1M99A

Crystal structure of the 26 kda glutathione s-transferase from schistosoma japonicum complexed with glutathione sulfonic acid
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
216
Chain Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-Transferase 26kDa
publication title Characterization of the electrophile binding site and substrate binding mode of the 26-kDa glutathione S-transferase from Schistosoma japonicum
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 71
structure length 216
sequence length 216
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1m99A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1m99A01
5IMZA 3CRTA 2OACA 1TU7A 3QAVA 1EEMA 2B7KA 2PUKC 2ZUPA 5B6MA 2PBJA 2CT6A 4PUFC 1XW6A 1DE2A 1PL2A 3VI7A 2OBIA 1FB6A 3CTGA 5JCUA 2LQOA 17GSA 3D0ZA 1A2JA 3D4MA 2P5QA 2V32A 5ECSA 1GSSA 1DUGA 3ZMKA 1F37A 3TJGA 3EC3A 1HNBA 3L4NA 3IAM2 3QAWA 2E2MA 3HJOA 2JZRA 1XBSA 14GSA 2YANA 5ECKB 1SD9A 3PPUA 1PMTA 1XVQA 4PNFA 3DVXA 1ERUA 1IYIA 4TR0A 5D8IA 1ZGNA 3ZFLA 4H86A 3GL5A 4POMA 2E7PA 4F9ZA 3TGZA 2NDOA 2RM6A 3E0UA 4EKZA 4JZQA 3WT1A 5AIXA 3O76A 5D93A 4EE0A 4ULXA 1FVJA 5JCWA 3TRQA 5ECIB 3G7JA 4YQMA 2H6XA 5F07A 4IBPA 4L5OA 2PU9C 1B8XA 1QUWA 5J5NA 3KIJA 1C72A 3A2XA 3FHKA 4I6XA 1OKDA 2IMFA 1NHYA 5ECNB 1YDKA 5ECHB 1SK1A 4MF7A 1K3LA 4IW9A 2FHEA 3R2QA 3TKPA 5L71A 3GTUA 1EGOA 1ABAA 3RPPA 4XS1A 2VL3A 4G2EA 4F03A 1PRXA 4N10A 1XW9A 5IMFA 2L5OA 3GUSA 2CV4A 1PD21 1WE0A 4HU9A 3SBCA 4PXOA 4BA7A 1A0RP 3D4TA 1O6JA 1Y25A 2WDUA 4K0GA 3UMAA 3MDKA 4GCIA 1F3AA 2TIRA 3GKMA 2A2RA 6GSXA 1XZOA 3F0IA 5JWQB 2ZCTA 5D96A 3ZRDA 2ON5A 9GSSA 3WD6A 1I5GA 4EDZA 4DVCA 1TOFA 2M80A 2HE3A 5F8BA 1SK2A 4TRXA 5CRWA 4I8BA 2B7JA 1XWCA 1M2AA 2H1AA 1SL0B 1PX7A 3WYWA 1FAAA 2XPDA 4MF6A 1A0FA 3BJ5A 2MMZA 4OO4A 3ERWA 1UVZA 2YP6A 1LBKA 1GUHA 2DMMA 5IPHA 6GSTA 2GS3A 2GT5A 1FG4A 12GSA 2MMOA 1K0MA 3FYGA 1TKDB 3R3EA 11GSA 2C3NA 4MJBA 1W4VA 4YQUA 4BVYB 2FUG2 2JL4A 2MBTA 3C7MA 1RW1A 2LSTA 4MZWA 5ELAA 4G0KA 3GH9A 2H19A 2AAWA 4TR1B 4BWQA 2A4VA 1XFLA 2HRKA 3UL3A 2OKAA 3F4SA 2I3YA 1EEJA 3CBUA 2ON7A 3LG6A 2RUFA 2DJ1A 4MDCA 1URMA 2H8LA 2FNOA 1GSEA 5G5FA 5GSTA 3RHCA 4TW5A 1GSFA 3NOFA 4IJIA 2VL9A 3GH6A 1YKAA 2VCQA 1U87A 4DSRA 3F63A 1QMVA 4PURA 2OE0A 2E2GA 1MDIA 5GSSA 1OC9B 4OCFA 2R37A 2RM5A 3TKSC 2AV4A 2PVOC 1GL8A 3IC4A 1GTIA 3BCIA 4X43A 2P0GA 1AQVA 2QGVA 2VCZA 2H70A 2C3QA 4D73A 1JZOA 1G6WA 3GRXA 1M2DA 4GQFA 4NXIA 3H93A 5CRDA 4E8EA 4GWRA 4MLYA 4O92A 5G2ZA 4EO3A 2GQMA 1PN9A 2IL3A 2C0FA 2LKUA 2X64A 2CX4A 5AN1A 1GP1A 3O6TA 5IO2A 1Z3EA 2F8AA 1WJKA 3KJYA 2IFQA 2WCIA 1K0DA 3LSZA 2VCVA 1ZCPA 4WKWA 3E9JB 4NHWA 3UVTA 3ZFBA 5J9CA 1Z6NA 4KGIA 5HFIA 4ZL9A 4EL1A 5ECLB 2BJXA 3HY2A 3U5RE 3QAGA 5B8AA 3KD0A 3C8EA 1K3OA 1SJIA 1GLQA 5HQPA 1XWGA 4KAEA 2OE1A 2R3XA 2AYTA 3TKRA 3FEUA 5D9WA 1R4WA 3CSIA 3KH9A 1AAZA 1V9WA 2DSAA 5LCZA 4RQXA 3HYPA 2H66A 3QDNA 1Q98A 3VURA 1THXA 2YN1A 4O7HA 2HI7A 4GSTA 3VPQA 2DJ3A 3TJJA 1V58A 5GAPD 3UIWA 4ZXGA 2UZ8A 2B1LA 1XIYA 22GSA 4TVEA 1B4PA 3VPTA 2FWEA 1YEXA 1KBNA 1ZOFA 4KH7A 1N8JA 3DGQA 1TTZA 4XTSA 1EOHA 5H5RA 4OFMA 4K6XA 1LU4A 4GRFA 4GXZA 2OA7A 2CVKA 5F05A 3EU3A 4ECJA 1T8EB 1X0RA 2JZSA 2VM2A 4XIHA 3FZAA 3ZVJA 3TJFA 5FT3A 4MJAA 2IWTA 2NTOA 5G1LA 3KMNA 3ZIVA 3TKQA 4I97A 3LXZA 3BD2A 2KUCA 3GIXA 4IQ1A 3IRAA 4HOJA 1XOBA 2RIIA 2B3SA 4F0BA 1XOAA 4KDYA 1E2YA 3Q18A 2H6YA 2YZHA 2HLSA 3EWLA 3DRNA 4KE3A 1WMJA 3A5WA 1EP8A 5B8BA 3TUEA 1GNWA 1K0BA 4HEA2 3WGXA 3ED3A 3MSZA 4HJMA 1U6TA 4DSSA 4ECBA 2L6CA 5G5EA 3HZ4A 4MABA 3GTUB 1FOVA 3N9JA 6GSVA 1BEDA 2VCWA 2D2ZA 3G9BA 3IDVA 5DAKA 1M9BA 1M99A 4NAXA 2BMXA 1PL1A 1Z7RA 3IBHA 1GWCA 2ALBA 1AC1A 4V2MA 4F82A 1FO5A 4ZILA 4MPFA 2AUVA 2P31A 3FRCA 1JZWA 1H75A 4IGJA 4EUYA 1AUCA 3ME7A 4XS6A 3RAZA 4ZBAA 2OADA 5IPGA 3J7Yb 2O7KA 1M7TA 1OAZA 1MDJA 2GT6A 4L8EA 3TCOA 16GSA 4BVXA 2K9FA 4JE1A 3BBYA 4YH2A 3EMPA 3H79A 3DKSA 4K2DA 4KB3A 1SJ6A 2EC4A 2HSHA 2DC5A 2JADA 3GKNA 3LGCA 1SL2B 1T3BA 3O3TA 1GH2A 2HT9A 2IN3A 1XCCA 4QQ7A 3APSA 1U3AA 1YZXA 3VWXA 2HNLA 4AGSA 4MMMA 3TDGA 4PTSA 3VWUA 2OBKA 2VO4A 1EZKA 3ZLPA 1A2LA 2G0FA 1R5AA 2JU5A 3A3TA 2HRKB 3ISOA 2EIRA 4GSSA 4NV2A 2XBQA 4KSMA 2F9SA 2N5AA 2VCTA 5HR3A 2GQLA 3QFBC 3L78A 2C3TA 4PNGA 2C8UA 2IJYA 3FZ4A 3KZQA 1GSYA 2I81A 5E59A 4HQSA 5BMUA 3IE3A 1T00A 2VLTA 4OFTA 2DJ0A 1YF0A 3L9VA 2V6KA 2YV7A 2HRFA 2ES7A 2FCHA 3HVXA 1G6YA 3KM6A 1GTBA 4RI6A 4O32A 1SYXA 4CDOA 3QD9A 5A5KA 2CQ9A 1PGTA 3HD5A 1GSQA 4D73B 5CNWA 5D9VA 5KN3A 2LTKA 5DCGA 3GKKA 4V1Ag 2FWHA 4I2TA 1U88A 2LRTA 5CREA 2X99A 3GURA 3GN3A 1T4YA 2IPAA 4POLA 2RUEA 3UJ1A 3DMLA 5D73A 5EPFA 4FH8A 4MJCA 4G9HA 2B6MA 2H0HA 3IK7A 2DMLA 1XW5A 2IFQB 3TRXA 2XHFA 3CYNA 5GAND 1T1VA 4ZB9A 2DBCA 4TXOA 4ISDA 1BQ7A 1PQNA 3NIVA 1EOGA 2GVPA 1U3IA 4GTUA 2O8VB 1AW9A 2B1KA 3APQA 4NHZA 2OJLA 4O5RA 3C1SA 2N5BA 2E0QA 2H1GA 3JCML 4JU5A 5EY6A 3HZ8A 3FW2A 2LV3A 4POKA 3CTFA 1F6MC 6GSYA 3IXRA 2VCXA 3PGTA 4FIWA 4XRAA 3V1WA 5IMVA 1TP9A 5DBQA 2LJKA 3EYTA 3PINA 1BJXA 2AHEA 3M3MA 2J23A 3ZTLA 5DJLA 4IVFA 3C1RA 4ZL8A 1XXUA 2HSNB 3VWWA 3DWVA 1GRXA 1GTUA 1X9WB 4IKHA 3F4RA 4FO5A 3FK8A 3ZYWA 4GLTA 2HSYA 4ZB6A 4XCSA 5CRGA 1J0FA 3LJRA 4J56E 3APOA 4MP4A 3KMOA 3UBKA 4HDEA 1R5PA 3A2VA 2GLRA 2WULA 4N30A 1YEPA 4GF0A 4OFNA 4AJ7A 5DJMA 5COHA 3C73A 3L9SA 2WGRA 3IAS2 2L6DA 2VD0A 2CA8A 1MEKA 2VIMA 2MMNA 5ID2A 2N5FA 2OE3A 2KOKA 2KP1A 2GGTA 4G0IA 1BX9A 4EDYA 3ZITA 1V57A 2FY6A 4Q5FA 4IS0A 2HRNA 3HKRA 3IPZA 4DSSB 1O8XA 2XC2A 1FB0A 3IOSA 1CQGA 3CRUA 3BOAA 3IK9A 2C4JA 1NHOA 1TJDA 2CX3A 2K8VA 4MJEA 1KEBA 2JSZA 2H1DA 3G7IA 1K0CA 1TK5B 1GSDA 2LNTA 4L5LA 5DAKB 4FYUA 1F3BA 3FZ9A 3LORA 3ZIJA 2C0EA 4NMUA 2CZ3A 3EVIA 4F0CA 1A23A 4GSNA 4QL9A 1SK0A 4IJ3A 4G0LA 4I2UA 4MCUA 5A4UA 1XWAA 1JZDA 5H5SA 5ECQB 10GSA 3H8QA 3WT2A 5J3RA 2R2JA 5CP1A 2V2GA 2WJUA 1OVNA 2TRCP 1EGRA 1JLWA 4OCEA 5JWRB 2A2SA 4HI7A 3ME8A 5ECOB 3UEMA 4FYCA 1WWJA 4WF5A 5IQYA 3F3RA 1JHBA 2KP2A 4BVXB 1O85A 2VLUA 2C80A 2M72A 5FWGA 2XPEA 3TRPA 2JSYA 3MNGA 1MTCA 4LL1B 2FGXA 2H75A 4CHSA 2LEGA 4K9ZA 2L4QA 3KGKA 4FQUA 3I69A 3FR9A 2MMAA 2K18A 5B6NA 1JLVA 2VAFA 1H4OA 3W8SA 3DXBA 2PWJA 3D6IA 3HVSA 4BL7A 4WR4A 2FA8A 1ST9A 4ID0A 2AJQB 1EV9A 4RI7A 3TOTA 2MYGA 3EURA 3VFIA 3EINA 2GZZA 1GUKA 2LQQA 2I1UA 1E6BA 2HXKA 2WS2A 3M0FA 1LJRA 1V98A 3DVWA 4Z7XA 4XS4A 4AF2A 5IMDA 1S3DA 1M2BA 1J08A 2YOIA 1TW9A 1VF2A 5H5QA 2TRXA 2KLXA 1FHEA 1M0UA 1QK8A 5ECPB 5JWOB 2R4VA 1MD4A 3PH9A 4ACSA 3EU4A 5AGYA 3FR3A 4WF4A 5CAXA 4J57E 2MZCA 3HJMA 2H73A 4I5QA 2ZNMA 5FHIA 4KDUA 5LD0A 1VF3A 3GMFA 4K7OA 3RPNA 6GSUA 1SJZA 4IP1A 4EXJA 1HYUA 1PSQA 4DSQA 5DALA 1X5CA 2L5LA 1JFUA 1O73A 4POBA 3E3EA 2YJHA 5LNKe 3CMIA 1GNEA 2DJ2A 5C00A 2J9HA 2VL2A 3IC8A 3KP9A 2IMEA 2V1MA 5CYYA 4ZBDA 1S3CA 2LUSA 4LA1A 3PR8A 2HYXA 1SKSB 5IO0A 2VL2C 2P5RA 2JZTA 1USBA 4JR6A 2M46A 3H1NA 2HSMA 1WP0A 2LNSA 5IMAA 5KN0A 3P7XA 1X5EA 4TXOB 3DEXA 3KCMA 4JR4A 3FY7A 1ZMAA 4MF5A 2LS5A 3KP8A 2O87A 1ZYEA 4RUVA 4X0XA 5A4WA 4XRDA 4TN8A 3LXTA 4G10A 