5J41A

Glutathione s-transferase bound with hydrolyzed piperlongumine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Structural and Biochemical Analyses Reveal the Mechanism of Glutathione S-Transferase Pi 1 Inhibition by the Anti-cancer Compound Piperlongumine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5j41A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5j41A01
2GSRA 3ZL5A 5ECHB 5JWQB 2J23A 4K9ZA 3M0FA 4OFNA 3TGZA 1HNCA 2YCDA 1G7OA 2OJLA 3KXOA 4RI7A 2V41A 1OYJA 2K18A 1GTUA 17GSA 2PUKC 3E0UA 2ALBA 2DJ3A 3UARA 1FAAA 3QAGA 3V1WA 4KCEA 2H6XA 1ZZYA 1B8XA 3VURA 2GT6A 2H71A 1FO5A 2WZ9A 1F2EA 4D73B 2IMKA 4JRRA 1AC1A 1USBA 3HZ4A 5IIZA 5GAND 4MA9A 2K9FA 3PINA 1PKZA 4LMVA 1J9BA 1M99A 1TI3A 4Q5NA 4KDYA 2HSYA 5ECOB 3TRXA 1TRUA 3ERWA 3DYRA 3FZ9A 2YWNA 3GH9A 2C80A 4NAXA 4TXOA 3ZLPA 4PQIA 1YY7A 3TJFA 2FUG2 2DMMA 1XOBA 2PPTA 1X5DA 3ZFLA 2A2SA 4V2LA 5HR2A 3ZITA 2YJ7A 2GSTA 2QSIA 1PGTA 2H72A 6GSSA 1J0FA 1DE2A 2FCHA 1X0RA 3RAZA 1T1VA 4YQMA 1KEBA 2I9HA 5HR3A 4N10A 2K8VA 5G1LA 2WCIA 4HU9A 5HFGA 4BWQA 3A2VA 4IW9A 3GL3A 4X43A 1PN9A 1T4YA 3C1RA 2R5GA 4O7HA 3HYPA 4PNGA 2VD0A 3FKFA 4ECBA 4XTSA 2WJUA 2H1DA 1R5AA 3F3RA 3J7Yb 4KE3A 1GNWA 2YPMA 4Q5RA 1FOVA 3ISOA 4MDCA 1ZYEA 3F4TA 2HLSA 4K1FA 3QAWA 2MMOA 1JLVA 3DWVA 2HSNB 5CREA 5A4WA 3CYNA 10GSA 1EV4A 3APOA 3L9SA 3GSTA 2R4VA 1EZKA 4TR1B 1OE8A 2B5YA 4POKA 3QOUA 2FWHA 2X8HA 3L4NA 4G2EA 2WB9A 1ZYQB 3KJYA 1O73A 3TRQA 3EWLA 2VM1A 1O81A 4G0LA 1SKRB 3IPZA 1VF2A 3LYPA 3PGTA 6GSYA 1TI1A 2VL2C 3P2AA 2GSSA 4KF9A 1G6WA 2EC4A 2DLXA 1BG5A 4G9HA 3EURA 2WULA 2C0FA 3RHBA 4TOPA 3FR9A 4MF6A 2GDRA 2K6VA 5HFIA 1UN2A 2VLTA 5IOXA 2AJQB 1TOFA 4NWYA 3LG6A 2QC7A 3DXBA 4EDYA 3I43A 4F2IA 4MK3A 3P90A 4AF2A 5G5EA 2OE1A 2YWOA 4MZWA 3DD3A 2VCWA 5ABRA 5GAPD 1YEPA 3KP9A 4AJ7A 4V1Ag 3HVVA 2DJ1A 3CXGA 4KGIA 2KP1A 1GSUA 3IE3A 2KLXA 1PX6A 2XPDA 4ZIJA 3L9UA 1ST9A 1TK5B 4ID0A 2C3QA 3W8SA 2YV7A 3F0IA 5D93A 2O85A 3G7IA 1TK0B 4HJMA 1U6TA 3TOTA 2CX4A 1ERVA 4BVXA 3H93A 1TW9A 4HDEA 4ZL9A 1YEXA 2DJJA 2VUPA 4I6XA 2F3MA 1B48A 1MDKA 1XOAA 2H6YA 2DSAA 5INYA 4MJCA 4KA0A 1NHYA 3KM6A 3ZRDA 4KCAA 3EMPA 1ZMAA 3HHVA 5IPGA 4JR4A 3ERFA 1MDJA 3VK9A 4G0KA 1CQGA 2JU5A 4YQUA 1SYXA 4KDXA 3KP8A 1SYRA 3DIEA 3QMXA 3BOAA 5B8BA 1XWBA 3LYKA 3EYTA 4BVYB 2GZZA 3WGEA 2H0HA 3FHKA 3IC4A 2M80A 6GSWA 1K0OA 2LEGA 3HJMA 5H5RA 4PUAA 5DALB 5ECNB 1GSYA 2O7KA 4XCSA 1X9MB 1GSEA 4NV5A 1F3AA 4D73A 3WT2A 2FWEA 2H73A 3SBCA 1QK8A 3GUSA 1K0MA 2LRTA 2HXKA 5F05A 1HNAA 4EDZA 1U87A 5D9TA 2I4AA 4I97A 3KD0A 4ISDA 4FYCA 3FR3A 3PPUA 1QGVA 3TDGA 2V1MA 4N11A 3HJPA 2IMIA 3Q6OA 1SL1B 3UIWA 3F4SA 3CRTA 1GUHA 4O5RA 4POMA 2DC5A 2ZUPA 3U6VA 2JZTA 1PQNA 5IOWA 1URMA 2C0DA 4JE1A 5EL8A 4ECIA 1SK2A 1SKSB 4USSA 5F0GA 3N9JA 3PR8A 2N5FA 2H1AA 2AAWA 4MMMA 2ON7A 2P5QA 4ECJA 2OA7A 5D9WA 4EXJA 2L5LA 1XIYA 2HZEA 5D96A 4XRAA 4BL7B 3VLNA 2R37A 2VAFA 4Q5FA 5F8BA 2B3SA 2OADA 2H0GA 2IPAA 2V6KA 5A5KA 5B6MA 1XWKA 3VPTA 4J2FA 2GTUA 2PWJA 2H76A 1K3OA 2IMFA 4HU7A 3ME8A 3S9FA 2GLRA 2A4VA 1HQOA 2IIYA 3MDKA 2LNTA 4LL1B 1T4ZA 4JU5A 1AQVA 3GFKA 3DKSA 1O8WA 1JZDA 3ZIVA 3VWXA 1VGLA 1Z5YE 1XBSA 3WD6A 2I3YA 1OC9B 2V2GA 4TR4A 5IMDA 1XW5A 4GCIA 1U3IA 4PNFA 3GN3A 4ILFA 1PA3A 2H6ZA 3TJKA 1EGOA 2NDOA 3LXZA 1Y6EA 3NOFA 1QQ2A 5AIVA 3EINA 3QPMA 1CQHA 4GSSA 1HD2A 1GTAA 3F6FA 1SKWB 4EUYA 2HZFA 3M1GA 5F07A 1VRSD 1G7EA 2C3TA 4GSNA 2HYXA 2BMXA 4IVFA 1TRVA 4FYBA 2VIMA 1WE0A 2IFQA 3M3MA 3GHAA 5J5NA 3TCOA 2K8SA 2H01A 4JZQA 3GIXA 4L8EA 4L5LA 2LJKA 4IJIA 5ELGA 4AJ6A 2O87A 4NV2A 5HR0A 3HZ8A 4HZ2A 1YF0A 1PRXA 4MLYA 2N5BA 4HOJA 1BAYA 1WIKA 3I6AA 2FA4A 3LSZA 3C73A 1XCCA 5G30A 2LKUA 4FO5A 3EVIA 3GYKA 1SJ6A 4EC0A 4JEDA 1R26A 1RW1A 2RLIA 3IV4A 4XS4B 1VF1A 3Q19A 1EGRA 3TJBA 4RQRA 1V2AA 4F03A 3I9V2 3ZZXA 1XVWA 2IL3A 2GS3A 4WETA 4YQVA 2HSHA 3GX8A 2YOIA 4FQUA 2HI7A 4OD7A 5DVBA 4Q5QA 1EP8A 2VL9A 4JBBA 4MH3A 1F9MA 1FB0A 3APSA 3VPQA 2VO4A 1UA5A 2LJRA 3GURA 3KIJA 5DCGA 4MF5A 5JCUA 5D9VA 4NHZA 2IWTA 2X8CA 2VM2A 1GNEA 22GSA 2RIIA 4BVYA 3MNGA 5G31A 3GX0A 1FVJA 3GSSA 2E2MA 3CTGA 5DALA 4K8MA 4WF4A 4ZB9A 4GQCA 4HUAA 1SD9A 2CAIA 2XHFA 3GH6A 4I2UA 5IQYA 5J3RA 1BQ7A 3BJ5A 1PL2A 2QGVA 1AW9A 1VF3A 2YANA 1U3AA 3QFBC 4WEYA 3LWAA 3ZREA 1Q4JA 2EIRA 2FLSA 1MD4A 4O92A 3LORA 1M2DA 1UC7A 3HY2A 3H79A 3RDWA 13GSA 5G5FA 3ZYWA 1ON4A 2HT9A 2F51A 5LNKe 1TJDA 1K3YA 4CDOA 1NM3A 5ECRB 5KN0A 5GSTA 1ERWA 2GSQA 1K0BA 1Z9HA 3ZTLA 1GSQA 4ZL8A 1J08A 2GVPA 2LV3A 2HRKB 2FD3A 1ZGNA 5CNWA 4IP6A 3MAKA 4J57E 1TKDB 1M9AA 3HKRA 3NZNA 4GLTA 4XIHA 2YN1A 4QQ7A 3LGCA 3KMNA 1OKDA 2HNLA 1SENA 2P31A 2JACA 1GLQA 1WP0A 2DJ2A 3IXRA 4HZ4A 2KUCA 3P8WA 4I5QA 1K0NA 3A5WA 4K7NA 4EF0A 4OMVA 2X8GA 4F82A 4G0IA 14GSA 1B4PA 2BJXA 1TRWA 1PKWA 4BL7A 4P3YB 1FB6A 2QKEA 3LJRA 4IELA 5JCGA 3APQA 2B7KA 3QCPA 2CV4A 4I8BA 5E4WA 4JR6A 5FT3A 2DMLA 3R2QA 2MZCA 3TB2A 4OCEA 2WDUA 4IP1A 3F63A 3IDVA 1LU4A 3IBHA 5H5QA 4ZXGA 4GWRA 1A23A 1LBKA 3I69A 3Q18A 3A3TA 4DVCA 4FH8A 1BJXA 1TK8B 5KEJA 2KP2A 4IGJA 1OC9A 5DDLA 1B9XC 2AV4A 1OAZA 1WJKA 1W89A 4MPGA 4ZL7A 3L0HA 3KCMA 3LEFA 2C8UA 1SL0B 1KNGA 5ID2A 1O7UA 3GKMA 2BTOT 1E6BA 4CHSA 3VFIA 2B1KA 3ZVJD 4TXOB 4GF0A 2YNXA 4L0UA 1SL2B 1TTZA 3D0ZA 1SJIA 1LJRA 4L5OA 1A0FA 1IYIA 4V2NA 3RHCA 2C3NA 1JLWA 5DJMA 3FEUA 3FK8A 2B5EA 4WXTA 2CZ3A 1HNBA 3UVHA 3UOMA 4NMUA 5B8AA 4PUFC 5HQPA 3ZMLA 2CT6A 5LCZA 4PURA 2VCXA 2YZUA 2HE3A 1ZL9A 16GSA 2C0EA 4RUVA 3DVWA 1SK1A 1DSBA 1A8LA 1YKAA 4GTUA 5DQYA 2NVLA 3BCIA 2ZNMA 2OKAA 1YJ6A 2GZPA 2GQKA 4PXOA 4OO5A 3GV1A 1M2BA 2C4JA 1GULA 5FWGA 2E2GA 20GSA 1YQ1A 2LJAA 2OBIA 1Z7PA 1EEMA 3P7XA 4OCFA 2YJHA 2NTOA 2IMEA 2DIZA 4YH2A 3HXSA 4IKHA 4XS4A 3G7JA 3D4TA 3GMFA 2P0GA 5ECMB 3KEBA 4F9ZA 5EPFA 3LXTA 1SD8A 5B6NA 1GSFA 2M46A 5DCHA 3FZ5A 3F9UA 4WR5A 1KBNA 1EV9A 5AIXA 5J41A 3DVXA 3EC3A 1XWAA 4HQZA 1GTIA 1SJZA 4K7IA 3FW2A 2F8AA 3D4MA 4HJ2A 2B1LA 1EEJA 2JSYA 5CYYA 2RUEA 4KSMA 3ZMKA 4WBRD 1X9WB 2WRTA 1ZOFA 4L0WA 4MABA 5A4UA 4WR4A 5D9XA 2E7PA 4ML1A 3BCKA 4KB3A 2LTKA 4LL4B 5BMUA 3CSIA 2YWIA 2FNOA 3TJJA 1GSSA 3IOSA 4EVMA 2XC2A 1QFNA 3L78A 4IHUA 9GSSA 2XBQA 2F8FA 1Z6NA 2VCQA 3IR4A 4ML6A 3K8NA 1QXHA 2H30A 5G2ZA 2CVDA 2B6MA 4TRXA 1XW9A 3GA4A 2TRCP 5F06A 3UMAA 2GZYA 1MDIA 2I81A 2FHEA 2C0GA 5J9BA 1V40A 2L4CA 3UL3A 5ECLB 2MMZA 4H86A 3C8EA 2AUVA 1ABAA 3FZ4A 1B9YC 4OFMA 5JWOB 2KHPA 3VWUA 3EU4A 1A8YA 5AN1A 3WYWA 1GLPA 4ZBDA 5ECQB 3ME7A 4O32A 4V2MA 4MZBA 4TR1A 5ENUA 4CW9A 2YP6A 1G0TA 2YWMA 5IMVA 1G6YA 1PSQA 4E8EA 2PN8A 1O8XA 3IA1A 4TVEA 3J7Yk 2HRKA 5EY6A 1T8EB 1EWXA 3W6GA 1R5PA 5CO3A 2E0QA 2J9HA 1N8JA 2PERA 1V98A 4AGSA 2TRXA 5CRDA 1S3AA 4MH2A 1QUWA 2IJYA 2MMNA 1WMJA 2WS2A 1HYUA 4PTSA 4ZBBA 2YV9A 2MBSA 3HDCA 2DJ0A 1X9SB 4BWSA 1SU9A 5IMCA 5J4UA 2L6CA 6GSXA 2JSZA 4BPYA 5FHIA 1N2AA 2LRCA 2CVBA 4G19A 4HI7A 1XXUA 2LS5A 2PU9C 1JHBA 3CSJA 3QDNA 3GNJA 4X1UA 2AHEA 3KTLA 4EL1A 3KGKA 1A24A 4YAPA 1K3LA 2CQ9A 2XBIA 3PH9A 4XS1A 3CTFA 3QR6A 2X99A 2DJKA 3NIVA 2JZSA 3UBLA 1DE1A 1X5EA 5G1KA 2CX3A 2FY6A 4DSSB 4ECCA 4PQ1A 1BEDA 3TKQA 3G7YA 3IRAA 3FRCA 3E3EA 2OE3A 2PMTA 5C04A 5IMFA 3ZIJA 3C7MA 3H8QA 1M9BA 4ZB6A 2ON5A 5CRWA 5ECKB 4YAVA 2H19A 3Q74A 3UEMA 3TOUA 4MJBA 4Z7XA 3M8NA 4KAEA 2CA8A 1A2MA 4AJ8A 1AIUA 1K0DA 4PX1A 3US3A 5IM9A 4K0NA 5CP1A 1T3BA 4IQAA 1TDIA 1XWGA 3KTBA 2HSMB 3IC8A 3FR6A 5AISA 1EOGA 1M0UA 2L59A 4GXZA 5IO2A 1GP1A 1GH2A 2G0FA 3KZQA 1AUCA 5DAKB 7GSSA 4MCUA 3H1NA 3VI5A 1AQXA 2LUSA 1ERUA 5KN3A 1NSWA 3O3TA 2REMA 2HQTA 1S3DA 1AXDA 2LRNA 1GWCA 4DEJA 3FY7A 1Z7RA 1GSDA 4XRDA 4KX4A 2FA8A 3AY8A 2VL3A 5E59A 5C00A 3JCML 5IO0A 3CRUA 5HR1A 1NHOA 5DJLA 2LQOA 4IJ3A 3BD2A 3HVXA 4MP4A 1JZWA 3GTUB 3LFLA 3FYGA 4PGTA 3E9JB 1OC8A 1GTBA 1TP9A 4DSRA 4NPBA 2HZEB 1MTCA 2VCZA 1K0AA 3F3QA 2WGRA 3WGDA 4WKWA 2FWFA 5ELAA 3F6DA 3RPNA 1XZOA 2XPEA 3HJOA 5IMAA 3WGXA 1F37A 3GKXA 4KH7A 1TU7A 1Y25A 2HRAA 4HS1A 4K6XA 3HD5A 1A2JA 1A0RP 2X64A 3F8UA 3EU3A 4K0GA 2JADA 1YDKA 3RBTA 5KN2A 2H0IA 4ZILA 4FYUA 18GSA 2CAQA 4WF5A 1YF1A 5AGYA 3UBKA 3IK7A 5A4VA 4ZBAA 3O76A 5B7CA 2A2RA 1Q98A 1XW6A 3DEXA 2R3XA 1ACVA 3C71A 4K2DA 2L57A 1JFUA 2VOCA 2GQLA 1TXXA 5D73A 3L9VA 1W4VA 4GSTA 1OKTA 3IAM2 1I5GA 1GUKA 4ULXA 4LMWA 2IFQB 2TIRA 5L71A 2GGTA 2H75A 1YKCA 2OACA 2O89A 2HRFA 1H75A 3C1SA 2VLUA 1XFLA 5ECIB 4BA7A 1XVQA 2DBCA 4I2TA 4QL7A 3UJ1A 5EVOA 2IN3A 4WBJA 1ERTA 1XPVA 5CRGA 1V9WA 5DBQA 2L5OA 4OO4A 2VD1A 1R4WA 1KTEA 3TKSA 3ED3A 4K7OA 5IMZA 4KW6A 2AB6A 2CZ2A 2AYTA 1AAZA 2VCTA 2ZCTA 2LQQA 3D22A 4X0XA 3D5JA 2PBJA 3CBUA 3HCZA 4GQFA 3IK9A 1WRYA 3TKRA 5ECSA 2H70A 1JZOA 4POBA 2VCVA 2H66A 2LSTA 3SWLA 5CRHA 4MF7A 4IS0A 1A2LA 4G10A 1Z6MA 3G9BA 3VWVA 3ERGA 3HVSA 3QD9A 3O6TA 3IAS2 3H4KA 3M9KA 1T00A 2H8LA 19GSA 2B7JA 3HA9A 1MD3A 3R3EA 2F9SA 5ECPB 5KN1A 4MPFA 3EMXA 3UAPA 1QMVA 2CVKA 4IBPA 4NXIA 4ZB8A 4OWYA 4ACSA 3UVTA 3D6IA 1WPIA 2D2ZA 1R7HA 4MJEA 1OC3A 5JWRB 4POLA 4KDUA 2RM5A 6GSTA 2KOKA 1THXA 1TRSA 1PL1A 4F0CA 2JZRA 2L4QA 1F3BA 4N30A 2MYGA 4N0VA 4DSSA 4HEA2 1DBYA 3QFAC 1TU8A 1WOUA 1E2YA 2IMDA 2GT5A 3CSHA 6GSVA 2Z9SA 3QAVA 4J56E 1GUMA 1BYEA 5CAXA 4XHMA 3TKPA 5IPHA 3A2XA 1DUGA 2MMAA 3OR5A 1X5CA 1M7TA 3N5OA 4HQSA 2PGTA 1UVZA 4KUNA 3MWHA 1FW1A 2JL4A 2GQMA 3DGQA 4MJAA 4TN8A 2HSMA 1OE7A 3TRPA 1S3CA 2NBSA 4RQXA 1RQMA 4TXVA 1ZCPA 2P5RA 5DAKA 3FZAA 1FHEA 3KH7A 2UZ8A 3RPPA 3DMLA 2EIQA 5LD0A 1Z3EA 2R6KA 3GL5A 2PVOC 2H1BA 4TW5A 5D8IA 1I9DA 2FWGA 1O85A 4OFTA 1C72A 2H74A 2R2JA 2RM6A 3U5RE 4EE0A 3GKNA 1U88A 2L6DA 2VLVA 2B5XA 11GSA 1THOA 5DQSA 4F0BA 1PD21 1O6JA 2WFCA 5COHA 3IHQA 4E8HA 2HRNA 1V57A 2M72A 3M9JA 1M2AA 1EOHA 3GTUA 1F6MC 4TR0A 12GSA 4MZCA 1NW2A 3BBYA 4EKZA 2O8VB 1JZRA 3EE2A 4EO3A 4FIWA 1PX7A 4V1Ap 1FG4A 4XS6A 6GSUA 1EP7A 3DRNA 2G2QA 2ES7A 1IYHA 3TJGA 3MSZA 4KNDA 3VWWA 1XWCA 1ILOA 8GSSA 3GRXA 1K0CA 3A2WA 1OVNA 4LA1A 3D21A 4IQ1A 3KMOA 2DIYA 5JCWA 4NHWA 2MBTA 5H5SA 3ZVJA 2HFDA 1BX9A 1H4OA 1GL8A 2I1UA 2FGXA 3TKSE 1YZXA 4BVXB 2RUFA 4GRFA 1RK4A 5GSSA 2VL2A 2H1GA 2YZHA 3TKSC 2NPBA 3ZFBA 4DSQA 2LNSA 1PMTA 4LLRA 2V6OA 1T7PB 5ID2B 1AQWA 3VI7A 1V58A 4PQHA 1FVKA 1SK0A 3LQ7A 3F4RA 3CMIA 4TR3A 3KH9A 2OBKA 2V32A 1ML6A 3GKKA 2OE0A 3WT1A 5HFKA 4QL9A 2C1YA 1WWJA 3TUEA 1B4QA 2EIOA 4IN0A 4RI6A 4TKYA 4N0ZA 1MEKA 5J9CA 1VF4A 1GRXA 4KSOA 5GZZB 2N5AA 2PVQA 3W8JA
