA 3CTFA 3I69A 5A34B 1Z6NA 5G1KA 1SYXA 1TU8A 1X0RA 2K6VA 4POKA 4AKIA 4XIHA 2PU9C 3DVXA 1WWJA 1AQVA 4KUNA 3HDCA 2YWNA 2O5VA 1SKSB 3D22A 1ABAA 3D4MA 3A2WA 2F8FA 7GSSA 2HRAA 1PKZA 2YP6A 2DJJA 4TKYA 2XPDA 4WF4A 2FY6A 1GSQA 5D93A 4EUYA 3ZVJA 4JU5A 1TP9A 1ZYEA 1OE7A 1TI3A 3HCZA 4K0NA 2MBSA 3FR6A 4ECJA 1R7HA 3GYKA 2OE0A 4NHZA 3D4TA 2GT6A 3RFRC 2NVLA 5D73A 3VPQA 1TTZA 4KSOA 4PURA 4DSSA 3TRQA 3DMLA 2DMLA 5D8IA 2WW1A 4KW6A 3V1WA 4V1Ap 2XC2A 2TRXA 2X64A 2YN1A 3DGQA 3HZ8A 3VWUA 2O3EA 5DALB 5J40A 4J2FA 5B8AA 3DVWA 4KSMA 4KNDA 2MMNA 1PFOA 3E9JB 2IMKA 1XVWA 1X9MB 3ZTLA 4EVMA 3PR8A 1Q4JA 4XRAA 3QCPA 3IAS2 2OBKA 2QKEA 1PRXA 2MMAA 3CRUA 1QXHA 2WVYA 3O3TA 5AIXA 2GSSA 4OD7A 6GSXA 3VWXA 4GXZA 2C80A 2JSYA 4EDYA 5GSTA 3F6DA 1Y1UA 2B1LA 2MYGA 3GTUA 4ECIA 2JADA 2R6KA 1HYUA 2K18A 5AIVA 2H1DA 2HSYA 4QMKA 4G2EA 1S4BP 2GVPA 3J7Yk 1K0BA 1JFUA 3LJRA 4BIKA 1PMTA 1O8WA 3CWGA 1H4OA 5IO0A 2HQTA 2HRFA 1K0NA 4WETA 2R0CA 5ID2B 2WW2A 3L9UA 4GLTA 3SWLA 1AQWA 3GN3A 2WULA 4AKXB 3FR9A 3GNJA 1MD3A 3UMAA 3IK9A 4WBRD 1GSUA 4MJCA 3DEXA 1ZZYA 2H01A 2C0FA 1JLWA 2R4VA 2HNLA 2F8AA 1MD4A 2PVQA 2YWOA 2FWHA 8GSSA 3PH9A 16GSA 4BVXB 2WGRA 1FOVA 5J4VA 4QL9A 4DSQA 4MP4A 1YEPA 5IOWA 5IMVA 4EKZA 2DC5A 3A5WA 3UJ1A 4YKFA 3M0FA 3DKSA 4MDCA 2GSRA 2RUFA 2H1AA 1YZXA 2DJ0A 2HLSA 2GT5A 1BG1A 1GL8A 1OC8A 3TKRA 4J57E 1SKRB 1GSYA 4X43A 1M99A 5C00A 1SJZA 1QFNA 4TXVA 1K3YA 2HT9A 4L0WA 2L5LA 1AIUA 3HHVA 1U87A 1GTBA 4FYCA 2VCTA 2QA1A 3RHBA 3HXSA 3EMPA 1EOGA 4BVXA 5CRHA 5A1NB 2AB6A 4GF0A 2XBIA 5F05A 3KGKA 3EVIA 1VF3A 3IE3A 2C1YA 4OFMA 3IV4A 2OE1A 5BRTA 2F3MA 3P2AA 5J9BA 2WS2A 4MZBA 1V98A 4TW5A 1G0TA 3SBCA 3CQFA 1QMVA 2FGXA 1WRYA 4XRDA 5EY6A 2CX4A 5DDLA 1FHEA 2IJYA 2HZEB 4HI7A 1XG8A 1WMJA 5HFKA 4RQXA 1MEKA 3TKSA 1S3RA 5A1NA 4KDUA 1SK0A 3WT1A 3QR6A 3IC4A 3I43A 3LFLA 4G19A 4X0XA 1WOUA 4BPYA 4WXTA 3E3EA 1XWCA 1ERTA 1EP7A 4N11A 2OKAA 1SK2A 2KP2A 2GSQA 2B3SA 1THXA 2EFDA 3ME7A 4HQZA 3UBKA 1I1IP 2H72A 1XWAA 1AXDA 1K0MA 3QMXA 4X4JA 2R3XA 4JR6A 1R4WA 2K8VA 2VM1A 3MDKA 3TJKA 4L0UA 1Y6EA 2JZRA 3MWHA 4LMWA 5ECSA 5ECPB 5ECHB 4ZB7A 4TOPA 1A8LA 4K7NA 4IGJA 4WBJA 1YVLA 2YZUA 1GSSA 3UARA 13GSA 4O92A 2X49A 4HEA2 1B9XC 4MA9A 2EIOA 2OBIA 4RI6A 4OCFA 4ID0A 3GUSA 5KN1A 2EFEA 1BF5A 4ZL8A 4ECCA 4PQHA 2WDUA 2VL2A 3HVNA 4HSCX 1VGLA 4GQFA 2YJ7A 3ZMLA 3BJ5A 1Z6MA 1QQ2A 3UBLA 3D6IA 3L9VA 3MNGA 4XTSA 3VFIA 1PL1A 4KE3A 3ZFLA 3GH9A 4Z2TA 2NBSA 5DCGA 1YKCA 4K5SA 3UOMA 2H70A 4TR0A 2NPBA 3MYDA 1YEWC 4L5LA 2RM6A 4AKHA 4IKHA 5CP1A 4TVEA 2R5GA 3M9KA 3ZITA 5B8BA 5DCHA 2WW3A 5ECLB 1KBNA 1ERWA 3EU4A 2IWTA 2GSTA 3CXGA 2GTUA 3QAGA 1PX6A 1QGVA 5IMCA 1GTUA 2AV4A 1C72A 3LXTA 3Q74A 2E0QA 1ZYQB 2EC4A 3TOTA 2V32A 2AJQB 3C71A 3PINA 5JWOB 4W66A 2A2SA 1W89A 2LQOA 5G31A 1EZKA 5C04A 4MJBA 3HYPA 3G7JA 4K7OA 2JZSA 3CTGA 2H0GA 1KNGA 1G6YA 1S3CA 3RDWA 4I8BA 4MLYA 2FD3A 2X99A 4OMVA 5J4YA 5A4WA 4KA0A 2B5EA 2M46A 2V1MA 1XW5A 5D96A 3ED3A 2EFCA 3RHCA 2MZCA 2KLXA 1O73A 2HZFA 1QK8A 2LJKA 5GSSA 2B7JA 4MH2A 1V58A 3KZQA 5G5EA 3D21A 2RM5A 3VWVA 3APSA 2H71A 2R37A 2BMXA 4RUVA 4G0LA 4FIWA 5JWRB 3ZIJA 3TCOA 1R5AA 4IP6A 2YZHA 3IC8A 1S3DA 4MF6A 3ZIVA 2J23A 1GUMA 1AQXA 5IIZA 3NZNA 1N8JA 1O8XA 2VCXA 3O6TA 2VCZA 1J9BA 2HRNA 4J56E 4ICYA 3US3A 2VLUA 4YAPA 14GSA 3TJJA 1GTIA 4Z2UA 1WP0A 2DLXA 3HVVA 1BEDA 1YJ6A 2O89A 2GQLA 2LSTA 1SENA 4YQUA 4ZILA 1NSWA 3UIWA 1N25A 1JZDA 2C3NA 2CVDA 4PHZC 5KEJA 3K8NA 4OCEA 3FMWA 3LW9A 2CAQA 4F0CA 3QD9A 3HKRA 2LV3A 1WJKA 4MJAA 3KJYA 6GSVA 3F6FA 2E2GA 1GLPA 4V2NA 3L4NA 1O81A 4ZBDA 4GQCA 2GDRA 1G7EA 4FH8A 1F3AA 1JHBA 1XWGA 2VCWA 3Q18A 5ECMB 2WVZA 1U6TA 4KDYA 3TRXA 1HNAA 2DJKA 3N5OA 1M3JA 1OC9B 3DD3A 2H19A 5J3RA 4MPGA 2IN3A 5HFGA 5DJMA 4ZB9A 2OADA 2EIQA 4K2DA 4E8HA 1BAYA 1U3IA 3N9JA 2CZ2A 5IMDA 2J9HA 1B4QA 4K9ZA 1TRVA 3W8SA 4DSRA 1K3LA 2R2JA 5A34A 2LRTA 1TKDB 3DXBA 2B5XA 1AUCA 2CZ3A 3FY7A 4K6XA 2IMEA 4G01A 3F3RA 1YKAA 1SL2B 4MPFA 4ZBBA 2ES7A 1ZCPA 2GQKA 4MH3A 3ZYWA 2IFQB 5BMUB 3P7XA 2G0FA 2LUSA 4IW9A 4I2UA 4G9HA 3F0IA 1CQHA 3BBYA 2FUG2 2PUKC 1R5PA 1SD8A 5JCUA 4F2IA 2IIYA 2JZTA 3L78A 1BX9A 5LCZA 1HQOA 4V2LA 5ECNB 3TB2A 1IYIA 1FVJA 1B48A 2E7PA 3VK9A 4IN0A 4N10A 2YJHA 1PGTA 2JL4A 2OJLA 1XIYA 2B6MA 3KCMA 1ERVA 3FR3A 1U3AA 1PSQA 2H8LA 2VOCA 1MDIA 2LEGA 4KF9A 3KTBA 1VF4A 3VPTA 2FWFA 5BMUA 3EYTA 2I1UA 1Z9HA 4OFNA 3ZZXA 5DBQA 5ENUA 5DALA 3TDGA 2L6CA 3TKQA 1HNCA 4N0VA 2QGVA 1RK4A 4Q5NA 2I4AA 3LSZA 2WFCA 1FW1A 1TU7A 4XS6A 1B4PA 3GKXA 4JR4A 2MMZA 4IHUA 3LXZA 3IHQA 5CRDA 4N30A 3GL5A 5CRWA 1F9MA 2DMMA 4ZXGA 4EE0A 3F3QA 2CVBA 3E0UA 4X1UA
chains in the Genus database with same CATH topology
3C73A 4WR4A 1NHYA 2NTOA 2ZNMA 3CSHA 1EOHA 3I9V2 3GSTA 2YCDA 3HA9A 1EV9A 2VM2A 4KGIA 1TRUA 4EC0A 5B6NA 3UEMA 3VI7A 2DIZA 3HJPA 2LJAA 3KH7A 3JCML 4KB3A 3KP9A 4BA7A 1ILOA 5ID2A 3TUEA 3WGDA 1ML6A 1A0FA 4LL1B 3EMXA 4PNFA 1O85A 1OC3A 4ML6A 3U5RE 4I2TA 2H76A 2GLRA 2H6XA 2OACA 1V2AA 20GSA 2ZCTA 1TK8B 3GV1A 2K9FA 5KN0A 1T4ZA 4HUAA 5ELGA 2UZ8A 3PPUA 1Z7PA 1JLVA 3IA1A 4LLRA 2H1GA 3FK8A 3KMNA 5G2ZA 3C7MA 5ECIB 2EFHA 2PWJA 3IK7A 1YF0A 4ZB6A 2AHEA 1O6JA 1GRXA 2C8UA 3W6GA 1T00A 1VF2A 4N3ZA 4HU9A 5FT3A 5G1LA 3M9JA 4PUFC 3TU3B 1YEXA 2L57A 5GAND 3DRNA 2DKIA 5G5FA 3GKKA 2FHEA 5B7CA 3TKSC 4IS0A 1DE1A 2QC7A 1EEMA 4NV5A 3GA4A 2CQ9A 1EGRA 2VLTA 2HSMB 4NHWA 3CRTA 2A2PA 5G30A 1LBKA 4L5OA 2H1BA 4O5RA 3FZ9A 5J41A 1GP1A 2C4JA 3HJMA 2CA8A 4BWSA 5IMZA 1XW6A 3TJGA 4GSNA 1S3AA 5KN3A 4KDXA 2HZEA 3ZL5A 4EF0A 3P8WA 4IVFA 3IAM2 4HU7A 3WT2A 3MIXA 6GSTA 2N5BA 4G0KA 2RUEA 5AN1A 4DVCA 3GX8A 4WKWA 4ZIJA 1ZOFA 2DIYA 5LD0A 3FYGA 3A2VA 3PGTA 3NOFA 2OT3A 2H66A 5DAKB 2V41A 2HSMA 3GURA 2KOKA 2H75A 1J08A 1ZYNA 5ECOB 1XCCA 5H5RA 3VURA 3FZ5A 4ZBAA 4K0GA 9GSSA 5FWGA 3DWVA 1TI1A 1AC1A 1ON4A 1VRSD 3RPPA 4XS1A 3RBTA 1QUWA 1J0FA 4CY6A 3ZLPA 5IMAA 3ZFBA 3QAVA 1TRSA 4NMUA 1SD9A 2VL2C 4NAXA 3O76A 4GRFA 3TGZA 2HI7A 3TKPA 4AJ8A 3GFKA 3G7IA 5DJLA 3L0HA 1A2MA 4TR3A 1FB6A 3LYPA 5DAKA 3OR5A 3GX0A 2PERA 5GZZB 4XS4B 3HJOA 1SVLA 2LTKA 1GULA 4CHSA 1BYEA 3F8UA 5GAPD 3C1SA 5ABRA 3EURA 1UVZA 2CT6A 4JEDA 1FOHA 3BCIA 4V2MA 2VKZG 4G0IA 4O7HA 3FHKA 1XVQA 1TXUA 3VLNA 4BVYB 4YH2A 4PGTA 3QFAC 4KCAA 1FB0A 3GRXA 2H6ZA 1FG4A 2ALBA 4IP1A 2X8CA 4MK3A 1Z3EA 4XS4A 1EP8A 5ECRB 2OE3A 1IYHA 4FQUA 1PA3A 1XW9A 4K7IA 5IM9A 1UC7A 1TK5B 5EVOA 2IL3A 1SKWB 5INYA 17GSA 1PL2A 3G9BA 2LNTA 1FAAA 4AF2A 2PN8A 1SYRA 4JRRA 3H93A 4EXJA 2VD1A 2HYXA 4BVYA 2MBTA 4HS1A 1X9WB 5F07A 3UVTA 1F37A 4AJ6A 3ZRDA 3TOUA 1NW2A 2L4CA 1BG5A 5CO3A 5HQPA 4PUAA 5FHIA 5IOXA 1E2YA 3QPMA 4OO4A 4ZB8A 5H5QA 6GSSA 1SVOA 1X5DA 4LL4B 4K5RA 5D9VA 1WPIA 1XWKA 4IQAA 1H75A 1K0CA 1OKDA 3WGEA 1B8XA 4P3YB 5IO2A 1XOAA 2P31A 3LQ7A 1OAZA 4GDFA 1OE8A 2R0PA 3GL3A 4WF5A 1GWCA 3RAZA 2LKUA 2QSIA 4E8EA 3LYKA 3S9FA 1F3BA 1SJ6A 4NPBA 2A4HA 3U6VA 5D9TA 1LJRA 4OFTA 1A8YA 3AY8A 4IJ3A 4TR4A 1BJXA 1A2LA 3NIVA 4D73B 4NWYA 4MF5A 3GMFA 1OVNA 4N0ZA 2PPTA 3UL3A 1TRWA 2N5AA 3A2XA 3EWLA 1XBSA 1YY7A 5CREA 4OO5A 3Q6OA 4NXIA 2GZPA 1M0UA 3ZMKA 4L8EA 4Q5FA 3P90A 5CRGA 3HD5A 4ZL7A 2MMOA 4EDZA 3F9UA 2OA7A 2P5RA 2HSNB 5HR3A 3HVSA 1X9SB 2X8HA 1F2EA 1PQNA 4MCUA 1EWXA 5A5KA 4D73A 4YKGA 1ZMAA 5A4UA 4HQSA 4ILFA 1YQ1A 1K3OA 3M3MA 3Q19A 1KTEA 2B7KA 1PN9A 4YQVA 1EGOA 1F6MC 3FEUA 2LNSA 1Z7RA 1GH2A 1M9AA 3F4RA 1T7PB 4HJ2A 5J4UA 4JE1A 1JZRA 3KD0A 3IXRA 1JZWA 2HSNA 3IBHA 4KCEA 4DSSB 2GZZA 3IPZA 2B1KA 3G7YA 4XHMA 1ERUA 4G10A 4POBA 1GTAA 2N5FA 1A0RP 1OC9A 1NHOA 3LG6A 4KAEA 3FRCA 5ECQB 1ACVA 1URMA 4FO5A 2XPEA 1V40A 5JCGA 2KHPA 3GH6A 2E2MA 4MF7A 3F4TA 4GTUA 1G6WA 3W8JA 1AAZA 1FVKA 2DKHA 2FWEA 1XZOA 1GUHA 3F4SA 4MZCA 5IMFA 2YOIA 1UN2A 1Q98A 2O7KA 4MMMA 2ON5A 5E4WA 5F06A 1V57A 2K8SA 