3TJKA 4AJ8A 3HVVA 4IP6A 5KN1A 2HZEA 1OC8A 5G30A 3H4KA 1XPVA 5HR0A 1M9AA 2H6ZA 1Q4JA 2H0GA 4PGTA 2YZUA 3LYPA 3RDWA 4K7IA 1V40A 3G7YA 2DJKA 4ILFA 3M1GA 1OC3A 1Z9HA 3VI5A 2H30A 2YCDA 2KHPA 4MH2A 2DIYA 2WRTA 1NW2A 4HZ2A 3LEFA 3GA4A 3QPMA 3QFAC 2IMDA 3UAPA 1SYRA 3F9UA 1AQXA 4PQHA 5G1KA 1V2AA 3QMXA 3UOMA 4L0WA 3M8NA 4NPBA 5ECMB 3VK9A 2FWGA 3DIEA 4X1UA 4IQAA 5ECRB 2VOCA 4KCAA 2WZ9A 4BWSA 1DE1A 4KUNA 3HXSA 3KH7A 2BTOT 1T4ZA 2F8FA 3KTBA 1W89A 1F2EA 2NBSA 3FZ5A 4HQZA 2DLXA 2H1BA 5ID2B 4EC0A 1TK8B 1DSBA 1UC7A 5E4WA 4PX1A 3KEBA 4HUAA 4ECCA 3FKFA 4KDXA 1TRVA 2HFDA 2RLIA 1Z5YE 3SWLA 1A8YA 1ML6A 3GFKA 2YWNA 2GTUA 3ZL5A 1QQ2A 4N0ZA 3GYKA 5J41A 2L4CA 4DEJA 2NVLA 2VUPA 3P8WA 5IM9A 4JEDA 5AIVA 1RQMA 2EIOA 4YQVA 4PUAA 2YWOA 4KCEA 3QOUA 3GSSA 1WPIA 5EVOA 3HJPA 1S3AA 1MD3A 3HCZA 4YAVA 2O85A 1SKWB 2H72A 4MPGA 1GLPA 3GNJA 3HA9A 4G19A 3QCPA 2H71A 3VWVA 5IOXA 2C0GA 3US3A 4J2FA 5ENUA 5HR1A 1G7OA 1GULA 3A2WA 1NSWA 4Q5NA 1R26A 2L57A 4RQRA 4WETA 1FVKA 5ELGA 1ON4A 3TB2A 1UN2A 4L0UA 3ZMLA 1VGLA 5HR2A 5KN2A 3EMXA 3HHVA 3W8JA 4LL4B 5HFGA 6GSSA 1GSUA 1I9DA 2PMTA 4N11A 4WBJA 4TR3A 4MA9A 2WB9A 2LJRA 1XVWA 3RHBA 1JZRA 1YQ1A 3J7Yk 8GSSA 2PN8A 1X5DA 1B9XC 2YWIA 3DD3A 2H0IA 1ERVA 1BG5A 3Q19A 4BL7B 2C1YA 2PPTA 2GSTA 4EVMA 3P90A 1MDKA 3GL3A 5IOWA 4HJ2A 5J9BA 3CSHA 4ECIA 3C71A 2VLVA 3I43A 1XWKA 3CSJA 3OR5A 1X9MB 4ZBBA 4TKYA 2DJJA 2HQTA 1PKZA 4XS4B 3UVHA 2PGTA 3K8NA 4WBRD 2F51A 3GKXA 1THOA 1TI1A 3IV4A 4ZIJA 4K1FA 2GSQA 1Z7PA 5CRHA 3LQ7A 2GDRA 1OYJA 4KF9A 3D5JA 3AY8A 4MH3A 1OE8A 5DVBA 4QL7A 3ZVJD 4JRRA 13GSA 2I4AA 4ZL7A 4YAPA 2FWFA 4V1Ap 2CAIA 2MBSA 1GTAA 3GX0A 1EV4A 1EP7A 1A24A 3GV1A 5DALB 5INYA 5A4VA 1SKRB 2QKEA 1R7HA 4KA0A 4Q5QA 1YY7A 4LMWA 4BPYA 3TKSA 3UBLA 2YWMA 1O7UA 4KNDA 1Y6EA 3F6DA 3TJBA 3U6VA 2IMKA 2GZPA 4CW9A 2H74A 3N5OA 1OKTA 2QSIA 5GZZB 2X8GA 2I9HA 3D22A 1TK0B 5F06A 1PX6A 3GX8A 3LYKA 5DQSA 4OWYA 1ERWA 2HSMB 3ERGA 1B9YC 2B5EA 2EIQA 1QFNA 3GSTA 3MWHA 5B7CA 1KNGA 1VF4A 5HFKA 1AIUA 4OD7A 1O81A 4OO5A 4IN0A 1AXDA 1K0OA 2B5XA 2FLSA 2L59A 1WRYA 1RK4A 4K7NA 1ILOA 2Z9SA 2AB6A 5JCGA 1HNAA 1HQOA 1OE7A 1HD2A 1GUMA 5C04A 2HZEB 1F9MA 3GHAA 1BAYA 4IELA 2PERA 2IMIA 3QR6A 2LJAA 3S9FA 1VF1A 4Q5RA 2CVBA 3TOUA 5AISA 2K8SA 3DYRA 2X8CA 1ACVA 5D9XA 5G31A 2VD1A 1BYEA 1TU8A 1PKWA 1O8WA 3I9V2 2H01A 3EE2A 2F3MA 1SL1B 2YJ7A 3KTLA 1T7PB 2CVDA 1EWXA 4WR5A 1Z6MA 2YV9A 3TKSE 3M9JA 3WGEA 6GSWA 3W6GA 3KXOA 4NWYA 3CXGA 3ZZXA 4K8MA 1XWBA 5EL8A 20GSA 5KEJA 4MZBA 1B48A 1SD8A 1QGVA 5D9TA 2R5GA 4HZ4A 1VRSD 2B5YA 5ABRA 1WIKA 1YF1A 1NM3A 4PQIA 5J4UA 3F8UA 4WXTA 3LWAA 2DIZA 3F6FA 4OMVA 4LLRA 2C0DA 4BVYA 2H76A 1ZL9A 4E8HA 2WFCA 3VLNA 3IR4A 3RBTA 1CQHA 5IIZA 3F4TA 3IHQA 1X9SB 4ML1A 1WOUA 3IA1A 4EF0A 4TR1A 1K0NA 2HRAA 2FA4A 19GSA 4V2LA 3ZREA 2REMA 4LMVA 1K3YA 2GSRA 2G2QA 3NZNA 7GSSA 1DBYA 4K0NA 3MAKA 4KX4A 4HU7A 1SENA 4F2IA 1TRSA 1TDIA 3I6AA 1G0TA 2HZFA 3L9UA 4V2NA 2LRCA 4ZB8A 1QXHA 1TXXA 1TRUA 1K0AA 2PVQA 3BCKA 3HDCA 4PQ1A 1OC9A 3ERFA 2K6VA 4GQCA 18GSA 3FR6A 5CO3A 1AQWA 1IYHA 1N2AA 4FYBA 4TOPA 1HNCA 4KW6A 4JBBA 1A2MA 3L0HA 1A8LA 2IIYA 3D21A 5F0GA 4AJ6A 1ZYQB 3M9KA 1SU9A 1B4QA 1UA5A 3UARA 3Q74A 2JACA 1ERTA 4USSA 2XBIA 2FD3A 3WGDA 5IMCA 4ML6A 4KSOA 2CZ2A 4WEYA 2QC7A 2O89A 1G7EA 5DCHA 1PA3A 3P2AA 2CAQA 2GSSA 2YNXA 4NV5A 4IHUA 2LRNA 2GQKA 3Q6OA 1KTEA 4TR4A 4N0VA 1FW1A 2VM1A 2X8HA 1TI3A 2GZYA 1YKCA 1YJ6A 4P3YB 5DDLA 2R6KA 4TXVA 2V41A 3F3QA 4XHMA 4HS1A 4MZCA 4MK3A 5DQYA 2NPBA 3LFLA 1ZZYA 2YPMA 1TRWA 1J9BA 2V6OA
chains in the Genus database with same CATH superfamily
5IMZA 3CRTA 2OACA 1TU7A 3QAVA 1EEMA 4EIPA 2B7KA 2PUKC 2ZUPA 5B6MA 2PBJA 2CT6A 4PUFC 1XW6A 1DE2A 1PL2A 3VI7A 2OBIA 1FB6A 3CTGA 5JCUA 5BRTA 2EFDA 1XG8A 2LQOA 17GSA 3D0ZA 1A2JA 4Z2RA 3D4MA 2P5QA 2V32A 5ECSA 1GSSA 1DUGA 3ZMKA 1F37A 3TJGA 3EC3A 1HNBA 4HSCX 3L4NA 3IAM2 3QAWA 2E2MA 3HJOA 2JZRA 1XBSA 14GSA 2YANA 5ECKB 1SD9A 3PPUA 1PMTA 1XVQA 4PNFA 3DVXA 1ERUA 1IYIA 4TR0A 5D8IA 1ZGNA 3ZFLA 4H86A 3GL5A 4POMA 2E7PA 4F9ZA 3TGZA 2NDOA 2RM6A 3E0UA 4EKZA 2R0PA 4JZQA 3WT1A 5AIXA 3O76A 5D93A 4EE0A 4ULXA 1FVJA 5JCWA 3TRQA 5ECIB 3G7JA 4YQMA 2H6XA 5F07A 4IBPA 4L5OA 2PU9C 1B8XA 1QUWA 3FMWA 5J5NA 3KIJA 1C72A 3A2XA 3FHKA 4I6XA 1OKDA 2WVZA 2IMFA 1NHYA 5ECNB 1YDKA 5ECHB 1SK1A 4MF7A 1K3LA 4IW9A 2FHEA 3R2QA 3TKPA 5L71A 3GTUA 1EGOA 1ABAA 3RPPA 4XS1A 1ZYPA 2VL3A 4G2EA 4F03A 1PRXA 4N10A 1XW9A 5IMFA 2L5OA 3GUSA 2CV4A 1PD21 1WE0A 4HU9A 3SBCA 4PXOA 4BA7A 1A0RP 3D4TA 1O6JA 1Y25A 2WDUA 4K0GA 3UMAA 3MDKA 4GCIA 1F3AA 2TIRA 3GKMA 2A2RA 6GSXA 1XZOA 3F0IA 5JWQB 2ZCTA 5D96A 3ZRDA 2ON5A 9GSSA 3WD6A 1I5GA 4EDZA 4DVCA 1TOFA 2M80A 2HE3A 5F8BA 1SK2A 4TRXA 5CRWA 4I8BA 2B7JA 1XWCA 1M2AA 1YEWC 2H1AA 1SL0B 1PX7A 3WYWA 1FAAA 2XPDA 4MF6A 1A0FA 3BJ5A 2MMZA 4OO4A 3ERWA 1UVZA 2YP6A 1LBKA 1GUHA 2DMMA 5IPHA 6GSTA 5J47A 2GS3A 2GT5A 1FG4A 12GSA 2MMOA 1K0MA 3FYGA 1TKDB 3R3EA 11GSA 2C3NA 4MJBA 1W4VA 4YQUA 4BVYB 2FUG2 2JL4A 2MBTA 3C7MA 1RW1A 2LSTA 4MZWA 5ELAA 4G0KA 3GH9A 2H19A 2AAWA 4TR1B 4BWQA 2A4VA 1XFLA 2HRKA 3UL3A 2OKAA 3F4SA 2I3YA 1EEJA 3CBUA 2ON7A 3LG6A 2RUFA 2DJ1A 4MDCA 1URMA 2H8LA 2FNOA 1GSEA 5G5FA 5GSTA 3RHCA 4TW5A 1GSFA 3NOFA 4IJIA 2VL9A 3GH6A 1YKAA 2VCQA 1U87A 4DSRA 3F63A 5A1NB 1QMVA 4PURA 5A5HB 2OE0A 4AKHA 2E2GA 3MIXA 1MDIA 3RFRC 5GSSA 1OC9B 4OCFA 2R37A 2RM5A 3TKSC 2AV4A 2PVOC 1GL8A 3IC4A 1GTIA 3BCIA 4X43A 2P0GA 1AQVA 2QGVA 2VCZA 2H70A 2C3QA 4D73A 1JZOA 1G6WA 3GRXA 1M2DA 4GQFA 4NXIA 3H93A 5CRDA 4E8EA 4GWRA 4MLYA 4O92A 5G2ZA 4EO3A 2GQMA 1PN9A 2IL3A 2C0FA 2LKUA 2X64A 2CX4A 5AN1A 1GP1A 3O6TA 5IO2A 1Z3EA 2F8AA 1WJKA 3KJYA 2IFQA 2WCIA 1K0DA 3LSZA 2VCVA 1ZCPA 4WKWA 3E9JB 4NHWA 3UVTA 3ZFBA 5J9CA 1Z6NA 4KGIA 5HFIA 3MYDA 4ZL9A 4EL1A 5ECLB 2BJXA 3HY2A 3U5RE 3QAGA 5B8AA 3KD0A 3C8EA 1K3OA 1SJIA 1GLQA 5HQPA 1XWGA 4KAEA 2OE1A 2R3XA 2AYTA 3TKRA 3FEUA 5D9WA 1R4WA 3CSIA 3KH9A 1AAZA 1V9WA 2DSAA 4O5UA 5LCZA 4RQXA 1Y1UA 3HYPA 2H66A 1Q98A 3QDNA 3VURA 1THXA 2YN1A 4O7HA 2HI7A 4GSTA 3VPQA 2DJ3A 3TJJA 1V58A 5GAPD 3UIWA 4ZXGA 2UZ8A 2B1LA 1XIYA 22GSA 2A4HA 4TVEA 2HSNA 1B4PA 3VPTA 2FWEA 1YEXA 1KBNA 1ZOFA 4KH7A 1N8JA 3DGQA 1TTZA 4XTSA 1EOHA 5H5RA 4OFMA 4K6XA 1LU4A 4GRFA 4GXZA 2OA7A 2CVKA 5F05A 3EU3A 4ECJA 1T8EB 1X0RA 2JZSA 2VM2A 4XIHA 3FZAA 3ZVJA 3TJFA 5FT3A 4MJAA 2IWTA 2NTOA 5G1LA 3KMNA 3ZIVA 3TKQA 4I97A 3LXZA 3BD2A 2KUCA 3GIXA 4IQ1A 3IRAA 4HOJA 1XOBA 2RIIA 2B3SA 4F0BA 1XOAA 4A5PA 4KDYA 1E2YA 3Q18A 2H6YA 2YZHA 2HLSA 3EWLA 3DRNA 4KE3A 4W66A 1WMJA 3A5WA 1EP8A 5B8BA 3TUEA 1GNWA 1K0BA 4HEA2 3WGXA 2R0CA 3ED3A 3MSZA 4HJMA 1U6TA 4DSSA 4ECBA 2L6CA 5G5EA 1SVOA 3HZ4A 1M3IA 4MABA 4K2XA 3GTUB 1FOVA 3N9JA 6GSVA 1BEDA 2VCWA 2D2ZA 3G9BA 3IDVA 5DAKA 1M9BA 1M99A 4NAXA 2BMXA 1PL1A 1Z7RA 2DKIA 3IBHA 1GWCA 2ALBA 1AC1A 4V2MA 5J4VA 4F82A 1FO5A 4ZILA 4MPFA 2AUVA 2P31A 3FRCA 1JZWA 1H75A 4IGJA 4EUYA 1AUCA 3ME7A 4XS6A 3RAZA 4ZBAA 2OADA 5IPGA 3J7Yb 2O7KA 1M7TA 1OAZA 1MDJA 2GT6A 4L8EA 3TCOA 16GSA 4BVXA 2K9FA 4JE1A 2VKZG 3BBYA 4YH2A 3EMPA 3EPTA 