chains in the Genus database with same CATH superfamily
2GSRA 3ZL5A 5ECHB 5JWQB 2J23A 4K9ZA 3M0FA 4OFNA 3TGZA 1HNCA 2YCDA 1G7OA 2OJLA 3KXOA 4RI7A 2V41A 4QMKA 1OYJA 2K18A 1GTUA 17GSA 2PUKC 3E0UA 2ALBA 2DJ3A 3UARA 1FAAA 3QAGA 3V1WA 4K5RA 4KCEA 2H6XA 2WW3A 1ZZYA 1B8XA 3VURA 2GT6A 2H71A 1FO5A 2WZ9A 1F2EA 4D73B 2WZSA 2IMKA 1M3IA 4JRRA 1AC1A 1USBA 3HZ4A 5IIZA 5GAND 4MA9A 2K9FA 3PINA 1PKZA 4LMVA 1J9BA 1M99A 1TI3A 4Q5NA 4KDYA 2HSYA 5ECOB 3TRXA 1TRUA 3ERWA 3DYRA 3FZ9A 2YWNA 3GH9A 2C80A 4NAXA 4TXOA 3ZLPA 4PQIA 1YY7A 3TJFA 2FUG2 2DMMA 1XOBA 2PPTA 1X5DA 3ZFLA 2A2SA 4V2LA 5HR2A 3ZITA 2YJ7A 2GSTA 2QSIA 1PGTA 2H72A 6GSSA 1J0FA 1DE2A 2FCHA 1X0RA 3RAZA 1T1VA 4YQMA 1KEBA 2I9HA 2WVYA 5HR3A 4N10A 2K8VA 5G1LA 2WCIA 4HU9A 5HFGA 4BWQA 3A2VA 4IW9A 3GL3A 4X43A 1PN9A 1T4YA 3C1RA 2R5GA 4O7HA 3HYPA 4PNGA 4O5UA 2VD0A 3FKFA 4ECBA 4XTSA 2WJUA 2H1DA 1R5AA 3F3RA 3J7Yb 4KE3A 1GNWA 2YPMA 4Q5RA 1FOVA 3ISOA 4MDCA 1ZYEA 3F4TA 2HLSA 4K1FA 3QAWA 2MMOA 1JLVA 3DWVA 2HSNB 5CREA 5A4WA 3CYNA 10GSA 1EV4A 3APOA 3L9SA 3GSTA 2R4VA 1EZKA 4TR1B 1OE8A 2WVZA 2B5YA 4POKA 3QOUA 2FWHA 2X8HA 3L4NA 2UV8G 4G2EA 2WB9A 1ZYQB 3KJYA 1O73A 3TRQA 3EWLA 2VM1A 1O81A 4G0LA 1SKRB 3IPZA 1VF2A 3LYPA 3PGTA 6GSYA 1TI1A 2VL2C 3P2AA 2GSSA 4KF9A 1G6WA 2EC4A 2DLXA 5A1NA 1BG5A 4G9HA 3EURA 2WULA 2C0FA 3RHBA 4TOPA 3FR9A 4MF6A 2GDRA 2K6VA 5HFIA 1UN2A 2VLTA 5IOXA 2AJQB 1TOFA 4NWYA 3LG6A 2QC7A 3DXBA 4EDYA 3I43A 4F2IA 4MK3A 3P90A 4AF2A 5G5EA 2OE1A 2YWOA 4MZWA 3DD3A 2VCWA 1FOHA 5ABRA 5GAPD 1YEPA 3KP9A 4AJ7A 4V1Ag 3HVVA 2DJ1A 3CXGA 4KGIA 2KP1A 1GSUA 3IE3A 2KLXA 1PX6A 2XPDA 4ZIJA 3L9UA 1ST9A 1TK5B 4ID0A 2C3QA 3W8SA 2YV7A 3F0IA 5D93A 3TU3B 2O85A 4GDFA 3G7IA 1TK0B 4HJMA 1U6TA 3TOTA 2CX4A 1ERVA 4BVXA 3H93A 3RGBC 1TW9A 4HDEA 4ZL9A 1YEXA 2DJJA 2VUPA 4I6XA 2F3MA 1B48A 1MDKA 1XOAA 2H6YA 2DSAA 5INYA 4MJCA 4KA0A 1NHYA 3KM6A 3ZRDA 4KCAA 3EMPA 1ZMAA 3HHVA 5IPGA 5A34A 4JR4A 3ERFA 1MDJA 1BF5A 3VK9A 4G0KA 1CQGA 2JU5A 4YQUA 1SYXA 4KDXA 3KP8A 1SYRA 3DIEA 3QMXA 3BOAA 5B8BA 1XWBA 3LYKA 3EYTA 4BVYB 2GZZA 3WGEA 2H0HA 3FHKA 3IC4A 2M80A 6GSWA 2LEGA 1K0OA 3HJMA 5H5RA 4PUAA 5DALB 5ECNB 1GSYA 2O7KA 4A5PA 4XCSA 1X9MB 1GSEA 4NV5A 1F3AA 4D73A 3WT2A 2FWEA 2H73A 3SBCA 1QK8A 3GUSA 1K0MA 2LRTA 2HXKA 5F05A 1HNAA 4EDZA 1U87A 5D9TA 2I4AA 4I97A 3EPTA 3KD0A 4ISDA 4FYCA 3FR3A 3PPUA 1QGVA 3TDGA 2V1MA 4N11A 3HJPA 1PN0A 2IMIA 3Q6OA 1SL1B 3UIWA 3F4SA 3CRTA 1GUHA 4O5RA 4POMA 2DC5A 4N3ZA 2ZUPA 3U6VA 2JZTA 1PQNA 5IOWA 1URMA 2C0DA 4JE1A 2VKZG 5EL8A 4ECIA 1SK2A 1SKSB 4USSA 2X49A 5F0GA 3N9JA 3PR8A 2N5FA 2H1AA 2AAWA 4MMMA 2ON7A 2P5QA 4ECJA 2OA7A 5D9WA 4EXJA 2L5LA 1XIYA 2HZEA 5D96A 4XRAA 4BL7B 3VLNA 2R37A 2VAFA 4Q5FA 5F8BA 2B3SA 2OADA 2H0GA 2IPAA 2V6KA 5A5KA 5B6MA 1XWKA 3VPTA 4J2FA 2GTUA 2PWJA 2H76A 1K3OA 2IMFA 4HU7A 3ME8A 3S9FA 2GLRA 2A4VA 1HQOA 2IIYA 3MDKA 2LNTA 4LL1B 2HSNA 1T4ZA 4JU5A 1AQVA 3GFKA 3DKSA 4EIQA 1O8WA 1JZDA 3ZIVA 3VWXA 1VGLA 1Z5YE 4PHZC 1XBSA 3WD6A 2I3YA 1OC9B 2V2GA 4TR4A 1N25A 5IMDA 1XW5A 1I1IP 4GCIA 1U3IA 4PNFA 3GN3A 4ILFA 1PA3A 2H6ZA 3TJKA 1EGOA 2NDOA 3LXZA 1Y6EA 3NOFA 1QQ2A 5AIVA 3EINA 3MYDA 3QPMA 1CQHA 4GSSA 1HD2A 1GTAA 3F6FA 1SKWB 2A2PA 4EUYA 2HZFA 3M1GA 5F07A 1VRSD 4HSCX 1G7EA 2C3TA 4GSNA 2HYXA 2BMXA 4IVFA 1TRVA 4FYBA 2VIMA 1WE0A 2IFQA 3M3MA 3GHAA 5J5NA 3TCOA 2K8SA 2H01A 4JZQA 1BG1A 3GIXA 4L8EA 2DKHA 4L5LA 2LJKA 4IJIA 5ELGA 4AJ6A 2O87A 4NV2A 5HR0A 3HZ8A 4HZ2A 1YF0A 1PRXA 4MLYA 4O5QA 2N5BA 4HOJA 4AKGA 1BAYA 1WIKA 3I6AA 2FA4A 3LSZA 3C73A 1XCCA 5G30A 2LKUA 4FO5A 3EVIA 3GYKA 1SJ6A 4EC0A 4JEDA 1R26A 1RW1A 2RLIA 3IV4A 4XS4B 5J4VA 1VF1A 3Q19A 1EGRA 3TJBA 4RQRA 1V2AA 4F03A 3I9V2 3ZZXA 1XVWA 2IL3A 2GS3A 4CY6A 4WETA 4YQVA 2HSHA 3GX8A 2YOIA 4FQUA 2HI7A 4OD7A 2EFHA 5DVBA 4Q5QA 1EP8A 2VL9A 4JBBA 4MH3A 1F9MA 1FB0A 3APSA 3VPQA 2VO4A 1UA5A 2LJRA 3GURA 3KIJA 5DCGA 4MF5A 5JCUA 4MNNA 5D9VA 4NHZA 2IWTA 2X8CA 2VM2A 1GNEA 22GSA 2RIIA 4BVYA 3MNGA 5G31A 3GX0A 1FVJA 3GSSA 2E2MA 3CTGA 2QA1A 5DALA 4K8MA 4WF4A 4ZB9A 5BMUB 4GQCA 4HUAA 1SD9A 2CAIA 2XHFA 3GH6A 4I2UA 5IQYA 5J3RA 1BQ7A 3BJ5A 1PL2A 2QGVA 1AW9A 1VF3A 1Y1UA 2YANA 1U3AA 3QFBC 4WEYA 3LWAA 3ZREA 1Q4JA 2EIRA 1SVLA 2FLSA 1MD4A 4O92A 3LORA 3CQFA 2WVXB 3CHXC 1M2DA 1UC7A 3HY2A 4BIKA 3H79A 3RDWA 13GSA 5G5FA 3ZYWA 1ON4A 2HT9A 2F51A 5LNKe 1TJDA 1K3YA 4CDOA 1NM3A 5ECRB 5KN0A 5GSTA 1ERWA 4ICYA 2GSQA 1K0BA 1Z9HA 3ZTLA 1GSQA 4ZL8A 1J08A 2GVPA 2LV3A 2HRKB 3LW9A 4CY8A 2FD3A 1ZGNA 5CNWA 4IP6A 3MAKA 4J57E 1TKDB 1M9AA 3HKRA 3NZNA 4GLTA 4XIHA 2YN1A 4QQ7A 3LGCA 3KMNA 1OKDA 2HNLA 2P31A 1SENA 2JACA 1GLQA 1WP0A 2DJ2A 3IXRA 4HZ4A 2KUCA 3P8WA 4I5QA 1K0NA 3A5WA 4K7NA 4EF0A 4OMVA 2X8GA 4F82A 4G0IA 14GSA 1B4PA 2BJXA 3CWGA 2R0CA 1TRWA 1PKWA 4BL7A 4P3YB 1FB6A 2QKEA 3LJRA 4IELA 5JCGA 3APQA 2B7KA 3QCPA 2CV4A 4I8BA 5E4WA 4JR6A 5FT3A 2DMLA 3R2QA 2MZCA 3TB2A 4OCEA 2WDUA 4IP1A 3F63A 3IDVA 1LU4A 3HMJG 3IBHA 5H5QA 4ZXGA 4GWRA 1A23A 1LBKA 3I69A 3Q18A 3A3TA 4DVCA 4FH8A 1BJXA 1TK8B 5KEJA 2KP2A 4IGJA 1OC9A 5DDLA 1B9XC 2AV4A 1OAZA 1WJKA 1W89A 4MPGA 4ZL7A 3L0HA 3KCMA 3LEFA 2C8UA 1SL0B 1KNGA 5ID2A 1O7UA 3GKMA 2BTOT 1E6BA 4CHSA 3VFIA 2B1KA 3ZVJD 4TXOB 4GF0A 2YNXA 4L0UA 1SL2B 1TTZA 3D0ZA 1SJIA 5KOXA 1LJRA 4L5OA 1A0FA 1IYIA 4V2NA 3RHCA 2C3NA 1JLWA 5DJMA 3FEUA 3FK8A 2B5EA 4WXTA 2CZ3A 1HNBA 3UVHA 3UOMA 4NMUA 5B8AA 4PUFC 5HQPA 3ZMLA 2CT6A 5LCZA 4PURA 2VCXA 2YZUA 2HE3A 3IHGA 1ZL9A 16GSA 2C0EA 4RUVA 3DVWA 1SK1A 1DSBA 1A8LA 1YKAA 4GTUA 5DQYA 2NVLA 2R0GA 3BCIA 2ZNMA 2OKAA 1YJ6A 2GZPA 2GQKA 4PXOA 4OO5A 3GV1A 1M2BA 2C4JA 5KOWA 1GULA 3HVNA 5FWGA 2E2GA 20GSA 1YQ1A 2LJAA 2OBIA 1Z7PA 1EEMA 3P7XA 4OCFA 2YJHA 2NTOA 2IMEA 2DIZA 4YH2A 3HXSA 4IKHA 3MIXA 3G7JA 3D4TA 4XS4A 3GMFA 2P0GA 5ECMB 3KEBA 4F9ZA 5EPFA 3LXTA 1SD8A 5B6NA 1GSFA 2M46A 5DCHA 3FZ5A 3F9UA 4WR5A 1KBNA 1EV9A 5AIXA 5J41A 3DVXA 3EC3A 1XWAA 4Z2UA 4G01A 4HQZA 1GTIA 1SJZA 4K7IA 3FW2A 2F8AA 4Z2TA 3D4MA 4HJ2A 2B1LA 1EEJA 2JSYA 5CYYA 2RUEA 4KSMA 3ZMKA 4WBRD 4YKGA 1X9WB 2WRTA 1ZOFA 4L0WA 4MABA 5A4UA 2R0PA 4WR4A 5D9XA 2E7PA 4ML1A 3BCKA 4KB3A 2LTKA 4LL4B 5BMUA 3CSIA 2YWIA 2FNOA 3TJJA 1GSSA 5A1NB 3IOSA 4EVMA 2XC2A 1QFNA 3L78A 4IHUA 9GSSA 2OT3A 2XBQA 2F8FA 1Z6NA 2VCQA 3IR4A 4ML6A 3K8NA 1QXHA 2H30A 5G2ZA 2CVDA 2B6MA 4TRXA 1XW9A 3GA4A 2TRCP 5F06A 2WW1A 3UMAA 2GZYA 1MDIA 2I81A 2FHEA 2C0GA 5J9BA 1V40A 2L4CA 3UL3A 5ECLB 2MMZA 4H86A 3C8EA 2WVXA 2AUVA 1ABAA 3FZ4A 1B9YC 4OFMA 5JWOB 2KHPA 3VWUA 3EU4A 1A8YA 5AN1A 3WYWA 1GLPA 4ZBDA 5ECQB 3ME7A 4O32A 4V2MA 4MZBA 4TR1A 5ENUA 4CW9A 2YP6A 1G0TA 2YWMA 5IMVA 1G6YA 1PSQA 2H1LA 4E8EA 2PN8A 1O8XA 3IA1A 4TVEA 3J7Yk 2HRKA 5EY6A 1T8EB 1EWXA 3W6GA 1R5PA 5CO3A 2E0QA 2J9HA 1N8JA 2PERA 1V98A 4AGSA 2TRXA 5CRDA 2A4HA 1S3AA 4MH2A 1QUWA 2IJYA 2MMNA 1WMJA 4K2XA 2WS2A 1HYUA 4PTSA 4ZBBA 2YV9A 2MBSA 3HDCA 2DJ0A 1X9SB 4BWSA 5BRTA 1SU9A 5IMCA 5J4UA 2L6CA 6GSXA 2JSZA 4BPYA 5FHIA 1N2AA 2LRCA 1PFOA 2CVBA 4G19A 4HI7A 1XXUA 2LS5A 2PU9C 1JHBA 3CSJA 1XG8A 3A5IA 3QDNA 3GNJA 2WW0A 4X1UA 2AHEA 3KTLA 4EL1A 3KGKA 4YKFA 1A24A 4YAPA 1K3LA 2CQ9A 2XBIA 3PH9A 4XS1A 4Z2RA 3CTFA 3QR6A 2X99A 2DJKA 3NIVA 2JZSA 3UBLA 1DE1A 1X5EA 5G1KA 2CX3A 2FY6A 4DSSB 4ECCA 4PQ1A 1BEDA 3TKQA 3G7YA 3IRAA 3FRCA 3E3EA 2OE3A 2O3EA 2PMTA 5C04A 5IMFA 3ZIJA 3C7MA 3H8QA 1M9BA 4ZB6A 2ON5A 5CRWA 5ECKB 4YAVA 2H19A 2O5VA 3Q74A 3UEMA 3TOUA 4MJBA 4Z7XA 3M8NA 4KAEA 2CA8A 1A2MA 4AJ8A 1AIUA 1K0DA 4PX1A 3US3A 5IM9A 4K0NA 5CP1A 1T3BA 4IQAA 1TDIA 1XWGA 3KTBA 4PI2C 2HSMB 3IC8A 3FR6A 5AISA 1EOGA 1M0UA 5A5HB 2L59A 4GXZA 5IO2A 1GP1A 1GH2A 4FXYP 2G0FA 3KZQA 4E68A 1AUCA 5DAKB 7GSSA 4MCUA 3H1NA 3VI5A 1AQXA 2LUSA 2X4AA 4AKXB 1ERUA 5KN3A 1NSWA 4K5SA 3O3TA 2REMA 2HQTA 1S3DA 1AXDA 2LRNA 1GWCA 4DEJA 3FY7A 1Z7RA 1GSDA 4XRDA 4KX4A 2FA8A 3AY8A 2VL3A 5E59A 5C00A 3JCML 5IO0A 4AI6A 3CRUA 5HR1A 1NHOA 5DJLA 2LQOA 4IJ3A 3BD2A 3HVXA 4MP4A 1JZWA 3GTUB 3LFLA 3FYGA 4PGTA 3E9JB 1OC8A 1GTBA 1TP9A 4DSRA 4NPBA 2HZEB 1MTCA 2VCZA 1K0AA 3F3QA 2WGRA 3WGDA 4WKWA 2FWFA 5ELAA 4ZB7A 2EFCA 1S3RA 3F6DA 3RPNA 1XZOA 2XPEA 3HJOA 2O36A 5IMAA 3WGXA 1F37A 3GKXA 4KH7A 1TU7A 1Y25A 2HRAA 4HS1A 4K6XA 3HD5A 1A2JA 1A0RP 2X64A 3F8UA 3EU3A 4W66A 4K0GA 2JADA 1YDKA 3RBTA 5KN2A 2H0IA 4ZILA 4FYUA 18GSA 2CAQA 4WF5A 1YF1A 5AGYA 3UBKA 3IK7A 5A4VA 4ZBAA 3O76A 5B7CA 2A2RA 1Q98A 1XW6A 3DEXA 2R3XA 1ACVA 3C71A 4K2DA 2L57A 1JFUA 2VOCA 2GQLA 1TXXA 5D73A 3L9VA 1W4VA 4GSTA 1OKTA 3IAM2 1I5GA 1GUKA 4ULXA 4LMWA 2IFQB 2TIRA 5L71A 2GGTA 2H75A 1YKCA 2OACA 2O89A 2QA2A 2HRFA 1H75A 3C1SA 1YEWC 2VLUA 1XFLA 5ECIB 4BA7A 1XVQA 2DBCA 4I2TA 4QL7A 3UJ1A 5EVOA 2IN3A 4WBJA 1ERTA 1XPVA 5CRGA 1V9WA 5DBQA 2L5OA 4OO4A 2VD1A 1R4WA 1KTEA 3TKSA 3ED3A 1ZYNA 4K7OA 5IMZA 4KW6A 2AB6A 2CZ2A 2AYTA 1AAZA 2VCTA 2ZCTA 2LQQA 3D22A 4X0XA 3D5JA 2PBJA 3CBUA 2EFEA 3HCZA 4GQFA 3IK9A 1WRYA 3TKRA 5ECSA 2H70A 1JZOA 4POBA 2VCVA 2H66A 2LSTA 3SWLA 5CRHA 4MF7A 4IS0A 1A2LA 4G10A 1Z6MA 1SVOA 3G9BA 3VWVA 1S4BP 3ERGA 3HVSA 3QD9A 3O6TA 3IAS2 3H4KA 3M9KA 1T00A 2H8LA 19GSA 5J47A 2B7JA 3HA9A 1MD3A 3R3EA 2F9SA 3RFRC 5ECPB 5KN1A 4MPFA 3EMXA 4AKHA 1YVLA 3UAPA 1QMVA 2CVKA 4IBPA 4NXIA 4ZB8A 4OWYA 4ACSA 3UVTA 3D6IA 1WPIA 2D2ZA 1R7HA 4MJEA 1OC3A 5JWRB 4POLA 4KDUA 2RM5A 6GSTA 2KOKA 1THXA 1TRSA 1PL1A 4F0CA 2JZRA 2L4QA 1F3BA 4N30A 2MYGA 4N0VA 4DSSA 4HEA2 1DBYA 3QFAC 1TU8A 1WOUA 1E2YA 2IMDA 2GT5A 3CSHA 6GSVA 2Z9SA 3QAVA 4J56E 1GUMA 1BYEA 5CAXA 4XHMA 3TKPA 5IPHA 5J40A 3A2XA 1DUGA 2MMAA 3OR5A 1X5CA 4EIPA 1M7TA 3N5OA 4HQSA 2PGTA 1UVZA 4KUNA 3MWHA 1FW1A 2JL4A 2GQMA 3DGQA 2WW2A 4MJAA 4TN8A 2HSMA 1OE7A 3TRPA 1S3CA 2NBSA 4RQXA 1RQMA 5A5HA 4TXVA 1ZCPA 2P5RA 5DAKA 3FZAA 1FHEA 3KH7A 2DKIA 2UZ8A 3RPPA 3DMLA 2EIQA 5LD0A 1Z3EA 2R6KA 3GL5A 2PVOC 2H1BA 4TW5A 5D8IA 1I9DA 2FWGA 1O85A 4OFTA 1C72A 2H74A 2R2JA 2RM6A 3U5RE 4EE0A 3GKNA 1U88A 2L6DA 2VLVA 2B5XA 11GSA 1THOA 5DQSA 4F0BA 1PD21 1O6JA 2WFCA 5COHA 4PI0C 3IHQA 4E8HA 2HRNA 1V57A 2M72A 3M9JA 1M2AA 1EOHA 3GTUA 1F6MC 4TR0A 12GSA 4MZCA 1NW2A 3BBYA 4EKZA 2O8VB 1JZRA 3EE2A 4EO3A 4FIWA 1PX7A 4V1Ap 1FG4A 4XS6A 6GSUA 1EP7A 3DRNA 2G2QA 2ES7A 1IYHA 5J4YA 3TJGA 3MSZA 4KNDA 3VWWA 1XWCA 2EFDA 1ILOA 8GSSA 1ZYPA 3GRXA 1K0CA 3A2WA 1OVNA 4LA1A 1SVMA 3D21A 4IQ1A 3KMOA 2DIYA 5JCWA 4NHWA 2MBTA 5H5SA 3ZVJA 2HFDA 1BX9A 1TXUA 1H4OA 1GL8A 2I1UA 4X4JA 2FGXA 3TKSE 1YZXA 4BVXB 2RUFA 4GRFA 1RK4A 5GSSA 1M3JA 2VL2A 2H1GA 2YZHA 3TKSC 2NPBA 3ZFBA 4DSQA 2LNSA 1PMTA 4LLRA 2V6OA 1T7PB 5ID2B 1AQWA 3VI7A 1V58A 4PQHA 1FVKA 5A34B 1SK0A 3LQ7A 3F4RA 3CMIA 4TR3A 3KH9A 2OBKA 2V32A 1ML6A 3GKKA 2OE0A 3WT1A 5HFKA 4QL9A 2C1YA 1WWJA 3TUEA 1B4QA 2EIOA 4AKIA 4IN0A 4RI6A 3FMWA 4TKYA 4N0ZA 1MEKA 5J9CA 1VF4A 1GRXA 4KSOA 5GZZB 2N5AA 2PVQA 3W8JA