2I81A 3CBUA 2CX3A 3GTUB 1B9YC 5IPGA 2I9HA 3HVXA 4GWRA 5H5SA 1T8EB 5D9XA 1O7UA 4JBBA 2YWMA 1SU9A 1UA5A 5KOXA 2C0EA 3CSIA 1SVMA 2VD0A 2IFQA 2CVKA 2DBCA 2JSZA 3TKSE 2H74A 6GSYA 1EEJA 1TXXA 4TN8A 3KIJA 1KEBA 3KH9A 5IPHA 2FA4A 1RQMA 2GQMA 2H0IA 1MDKA 3HMJG 2LRCA 2XHFA 3GHAA 3FZAA 5B6MA 2IPAA 2LQQA 5D9WA 4YAVA 2C3TA 1HD2A 2F51A 4CY8A 3IR4A 3CYNA 3IOSA 2DJ1A 3LORA 4IQ1A 3TRPA 4PX1A 4DEJA 1TK0B 3BD2A 1BQ7A 3H79A 4I5QA 3GIXA 5DQSA 3FW2A 1A24A 3LWAA 4HOJA 3D5JA 3EU3A 2FWGA 5KOWA 1M9BA 4WEYA 1XFLA 2I3YA 3BCKA 4NV2A 3TJBA 2DSAA 2L6DA 5JCWA 2QA2A 1RW1A 5HR0A 2H0HA 2KUCA 1OKTA 5A4VA 2HSHA 2VIMA 1ZL9A 3QFBC 3M1GA 3KTLA 4EL1A 1DSBA 3VWWA 5HR2A 3FZ4A 3CSJA 2REMA 3IDVA 4F0BA 1GNEA 1WE0A 4O5UA 2TRCP 1ST9A 2V6KA 2L4QA 4PNGA 6GSWA 2B5YA 4MZWA 1Z5YE 1Y25A 3DIEA 4K8MA 3CMIA 2WB9A 4FYUA 4AKGA 2H73A 5CNWA 3A5IA 1DUGA 5L71A 5A5HB 2FCHA 4O32A 1PN0A 2L5OA 4ULXA 3ERFA 3KM6A 2ZUPA 3EPTA 5CYYA 2UV8G 4E68A 2YPMA 2G2QA 2YNXA 2AUVA 5J9CA 5IQYA 4WR5A 3R2QA 4KH7A 5J47A 3GKMA 2VLVA 2O8VB 3LEFA 3WD6A 1M7TA 2X8GA 2RIIA 4USSA 4BL7B 2IMDA 1NM3A 2AYTA 1VF1A 4ECBA 4EO3A 5A5HA 4A5PA 4LA1A 4TXOB 2FNOA 4POMA 1AW9A 3KMOA 3BOAA 4CW9A 3L9SA 2EIRA 2LRNA 3D0ZA 4H86A 2PBJA 3KEBA 1I9DA 5J5NA 3H1NA 2F9SA 2YV9A 4RI7A 1DE2A 2VO4A 3RPNA 2X4AA 1M2DA 5KN2A 4MABA 1XWBA 2BTOT 3FKFA 1I5GA 4BL7A 2GZYA 2RLIA 2GS3A 4F9ZA 4TXOA 2A4VA 3GSSA 1N2AA 1T3BA 1TDIA 2KP1A 3WGXA 3I6AA 5F0GA 1V9WA 1EV4A 5E59A 3DYRA 2VL3A 4AI6A 1XXUA 2VAFA 3VI5A 5ELAA 4TR1B 2VL9A 4HZ4A 2YV7A 1E6BA 1SJIA 4ISDA 3ZVJD 1R26A 1T1VA 18GSA 1PD21 2M80A 2XBQA 3C8EA 1GSFA 2HRKB 2VCVA 4PXOA 4K2XA 1JZOA 2LJRA 1CQGA 5EL8A 4BWQA 3WYWA 2FLSA 1XOBA 1GSEA 1U88A 3H4KA 4MNNA 1A2JA 2P0GA 2WCIA 4EIPA 4TR1A 4ML1A 5HFIA 5ECKB 1SL1B 3UVHA 4YQMA 3ERWA 2C3QA 2FA8A 1M2AA 2D2ZA 1LU4A 4I6XA 1FO5A 1PX7A 5DQYA 2HRKA 2NDOA 2H30A 2Z9SA 4F03A 4O5QA 2PVOC 4GSSA 2V2GA 5DVBA 2AAWA 1XPVA 3EE2A 2HE3A 4AGSA 3J7Yb 4JZQA 22GSA 2CV4A 3F63A 2IMIA 3APOA 19GSA 2PGTA 3APQA 1OYJA 2C0DA 4Q5RA 2YWIA 3EC3A 3ME8A 4CDOA 2H6YA 2M72A 6GSUA 2VUPA 3KP8A 1GSDA 4FYBA 2CAIA 1TW9A 2O85A 2PMTA 3ISOA 1G7OA 5CAXA 1WIKA 4I97A 4HJMA 4K1FA 3IRAA 1HNBA 3MAKA 3QDNA 3C1RA 4XCSA 4EIQA 5LNKe 2YANA 1SK1A 3EINA 3H8QA 2WJUA 3KXOA 1TJDA 3ERGA 2O87A 1M2BA 3A3TA 3GKNA 5AISA 2ON7A 1DBYA 4OWYA 2V6OA 4GSTA 3HZ4A 4Z7XA 1ZYPA 2WRTA 3QOUA 3LGCA 4Q5QA 2L59A 1GUKA 2P5QA 1K0OA 3M8NA 4POLA 2R0GA 1GLQA 2DJ2A 5HR1A 1K0AA 2IMFA 2H1LA 2A2RA 1MDJA 2GGTA 1T4YA 4QL7A 2HXKA 4PQ1A 2C0GA 4KX4A 1K0DA 3R3EA 1TOFA 2BJXA 1THOA 2JACA 4MJEA 1YF1A 2WZ9A 5EPFA 4Z2RA 2VCQA 5JWQB 4AJ7A 2TIRA 4RQRA 3IHGA 4V1Ag 4LMVA 1ZGNA 3HY2A 1USBA 4QQ7A 4PTSA 1YDKA 3QAWA 4IBPA 3ZREA 1GNWA 1PKWA 3TJFA 4ACSA 1X5EA 4HZ2A 2HFDA 4F82A 1W4VA 5F8BA 4IJIA 2DJ3A 1SL0B 10GSA 4IELA 1MTCA 4HDEA 5AGYA 4GCIA 4ZL9A 1A23A 4TRXA 2LS5A 3MSZA 2JU5A 12GSA 1X5CA 11GSA 4PQIA 3UAPA 5COHA 3CTFA 3I69A 5A34B 1Z6NA 5G1KA 1SYXA 1TU8A 1X0RA 2K6VA 4POKA 4AKIA 4XIHA 2PU9C 3DVXA 1WWJA 1AQVA 4KUNA 3HDCA 2YWNA 2O5VA 1SKSB 3D22A 1ABAA 3D4MA 3A2WA 2F8FA 7GSSA 2HRAA 1PKZA 2YP6A 2DJJA 4TKYA 2XPDA 4WF4A 2FY6A 1GSQA 5D93A 4EUYA 3ZVJA 4JU5A 1TP9A 1ZYEA 1OE7A 1TI3A 3HCZA 4K0NA 2MBSA 3FR6A 4ECJA 1R7HA 3GYKA 2OE0A 4NHZA 3D4TA 2GT6A 2NVLA 5D73A 3VPQA 1TTZA 4KSOA 4PURA 4DSSA 3TRQA 3DMLA 2DMLA 5D8IA 4KW6A 3V1WA 4V1Ap 2XC2A 2TRXA 2X64A 2YN1A 3DGQA 3HZ8A 3VWUA 5DALB 5J40A 4J2FA 5B8AA 3DVWA 4KSMA 4KNDA 2MMNA 3E9JB 2IMKA 1XVWA 1X9MB 3ZTLA 4EVMA 3PR8A 1Q4JA 4XRAA 3QCPA 3IAS2 2OBKA 2QKEA 1PRXA 2MMAA 3CRUA 1QXHA 3O3TA 5AIXA 2GSSA 4OD7A 6GSXA 3VWXA 4GXZA 2C80A 2JSYA 4EDYA 5GSTA 3F6DA 1Y1UA 2B1LA 2MYGA 3GTUA 4ECIA 2JADA 2R6KA 1HYUA 2K18A 5AIVA 2H1DA 2HSYA 4QMKA 4G2EA 2GVPA 3J7Yk 1K0BA 1JFUA 3LJRA 1PMTA 1O8WA 3CWGA 1H4OA 5IO0A 2HQTA 2HRFA 1K0NA 4WETA 2R0CA 5ID2B 3L9UA 4GLTA 3SWLA 1AQWA 3GN3A 2WULA 4AKXB 3FR9A 3GNJA 1MD3A 3UMAA 3IK9A 4WBRD 1GSUA 4MJCA 3DEXA 1ZZYA 2H01A 2C0FA 1JLWA 2R4VA 2HNLA 2F8AA 1MD4A 2PVQA 2YWOA 2FWHA 8GSSA 3PH9A 16GSA 4BVXB 2WGRA 1FOVA 5J4VA 4QL9A 4DSQA 4MP4A 1YEPA 5IOWA 5IMVA 4EKZA 2DC5A 3A5WA 3UJ1A 4YKFA 3M0FA 3DKSA 4MDCA 2GSRA 2RUFA 2H1AA 1YZXA 2DJ0A 2HLSA 2GT5A 1BG1A 1GL8A 1OC8A 3TKRA 4J57E 1SKRB 1GSYA 4X43A 1M99A 5C00A 1SJZA 1QFNA 4TXVA 1K3YA 2HT9A 4L0WA 2L5LA 1AIUA 3HHVA 1U87A 1GTBA 4FYCA 2VCTA 2QA1A 3RHBA 3HXSA 3EMPA 1EOGA 4BVXA 5CRHA 5A1NB 2AB6A 4GF0A 2XBIA 5F05A 3KGKA 3EVIA 1VF3A 3IE3A 2C1YA 4OFMA 3IV4A 2OE1A 5BRTA 2F3MA 3P2AA 5J9BA 2WS2A 4MZBA 1V98A 4TW5A 1G0TA 3SBCA 1QMVA 2FGXA 1WRYA 4XRDA 5EY6A 2CX4A 5DDLA 1FHEA 2IJYA 2HZEB 4HI7A 1WMJA 5HFKA 4RQXA 1MEKA 3TKSA 5A1NA 4KDUA 1SK0A 3WT1A 3QR6A 3IC4A 3I43A 3LFLA 4G19A 4X0XA 1WOUA 4BPYA 4WXTA 3E3EA 1XWCA 1ERTA 1EP7A 4N11A 2OKAA 1SK2A 2KP2A 2GSQA 2B3SA 1THXA 2EFDA 3ME7A 4HQZA 3UBKA 2H72A 1XWAA 1AXDA 1K0MA 3QMXA 4X4JA 2R3XA 4JR6A 1R4WA 2K8VA 2VM1A 3MDKA 3TJKA 4L0UA 1Y6EA 2JZRA 3MWHA 4LMWA 5ECSA 5ECPB 5ECHB 4ZB7A 4TOPA 1A8LA 4K7NA 4IGJA 4WBJA 1YVLA 2YZUA 1GSSA 3UARA 13GSA 4O92A 2X49A 4HEA2 1B9XC 4MA9A 2EIOA 2OBIA 4RI6A 4OCFA 4ID0A 3GUSA 5KN1A 2EFEA 1BF5A 4ZL8A 4ECCA 4PQHA 2WDUA 2VL2A 1VGLA 4GQFA 2YJ7A 3ZMLA 3BJ5A 1Z6MA 1QQ2A 3UBLA 3D6IA 3L9VA 3MNGA 4XTSA 3VFIA 1PL1A 4KE3A 3ZFLA 3GH9A 4Z2TA 2NBSA 5DCGA 1YKCA 4K5SA 3UOMA 2H70A 4TR0A 2NPBA 3MYDA 4L5LA 2RM6A 4AKHA 4IKHA 5CP1A 4TVEA 2R5GA 3M9KA 3ZITA 5B8BA 5DCHA 5ECLB 1KBNA 1ERWA 3EU4A 2IWTA 2GSTA 3CXGA 2GTUA 3QAGA 1PX6A 1QGVA 5IMCA 1GTUA 2AV4A 1C72A 3LXTA 3Q74A 2E0QA 1ZYQB 2EC4A 3TOTA 2V32A 2AJQB 3C71A 3PINA 5JWOB 4W66A 2A2SA 1W89A 2LQOA 5G31A 1EZKA 5C04A 4MJBA 3HYPA 3G7JA 4K7OA 2JZSA 3CTGA 2H0GA 1KNGA 1G6YA 1S3CA 3RDWA 4I8BA 4MLYA 2FD3A 2X99A 4OMVA 5J4YA 5A4WA 4KA0A 2B5EA 2M46A 2V1MA 1XW5A 5D96A 3ED3A 2EFCA 3RHCA 2MZCA 2KLXA 1O73A 2HZFA 1QK8A 2LJKA 5GSSA 2B7JA 4MH2A 1V58A 3KZQA 5G5EA 3D21A 2RM5A 3VWVA 3APSA 2H71A 2R37A 2BMXA 4RUVA 4G0LA 4FIWA 5JWRB 3ZIJA 3TCOA 1R5AA 4IP6A 2YZHA 3IC8A 1S3DA 4MF6A 3ZIVA 2J23A 1GUMA 1AQXA 5IIZA 3NZNA 1N8JA 1O8XA 2VCXA 3O6TA 2VCZA 1J9BA 2HRNA 4J56E 4ICYA 3US3A 2VLUA 4YAPA 14GSA 3TJJA 1GTIA 4Z2UA 1WP0A 2DLXA 3HVVA 1BEDA 1YJ6A 2O89A 2GQLA 2LSTA 1SENA 4YQUA 4ZILA 1NSWA 3UIWA 1N25A 1JZDA 2C3NA 2CVDA 5KEJA 3K8NA 4OCEA 3FMWA 3LW9A 2CAQA 4F0CA 3QD9A 3HKRA 2LV3A 1WJKA 4MJAA 3KJYA 6GSVA 3F6FA 2E2GA 1GLPA 4V2NA 3L4NA 1O81A 4ZBDA 4GQCA 2GDRA 1G7EA 4FH8A 1F3AA 1JHBA 1XWGA 2VCWA 3Q18A 5ECMB 1U6TA 4KDYA 3TRXA 1HNAA 2DJKA 3N5OA 1OC9B 3DD3A 2H19A 5J3RA 4MPGA 2IN3A 5HFGA 5DJMA 4ZB9A 2OADA 2EIQA 4K2DA 4E8HA 1BAYA 1U3IA 3N9JA 2CZ2A 5IMDA 2J9HA 1B4QA 4K9ZA 1TRVA 3W8SA 4DSRA 1K3LA 2R2JA 5A34A 2LRTA 1TKDB 3DXBA 2B5XA 1AUCA 2CZ3A 3FY7A 4K6XA 2IMEA 4G01A 3F3RA 1YKAA 1SL2B 4MPFA 4ZBBA 2ES7A 1ZCPA 2GQKA 4MH3A 3ZYWA 2IFQB 5BMUB 3P7XA 2G0FA 2LUSA 4IW9A 4I2UA 4G9HA 3F0IA 1CQHA 3BBYA 2FUG2 2PUKC 1R5PA 1SD8A 5JCUA 4F2IA 2IIYA 2JZTA 3L78A 1BX9A 5LCZA 1HQOA 4V2LA 5ECNB 3TB2A 1IYIA 1FVJA 1B48A 2E7PA 3VK9A 4IN0A 4N10A 2YJHA 1PGTA 2JL4A 2OJLA 1XIYA 2B6MA 3KCMA 1ERVA 3FR3A 1U3AA 1PSQA 2H8LA 2VOCA 1MDIA 2LEGA 4KF9A 3KTBA 1VF4A 3VPTA 2FWFA 5BMUA 3EYTA 2I1UA 1Z9HA 4OFNA 3ZZXA 5DBQA 5ENUA 5DALA 3TDGA 2L6CA 3TKQA 1HNCA 4N0VA 2QGVA 1RK4A 4Q5NA 2I4AA 3LSZA 2WFCA 1FW1A 1TU7A 4XS6A 1B4PA 3GKXA 4JR4A 2MMZA 4IHUA 3LXZA 3IHQA 5CRDA 4N30A 3GL5A 5CRWA 1F9MA 2DMMA 4ZXGA 4EE0A 3F3QA 2CVBA 3E0UA 4X1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C73 A;  4WR4 A;  1NHY A;  2NTO A;  2ZNM A;  3CSH A;  1EOH A;  3I9V 2;  3GST A;  2YCD A;  3HA9 A;  1EV9 A;  2VM2 A;  4KGI A;  1TRU A;  4EC0 A;  5B6N A;  3UEM A;  3VI7 A;  2DIZ A;  3HJP A;  2LJA A;  3KH7 A;  3JCM L;  4KB3 A;  3KP9 A;  4BA7 A;  1ILO A;  5ID2 A;  3TUE