3H79A 3DKSA 4K2DA 4KB3A 1SJ6A 2EC4A 2O5VA 2HSHA 2DC5A 2JADA 3GKNA 3LGCA 2QA1A 1SL2B 1T3BA 3O3TA 1GH2A 2HT9A 2IN3A 1XCCA 4QQ7A 3APSA 2WW2A 1U3AA 2X4AA 1YZXA 3VWXA 2HNLA 4AGSA 4MMMA 5A34A 3TDGA 4PTSA 3VWUA 2OBKA 2VO4A 1EZKA 1BG1A 3ZLPA 1A2LA 2G0FA 1R5AA 2JU5A 3A3TA 2HRKB 3ISOA 2EIRA 4GSSA 2EFHA 4NV2A 2XBQA 4KSMA 2F9SA 2N5AA 2A2PA 2VCTA 5HR3A 2GQLA 3QFBC 3L78A 2C3TA 4PNGA 2C8UA 2IJYA 3FZ4A 3KZQA 1GSYA 2I81A 1I1IP 5E59A 4HQSA 1FOHA 5BMUA 3LW9A 3IE3A 1T00A 4QMKA 2VLTA 4OFTA 2DJ0A 1YF0A 4BIKA 3L9VA 2V6KA 2YV7A 2HRFA 2ES7A 2FCHA 3HVXA 1G6YA 3KM6A 1GTBA 4RI6A 4O32A 1SYXA 4CDOA 3QD9A 5A5KA 2CQ9A 1PGTA 2WW3A 3HD5A 1GSQA 4D73B 5CNWA 2OT3A 5D9VA 5KN3A 2LTKA 5DCGA 3GKKA 4V1Ag 2FWHA 4I2TA 4AI6A 1U88A 2UV8G 2LRTA 5CREA 4CY8A 2X99A 3GURA 3GN3A 1T4YA 2IPAA 4POLA 2RUEA 3UJ1A 3DMLA 5D73A 5EPFA 4FH8A 4MJCA 4G9HA 2B6MA 2H0HA 3IK7A 2DMLA 1XW5A 2IFQB 3TRXA 2EFCA 2XHFA 3CYNA 5GAND 1T1VA 1N25A 4ZB9A 2DBCA 4TXOA 4ISDA 1BQ7A 1PQNA 3NIVA 1EOGA 2GVPA 1U3IA 4GTUA 2O8VB 1AW9A 2B1KA 3APQA 4PHZC 4NHZA 2OJLA 4O5RA 3C1SA 2N5BA 2E0QA 2H1GA 4AKIA 4E68A 4K5SA 3JCML 4JU5A 5EY6A 3HZ8A 3FW2A 2LV3A 4POKA 3CTFA 1F6MC 6GSYA 3IXRA 2VCXA 3PGTA 4FIWA 4XRAA 3V1WA 5IMVA 1TP9A 5DBQA 2LJKA 3EYTA 3PINA 1BJXA 2AHEA 3M3MA 2J23A 3ZTLA 5DJLA 4IVFA 3C1RA 4ZL8A 1XXUA 2HSNB 3VWWA 3DWVA 1GRXA 1GTUA 1X9WB 4IKHA 3F4RA 4FO5A 3FK8A 3ZYWA 4GLTA 2HSYA 4ZB6A 4XCSA 5CRGA 1J0FA 3LJRA 4J56E 3APOA 4MP4A 3KMOA 3UBKA 4HDEA 1R5PA 3A2VA 2GLRA 2WULA 4N30A 1YEPA 4GF0A 4OFNA 4AJ7A 5DJMA 5COHA 3C73A 3L9SA 2WGRA 3IAS2 2L6DA 2VD0A 2CA8A 1MEKA 1ZYNA 2VIMA 2MMNA 5ID2A 2O3EA 1TXUA 2N5FA 2OE3A 2KOKA 2KP1A 2GGTA 1BX9A 4G0IA 4EDYA 3ZITA 1V57A 2FY6A 4Q5FA 4FXYP 4IS0A 2HRNA 3HKRA 3IPZA 4DSSB 1O8XA 2XC2A 1FB0A 3IOSA 4EIQA 1CQGA 3CRUA 3BOAA 3IK9A 2C4JA 1NHOA 1TJDA 2CX3A 2K8VA 4MJEA 2WVYA 1KEBA 2JSZA 2H1DA 3G7IA 1K0CA 1TK5B 1GSDA 2LNTA 4L5LA 5DAKB 4FYUA 1F3BA 3FZ9A 3LORA 3ZIJA 2C0EA 4NMUA 2CZ3A 3EVIA 4F0CA 1A23A 3HMJG 4GSNA 4QL9A 1SK0A 4IJ3A 4G0LA 4I2UA 4MCUA 5A4UA 1XWAA 1JZDA 5H5SA 5ECQB 10GSA 3H8QA 3WT2A 2WVXA 5J3RA 2R2JA 5CP1A 2V2GA 4O5QA 2WJUA 1OVNA 2TRCP 1EGRA 1JLWA 4OCEA 5JWRB 2A2SA 4HI7A 3ME8A 5ECOB 3UEMA 4FYCA 1WWJA 4WF5A 5IQYA 3F3RA 3A5IA 1JHBA 2KP2A 4BVXB 1O85A 2VLUA 2C80A 5KOWA 2M72A 5FWGA 2XPEA 3TRPA 2JSYA 3MNGA 1MTCA 3CQFA 4LL1B 2FGXA 2H75A 4CHSA 2LEGA 4K9ZA 2L4QA 3KGKA 3I69A 4FQUA 3FR9A 2MMAA 2K18A 5B6NA 1JLVA 2VAFA 1H4OA 3W8SA 3DXBA 2PWJA 3D6IA 3HVSA 4BL7A 4WR4A 2FA8A 1ST9A 4ID0A 2AJQB 1EV9A 4RI7A 3TOTA 2MYGA 3EURA 5A34B 3VFIA 3EINA 2GZZA 1GUKA 2LQQA 2I1UA 1E6BA 4G01A 2HXKA 2WS2A 4ICYA 3M0FA 1LJRA 1V98A 3DVWA 4Z7XA 4XS4A 4AF2A 5IMDA 1S3DA 1M2BA 1J08A 2YOIA 1TW9A 1VF2A 5H5QA 2TRXA 2KLXA 1FHEA 1M0UA 3RGBC 1QK8A 5ECPB 5JWOB 2R4VA 1MD4A 3PH9A 4ACSA 3EU4A 5AGYA 3FR3A 4WF4A 4GDFA 5BMUB 5CAXA 4J57E 2MZCA 3HJMA 2H73A 4I5QA 2ZNMA 5FHIA 4KDUA 5LD0A 1VF3A 3GMFA 4K7OA 5J40A 3IHGA 3RPNA 6GSUA 1SJZA 4IP1A 4EXJA 1HYUA 1PSQA 4DSQA 5DALA 1X5CA 2L5LA 1JFUA 1O73A 4POBA 3E3EA 2YJHA 5LNKe 3CMIA 1GNEA 2DJ2A 5C00A 2J9HA 2VL2A 2WW1A 3IC8A 3KP9A 2IMEA 2V1MA 5CYYA 4ZBDA 1S3CA 2LUSA 4LA1A 3PR8A 2HYXA 1SKSB 5IO0A 2VL2C 2P5RA 2JZTA 1USBA 4JR6A 2M46A 3H1NA 2HSMA 1WP0A 2LNSA 5IMAA 5KN0A 3P7XA 1X5EA 4TXOB 3DEXA 3KCMA 4JR4A 3FY7A 1ZMAA 4MF5A 2LS5A 3KP8A 2O87A 1ZYEA 4RUVA 4X0XA 5A4WA 3CHXC 4XRDA 4TN8A 3LXTA 4G10A 3TJKA 4AJ8A 3HVVA 4IP6A 5KN1A 2HZEA 1OC8A 5G30A 3H4KA 1XPVA 5HR0A 1M9AA 2H6ZA 1Q4JA 2H0GA 4PGTA 2YZUA 3LYPA 3RDWA 4K7IA 1V40A 3G7YA 2DJKA 4ILFA 3M1GA 2R0GA 1OC3A 1Z9HA 3VI5A 2H30A 2YCDA 2KHPA 4MH2A 2DIYA 2WRTA 1NW2A 4HZ2A 3LEFA 3GA4A 3QPMA 3QFAC 2IMDA 3UAPA 1SYRA 3F9UA 1AQXA 4PQHA 5G1KA 1V2AA 3QMXA 3UOMA 4L0WA 3M8NA 4NPBA 5ECMB 3VK9A 2FWGA 3DIEA 4X1UA 4IQAA 5ECRB 2VOCA 4KCAA 2WZ9A 4BWSA 1DE1A 4KUNA 3HXSA 3KH7A 2BTOT 1T4ZA 2F8FA 3KTBA 1W89A 1F2EA 2NBSA 3FZ5A 4HQZA 2DLXA 2H1BA 5ID2B 4EC0A 1TK8B 1DSBA 1UC7A 5E4WA 4PX1A 3TU3B 3KEBA 4HUAA 4ECCA 3FKFA 4KDXA 1TRVA 2HFDA 2RLIA 1Z5YE 3SWLA 1A8YA 1ML6A 3GFKA 2YWNA 2GTUA 3ZL5A 1QQ2A 4N0ZA 3GYKA 5J41A 2L4CA 4DEJA 2NVLA 2VUPA 3P8WA 5IM9A 4JEDA 5AIVA 1RQMA 2EIOA 4YQVA 4PUAA 2YWOA 4KCEA 2EFEA 3QOUA 3GSSA 1WPIA 1SVLA 5EVOA 3HJPA 1S3AA 1MD3A 3HCZA 4YAVA 2O85A 1SKWB 2H72A 4MPGA 1GLPA 3GNJA 3HA9A 4G19A 3QCPA 2H71A 3VWVA 5IOXA 2C0GA 3US3A 4J2FA 2O36A 5ENUA 5HR1A 1G7OA 1GULA 3A2WA 2WVXB 1NSWA 1S3RA 4Q5NA 1R26A 2L57A 4RQRA 4WETA 1FVKA 5ELGA 1ON4A 3TB2A 1UN2A 4K5RA 4L0UA 3ZMLA 4PI0C 1VGLA 5HR2A 5KN2A 3EMXA 3HHVA 3W8JA 4LL4B 5HFGA 6GSSA 1GSUA 1I9DA 2PMTA 4N11A 4WBJA 4TR3A 4MA9A 2WB9A 2LJRA 1XVWA 3RHBA 1JZRA 1YQ1A 3J7Yk 8GSSA 2PN8A 1X5DA 1B9XC 4AKGA 2YWIA 4N3ZA 3DD3A 2H0IA 1ERVA 1BG5A 3Q19A 4BL7B 2C1YA 2PPTA 2GSTA 4EVMA 3P90A 1MDKA 3GL3A 5IOWA 4HJ2A 5J9BA 3CSHA 2H1LA 4ECIA 3C71A 2VLVA 3I43A 1XWKA 3CSJA 3OR5A 1X9MB 4ZBBA 4TKYA 2DJJA 2HQTA 2QA2A 1PKZA 4XS4B 3UVHA 2PGTA 3K8NA 4WBRD 2F51A 3GKXA 1THOA 4CY6A 1TI1A 3IV4A 2DKHA 4ZIJA 4K1FA 2GSQA 1Z7PA 5CRHA 3LQ7A 2GDRA 1OYJA 4MNNA 4KF9A 3D5JA 4AKXB 3AY8A 4MH3A 1OE8A 4PI2C 5DVBA 4QL7A 3ZVJD 4JRRA 13GSA 2I4AA 4ZL7A 4YAPA 2FWFA 4V1Ap 2CAIA 2MBSA 1GTAA 3GX0A 1EV4A 1EP7A 1A24A 3GV1A 5DALB 5INYA 5A4VA 1SKRB 2QKEA 1R7HA 4KA0A 4Q5QA 1YY7A 4LMWA 4BPYA 3TKSA 3UBLA 2YWMA 1O7UA 4KNDA 1Y6EA 3F6DA 3TJBA 3U6VA 2IMKA 2GZPA 4CW9A 2H74A 3N5OA 1OKTA 2QSIA 5GZZB 1M3JA 2X8GA 2I9HA 3D22A 4X4JA 1TK0B 5F06A 1PX6A 3GX8A 3LYKA 5DQSA 4OWYA 1ERWA 2HSMB 3ERGA 1B9YC 2B5EA 2EIQA 1QFNA 3GSTA 4Z2TA 3MWHA 5B7CA 1KNGA 1VF4A 5HFKA 1AIUA 4OD7A 1O81A 4OO5A 4IN0A 1AXDA 1K0OA 2B5XA 2FLSA 2L59A 1WRYA 1RK4A 4K7NA 4Z2UA 1ILOA 2Z9SA 2AB6A 5JCGA 1HNAA 1HQOA 1OE7A 1HD2A 1GUMA 5C04A 2HZEB 1F9MA 3GHAA 4YKFA 1BAYA 4IELA 2PERA 2IMIA 3QR6A 2LJAA 3S9FA 1VF1A 4Q5RA 2CVBA 3TOUA 5AISA 2K8SA 3DYRA 2X8CA 1ACVA 5D9XA 5G31A 2VD1A 1BYEA 1TU8A 1PKWA 1PFOA 3CWGA 1O8WA 3I9V2 2H01A 3EE2A 2WW0A 2F3MA 1SL1B 2YJ7A 3KTLA 1T7PB 2CVDA 1EWXA 4WR5A 1Z6MA 2YV9A 3TKSE 3M9JA 3WGEA 6GSWA 3W6GA 3KXOA 3HVNA 4NWYA 3CXGA 1YVLA 3ZZXA 4K8MA 1XWBA 5EL8A 20GSA 5KEJA 4MZBA 1B48A 1SD8A 1QGVA 5D9TA 2R5GA 4HZ4A 1VRSD 2B5YA 5ABRA 4YKGA 1WIKA 1YF1A 1NM3A 4PQIA 5J4UA 3F8UA 4WXTA 3LWAA 2DIZA 3F6FA 4OMVA 4LLRA 2C0DA 4BVYA 2H76A 1ZL9A 4E8HA 2WFCA 3VLNA 2X49A 3IR4A 3RBTA 1CQHA 5IIZA 3F4TA 3IHQA 1X9SB 4ML1A 1WOUA 3IA1A 4EF0A 4TR1A 1K0NA 2HRAA 2FA4A 19GSA 4V2LA 3ZREA 2REMA 4LMVA 1K3YA 2GSRA 2WZSA 2G2QA 3NZNA 7GSSA 1DBYA 1BF5A 4K0NA 3MAKA 4KX4A 4HU7A 1SENA 4F2IA 1TRSA 1TDIA 3I6AA 1G0TA 2HZFA 3L9UA 4V2NA 2LRCA 4ZB8A 5A1NA 1QXHA 1TXXA 1S4BP 5A5HA 1TRUA 1K0AA 2PVQA 3BCKA 3HDCA 4PQ1A 1OC9A 3ERFA 2K6VA 4GQCA 18GSA 3FR6A 5CO3A 1AQWA 1IYHA 1N2AA 4FYBA 4TOPA 1HNCA 4KW6A 4JBBA 4ZB7A 1A2MA 3L0HA 1A8LA 2IIYA 3D21A 5F0GA 4AJ6A 1ZYQB 3M9KA 1SU9A 1B4QA 1UA5A 3UARA 3Q74A 2JACA 1ERTA 4USSA 2XBIA 2FD3A 1PN0A 3WGDA 5IMCA 4ML6A 4KSOA 2CZ2A 4WEYA 2QC7A 2O89A 1G7EA 5DCHA 1PA3A 3P2AA 2CAQA 2GSSA 2YNXA 4NV5A 4IHUA 2LRNA 2GQKA 3Q6OA 1KTEA 4TR4A 4N0VA 1FW1A 2VM1A 2X8HA 1TI3A 2GZYA 1YKCA 1YJ6A 4P3YB 5DDLA 2R6KA 4TXVA 2V41A 3F3QA 4XHMA 4HS1A 4MZCA 4MK3A 5DQYA 2NPBA 1SVMA 3LFLA 1ZZYA 5J4YA 2YPMA 5KOXA 1TRWA 1J9BA 2V6OA