chains in the Genus database with same CATH topology
2GSRA 3ZL5A 5ECHB 5JWQB 2J23A 4K9ZA 3M0FA 4OFNA 3TGZA 1HNCA 2YCDA 1G7OA 2OJLA 3KXOA 4RI7A 2V41A 4QMKA 1OYJA 2K18A 1GTUA 17GSA 2PUKC 3E0UA 2ALBA 2DJ3A 3UARA 1FAAA 3QAGA 3V1WA 4K5RA 4KCEA 2H6XA 1ZZYA 1B8XA 3VURA 2GT6A 2H71A 1FO5A 2WZ9A 1F2EA 4D73B 2IMKA 4JRRA 1AC1A 1USBA 3HZ4A 5IIZA 5GAND 4MA9A 2K9FA 3PINA 1PKZA 4LMVA 1J9BA 1M99A 1TI3A 4Q5NA 4KDYA 2HSYA 5ECOB 3TRXA 1TRUA 3ERWA 3DYRA 3FZ9A 2YWNA 3GH9A 2C80A 4NAXA 4TXOA 3ZLPA 4PQIA 1YY7A 3TJFA 2FUG2 2DMMA 1XOBA 2PPTA 1X5DA 3ZFLA 2A2SA 4V2LA 5HR2A 3ZITA 2YJ7A 2GSTA 2QSIA 1PGTA 2H72A 6GSSA 1J0FA 1DE2A 2FCHA 1X0RA 3RAZA 1T1VA 4YQMA 1KEBA 2I9HA 5HR3A 4N10A 2K8VA 5G1LA 2WCIA 4HU9A 5HFGA 4BWQA 3A2VA 4IW9A 3GL3A 4X43A 1PN9A 1T4YA 3C1RA 2R5GA 4O7HA 3HYPA 4PNGA 4O5UA 2VD0A 3FKFA 4ECBA 4XTSA 2WJUA 2H1DA 1R5AA 3F3RA 3J7Yb 4KE3A 1GNWA 2YPMA 4Q5RA 1FOVA 3ISOA 4MDCA 1ZYEA 3F4TA 2HLSA 4K1FA 3QAWA 2MMOA 1JLVA 3DWVA 2HSNB 5CREA 5A4WA 3CYNA 10GSA 1EV4A 3APOA 3L9SA 3GSTA 2R4VA 1EZKA 4TR1B 1OE8A 2B5YA 4POKA 3QOUA 2FWHA 2X8HA 3L4NA 2UV8G 4G2EA 2WB9A 1ZYQB 3KJYA 1O73A 3TRQA 3EWLA 2VM1A 1O81A 4G0LA 1SKRB 3IPZA 1VF2A 3LYPA 3PGTA 6GSYA 1TI1A 2VL2C 3P2AA 2GSSA 4KF9A 1G6WA 2EC4A 2DLXA 5A1NA 1BG5A 4G9HA 3EURA 2WULA 2C0FA 3RHBA 4TOPA 3FR9A 4MF6A 2GDRA 2K6VA 5HFIA 1UN2A 2VLTA 5IOXA 2AJQB 1TOFA 4NWYA 3LG6A 2QC7A 3DXBA 4EDYA 3I43A 4F2IA 4MK3A 3P90A 4AF2A 5G5EA 2OE1A 2YWOA 4MZWA 3DD3A 2VCWA 1FOHA 5ABRA 5GAPD 1YEPA 3KP9A 4AJ7A 4V1Ag 3HVVA 2DJ1A 3CXGA 4KGIA 2KP1A 1GSUA 3IE3A 2KLXA 1PX6A 2XPDA 4ZIJA 3L9UA 1ST9A 1TK5B 4ID0A 2C3QA 3W8SA 2YV7A 3F0IA 5D93A 3TU3B 2O85A 4GDFA 3G7IA 1TK0B 4HJMA 1U6TA 3TOTA 2CX4A 1ERVA 4BVXA 3H93A 1TW9A 4HDEA 4ZL9A 1YEXA 2DJJA 2VUPA 4I6XA 2F3MA 1B48A 1MDKA 1XOAA 2H6YA 2DSAA 5INYA 4MJCA 4KA0A 1NHYA 3KM6A 3ZRDA 4KCAA 3EMPA 1ZMAA 3HHVA 5IPGA 5A34A 4JR4A 3ERFA 1MDJA 1BF5A 3VK9A 4G0KA 1CQGA 2JU5A 4YQUA 1SYXA 4KDXA 3KP8A 1SYRA 3DIEA 3QMXA 3BOAA 5B8BA 1XWBA 3LYKA 3EYTA 4BVYB 2GZZA 3WGEA 2H0HA 3FHKA 3IC4A 2M80A 6GSWA 2LEGA 1K0OA 3HJMA 5H5RA 4PUAA 5DALB 5ECNB 1GSYA 2O7KA 4A5PA 4XCSA 1X9MB 1GSEA 4NV5A 1F3AA 4D73A 3WT2A 2FWEA 2H73A 3SBCA 1QK8A 3GUSA 1K0MA 2LRTA 2HXKA 5F05A 1HNAA 4EDZA 1U87A 5D9TA 2I4AA 4I97A 3EPTA 3KD0A 4ISDA 4FYCA 3FR3A 3PPUA 1QGVA 3TDGA 2V1MA 4N11A 3HJPA 1PN0A 2IMIA 3Q6OA 1SL1B 3UIWA 3F4SA 3CRTA 1GUHA 4O5RA 4POMA 2DC5A 4N3ZA 2ZUPA 3U6VA 2JZTA 1PQNA 5IOWA 1URMA 2C0DA 4JE1A 2VKZG 5EL8A 4ECIA 1SK2A 1SKSB 4USSA 2X49A 5F0GA 3N9JA 3PR8A 2N5FA 2H1AA 2AAWA 4MMMA 2ON7A 2P5QA 4ECJA 2OA7A 5D9WA 4EXJA 2L5LA 1XIYA 2HZEA 5D96A 4XRAA 4BL7B 3VLNA 2R37A 2VAFA 4Q5FA 5F8BA 2B3SA 2OADA 2H0GA 2IPAA 2V6KA 5A5KA 5B6MA 1XWKA 3VPTA 4J2FA 2GTUA 2PWJA 2H76A 1K3OA 2IMFA 4HU7A 3ME8A 3S9FA 2GLRA 2A4VA 1HQOA 2IIYA 3MDKA 2LNTA 4LL1B 2HSNA 1T4ZA 4JU5A 1AQVA 3GFKA 3DKSA 4EIQA 1O8WA 1JZDA 3ZIVA 3VWXA 1VGLA 1Z5YE 1XBSA 3WD6A 2I3YA 1OC9B 2V2GA 4TR4A 1N25A 5IMDA 1XW5A 4GCIA 1U3IA 4PNFA 3GN3A 4ILFA 1PA3A 2H6ZA 3TJKA 1EGOA 2NDOA 3LXZA 1Y6EA 3NOFA 1QQ2A 5AIVA 3EINA 3MYDA 3QPMA 1CQHA 4GSSA 1HD2A 1GTAA 3F6FA 1SKWB 2A2PA 4EUYA 2HZFA 3M1GA 5F07A 1VRSD 1G7EA 2C3TA 4GSNA 2HYXA 2BMXA 4IVFA 1TRVA 4FYBA 2VIMA 1WE0A 2IFQA 3M3MA 3GHAA 5J5NA 3TCOA 2K8SA 2H01A 4JZQA 1BG1A 3GIXA 4L8EA 2DKHA 4L5LA 2LJKA 4IJIA 5ELGA 4AJ6A 2O87A 4NV2A 5HR0A 3HZ8A 4HZ2A 1YF0A 1PRXA 4MLYA 4O5QA 2N5BA 4HOJA 4AKGA 1BAYA 1WIKA 3I6AA 2FA4A 3LSZA 3C73A 1XCCA 5G30A 2LKUA 4FO5A 3EVIA 3GYKA 1SJ6A 4EC0A 4JEDA 1R26A 1RW1A 2RLIA 3IV4A 4XS4B 5J4VA 1VF1A 3Q19A 1EGRA 3TJBA 4RQRA 1V2AA 4F03A 3I9V2 3ZZXA 1XVWA 2IL3A 2GS3A 4CY6A 4WETA 4YQVA 2HSHA 3GX8A 2YOIA 4FQUA 2HI7A 4OD7A 2EFHA 5DVBA 4Q5QA 1EP8A 2VL9A 4JBBA 4MH3A 1F9MA 1FB0A 3APSA 3VPQA 2VO4A 1UA5A 2LJRA 3GURA 3KIJA 5DCGA 4MF5A 5JCUA 4MNNA 5D9VA 4NHZA 2IWTA 2X8CA 2VM2A 1GNEA 22GSA 2RIIA 4BVYA 3MNGA 5G31A 3GX0A 1FVJA 3GSSA 2E2MA 3CTGA 2QA1A 5DALA 4K8MA 4WF4A 4ZB9A 5BMUB 4GQCA 4HUAA 1SD9A 2CAIA 2XHFA 3GH6A 4I2UA 5IQYA 5J3RA 1BQ7A 3BJ5A 1PL2A 2QGVA 1AW9A 1VF3A 1Y1UA 2YANA 1U3AA 3QFBC 4WEYA 3LWAA 3ZREA 1Q4JA 2EIRA 1SVLA 2FLSA 1MD4A 4O92A 3LORA 1M2DA 1UC7A 3HY2A 3H79A 3RDWA 13GSA 5G5FA 3ZYWA 1ON4A 2HT9A 2F51A 5LNKe 1TJDA 1K3YA 4CDOA 1NM3A 5ECRB 5KN0A 5GSTA 1ERWA 4ICYA 2GSQA 1K0BA 1Z9HA 3ZTLA 1GSQA 4ZL8A 1J08A 2GVPA 2LV3A 2HRKB 3LW9A 4CY8A 2FD3A 1ZGNA 5CNWA 4IP6A 3MAKA 4J57E 1TKDB 1M9AA 3HKRA 3NZNA 4GLTA 4XIHA 2YN1A 4QQ7A 3LGCA 3KMNA 1OKDA 2HNLA 2P31A 1SENA 2JACA 1GLQA 1WP0A 2DJ2A 3IXRA 4HZ4A 2KUCA 3P8WA 4I5QA 1K0NA 3A5WA 4K7NA 4EF0A 4OMVA 2X8GA 4F82A 4G0IA 14GSA 1B4PA 2BJXA 3CWGA 2R0CA 1TRWA 1PKWA 4BL7A 4P3YB 1FB6A 2QKEA 3LJRA 4IELA 5JCGA 3APQA 2B7KA 3QCPA 2CV4A 4I8BA 5E4WA 4JR6A 5FT3A 2DMLA 3R2QA 2MZCA 3TB2A 4OCEA 2WDUA 4IP1A 3F63A 3IDVA 1LU4A 3HMJG 3IBHA 5H5QA 4ZXGA 4GWRA 1A23A 1LBKA 3I69A 3Q18A 3A3TA 4DVCA 4FH8A 1BJXA 1TK8B 5KEJA 2KP2A 4IGJA 1OC9A 5DDLA 1B9XC 2AV4A 1OAZA 1WJKA 1W89A 4MPGA 4ZL7A 3L0HA 3KCMA 3LEFA 2C8UA 1SL0B 1KNGA 5ID2A 1O7UA 3GKMA 2BTOT 1E6BA 4CHSA 3VFIA 2B1KA 3ZVJD 4TXOB 4GF0A 2YNXA 4L0UA 1SL2B 1TTZA 3D0ZA 1SJIA 5KOXA 1LJRA 4L5OA 1A0FA 1IYIA 4V2NA 3RHCA 2C3NA 1JLWA 5DJMA 3FEUA 3FK8A 2B5EA 4WXTA 2CZ3A 1HNBA 3UVHA 3UOMA 4NMUA 5B8AA 4PUFC 5HQPA 3ZMLA 2CT6A 5LCZA 4PURA 2VCXA 2YZUA 2HE3A 3IHGA 1ZL9A 16GSA 2C0EA 4RUVA 3DVWA 1SK1A 1DSBA 1A8LA 1YKAA 4GTUA 5DQYA 2NVLA 2R0GA 3BCIA 2ZNMA 2OKAA 1YJ6A 2GZPA 2GQKA 4PXOA 4OO5A 3GV1A 1M2BA 2C4JA 5KOWA 1GULA 5FWGA 2E2GA 20GSA 1YQ1A 2LJAA 2OBIA 1Z7PA 1EEMA 3P7XA 4OCFA 2YJHA 2NTOA 2IMEA 2DIZA 4YH2A 3HXSA 4IKHA 3MIXA 3G7JA 3D4TA 4XS4A 3GMFA 2P0GA 5ECMB 3KEBA 4F9ZA 5EPFA 3LXTA 1SD8A 5B6NA 1GSFA 2M46A 5DCHA 3FZ5A 3F9UA 4WR5A 1KBNA 1EV9A 5AIXA 5J41A 3DVXA 3EC3A 1XWAA 4Z2UA 4G01A 4HQZA 1GTIA 1SJZA 4K7IA 3FW2A 2F8AA 4Z2TA 3D4MA 4HJ2A 2B1LA 1EEJA 2JSYA 5CYYA 2RUEA 4KSMA 3ZMKA 4WBRD 4YKGA 1X9WB 2WRTA 1ZOFA 4L0WA 4MABA 5A4UA 2R0PA 4WR4A 5D9XA 2E7PA 4ML1A 3BCKA 4KB3A 2LTKA 4LL4B 5BMUA 3CSIA 2YWIA 2FNOA 3TJJA 1GSSA 5A1NB 3IOSA 4EVMA 2XC2A 1QFNA 3L78A 4IHUA 9GSSA 2OT3A 2XBQA 2F8FA 1Z6NA 2VCQA 3IR4A 4ML6A 3K8NA 1QXHA 2H30A 5G2ZA 2CVDA 2B6MA 4TRXA 1XW9A 3GA4A 2TRCP 5F06A 3UMAA 2GZYA 1MDIA 2I81A 2FHEA 2C0GA 5J9BA 1V40A 2L4CA 3UL3A 5ECLB 2MMZA 4H86A 3C8EA 2AUVA 1ABAA 3FZ4A 1B9YC 4OFMA 5JWOB 2KHPA 3VWUA 3EU4A 1A8YA 5AN1A 3WYWA 1GLPA 4ZBDA 5ECQB 3ME7A 4O32A 4V2MA 4MZBA 4TR1A 5ENUA 4CW9A 2YP6A 1G0TA 2YWMA 5IMVA 1G6YA 1PSQA 2H1LA 4E8EA 2PN8A 1O8XA 3IA1A 4TVEA 3J7Yk 2HRKA 5EY6A 1T8EB 1EWXA 3W6GA 1R5PA 5CO3A 2E0QA 2J9HA 1N8JA 2PERA 1V98A 4AGSA 2TRXA 5CRDA 2A4HA 1S3AA 4MH2A 1QUWA 2IJYA 2MMNA 1WMJA 4K2XA 2WS2A 1HYUA 4PTSA 4ZBBA 2YV9A 2MBSA 3HDCA 2DJ0A 1X9SB 4BWSA 5BRTA 1SU9A 5IMCA 5J4UA 2L6CA 6GSXA 2JSZA 4BPYA 5FHIA 1N2AA 2LRCA 2CVBA 4G19A 4HI7A 1XXUA 2LS5A 2PU9C 1JHBA 3CSJA 3A5IA 3QDNA 3GNJA 4X1UA 2AHEA 3KTLA 4EL1A 3KGKA 4YKFA 1A24A 4YAPA 1K3LA 2CQ9A 2XBIA 3PH9A 4XS1A 4Z2RA 3CTFA 3QR6A 2X99A 2DJKA 3NIVA 2JZSA 3UBLA 1DE1A 1X5EA 5G1KA 2CX3A 2FY6A 4DSSB 4ECCA 4PQ1A 1BEDA 3TKQA 3G7YA 3IRAA 3FRCA 3E3EA 2OE3A 2PMTA 5C04A 5IMFA 3ZIJA 3C7MA 3H8QA 1M9BA 4ZB6A 2ON5A 5CRWA 5ECKB 4YAVA 2H19A 2O5VA 3Q74A 3UEMA 3TOUA 4MJBA 4Z7XA 3M8NA 4KAEA 2CA8A 1A2MA 4AJ8A 1AIUA 1K0DA 4PX1A 3US3A 5IM9A 4K0NA 5CP1A 1T3BA 4IQAA 1TDIA 1XWGA 3KTBA 2HSMB 3IC8A 3FR6A 5AISA 1EOGA 1M0UA 5A5HB 2L59A 4GXZA 5IO2A 1GP1A 1GH2A 2G0FA 3KZQA 4E68A 1AUCA 5DAKB 7GSSA 4MCUA 3H1NA 3VI5A 1AQXA 2LUSA 2X4AA 4AKXB 1ERUA 5KN3A 1NSWA 4K5SA 3O3TA 2REMA 2HQTA 1S3DA 1AXDA 2LRNA 1GWCA 4DEJA 3FY7A 1Z7RA 1GSDA 4XRDA 4KX4A 2FA8A 3AY8A 2VL3A 5E59A 5C00A 3JCML 5IO0A 4AI6A 3CRUA 5HR1A 1NHOA 5DJLA 2LQOA 4IJ3A 3BD2A 3HVXA 4MP4A 1JZWA 3GTUB 3LFLA 3FYGA 4PGTA 3E9JB 1OC8A 1GTBA 1TP9A 4DSRA 4NPBA 2HZEB 1MTCA 2VCZA 1K0AA 3F3QA 2WGRA 3WGDA 4WKWA 2FWFA 5ELAA 4ZB7A 2EFCA 3F6DA 3RPNA 1XZOA 2XPEA 3HJOA 5IMAA 3WGXA 1F37A 3GKXA 4KH7A 1TU7A 1Y25A 2HRAA 4HS1A 4K6XA 3HD5A 1A2JA 1A0RP 2X64A 3F8UA 3EU3A 4W66A 4K0GA 2JADA 1YDKA 3RBTA 5KN2A 2H0IA 4ZILA 4FYUA 18GSA 2CAQA 4WF5A 1YF1A 5AGYA 3UBKA 3IK7A 5A4VA 4ZBAA 3O76A 5B7CA 2A2RA 1Q98A 1XW6A 3DEXA 2R3XA 1ACVA 3C71A 4K2DA 2L57A 1JFUA 2VOCA 2GQLA 1TXXA 5D73A 3L9VA 1W4VA 4GSTA 1OKTA 3IAM2 1I5GA 1GUKA 4ULXA 4LMWA 2IFQB 2TIRA 5L71A 2GGTA 2H75A 