A;  3WGD A;  1ML6 A;  1A0F A;  4LL1 B;  3EMX A;  4PNF A;  1O85 A;  1OC3 A;  4ML6 A;  3U5R E;  4I2T A;  2H76 A;  2GLR A;  2H6X A;  2OAC A;  1V2A A;  20GS A;  2ZCT A;  1TK8 B;  3GV1 A;  2K9F A;  5KN0 A;  1T4Z A;  4HUA A;  5ELG A;  2UZ8 A;  3PPU A;  1Z7P A;  1JLV A;  3IA1 A;  4LLR A;  2H1G A;  3FK8 A;  3KMN A;  5G2Z A;  3C7M A;  5ECI B;  2PWJ A;  3IK7 A;  1YF0 A;  4ZB6 A;  2AHE A;  1O6J A;  1GRX A;  2C8U A;  3W6G A;  1T00 A;  1VF2 A;  4HU9 A;  5FT3 A;  5G1L A;  3M9J A;  4PUF C;  1YEX A;  2L57 A;  5GAN D;  3DRN A;  5G5F A;  3GKK A;  2FHE A;  5B7C A;  3TKS C;  4IS0 A;  1DE1 A;  2QC7 A;  1EEM A;  4NV5 A;  3GA4 A;  2CQ9 A;  1EGR A;  2VLT A;  2HSM B;  4NHW A;  3CRT A;  5G30 A;  1LBK A;  4L5O A;  2H1B A;  4O5R A;  3FZ9 A;  5J41 A;  1GP1 A;  2C4J A;  3HJM A;  2CA8 A;  4BWS A;  5IMZ A;  1XW6 A;  3TJG A;  4GSN A;  1S3A A;  5KN3 A;  4KDX A;  2HZE A;  3ZL5 A;  4EF0 A;  3P8W A;  4IVF A;  3IAM 2;  4HU7 A;  3WT2 A;  6GST A;  2N5B A;  4G0K A;  2RUE A;  5AN1 A;  4DVC A;  3GX8 A;  4WKW A;  4ZIJ A;  1ZOF A;  2DIY A;  5LD0 A;  3FYG A;  3A2V A;  3PGT A;  3NOF A;  2H66 A;  5DAK B;  2V41 A;  2HSM A;  3GUR A;  2KOK A;  2H75 A;  1J08 A;  5ECO B;  1XCC A;  5H5R A;  3VUR A;  3FZ5 A;  4ZBA A;  4K0G A;  9GSS A;  5FWG A;  3DWV A;  1TI1 A;  1AC1 A;  1ON4 A;  1VRS D;  3RPP A;  4XS1 A;  3RBT A;  1QUW A;  1J0F A;  5IMA A;  3ZLP A;  3ZFB A;  3QAV A;  1TRS A;  4NMU A;  1SD9 A;  2VL2 C;  4NAX A;  3O76 A;  4GRF A;  3TGZ A;  2HI7 A;  3TKP A;  4AJ8 A;  3GFK A;  3G7I A;  5DJL A;  3L0H A;  1A2M A;  4TR3 A;  1FB6 A;  3LYP A;  5DAK A;  3OR5 A;  3GX0 A;  2PER A;  5GZZ B;  4XS4 B;  3HJO A;  2LTK A;  1GUL A;  4CHS A;  1BYE A;  3F8U A;  5GAP D;  3C1S A;  5ABR A;  3EUR A;  1UVZ A;  2CT6 A;  4JED A;  3BCI A;  4V2M A;  4G0I A;  4O7H A;  3FHK A;  1XVQ A;  3VLN A;  4BVY B;  4YH2 A;  4PGT A;  3QFA C;  4KCA A;  1FB0 A;  3GRX A;  2H6Z A;  1FG4 A;  2ALB A;  4IP1 A;  2X8C A;  4MK3 A;  1Z3E A;  4XS4 A;  1EP8 A;  5ECR B;  2OE3 A;  1IYH A;  4FQU A;  1PA3 A;  1XW9 A;  4K7I A;  5IM9 A;  1UC7 A;  1TK5 B;  5EVO A;  2IL3 A;  1SKW B;  5INY A;  17GS A;  1PL2 A;  3G9B A;  2LNT A;  1FAA A;  4AF2 A;  2PN8 A;  1SYR A;  4JRR A;  3H93 A;  4EXJ A;  2VD1 A;  2HYX A;  4BVY A;  2MBT A;  4HS1 A;  1X9W B;  5F07 A;  3UVT A;  1F37 A;  4AJ6 A;  3ZRD A;  3TOU A;  1NW2 A;  2L4C A;  1BG5 A;  5CO3 A;  5HQP A;  4PUA A;  5FHI A;  5IOX A;  1E2Y A;  3QPM A;  4OO4 A;  4ZB8 A;  5H5Q A;  6GSS A;  1X5D A;  4LL4 B;  5D9V A;  1WPI A;  1XWK A;  4IQA A;  1H75 A;  1K0C A;  1OKD A;  3WGE A;  1B8X A;  4P3Y B;  5IO2 A;  1XOA A;  2P31 A;  3LQ7 A;  1OAZ A;  1OE8 A;  3GL3 A;  4WF5 A;  1GWC A;  3RAZ A;  2LKU A;  2QSI A;  4E8E A;  3LYK A;  3S9F A;  1F3B A;  1SJ6 A;  4NPB A;  3U6V A;  5D9T A;  1LJR A;  4OFT A;  1A8Y A;  3AY8 A;  4IJ3 A;  4TR4 A;  1BJX A;  1A2L A;  3NIV A;  4D73 B;  4NWY A;  4MF5 A;  3GMF A;  1OVN A;  4N0Z A;  2PPT A;  3UL3 A;  1TRW A;  2N5A A;  3A2X A;  3EWL A;  1XBS A;  1YY7 A;  5CRE A;  4OO5 A;  3Q6O A;  4NXI A;  2GZP A;  1M0U A;  3ZMK A;  4L8E A;  4Q5F A;  3P90 A;  5CRG A;  3HD5 A;  4ZL7 A;  2MMO A;  4EDZ A;  3F9U A;  2OA7 A;  2P5R A;  2HSN B;  5HR3 A;  3HVS A;  1X9S B;  2X8H A;  1F2E A;  1PQN A;  4MCU A;  1EWX A;  5A5K A;  4D73 A;  1ZMA A;  5A4U A;  4HQS A;  4ILF A;  1YQ1 A;  1K3O A;  3M3M A;  3Q19 A;  1KTE A;  2B7K A;  1PN9 A;  4YQV A;  1EGO A;  1F6M C;  3FEU A;  2LNS A;  1Z7R A;  1GH2 A;  1M9A A;  3F4R A;  1T7P B;  4HJ2 A;  5J4U A;  4JE1 A;  1JZR A;  3KD0 A;  3IXR A;  1JZW A;  3IBH A;  4KCE A;  4DSS B;  2GZZ A;  3IPZ A;  2B1K A;  3G7Y A;  4XHM A;  1ERU A;  4G10 A;  4POB A;  1GTA A;  2N5F A;  1A0R P;  1OC9 A;  1NHO A;  3LG6 A;  4KAE A;  3FRC A;  5ECQ B;  1ACV A;  1URM A;  4FO5 A;  2XPE A;  1V40 A;  5JCG A;  2KHP A;  3GH6 A;  2E2M A;  4MF7 A;  3F4T A;  4GTU A;  1G6W A;  3W8J A;  1AAZ A;  1FVK A;  2FWE A;  1XZO A;  1GUH A;  3F4S A;  4MZC A;  5IMF A;  2YOI A;  1UN2 A;  1Q98 A;  2O7K A;  4MMM A;  2ON5 A;  5E4W A;  5F06 A;  1V57 A;  2K8S A;  2I81 A;  3CBU A;  2CX3 A;  3GTU B;  1B9Y C;  5IPG A;  2I9H A;  3HVX A;  4GWR A;  5H5S A;  1T8E B;  5D9X A;  1O7U A;  4JBB A;  2YWM A;  1SU9 A;  1UA5 A;  2C0E A;  3CSI A;  2VD0 A;  2IFQ A;  2CVK A;  2DBC A;  2JSZ A;  3TKS E;  2H74 A;  6GSY A;  1EEJ A;  1TXX A;  4TN8 A;  3KIJ A;  1KEB A;  3KH9 A;  5IPH A;  2FA4 A;  1RQM A;  2GQM A;  1MDK A;  2H0I A;  2XHF A;  2LRC A;  3GHA A;  3FZA A;  5B6M A;  2IPA A;  2LQQ A;  5D9W A;  4YAV A;  2C3T A;  1HD2 A;  2F51 A;  3IR4 A;  3CYN A;  3IOS A;  2DJ1 A;  3LOR A;  4IQ1 A;  3TRP A;  4PX1 A;  4DEJ A;  1TK0 B;  3BD2 A;  1BQ7 A;  3H79 A;  4I5Q A;  3GIX A;  5DQS A;  3FW2 A;  1A24 A;  3LWA A;  4HOJ A;  3D5J A;  3EU3 A;  2FWG A;  1M9B A;  4WEY A;  1XFL A;  2I3Y A;  3BCK A;  4NV2 A;  3TJB A;  2DSA A;  2L6D A;  5JCW A;  1RW1 A;  5HR0 A;  2H0H A;  2KUC A;  1OKT A;  5A4V A;  2HSH A;  2VIM A;  1ZL9 A;  3QFB C;  3M1G A;  3KTL A;  4EL1 A;  1DSB A;  3VWW A;  5HR2 A;  3FZ4 A;  3CSJ A;  2REM A;  3IDV A;  4F0B A;  1GNE A;  1WE0 A;  2TRC P;  1ST9 A;  2V6K A;  2L4Q A;  4PNG A;  6GSW A;  2B5Y A;  4MZW A;  1Z5Y E;  1Y25 A;  3DIE A;  4K8M A;  3CMI A;  2WB9 A;  4FYU A;  2H73 A;  5CNW A;  5L71 A;  1DUG A;  2FCH A;  4O32 A;  2L5O A;  4ULX A;  3ERF A;  3KM6 A;  2ZUP A;  5CYY A;  2YPM A;  2G2Q A;  2YNX A;  2AUV A;  5J9C A;  5IQY A;  4WR5 A;  3R2Q A;  4KH7 A;  3GKM A;  2VLV A;  2O8V B;  3LEF A;  3WD6 A;  1M7T A;  2X8G A;  2RII A;  4USS A;  4BL7 B;  2IMD A;  1NM3 A;  2AYT A;  1VF1 A;  4ECB A;  4EO3 A;  4LA1 A;  4TXO B;  2FNO A;  4POM A;  1AW9 A;  3KMO A;  3BOA A;  4CW9 A;  3L9S A;  2EIR A;  2LRN A;  3D0Z A;  4H86 A;  2PBJ A;  3KEB A;  1I9D A;  5J5N A;  3H1N A;  2F9S A;  2YV9 A;  4RI7 A;  1DE2 A;  2VO4 A;  3RPN A;  1M2D A;  5KN2 A;  4MAB A;  1XWB A;  2BTO T;  3FKF A;  1I5G A;  4BL7 A;  2GZY A;  2RLI A;  2GS3 A;  4F9Z A;  4TXO A;  2A4V A;  3GSS A;  1N2A A;  1T3B A;  1TDI A;  2KP1 A;  3WGX A;  3I6A A;  5F0G A;  1V9W A;  1EV4 A;  5E59 A;  3DYR A;  2VL3 A;  1XXU A;  2VAF A;  3VI5 A;  5ELA A;  4TR1 B;  2VL9 A;  4HZ4 A;  2YV7 A;  1E6B A;  1SJI A;  4ISD A;  3ZVJ D;  1R26 A;  1T1V A;  18GS A;  1PD2 1;  2M80 A;  2XBQ A;  3C8E A;  1GSF A;  2HRK B;  2VCV A;  4PXO A;  1JZO A;  2LJR A;  1CQG A;  5EL8 A;  4BWQ A;  3WYW A;  2FLS A;  1XOB A;  1GSE A;  1U88 A;  3H4K A;  1A2J A;  2P0G A;  2WCI A;  4TR1 A;  4ML1 A;  5HFI A;  5ECK B;  1SL1 B;  3UVH A;  4YQM A;  3ERW A;  2C3Q A;  2FA8 A;  1M2A A;  2D2Z A;  1LU4 A;  4I6X A;  1FO5 A;  1PX7 A;  5DQY A;  2HRK A;  2NDO A;  2H30 A;  2Z9S A;  4F03 A;  2PVO C;  4GSS A;  2V2G A;  5DVB A;  2AAW A;  1XPV A;  3EE2 A;  2HE3 A;  4AGS A;  3J7Y b;  4JZQ A;  22GS A;  2CV4 A;  3F63 A;  2IMI A;  3APO A;  19GS A;  2PGT A;  3APQ A;  1OYJ A;  2C0D A;  4Q5R A;  2YWI A;  3EC3 A;  3ME8 A;  4CDO A;  2H6Y A;  2M72 A;  6GSU A;  2VUP A;  3KP8 A;  1GSD A;  4FYB A;  2CAI A;  1TW9 A;  2O85 A;  2PMT A;  3ISO A;  1G7O A;  5CAX A;  1WIK A;  4I97 A;  4HJM A;  4K1F A;  3IRA A;  1HNB A;  3MAK A;  3QDN A;  3C1R A;  4XCS A;  5LNK e;  2YAN A;  1SK1 A;  3EIN A;  3H8Q A;  2WJU A;  3KXO A;  1TJD A;  3ERG A;  2O87 A;  1M2B A;  3A3T A;  3GKN A;  5AIS A;  2ON7 A;  1DBY A;  4OWY A;  2V6O A;  4GST A;  3HZ4 A;  4Z7X A;  2WRT A;  3QOU A;  3LGC A;  4Q5Q A;  2L59 A;  1GUK A;  2P5Q A;  1K0O A;  3M8N A;  4POL A;  1GLQ A;  2DJ2 A;  5HR1 A;  1K0A A;  2IMF A;  2A2R A;  1MDJ A;  2GGT A;  1T4Y A;  4QL7 A;  2HXK A;  4PQ1 A;  2C0G A;  4KX4 A;  1K0D A;  3R3E A;  1TOF A;  2BJX A;  1THO A;  2JAC A;  4MJE A;  1YF1 A;  2WZ9 A;  