chains in the Genus database with same CATH topology
5IMZA 3CRTA 2OACA 1TU7A 3QAVA 1EEMA 4EIPA 2B7KA 2PUKC 2ZUPA 5B6MA 2PBJA 2CT6A 4PUFC 1XW6A 1DE2A 1PL2A 3VI7A 2OBIA 1FB6A 3CTGA 5JCUA 5BRTA 2EFDA 2LQOA 17GSA 3D0ZA 1A2JA 4Z2RA 3D4MA 2P5QA 2V32A 5ECSA 1GSSA 1DUGA 3ZMKA 1F37A 3TJGA 3EC3A 1HNBA 3L4NA 3IAM2 3QAWA 2E2MA 3HJOA 2JZRA 1XBSA 14GSA 2YANA 5ECKB 1SD9A 3PPUA 1PMTA 1XVQA 4PNFA 3DVXA 1ERUA 1IYIA 4TR0A 5D8IA 1ZGNA 3ZFLA 4H86A 3GL5A 4POMA 2E7PA 4F9ZA 3TGZA 2NDOA 2RM6A 3E0UA 4EKZA 2R0PA 4JZQA 3WT1A 5AIXA 3O76A 5D93A 4EE0A 4ULXA 1FVJA 5JCWA 3TRQA 5ECIB 3G7JA 4YQMA 2H6XA 5F07A 4IBPA 4L5OA 2PU9C 1B8XA 1QUWA 3FMWA 5J5NA 3KIJA 1C72A 3A2XA 3FHKA 4I6XA 1OKDA 2IMFA 1NHYA 5ECNB 1YDKA 5ECHB 1SK1A 4MF7A 1K3LA 4IW9A 2FHEA 3R2QA 3TKPA 5L71A 3GTUA 1EGOA 1ABAA 3RPPA 4XS1A 1ZYPA 2VL3A 4G2EA 4F03A 1PRXA 4N10A 1XW9A 5IMFA 2L5OA 3GUSA 2CV4A 1PD21 1WE0A 4HU9A 3SBCA 4PXOA 4BA7A 1A0RP 3D4TA 1O6JA 1Y25A 2WDUA 4K0GA 3UMAA 3MDKA 4GCIA 1F3AA 2TIRA 3GKMA 2A2RA 6GSXA 1XZOA 3F0IA 5JWQB 2ZCTA 5D96A 3ZRDA 2ON5A 9GSSA 3WD6A 1I5GA 4EDZA 4DVCA 1TOFA 2M80A 2HE3A 5F8BA 1SK2A 4TRXA 5CRWA 4I8BA 2B7JA 1XWCA 1M2AA 2H1AA 1SL0B 1PX7A 3WYWA 1FAAA 2XPDA 4MF6A 1A0FA 3BJ5A 2MMZA 4OO4A 3ERWA 1UVZA 2YP6A 1LBKA 1GUHA 2DMMA 5IPHA 6GSTA 5J47A 2GS3A 2GT5A 1FG4A 12GSA 2MMOA 1K0MA 3FYGA 1TKDB 3R3EA 11GSA 2C3NA 4MJBA 1W4VA 4YQUA 4BVYB 2FUG2 2JL4A 2MBTA 3C7MA 1RW1A 2LSTA 4MZWA 5ELAA 4G0KA 3GH9A 2H19A 2AAWA 4TR1B 4BWQA 2A4VA 1XFLA 2HRKA 3UL3A 2OKAA 3F4SA 2I3YA 1EEJA 3CBUA 2ON7A 3LG6A 2RUFA 2DJ1A 4MDCA 1URMA 2H8LA 2FNOA 1GSEA 5G5FA 5GSTA 3RHCA 4TW5A 1GSFA 3NOFA 4IJIA 2VL9A 3GH6A 1YKAA 2VCQA 1U87A 4DSRA 3F63A 5A1NB 1QMVA 4PURA 5A5HB 2OE0A 4AKHA 2E2GA 3MIXA 1MDIA 5GSSA 1OC9B 4OCFA 2R37A 2RM5A 3TKSC 2AV4A 2PVOC 1GL8A 3IC4A 1GTIA 3BCIA 4X43A 2P0GA 1AQVA 2QGVA 2VCZA 2H70A 2C3QA 4D73A 1JZOA 1G6WA 3GRXA 1M2DA 4GQFA 4NXIA 3H93A 5CRDA 4E8EA 4GWRA 4MLYA 4O92A 5G2ZA 4EO3A 2GQMA 1PN9A 2IL3A 2C0FA 2LKUA 2X64A 2CX4A 5AN1A 1GP1A 3O6TA 5IO2A 1Z3EA 2F8AA 1WJKA 3KJYA 2IFQA 2WCIA 1K0DA 3LSZA 2VCVA 1ZCPA 4WKWA 3E9JB 4NHWA 3UVTA 3ZFBA 5J9CA 1Z6NA 4KGIA 5HFIA 3MYDA 4ZL9A 4EL1A 5ECLB 2BJXA 3HY2A 3U5RE 3QAGA 5B8AA 3KD0A 3C8EA 1K3OA 1SJIA 1GLQA 5HQPA 1XWGA 4KAEA 2OE1A 2R3XA 2AYTA 3TKRA 3FEUA 5D9WA 1R4WA 3CSIA 3KH9A 1AAZA 1V9WA 2DSAA 4O5UA 5LCZA 4RQXA 1Y1UA 3HYPA 2H66A 1Q98A 3QDNA 3VURA 1THXA 2YN1A 4O7HA 2HI7A 4GSTA 3VPQA 2DJ3A 3TJJA 1V58A 5GAPD 3UIWA 4ZXGA 2UZ8A 2B1LA 1XIYA 22GSA 2A4HA 4TVEA 2HSNA 1B4PA 3VPTA 2FWEA 1YEXA 1KBNA 1ZOFA 4KH7A 1N8JA 3DGQA 1TTZA 4XTSA 1EOHA 5H5RA 4OFMA 4K6XA 1LU4A 4GRFA 4GXZA 2OA7A 2CVKA 5F05A 3EU3A 4ECJA 1T8EB 1X0RA 2JZSA 2VM2A 4XIHA 3FZAA 3ZVJA 3TJFA 5FT3A 4MJAA 2IWTA 2NTOA 5G1LA 3KMNA 3ZIVA 3TKQA 4I97A 3LXZA 3BD2A 2KUCA 3GIXA 4IQ1A 3IRAA 4HOJA 1XOBA 2RIIA 2B3SA 4F0BA 1XOAA 4A5PA 4KDYA 1E2YA 3Q18A 2H6YA 2YZHA 2HLSA 3EWLA 3DRNA 4KE3A 4W66A 1WMJA 3A5WA 1EP8A 5B8BA 3TUEA 1GNWA 1K0BA 4HEA2 3WGXA 2R0CA 3ED3A 3MSZA 4HJMA 1U6TA 4DSSA 4ECBA 2L6CA 5G5EA 1SVOA 3HZ4A 4MABA 4K2XA 3GTUB 1FOVA 3N9JA 6GSVA 1BEDA 2VCWA 2D2ZA 3G9BA 3IDVA 5DAKA 1M9BA 1M99A 4NAXA 2BMXA 1PL1A 1Z7RA 2DKIA 3IBHA 1GWCA 2ALBA 1AC1A 4V2MA 5J4VA 4F82A 1FO5A 4ZILA 4MPFA 2AUVA 2P31A 3FRCA 1JZWA 1H75A 4IGJA 4EUYA 1AUCA 3ME7A 4XS6A 3RAZA 4ZBAA 2OADA 5IPGA 3J7Yb 2O7KA 1M7TA 1OAZA 1MDJA 2GT6A 4L8EA 3TCOA 16GSA 4BVXA 2K9FA 4JE1A 2VKZG 3BBYA 4YH2A 3EMPA 3EPTA 3H79A 3DKSA 4K2DA 4KB3A 1SJ6A 2EC4A 2O5VA 2HSHA 2DC5A 2JADA 3GKNA 3LGCA 2QA1A 1SL2B 1T3BA 3O3TA 1GH2A 2HT9A 2IN3A 1XCCA 4QQ7A 3APSA 1U3AA 2X4AA 1YZXA 3VWXA 2HNLA 4AGSA 4MMMA 5A34A 3TDGA 4PTSA 3VWUA 2OBKA 2VO4A 1EZKA 1BG1A 3ZLPA 1A2LA 2G0FA 1R5AA 2JU5A 3A3TA 2HRKB 3ISOA 2EIRA 4GSSA 2EFHA 4NV2A 2XBQA 4KSMA 2F9SA 2N5AA 2A2PA 2VCTA 5HR3A 2GQLA 3QFBC 3L78A 2C3TA 4PNGA 2C8UA 2IJYA 3FZ4A 3KZQA 1GSYA 2I81A 5E59A 4HQSA 1FOHA 5BMUA 3LW9A 3IE3A 1T00A 4QMKA 2VLTA 4OFTA 2DJ0A 1YF0A 3L9VA 2V6KA 2YV7A 2HRFA 2ES7A 2FCHA 3HVXA 1G6YA 3KM6A 1GTBA 4RI6A 4O32A 1SYXA 4CDOA 3QD9A 5A5KA 2CQ9A 1PGTA 3HD5A 1GSQA 4D73B 5CNWA 2OT3A 5D9VA 5KN3A 2LTKA 5DCGA 3GKKA 4V1Ag 2FWHA 4I2TA 4AI6A 1U88A 2UV8G 2LRTA 5CREA 4CY8A 2X99A 3GURA 3GN3A 1T4YA 2IPAA 4POLA 2RUEA 3UJ1A 3DMLA 5D73A 5EPFA 4FH8A 4MJCA 4G9HA 2B6MA 2H0HA 3IK7A 2DMLA 1XW5A 2IFQB 3TRXA 2EFCA 2XHFA 3CYNA 5GAND 1T1VA 1N25A 4ZB9A 2DBCA 4TXOA 4ISDA 1BQ7A 1PQNA 3NIVA 1EOGA 2GVPA 1U3IA 4GTUA 2O8VB 1AW9A 2B1KA 3APQA 4NHZA 2OJLA 4O5RA 3C1SA 2N5BA 2E0QA 2H1GA 4AKIA 4E68A 4K5SA 3JCML 4JU5A 5EY6A 3HZ8A 3FW2A 2LV3A 4POKA 3CTFA 1F6MC 6GSYA 3IXRA 2VCXA 3PGTA 4FIWA 4XRAA 3V1WA 5IMVA 1TP9A 5DBQA 2LJKA 3EYTA 3PINA 1BJXA 2AHEA 3M3MA 2J23A 3ZTLA 5DJLA 4IVFA 3C1RA 4ZL8A 1XXUA 2HSNB 3VWWA 3DWVA 1GRXA 1GTUA 1X9WB 4IKHA 3F4RA 4FO5A 3FK8A 3ZYWA 4GLTA 2HSYA 4ZB6A 4XCSA 5CRGA 1J0FA 3LJRA 4J56E 3APOA 4MP4A 3KMOA 3UBKA 4HDEA 1R5PA 3A2VA 2GLRA 2WULA 4N30A 1YEPA 4GF0A 4OFNA 4AJ7A 5DJMA 5COHA 3C73A 3L9SA 2WGRA 3IAS2 2L6DA 2VD0A 2CA8A 1MEKA 1ZYNA 2VIMA 2MMNA 5ID2A 1TXUA 2N5FA 2OE3A 2KOKA 2KP1A 2GGTA 1BX9A 4G0IA 4EDYA 3ZITA 1V57A 2FY6A 4Q5FA 4IS0A 2HRNA 3HKRA 3IPZA 4DSSB 1O8XA 2XC2A 1FB0A 3IOSA 4EIQA 1CQGA 3CRUA 3BOAA 3IK9A 2C4JA 1NHOA 1TJDA 2CX3A 2K8VA 4MJEA 1KEBA 2JSZA 2H1DA 3G7IA 1K0CA 1TK5B 1GSDA 2LNTA 4L5LA 5DAKB 4FYUA 1F3BA 3FZ9A 3LORA 3ZIJA 2C0EA 4NMUA 2CZ3A 3EVIA 4F0CA 1A23A 3HMJG 4GSNA 4QL9A 1SK0A 4IJ3A 4G0LA 4I2UA 4MCUA 5A4UA 1XWAA 1JZDA 5H5SA 5ECQB 10GSA 3H8QA 3WT2A 5J3RA 2R2JA 5CP1A 2V2GA 4O5QA 2WJUA 1OVNA 2TRCP 1EGRA 1JLWA 4OCEA 5JWRB 2A2SA 4HI7A 3ME8A 5ECOB 3UEMA 4FYCA 1WWJA 4WF5A 5IQYA 3F3RA 3A5IA 1JHBA 2KP2A 4BVXB 1O85A 2VLUA 2C80A 5KOWA 2M72A 5FWGA 2XPEA 3TRPA 2JSYA 3MNGA 1MTCA 4LL1B 2FGXA 2H75A 4CHSA 2LEGA 4K9ZA 2L4QA 3KGKA 3I69A 4FQUA 3FR9A 2MMAA 2K18A 5B6NA 1JLVA 2VAFA 1H4OA 3W8SA 3DXBA 2PWJA 3D6IA 3HVSA 4BL7A 4WR4A 2FA8A 1ST9A 4ID0A 2AJQB 1EV9A 4RI7A 3TOTA 2MYGA 3EURA 5A34B 3VFIA 3EINA 2GZZA 1GUKA 2LQQA 2I1UA 1E6BA 4G01A 2HXKA 2WS2A 4ICYA 3M0FA 1LJRA 1V98A 3DVWA 4Z7XA 4XS4A 4AF2A 5IMDA 1S3DA 1M2BA 1J08A 2YOIA 1TW9A 1VF2A 5H5QA 2TRXA 2KLXA 1FHEA 1M0UA 1QK8A 5ECPB 5JWOB 2R4VA 1MD4A 3PH9A 4ACSA 3EU4A 5AGYA 3FR3A 4WF4A 4GDFA 5BMUB 5CAXA 4J57E 2MZCA 3HJMA 2H73A 4I5QA 2ZNMA 5FHIA 4KDUA 5LD0A 1VF3A 3GMFA 4K7OA 5J40A 3IHGA 3RPNA 6GSUA 1SJZA 4IP1A 4EXJA 1HYUA 1PSQA 4DSQA 5DALA 1X5CA 2L5LA 1JFUA 1O73A 4POBA 3E3EA 2YJHA 5LNKe 3CMIA 1GNEA 2DJ2A 5C00A 2J9HA 2VL2A 3IC8A 3KP9A 2IMEA 2V1MA 5CYYA 4ZBDA 1S3CA 2LUSA 4LA1A 3PR8A 2HYXA 1SKSB 5IO0A 2VL2C 2P5RA 2JZTA 1USBA 4JR6A 2M46A 3H1NA 2HSMA 1WP0A 2LNSA 5IMAA 5KN0A 3P7XA 1X5EA 4TXOB 3DEXA 3KCMA 4JR4A 3FY7A 1ZMAA 4MF5A 2LS5A 3KP8A 2O87A 1ZYEA 4RUVA 4X0XA 5A4WA 4XRDA 4TN8A 3LXTA 4G10A 3TJKA 4AJ8A 3HVVA 4IP6A 5KN1A 2HZEA 1OC8A 5G30A 3H4KA 1XPVA 5HR0A 1M9AA 2H6ZA 1Q4JA 2H0GA 