1YKCA 2OACA 2O89A 2QA2A 2HRFA 1H75A 3C1SA 2VLUA 1XFLA 5ECIB 4BA7A 1XVQA 2DBCA 4I2TA 4QL7A 3UJ1A 5EVOA 2IN3A 4WBJA 1ERTA 1XPVA 5CRGA 1V9WA 5DBQA 2L5OA 4OO4A 2VD1A 1R4WA 1KTEA 3TKSA 3ED3A 1ZYNA 4K7OA 5IMZA 4KW6A 2AB6A 2CZ2A 2AYTA 1AAZA 2VCTA 2ZCTA 2LQQA 3D22A 4X0XA 3D5JA 2PBJA 3CBUA 2EFEA 3HCZA 4GQFA 3IK9A 1WRYA 3TKRA 5ECSA 2H70A 1JZOA 4POBA 2VCVA 2H66A 2LSTA 3SWLA 5CRHA 4MF7A 4IS0A 1A2LA 4G10A 1Z6MA 1SVOA 3G9BA 3VWVA 3ERGA 3HVSA 3QD9A 3O6TA 3IAS2 3H4KA 3M9KA 1T00A 2H8LA 19GSA 5J47A 2B7JA 3HA9A 1MD3A 3R3EA 2F9SA 5ECPB 5KN1A 4MPFA 3EMXA 4AKHA 1YVLA 3UAPA 1QMVA 2CVKA 4IBPA 4NXIA 4ZB8A 4OWYA 4ACSA 3UVTA 3D6IA 1WPIA 2D2ZA 1R7HA 4MJEA 1OC3A 5JWRB 4POLA 4KDUA 2RM5A 6GSTA 2KOKA 1THXA 1TRSA 1PL1A 4F0CA 2JZRA 2L4QA 1F3BA 4N30A 2MYGA 4N0VA 4DSSA 4HEA2 1DBYA 3QFAC 1TU8A 1WOUA 1E2YA 2IMDA 2GT5A 3CSHA 6GSVA 2Z9SA 3QAVA 4J56E 1GUMA 1BYEA 5CAXA 4XHMA 3TKPA 5IPHA 5J40A 3A2XA 1DUGA 2MMAA 3OR5A 1X5CA 4EIPA 1M7TA 3N5OA 4HQSA 2PGTA 1UVZA 4KUNA 3MWHA 1FW1A 2JL4A 2GQMA 3DGQA 4MJAA 4TN8A 2HSMA 1OE7A 3TRPA 1S3CA 2NBSA 4RQXA 1RQMA 5A5HA 4TXVA 1ZCPA 2P5RA 5DAKA 3FZAA 1FHEA 3KH7A 2DKIA 2UZ8A 3RPPA 3DMLA 2EIQA 5LD0A 1Z3EA 2R6KA 3GL5A 2PVOC 2H1BA 4TW5A 5D8IA 1I9DA 2FWGA 1O85A 4OFTA 1C72A 2H74A 2R2JA 2RM6A 3U5RE 4EE0A 3GKNA 1U88A 2L6DA 2VLVA 2B5XA 11GSA 1THOA 5DQSA 4F0BA 1PD21 1O6JA 2WFCA 5COHA 3IHQA 4E8HA 2HRNA 1V57A 2M72A 3M9JA 1M2AA 1EOHA 3GTUA 1F6MC 4TR0A 12GSA 4MZCA 1NW2A 3BBYA 4EKZA 2O8VB 1JZRA 3EE2A 4EO3A 4FIWA 1PX7A 4V1Ap 1FG4A 4XS6A 6GSUA 1EP7A 3DRNA 2G2QA 2ES7A 1IYHA 5J4YA 3TJGA 3MSZA 4KNDA 3VWWA 1XWCA 2EFDA 1ILOA 8GSSA 1ZYPA 3GRXA 1K0CA 3A2WA 1OVNA 4LA1A 1SVMA 3D21A 4IQ1A 3KMOA 2DIYA 5JCWA 4NHWA 2MBTA 5H5SA 3ZVJA 2HFDA 1BX9A 1TXUA 1H4OA 1GL8A 2I1UA 4X4JA 2FGXA 3TKSE 1YZXA 4BVXB 2RUFA 4GRFA 1RK4A 5GSSA 2VL2A 2H1GA 2YZHA 3TKSC 2NPBA 3ZFBA 4DSQA 2LNSA 1PMTA 4LLRA 2V6OA 1T7PB 5ID2B 1AQWA 3VI7A 1V58A 4PQHA 1FVKA 5A34B 1SK0A 3LQ7A 3F4RA 3CMIA 4TR3A 3KH9A 2OBKA 2V32A 1ML6A 3GKKA 2OE0A 3WT1A 5HFKA 4QL9A 2C1YA 1WWJA 3TUEA 1B4QA 2EIOA 4AKIA 4IN0A 4RI6A 3FMWA 4TKYA 4N0ZA 1MEKA 5J9CA 1VF4A 1GRXA 4KSOA 5GZZB 2N5AA 2PVQA 3W8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSR A;  3ZL5 A;  5ECH B;  5JWQ B;  2J23 A;  4K9Z A;  3M0F A;  4OFN A;  3TGZ A;  1HNC A;  2YCD A;  1G7O A;  2OJL A;  3KXO A;  4RI7 A;  2V41 A;  1OYJ A;  2K18 A;  1GTU A;  17GS A;  2PUK C;  3E0U A;  2ALB A;  2DJ3 A;  3UAR A;  1FAA A;  3QAG A;  3V1W A;  4KCE A;  2H6X A;  1ZZY A;  1B8X A;  3VUR A;  2GT6 A;  2H71 A;  1FO5 A;  2WZ9 A;  1F2E A;  4D73 B;  2IMK A;  4JRR A;  1AC1 A;  1USB A;  3HZ4 A;  5IIZ A;  5GAN D;  4MA9 A;  2K9F A;  3PIN A;  1PKZ A;  4LMV A;  1J9B A;  1M99 A;  1TI3 A;  4Q5N A;  4KDY A;  2HSY A;  5ECO B;  3TRX A;  1TRU A;  3ERW A;  3DYR A;  3FZ9 A;  2YWN A;  3GH9 A;  2C80 A;  4NAX A;  4TXO A;  3ZLP A;  4PQI A;  1YY7 A;  3TJF A;  2FUG 2;  2DMM A;  1XOB A;  2PPT A;  1X5D A;  3ZFL A;  2A2S A;  4V2L A;  5HR2 A;  3ZIT A;  2YJ7 A;  2GST A;  2QSI A;  1PGT A;  2H72 A;  6GSS A;  1J0F A;  1DE2 A;  2FCH A;  1X0R A;  3RAZ A;  1T1V A;  4YQM A;  1KEB A;  2I9H A;  5HR3 A;  4N10 A;  2K8V A;  5G1L A;  2WCI A;  4HU9 A;  5HFG A;  4BWQ A;  3A2V A;  4IW9 A;  3GL3 A;  4X43 A;  1PN9 A;  1T4Y A;  3C1R A;  2R5G A;  4O7H A;  3HYP A;  4PNG A;  2VD0 A;  3FKF A;  4ECB A;  4XTS A;  2WJU A;  2H1D A;  1R5A A;  3F3R A;  3J7Y b;  4KE3 A;  1GNW A;  2YPM A;  4Q5R A;  1FOV A;  3ISO A;  4MDC A;  1ZYE A;  3F4T A;  2HLS A;  4K1F A;  3QAW A;  2MMO A;  1JLV A;  3DWV A;  2HSN B;  5CRE A;  5A4W A;  3CYN A;  10GS A;  1EV4 A;  3APO A;  3L9S A;  3GST A;  2R4V A;  1EZK A;  4TR1 B;  1OE8 A;  2B5Y A;  4POK A;  3QOU A;  2FWH A;  2X8H A;  3L4N A;  4G2E A;  2WB9 A;  1ZYQ B;  3KJY A;  1O73 A;  3TRQ A;  3EWL A;  2VM1 A;  1O81 A;  4G0L A;  1SKR B;  3IPZ A;  1VF2 A;  3LYP A;  3PGT A;  6GSY A;  1TI1 A;  2VL2 C;  3P2A A;  2GSS A;  4KF9 A;  1G6W A;  2EC4 A;  2DLX A;  1BG5 A;  4G9H A;  3EUR A;  2WUL A;  2C0F A;  3RHB A;  4TOP A;  3FR9 A;  4MF6 A;  2GDR A;  2K6V A;  5HFI A;  1UN2 A;  2VLT A;  5IOX A;  2AJQ B;  1TOF A;  4NWY A;  3LG6 A;  2QC7 A;  3DXB A;  4EDY A;  3I43 A;  4F2I A;  4MK3 A;  3P90 A;  4AF2 A;  5G5E A;  2OE1 A;  2YWO A;  4MZW A;  3DD3 A;  2VCW A;  5ABR A;  5GAP D;  1YEP A;  3KP9 A;  4AJ7 A;  4V1A g;  3HVV A;  2DJ1 A;  3CXG A;  4KGI A;  2KP1 A;  1GSU A;  3IE3 A;  2KLX A;  1PX6 A;  2XPD A;  4ZIJ A;  3L9U A;  1ST9 A;  1TK5 B;  4ID0 A;  2C3Q A;  3W8S A;  2YV7 A;  3F0I A;  5D93 A;  2O85 A;  3G7I A;  1TK0 B;  4HJM A;  1U6T A;  3TOT A;  2CX4 A;  1ERV A;  4BVX A;  3H93 A;  1TW9 A;  4HDE A;  4ZL9 A;  1YEX A;  2DJJ A;  2VUP A;  4I6X A;  2F3M A;  1B48 A;  1MDK A;  1XOA A;  2H6Y A;  2DSA A;  5INY A;  4MJC A;  4KA0 A;  1NHY A;  3KM6 A;  3ZRD A;  4KCA A;  3EMP A;  1ZMA A;  3HHV A;  5IPG A;  4JR4 A;  3ERF A;  1MDJ A;  3VK9 A;  4G0K A;  1CQG A;  2JU5 A;  4YQU A;  1SYX A;  4KDX A;  3KP8 A;  1SYR A;  3DIE A;  3QMX A;  3BOA A;  5B8B A;  1XWB A;  3LYK A;  3EYT A;  4BVY B;  2GZZ A;  3WGE A;  2H0H A;  3FHK A;  3IC4 A;  2M80 A;  6GSW A;  1K0O A;  2LEG A;  3HJM A;  5H5R A;  4PUA A;  5DAL B;  5ECN B;  1GSY A;  2O7K A;  4XCS A;  1X9M B;  1GSE A;  4NV5 A;  1F3A A;  4D73 A;  3WT2 A;  2FWE A;  2H73 A;  3SBC A;  1QK8 A;  3GUS A;  1K0M A;  2LRT A;  2HXK A;  5F05 A;  1HNA A;  4EDZ A;  1U87 A;  5D9T A;  2I4A A;  4I97 A;  3KD0 A;  4ISD A;  4FYC A;  3FR3 A;  3PPU A;  1QGV A;  3TDG A;  2V1M A;  4N11 A;  3HJP A;  2IMI A;  3Q6O A;  1SL1 B;  3UIW A;  3F4S A;  3CRT A;  1GUH A;  4O5R A;  4POM A;  2DC5 A;  2ZUP A;  3U6V A;  2JZT A;  1PQN A;  5IOW A;  1URM A;  2C0D A;  4JE1 A;  5EL8 A;  4ECI A;  1SK2 A;  1SKS B;  4USS A;  5F0G A;  3N9J A;  3PR8 A;  2N5F A;  2H1A A;  2AAW A;  4MMM A;  2ON7 A;  2P5Q A;  4ECJ A;  2OA7 A;  5D9W A;  4EXJ A;  2L5L A;  1XIY A;  2HZE A;  5D96 A;  4XRA A;  4BL7 B;  3VLN A;  2R37 A;  2VAF A;  4Q5F A;  5F8B A;  2B3S A;  2OAD A;  2H0G A;  2IPA A;  2V6K A;  5A5K A;  5B6M A;  1XWK A;  3VPT A;  4J2F A;  2GTU A;  2PWJ A;  2H76 A;  1K3O A;  2IMF A;  4HU7 A;  3ME8 A;  3S9F A;  2GLR A;  2A4V A;  1HQO A;  2IIY A;  3MDK A;  2LNT A;  4LL1 B;  1T4Z A;  4JU5 A;  1AQV A;  3GFK A;  3DKS A;  1O8W A;  1JZD A;  3ZIV A;  3VWX A;  1VGL A;  1Z5Y E;  1XBS A;  3WD6 A;  2I3Y A;  1OC9 B;  2V2G A;  4TR4 A;  5IMD A;  1XW5 A;  4GCI A;  1U3I A;  4PNF A;  3GN3 A;  4ILF A;  1PA3 A;  2H6Z A;  3TJK A;  1EGO A;  2NDO A;  3LXZ A;  1Y6E A;  3NOF A;  1QQ2 A;  5AIV A;  3EIN A;  3QPM A;  1CQH A;  4GSS A;  1HD2 A;  1GTA A;  3F6F A;  1SKW B;  4EUY A;  2HZF A;  3M1G A;  5F07 A;  1VRS D;  1G7E A;  2C3T A;  4GSN A;  2HYX A;  2BMX A;  4IVF A;  1TRV A;  4FYB A;  2VIM A;  1WE0 A;  2IFQ A;  3M3M A;  3GHA A;  5J5N A;  3TCO A;  2K8S A;  2H01 A;  4JZQ A;  3GIX A;  4L8E A;  4L5L A;  2LJK A;  4IJI A;  5ELG A;  4AJ6 A;  2O87 A;  4NV2 A;  5HR0 A;  3HZ8 A;  4HZ2 A;  1YF0 A;  1PRX A;  4MLY A;  2N5B A;  4HOJ A;  1BAY A;  1WIK A;  3I6A A;  2FA4 A;  3LSZ A;  3C73 A;  1XCC A;  5G30 A;  2LKU A;  4FO5 A;  3EVI A;  3GYK A;  1SJ6 A;  4EC0 A;  4JED A;  1R26 A;  1RW1 A;  2RLI A;  3IV4 A;  4XS4 B;  1VF1 A;  3Q19 A;  1EGR A;  3TJB A;  4RQR A;  1V2A A;  4F03 A;  3I9V 2;  3ZZX A;  1XVW A;  2IL3 A;  2GS3 A;  4WET A;  4YQV A;  2HSH A;  3GX8 A;  2YOI A;  4FQU A;  2HI7 A;  4OD7 A;  5DVB A;  4Q5Q A;  1EP8 A;  2VL9 A;  4JBB A;  4MH3 A;  1F9M A;  1FB0 A;  3APS A;  3VPQ A;  2VO4 A;  1UA5 A;  2LJR A;  3GUR A;  3KIJ A;  5DCG A;  4MF5 A;  5JCU A;  5D9V A;  4NHZ A;  2IWT A;  2X8C A;  2VM2 A;  1GNE A;  22GS A;  2RII A;  4BVY A;  3MNG A;  5G31 A;  3GX0 A;  1FVJ A;  3GSS A;  2E2M A;  3CTG A;  5DAL A;  4K8M A;  4WF4 A;  4ZB9 A;  4GQC A;  4HUA A;  1SD9 A;  2CAI A;  2XHF A;  3GH6 A;  4I2U A;  5IQY A;  5J3R A;  1BQ7 A;  3BJ5 A;  1PL2 A;  2QGV A;  1AW9 A;  1VF3 A;  2YAN A;  1U3A A;  3QFB C;  4WEY A;  3LWA A;  3ZRE A;  1Q4J A;  2EIR A;  2FLS A;  1MD4 A;  4O92 A;  3LOR A;  1M2D A;  1UC7 A;  3HY2 A;  3H79 A;  3RDW A;  13GS A;  5G5F A;  3ZYW A;  1ON4 A;  2HT9 A;  2F51 A;  5LNK e;  1TJD A;  1K3Y A;  4CDO A;  1NM3 A;  5ECR B;  5KN0 A;  5GST A;  1ERW A;  2GSQ A;  1K0B A;  1Z9H A;  3ZTL A;  1GSQ A;  4ZL8 A;  1J08 A;  2GVP A;  2LV3 A;  2HRK B;  2FD3 A;  1ZGN A;  5CNW A;  4IP6 A;  3MAK A;  4J57 E;  1TKD B;  1M9A A;  3HKR A;  3NZN A;  4GLT A;  4XIH A;  2YN1 A;  4QQ7 A;  3LGC A;  3KMN A;  1OKD A;  2HNL A;  1SEN A;  2P31 A;  2JAC A;  1GLQ A;  1WP0 A;  2DJ2 A;  3IXR A;  4HZ4 A;  2KUC A;  3P8W A;  4I5Q A;  1K0N A;  3A5W A;  4K7N A;  4EF0 A;  4OMV A;  2X8G A;  4F82 A;  4G0I A;  14GS A;  1B4P A;  2BJX A;  1TRW A;  1PKW A;  4BL7 A;  4P3Y B;  1FB6 A;  2QKE A;  3LJR A;  4IEL A;  5JCG A;  3APQ A;  2B7K A;  3QCP A;  2CV4 A;  4I8B A;  5E4W A;  4JR6 A;  5FT3 A;  2DML A;  3R2Q A;  2MZC A;  3TB2 A;  4OCE A;  2WDU A;  4IP1 A;  3F63 A;  3IDV A;  1LU4 A;  3IBH A;  5H5Q A;  4ZXG A;  4GWR A;  1A23 A;  1LBK A;  3I69 A;  3Q18 A;  3A3T A;  4DVC A;  4FH8 A;  1BJX A;  1TK8 B;  5KEJ A;  2KP2 A;  4IGJ A;  1OC9 A;  5DDL A;  1B9X C;  2AV4 A;  1OAZ A;  1WJK A;  1W89 A;  4MPG A;  4ZL7 A;  3L0H A;  3KCM A;  3LEF A;  2C8U A;  1SL0 B;  1KNG A;  5ID2 A;  1O7U A;  3GKM A;  2BTO T;  1E6B A;  4CHS A;  3VFI A;  2B1K A;  3ZVJ D;  4TXO B;  4GF0 A;  2YNX A;  4L0U A;  1SL2 B;  1TTZ A;  3D0Z A;  1SJI A;  1LJR A;  4L5O A;  1A0F A;  1IYI A;  4V2N A;  3RHC A;  2C3N A;  1JLW A;  5DJM A;  3FEU A;  3FK8 A;  2B5E A;  4WXT A;  2CZ3 A;  1HNB A;  3UVH A;  3UOM A;  4NMU A;  5B8A A;  4PUF C;  5HQP A;  3ZML A;  2CT6 A;  5LCZ A;  4PUR A;  2VCX A;  2YZU A;  2HE3 A;  1ZL9 A;  16GS A;  