5EPF A;  2VCQ A;  5JWQ B;  4AJ7 A;  2TIR A;  4RQR A;  4V1A g;  4LMV A;  1ZGN A;  3HY2 A;  1USB A;  4QQ7 A;  4PTS A;  1YDK A;  3QAW A;  4IBP A;  3ZRE A;  1GNW A;  1PKW A;  3TJF A;  4ACS A;  1X5E A;  4HZ2 A;  2HFD A;  4F82 A;  1W4V A;  5F8B A;  4IJI A;  2DJ3 A;  1SL0 B;  10GS A;  4IEL A;  1MTC A;  4HDE A;  5AGY A;  4GCI A;  4ZL9 A;  1A23 A;  4TRX A;  2LS5 A;  3MSZ A;  2JU5 A;  12GS A;  1X5C A;  11GS A;  4PQI A;  3UAP A;  5COH A;  3CTF A;  3I69 A;  1Z6N A;  5G1K A;  1SYX A;  1TU8 A;  1X0R A;  2K6V A;  4POK A;  4XIH A;  2PU9 C;  3DVX A;  1WWJ A;  1AQV A;  4KUN A;  3HDC A;  2YWN A;  1SKS B;  3D22 A;  1ABA A;  3D4M A;  3A2W A;  2F8F A;  7GSS A;  2HRA A;  1PKZ A;  2YP6 A;  2DJJ A;  4TKY A;  2XPD A;  4WF4 A;  2FY6 A;  1GSQ A;  5D93 A;  4EUY A;  3ZVJ A;  4JU5 A;  1TP9 A;  1ZYE A;  1OE7 A;  1TI3 A;  3HCZ A;  4K0N A;  2MBS A;  3FR6 A;  4ECJ A;  1R7H A;  3GYK A;  2OE0 A;  4NHZ A;  3D4T A;  2GT6 A;  2NVL A;  5D73 A;  3VPQ A;  1TTZ A;  4KSO A;  4PUR A;  4DSS A;  3TRQ A;  3DML A;  2DML A;  5D8I A;  4KW6 A;  3V1W A;  4V1A p;  2XC2 A;  2TRX A;  2X64 A;  2YN1 A;  3DGQ A;  3HZ8 A;  3VWU A;  5DAL B;  4J2F A;  5B8A A;  3DVW A;  4KSM A;  4KND A;  2MMN A;  3E9J B;  2IMK A;  1XVW A;  1X9M B;  3ZTL A;  4EVM A;  3PR8 A;  1Q4J A;  4XRA A;  3QCP A;  3IAS 2;  2OBK A;  2QKE A;  1PRX A;  2MMA A;  3CRU A;  1QXH A;  3O3T A;  5AIX A;  2GSS A;  4OD7 A;  6GSX A;  3VWX A;  4GXZ A;  2C80 A;  2JSY A;  4EDY A;  5GST A;  3F6D A;  2B1L A;  2MYG A;  3GTU A;  4ECI A;  2JAD A;  2R6K A;  1HYU A;  2K18 A;  5AIV A;  2H1D A;  2HSY A;  4G2E A;  2GVP A;  3J7Y k;  1K0B A;  1JFU A;  3LJR A;  1PMT A;  1O8W A;  1H4O A;  5IO0 A;  2HQT A;  2HRF A;  1K0N A;  4WET A;  5ID2 B;  3L9U A;  4GLT A;  3SWL A;  1AQW A;  3GN3 A;  2WUL A;  3FR9 A;  3GNJ A;  1MD3 A;  3UMA A;  3IK9 A;  4WBR D;  1GSU A;  4MJC A;  3DEX A;  1ZZY A;  2H01 A;  2C0F A;  1JLW A;  2R4V A;  2HNL A;  2F8A A;  1MD4 A;  2PVQ A;  2YWO A;  2FWH A;  8GSS A;  3PH9 A;  16GS A;  4BVX B;  2WGR A;  1FOV A;  4QL9 A;  4DSQ A;  4MP4 A;  1YEP A;  5IOW A;  5IMV A;  4EKZ A;  2DC5 A;  3A5W A;  3UJ1 A;  3M0F A;  3DKS A;  4MDC A;  2GSR A;  2RUF A;  2H1A A;  1YZX A;  2DJ0 A;  2HLS A;  2GT5 A;  1GL8 A;  1OC8 A;  3TKR A;  4J57 E;  1SKR B;  1GSY A;  4X43 A;  1M99 A;  5C00 A;  1SJZ A;  1QFN A;  4TXV A;  1K3Y A;  2HT9 A;  4L0W A;  2L5L A;  1AIU A;  3HHV A;  1U87 A;  1GTB A;  4FYC A;  2VCT A;  3RHB A;  3HXS A;  3EMP A;  1EOG A;  4BVX A;  5CRH A;  2AB6 A;  4GF0 A;  2XBI A;  5F05 A;  3KGK A;  3EVI A;  1VF3 A;  3IE3 A;  2C1Y A;  4OFM A;  3IV4 A;  2OE1 A;  2F3M A;  3P2A A;  5J9B A;  2WS2 A;  4MZB A;  1V98 A;  4TW5 A;  1G0T A;  3SBC A;  1QMV A;  2FGX A;  1WRY A;  4XRD A;  5EY6 A;  2CX4 A;  5DDL A;  1FHE A;  2IJY A;  2HZE B;  4HI7 A;  1WMJ A;  5HFK A;  4RQX A;  1MEK A;  3TKS A;  4KDU A;  1SK0 A;  3WT1 A;  3QR6 A;  3IC4 A;  3I43 A;  3LFL A;  4G19 A;  4X0X A;  1WOU A;  4BPY A;  4WXT A;  3E3E A;  1XWC A;  1ERT A;  1EP7 A;  4N11 A;  2OKA A;  1SK2 A;  2KP2 A;  2GSQ A;  2B3S A;  1THX A;  3ME7 A;  4HQZ A;  3UBK A;  2H72 A;  1XWA A;  1AXD A;  1K0M A;  3QMX A;  2R3X A;  4JR6 A;  1R4W A;  2K8V A;  2VM1 A;  3MDK A;  3TJK A;  4L0U A;  1Y6E A;  2JZR A;  3MWH A;  4LMW A;  5ECS A;  5ECP B;  5ECH B;  4K7N A;  4TOP A;  1A8L A;  4IGJ A;  4WBJ A;  2YZU A;  1GSS A;  3UAR A;  13GS A;  4O92 A;  4HEA 2;  1B9X C;  4MA9 A;  2EIO A;  2OBI A;  4RI6 A;  4OCF A;  4ID0 A;  3GUS A;  5KN1 A;  4ZL8 A;  4ECC A;  4PQH A;  2WDU A;  2VL2 A;  1VGL A;  4GQF A;  2YJ7 A;  3ZML A;  3BJ5 A;  1Z6M A;  1QQ2 A;  3UBL A;  3D6I A;  3L9V A;  3MNG A;  4XTS A;  3VFI A;  1PL1 A;  4KE3 A;  3ZFL A;  3GH9 A;  2NBS A;  5DCG A;  1YKC A;  3UOM A;  2H70 A;  4TR0 A;  2NPB A;  4L5L A;  2RM6 A;  4IKH A;  5CP1 A;  4TVE A;  2R5G A;  3M9K A;  3ZIT A;  5B8B A;  5DCH A;  5ECL B;  1KBN A;  1ERW A;  3EU4 A;  2IWT A;  2GST A;  3CXG A;  2GTU A;  3QAG A;  1PX6 A;  1QGV A;  5IMC A;  1GTU A;  2AV4 A;  1C72 A;  3LXT A;  3Q74 A;  2E0Q A;  1ZYQ B;  2EC4 A;  3TOT A;  2V32 A;  2AJQ B;  3C71 A;  3PIN A;  5JWO B;  2A2S A;  1W89 A;  2LQO A;  5G31 A;  1EZK A;  5C04 A;  4MJB A;  3HYP A;  3G7J A;  4K7O A;  2JZS A;  3CTG A;  2H0G A;  1KNG A;  1G6Y A;  1S3C A;  3RDW A;  4I8B A;  4MLY A;  2FD3 A;  2X99 A;  4OMV A;  5A4W A;  4KA0 A;  2B5E A;  2M46 A;  2V1M A;  1XW5 A;  5D96 A;  3ED3 A;  3RHC A;  2MZC A;  2KLX A;  1O73 A;  2HZF A;  1QK8 A;  2LJK A;  5GSS A;  2B7J A;  4MH2 A;  1V58 A;  3KZQ A;  5G5E A;  3D21 A;  2RM5 A;  3VWV A;  3APS A;  2H71 A;  2R37 A;  2BMX A;  4RUV A;  4G0L A;  4FIW A;  5JWR B;  3ZIJ A;  3TCO A;  1R5A A;  4IP6 A;  2YZH A;  3IC8 A;  1S3D A;  4MF6 A;  3ZIV A;  2J23 A;  1GUM A;  1AQX A;  5IIZ A;  3NZN A;  1N8J A;  1O8X A;  2VCX A;  3O6T A;  2VCZ A;  1J9B A;  2HRN A;  4J56 E;  3US3 A;  2VLU A;  4YAP A;  14GS A;  3TJJ A;  1GTI A;  1WP0 A;  2DLX A;  3HVV A;  1BED A;  1YJ6 A;  2O89 A;  2GQL A;  2LST A;  1SEN A;  4YQU A;  4ZIL A;  1NSW A;  3UIW A;  1JZD A;  2C3N A;  2CVD A;  5KEJ A;  3K8N A;  4OCE A;  2CAQ A;  4F0C A;  3QD9 A;  3HKR A;  2LV3 A;  1WJK A;  4MJA A;  3KJY A;  6GSV A;  3F6F A;  2E2G A;  1GLP A;  4V2N A;  3L4N A;  1O81 A;  4ZBD A;  4GQC A;  2GDR A;  1G7E A;  4FH8 A;  1F3A A;  1JHB A;  1XWG A;  2VCW A;  3Q18 A;  5ECM B;  1U6T A;  4KDY A;  3TRX A;  1HNA A;  2DJK A;  3N5O A;  1OC9 B;  3DD3 A;  2H19 A;  5J3R A;  4MPG A;  2IN3 A;  5HFG A;  5DJM A;  4ZB9 A;  2OAD A;  2EIQ A;  4K2D A;  4E8H A;  1BAY A;  1U3I A;  3N9J A;  2CZ2 A;  5IMD A;  2J9H A;  1B4Q A;  4K9Z A;  1TRV A;  3W8S A;  4DSR A;  1K3L A;  2R2J A;  2LRT A;  1TKD B;  3DXB A;  2B5X A;  1AUC A;  2CZ3 A;  3FY7 A;  4K6X A;  2IME A;  3F3R A;  1YKA A;  1SL2 B;  4MPF A;  4ZBB A;  2ES7 A;  1ZCP A;  2GQK A;  4MH3 A;  3ZYW A;  2IFQ B;  3P7X A;  2G0F A;  2LUS A;  4IW9 A;  4I2U A;  4G9H A;  3F0I A;  1CQH A;  3BBY A;  2FUG 2;  2PUK C;  1R5P A;  1SD8 A;  5JCU A;  4F2I A;  2IIY A;  2JZT A;  3L78 A;  1BX9 A;  5LCZ A;  1HQO A;  4V2L A;  5ECN B;  3TB2 A;  1IYI A;  1FVJ A;  1B48 A;  2E7P A;  3VK9 A;  4IN0 A;  4N10 A;  2YJH A;  1PGT A;  2JL4 A;  2OJL A;  1XIY A;  2B6M A;  3KCM A;  1ERV A;  3FR3 A;  1U3A A;  1PSQ A;  2H8L A;  2VOC A;  1MDI A;  2LEG A;  4KF9 A;  3KTB A;  1VF4 A;  3VPT A;  2FWF A;  5BMU A;  3EYT A;  2I1U A;  1Z9H A;  4OFN A;  3ZZX A;  5DBQ A;  5ENU A;  5DAL A;  3TDG A;  2L6C A;  3TKQ A;  1HNC A;  4N0V A;  2QGV A;  1RK4 A;  4Q5N A;  2I4A A;  3LSZ A;  2WFC A;  1FW1 A;  1TU7 A;  4XS6 A;  1B4P A;  3GKX A;  4JR4 A;  2MMZ A;  4IHU A;  3LXZ A;  3IHQ A;  5CRD A;  4N30 A;  3GL5 A;  5CRW A;  1F9M A;  2DMM A;  4ZXG A;  4EE0 A;  3F3Q A;  2CVB A;  3E0U A;  4X1U A; 
#chains in the Genus database with same CATH topology