4PGTA 2YZUA 3LYPA 3RDWA 4K7IA 1V40A 3G7YA 2DJKA 4ILFA 3M1GA 2R0GA 1OC3A 1Z9HA 3VI5A 2H30A 2YCDA 2KHPA 4MH2A 2DIYA 2WRTA 1NW2A 4HZ2A 3LEFA 3GA4A 3QPMA 3QFAC 2IMDA 3UAPA 1SYRA 3F9UA 1AQXA 4PQHA 5G1KA 1V2AA 3QMXA 3UOMA 4L0WA 3M8NA 4NPBA 5ECMB 3VK9A 2FWGA 3DIEA 4X1UA 4IQAA 5ECRB 2VOCA 4KCAA 2WZ9A 4BWSA 1DE1A 4KUNA 3HXSA 3KH7A 2BTOT 1T4ZA 2F8FA 3KTBA 1W89A 1F2EA 2NBSA 3FZ5A 4HQZA 2DLXA 2H1BA 5ID2B 4EC0A 1TK8B 1DSBA 1UC7A 5E4WA 4PX1A 3TU3B 3KEBA 4HUAA 4ECCA 3FKFA 4KDXA 1TRVA 2HFDA 2RLIA 1Z5YE 3SWLA 1A8YA 1ML6A 3GFKA 2YWNA 2GTUA 3ZL5A 1QQ2A 4N0ZA 3GYKA 5J41A 2L4CA 4DEJA 2NVLA 2VUPA 3P8WA 5IM9A 4JEDA 5AIVA 1RQMA 2EIOA 4YQVA 4PUAA 2YWOA 4KCEA 2EFEA 3QOUA 3GSSA 1WPIA 1SVLA 5EVOA 3HJPA 1S3AA 1MD3A 3HCZA 4YAVA 2O85A 1SKWB 2H72A 4MPGA 1GLPA 3GNJA 3HA9A 4G19A 3QCPA 2H71A 3VWVA 5IOXA 2C0GA 3US3A 4J2FA 5ENUA 5HR1A 1G7OA 1GULA 3A2WA 1NSWA 4Q5NA 1R26A 2L57A 4RQRA 4WETA 1FVKA 5ELGA 1ON4A 3TB2A 1UN2A 4K5RA 4L0UA 3ZMLA 1VGLA 5HR2A 5KN2A 3EMXA 3HHVA 3W8JA 4LL4B 5HFGA 6GSSA 1GSUA 1I9DA 2PMTA 4N11A 4WBJA 4TR3A 4MA9A 2WB9A 2LJRA 1XVWA 3RHBA 1JZRA 1YQ1A 3J7Yk 8GSSA 2PN8A 1X5DA 1B9XC 4AKGA 2YWIA 4N3ZA 3DD3A 2H0IA 1ERVA 1BG5A 3Q19A 4BL7B 2C1YA 2PPTA 2GSTA 4EVMA 3P90A 1MDKA 3GL3A 5IOWA 4HJ2A 5J9BA 3CSHA 2H1LA 4ECIA 3C71A 2VLVA 3I43A 1XWKA 3CSJA 3OR5A 1X9MB 4ZBBA 4TKYA 2DJJA 2HQTA 2QA2A 1PKZA 4XS4B 3UVHA 2PGTA 3K8NA 4WBRD 2F51A 3GKXA 1THOA 4CY6A 1TI1A 3IV4A 2DKHA 4ZIJA 4K1FA 2GSQA 1Z7PA 5CRHA 3LQ7A 2GDRA 1OYJA 4MNNA 4KF9A 3D5JA 4AKXB 3AY8A 4MH3A 1OE8A 5DVBA 4QL7A 3ZVJD 4JRRA 13GSA 2I4AA 4ZL7A 4YAPA 2FWFA 4V1Ap 2CAIA 2MBSA 1GTAA 3GX0A 1EV4A 1EP7A 1A24A 3GV1A 5DALB 5INYA 5A4VA 1SKRB 2QKEA 1R7HA 4KA0A 4Q5QA 1YY7A 4LMWA 4BPYA 3TKSA 3UBLA 2YWMA 1O7UA 4KNDA 1Y6EA 3F6DA 3TJBA 3U6VA 2IMKA 2GZPA 4CW9A 2H74A 3N5OA 1OKTA 2QSIA 5GZZB 2X8GA 2I9HA 3D22A 4X4JA 1TK0B 5F06A 1PX6A 3GX8A 3LYKA 5DQSA 4OWYA 1ERWA 2HSMB 3ERGA 1B9YC 2B5EA 2EIQA 1QFNA 3GSTA 4Z2TA 3MWHA 5B7CA 1KNGA 1VF4A 5HFKA 1AIUA 4OD7A 1O81A 4OO5A 4IN0A 1AXDA 1K0OA 2B5XA 2FLSA 2L59A 1WRYA 1RK4A 4K7NA 4Z2UA 1ILOA 2Z9SA 2AB6A 5JCGA 1HNAA 1HQOA 1OE7A 1HD2A 1GUMA 5C04A 2HZEB 1F9MA 3GHAA 4YKFA 1BAYA 4IELA 2PERA 2IMIA 3QR6A 2LJAA 3S9FA 1VF1A 4Q5RA 2CVBA 3TOUA 5AISA 2K8SA 3DYRA 2X8CA 1ACVA 5D9XA 5G31A 2VD1A 1BYEA 1TU8A 1PKWA 3CWGA 1O8WA 3I9V2 2H01A 3EE2A 2F3MA 1SL1B 2YJ7A 3KTLA 1T7PB 2CVDA 1EWXA 4WR5A 1Z6MA 2YV9A 3TKSE 3M9JA 3WGEA 6GSWA 3W6GA 3KXOA 4NWYA 3CXGA 1YVLA 3ZZXA 4K8MA 1XWBA 5EL8A 20GSA 5KEJA 4MZBA 1B48A 1SD8A 1QGVA 5D9TA 2R5GA 4HZ4A 1VRSD 2B5YA 5ABRA 4YKGA 1WIKA 1YF1A 1NM3A 4PQIA 5J4UA 3F8UA 4WXTA 3LWAA 2DIZA 3F6FA 4OMVA 4LLRA 2C0DA 4BVYA 2H76A 1ZL9A 4E8HA 2WFCA 3VLNA 2X49A 3IR4A 3RBTA 1CQHA 5IIZA 3F4TA 3IHQA 1X9SB 4ML1A 1WOUA 3IA1A 4EF0A 4TR1A 1K0NA 2HRAA 2FA4A 19GSA 4V2LA 3ZREA 2REMA 4LMVA 1K3YA 2GSRA 2G2QA 3NZNA 7GSSA 1DBYA 1BF5A 4K0NA 3MAKA 4KX4A 4HU7A 1SENA 4F2IA 1TRSA 1TDIA 3I6AA 1G0TA 2HZFA 3L9UA 4V2NA 2LRCA 4ZB8A 5A1NA 1QXHA 1TXXA 5A5HA 1TRUA 1K0AA 2PVQA 3BCKA 3HDCA 4PQ1A 1OC9A 3ERFA 2K6VA 4GQCA 18GSA 3FR6A 5CO3A 1AQWA 1IYHA 1N2AA 4FYBA 4TOPA 1HNCA 4KW6A 4JBBA 4ZB7A 1A2MA 3L0HA 1A8LA 2IIYA 3D21A 5F0GA 4AJ6A 1ZYQB 3M9KA 1SU9A 1B4QA 1UA5A 3UARA 3Q74A 2JACA 1ERTA 4USSA 2XBIA 2FD3A 1PN0A 3WGDA 5IMCA 4ML6A 4KSOA 2CZ2A 4WEYA 2QC7A 2O89A 1G7EA 5DCHA 1PA3A 3P2AA 2CAQA 2GSSA 2YNXA 4NV5A 4IHUA 2LRNA 2GQKA 3Q6OA 1KTEA 4TR4A 4N0VA 1FW1A 2VM1A 2X8HA 1TI3A 2GZYA 1YKCA 1YJ6A 4P3YB 5DDLA 2R6KA 4TXVA 2V41A 3F3QA 4XHMA 4HS1A 4MZCA 4MK3A 5DQYA 2NPBA 1SVMA 3LFLA 1ZZYA 5J4YA 2YPMA 5KOXA 1TRWA 1J9BA 2V6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IMZ A;  3CRT A;  2OAC A;  1TU7 A;  3QAV A;  1EEM A;  2B7K A;  2PUK C;  2ZUP A;  5B6M A;  2PBJ A;  2CT6 A;  4PUF C;  1XW6 A;  1DE2 A;  1PL2 A;  3VI7 A;  2OBI A;  1FB6 A;  3CTG A;  5JCU A;  2LQO A;  17GS A;  3D0Z A;  1A2J A;  3D4M A;  2P5Q A;  2V32 A;  5ECS A;  1GSS A;  1DUG A;  3ZMK A;  1F37 A;  3TJG A;  3EC3 A;  1HNB A;  3L4N A;  3IAM 2;  3QAW A;  2E2M A;  3HJO A;  2JZR A;  1XBS A;  14GS A;  2YAN A;  5ECK B;  1SD9 A;  3PPU A;  1PMT A;  1XVQ A;  4PNF A;  3DVX A;  1ERU A;  1IYI A;  4TR0 A;  5D8I A;  1ZGN A;  3ZFL A;  4H86 A;  3GL5 A;  4POM A;  2E7P A;  4F9Z A;  3TGZ A;  2NDO A;  2RM6 A;  3E0U A;  4EKZ A;  4JZQ A;  3WT1 A;  5AIX A;  3O76 A;  5D93 A;  4EE0 A;  4ULX A;  1FVJ A;  5JCW A;  3TRQ A;  5ECI B;  3G7J A;  4YQM A;  2H6X A;  5F07 A;  4IBP A;  4L5O A;  2PU9 C;  1B8X A;  1QUW A;  5J5N A;  3KIJ A;  1C72 A;  3A2X A;  3FHK A;  4I6X A;  1OKD A;  2IMF A;  1NHY A;  5ECN B;  1YDK A;  5ECH B;  1SK1 A;  4MF7 A;  1K3L A;  4IW9 A;  2FHE A;  3R2Q A;  3TKP A;  5L71 A;  3GTU A;  1EGO A;  1ABA A;  3RPP A;  4XS1 A;  2VL3 A;  4G2E A;  4F03 A;  1PRX A;  4N10 A;  1XW9 A;  5IMF A;  2L5O A;  3GUS A;  2CV4 A;  1PD2 1;  1WE0 A;  4HU9 A;  3SBC A;  4PXO A;  4BA7 A;  1A0R P;  3D4T A;  1O6J A;  1Y25 A;  2WDU A;  4K0G A;  3UMA A;  3MDK A;  4GCI A;  1F3A A;  2TIR A;  3GKM A;  2A2R A;  6GSX A;  1XZO A;  3F0I A;  5JWQ B;  2ZCT A;  5D96 A;  3ZRD A;  2ON5 A;  9GSS A;  3WD6 A;  1I5G A;  4EDZ A;  4DVC A;  1TOF A;  2M80 A;  2HE3 A;  5F8B A;  1SK2 A;  4TRX A;  5CRW A;  4I8B A;  2B7J A;  1XWC A;  1M2A A;  2H1A A;  1SL0 B;  1PX7 A;  3WYW A;  1FAA A;  2XPD A;  4MF6 A;  1A0F A;  3BJ5 A;  2MMZ A;  4OO4 A;  3ERW A;  1UVZ A;  2YP6 A;  1LBK A;  1GUH A;  2DMM A;  5IPH A;  6GST A;  2GS3 A;  2GT5 A;  1FG4 A;  12GS A;  2MMO A;  1K0M A;  3FYG A;  1TKD B;  3R3E A;  11GS A;  2C3N A;  4MJB A;  1W4V A;  4YQU A;  4BVY B;  2FUG 2;  2JL4 A;  2MBT A;  3C7M A;  1RW1 A;  2LST A;  4MZW A;  5ELA A;  4G0K A;  3GH9 A;  2H19 A;  2AAW A;  4TR1 B;  4BWQ A;  2A4V A;  1XFL A;  2HRK A;  3UL3 A;  2OKA A;  3F4S A;  2I3Y A;  1EEJ A;  3CBU A;  2ON7 A;  3LG6 A;  2RUF A;  2DJ1 A;  4MDC A;  1URM A;  2H8L A;  2FNO A;  1GSE A;  5G5F A;  5GST A;  3RHC A;  4TW5 A;  1GSF A;  3NOF A;  4IJI A;  2VL9 A;  3GH6 A;  1YKA A;  2VCQ A;  1U87 A;  4DSR A;  3F63 A;  1QMV A;  4PUR A;  2OE0 A;  2E2G A;  1MDI A;  5GSS A;  1OC9 B;  4OCF A;  2R37 A;  2RM5 A;  3TKS C;  2AV4 A;  2PVO C;  1GL8 A;  3IC4 A;  1GTI A;  3BCI A;  4X43 A;  2P0G A;  1AQV A;  2QGV A;  2VCZ A;  2H70 A;  2C3Q A;  4D73 A;  1JZO A;  1G6W A;  3GRX A;  1M2D A;  4GQF A;  4NXI A;  3H93 A;  5CRD A;  4E8E A;  4GWR A;  4MLY A;  4O92 A;  5G2Z A;  4EO3 A;  2GQM A;  1PN9 A;  2IL3 A;  2C0F A;  2LKU A;  2X64 A;  2CX4 A;  5AN1 A;  1GP1 A;  3O6T A;  5IO2 A;  1Z3E A;  2F8A A;  1WJK A;  3KJY A;  2IFQ A;  2WCI A;  1K0D A;  3LSZ A;  2VCV A;  1ZCP A;  4WKW A;  3E9J B;  4NHW A;  3UVT A;  3ZFB A;  5J9C A;  1Z6N A;  4KGI A;  5HFI A;  4ZL9 A;  4EL1 A;  5ECL B;  2BJX A;  3HY2 A;  3U5R E;  3QAG A;  5B8A A;  3KD0 A;  3C8E A;  1K3O A;  1SJI A;  1GLQ A;  5HQP A;  1XWG A;  4KAE A;  2OE1 A;  2R3X A;  2AYT A;  3TKR A;  3FEU A;  5D9W A;  1R4W A;  3CSI A;  3KH9 A;  1AAZ A;  1V9W A;  2DSA A;  5LCZ A;  4RQX A;  3HYP A;  2H66 