2C0E A;  4RUV A;  3DVW A;  1SK1 A;  1DSB A;  1A8L A;  1YKA A;  4GTU A;  5DQY A;  2NVL A;  3BCI A;  2ZNM A;  2OKA A;  1YJ6 A;  2GZP A;  2GQK A;  4PXO A;  4OO5 A;  3GV1 A;  1M2B A;  2C4J A;  1GUL A;  5FWG A;  2E2G A;  20GS A;  1YQ1 A;  2LJA A;  2OBI A;  1Z7P A;  1EEM A;  3P7X A;  4OCF A;  2YJH A;  2NTO A;  2IME A;  2DIZ A;  4YH2 A;  3HXS A;  4IKH A;  4XS4 A;  3G7J A;  3D4T A;  3GMF A;  2P0G A;  5ECM B;  3KEB A;  4F9Z A;  5EPF A;  3LXT A;  1SD8 A;  5B6N A;  1GSF A;  2M46 A;  5DCH A;  3FZ5 A;  3F9U A;  4WR5 A;  1KBN A;  1EV9 A;  5AIX A;  5J41 A;  3DVX A;  3EC3 A;  1XWA A;  4HQZ A;  1GTI A;  1SJZ A;  4K7I A;  3FW2 A;  2F8A A;  3D4M A;  4HJ2 A;  2B1L A;  1EEJ A;  2JSY A;  5CYY A;  2RUE A;  4KSM A;  3ZMK A;  4WBR D;  1X9W B;  2WRT A;  1ZOF A;  4L0W A;  4MAB A;  5A4U A;  4WR4 A;  5D9X A;  2E7P A;  4ML1 A;  3BCK A;  4KB3 A;  2LTK A;  4LL4 B;  5BMU A;  3CSI A;  2YWI A;  2FNO A;  3TJJ A;  1GSS A;  3IOS A;  4EVM A;  2XC2 A;  1QFN A;  3L78 A;  4IHU A;  9GSS A;  2XBQ A;  2F8F A;  1Z6N A;  2VCQ A;  3IR4 A;  4ML6 A;  3K8N A;  1QXH A;  2H30 A;  5G2Z A;  2CVD A;  2B6M A;  4TRX A;  1XW9 A;  3GA4 A;  2TRC P;  5F06 A;  3UMA A;  2GZY A;  1MDI A;  2I81 A;  2FHE A;  2C0G A;  5J9B A;  1V40 A;  2L4C A;  3UL3 A;  5ECL B;  2MMZ A;  4H86 A;  3C8E A;  2AUV A;  1ABA A;  3FZ4 A;  1B9Y C;  4OFM A;  5JWO B;  2KHP A;  3VWU A;  3EU4 A;  1A8Y A;  5AN1 A;  3WYW A;  1GLP A;  4ZBD A;  5ECQ B;  3ME7 A;  4O32 A;  4V2M A;  4MZB A;  4TR1 A;  5ENU A;  4CW9 A;  2YP6 A;  1G0T A;  2YWM A;  5IMV A;  1G6Y A;  1PSQ A;  4E8E A;  2PN8 A;  1O8X A;  3IA1 A;  4TVE A;  3J7Y k;  2HRK A;  5EY6 A;  1T8E B;  1EWX A;  3W6G A;  1R5P A;  5CO3 A;  2E0Q A;  2J9H A;  1N8J A;  2PER A;  1V98 A;  4AGS A;  2TRX A;  5CRD A;  1S3A A;  4MH2 A;  1QUW A;  2IJY A;  2MMN A;  1WMJ A;  2WS2 A;  1HYU A;  4PTS A;  4ZBB A;  2YV9 A;  2MBS A;  3HDC A;  2DJ0 A;  1X9S B;  4BWS A;  1SU9 A;  5IMC A;  5J4U A;  2L6C A;  6GSX A;  2JSZ A;  4BPY A;  5FHI A;  1N2A A;  2LRC A;  2CVB A;  4G19 A;  4HI7 A;  1XXU A;  2LS5 A;  2PU9 C;  1JHB A;  3CSJ A;  3QDN A;  3GNJ A;  4X1U A;  2AHE A;  3KTL A;  4EL1 A;  3KGK A;  1A24 A;  4YAP A;  1K3L A;  2CQ9 A;  2XBI A;  3PH9 A;  4XS1 A;  3CTF A;  3QR6 A;  2X99 A;  2DJK A;  3NIV A;  2JZS A;  3UBL A;  1DE1 A;  1X5E A;  5G1K A;  2CX3 A;  2FY6 A;  4DSS B;  4ECC A;  4PQ1 A;  1BED A;  3TKQ A;  3G7Y A;  3IRA A;  3FRC A;  3E3E A;  2OE3 A;  2PMT A;  5C04 A;  5IMF A;  3ZIJ A;  3C7M A;  3H8Q A;  1M9B A;  4ZB6 A;  2ON5 A;  5CRW A;  5ECK B;  4YAV A;  2H19 A;  3Q74 A;  3UEM A;  3TOU A;  4MJB A;  4Z7X A;  3M8N A;  4KAE A;  2CA8 A;  1A2M A;  4AJ8 A;  1AIU A;  1K0D A;  4PX1 A;  3US3 A;  5IM9 A;  4K0N A;  5CP1 A;  1T3B A;  4IQA A;  1TDI A;  1XWG A;  3KTB A;  2HSM B;  3IC8 A;  3FR6 A;  5AIS A;  1EOG A;  1M0U A;  2L59 A;  4GXZ A;  5IO2 A;  1GP1 A;  1GH2 A;  2G0F A;  3KZQ A;  1AUC A;  5DAK B;  7GSS A;  4MCU A;  3H1N A;  3VI5 A;  1AQX A;  2LUS A;  1ERU A;  5KN3 A;  1NSW A;  3O3T A;  2REM A;  2HQT A;  1S3D A;  1AXD A;  2LRN A;  1GWC A;  4DEJ A;  3FY7 A;  1Z7R A;  1GSD A;  4XRD A;  4KX4 A;  2FA8 A;  3AY8 A;  2VL3 A;  5E59 A;  5C00 A;  3JCM L;  5IO0 A;  3CRU A;  5HR1 A;  1NHO A;  5DJL A;  2LQO A;  4IJ3 A;  3BD2 A;  3HVX A;  4MP4 A;  1JZW A;  3GTU B;  3LFL A;  3FYG A;  4PGT A;  3E9J B;  1OC8 A;  1GTB A;  1TP9 A;  4DSR A;  4NPB A;  2HZE B;  1MTC A;  2VCZ A;  1K0A A;  3F3Q A;  2WGR A;  3WGD A;  4WKW A;  2FWF A;  5ELA A;  3F6D A;  3RPN A;  1XZO A;  2XPE A;  3HJO A;  5IMA A;  3WGX A;  1F37 A;  3GKX A;  4KH7 A;  1TU7 A;  1Y25 A;  2HRA A;  4HS1 A;  4K6X A;  3HD5 A;  1A2J A;  1A0R P;  2X64 A;  3F8U A;  3EU3 A;  4K0G A;  2JAD A;  1YDK A;  3RBT A;  5KN2 A;  2H0I A;  4ZIL A;  4FYU A;  18GS A;  2CAQ A;  4WF5 A;  1YF1 A;  5AGY A;  3UBK A;  3IK7 A;  5A4V A;  4ZBA A;  3O76 A;  5B7C A;  2A2R A;  1Q98 A;  1XW6 A;  3DEX A;  2R3X A;  1ACV A;  3C71 A;  4K2D A;  2L57 A;  1JFU A;  2VOC A;  2GQL A;  1TXX A;  5D73 A;  3L9V A;  1W4V A;  4GST A;  1OKT A;  3IAM 2;  1I5G A;  1GUK A;  4ULX A;  4LMW A;  2IFQ B;  2TIR A;  5L71 A;  2GGT A;  2H75 A;  1YKC A;  2OAC A;  2O89 A;  2HRF A;  1H75 A;  3C1S A;  2VLU A;  1XFL A;  5ECI B;  4BA7 A;  1XVQ A;  2DBC A;  4I2T A;  4QL7 A;  3UJ1 A;  5EVO A;  2IN3 A;  4WBJ A;  1ERT A;  1XPV A;  5CRG A;  1V9W A;  5DBQ A;  2L5O A;  4OO4 A;  2VD1 A;  1R4W A;  1KTE A;  3TKS A;  3ED3 A;  4K7O A;  5IMZ A;  4KW6 A;  2AB6 A;  2CZ2 A;  2AYT A;  1AAZ A;  2VCT A;  2ZCT A;  2LQQ A;  3D22 A;  4X0X A;  3D5J A;  2PBJ A;  3CBU A;  3HCZ A;  4GQF A;  3IK9 A;  1WRY A;  3TKR A;  5ECS A;  2H70 A;  1JZO A;  4POB A;  2VCV A;  2H66 A;  2LST A;  3SWL A;  5CRH A;  4MF7 A;  4IS0 A;  1A2L A;  4G10 A;  1Z6M A;  3G9B A;  3VWV A;  3ERG A;  3HVS A;  3QD9 A;  3O6T A;  3IAS 2;  3H4K A;  3M9K A;  1T00 A;  2H8L A;  19GS A;  2B7J A;  3HA9 A;  1MD3 A;  3R3E A;  2F9S A;  5ECP B;  5KN1 A;  4MPF A;  3EMX A;  3UAP A;  1QMV A;  2CVK A;  4IBP A;  4NXI A;  4ZB8 A;  4OWY A;  4ACS A;  3UVT A;  3D6I A;  1WPI A;  2D2Z A;  1R7H A;  4MJE A;  1OC3 A;  5JWR B;  4POL A;  4KDU A;  2RM5 A;  6GST A;  2KOK A;  1THX A;  1TRS A;  1PL1 A;  4F0C A;  2JZR A;  2L4Q A;  1F3B A;  4N30 A;  2MYG A;  4N0V A;  4DSS A;  4HEA 2;  1DBY A;  3QFA C;  1TU8 A;  1WOU A;  1E2Y A;  2IMD A;  2GT5 A;  3CSH A;  6GSV A;  2Z9S A;  3QAV A;  4J56 E;  1GUM A;  1BYE A;  5CAX A;  4XHM A;  3TKP A;  5IPH A;  3A2X A;  1DUG A;  2MMA A;  3OR5 A;  1X5C A;  1M7T A;  3N5O A;  4HQS A;  2PGT A;  1UVZ A;  4KUN A;  3MWH A;  1FW1 A;  2JL4 A;  2GQM A;  3DGQ A;  4MJA A;  4TN8 A;  2HSM A;  1OE7 A;  3TRP A;  1S3C A;  2NBS A;  4RQX A;  1RQM A;  4TXV A;  1ZCP A;  2P5R A;  5DAK A;  3FZA A;  1FHE A;  3KH7 A;  2UZ8 A;  3RPP A;  3DML A;  2EIQ A;  5LD0 A;  1Z3E A;  2R6K A;  3GL5 A;  2PVO C;  2H1B A;  4TW5 A;  5D8I A;  1I9D A;  2FWG A;  1O85 A;  4OFT A;  1C72 A;  2H74 A;  2R2J A;  2RM6 A;  3U5R E;  4EE0 A;  3GKN A;  1U88 A;  2L6D A;  2VLV A;  2B5X A;  11GS A;  1THO A;  5DQS A;  4F0B A;  1PD2 1;  1O6J A;  2WFC A;  5COH A;  3IHQ A;  4E8H A;  2HRN A;  1V57 A;  2M72 A;  3M9J A;  1M2A A;  1EOH A;  3GTU A;  1F6M C;  4TR0 A;  12GS A;  4MZC A;  1NW2 A;  3BBY A;  4EKZ A;  2O8V B;  1JZR A;  3EE2 A;  4EO3 A;  4FIW A;  1PX7 A;  4V1A p;  1FG4 A;  4XS6 A;  6GSU A;  1EP7 A;  3DRN A;  2G2Q A;  2ES7 A;  1IYH A;  3TJG A;  3MSZ A;  4KND A;  3VWW A;  1XWC A;  1ILO A;  8GSS A;  3GRX A;  1K0C A;  3A2W A;  1OVN A;  4LA1 A;  3D21 A;  4IQ1 A;  3KMO A;  2DIY A;  5JCW A;  4NHW A;  2MBT A;  5H5S A;  3ZVJ A;  2HFD A;  1BX9 A;  1H4O A;  1GL8 A;  2I1U A;  2FGX A;  3TKS E;  1YZX A;  4BVX B;  2RUF A;  4GRF A;  1RK4 A;  5GSS A;  2VL2 A;  2H1G A;  2YZH A;  3TKS C;  2NPB A;  3ZFB A;  4DSQ A;  2LNS A;  1PMT A;  4LLR A;  2V6O A;  1T7P B;  5ID2 B;  1AQW A;  3VI7 A;  1V58 A;  4PQH A;  1FVK A;  1SK0 A;  3LQ7 A;  3F4R A;  3CMI A;  4TR3 A;  3KH9 A;  2OBK A;  2V32 A;  1ML6 A;  3GKK A;  2OE0 A;  3WT1 A;  5HFK A;  4QL9 A;  2C1Y A;  1WWJ A;  3TUE A;  1B4Q A;  2EIO A;  4IN0 A;  4RI6 A;  4TKY A;  4N0Z A;  1MEK A;  5J9C A;  1VF4 A;  1GRX A;  4KSO A;  5GZZ B;  2N5A A;  2PVQ A;  3W8J A; 
#chains in the Genus database with same CATH topology
 2GSR A;  3ZL5 A;  5ECH B;  5JWQ B;  2J23 A;  4K9Z A;  3M0F A;  4OFN A;  3TGZ A;  1HNC A;  2YCD A;  1G7O A;  2OJL A;  3KXO A;  4RI7 A;  2V41 A;  4QMK A;  1OYJ A;  2K18 A;  1GTU A;  17GS A;  2PUK C;  3E0U A;  2ALB A;  2DJ3 A;  3UAR A;  1FAA A;  3QAG A;  3V1W A;  4K5R A;  4KCE A;  2H6X A;  2WW3 A;  1ZZY A;  1B8X A;  3VUR A;  2GT6 A;  2H71 A;  1FO5 A;  2WZ9 A;  1F2E A;  4D73 B;  2WZS A;  2IMK A;  1M3I A;  4JRR A;  1AC1 A;  1USB A;  3HZ4 A;  5IIZ A;  5GAN D;  4MA9 A;  2K9F A;  3PIN A;  1PKZ A;  4LMV A;  1J9B A;  1M99 A;  1TI3 A;  4Q5N A;  4KDY A;  2HSY A;  5ECO B;  3TRX A;  1TRU A;  3ERW A;  3DYR A;  3FZ9 A;  2YWN A;  3GH9 A;  2C80 A;  4NAX A;  4TXO A;  3ZLP A;  4PQI A;  1YY7 A;  3TJF A;  2FUG 2;  2DMM A;  1XOB A;  2PPT A;  1X5D A;  3ZFL A;  2A2S A;  4V2L A;  5HR2 A;  3ZIT A;  2YJ7 A;  2GST A;  2QSI A;  1PGT A;  2H72 A;  6GSS A;  1J0F A;  1DE2 A;  2FCH A;  1X0R A;  3RAZ A;  1T1V A;  4YQM A;  1KEB A;  2I9H A;  2WVY A;  5HR3 A;  4N10 A;  2K8V A;  5G1L A;  2WCI A;  4HU9 A;  5HFG A;  4BWQ A;  3A2V A;  4IW9 A;  3GL3 A;  4X43 A;  1PN9 A;  1T4Y A;  3C1R A;  2R5G A;  4O7H A;  3HYP A;  4PNG A;  4O5U A;  2VD0 A;  3FKF A;  4ECB A;  4XTS A;  2WJU A;  2H1D A;  1R5A A;  3F3R A;  3J7Y b;  4KE3 A;  1GNW A;  2YPM A;  4Q5R A;  1FOV A;  3ISO A;  4MDC A;  1ZYE A;  3F4T A;  2HLS A;  4K1F A;  3QAW A;  2MMO A;  1JLV A;  3DWV A;  2HSN B;  5CRE A;  5A4W A;  3CYN A;  10GS A;  1EV4 A;  3APO A;  3L9S A;  3GST A;  2R4V A;  1EZK A;  4TR1 B;  1OE8 A;  2WVZ A;  2B5Y A;  4POK A;  3QOU A;  2FWH A;  2X8H A;  3L4N A;  2UV8 G;  4G2E A;  2WB9 A;  1ZYQ B;  3KJY A;  1O73 A;  3TRQ A;  3EWL A;  2VM1 A;  1O81 A;  4G0L A;  1SKR B;  3IPZ A;  1VF2 A;  3LYP A;  3PGT A;  6GSY A;  1TI1 A;  2VL2 C;  3P2A A;  2GSS A;  4KF9 A;  1G6W A;  2EC4 A;  2DLX A;  5A1N A;  1BG5 A;  4G9H A;  3EUR A;  2WUL A;  2C0F A;  3RHB A;  4TOP A;  3FR9 A;  4MF6 A;  2GDR A;  2K6V A;  5HFI A;  1UN2 A;  2VLT A;  5IOX A;  2AJQ B;  1TOF A;  4NWY A;  3LG6 A;  2QC7 A;  3DXB A;  4EDY A;  3I43 A;  4F2I A;  4MK3 A;  3P90 A;  4AF2 A;  5G5E A;  2OE1 A;  2YWO A;  4MZW A;  3DD3 A;  2VCW A;  1FOH A;  5ABR A;  5GAP D;  1YEP A;  3KP9 A;  4AJ7 A;  4V1A g;  3HVV A;  2DJ1 A;  3CXG A;  4KGI A;  2KP1 A;  1GSU A;  3IE3 A;  2KLX A;  1PX6 A;  2XPD A;  4ZIJ A;  3L9U A;  1ST9 A;  1TK5 B;  4ID0 A;  2C3Q A;  3W8S A;  2YV7 A;  