 3C73 A;  4WR4 A;  1NHY A;  2NTO A;  2ZNM A;  3CSH A;  1EOH A;  3I9V 2;  3GST A;  2YCD A;  3HA9 A;  1EV9 A;  2VM2 A;  4KGI A;  1TRU A;  4EC0 A;  5B6N A;  3UEM A;  3VI7 A;  2DIZ A;  3HJP A;  2LJA A;  3KH7 A;  3JCM L;  4KB3 A;  3KP9 A;  4BA7 A;  1ILO A;  5ID2 A;  3TUE A;  3WGD A;  1ML6 A;  1A0F A;  4LL1 B;  3EMX A;  4PNF A;  1O85 A;  1OC3 A;  4ML6 A;  3U5R E;  4I2T A;  2H76 A;  2GLR A;  2H6X A;  2OAC A;  1V2A A;  20GS A;  2ZCT A;  1TK8 B;  3GV1 A;  2K9F A;  5KN0 A;  1T4Z A;  4HUA A;  5ELG A;  2UZ8 A;  3PPU A;  1Z7P A;  1JLV A;  3IA1 A;  4LLR A;  2H1G A;  3FK8 A;  3KMN A;  5G2Z A;  3C7M A;  5ECI B;  2EFH A;  2PWJ A;  3IK7 A;  1YF0 A;  4ZB6 A;  2AHE A;  1O6J A;  1GRX A;  2C8U A;  3W6G A;  1T00 A;  1VF2 A;  4N3Z A;  4HU9 A;  5FT3 A;  5G1L A;  3M9J A;  4PUF C;  3TU3 B;  1YEX A;  2L57 A;  5GAN D;  3DRN A;  2DKI A;  5G5F A;  3GKK A;  2FHE A;  5B7C A;  3TKS C;  4IS0 A;  1DE1 A;  2QC7 A;  1EEM A;  4NV5 A;  3GA4 A;  2CQ9 A;  1EGR A;  2VLT A;  2HSM B;  4NHW A;  3CRT A;  2A2P A;  5G30 A;  1LBK A;  4L5O A;  2H1B A;  4O5R A;  3FZ9 A;  5J41 A;  1GP1 A;  2C4J A;  3HJM A;  2CA8 A;  4BWS A;  5IMZ A;  1XW6 A;  3TJG A;  4GSN A;  1S3A A;  5KN3 A;  4KDX A;  2HZE A;  3ZL5 A;  4EF0 A;  3P8W A;  4IVF A;  3IAM 2;  4HU7 A;  3WT2 A;  3MIX A;  6GST A;  2N5B A;  4G0K A;  2RUE A;  5AN1 A;  4DVC A;  3GX8 A;  4WKW A;  4ZIJ A;  1ZOF A;  2DIY A;  5LD0 A;  3FYG A;  3A2V A;  3PGT A;  3NOF A;  2OT3 A;  2H66 A;  5DAK B;  2V41 A;  2HSM A;  3GUR A;  2KOK A;  2H75 A;  1J08 A;  1ZYN A;  5ECO B;  1XCC A;  5H5R A;  3VUR A;  3FZ5 A;  4ZBA A;  4K0G A;  9GSS A;  5FWG A;  3DWV A;  1TI1 A;  1AC1 A;  1ON4 A;  1VRS D;  3RPP A;  4XS1 A;  3RBT A;  1QUW A;  1J0F A;  4CY6 A;  3ZLP A;  5IMA A;  3ZFB A;  3QAV A;  1TRS A;  4NMU A;  1SD9 A;  2VL2 C;  4NAX A;  3O76 A;  4GRF A;  3TGZ A;  2HI7 A;  3TKP A;  4AJ8 A;  3GFK A;  3G7I A;  5DJL A;  3L0H A;  1A2M A;  4TR3 A;  1FB6 A;  3LYP A;  5DAK A;  3OR5 A;  3GX0 A;  2PER A;  5GZZ B;  4XS4 B;  3HJO A;  1SVL A;  2LTK A;  1GUL A;  4CHS A;  1BYE A;  3F8U A;  5GAP D;  3C1S A;  5ABR A;  3EUR A;  1UVZ A;  2CT6 A;  4JED A;  1FOH A;  3BCI A;  4V2M A;  2VKZ G;  4G0I A;  4O7H A;  3FHK A;  1XVQ A;  1TXU A;  3VLN A;  4BVY B;  4YH2 A;  4PGT A;  3QFA C;  4KCA A;  4FXY P;  1FB0 A;  3GRX A;  2H6Z A;  1FG4 A;  2ALB A;  4IP1 A;  2X8C A;  4MK3 A;  1Z3E A;  4XS4 A;  1EP8 A;  5ECR B;  2OE3 A;  1IYH A;  4FQU A;  1PA3 A;  1XW9 A;  4K7I A;  5IM9 A;  1UC7 A;  1TK5 B;  5EVO A;  2IL3 A;  1SKW B;  5INY A;  17GS A;  1PL2 A;  3G9B A;  2LNT A;  1FAA A;  4AF2 A;  2PN8 A;  1SYR A;  4JRR A;  3H93 A;  4EXJ A;  2VD1 A;  2HYX A;  4BVY A;  2MBT A;  4HS1 A;  1X9W B;  5F07 A;  3UVT A;  1F37 A;  4AJ6 A;  3ZRD A;  3TOU A;  1NW2 A;  2L4C A;  1BG5 A;  5CO3 A;  5HQP A;  4PUA A;  5FHI A;  5IOX A;  1E2Y A;  3QPM A;  4OO4 A;  2WZS A;  4ZB8 A;  5H5Q A;  3CHX C;  6GSS A;  1SVO A;  1X5D A;  4LL4 B;  4K5R A;  5D9V A;  1WPI A;  1XWK A;  4IQA A;  1H75 A;  1K0C A;  1OKD A;  3WGE A;  1B8X A;  4P3Y B;  5IO2 A;  1XOA A;  2P31 A;  3LQ7 A;  1OAZ A;  4GDF A;  1OE8 A;  2R0P A;  3GL3 A;  4WF5 A;  1GWC A;  3RAZ A;  2LKU A;  2QSI A;  4E8E A;  3LYK A;  3S9F A;  1F3B A;  1SJ6 A;  4NPB A;  2A4H A;  3U6V A;  5D9T A;  1LJR A;  4OFT A;  1A8Y A;  3AY8 A;  4IJ3 A;  4TR4 A;  1BJX A;  1A2L A;  3NIV A;  4D73 B;  4NWY A;  4MF5 A;  3GMF A;  1OVN A;  4N0Z A;  2PPT A;  3UL3 A;  1TRW A;  2N5A A;  3A2X A;  3EWL A;  2WW0 A;  1XBS A;  1YY7 A;  5CRE A;  4OO5 A;  3Q6O A;  4NXI A;  2GZP A;  1M0U A;  3ZMK A;  4L8E A;  4Q5F A;  3P90 A;  5CRG A;  3HD5 A;  4ZL7 A;  2MMO A;  4EDZ A;  3F9U A;  2OA7 A;  2P5R A;  2HSN B;  5HR3 A;  3HVS A;  1X9S B;  2X8H A;  1F2E A;  1PQN A;  4MCU A;  1EWX A;  5A5K A;  4D73 A;  4YKG A;  1ZMA A;  5A4U A;  4HQS A;  4ILF A;  1YQ1 A;  1K3O A;  3M3M A;  3Q19 A;  1KTE A;  2B7K A;  1PN9 A;  4YQV A;  1EGO A;  1F6M C;  3FEU A;  2LNS A;  1Z7R A;  1GH2 A;  1M9A A;  3F4R A;  1T7P B;  4HJ2 A;  5J4U A;  4JE1 A;  1JZR A;  3KD0 A;  3IXR A;  1JZW A;  2HSN A;  3IBH A;  4KCE A;  4DSS B;  2GZZ A;  3IPZ A;  2B1K A;  3G7Y A;  4XHM A;  1ERU A;  4G10 A;  4POB A;  1GTA A;  2N5F A;  1A0R P;  1OC9 A;  1NHO A;  3LG6 A;  4KAE A;  3FRC A;  5ECQ B;  1ACV A;  1URM A;  4FO5 A;  2XPE A;  1V40 A;  5JCG A;  2KHP A;  3GH6 A;  2E2M A;  4MF7 A;  3F4T A;  4GTU A;  1G6W A;  3W8J A;  1AAZ A;  1FVK A;  2DKH A;  2FWE A;  1XZO A;  1GUH A;  3F4S A;  4MZC A;  5IMF A;  2YOI A;  1UN2 A;  1Q98 A;  2O7K A;  4MMM A;  2ON5 A;  5E4W A;  5F06 A;  1V57 A;  2K8S A;  2I81 A;  3CBU A;  2CX3 A;  3GTU B;  1B9Y C;  5IPG A;  2I9H A;  3HVX A;  4GWR A;  5H5S A;  1T8E B;  5D9X A;  1O7U A;  4JBB A;  2YWM A;  1SU9 A;  1UA5 A;  5KOX A;  2C0E A;  4PI2 C;  3CSI A;  1SVM A;  2VD0 A;  2IFQ A;  2CVK A;  2DBC A;  2JSZ A;  3TKS E;  2H74 A;  6GSY A;  1EEJ A;  1TXX A;  4TN8 A;  3KIJ A;  1KEB A;  3KH9 A;  5IPH A;  2FA4 A;  1RQM A;  2GQM A;  2H0I A;  1MDK A;  3HMJ G;  2LRC A;  2XHF A;  3GHA A;  3FZA A;  5B6M A;  2IPA A;  2LQQ A;  2WVX B;  5D9W A;  4YAV A;  2C3T A;  1HD2 A;  2F51 A;  4CY8 A;  3IR4 A;  3CYN A;  3IOS A;  2DJ1 A;  3LOR A;  4IQ1 A;  3TRP A;  4PX1 A;  4DEJ A;  1TK0 B;  3BD2 A;  1BQ7 A;  3H79 A;  4I5Q A;  3GIX A;  5DQS A;  3FW2 A;  1A24 A;  3LWA A;  4HOJ A;  3D5J A;  3EU3 A;  2FWG A;  5KOW A;  1M9B A;  4WEY A;  1XFL A;  2I3Y A;  3BCK A;  4NV2 A;  3TJB A;  2DSA A;  2L6D A;  5JCW A;  2QA2 A;  1RW1 A;  5HR0 A;  2H0H A;  2KUC A;  1OKT A;  5A4V A;  2HSH A;  2WVX A;  2VIM A;  1ZL9 A;  3QFB C;  3M1G A;  3KTL A;  4EL1 A;  1DSB A;  3VWW A;  5HR2 A;  3FZ4 A;  3CSJ A;  2REM A;  3IDV A;  4F0B A;  1GNE A;  1WE0 A;  4O5U A;  2TRC P;  1ST9 A;  2V6K A;  2L4Q A;  4PNG A;  6GSW A;  2B5Y A;  4MZW A;  1Z5Y E;  1Y25 A;  3DIE A;  4K8M A;  3CMI A;  2WB9 A;  4FYU A;  4AKG A;  2H73 A;  5CNW A;  3A5I A;  1DUG A;  5L71 A;  5A5H B;  2FCH A;  4O32 A;  1PN0 A;  2L5O A;  4ULX A;  3ERF A;  3KM6 A;  2ZUP A;  3EPT A;  5CYY A;  2UV8 G;  4E68 A;  2YPM A;  2G2Q A;  2YNX A;  2AUV A;  5J9C A;  5IQY A;  4WR5 A;  3R2Q A;  4KH7 A;  5J47 A;  3GKM A;  2VLV A;  2O8V B;  3LEF A;  3WD6 A;  1M7T A;  2X8G A;  2RII A;  4USS A;  4BL7 B;  2IMD A;  1NM3 A;  2AYT A;  1VF1 A;  4ECB A;  4EO3 A;  5A5H A;  4A5P A;  4LA1 A;  4TXO B;  2FNO A;  4POM A;  1AW9 A;  3KMO A;  3BOA A;  4CW9 A;  3L9S A;  2EIR A;  2LRN A;  3D0Z A;  4H86 A;  2PBJ A;  3KEB A;  1I9D A;  5J5N A;  3H1N A;  2F9S A;  2YV9 A;  4RI7 A;  1DE2 A;  2VO4 A;  3RPN A;  2X4A A;  1M2D A;  5KN2 A;  4MAB A;  1XWB A;  2BTO T;  3FKF A;  1I5G A;  4BL7 A;  2GZY A;  2RLI A;  2GS3 A;  4F9Z A;  4TXO A;  2A4V A;  3GSS A;  1N2A A;  1T3B A;  1TDI A;  2KP1 A;  3WGX A;  3I6A A;  5F0G A;  1V9W A;  1EV4 A;  5E59 A;  3DYR A;  2VL3 A;  4AI6 A;  1XXU A;  2VAF A;  3VI5 A;  5ELA A;  4TR1 B;  2VL9 A;  4HZ4 A;  2YV7 A;  1E6B A;  1SJI A;  4ISD A;  3ZVJ D;  1R26 A;  1T1V A;  18GS A;  1PD2 1;  2M80 A;  2XBQ A;  3C8E A;  1GSF A;  2HRK B;  2VCV A;  4PXO A;  4K2X A;  1JZO A;  2LJR A;  1CQG A;  5EL8 A;  4BWQ A;  3WYW A;  2FLS A;  1XOB A;  1GSE A;  1U88 A;  3H4K A;  4MNN A;  1A2J A;  2P0G A;  2WCI A;  4EIP A;  4TR1 A;  4ML1 A;  5HFI A;  5ECK B;  1SL1 B;  3UVH A;  4PI0 C;  4YQM A;  3ERW A;  2C3Q A;  2FA8 A;  1M2A A;  2D2Z A;  1LU4 A;  4I6X A;  1FO5 A;  1PX7 A;  5DQY A;  2HRK A;  2NDO A;  2H30 A;  2Z9S A;  4F03 A;  4O5Q A;  2PVO C;  4GSS A;  2V2G A;  5DVB A;  2AAW A;  1XPV A;  3EE2 A;  2HE3 A;  4AGS A;  3J7Y b;  4JZQ A;  22GS A;  2CV4 A;  3F63 A;  2IMI A;  3APO A;  19GS A;  2PGT A;  3APQ A;  1OYJ A;  2C0D A;  4Q5R A;  2YWI A;  3EC3 A;  3ME8 A;  4CDO A;  2H6Y A;  2M72 A;  6GSU A;  2VUP A;  3KP8 A;  1GSD A;  2O36 A;  4FYB A;  2CAI A;  1TW9 A;  2O85 A;  2PMT A;  3ISO A;  1G7O A;  5CAX A;  1WIK A;  4I97 A;  4HJM A;  4K1F A;  3IRA A;  1HNB A;  3MAK A;  3QDN A;  3C1R A;  4XCS A;  4EIQ A;  3RGB C;  5LNK e;  2YAN A;  1SK1 A;  3EIN A;  3H8Q A;  2WJU A;  3KXO A;  1TJD A;  3ERG A;  2O87 A;  1M2B A;  3A3T A;  3GKN A;  5AIS A;  2ON7 A;  1DBY A;  4OWY A;  2V6O A;  4GST A;  3HZ4 A;  4Z7X A;  1ZYP A;  2WRT A;  3QOU A;  3LGC A;  1M3I A;  4Q5Q A;  2L59 A;  1GUK A;  2P5Q A;  1K0O A;  3M8N A;  4POL A;  2R0G A;  1GLQ A;  2DJ2 A;  5HR1 A;  1K0A A;  2IMF A;  2H1L A;  2A2R A;  1MDJ A;  2GGT A;  1T4Y A;  4QL7 A;  2HXK A;  4PQ1 A;  2C0G A;  4KX4 A;  1K0D A;  3R3E A;  1TOF A;  2BJX A;  1THO A;  2JAC A;  4MJE A;  1YF1 A;  2WZ9 