A;  3QDN A;  1Q98 A;  3VUR A;  1THX A;  2YN1 A;  4O7H A;  2HI7 A;  4GST A;  3VPQ A;  2DJ3 A;  3TJJ A;  1V58 A;  5GAP D;  3UIW A;  4ZXG A;  2UZ8 A;  2B1L A;  1XIY A;  22GS A;  4TVE A;  1B4P A;  3VPT A;  2FWE A;  1YEX A;  1KBN A;  1ZOF A;  4KH7 A;  1N8J A;  3DGQ A;  1TTZ A;  4XTS A;  1EOH A;  5H5R A;  4OFM A;  4K6X A;  1LU4 A;  4GRF A;  4GXZ A;  2OA7 A;  2CVK A;  5F05 A;  3EU3 A;  4ECJ A;  1T8E B;  1X0R A;  2JZS A;  2VM2 A;  4XIH A;  3FZA A;  3ZVJ A;  3TJF A;  5FT3 A;  4MJA A;  2IWT A;  2NTO A;  5G1L A;  3KMN A;  3ZIV A;  3TKQ A;  4I97 A;  3LXZ A;  3BD2 A;  2KUC A;  3GIX A;  4IQ1 A;  3IRA A;  4HOJ A;  1XOB A;  2RII A;  2B3S A;  4F0B A;  1XOA A;  4KDY A;  1E2Y A;  3Q18 A;  2H6Y A;  2YZH A;  2HLS A;  3EWL A;  3DRN A;  4KE3 A;  1WMJ A;  3A5W A;  1EP8 A;  5B8B A;  3TUE A;  1GNW A;  1K0B A;  4HEA 2;  3WGX A;  3ED3 A;  3MSZ A;  4HJM A;  1U6T A;  4DSS A;  4ECB A;  2L6C A;  5G5E A;  3HZ4 A;  4MAB A;  3GTU B;  1FOV A;  3N9J A;  6GSV A;  1BED A;  2VCW A;  2D2Z A;  3G9B A;  3IDV A;  5DAK A;  1M9B A;  1M99 A;  4NAX A;  2BMX A;  1PL1 A;  1Z7R A;  3IBH A;  1GWC A;  2ALB A;  1AC1 A;  4V2M A;  4F82 A;  1FO5 A;  4ZIL A;  4MPF A;  2AUV A;  2P31 A;  3FRC A;  1JZW A;  1H75 A;  4IGJ A;  4EUY A;  1AUC A;  3ME7 A;  4XS6 A;  3RAZ A;  4ZBA A;  2OAD A;  5IPG A;  3J7Y b;  2O7K A;  1M7T A;  1OAZ A;  1MDJ A;  2GT6 A;  4L8E A;  3TCO A;  16GS A;  4BVX A;  2K9F A;  4JE1 A;  3BBY A;  4YH2 A;  3EMP A;  3H79 A;  3DKS A;  4K2D A;  4KB3 A;  1SJ6 A;  2EC4 A;  2HSH A;  2DC5 A;  2JAD A;  3GKN A;  3LGC A;  1SL2 B;  1T3B A;  3O3T A;  1GH2 A;  2HT9 A;  2IN3 A;  1XCC A;  4QQ7 A;  3APS A;  1U3A A;  1YZX A;  3VWX A;  2HNL A;  4AGS A;  4MMM A;  3TDG A;  4PTS A;  3VWU A;  2OBK A;  2VO4 A;  1EZK A;  3ZLP A;  1A2L A;  2G0F A;  1R5A A;  2JU5 A;  3A3T A;  2HRK B;  3ISO A;  2EIR A;  4GSS A;  4NV2 A;  2XBQ A;  4KSM A;  2F9S A;  2N5A A;  2VCT A;  5HR3 A;  2GQL A;  3QFB C;  3L78 A;  2C3T A;  4PNG A;  2C8U A;  2IJY A;  3FZ4 A;  3KZQ A;  1GSY A;  2I81 A;  5E59 A;  4HQS A;  5BMU A;  3IE3 A;  1T00 A;  2VLT A;  4OFT A;  2DJ0 A;  1YF0 A;  3L9V A;  2V6K A;  2YV7 A;  2HRF A;  2ES7 A;  2FCH A;  3HVX A;  1G6Y A;  3KM6 A;  1GTB A;  4RI6 A;  4O32 A;  1SYX A;  4CDO A;  3QD9 A;  5A5K A;  2CQ9 A;  1PGT A;  3HD5 A;  1GSQ A;  4D73 B;  5CNW A;  5D9V A;  5KN3 A;  2LTK A;  5DCG A;  3GKK A;  4V1A g;  2FWH A;  4I2T A;  1U88 A;  2LRT A;  5CRE A;  2X99 A;  3GUR A;  3GN3 A;  1T4Y A;  2IPA A;  4POL A;  2RUE A;  3UJ1 A;  3DML A;  5D73 A;  5EPF A;  4FH8 A;  4MJC A;  4G9H A;  2B6M A;  2H0H A;  3IK7 A;  2DML A;  1XW5 A;  2IFQ B;  3TRX A;  2XHF A;  3CYN A;  5GAN D;  1T1V A;  4ZB9 A;  2DBC A;  4TXO A;  4ISD A;  1BQ7 A;  1PQN A;  3NIV A;  1EOG A;  2GVP A;  1U3I A;  4GTU A;  2O8V B;  1AW9 A;  2B1K A;  3APQ A;  4NHZ A;  2OJL A;  4O5R A;  3C1S A;  2N5B A;  2E0Q A;  2H1G A;  3JCM L;  4JU5 A;  5EY6 A;  3HZ8 A;  3FW2 A;  2LV3 A;  4POK A;  3CTF A;  1F6M C;  6GSY A;  3IXR A;  2VCX A;  3PGT A;  4FIW A;  4XRA A;  3V1W A;  5IMV A;  1TP9 A;  5DBQ A;  2LJK A;  3EYT A;  3PIN A;  1BJX A;  2AHE A;  3M3M A;  2J23 A;  3ZTL A;  5DJL A;  4IVF A;  3C1R A;  4ZL8 A;  1XXU A;  2HSN B;  3VWW A;  3DWV A;  1GRX A;  1GTU A;  1X9W B;  4IKH A;  3F4R A;  4FO5 A;  3FK8 A;  3ZYW A;  4GLT A;  2HSY A;  4ZB6 A;  4XCS A;  5CRG A;  1J0F A;  3LJR A;  4J56 E;  3APO A;  4MP4 A;  3KMO A;  3UBK A;  4HDE A;  1R5P A;  3A2V A;  2GLR A;  2WUL A;  4N30 A;  1YEP A;  4GF0 A;  4OFN A;  4AJ7 A;  5DJM A;  5COH A;  3C73 A;  3L9S A;  2WGR A;  3IAS 2;  2L6D A;  2VD0 A;  2CA8 A;  1MEK A;  2VIM A;  2MMN A;  5ID2 A;  2N5F A;  2OE3 A;  2KOK A;  2KP1 A;  2GGT A;  4G0I A;  1BX9 A;  4EDY A;  3ZIT A;  1V57 A;  2FY6 A;  4Q5F A;  4IS0 A;  2HRN A;  3HKR A;  3IPZ A;  4DSS B;  1O8X A;  2XC2 A;  1FB0 A;  3IOS A;  1CQG A;  3CRU A;  3BOA A;  3IK9 A;  2C4J A;  1NHO A;  1TJD A;  2CX3 A;  2K8V A;  4MJE A;  1KEB A;  2JSZ A;  2H1D A;  3G7I A;  1K0C A;  1TK5 B;  1GSD A;  2LNT A;  4L5L A;  5DAK B;  4FYU A;  1F3B A;  3FZ9 A;  3LOR A;  3ZIJ A;  2C0E A;  4NMU A;  2CZ3 A;  3EVI A;  4F0C A;  1A23 A;  4GSN A;  4QL9 A;  1SK0 A;  4IJ3 A;  4G0L A;  4I2U A;  4MCU A;  5A4U A;  1XWA A;  1JZD A;  5H5S A;  5ECQ B;  10GS A;  3H8Q A;  3WT2 A;  5J3R A;  2R2J A;  5CP1 A;  2V2G A;  2WJU A;  1OVN A;  2TRC P;  1EGR A;  1JLW A;  4OCE A;  5JWR B;  2A2S A;  4HI7 A;  3ME8 A;  5ECO B;  3UEM A;  4FYC A;  1WWJ A;  4WF5 A;  5IQY A;  3F3R A;  1JHB A;  2KP2 A;  4BVX B;  1O85 A;  2VLU A;  2C80 A;  2M72 A;  5FWG A;  2XPE A;  3TRP A;  2JSY A;  3MNG A;  1MTC A;  4LL1 B;  2FGX A;  2H75 A;  4CHS A;  2LEG A;  4K9Z A;  2L4Q A;  3KGK A;  4FQU A;  3I69 A;  3FR9 A;  2MMA A;  2K18 A;  5B6N A;  1JLV A;  2VAF A;  1H4O A;  3W8S A;  3DXB A;  2PWJ A;  3D6I A;  3HVS A;  4BL7 A;  4WR4 A;  2FA8 A;  1ST9 A;  4ID0 A;  2AJQ B;  1EV9 A;  4RI7 A;  3TOT A;  2MYG A;  3EUR A;  3VFI A;  3EIN A;  2GZZ A;  1GUK A;  2LQQ A;  2I1U A;  1E6B A;  2HXK A;  2WS2 A;  3M0F A;  1LJR A;  1V98 A;  3DVW A;  4Z7X A;  4XS4 A;  4AF2 A;  5IMD A;  1S3D A;  1M2B A;  1J08 A;  2YOI A;  1TW9 A;  1VF2 A;  5H5Q A;  2TRX A;  2KLX A;  1FHE A;  1M0U A;  1QK8 A;  5ECP B;  5JWO B;  2R4V A;  1MD4 A;  3PH9 A;  4ACS A;  3EU4 A;  5AGY A;  3FR3 A;  4WF4 A;  5CAX A;  4J57 E;  2MZC A;  3HJM A;  2H73 A;  4I5Q A;  2ZNM A;  5FHI A;  4KDU A;  5LD0 A;  1VF3 A;  3GMF A;  4K7O A;  3RPN A;  6GSU A;  1SJZ A;  4IP1 A;  4EXJ A;  1HYU A;  1PSQ A;  4DSQ A;  5DAL A;  1X5C A;  2L5L A;  1JFU A;  1O73 A;  4POB A;  3E3E A;  2YJH A;  5LNK e;  3CMI A;  1GNE A;  2DJ2 A;  5C00 A;  2J9H A;  2VL2 A;  3IC8 A;  3KP9 A;  2IME A;  2V1M A;  5CYY A;  4ZBD A;  1S3C A;  2LUS A;  4LA1 A;  3PR8 A;  2HYX A;  1SKS B;  5IO0 A;  2VL2 C;  2P5R A;  2JZT A;  1USB A;  4JR6 A;  2M46 A;  3H1N A;  2HSM A;  1WP0 A;  2LNS A;  5IMA A;  5KN0 A;  3P7X A;  1X5E A;  4TXO B;  3DEX A;  3KCM A;  4JR4 A;  3FY7 A;  1ZMA A;  4MF5 A;  2LS5 A;  3KP8 A;  2O87 A;  1ZYE A;  4RUV A;  4X0X A;  5A4W A;  4XRD A;  4TN8 A;  3LXT A;  4G10 A;  3TJK A;  4AJ8 A;  3HVV A;  4IP6 A;  5KN1 A;  2HZE A;  1OC8 A;  5G30 A;  3H4K A;  1XPV A;  5HR0 A;  1M9A A;  2H6Z A;  1Q4J A;  2H0G A;  4PGT A;  2YZU A;  3LYP A;  3RDW A;  4K7I A;  1V40 A;  3G7Y A;  2DJK A;  4ILF A;  3M1G A;  1OC3 A;  1Z9H A;  3VI5 A;  2H30 A;  2YCD A;  2KHP A;  4MH2 A;  2DIY A;  2WRT A;  1NW2 A;  4HZ2 A;  3LEF A;  3GA4 A;  3QPM A;  3QFA C;  2IMD A;  3UAP A;  1SYR A;  3F9U A;  1AQX A;  4PQH A;  5G1K A;  1V2A A;  3QMX A;  3UOM A;  4L0W A;  3M8N A;  4NPB A;  5ECM B;  3VK9 A;  2FWG A;  3DIE A;  4X1U A;  4IQA A;  5ECR B;  2VOC A;  4KCA A;  2WZ9 A;  4BWS A;  1DE1 A;  4KUN A;  3HXS A;  3KH7 A;  2BTO T;  1T4Z A;  2F8F A;  3KTB A;  1W89 A;  1F2E A;  2NBS A;  3FZ5 A;  4HQZ A;  2DLX A;  2H1B A;  5ID2 B;  4EC0 A;  1TK8 B;  1DSB A;  1UC7 A;  5E4W A;  4PX1 A;  3KEB A;  4HUA A;  4ECC A;  3FKF A;  4KDX A;  1TRV