3F0I A;  5D93 A;  3TU3 B;  2O85 A;  4GDF A;  3G7I A;  1TK0 B;  4HJM A;  1U6T A;  3TOT A;  2CX4 A;  1ERV A;  4BVX A;  3H93 A;  3RGB C;  1TW9 A;  4HDE A;  4ZL9 A;  1YEX A;  2DJJ A;  2VUP A;  4I6X A;  2F3M A;  1B48 A;  1MDK A;  1XOA A;  2H6Y A;  2DSA A;  5INY A;  4MJC A;  4KA0 A;  1NHY A;  3KM6 A;  3ZRD A;  4KCA A;  3EMP A;  1ZMA A;  3HHV A;  5IPG A;  5A34 A;  4JR4 A;  3ERF A;  1MDJ A;  1BF5 A;  3VK9 A;  4G0K A;  1CQG A;  2JU5 A;  4YQU A;  1SYX A;  4KDX A;  3KP8 A;  1SYR A;  3DIE A;  3QMX A;  3BOA A;  5B8B A;  1XWB A;  3LYK A;  3EYT A;  4BVY B;  2GZZ A;  3WGE A;  2H0H A;  3FHK A;  3IC4 A;  2M80 A;  6GSW A;  2LEG A;  1K0O A;  3HJM A;  5H5R A;  4PUA A;  5DAL B;  5ECN B;  1GSY A;  2O7K A;  4A5P A;  4XCS A;  1X9M B;  1GSE A;  4NV5 A;  1F3A A;  4D73 A;  3WT2 A;  2FWE A;  2H73 A;  3SBC A;  1QK8 A;  3GUS A;  1K0M A;  2LRT A;  2HXK A;  5F05 A;  1HNA A;  4EDZ A;  1U87 A;  5D9T A;  2I4A A;  4I97 A;  3EPT A;  3KD0 A;  4ISD A;  4FYC A;  3FR3 A;  3PPU A;  1QGV A;  3TDG A;  2V1M A;  4N11 A;  3HJP A;  1PN0 A;  2IMI A;  3Q6O A;  1SL1 B;  3UIW A;  3F4S A;  3CRT A;  1GUH A;  4O5R A;  4POM A;  2DC5 A;  4N3Z A;  2ZUP A;  3U6V A;  2JZT A;  1PQN A;  5IOW A;  1URM A;  2C0D A;  4JE1 A;  2VKZ G;  5EL8 A;  4ECI A;  1SK2 A;  1SKS B;  4USS A;  2X49 A;  5F0G A;  3N9J A;  3PR8 A;  2N5F A;  2H1A A;  2AAW A;  4MMM A;  2ON7 A;  2P5Q A;  4ECJ A;  2OA7 A;  5D9W A;  4EXJ A;  2L5L A;  1XIY A;  2HZE A;  5D96 A;  4XRA A;  4BL7 B;  3VLN A;  2R37 A;  2VAF A;  4Q5F A;  5F8B A;  2B3S A;  2OAD A;  2H0G A;  2IPA A;  2V6K A;  5A5K A;  5B6M A;  1XWK A;  3VPT A;  4J2F A;  2GTU A;  2PWJ A;  2H76 A;  1K3O A;  2IMF A;  4HU7 A;  3ME8 A;  3S9F A;  2GLR A;  2A4V A;  1HQO A;  2IIY A;  3MDK A;  2LNT A;  4LL1 B;  2HSN A;  1T4Z A;  4JU5 A;  1AQV A;  3GFK A;  3DKS A;  4EIQ A;  1O8W A;  1JZD A;  3ZIV A;  3VWX A;  1VGL A;  1Z5Y E;  4PHZ C;  1XBS A;  3WD6 A;  2I3Y A;  1OC9 B;  2V2G A;  4TR4 A;  1N25 A;  5IMD A;  1XW5 A;  1I1I P;  4GCI A;  1U3I A;  4PNF A;  3GN3 A;  4ILF A;  1PA3 A;  2H6Z A;  3TJK A;  1EGO A;  2NDO A;  3LXZ A;  1Y6E A;  3NOF A;  1QQ2 A;  5AIV A;  3EIN A;  3MYD A;  3QPM A;  1CQH A;  4GSS A;  1HD2 A;  1GTA A;  3F6F A;  1SKW B;  2A2P A;  4EUY A;  2HZF A;  3M1G A;  5F07 A;  1VRS D;  4HSC X;  1G7E A;  2C3T A;  4GSN A;  2HYX A;  2BMX A;  4IVF A;  1TRV A;  4FYB A;  2VIM A;  1WE0 A;  2IFQ A;  3M3M A;  3GHA A;  5J5N A;  3TCO A;  2K8S A;  2H01 A;  4JZQ A;  1BG1 A;  3GIX A;  4L8E A;  2DKH A;  4L5L A;  2LJK A;  4IJI A;  5ELG A;  4AJ6 A;  2O87 A;  4NV2 A;  5HR0 A;  3HZ8 A;  4HZ2 A;  1YF0 A;  1PRX A;  4MLY A;  4O5Q A;  2N5B A;  4HOJ A;  4AKG A;  1BAY A;  1WIK A;  3I6A A;  2FA4 A;  3LSZ A;  3C73 A;  1XCC A;  5G30 A;  2LKU A;  4FO5 A;  3EVI A;  3GYK A;  1SJ6 A;  4EC0 A;  4JED A;  1R26 A;  1RW1 A;  2RLI A;  3IV4 A;  4XS4 B;  5J4V A;  1VF1 A;  3Q19 A;  1EGR A;  3TJB A;  4RQR A;  1V2A A;  4F03 A;  3I9V 2;  3ZZX A;  1XVW A;  2IL3 A;  2GS3 A;  4CY6 A;  4WET A;  4YQV A;  2HSH A;  3GX8 A;  2YOI A;  4FQU A;  2HI7 A;  4OD7 A;  2EFH A;  5DVB A;  4Q5Q A;  1EP8 A;  2VL9 A;  4JBB A;  4MH3 A;  1F9M A;  1FB0 A;  3APS A;  3VPQ A;  2VO4 A;  1UA5 A;  2LJR A;  3GUR A;  3KIJ A;  5DCG A;  4MF5 A;  5JCU A;  4MNN A;  5D9V A;  4NHZ A;  2IWT A;  2X8C A;  2VM2 A;  1GNE A;  22GS A;  2RII A;  4BVY A;  3MNG A;  5G31 A;  3GX0 A;  1FVJ A;  3GSS A;  2E2M A;  3CTG A;  2QA1 A;  5DAL A;  4K8M A;  4WF4 A;  4ZB9 A;  5BMU B;  4GQC A;  4HUA A;  1SD9 A;  2CAI A;  2XHF A;  3GH6 A;  4I2U A;  5IQY A;  5J3R A;  1BQ7 A;  3BJ5 A;  1PL2 A;  2QGV A;  1AW9 A;  1VF3 A;  1Y1U A;  2YAN A;  1U3A A;  3QFB C;  4WEY A;  3LWA A;  3ZRE A;  1Q4J A;  2EIR A;  1SVL A;  2FLS A;  1MD4 A;  4O92 A;  3LOR A;  3CQF A;  2WVX B;  3CHX C;  1M2D A;  1UC7 A;  3HY2 A;  4BIK A;  3H79 A;  3RDW A;  13GS A;  5G5F A;  3ZYW A;  1ON4 A;  2HT9 A;  2F51 A;  5LNK e;  1TJD A;  1K3Y A;  4CDO A;  1NM3 A;  5ECR B;  5KN0 A;  5GST A;  1ERW A;  4ICY A;  2GSQ A;  1K0B A;  1Z9H A;  3ZTL A;  1GSQ A;  4ZL8 A;  1J08 A;  2GVP A;  2LV3 A;  2HRK B;  3LW9 A;  4CY8 A;  2FD3 A;  1ZGN A;  5CNW A;  4IP6 A;  3MAK A;  4J57 E;  1TKD B;  1M9A A;  3HKR A;  3NZN A;  4GLT A;  4XIH A;  2YN1 A;  4QQ7 A;  3LGC A;  3KMN A;  1OKD A;  2HNL A;  2P31 A;  1SEN A;  2JAC A;  1GLQ A;  1WP0 A;  2DJ2 A;  3IXR A;  4HZ4 A;  2KUC A;  3P8W A;  4I5Q A;  1K0N A;  3A5W A;  4K7N A;  4EF0 A;  4OMV A;  2X8G A;  4F82 A;  4G0I A;  14GS A;  1B4P A;  2BJX A;  3CWG A;  2R0C A;  1TRW A;  1PKW A;  4BL7 A;  4P3Y B;  1FB6 A;  2QKE A;  3LJR A;  4IEL A;  5JCG A;  3APQ A;  2B7K A;  3QCP A;  2CV4 A;  4I8B A;  5E4W A;  4JR6 A;  5FT3 A;  2DML A;  3R2Q A;  2MZC A;  3TB2 A;  4OCE A;  2WDU A;  4IP1 A;  3F63 A;  3IDV A;  1LU4 A;  3HMJ G;  3IBH A;  5H5Q A;  4ZXG A;  4GWR A;  1A23 A;  1LBK A;  3I69 A;  3Q18 A;  3A3T A;  4DVC A;  4FH8 A;  1BJX A;  1TK8 B;  5KEJ A;  2KP2 A;  4IGJ A;  1OC9 A;  5DDL A;  1B9X C;  2AV4 A;  1OAZ A;  1WJK A;  1W89 A;  4MPG A;  4ZL7 A;  3L0H A;  3KCM A;  3LEF A;  2C8U A;  1SL0 B;  1KNG A;  5ID2 A;  1O7U A;  3GKM A;  2BTO T;  1E6B A;  4CHS A;  3VFI A;  2B1K A;  3ZVJ D;  4TXO B;  4GF0 A;  2YNX A;  4L0U A;  1SL2 B;  1TTZ A;  3D0Z A;  1SJI A;  5KOX A;  1LJR A;  4L5O A;  1A0F A;  1IYI A;  4V2N A;  3RHC A;  2C3N A;  1JLW A;  5DJM A;  3FEU A;  3FK8 A;  2B5E A;  4WXT A;  2CZ3 A;  1HNB A;  3UVH A;  3UOM A;  4NMU A;  5B8A A;  4PUF C;  5HQP A;  3ZML A;  2CT6 A;  5LCZ A;  4PUR A;  2VCX A;  2YZU A;  2HE3 A;  3IHG A;  1ZL9 A;  16GS A;  2C0E A;  4RUV A;  3DVW A;  1SK1 A;  1DSB A;  1A8L A;  1YKA A;  4GTU A;  5DQY A;  2NVL A;  2R0G A;  3BCI A;  2ZNM A;  2OKA A;  1YJ6 A;  2GZP A;  2GQK A;  4PXO A;  4OO5 A;  3GV1 A;  1M2B A;  2C4J A;  5KOW A;  1GUL A;  3HVN A;  5FWG A;  2E2G A;  20GS A;  1YQ1 A;  2LJA A;  2OBI A;  1Z7P A;  1EEM A;  3P7X A;  4OCF A;  2YJH A;  2NTO A;  2IME A;  2DIZ A;  4YH2 A;  3HXS A;  4IKH A;  3MIX A;  3G7J A;  3D4T A;  4XS4 A;  3GMF A;  2P0G A;  5ECM B;  3KEB A;  4F9Z A;  5EPF A;  3LXT A;  1SD8 A;  5B6N A;  1GSF A;  2M46 A;  5DCH A;  3FZ5 A;  3F9U A;  4WR5 A;  1KBN A;  1EV9 A;  5AIX A;  5J41 A;  3DVX A;  3EC3 A;  1XWA A;  4Z2U A;  4G01 A;  4HQZ A;  1GTI A;  1SJZ A;  4K7I A;  3FW2 A;  2F8A A;  4Z2T A;  3D4M A;  4HJ2 A;  2B1L A;  1EEJ A;  2JSY A;  5CYY A;  2RUE A;  4KSM A;  3ZMK A;  4WBR D;  4YKG A;  1X9W B;  2WRT A;  1ZOF A;  4L0W A;  4MAB A;  5A4U A;  2R0P A;  4WR4 A;  5D9X A;  2E7P A;  4ML1 A;  3BCK A;  4KB3 A;  2LTK A;  4LL4 B;  5BMU A;  3CSI A;  2YWI A;  2FNO A;  3TJJ A;  1GSS A;  5A1N B;  3IOS A;  4EVM A;  2XC2 A;  1QFN A;  3L78 A;  4IHU A;  9GSS A;  2OT3 A;  2XBQ A;  2F8F A;  1Z6N A;  2VCQ A;  3IR4 A;  4ML6 A;  3K8N A;  1QXH A;  2H30 A;  5G2Z A;  2CVD A;  2B6M A;  4TRX A;  1XW9 A;  3GA4 A;  2TRC P;  5F06 A;  2WW1 A;  3UMA A;  2GZY A;  1MDI A;  2I81 A;  2FHE A;  2C0G A;  5J9B A;  1V40 A;  2L4C A;  3UL3 A;  5ECL B;  2MMZ A;  4H86 A;  3C8E A;  2WVX A;  2AUV A;  1ABA A;  3FZ4 A;  1B9Y C;  4OFM A;  5JWO B;  2KHP A;  3VWU A;  3EU4 A;  1A8Y A;  5AN1 A;  3WYW A;  1GLP A;  4ZBD A;  5ECQ B;  3ME7 A;  4O32 A;  4V2M A;  4MZB A;  4TR1 A;  5ENU A;  4CW9 A;  2YP6 A;  1G0T A;  2YWM A;  5IMV A;  1G6Y A;  1PSQ A;  2H1L A;  4E8E A;  2PN8 A;  1O8X A;  3IA1 A;  4TVE A;  3J7Y k;  2HRK A;  5EY6 A;  1T8E B;  1EWX A;  3W6G A;  1R5P A;  5CO3 A;  2E0Q A;  2J9H A;  1N8J A;  2PER A;  1V98 A;  4AGS A;  2TRX A;  5CRD A;  2A4H A;  1S3A A;  4MH2 A;  1QUW A;  2IJY A;  2MMN A;  1WMJ A;  4K2X A;  2WS2 A;  1HYU A;  4PTS A;  4ZBB A;  2YV9 A;  2MBS A;  3HDC A;  2DJ0 A;  1X9S B;  4BWS A;  5BRT A;  1SU9 A;  5IMC A;  5J4U A;  2L6C A;  6GSX A;  2JSZ A;  4BPY A;  5FHI A;  1N2A A;  2LRC A;  1PFO A;  2CVB A;  4G19 A;  4HI7 A;  1XXU A;  2LS5 A;  2PU9 C;  1JHB A;  3CSJ A;  1XG8 A;  3A5I A;  3QDN A;  3GNJ A;  2WW0 A;  4X1U A;  2AHE A;  3KTL A;  4EL1 A;  3KGK A;  4YKF A;  1A24 A;  4YAP A;  1K3L A;  2CQ9 A;  2XBI A;  3PH9 A;  4XS1 A;  4Z2R A;  3CTF A;  3QR6 A;  2X99 A;  2DJK A;  3NIV A;  2JZS A;  3UBL A;  1DE1 A;  1X5E A;  5G1K A;  2CX3 A;  2FY6 A;  4DSS B;  4ECC A;  4PQ1 A;  1BED A;  3TKQ A;  3G7Y A;  3IRA A;  3FRC A;  3E3E A;  2OE3 A;  2O3E A;  2PMT A;  5C04 A;  5IMF A;  3ZIJ A;  3C7M A;  3H8Q A;  1M9B A;  4ZB6 A;  2ON5 A;  5CRW A;  5ECK B;  4YAV A;  2H19 A;  2O5V A;  3Q74 A;  3UEM A;  3TOU A;  4MJB A;  4Z7X A;  3M8N A;  4KAE A;  2CA8 A;  1A2M A;  4AJ8 A;  1AIU A;  1K0D A;  4PX1 A;  3US3 A;  5IM9 A;  4K0N A;  5CP1 A;  1T3B A;  4IQA A;  1TDI A;  1XWG A;  3KTB A;  4PI2 C;  2HSM B;  3IC8 A;  3FR6 A;  5AIS A;  1EOG A;  1M0U A;  5A5H B;  2L59 A;  4GXZ A;  5IO2 A;  1GP1 A;  1GH2 A;  4FXY P;  2G0F A;  3KZQ A;  4E68 A;  1AUC A;  5DAK B;  7GSS A;  4MCU A;  3H1N A;  3VI5 A;  1AQX A;  2LUS A;  2X4A A;  4AKX B;  1ERU A;  5KN3 A;  1NSW A;  4K5S A;  3O3T A;  2REM A;  2HQT A;  1S3D A;  1AXD A;  2LRN A;  1GWC A;  4DEJ A;  3FY7 A;  1Z7R A;  1GSD A;  4XRD A;  4KX4 A;  2FA8 A;  3AY8 A;  2VL3 A;  5E59 A;  5C00 A;  3JCM L;  5IO0 A;  4AI6 A;  3CRU A;  5HR1 A;  1NHO A;  5DJL A;  2LQO A;  4IJ3 A;  3BD2 A;  3HVX A;  4MP4 A;  1JZW A;  3GTU B;  3LFL A;  3FYG A;  4PGT A;  3E9J B;  1OC8 A;  1GTB A;  1TP9 A;  4DSR A;  4NPB A;  2HZE B;  1MTC A;  2VCZ A;  1K0A A;  3F3Q A;  2WGR A;  3WGD A;  4WKW A;  2FWF A;  5ELA A;  4ZB7 A;  2EFC A;  1S3R A;  3F6D A;  3RPN A;  1XZO A;  2XPE A;  3HJO A;  2O36 A;  5IMA A;  3WGX A;  1F37 A;  3GKX A;  4KH7 A;  1TU7 A;  1Y25 A;  2HRA A;  4HS1 A;  4K6X A;  3HD5 A;  1A2J A;  1A0R P;  2X64 A;  3F8U A;  3EU3 A;  4W66 A;  4K0G A;  2JAD A;  1YDK A;  