A;  5EPF A;  4Z2R A;  2VCQ A;  5JWQ B;  4AJ7 A;  2TIR A;  4RQR A;  3IHG A;  4V1A g;  4LMV A;  1ZGN A;  3HY2 A;  1USB A;  4QQ7 A;  4PTS A;  1YDK A;  3QAW A;  4IBP A;  3ZRE A;  1GNW A;  1PKW A;  3TJF A;  4ACS A;  1X5E A;  4HZ2 A;  2HFD A;  4F82 A;  1W4V A;  5F8B A;  4IJI A;  2DJ3 A;  1SL0 B;  10GS A;  4IEL A;  1MTC A;  4HDE A;  5AGY A;  4GCI A;  4ZL9 A;  1A23 A;  4TRX A;  2LS5 A;  3MSZ A;  2JU5 A;  12GS A;  1X5C A;  11GS A;  4PQI A;  3UAP A;  5COH A;  3CTF A;  3I69 A;  5A34 B;  1Z6N A;  5G1K A;  1SYX A;  1TU8 A;  1X0R A;  2K6V A;  4POK A;  4AKI A;  4XIH A;  2PU9 C;  3DVX A;  1WWJ A;  1AQV A;  4KUN A;  3HDC A;  2YWN A;  2O5V A;  1SKS B;  3D22 A;  1ABA A;  3D4M A;  3A2W A;  2F8F A;  7GSS A;  2HRA A;  1PKZ A;  2YP6 A;  2DJJ A;  4TKY A;  2XPD A;  4WF4 A;  2FY6 A;  1GSQ A;  5D93 A;  4EUY A;  3ZVJ A;  4JU5 A;  1TP9 A;  1ZYE A;  1OE7 A;  1TI3 A;  3HCZ A;  4K0N A;  2MBS A;  3FR6 A;  4ECJ A;  1R7H A;  3GYK A;  2OE0 A;  4NHZ A;  3D4T A;  2GT6 A;  3RFR C;  2NVL A;  5D73 A;  3VPQ A;  1TTZ A;  4KSO A;  4PUR A;  4DSS A;  3TRQ A;  3DML A;  2DML A;  5D8I A;  2WW1 A;  4KW6 A;  3V1W A;  4V1A p;  2XC2 A;  2TRX A;  2X64 A;  2YN1 A;  3DGQ A;  3HZ8 A;  3VWU A;  2O3E A;  5DAL B;  5J40 A;  4J2F A;  5B8A A;  3DVW A;  4KSM A;  4KND A;  2MMN A;  1PFO A;  3E9J B;  2IMK A;  1XVW A;  1X9M B;  3ZTL A;  4EVM A;  3PR8 A;  1Q4J A;  4XRA A;  3QCP A;  3IAS 2;  2OBK A;  2QKE A;  1PRX A;  2MMA A;  3CRU A;  1QXH A;  2WVY A;  3O3T A;  5AIX A;  2GSS A;  4OD7 A;  6GSX A;  3VWX A;  4GXZ A;  2C80 A;  2JSY A;  4EDY A;  5GST A;  3F6D A;  1Y1U A;  2B1L A;  2MYG A;  3GTU A;  4ECI A;  2JAD A;  2R6K A;  1HYU A;  2K18 A;  5AIV A;  2H1D A;  2HSY A;  4QMK A;  4G2E A;  1S4B P;  2GVP A;  3J7Y k;  1K0B A;  1JFU A;  3LJR A;  4BIK A;  1PMT A;  1O8W A;  3CWG A;  1H4O A;  5IO0 A;  2HQT A;  2HRF A;  1K0N A;  4WET A;  2R0C A;  5ID2 B;  2WW2 A;  3L9U A;  4GLT A;  3SWL A;  1AQW A;  3GN3 A;  2WUL A;  4AKX B;  3FR9 A;  3GNJ A;  1MD3 A;  3UMA A;  3IK9 A;  4WBR D;  1GSU A;  4MJC A;  3DEX A;  1ZZY A;  2H01 A;  2C0F A;  1JLW A;  2R4V A;  2HNL A;  2F8A A;  1MD4 A;  2PVQ A;  2YWO A;  2FWH A;  8GSS A;  3PH9 A;  16GS A;  4BVX B;  2WGR A;  1FOV A;  5J4V A;  4QL9 A;  4DSQ A;  4MP4 A;  1YEP A;  5IOW A;  5IMV A;  4EKZ A;  2DC5 A;  3A5W A;  3UJ1 A;  4YKF A;  3M0F A;  3DKS A;  4MDC A;  2GSR A;  2RUF A;  2H1A A;  1YZX A;  2DJ0 A;  2HLS A;  2GT5 A;  1BG1 A;  1GL8 A;  1OC8 A;  3TKR A;  4J57 E;  1SKR B;  1GSY A;  4X43 A;  1M99 A;  5C00 A;  1SJZ A;  1QFN A;  4TXV A;  1K3Y A;  2HT9 A;  4L0W A;  2L5L A;  1AIU A;  3HHV A;  1U87 A;  1GTB A;  4FYC A;  2VCT A;  2QA1 A;  3RHB A;  3HXS A;  3EMP A;  1EOG A;  4BVX A;  5CRH A;  5A1N B;  2AB6 A;  4GF0 A;  2XBI A;  5F05 A;  3KGK A;  3EVI A;  1VF3 A;  3IE3 A;  2C1Y A;  4OFM A;  3IV4 A;  2OE1 A;  5BRT A;  2F3M A;  3P2A A;  5J9B A;  2WS2 A;  4MZB A;  1V98 A;  4TW5 A;  1G0T A;  3SBC A;  3CQF A;  1QMV A;  2FGX A;  1WRY A;  4XRD A;  5EY6 A;  2CX4 A;  5DDL A;  1FHE A;  2IJY A;  2HZE B;  4HI7 A;  1XG8 A;  1WMJ A;  5HFK A;  4RQX A;  1MEK A;  3TKS A;  1S3R A;  5A1N A;  4KDU A;  1SK0 A;  3WT1 A;  3QR6 A;  3IC4 A;  3I43 A;  3LFL A;  4G19 A;  4X0X A;  1WOU A;  4BPY A;  4WXT A;  3E3E A;  1XWC A;  1ERT A;  1EP7 A;  4N11 A;  2OKA A;  1SK2 A;  2KP2 A;  2GSQ A;  2B3S A;  1THX A;  2EFD A;  3ME7 A;  4HQZ A;  3UBK A;  1I1I P;  2H72 A;  1XWA A;  1AXD A;  1K0M A;  3QMX A;  4X4J A;  2R3X A;  4JR6 A;  1R4W A;  2K8V A;  2VM1 A;  3MDK A;  3TJK A;  4L0U A;  1Y6E A;  2JZR A;  3MWH A;  4LMW A;  5ECS A;  5ECP B;  5ECH B;  4ZB7 A;  4TOP A;  1A8L A;  4K7N A;  4IGJ A;  4WBJ A;  1YVL A;  2YZU A;  1GSS A;  3UAR A;  13GS A;  4O92 A;  2X49 A;  4HEA 2;  1B9X C;  4MA9 A;  2EIO A;  2OBI A;  4RI6 A;  4OCF A;  4ID0 A;  3GUS A;  5KN1 A;  2EFE A;  1BF5 A;  4ZL8 A;  4ECC A;  4PQH A;  2WDU A;  2VL2 A;  3HVN A;  4HSC X;  1VGL A;  4GQF A;  2YJ7 A;  3ZML A;  3BJ5 A;  1Z6M A;  1QQ2 A;  3UBL A;  3D6I A;  3L9V A;  3MNG A;  4XTS A;  3VFI A;  1PL1 A;  4KE3 A;  3ZFL A;  3GH9 A;  4Z2T A;  2NBS A;  5DCG A;  1YKC A;  4K5S A;  3UOM A;  2H70 A;  4TR0 A;  2NPB A;  3MYD A;  1YEW C;  4L5L A;  2RM6 A;  4AKH A;  4IKH A;  5CP1 A;  4TVE A;  2R5G A;  3M9K A;  3ZIT A;  5B8B A;  5DCH A;  2WW3 A;  5ECL B;  1KBN A;  1ERW A;  3EU4 A;  2IWT A;  2GST A;  3CXG A;  2GTU A;  3QAG A;  1PX6 A;  1QGV A;  5IMC A;  1GTU A;  2AV4 A;  1C72 A;  3LXT A;  3Q74 A;  2E0Q A;  1ZYQ B;  2EC4 A;  3TOT A;  2V32 A;  2AJQ B;  3C71 A;  3PIN A;  5JWO B;  4W66 A;  2A2S A;  1W89 A;  2LQO A;  5G31 A;  1EZK A;  5C04 A;  4MJB A;  3HYP A;  3G7J A;  4K7O A;  2JZS A;  3CTG A;  2H0G A;  1KNG A;  1G6Y A;  1S3C A;  3RDW A;  4I8B A;  4MLY A;  2FD3 A;  2X99 A;  4OMV A;  5J4Y A;  5A4W A;  4KA0 A;  2B5E A;  2M46 A;  2V1M A;  1XW5 A;  5D96 A;  3ED3 A;  2EFC A;  3RHC A;  2MZC A;  2KLX A;  1O73 A;  2HZF A;  1QK8 A;  2LJK A;  5GSS A;  2B7J A;  4MH2 A;  1V58 A;  3KZQ A;  5G5E A;  3D21 A;  2RM5 A;  3VWV A;  3APS A;  2H71 A;  2R37 A;  2BMX A;  4RUV A;  4G0L A;  4FIW A;  5JWR B;  3ZIJ A;  3TCO A;  1R5A A;  4IP6 A;  2YZH A;  3IC8 A;  1S3D A;  4MF6 A;  3ZIV A;  2J23 A;  1GUM A;  1AQX A;  5IIZ A;  3NZN A;  1N8J A;  1O8X A;  2VCX A;  3O6T A;  2VCZ A;  1J9B A;  2HRN A;  4J56 E;  4ICY A;  3US3 A;  2VLU A;  4YAP A;  14GS A;  3TJJ A;  1GTI A;  4Z2U A;  1WP0 A;  2DLX A;  3HVV A;  1BED A;  1YJ6 A;  2O89 A;  2GQL A;  2LST A;  1SEN A;  4YQU A;  4ZIL A;  1NSW A;  3UIW A;  1N25 A;  1JZD A;  2C3N A;  2CVD A;  4PHZ C;  5KEJ A;  3K8N A;  4OCE A;  3FMW A;  3LW9 A;  2CAQ A;  4F0C A;  3QD9 A;  3HKR A;  2LV3 A;  1WJK A;  4MJA A;  3KJY A;  6GSV A;  3F6F A;  2E2G A;  1GLP A;  4V2N A;  3L4N A;  1O81 A;  4ZBD A;  4GQC A;  2GDR A;  1G7E A;  4FH8 A;  1F3A A;  1JHB A;  1XWG A;  2VCW A;  3Q18 A;  5ECM B;  2WVZ A;  1U6T A;  4KDY A;  3TRX A;  1HNA A;  2DJK A;  3N5O A;  1M3J A;  1OC9 B;  3DD3 A;  2H19 A;  5J3R A;  4MPG A;  2IN3 A;  5HFG A;  5DJM A;  4ZB9 A;  2OAD A;  2EIQ A;  4K2D A;  4E8H A;  1BAY A;  1U3I A;  3N9J A;  2CZ2 A;  5IMD A;  2J9H A;  1B4Q A;  4K9Z A;  1TRV A;  3W8S A;  4DSR A;  1K3L A;  2R2J A;  5A34 A;  2LRT A;  1TKD B;  3DXB A;  2B5X A;  1AUC A;  2CZ3 A;  3FY7 A;  4K6X A;  2IME A;  4G01 A;  3F3R A;  1YKA A;  1SL2 B;  4MPF A;  4ZBB A;  2ES7 A;  1ZCP A;  2GQK A;  4MH3 A;  3ZYW A;  2IFQ B;  5BMU B;  3P7X A;  2G0F A;  2LUS A;  4IW9 A;  4I2U A;  4G9H A;  3F0I A;  1CQH A;  3BBY A;  2FUG 2;  2PUK C;  1R5P A;  1SD8 A;  5JCU A;  4F2I A;  2IIY A;  2JZT A;  3L78 A;  1BX9 A;  5LCZ A;  1HQO A;  4V2L A;  5ECN B;  3TB2 A;  1IYI A;  1FVJ A;  1B48 A;  2E7P A;  3VK9 A;  4IN0 A;  4N10 A;  2YJH A;  1PGT A;  2JL4 A;  2OJL A;  1XIY A;  2B6M A;  3KCM A;  1ERV A;  3FR3 A;  1U3A A;  1PSQ A;  2H8L A;  2VOC A;  1MDI A;  2LEG A;  4KF9 A;  3KTB A;  1VF4 A;  3VPT A;  2FWF A;  5BMU A;  3EYT A;  2I1U A;  1Z9H A;  4OFN A;  3ZZX A;  5DBQ A;  5ENU A;  5DAL A;  3TDG A;  2L6C A;  3TKQ A;  1HNC A;  4N0V A;  2QGV A;  1RK4 A;  4Q5N A;  2I4A A;  3LSZ A;  2WFC A;  1FW1 A;  1TU7 A;  4XS6 A;  1B4P A;  3GKX A;  4JR4 A;  2MMZ A;  4IHU A;  3LXZ A;  3IHQ A;  5CRD A;  4N30 A;  3GL5 A;  5CRW A;  1F9M A;  2DMM A;  4ZXG A;  4EE0 A;  3F3Q A;  2CVB A;  3E0U A;  4X1U A; 
#chains in the Genus database with same CATH homology