A;  2HFD A;  2RLI A;  1Z5Y E;  3SWL A;  1A8Y A;  1ML6 A;  3GFK A;  2YWN A;  2GTU A;  3ZL5 A;  1QQ2 A;  4N0Z A;  3GYK A;  5J41 A;  2L4C A;  4DEJ A;  2NVL A;  2VUP A;  3P8W A;  5IM9 A;  4JED A;  5AIV A;  1RQM A;  2EIO A;  4YQV A;  4PUA A;  2YWO A;  4KCE A;  3QOU A;  3GSS A;  1WPI A;  5EVO A;  3HJP A;  1S3A A;  1MD3 A;  3HCZ A;  4YAV A;  2O85 A;  1SKW B;  2H72 A;  4MPG A;  1GLP A;  3GNJ A;  3HA9 A;  4G19 A;  3QCP A;  2H71 A;  3VWV A;  5IOX A;  2C0G A;  3US3 A;  4J2F A;  5ENU A;  5HR1 A;  1G7O A;  1GUL A;  3A2W A;  1NSW A;  4Q5N A;  1R26 A;  2L57 A;  4RQR A;  4WET A;  1FVK A;  5ELG A;  1ON4 A;  3TB2 A;  1UN2 A;  4L0U A;  3ZML A;  1VGL A;  5HR2 A;  5KN2 A;  3EMX A;  3HHV A;  3W8J A;  4LL4 B;  5HFG A;  6GSS A;  1GSU A;  1I9D A;  2PMT A;  4N11 A;  4WBJ A;  4TR3 A;  4MA9 A;  2WB9 A;  2LJR A;  1XVW A;  3RHB A;  1JZR A;  1YQ1 A;  3J7Y k;  8GSS A;  2PN8 A;  1X5D A;  1B9X C;  2YWI A;  3DD3 A;  2H0I A;  1ERV A;  1BG5 A;  3Q19 A;  4BL7 B;  2C1Y A;  2PPT A;  2GST A;  4EVM A;  3P90 A;  1MDK A;  3GL3 A;  5IOW A;  4HJ2 A;  5J9B A;  3CSH A;  4ECI A;  3C71 A;  2VLV A;  3I43 A;  1XWK A;  3CSJ A;  3OR5 A;  1X9M B;  4ZBB A;  4TKY A;  2DJJ A;  2HQT A;  1PKZ A;  4XS4 B;  3UVH A;  2PGT A;  3K8N A;  4WBR D;  2F51 A;  3GKX A;  1THO A;  1TI1 A;  3IV4 A;  4ZIJ A;  4K1F A;  2GSQ A;  1Z7P A;  5CRH A;  3LQ7 A;  2GDR A;  1OYJ A;  4KF9 A;  3D5J A;  3AY8 A;  4MH3 A;  1OE8 A;  5DVB A;  4QL7 A;  3ZVJ D;  4JRR A;  13GS A;  2I4A A;  4ZL7 A;  4YAP A;  2FWF A;  4V1A p;  2CAI A;  2MBS A;  1GTA A;  3GX0 A;  1EV4 A;  1EP7 A;  1A24 A;  3GV1 A;  5DAL B;  5INY A;  5A4V A;  1SKR B;  2QKE A;  1R7H A;  4KA0 A;  4Q5Q A;  1YY7 A;  4LMW A;  4BPY A;  3TKS A;  3UBL A;  2YWM A;  1O7U A;  4KND A;  1Y6E A;  3F6D A;  3TJB A;  3U6V A;  2IMK A;  2GZP A;  4CW9 A;  2H74 A;  3N5O A;  1OKT A;  2QSI A;  5GZZ B;  2X8G A;  2I9H A;  3D22 A;  1TK0 B;  5F06 A;  1PX6 A;  3GX8 A;  3LYK A;  5DQS A;  4OWY A;  1ERW A;  2HSM B;  3ERG A;  1B9Y C;  2B5E A;  2EIQ A;  1QFN A;  3GST A;  3MWH A;  5B7C A;  1KNG A;  1VF4 A;  5HFK A;  1AIU A;  4OD7 A;  1O81 A;  4OO5 A;  4IN0 A;  1AXD A;  1K0O A;  2B5X A;  2FLS A;  2L59 A;  1WRY A;  1RK4 A;  4K7N A;  1ILO A;  2Z9S A;  2AB6 A;  5JCG A;  1HNA A;  1HQO A;  1OE7 A;  1HD2 A;  1GUM A;  5C04 A;  2HZE B;  1F9M A;  3GHA A;  1BAY A;  4IEL A;  2PER A;  2IMI A;  3QR6 A;  2LJA A;  3S9F A;  1VF1 A;  4Q5R A;  2CVB A;  3TOU A;  5AIS A;  2K8S A;  3DYR A;  2X8C A;  1ACV A;  5D9X A;  5G31 A;  2VD1 A;  1BYE A;  1TU8 A;  1PKW A;  1O8W A;  3I9V 2;  2H01 A;  3EE2 A;  2F3M A;  1SL1 B;  2YJ7 A;  3KTL A;  1T7P B;  2CVD A;  1EWX A;  4WR5 A;  1Z6M A;  2YV9 A;  3TKS E;  3M9J A;  3WGE A;  6GSW A;  3W6G A;  3KXO A;  4NWY A;  3CXG A;  3ZZX A;  4K8M A;  1XWB A;  5EL8 A;  20GS A;  5KEJ A;  4MZB A;  1B48 A;  1SD8 A;  1QGV A;  5D9T A;  2R5G A;  4HZ4 A;  1VRS D;  2B5Y A;  5ABR A;  1WIK A;  1YF1 A;  1NM3 A;  4PQI A;  5J4U A;  3F8U A;  4WXT A;  3LWA A;  2DIZ A;  3F6F A;  4OMV A;  4LLR A;  2C0D A;  4BVY A;  2H76 A;  1ZL9 A;  4E8H A;  2WFC A;  3VLN A;  3IR4 A;  3RBT A;  1CQH A;  5IIZ A;  3F4T A;  3IHQ A;  1X9S B;  4ML1 A;  1WOU A;  3IA1 A;  4EF0 A;  4TR1 A;  1K0N A;  2HRA A;  2FA4 A;  19GS A;  4V2L A;  3ZRE A;  2REM A;  4LMV A;  1K3Y A;  2GSR A;  2G2Q A;  3NZN A;  7GSS A;  1DBY A;  4K0N A;  3MAK A;  4KX4 A;  4HU7 A;  1SEN A;  4F2I A;  1TRS A;  1TDI A;  3I6A A;  1G0T A;  2HZF A;  3L9U A;  4V2N A;  2LRC A;  4ZB8 A;  1QXH A;  1TXX A;  1TRU A;  1K0A A;  2PVQ A;  3BCK A;  3HDC A;  4PQ1 A;  1OC9 A;  3ERF A;  2K6V A;  4GQC A;  18GS A;  3FR6 A;  5CO3 A;  1AQW A;  1IYH A;  1N2A A;  4FYB A;  4TOP A;  1HNC A;  4KW6 A;  4JBB A;  1A2M A;  3L0H A;  1A8L A;  2IIY A;  3D21 A;  5F0G A;  4AJ6 A;  1ZYQ B;  3M9K A;  1SU9 A;  1B4Q A;  1UA5 A;  3UAR A;  3Q74 A;  2JAC A;  1ERT A;  4USS A;  2XBI A;  2FD3 A;  3WGD A;  5IMC A;  4ML6 A;  4KSO A;  2CZ2 A;  4WEY A;  2QC7 A;  2O89 A;  1G7E A;  5DCH A;  1PA3 A;  3P2A A;  2CAQ A;  2GSS A;  2YNX A;  4NV5 A;  4IHU A;  2LRN A;  2GQK A;  3Q6O A;  1KTE A;  4TR4 A;  4N0V A;  1FW1 A;  2VM1 A;  2X8H A;  1TI3 A;  2GZY A;  1YKC A;  1YJ6 A;  4P3Y B;  5DDL A;  2R6K A;  4TXV A;  2V41 A;  3F3Q A;  4XHM A;  4HS1 A;  4MZC A;  4MK3 A;  5DQY A;  2NPB A;  3LFL A;  1ZZY A;  2YPM A;  1TRW A;  1J9B A;  2V6O A; 
#chains in the Genus database with same CATH topology
 5IMZ A;  3CRT A;  2OAC A;  1TU7 A;  3QAV A;  1EEM A;  4EIP A;  2B7K A;  2PUK C;  2ZUP A;  5B6M A;  2PBJ A;  2CT6 A;  4PUF C;  1XW6 A;  1DE2 A;  1PL2 A;  3VI7 A;  2OBI A;  1FB6 A;  3CTG A;  5JCU A;  5BRT A;  2EFD A;  1XG8 A;  2LQO A;  17GS A;  3D0Z A;  1A2J A;  4Z2R A;  3D4M A;  2P5Q A;  2V32 A;  5ECS A;  1GSS A;  1DUG A;  3ZMK A;  1F37 A;  3TJG A;  3EC3 A;  1HNB A;  4HSC X;  3L4N A;  3IAM 2;  3QAW A;  2E2M A;  3HJO A;  2JZR A;  1XBS A;  14GS A;  2YAN A;  5ECK B;  1SD9 A;  3PPU A;  1PMT A;  1XVQ A;  4PNF A;  3DVX A;  1ERU A;  1IYI A;  4TR0 A;  5D8I A;  1ZGN A;  3ZFL A;  4H86 A;  3GL5 A;  4POM A;  2E7P A;  4F9Z A;  3TGZ A;  2NDO A;  2RM6 A;  3E0U A;  4EKZ A;  2R0P A;  4JZQ A;  3WT1 A;  5AIX A;  3O76 A;  5D93 A;  4EE0 A;  4ULX A;  1FVJ A;  5JCW A;  3TRQ A;  5ECI B;  3G7J A;  4YQM A;  2H6X A;  5F07 A;  4IBP A;  4L5O A;  2PU9 C;  1B8X A;  1QUW A;  3FMW A;  5J5N A;  3KIJ A;  1C72 A;  3A2X A;  3FHK A;  4I6X A;  1OKD A;  2WVZ A;  2IMF A;  1NHY A;  5ECN B;  1YDK A;  5ECH B;  1SK1 A;  4MF7 A;  1K3L A;  4IW9 A;  2FHE A;  3R2Q A;  3TKP A;  5L71 A;  3GTU A;  1EGO A;  1ABA A;  3RPP A;  4XS1 A;  1ZYP A;  2VL3 A;  4G2E A;  4F03 A;  1PRX A;  4N10 A;  1XW9 A;  5IMF A;  2L5O A;  3GUS A;  2CV4 A;  1PD2 1;  1WE0 A;  4HU9 A;  3SBC A;  4PXO A;  4BA7 A;  1A0R P;  3D4T A;  1O6J A;  1Y25 A;  2WDU A;  4K0G A;  3UMA A;  3MDK A;  4GCI A;  1F3A A;  2TIR A;  3GKM A;  2A2R A;  6GSX A;  1XZO A;  3F0I A;  5JWQ B;  2ZCT A;  5D96 A;  3ZRD A;  2ON5 A;  9GSS A;  3WD6 A;  1I5G A;  4EDZ A;  4DVC A;  1TOF A;  2M80 A;  2HE3 A;  5F8B A;  1SK2 A;  4TRX A;  5CRW A;  4I8B A;  2B7J A;  1XWC A;  1M2A A;  1YEW C;  2H1A A;  1SL0 B;  1PX7 A;  3WYW A;  1FAA A;  2XPD A;  4MF6 A;  1A0F A;  3BJ5 A;  2MMZ A;  4OO4 A;  3ERW A;  1UVZ A;  2YP6 A;  1LBK A;  1GUH A;  2DMM A;  5IPH A;  6GST A;  5J47 A;  2GS3 A;  2GT5 A;  1FG4 A;  12GS A;  2MMO A;  1K0M A;  3FYG A;  1TKD B;  3R3E A;  11GS A;  2C3N A;  4MJB A;  1W4V A;  4YQU A;  4BVY B;  2FUG 2;  2JL4 A;  2MBT A;  3C7M A;  1RW1 A;  2LST A;  4MZW A;  5ELA A;  4G0K A;  3GH9 A;  2H19 A;  2AAW A;  4TR1 B;  4BWQ A;  2A4V A;  1XFL A;  2HRK A;  3UL3 A;  2OKA A;  3F4S A;  2I3Y A;  1EEJ A;  3CBU A;  2ON7 A;  3LG6 A;  2RUF A;  2DJ1 A;  4MDC A;  1URM A;  2H8L A;  2FNO A;  1GSE A;  5G5F A;  5GST A;  3RHC A;  4TW5 A;  1GSF A;  3NOF A;  4IJI A;  2VL9 A;  3GH6 A;  1YKA A;  2VCQ A;  1U87 A;  4DSR A;  3F63 A;  5A1N B;  1QMV A;  4PUR A;  5A5H B;  2OE0 A;  4AKH A;  