3RBT A;  5KN2 A;  2H0I A;  4ZIL A;  4FYU A;  18GS A;  2CAQ A;  4WF5 A;  1YF1 A;  5AGY A;  3UBK A;  3IK7 A;  5A4V A;  4ZBA A;  3O76 A;  5B7C A;  2A2R A;  1Q98 A;  1XW6 A;  3DEX A;  2R3X A;  1ACV A;  3C71 A;  4K2D A;  2L57 A;  1JFU A;  2VOC A;  2GQL A;  1TXX A;  5D73 A;  3L9V A;  1W4V A;  4GST A;  1OKT A;  3IAM 2;  1I5G A;  1GUK A;  4ULX A;  4LMW A;  2IFQ B;  2TIR A;  5L71 A;  2GGT A;  2H75 A;  1YKC A;  2OAC A;  2O89 A;  2QA2 A;  2HRF A;  1H75 A;  3C1S A;  1YEW C;  2VLU A;  1XFL A;  5ECI B;  4BA7 A;  1XVQ A;  2DBC A;  4I2T A;  4QL7 A;  3UJ1 A;  5EVO A;  2IN3 A;  4WBJ A;  1ERT A;  1XPV A;  5CRG A;  1V9W A;  5DBQ A;  2L5O A;  4OO4 A;  2VD1 A;  1R4W A;  1KTE A;  3TKS A;  3ED3 A;  1ZYN A;  4K7O A;  5IMZ A;  4KW6 A;  2AB6 A;  2CZ2 A;  2AYT A;  1AAZ A;  2VCT A;  2ZCT A;  2LQQ A;  3D22 A;  4X0X A;  3D5J A;  2PBJ A;  3CBU A;  2EFE A;  3HCZ A;  4GQF A;  3IK9 A;  1WRY A;  3TKR A;  5ECS A;  2H70 A;  1JZO A;  4POB A;  2VCV A;  2H66 A;  2LST A;  3SWL A;  5CRH A;  4MF7 A;  4IS0 A;  1A2L A;  4G10 A;  1Z6M A;  1SVO A;  3G9B A;  3VWV A;  1S4B P;  3ERG A;  3HVS A;  3QD9 A;  3O6T A;  3IAS 2;  3H4K A;  3M9K A;  1T00 A;  2H8L A;  19GS A;  5J47 A;  2B7J A;  3HA9 A;  1MD3 A;  3R3E A;  2F9S A;  3RFR C;  5ECP B;  5KN1 A;  4MPF A;  3EMX A;  4AKH A;  1YVL A;  3UAP A;  1QMV A;  2CVK A;  4IBP A;  4NXI A;  4ZB8 A;  4OWY A;  4ACS A;  3UVT A;  3D6I A;  1WPI A;  2D2Z A;  1R7H A;  4MJE A;  1OC3 A;  5JWR B;  4POL A;  4KDU A;  2RM5 A;  6GST A;  2KOK A;  1THX A;  1TRS A;  1PL1 A;  4F0C A;  2JZR A;  2L4Q A;  1F3B A;  4N30 A;  2MYG A;  4N0V A;  4DSS A;  4HEA 2;  1DBY A;  3QFA C;  1TU8 A;  1WOU A;  1E2Y A;  2IMD A;  2GT5 A;  3CSH A;  6GSV A;  2Z9S A;  3QAV A;  4J56 E;  1GUM A;  1BYE A;  5CAX A;  4XHM A;  3TKP A;  5IPH A;  5J40 A;  3A2X A;  1DUG A;  2MMA A;  3OR5 A;  1X5C A;  4EIP A;  1M7T A;  3N5O A;  4HQS A;  2PGT A;  1UVZ A;  4KUN A;  3MWH A;  1FW1 A;  2JL4 A;  2GQM A;  3DGQ A;  2WW2 A;  4MJA A;  4TN8 A;  2HSM A;  1OE7 A;  3TRP A;  1S3C A;  2NBS A;  4RQX A;  1RQM A;  5A5H A;  4TXV A;  1ZCP A;  2P5R A;  5DAK A;  3FZA A;  1FHE A;  3KH7 A;  2DKI A;  2UZ8 A;  3RPP A;  3DML A;  2EIQ A;  5LD0 A;  1Z3E A;  2R6K A;  3GL5 A;  2PVO C;  2H1B A;  4TW5 A;  5D8I A;  1I9D A;  2FWG A;  1O85 A;  4OFT A;  1C72 A;  2H74 A;  2R2J A;  2RM6 A;  3U5R E;  4EE0 A;  3GKN A;  1U88 A;  2L6D A;  2VLV A;  2B5X A;  11GS A;  1THO A;  5DQS A;  4F0B A;  1PD2 1;  1O6J A;  2WFC A;  5COH A;  4PI0 C;  3IHQ A;  4E8H A;  2HRN A;  1V57 A;  2M72 A;  3M9J A;  1M2A A;  1EOH A;  3GTU A;  1F6M C;  4TR0 A;  12GS A;  4MZC A;  1NW2 A;  3BBY A;  4EKZ A;  2O8V B;  1JZR A;  3EE2 A;  4EO3 A;  4FIW A;  1PX7 A;  4V1A p;  1FG4 A;  4XS6 A;  6GSU A;  1EP7 A;  3DRN A;  2G2Q A;  2ES7 A;  1IYH A;  5J4Y A;  3TJG A;  3MSZ A;  4KND A;  3VWW A;  1XWC A;  2EFD A;  1ILO A;  8GSS A;  1ZYP A;  3GRX A;  1K0C A;  3A2W A;  1OVN A;  4LA1 A;  1SVM A;  3D21 A;  4IQ1 A;  3KMO A;  2DIY A;  5JCW A;  4NHW A;  2MBT A;  5H5S A;  3ZVJ A;  2HFD A;  1BX9 A;  1TXU A;  1H4O A;  1GL8 A;  2I1U A;  4X4J A;  2FGX A;  3TKS E;  1YZX A;  4BVX B;  2RUF A;  4GRF A;  1RK4 A;  5GSS A;  1M3J A;  2VL2 A;  2H1G A;  2YZH A;  3TKS C;  2NPB A;  3ZFB A;  4DSQ A;  2LNS A;  1PMT A;  4LLR A;  2V6O A;  1T7P B;  5ID2 B;  1AQW A;  3VI7 A;  1V58 A;  4PQH A;  1FVK A;  5A34 B;  1SK0 A;  3LQ7 A;  3F4R A;  3CMI A;  4TR3 A;  3KH9 A;  2OBK A;  2V32 A;  1ML6 A;  3GKK A;  2OE0 A;  3WT1 A;  5HFK A;  4QL9 A;  2C1Y A;  1WWJ A;  3TUE A;  1B4Q A;  2EIO A;  4AKI A;  4IN0 A;  4RI6 A;  3FMW A;  4TKY A;  4N0Z A;  1MEK A;  5J9C A;  1VF4 A;  1GRX A;  4KSO A;  5GZZ B;  2N5A A;  2PVQ A;  3W8J A; 
#chains in the Genus database with same CATH homology
 2GSR A;  3ZL5 A;  5ECH B;  5JWQ B;  2J23 A;  4K9Z A;  3M0F A;  4OFN A;  3TGZ A;  1HNC A;  2YCD A;  1G7O A;  2OJL A;  3KXO A;  4RI7 A;  2V41 A;  4QMK A;  1OYJ A;  2K18 A;  1GTU A;  17GS A;  2PUK C;  3E0U A;  2ALB A;  2DJ3 A;  3UAR A;  1FAA A;  3QAG A;  3V1W A;  4K5R A;  4KCE A;  2H6X A;  1ZZY A;  1B8X A;  3VUR A;  2GT6 A;  2H71 A;  1FO5 A;  2WZ9 A;  1F2E A;  4D73 B;  2IMK A;  4JRR A;  1AC1 A;  1USB A;  3HZ4 A;  5IIZ A;  5GAN D;  4MA9 A;  2K9F A;  3PIN A;  1PKZ A;  4LMV A;  1J9B A;  1M99 A;  1TI3 A;  4Q5N A;  4KDY A;  2HSY A;  5ECO B;  3TRX A;  1TRU A;  3ERW A;  3DYR A;  3FZ9 A;  2YWN A;  3GH9 A;  2C80 A;  4NAX A;  4TXO A;  3ZLP A;  4PQI A;  1YY7 A;  3TJF A;  2FUG 2;  2DMM A;  1XOB A;  2PPT A;  1X5D A;  3ZFL A;  2A2S A;  4V2L A;  5HR2 A;  3ZIT A;  2YJ7 A;  2GST A;  2QSI A;  1PGT A;  2H72 A;  6GSS A;  1J0F A;  1DE2 A;  2FCH A;  1X0R A;  3RAZ A;  1T1V A;  4YQM A;  1KEB A;  2I9H A;  5HR3 A;  4N10 A;  2K8V A;  5G1L A;  2WCI A;  4HU9 A;  5HFG A;  4BWQ A;  3A2V A;  4IW9 A;  3GL3 A;  4X43 A;  1PN9 A;  1T4Y A;  3C1R A;  2R5G A;  4O7H A;  3HYP A;  4PNG A;  4O5U A;  2VD0 A;  3FKF A;  4ECB A;  4XTS A;  2WJU A;  2H1D A;  1R5A A;  3F3R A;  3J7Y b;  4KE3 A;  1GNW A;  2YPM A;  4Q5R A;  1FOV A;  3ISO A;  4MDC A;  1ZYE A;  3F4T A;  2HLS A;  4K1F A;  3QAW A;  2MMO A;  1JLV A;  3DWV A;  2HSN B;  5CRE A;  5A4W A;  3CYN A;  10GS A;  1EV4 A;  3APO A;  3L9S A;  3GST A;  2R4V A;  1EZK A;  4TR1 B;  1OE8 A;  2B5Y A;  4POK A;  3QOU A;  2FWH A;  2X8H A;  3L4N A;  2UV8 G;  4G2E A;  2WB9 A;  1ZYQ B;  3KJY A;  1O73 A;  3TRQ A;  3EWL A;  2VM1 A;  1O81 A;  4G0L A;  1SKR B;  3IPZ A;  1VF2 A;  3LYP A;  3PGT A;  6GSY A;  1TI1 A;  2VL2 C;  3P2A A;  2GSS A;  4KF9 A;  1G6W A;  2EC4 A;  2DLX A;  5A1N A;  1BG5 A;  4G9H A;  3EUR A;  2WUL A;  2C0F A;  3RHB A;  4TOP A;  3FR9 A;  4MF6 A;  2GDR A;  2K6V A;  5HFI A;  1UN2 A;  2VLT A;  5IOX A;  2AJQ B;  1TOF A;  4NWY A;  3LG6 A;  2QC7 A;  3DXB A;  4EDY A;  3I43 A;  4F2I A;  4MK3 A;  3P90 A;  4AF2 A;  5G5E A;  2OE1 A;  2YWO A;  4MZW A;  3DD3 A;  2VCW A;  1FOH A;  5ABR A;  5GAP D;  1YEP A;  3KP9 A;  4AJ7 A;  4V1A g;  3HVV A;  2DJ1 A;  3CXG A;  4KGI A;  2KP1 A;  1GSU A;  3IE3 A;  2KLX A;  1PX6 A;  2XPD A;  4ZIJ A;  3L9U A;  1ST9 A;  1TK5 B;  4ID0 A;  2C3Q A;  3W8S A;  2YV7 A;  3F0I A;  5D93 A;  3TU3 B;  2O85 A;  4GDF A;  3G7I A;  1TK0 B;  4HJM A;  1U6T A;  3TOT A;  2CX4 A;  1ERV A;  4BVX A;  3H93 A;  1TW9 A;  4HDE A;  4ZL9 A;  1YEX A;  2DJJ A;  2VUP A;  4I6X A;  2F3M A;  1B48 A;  1MDK A;  1XOA A;  2H6Y A;  2DSA A;  5INY A;  4MJC A;  4KA0 A;  1NHY A;  3KM6 A;  3ZRD A;  4KCA A;  3EMP A;  1ZMA A;  3HHV A;  5IPG A;  5A34 A;  4JR4 A;  3ERF A;  1MDJ A;  1BF5 A;  3VK9 A;  4G0K A;  1CQG A;  2JU5 A;  4YQU A;  1SYX A;  4KDX A;  3KP8 A;  1SYR A;  3DIE A;  3QMX A;  3BOA A;  5B8B A;  1XWB A;  3LYK A;  3EYT A;  4BVY B;  2GZZ A;  3WGE A;  2H0H A;  3FHK A;  3IC4 A;  2M80 A;  6GSW A;  2LEG A;  1K0O A;  3HJM A;  5H5R A;  4PUA A;  5DAL B;  5ECN B;  1GSY A;  2O7K A;  4A5P A;  4XCS A;  1X9M B;  1GSE A;  4NV5 A;  1F3A A;  4D73 A;  3WT2 A;  2FWE A;  2H73 A;  3SBC A;  1QK8 A;  3GUS A;  1K0M A;  2LRT A;  2HXK A;  5F05 A;  1HNA A;  4EDZ A;  1U87 A;  5D9T A;  2I4A A;  4I97 A;  3EPT A;  3KD0 A;  4ISD A;  4FYC A;  3FR3 A;  3PPU A;  1QGV A;  3TDG A;  2V1M A;  4N11 A;  3HJP A;  1PN0 A;  2IMI A;  3Q6O A;  1SL1 B;  3UIW A;  3F4S A;  3CRT A;  1GUH A;  4O5R A;  4POM A;  2DC5 A;  4N3Z A;  2ZUP A;  3U6V A;  2JZT A;  1PQN A;  5IOW A;  1URM A;  2C0D A;  4JE1 A;  2VKZ G;  5EL8 A;  4ECI A;  1SK2 A;  1SKS B;  4USS A;  2X49 A;  5F0G A;  3N9J A;  3PR8 A;  2N5F A;  2H1A A;  2AAW A;  4MMM A;  2ON7 A;  2P5Q A;  4ECJ A;  2OA7 A;  5D9W A;  4EXJ A;  2L5L A;  1XIY A;  2HZE A;  5D96 A;  4XRA A;  4BL7 B;  3VLN A;  2R37 A;  2VAF A;  4Q5F A;  5F8B A;  2B3S A;  2OAD A;  2H0G A;  2IPA A;  2V6K A;  5A5K A;  5B6M A;  1XWK A;  3VPT A;  4J2F A;  2GTU A;  2PWJ A;  2H76 A;  1K3O A;  2IMF A;  4HU7 A;  3ME8 A;  3S9F A;  2GLR A;  2A4V A;  1HQO A;  2IIY A;  3MDK A;  2LNT A;  4LL1 B;  2HSN A;  1T4Z A;  4JU5 A;  1AQV A;  3GFK A;  3DKS A;  4EIQ A;  1O8W A;  1JZD A;  3ZIV A;  3VWX A;  1VGL A;  1Z5Y E;  1XBS A;  3WD6 A;  2I3Y A;  1OC9 B;  2V2G A;  4TR4 A;  1N25 A;  5IMD A;  1XW5 A;  4GCI A;  1U3I A;  4PNF A;  3GN3 A;  4ILF A;  1PA3 A;  2H6Z A;  3TJK A;  1EGO A;  2NDO A;  3LXZ A;  1Y6E A;  3NOF A;  1QQ2 A;  5AIV A;  3EIN A;  3MYD A;  3QPM A;  1CQH A;  4GSS A;  1HD2 A;  1GTA A;  3F6F A;  1SKW B;  2A2P A;  4EUY A;  2HZF A;  3M1G A;  5F07 A;  1VRS D;  1G7E A;  2C3T A;  4GSN A;  2HYX A;  2BMX A;  4IVF A;  1TRV A;  4FYB A;  2VIM A;  1WE0 A;  2IFQ A;  3M3M A;  3GHA A;  5J5N A;  3TCO A;  2K8S A;  2H01 A;  4JZQ A;  1BG1 A;  3GIX A;  4L8E A;  2DKH A;  4L5L A;  2LJK A;  4IJI A;  5ELG A;  4AJ6 A;  2O87 A;  4NV2 A;  5HR0 A;  3HZ8 A;  4HZ2 A;  1YF0 A;  1PRX A;  4MLY A;  4O5Q A;  2N5B A;  4HOJ A;  4AKG A;  1BAY A;  1WIK A;  3I6A A;  2FA4 A;  3LSZ A;  3C73 A;  1XCC A;  5G30 A;  2LKU A;  4FO5 A;  3EVI A;  3GYK A;  1SJ6 A;  4EC0 A;  4JED A;  1R26 A;  1RW1 A;  2RLI A;  3IV4 A;  4XS4 B;  5J4V A;  1VF1 A;  3Q19 A;  1EGR A;  3TJB A;  4RQR A;  1V2A A;  4F03 A;  3I9V 2;  3ZZX A;  1XVW A;  2IL3 A;  2GS3 A;  4CY6 A;  4WET A;  4YQV A;  2HSH A;  3GX8 A;  2YOI A;  4FQU A;  2HI7 A;  4OD7 A;  2EFH A;  5DVB A;  4Q5Q A;  1EP8 A;  2VL9 A;  4JBB A;  4MH3 A;  1F9M A;  1FB0 A;  3APS A;  3VPQ A;  2VO4 A;  1UA5 A;  2LJR A;  3GUR A;  3KIJ A;  5DCG A;  4MF5 A;  5JCU A;  4MNN A;  5D9V A;  4NHZ A;  2IWT A;  2X8C A;  2VM2 A;  1GNE A;  22GS A;  2RII A;  4BVY A;  3MNG A;  5G31 A;  3GX0 A;  1FVJ A;  3GSS A;  2E2M A;  3CTG A;  2QA1 A;  5DAL A;  4K8M A;  4WF4 A;  4ZB9 A;  5BMU B;  4GQC A;  4HUA A;  1SD9 A;  2CAI A;  2XHF A;  3GH6 A;  4I2U A;  5IQY