 3C73 A;  4WR4 A;  1NHY A;  2NTO A;  2ZNM A;  3CSH A;  1EOH A;  3I9V 2;  3GST A;  2YCD A;  3HA9 A;  1EV9 A;  2VM2 A;  4KGI A;  1TRU A;  4EC0 A;  5B6N A;  3UEM A;  3VI7 A;  2DIZ A;  3HJP A;  2LJA A;  3KH7 A;  3JCM L;  4KB3 A;  3KP9 A;  4BA7 A;  1ILO A;  5ID2 A;  3TUE A;  3WGD A;  1ML6 A;  1A0F A;  4LL1 B;  3EMX A;  4PNF A;  1O85 A;  1OC3 A;  4ML6 A;  3U5R E;  4I2T A;  2H76 A;  2GLR A;  2H6X A;  2OAC A;  1V2A A;  20GS A;  2ZCT A;  1TK8 B;  3GV1 A;  2K9F A;  5KN0 A;  1T4Z A;  4HUA A;  5ELG A;  2UZ8 A;  3PPU A;  1Z7P A;  1JLV A;  3IA1 A;  4LLR A;  2H1G A;  3FK8 A;  3KMN A;  5G2Z A;  3C7M A;  5ECI B;  2EFH A;  2PWJ A;  3IK7 A;  1YF0 A;  4ZB6 A;  2AHE A;  1O6J A;  1GRX A;  2C8U A;  3W6G A;  1T00 A;  1VF2 A;  4N3Z A;  4HU9 A;  5FT3 A;  5G1L A;  3M9J A;  4PUF C;  3TU3 B;  1YEX A;  2L57 A;  5GAN D;  3DRN A;  2DKI A;  5G5F A;  3GKK A;  2FHE A;  5B7C A;  3TKS C;  4IS0 A;  1DE1 A;  2QC7 A;  1EEM A;  4NV5 A;  3GA4 A;  2CQ9 A;  1EGR A;  2VLT A;  2HSM B;  4NHW A;  3CRT A;  2A2P A;  5G30 A;  1LBK A;  4L5O A;  2H1B A;  4O5R A;  3FZ9 A;  5J41 A;  1GP1 A;  2C4J A;  3HJM A;  2CA8 A;  4BWS A;  5IMZ A;  1XW6 A;  3TJG A;  4GSN A;  1S3A A;  5KN3 A;  4KDX A;  2HZE A;  3ZL5 A;  4EF0 A;  3P8W A;  4IVF A;  3IAM 2;  4HU7 A;  3WT2 A;  3MIX A;  6GST A;  2N5B A;  4G0K A;  2RUE A;  5AN1 A;  4DVC A;  3GX8 A;  4WKW A;  4ZIJ A;  1ZOF A;  2DIY A;  5LD0 A;  3FYG A;  3A2V A;  3PGT A;  3NOF A;  2OT3 A;  2H66 A;  5DAK B;  2V41 A;  2HSM A;  3GUR A;  2KOK A;  2H75 A;  1J08 A;  1ZYN A;  5ECO B;  1XCC A;  5H5R A;  3VUR A;  3FZ5 A;  4ZBA A;  4K0G A;  9GSS A;  5FWG A;  3DWV A;  1TI1 A;  1AC1 A;  1ON4 A;  1VRS D;  3RPP A;  4XS1 A;  3RBT A;  1QUW A;  1J0F A;  4CY6 A;  3ZLP A;  5IMA A;  3ZFB A;  3QAV A;  1TRS A;  4NMU A;  1SD9 A;  2VL2 C;  4NAX A;  3O76 A;  4GRF A;  3TGZ A;  2HI7 A;  3TKP A;  4AJ8 A;  3GFK A;  3G7I A;  5DJL A;  3L0H A;  1A2M A;  4TR3 A;  1FB6 A;  3LYP A;  5DAK A;  3OR5 A;  3GX0 A;  2PER A;  5GZZ B;  4XS4 B;  3HJO A;  1SVL A;  2LTK A;  1GUL A;  4CHS A;  1BYE A;  3F8U A;  5GAP D;  3C1S A;  5ABR A;  3EUR A;  1UVZ A;  2CT6 A;  4JED A;  1FOH A;  3BCI A;  4V2M A;  2VKZ G;  4G0I A;  4O7H A;  3FHK A;  1XVQ A;  1TXU A;  3VLN A;  4BVY B;  4YH2 A;  4PGT A;  3QFA C;  4KCA A;  1FB0 A;  3GRX A;  2H6Z A;  1FG4 A;  2ALB A;  4IP1 A;  2X8C A;  4MK3 A;  1Z3E A;  4XS4 A;  1EP8 A;  5ECR B;  2OE3 A;  1IYH A;  4FQU A;  1PA3 A;  1XW9 A;  4K7I A;  5IM9 A;  1UC7 A;  1TK5 B;  5EVO A;  2IL3 A;  1SKW B;  5INY A;  17GS A;  1PL2 A;  3G9B A;  2LNT A;  1FAA A;  4AF2 A;  2PN8 A;  1SYR A;  4JRR A;  3H93 A;  4EXJ A;  2VD1 A;  2HYX A;  4BVY A;  2MBT A;  4HS1 A;  1X9W B;  5F07 A;  3UVT A;  1F37 A;  4AJ6 A;  3ZRD A;  3TOU A;  1NW2 A;  2L4C A;  1BG5 A;  5CO3 A;  5HQP A;  4PUA A;  5FHI A;  5IOX A;  1E2Y A;  3QPM A;  4OO4 A;  4ZB8 A;  5H5Q A;  6GSS A;  1SVO A;  1X5D A;  4LL4 B;  4K5R A;  5D9V A;  1WPI A;  1XWK A;  4IQA A;  1H75 A;  1K0C A;  1OKD A;  3WGE A;  1B8X A;  4P3Y B;  5IO2 A;  1XOA A;  2P31 A;  3LQ7 A;  1OAZ A;  4GDF A;  1OE8 A;  2R0P A;  3GL3 A;  4WF5 A;  1GWC A;  3RAZ A;  2LKU A;  2QSI A;  4E8E A;  3LYK A;  3S9F A;  1F3B A;  1SJ6 A;  4NPB A;  2A4H A;  3U6V A;  5D9T A;  1LJR A;  4OFT A;  1A8Y A;  3AY8 A;  4IJ3 A;  4TR4 A;  1BJX A;  1A2L A;  3NIV A;  4D73 B;  4NWY A;  4MF5 A;  3GMF A;  1OVN A;  4N0Z A;  2PPT A;  3UL3 A;  1TRW A;  2N5A A;  3A2X A;  3EWL A;  1XBS A;  1YY7 A;  5CRE A;  4OO5 A;  3Q6O A;  4NXI A;  2GZP A;  1M0U A;  3ZMK A;  4L8E A;  4Q5F A;  3P90 A;  5CRG A;  3HD5 A;  4ZL7 A;  2MMO A;  4EDZ A;  3F9U A;  2OA7 A;  2P5R A;  2HSN B;  5HR3 A;  3HVS A;  1X9S B;  2X8H A;  1F2E A;  1PQN A;  4MCU A;  1EWX A;  5A5K A;  4D73 A;  4YKG A;  1ZMA A;  5A4U A;  4HQS A;  4ILF A;  1YQ1 A;  1K3O A;  3M3M A;  3Q19 A;  1KTE A;  2B7K A;  1PN9 A;  4YQV A;  1EGO A;  1F6M C;  3FEU A;  2LNS A;  1Z7R A;  1GH2 A;  1M9A A;  3F4R A;  1T7P B;  4HJ2 A;  5J4U A;  4JE1 A;  1JZR A;  3KD0 A;  3IXR A;  1JZW A;  2HSN A;  3IBH A;  4KCE A;  4DSS B;  2GZZ A;  3IPZ A;  2B1K A;  3G7Y A;  4XHM A;  1ERU A;  4G10 A;  4POB A;  1GTA A;  2N5F A;  1A0R P;  1OC9 A;  1NHO A;  3LG6 A;  4KAE A;  3FRC A;  5ECQ B;  1ACV A;  1URM A;  4FO5 A;  2XPE A;  1V40 A;  5JCG A;  2KHP A;  3GH6 A;  2E2M A;  4MF7 A;  3F4T A;  4GTU A;  1G6W A;  3W8J A;  1AAZ A;  1FVK A;  2DKH A;  2FWE A;  1XZO A;  1GUH A;  3F4S A;  4MZC A;  5IMF A;  2YOI A;  1UN2 A;  1Q98 A;  2O7K A;  4MMM A;  2ON5 A;  5E4W A;  5F06 A;  1V57 A;  2K8S A;  2I81 A;  3CBU A;  2CX3 A;  3GTU B;  1B9Y C;  5IPG A;  2I9H A;  3HVX A;  4GWR A;  5H5S A;  1T8E B;  5D9X A;  1O7U A;  4JBB A;  2YWM A;  1SU9 A;  1UA5 A;  5KOX A;  2C0E A;  3CSI A;  1SVM A;  2VD0 A;  2IFQ A;  2CVK A;  2DBC A;  2JSZ A;  3TKS E;  2H74 A;  6GSY A;  1EEJ A;  1TXX A;  4TN8 A;  3KIJ A;  1KEB A;  3KH9 A;  5IPH A;  2FA4 A;  1RQM A;  2GQM A;  2H0I A;  1MDK A;  3HMJ G;  2LRC A;  2XHF A;  3GHA A;  3FZA A;  5B6M A;  2IPA A;  2LQQ A;  5D9W A;  4YAV A;  2C3T A;  1HD2 A;  2F51 A;  4CY8 A;  3IR4 A;  3CYN A;  3IOS A;  2DJ1 A;  3LOR A;  4IQ1 A;  3TRP A;  4PX1 A;  4DEJ A;  1TK0 B;  3BD2 A;  1BQ7 A;  3H79 A;  4I5Q A;  3GIX A;  5DQS A;  3FW2 A;  1A24 A;  3LWA A;  4HOJ A;  3D5J A;  3EU3 A;  2FWG A;  5KOW A;  1M9B A;  4WEY A;  1XFL A;  2I3Y A;  3BCK A;  4NV2 A;  3TJB A;  2DSA A;  2L6D A;  5JCW A;  2QA2 A;  1RW1 A;  5HR0 A;  2H0H A;  2KUC A;  1OKT A;  5A4V A;  2HSH A;  2VIM A;  1ZL9 A;  3QFB C;  3M1G A;  3KTL A;  4EL1 A;  1DSB A;  3VWW A;  5HR2 A;  3FZ4 A;  3CSJ A;  2REM A;  3IDV A;  4F0B A;  1GNE A;  1WE0 A;  4O5U A;  2TRC P;  1ST9 A;  2V6K A;  2L4Q A;  4PNG A;  6GSW A;  2B5Y A;  4MZW A;  1Z5Y E;  1Y25 A;  3DIE A;  4K8M A;  3CMI A;  2WB9 A;  4FYU A;  4AKG A;  2H73 A;  5CNW A;  3A5I A;  1DUG A;  5L71 A;  5A5H B;  2FCH A;  4O32 A;  1PN0 A;  2L5O A;  4ULX A;  3ERF A;  3KM6 A;  2ZUP A;  3EPT A;  5CYY A;  2UV8 G;  4E68 A;  2YPM A;  2G2Q A;  2YNX A;  2AUV A;  5J9C A;  5IQY A;  4WR5 A;  3R2Q A;  4KH7 A;  5J47 A;  3GKM A;  2VLV A;  2O8V B;  3LEF A;  3WD6 A;  1M7T A;  2X8G A;  2RII A;  4USS A;  4BL7 B;  2IMD A;  1NM3 A;  2AYT A;  1VF1 A;  4ECB A;  4EO3 A;  5A5H A;  4A5P A;  4LA1 A;  4TXO B;  2FNO A;  4POM A;  1AW9 A;  3KMO A;  3BOA A;  4CW9 A;  3L9S A;  2EIR A;  2LRN A;  3D0Z A;  4H86 A;  2PBJ A;  3KEB A;  1I9D A;  5J5N A;  3H1N A;  2F9S A;  2YV9 A;  4RI7 A;  1DE2 A;  2VO4 A;  3RPN A;  2X4A A;  1M2D A;  5KN2 A;  4MAB A;  1XWB A;  2BTO T;  3FKF A;  1I5G A;  4BL7 A;  2GZY A;  2RLI A;  2GS3 A;  4F9Z A;  4TXO A;  2A4V A;  3GSS A;  1N2A A;  1T3B A;  1TDI A;  2KP1 A;  3WGX A;  3I6A A;  5F0G A;  1V9W A;  1EV4 A;  5E59 A;  3DYR A;  2VL3 A;  4AI6 A;  1XXU A;  2VAF A;  3VI5 A;  5ELA A;  4TR1 B;  2VL9 A;  4HZ4 A;  2YV7 A;  1E6B A;  1SJI A;  4ISD A;  3ZVJ D;  1R26 A;  1T1V A;  18GS A;  1PD2 1;  2M80 A;  2XBQ A;  3C8E A;  1GSF A;  2HRK B;  2VCV A;  4PXO A;  4K2X A;  1JZO A;  2LJR A;  1CQG A;  5EL8 A;  4BWQ A;  3WYW A;  2FLS A;  1XOB A;  1GSE A;  1U88 A;  3H4K A;  4MNN A;  1A2J A;  2P0G A;  2WCI A;  4EIP A;  4TR1 A;  4ML1 A;  5HFI A;  5ECK B;  1SL1 B;  3UVH A;  4YQM A;  3ERW A;  2C3Q A;  2FA8 A;  1M2A A;  2D2Z A;  1LU4 A;  4I6X A;  1FO5 A;  1PX7 A;  5DQY A;  2HRK A;  2NDO A;  2H30 A;  2Z9S A;  4F03 A;  4O5Q A;  2PVO C;  4GSS A;  2V2G A;  5DVB A;  2AAW A;  1XPV A;  3EE2 A;  2HE3 A;  4AGS A;  3J7Y b;  4JZQ A;  22GS A;  2CV4 A;  3F63 A;  2IMI A;  3APO A;  19GS A;  2PGT A;  3APQ A;  1OYJ A;  2C0D A;  4Q5R A;  2YWI A;  3EC3 A;  3ME8 A;  4CDO A;  2H6Y A;  2M72 A;  6GSU A;  2VUP A;  3KP8 A;  1GSD A;  4FYB A;  2CAI A;  1TW9 A;  2O85 A;  2PMT A;  3ISO A;  1G7O A;  5CAX A;  1WIK A;  4I97 A;  4HJM A;  4K1F A;  3IRA A;  1HNB A;  3MAK A;  3QDN A;  3C1R A;  4XCS A;  4EIQ A;  5LNK e;  2YAN A;  1SK1 A;  3EIN A;  3H8Q A;  2WJU A;  3KXO A;  1TJD A;  