A;  5J3R A;  1BQ7 A;  3BJ5 A;  1PL2 A;  2QGV A;  1AW9 A;  1VF3 A;  1Y1U A;  2YAN A;  1U3A A;  3QFB C;  4WEY A;  3LWA A;  3ZRE A;  1Q4J A;  2EIR A;  1SVL A;  2FLS A;  1MD4 A;  4O92 A;  3LOR A;  1M2D A;  1UC7 A;  3HY2 A;  3H79 A;  3RDW A;  13GS A;  5G5F A;  3ZYW A;  1ON4 A;  2HT9 A;  2F51 A;  5LNK e;  1TJD A;  1K3Y A;  4CDO A;  1NM3 A;  5ECR B;  5KN0 A;  5GST A;  1ERW A;  4ICY A;  2GSQ A;  1K0B A;  1Z9H A;  3ZTL A;  1GSQ A;  4ZL8 A;  1J08 A;  2GVP A;  2LV3 A;  2HRK B;  3LW9 A;  4CY8 A;  2FD3 A;  1ZGN A;  5CNW A;  4IP6 A;  3MAK A;  4J57 E;  1TKD B;  1M9A A;  3HKR A;  3NZN A;  4GLT A;  4XIH A;  2YN1 A;  4QQ7 A;  3LGC A;  3KMN A;  1OKD A;  2HNL A;  2P31 A;  1SEN A;  2JAC A;  1GLQ A;  1WP0 A;  2DJ2 A;  3IXR A;  4HZ4 A;  2KUC A;  3P8W A;  4I5Q A;  1K0N A;  3A5W A;  4K7N A;  4EF0 A;  4OMV A;  2X8G A;  4F82 A;  4G0I A;  14GS A;  1B4P A;  2BJX A;  3CWG A;  2R0C A;  1TRW A;  1PKW A;  4BL7 A;  4P3Y B;  1FB6 A;  2QKE A;  3LJR A;  4IEL A;  5JCG A;  3APQ A;  2B7K A;  3QCP A;  2CV4 A;  4I8B A;  5E4W A;  4JR6 A;  5FT3 A;  2DML A;  3R2Q A;  2MZC A;  3TB2 A;  4OCE A;  2WDU A;  4IP1 A;  3F63 A;  3IDV A;  1LU4 A;  3HMJ G;  3IBH A;  5H5Q A;  4ZXG A;  4GWR A;  1A23 A;  1LBK A;  3I69 A;  3Q18 A;  3A3T A;  4DVC A;  4FH8 A;  1BJX A;  1TK8 B;  5KEJ A;  2KP2 A;  4IGJ A;  1OC9 A;  5DDL A;  1B9X C;  2AV4 A;  1OAZ A;  1WJK A;  1W89 A;  4MPG A;  4ZL7 A;  3L0H A;  3KCM A;  3LEF A;  2C8U A;  1SL0 B;  1KNG A;  5ID2 A;  1O7U A;  3GKM A;  2BTO T;  1E6B A;  4CHS A;  3VFI A;  2B1K A;  3ZVJ D;  4TXO B;  4GF0 A;  2YNX A;  4L0U A;  1SL2 B;  1TTZ A;  3D0Z A;  1SJI A;  5KOX A;  1LJR A;  4L5O A;  1A0F A;  1IYI A;  4V2N A;  3RHC A;  2C3N A;  1JLW A;  5DJM A;  3FEU A;  3FK8 A;  2B5E A;  4WXT A;  2CZ3 A;  1HNB A;  3UVH A;  3UOM A;  4NMU A;  5B8A A;  4PUF C;  5HQP A;  3ZML A;  2CT6 A;  5LCZ A;  4PUR A;  2VCX A;  2YZU A;  2HE3 A;  3IHG A;  1ZL9 A;  16GS A;  2C0E A;  4RUV A;  3DVW A;  1SK1 A;  1DSB A;  1A8L A;  1YKA A;  4GTU A;  5DQY A;  2NVL A;  2R0G A;  3BCI A;  2ZNM A;  2OKA A;  1YJ6 A;  2GZP A;  2GQK A;  4PXO A;  4OO5 A;  3GV1 A;  1M2B A;  2C4J A;  5KOW A;  1GUL A;  5FWG A;  2E2G A;  20GS A;  1YQ1 A;  2LJA A;  2OBI A;  1Z7P A;  1EEM A;  3P7X A;  4OCF A;  2YJH A;  2NTO A;  2IME A;  2DIZ A;  4YH2 A;  3HXS A;  4IKH A;  3MIX A;  3G7J A;  3D4T A;  4XS4 A;  3GMF A;  2P0G A;  5ECM B;  3KEB A;  4F9Z A;  5EPF A;  3LXT A;  1SD8 A;  5B6N A;  1GSF A;  2M46 A;  5DCH A;  3FZ5 A;  3F9U A;  4WR5 A;  1KBN A;  1EV9 A;  5AIX A;  5J41 A;  3DVX A;  3EC3 A;  1XWA A;  4Z2U A;  4G01 A;  4HQZ A;  1GTI A;  1SJZ A;  4K7I A;  3FW2 A;  2F8A A;  4Z2T A;  3D4M A;  4HJ2 A;  2B1L A;  1EEJ A;  2JSY A;  5CYY A;  2RUE A;  4KSM A;  3ZMK A;  4WBR D;  4YKG A;  1X9W B;  2WRT A;  1ZOF A;  4L0W A;  4MAB A;  5A4U A;  2R0P A;  4WR4 A;  5D9X A;  2E7P A;  4ML1 A;  3BCK A;  4KB3 A;  2LTK A;  4LL4 B;  5BMU A;  3CSI A;  2YWI A;  2FNO A;  3TJJ A;  1GSS A;  5A1N B;  3IOS A;  4EVM A;  2XC2 A;  1QFN A;  3L78 A;  4IHU A;  9GSS A;  2OT3 A;  2XBQ A;  2F8F A;  1Z6N A;  2VCQ A;  3IR4 A;  4ML6 A;  3K8N A;  1QXH A;  2H30 A;  5G2Z A;  2CVD A;  2B6M A;  4TRX A;  1XW9 A;  3GA4 A;  2TRC P;  5F06 A;  3UMA A;  2GZY A;  1MDI A;  2I81 A;  2FHE A;  2C0G A;  5J9B A;  1V40 A;  2L4C A;  3UL3 A;  5ECL B;  2MMZ A;  4H86 A;  3C8E A;  2AUV A;  1ABA A;  3FZ4 A;  1B9Y C;  4OFM A;  5JWO B;  2KHP A;  3VWU A;  3EU4 A;  1A8Y A;  5AN1 A;  3WYW A;  1GLP A;  4ZBD A;  5ECQ B;  3ME7 A;  4O32 A;  4V2M A;  4MZB A;  4TR1 A;  5ENU A;  4CW9 A;  2YP6 A;  1G0T A;  2YWM A;  5IMV A;  1G6Y A;  1PSQ A;  2H1L A;  4E8E A;  2PN8 A;  1O8X A;  3IA1 A;  4TVE A;  3J7Y k;  2HRK A;  5EY6 A;  1T8E B;  1EWX A;  3W6G A;  1R5P A;  5CO3 A;  2E0Q A;  2J9H A;  1N8J A;  2PER A;  1V98 A;  4AGS A;  2TRX A;  5CRD A;  2A4H A;  1S3A A;  4MH2 A;  1QUW A;  2IJY A;  2MMN A;  1WMJ A;  4K2X A;  2WS2 A;  1HYU A;  4PTS A;  4ZBB A;  2YV9 A;  2MBS A;  3HDC A;  2DJ0 A;  1X9S B;  4BWS A;  5BRT A;  1SU9 A;  5IMC A;  5J4U A;  2L6C A;  6GSX A;  2JSZ A;  4BPY A;  5FHI A;  1N2A A;  2LRC A;  2CVB A;  4G19 A;  4HI7 A;  1XXU A;  2LS5 A;  2PU9 C;  1JHB A;  3CSJ A;  3A5I A;  3QDN A;  3GNJ A;  4X1U A;  2AHE A;  3KTL A;  4EL1 A;  3KGK A;  4YKF A;  1A24 A;  4YAP A;  1K3L A;  2CQ9 A;  2XBI A;  3PH9 A;  4XS1 A;  4Z2R A;  3CTF A;  3QR6 A;  2X99 A;  2DJK A;  3NIV A;  2JZS A;  3UBL A;  1DE1 A;  1X5E A;  5G1K A;  2CX3 A;  2FY6 A;  4DSS B;  4ECC A;  4PQ1 A;  1BED A;  3TKQ A;  3G7Y A;  3IRA A;  3FRC A;  3E3E A;  2OE3 A;  2PMT A;  5C04 A;  5IMF A;  3ZIJ A;  3C7M A;  3H8Q A;  1M9B A;  4ZB6 A;  2ON5 A;  5CRW A;  5ECK B;  4YAV A;  2H19 A;  2O5V A;  3Q74 A;  3UEM A;  3TOU A;  4MJB A;  4Z7X A;  3M8N A;  4KAE A;  2CA8 A;  1A2M A;  4AJ8 A;  1AIU A;  1K0D A;  4PX1 A;  3US3 A;  5IM9 A;  4K0N A;  5CP1 A;  1T3B A;  4IQA A;  1TDI A;  1XWG A;  3KTB A;  2HSM B;  3IC8 A;  3FR6 A;  5AIS A;  1EOG A;  1M0U A;  5A5H B;  2L59 A;  4GXZ A;  5IO2 A;  1GP1 A;  1GH2 A;  2G0F A;  3KZQ A;  4E68 A;  1AUC A;  5DAK B;  7GSS A;  4MCU A;  3H1N A;  3VI5 A;  1AQX A;  2LUS A;  2X4A A;  4AKX B;  1ERU A;  5KN3 A;  1NSW A;  4K5S A;  3O3T A;  2REM A;  2HQT A;  1S3D A;  1AXD A;  2LRN A;  1GWC A;  4DEJ A;  3FY7 A;  1Z7R A;  1GSD A;  4XRD A;  4KX4 A;  2FA8 A;  3AY8 A;  2VL3 A;  5E59 A;  5C00 A;  3JCM L;  5IO0 A;  4AI6 A;  3CRU A;  5HR1 A;  1NHO A;  5DJL A;  2LQO A;  4IJ3 A;  3BD2 A;  3HVX A;  4MP4 A;  1JZW A;  3GTU B;  3LFL A;  3FYG A;  4PGT A;  3E9J B;  1OC8 A;  1GTB A;  1TP9 A;  4DSR A;  4NPB A;  2HZE B;  1MTC A;  2VCZ A;  1K0A A;  3F3Q A;  2WGR A;  3WGD A;  4WKW A;  2FWF A;  5ELA A;  4ZB7 A;  2EFC A;  3F6D A;  3RPN A;  1XZO A;  2XPE A;  3HJO A;  5IMA A;  3WGX A;  1F37 A;  3GKX A;  4KH7 A;  1TU7 A;  1Y25 A;  2HRA A;  4HS1 A;  4K6X A;  3HD5 A;  1A2J A;  1A0R P;  2X64 A;  3F8U A;  3EU3 A;  4W66 A;  4K0G A;  2JAD A;  1YDK A;  3RBT A;  5KN2 A;  2H0I A;  4ZIL A;  4FYU A;  18GS A;  2CAQ A;  4WF5 A;  1YF1 A;  5AGY A;  3UBK A;  3IK7 A;  5A4V A;  4ZBA A;  3O76 A;  5B7C A;  2A2R A;  1Q98 A;  1XW6 A;  3DEX A;  2R3X A;  1ACV A;  3C71 A;  4K2D A;  2L57 A;  1JFU A;  2VOC A;  2GQL A;  1TXX A;  5D73 A;  3L9V A;  1W4V A;  4GST A;  1OKT A;  3IAM 2;  1I5G A;  1GUK A;  4ULX A;  4LMW A;  2IFQ B;  2TIR A;  5L71 A;  2GGT A;  2H75 A;  1YKC A;  2OAC A;  2O89 A;  2QA2 A;  2HRF A;  1H75 A;  3C1S A;  2VLU A;  1XFL A;  5ECI B;  4BA7 A;  1XVQ A;  2DBC A;  4I2T A;  4QL7 A;  3UJ1 A;  5EVO A;  2IN3 A;  4WBJ A;  1ERT A;  1XPV A;  5CRG A;  1V9W A;  5DBQ A;  2L5O A;  4OO4 A;  2VD1 A;  1R4W A;  1KTE A;  3TKS A;  3ED3 A;  1ZYN A;  4K7O A;  5IMZ A;  4KW6 A;  2AB6 A;  2CZ2 A;  2AYT A;  1AAZ A;  2VCT A;  2ZCT A;  2LQQ A;  3D22 A;  4X0X A;  3D5J A;  2PBJ A;  3CBU A;  2EFE A;  3HCZ A;  4GQF A;  3IK9 A;  1WRY A;  3TKR A;  5ECS A;  2H70 A;  1JZO A;  4POB A;  2VCV A;  2H66 A;  2LST A;  3SWL A;  5CRH A;  4MF7 A;  4IS0 A;  1A2L A;  4G10 A;  1Z6M A;  1SVO A;  3G9B A;  3VWV A;  3ERG A;  3HVS A;  3QD9 A;  3O6T A;  3IAS 2;  3H4K A;  3M9K A;  1T00 A;  2H8L A;  19GS A;  5J47 A;  2B7J A;  3HA9 A;  1MD3 A;  3R3E A;  2F9S A;  5ECP B;  5KN1 A;  4MPF A;  3EMX A;  4AKH A;  1YVL A;  3UAP A;  1QMV A;  2CVK A;  4IBP A;  4NXI A;  4ZB8 A;  4OWY A;  4ACS A;  3UVT A;  3D6I A;  1WPI A;  2D2Z A;  1R7H A;  4MJE A;  1OC3 A;  5JWR B;  4POL A;  4KDU A;  2RM5 A;  6GST A;  2KOK A;  1THX A;  1TRS A;  1PL1 A;  4F0C A;  2JZR A;  2L4Q A;  1F3B A;  4N30 A;  2MYG A;  4N0V A;  4DSS A;  4HEA 2;  1DBY A;  3QFA C;  1TU8 A;  1WOU A;  1E2Y A;  2IMD A;  2GT5 A;  3CSH A;  6GSV A;  2Z9S A;  3QAV A;  4J56 E;  1GUM A;  1BYE A;  5CAX A;  4XHM A;  3TKP A;  5IPH A;  5J40 A;  3A2X A;  1DUG A;  2MMA A;  3OR5 A;  1X5C A;  4EIP A;  1M7T A;  3N5O A;  4HQS A;  2PGT A;  1UVZ A;  4KUN A;  3MWH A;  1FW1 A;  2JL4 A;  2GQM A;  3DGQ A;  4MJA A;  4TN8 A;  2HSM A;  1OE7 A;  3TRP A;  1S3C A;  2NBS A;  4RQX A;  1RQM A;  5A5H A;  4TXV A;  1ZCP A;  2P5R A;  5DAK A;  3FZA A;  1FHE A;  3KH7 A;  2DKI A;  2UZ8 A;  3RPP A;  3DML A;  2EIQ A;  5LD0 A;  1Z3E A;  2R6K A;  3GL5 A;  2PVO C;  2H1B A;  4TW5 A;  5D8I A;  1I9D A;  2FWG A;  1O85 A;  4OFT A;  1C72 A;  2H74 A;  2R2J A;  2RM6 A;  3U5R E;  4EE0 A;  3GKN A;  1U88 A;  2L6D A;  2VLV A;  2B5X A;  11GS A;  1THO A;  5DQS A;  4F0B A;  1PD2 1;  1O6J A;  2WFC A;  5COH A;  3IHQ A;  4E8H A;  2HRN A;  1V57 A;  2M72 A;  3M9J A;  1M2A A;  1EOH A;  3GTU A;  1F6M C;  4TR0 A;  12GS A;  4MZC A;  1NW2 A;  3BBY A;  4EKZ A;  2O8V B;  1JZR A;  3EE2 A;  4EO3 A;  4FIW A;  1PX7 A;  4V1A p;  1FG4 A;  4XS6 A;  6GSU A;  1EP7 A;  3DRN A;  2G2Q A;  2ES7 A;  1IYH A;  5J4Y A;  3TJG A;  3MSZ A;  4KND A;  3VWW A;  1XWC A;  2EFD A;  1ILO A;  8GSS A;  1ZYP A;  3GRX A;  1K0C A;  3A2W A;  1OVN A;  4LA1 A;  1SVM A;  3D21 A;  4IQ1 A;  3KMO A;  2DIY A;  5JCW A;  4NHW A;  2MBT A;  5H5S A;  3ZVJ A;  2HFD A;  1BX9 A;  1TXU A;  1H4O A;  1GL8 A;  2I1U A;  4X4J A;  2FGX A;  3TKS E;  1YZX A;  4BVX B;  2RUF A;  4GRF A;  1RK4 A;  5GSS A;  2VL2 A;  2H1G A;  2YZH A;  3TKS C;  2NPB A;  3ZFB A;  4DSQ A;  2LNS A;  1PMT A;  4LLR A;  2V6O A;  1T7P B;  5ID2 B;  1AQW A;  3VI7 A;  1V58 A;  4PQH A;  1FVK A;  5A34 B;  1SK0 A;  3LQ7 A;  3F4R A;  3CMI A;  4TR3 A;  3KH9 A;  2OBK A;  2V32 A;  1ML6 A;  3GKK A;  2OE0 A;  3WT1 A;  5HFK A;  4QL9 A;  2C1Y A;  1WWJ A;  3TUE A;  1B4Q A;  2EIO A;  4AKI A;  4IN0 A;  4RI6 A;  3FMW A;  4TKY A;  4N0Z A;  1MEK A;  5J9C A;  1VF4 A;  1GRX A;  4KSO A;  5GZZ B;  2N5A A;  2PVQ A;  3W8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...