3ERG A;  2O87 A;  1M2B A;  3A3T A;  3GKN A;  5AIS A;  2ON7 A;  1DBY A;  4OWY A;  2V6O A;  4GST A;  3HZ4 A;  4Z7X A;  1ZYP A;  2WRT A;  3QOU A;  3LGC A;  4Q5Q A;  2L59 A;  1GUK A;  2P5Q A;  1K0O A;  3M8N A;  4POL A;  2R0G A;  1GLQ A;  2DJ2 A;  5HR1 A;  1K0A A;  2IMF A;  2H1L A;  2A2R A;  1MDJ A;  2GGT A;  1T4Y A;  4QL7 A;  2HXK A;  4PQ1 A;  2C0G A;  4KX4 A;  1K0D A;  3R3E A;  1TOF A;  2BJX A;  1THO A;  2JAC A;  4MJE A;  1YF1 A;  2WZ9 A;  5EPF A;  4Z2R A;  2VCQ A;  5JWQ B;  4AJ7 A;  2TIR A;  4RQR A;  3IHG A;  4V1A g;  4LMV A;  1ZGN A;  3HY2 A;  1USB A;  4QQ7 A;  4PTS A;  1YDK A;  3QAW A;  4IBP A;  3ZRE A;  1GNW A;  1PKW A;  3TJF A;  4ACS A;  1X5E A;  4HZ2 A;  2HFD A;  4F82 A;  1W4V A;  5F8B A;  4IJI A;  2DJ3 A;  1SL0 B;  10GS A;  4IEL A;  1MTC A;  4HDE A;  5AGY A;  4GCI A;  4ZL9 A;  1A23 A;  4TRX A;  2LS5 A;  3MSZ A;  2JU5 A;  12GS A;  1X5C A;  11GS A;  4PQI A;  3UAP A;  5COH A;  3CTF A;  3I69 A;  5A34 B;  1Z6N A;  5G1K A;  1SYX A;  1TU8 A;  1X0R A;  2K6V A;  4POK A;  4AKI A;  4XIH A;  2PU9 C;  3DVX A;  1WWJ A;  1AQV A;  4KUN A;  3HDC A;  2YWN A;  2O5V A;  1SKS B;  3D22 A;  1ABA A;  3D4M A;  3A2W A;  2F8F A;  7GSS A;  2HRA A;  1PKZ A;  2YP6 A;  2DJJ A;  4TKY A;  2XPD A;  4WF4 A;  2FY6 A;  1GSQ A;  5D93 A;  4EUY A;  3ZVJ A;  4JU5 A;  1TP9 A;  1ZYE A;  1OE7 A;  1TI3 A;  3HCZ A;  4K0N A;  2MBS A;  3FR6 A;  4ECJ A;  1R7H A;  3GYK A;  2OE0 A;  4NHZ A;  3D4T A;  2GT6 A;  2NVL A;  5D73 A;  3VPQ A;  1TTZ A;  4KSO A;  4PUR A;  4DSS A;  3TRQ A;  3DML A;  2DML A;  5D8I A;  4KW6 A;  3V1W A;  4V1A p;  2XC2 A;  2TRX A;  2X64 A;  2YN1 A;  3DGQ A;  3HZ8 A;  3VWU A;  5DAL B;  5J40 A;  4J2F A;  5B8A A;  3DVW A;  4KSM A;  4KND A;  2MMN A;  3E9J B;  2IMK A;  1XVW A;  1X9M B;  3ZTL A;  4EVM A;  3PR8 A;  1Q4J A;  4XRA A;  3QCP A;  3IAS 2;  2OBK A;  2QKE A;  1PRX A;  2MMA A;  3CRU A;  1QXH A;  3O3T A;  5AIX A;  2GSS A;  4OD7 A;  6GSX A;  3VWX A;  4GXZ A;  2C80 A;  2JSY A;  4EDY A;  5GST A;  3F6D A;  1Y1U A;  2B1L A;  2MYG A;  3GTU A;  4ECI A;  2JAD A;  2R6K A;  1HYU A;  2K18 A;  5AIV A;  2H1D A;  2HSY A;  4QMK A;  4G2E A;  2GVP A;  3J7Y k;  1K0B A;  1JFU A;  3LJR A;  1PMT A;  1O8W A;  3CWG A;  1H4O A;  5IO0 A;  2HQT A;  2HRF A;  1K0N A;  4WET A;  2R0C A;  5ID2 B;  3L9U A;  4GLT A;  3SWL A;  1AQW A;  3GN3 A;  2WUL A;  4AKX B;  3FR9 A;  3GNJ A;  1MD3 A;  3UMA A;  3IK9 A;  4WBR D;  1GSU A;  4MJC A;  3DEX A;  1ZZY A;  2H01 A;  2C0F A;  1JLW A;  2R4V A;  2HNL A;  2F8A A;  1MD4 A;  2PVQ A;  2YWO A;  2FWH A;  8GSS A;  3PH9 A;  16GS A;  4BVX B;  2WGR A;  1FOV A;  5J4V A;  4QL9 A;  4DSQ A;  4MP4 A;  1YEP A;  5IOW A;  5IMV A;  4EKZ A;  2DC5 A;  3A5W A;  3UJ1 A;  4YKF A;  3M0F A;  3DKS A;  4MDC A;  2GSR A;  2RUF A;  2H1A A;  1YZX A;  2DJ0 A;  2HLS A;  2GT5 A;  1BG1 A;  1GL8 A;  1OC8 A;  3TKR A;  4J57 E;  1SKR B;  1GSY A;  4X43 A;  1M99 A;  5C00 A;  1SJZ A;  1QFN A;  4TXV A;  1K3Y A;  2HT9 A;  4L0W A;  2L5L A;  1AIU A;  3HHV A;  1U87 A;  1GTB A;  4FYC A;  2VCT A;  2QA1 A;  3RHB A;  3HXS A;  3EMP A;  1EOG A;  4BVX A;  5CRH A;  5A1N B;  2AB6 A;  4GF0 A;  2XBI A;  5F05 A;  3KGK A;  3EVI A;  1VF3 A;  3IE3 A;  2C1Y A;  4OFM A;  3IV4 A;  2OE1 A;  5BRT A;  2F3M A;  3P2A A;  5J9B A;  2WS2 A;  4MZB A;  1V98 A;  4TW5 A;  1G0T A;  3SBC A;  1QMV A;  2FGX A;  1WRY A;  4XRD A;  5EY6 A;  2CX4 A;  5DDL A;  1FHE A;  2IJY A;  2HZE B;  4HI7 A;  1WMJ A;  5HFK A;  4RQX A;  1MEK A;  3TKS A;  5A1N A;  4KDU A;  1SK0 A;  3WT1 A;  3QR6 A;  3IC4 A;  3I43 A;  3LFL A;  4G19 A;  4X0X A;  1WOU A;  4BPY A;  4WXT A;  3E3E A;  1XWC A;  1ERT A;  1EP7 A;  4N11 A;  2OKA A;  1SK2 A;  2KP2 A;  2GSQ A;  2B3S A;  1THX A;  2EFD A;  3ME7 A;  4HQZ A;  3UBK A;  2H72 A;  1XWA A;  1AXD A;  1K0M A;  3QMX A;  4X4J A;  2R3X A;  4JR6 A;  1R4W A;  2K8V A;  2VM1 A;  3MDK A;  3TJK A;  4L0U A;  1Y6E A;  2JZR A;  3MWH A;  4LMW A;  5ECS A;  5ECP B;  5ECH B;  4ZB7 A;  4TOP A;  1A8L A;  4K7N A;  4IGJ A;  4WBJ A;  1YVL A;  2YZU A;  1GSS A;  3UAR A;  13GS A;  4O92 A;  2X49 A;  4HEA 2;  1B9X C;  4MA9 A;  2EIO A;  2OBI A;  4RI6 A;  4OCF A;  4ID0 A;  3GUS A;  5KN1 A;  2EFE A;  1BF5 A;  4ZL8 A;  4ECC A;  4PQH A;  2WDU A;  2VL2 A;  1VGL A;  4GQF A;  2YJ7 A;  3ZML A;  3BJ5 A;  1Z6M A;  1QQ2 A;  3UBL A;  3D6I A;  3L9V A;  3MNG A;  4XTS A;  3VFI A;  1PL1 A;  4KE3 A;  3ZFL A;  3GH9 A;  4Z2T A;  2NBS A;  5DCG A;  1YKC A;  4K5S A;  3UOM A;  2H70 A;  4TR0 A;  2NPB A;  3MYD A;  4L5L A;  2RM6 A;  4AKH A;  4IKH A;  5CP1 A;  4TVE A;  2R5G A;  3M9K A;  3ZIT A;  5B8B A;  5DCH A;  5ECL B;  1KBN A;  1ERW A;  3EU4 A;  2IWT A;  2GST A;  3CXG A;  2GTU A;  3QAG A;  1PX6 A;  1QGV A;  5IMC A;  1GTU A;  2AV4 A;  1C72 A;  3LXT A;  3Q74 A;  2E0Q A;  1ZYQ B;  2EC4 A;  3TOT A;  2V32 A;  2AJQ B;  3C71 A;  3PIN A;  5JWO B;  4W66 A;  2A2S A;  1W89 A;  2LQO A;  5G31 A;  1EZK A;  5C04 A;  4MJB A;  3HYP A;  3G7J A;  4K7O A;  2JZS A;  3CTG A;  2H0G A;  1KNG A;  1G6Y A;  1S3C A;  3RDW A;  4I8B A;  4MLY A;  2FD3 A;  2X99 A;  4OMV A;  5J4Y A;  5A4W A;  4KA0 A;  2B5E A;  2M46 A;  2V1M A;  1XW5 A;  5D96 A;  3ED3 A;  2EFC A;  3RHC A;  2MZC A;  2KLX A;  1O73 A;  2HZF A;  1QK8 A;  2LJK A;  5GSS A;  2B7J A;  4MH2 A;  1V58 A;  3KZQ A;  5G5E A;  3D21 A;  2RM5 A;  3VWV A;  3APS A;  2H71 A;  2R37 A;  2BMX A;  4RUV A;  4G0L A;  4FIW A;  5JWR B;  3ZIJ A;  3TCO A;  1R5A A;  4IP6 A;  2YZH A;  3IC8 A;  1S3D A;  4MF6 A;  3ZIV A;  2J23 A;  1GUM A;  1AQX A;  5IIZ A;  3NZN A;  1N8J A;  1O8X A;  2VCX A;  3O6T A;  2VCZ A;  1J9B A;  2HRN A;  4J56 E;  4ICY A;  3US3 A;  2VLU A;  4YAP A;  14GS A;  3TJJ A;  1GTI A;  4Z2U A;  1WP0 A;  2DLX A;  3HVV A;  1BED A;  1YJ6 A;  2O89 A;  2GQL A;  2LST A;  1SEN A;  4YQU A;  4ZIL A;  1NSW A;  3UIW A;  1N25 A;  1JZD A;  2C3N A;  2CVD A;  5KEJ A;  3K8N A;  4OCE A;  3FMW A;  3LW9 A;  2CAQ A;  4F0C A;  3QD9 A;  3HKR A;  2LV3 A;  1WJK A;  4MJA A;  3KJY A;  6GSV A;  3F6F A;  2E2G A;  1GLP A;  4V2N A;  3L4N A;  1O81 A;  4ZBD A;  4GQC A;  2GDR A;  1G7E A;  4FH8 A;  1F3A A;  1JHB A;  1XWG A;  2VCW A;  3Q18 A;  5ECM B;  1U6T A;  4KDY A;  3TRX A;  1HNA A;  2DJK A;  3N5O A;  1OC9 B;  3DD3 A;  2H19 A;  5J3R A;  4MPG A;  2IN3 A;  5HFG A;  5DJM A;  4ZB9 A;  2OAD A;  2EIQ A;  4K2D A;  4E8H A;  1BAY A;  1U3I A;  3N9J A;  2CZ2 A;  5IMD A;  2J9H A;  1B4Q A;  4K9Z A;  1TRV A;  3W8S A;  4DSR A;  1K3L A;  2R2J A;  5A34 A;  2LRT A;  1TKD B;  3DXB A;  2B5X A;  1AUC A;  2CZ3 A;  3FY7 A;  4K6X A;  2IME A;  4G01 A;  3F3R A;  1YKA A;  1SL2 B;  4MPF A;  4ZBB A;  2ES7 A;  1ZCP A;  2GQK A;  4MH3 A;  3ZYW A;  2IFQ B;  5BMU B;  3P7X A;  2G0F A;  2LUS A;  4IW9 A;  4I2U A;  4G9H A;  3F0I A;  1CQH A;  3BBY A;  2FUG 2;  2PUK C;  1R5P A;  1SD8 A;  5JCU A;  4F2I A;  2IIY A;  2JZT A;  3L78 A;  1BX9 A;  5LCZ A;  1HQO A;  4V2L A;  5ECN B;  3TB2 A;  1IYI A;  1FVJ A;  1B48 A;  2E7P A;  3VK9 A;  4IN0 A;  4N10 A;  2YJH A;  1PGT A;  2JL4 A;  2OJL A;  1XIY A;  2B6M A;  3KCM A;  1ERV A;  3FR3 A;  1U3A A;  1PSQ A;  2H8L A;  2VOC A;  1MDI A;  2LEG A;  4KF9 A;  3KTB A;  1VF4 A;  3VPT A;  2FWF A;  5BMU A;  3EYT A;  2I1U A;  1Z9H A;  4OFN A;  3ZZX A;  5DBQ A;  5ENU A;  5DAL A;  3TDG A;  2L6C A;  3TKQ A;  1HNC A;  4N0V A;  2QGV A;  1RK4 A;  4Q5N A;  2I4A A;  3LSZ A;  2WFC A;  1FW1 A;  1TU7 A;  4XS6 A;  1B4P A;  3GKX A;  4JR4 A;  2MMZ A;  4IHU A;  3LXZ A;  3IHQ A;  5CRD A;  4N30 A;  3GL5 A;  5CRW A;  1F9M A;  2DMM A;  4ZXG A;  4EE0 A;  3F3Q A;  2CVB A;  3E0U A;  4X1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...