2E2G A;  3MIX A;  1MDI A;  3RFR C;  5GSS A;  1OC9 B;  4OCF A;  2R37 A;  2RM5 A;  3TKS C;  2AV4 A;  2PVO C;  1GL8 A;  3IC4 A;  1GTI A;  3BCI A;  4X43 A;  2P0G A;  1AQV A;  2QGV A;  2VCZ A;  2H70 A;  2C3Q A;  4D73 A;  1JZO A;  1G6W A;  3GRX A;  1M2D A;  4GQF A;  4NXI A;  3H93 A;  5CRD A;  4E8E A;  4GWR A;  4MLY A;  4O92 A;  5G2Z A;  4EO3 A;  2GQM A;  1PN9 A;  2IL3 A;  2C0F A;  2LKU A;  2X64 A;  2CX4 A;  5AN1 A;  1GP1 A;  3O6T A;  5IO2 A;  1Z3E A;  2F8A A;  1WJK A;  3KJY A;  2IFQ A;  2WCI A;  1K0D A;  3LSZ A;  2VCV A;  1ZCP A;  4WKW A;  3E9J B;  4NHW A;  3UVT A;  3ZFB A;  5J9C A;  1Z6N A;  4KGI A;  5HFI A;  3MYD A;  4ZL9 A;  4EL1 A;  5ECL B;  2BJX A;  3HY2 A;  3U5R E;  3QAG A;  5B8A A;  3KD0 A;  3C8E A;  1K3O A;  1SJI A;  1GLQ A;  5HQP A;  1XWG A;  4KAE A;  2OE1 A;  2R3X A;  2AYT A;  3TKR A;  3FEU A;  5D9W A;  1R4W A;  3CSI A;  3KH9 A;  1AAZ A;  1V9W A;  2DSA A;  4O5U A;  5LCZ A;  4RQX A;  1Y1U A;  3HYP A;  2H66 A;  1Q98 A;  3QDN A;  3VUR A;  1THX A;  2YN1 A;  4O7H A;  2HI7 A;  4GST A;  3VPQ A;  2DJ3 A;  3TJJ A;  1V58 A;  5GAP D;  3UIW A;  4ZXG A;  2UZ8 A;  2B1L A;  1XIY A;  22GS A;  2A4H A;  4TVE A;  2HSN A;  1B4P A;  3VPT A;  2FWE A;  1YEX A;  1KBN A;  1ZOF A;  4KH7 A;  1N8J A;  3DGQ A;  1TTZ A;  4XTS A;  1EOH A;  5H5R A;  4OFM A;  4K6X A;  1LU4 A;  4GRF A;  4GXZ A;  2OA7 A;  2CVK A;  5F05 A;  3EU3 A;  4ECJ A;  1T8E B;  1X0R A;  2JZS A;  2VM2 A;  4XIH A;  3FZA A;  3ZVJ A;  3TJF A;  5FT3 A;  4MJA A;  2IWT A;  2NTO A;  5G1L A;  3KMN A;  3ZIV A;  3TKQ A;  4I97 A;  3LXZ A;  3BD2 A;  2KUC A;  3GIX A;  4IQ1 A;  3IRA A;  4HOJ A;  1XOB A;  2RII A;  2B3S A;  4F0B A;  1XOA A;  4A5P A;  4KDY A;  1E2Y A;  3Q18 A;  2H6Y A;  2YZH A;  2HLS A;  3EWL A;  3DRN A;  4KE3 A;  4W66 A;  1WMJ A;  3A5W A;  1EP8 A;  5B8B A;  3TUE A;  1GNW A;  1K0B A;  4HEA 2;  3WGX A;  2R0C A;  3ED3 A;  3MSZ A;  4HJM A;  1U6T A;  4DSS A;  4ECB A;  2L6C A;  5G5E A;  1SVO A;  3HZ4 A;  1M3I A;  4MAB A;  4K2X A;  3GTU B;  1FOV A;  3N9J A;  6GSV A;  1BED A;  2VCW A;  2D2Z A;  3G9B A;  3IDV A;  5DAK A;  1M9B A;  1M99 A;  4NAX A;  2BMX A;  1PL1 A;  1Z7R A;  2DKI A;  3IBH A;  1GWC A;  2ALB A;  1AC1 A;  4V2M A;  5J4V A;  4F82 A;  1FO5 A;  4ZIL A;  4MPF A;  2AUV A;  2P31 A;  3FRC A;  1JZW A;  1H75 A;  4IGJ A;  4EUY A;  1AUC A;  3ME7 A;  4XS6 A;  3RAZ A;  4ZBA A;  2OAD A;  5IPG A;  3J7Y b;  2O7K A;  1M7T A;  1OAZ A;  1MDJ A;  2GT6 A;  4L8E A;  3TCO A;  16GS A;  4BVX A;  2K9F A;  4JE1 A;  2VKZ G;  3BBY A;  4YH2 A;  3EMP A;  3EPT A;  3H79 A;  3DKS A;  4K2D A;  4KB3 A;  1SJ6 A;  2EC4 A;  2O5V A;  2HSH A;  2DC5 A;  2JAD A;  3GKN A;  3LGC A;  2QA1 A;  1SL2 B;  1T3B A;  3O3T A;  1GH2 A;  2HT9 A;  2IN3 A;  1XCC A;  4QQ7 A;  3APS A;  2WW2 A;  1U3A A;  2X4A A;  1YZX A;  3VWX A;  2HNL A;  4AGS A;  4MMM A;  5A34 A;  3TDG A;  4PTS A;  3VWU A;  2OBK A;  2VO4 A;  1EZK A;  1BG1 A;  3ZLP A;  1A2L A;  2G0F A;  1R5A A;  2JU5 A;  3A3T A;  2HRK B;  3ISO A;  2EIR A;  4GSS A;  2EFH A;  4NV2 A;  2XBQ A;  4KSM A;  2F9S A;  2N5A A;  2A2P A;  2VCT A;  5HR3 A;  2GQL A;  3QFB C;  3L78 A;  2C3T A;  4PNG A;  2C8U A;  2IJY A;  3FZ4 A;  3KZQ A;  1GSY A;  2I81 A;  1I1I P;  5E59 A;  4HQS A;  1FOH A;  5BMU A;  3LW9 A;  3IE3 A;  1T00 A;  4QMK A;  2VLT A;  4OFT A;  2DJ0 A;  1YF0 A;  4BIK A;  3L9V A;  2V6K A;  2YV7 A;  2HRF A;  2ES7 A;  2FCH A;  3HVX A;  1G6Y A;  3KM6 A;  1GTB A;  4RI6 A;  4O32 A;  1SYX A;  4CDO A;  3QD9 A;  5A5K A;  2CQ9 A;  1PGT A;  2WW3 A;  3HD5 A;  1GSQ A;  4D73 B;  5CNW A;  2OT3 A;  5D9V A;  5KN3 A;  2LTK A;  5DCG A;  3GKK A;  4V1A g;  2FWH A;  4I2T A;  4AI6 A;  1U88 A;  2UV8 G;  2LRT A;  5CRE A;  4CY8 A;  2X99 A;  3GUR A;  3GN3 A;  1T4Y A;  2IPA A;  4POL A;  2RUE A;  3UJ1 A;  3DML A;  5D73 A;  5EPF A;  4FH8 A;  4MJC A;  4G9H A;  2B6M A;  2H0H A;  3IK7 A;  2DML A;  1XW5 A;  2IFQ B;  3TRX A;  2EFC A;  2XHF A;  3CYN A;  5GAN D;  1T1V A;  1N25 A;  4ZB9 A;  2DBC A;  4TXO A;  4ISD A;  1BQ7 A;  1PQN A;  3NIV A;  1EOG A;  2GVP A;  1U3I A;  4GTU A;  2O8V B;  1AW9 A;  2B1K A;  3APQ A;  4PHZ C;  4NHZ A;  2OJL A;  4O5R A;  3C1S A;  2N5B A;  2E0Q A;  2H1G A;  4AKI A;  4E68 A;  4K5S A;  3JCM L;  4JU5 A;  5EY6 A;  3HZ8 A;  3FW2 A;  2LV3 A;  4POK A;  3CTF A;  1F6M C;  6GSY A;  3IXR A;  2VCX A;  3PGT A;  4FIW A;  4XRA A;  3V1W A;  5IMV A;  1TP9 A;  5DBQ A;  2LJK A;  3EYT A;  3PIN A;  1BJX A;  2AHE A;  3M3M A;  2J23 A;  3ZTL A;  5DJL A;  4IVF A;  3C1R A;  4ZL8 A;  1XXU A;  2HSN B;  3VWW A;  3DWV A;  1GRX A;  1GTU A;  1X9W B;  4IKH A;  3F4R A;  4FO5 A;  3FK8 A;  3ZYW A;  4GLT A;  2HSY A;  4ZB6 A;  4XCS A;  5CRG A;  1J0F A;  3LJR A;  4J56 E;  3APO A;  4MP4 A;  3KMO A;  3UBK A;  4HDE A;  1R5P A;  3A2V A;  2GLR A;  2WUL A;  4N30 A;  1YEP A;  4GF0 A;  4OFN A;  4AJ7 A;  5DJM A;  5COH A;  3C73 A;  3L9S A;  2WGR A;  3IAS 2;  2L6D A;  2VD0 A;  2CA8 A;  1MEK A;  1ZYN A;  2VIM A;  2MMN A;  5ID2 A;  2O3E A;  1TXU A;  2N5F A;  2OE3 A;  2KOK A;  2KP1 A;  2GGT A;  1BX9 A;  4G0I A;  4EDY A;  3ZIT A;  1V57 A;  2FY6 A;  4Q5F A;  4FXY P;  4IS0 A;  2HRN A;  3HKR A;  3IPZ A;  4DSS B;  1O8X A;  2XC2 A;  1FB0 A;  3IOS A;  4EIQ A;  1CQG A;  3CRU A;  3BOA A;  3IK9 A;  2C4J A;  1NHO A;  1TJD A;  2CX3 A;  2K8V A;  4MJE A;  2WVY A;  1KEB A;  2JSZ A;  2H1D A;  3G7I A;  1K0C A;  1TK5 B;  1GSD A;  2LNT A;  4L5L A;  5DAK B;  4FYU A;  1F3B A;  3FZ9 A;  3LOR A;  3ZIJ A;  2C0E A;  4NMU A;  2CZ3 A;  3EVI A;  4F0C A;  1A23 A;  3HMJ G;  4GSN A;  4QL9 A;  1SK0 A;  4IJ3 A;  4G0L A;  4I2U A;  4MCU A;  5A4U A;  1XWA A;  1JZD A;  5H5S A;  5ECQ B;  10GS A;  3H8Q A;  3WT2 A;  2WVX A;  5J3R A;  2R2J A;  5CP1 A;  2V2G A;  4O5Q A;  2WJU A;  1OVN A;  2TRC P;  1EGR A;  1JLW A;  4OCE A;  5JWR B;  2A2S A;  4HI7 A;  3ME8 A;  5ECO B;  3UEM A;  4FYC A;  1WWJ A;  4WF5 A;  5IQY A;  3F3R A;  3A5I A;  1JHB A;  2KP2 A;  4BVX B;  1O85 A;  2VLU A;  2C80 A;  5KOW A;  2M72 A;  5FWG A;  2XPE A;  3TRP A;  2JSY A;  3MNG A;  1MTC A;  3CQF A;  4LL1 B;  2FGX A;  2H75 A;  4CHS A;  2LEG A;  4K9Z A;  2L4Q A;  3KGK A;  3I69 A;  4FQU A;  3FR9 A;  2MMA A;  2K18 A;  5B6N A;  1JLV A;  2VAF A;  1H4O A;  3W8S A;  3DXB A;  2PWJ A;  3D6I A;  3HVS A;  4BL7 A;  4WR4 A;  2FA8 A;  1ST9 A;  4ID0 A;  2AJQ B;  1EV9 A;  4RI7 A;  3TOT A;  2MYG A;  3EUR A;  5A34 B;  3VFI A;  3EIN A;  2GZZ A;  1GUK A;  2LQQ A;  2I1U A;  1E6B A;  4G01 A;  2HXK A;  2WS2 A;  4ICY A;  3M0F A;  1LJR A;  1V98 A;  3DVW A;  4Z7X A;  4XS4 A;  4AF2 A;  5IMD A;  1S3D A;  1M2B A;  1J08 A;  2YOI A;  1TW9 A;  1VF2 A;  5H5Q A;  2TRX A;  2KLX A;  1FHE A;  1M0U A;  3RGB C;  1QK8 A;  5ECP B;  5JWO B;  2R4V A;  1MD4 A;  3PH9 A;  4ACS A;  3EU4 A;  5AGY A;  3FR3 A;  4WF4 A;  4GDF A;  5BMU B;  5CAX A;  4J57 E;  2MZC A;  3HJM A;  2H73 A;  4I5Q A;  2ZNM A;  5FHI A;  4KDU A;  5LD0 A;  1VF3 A;  3GMF A;  4K7O A;  5J40 A;  3IHG A;  3RPN A;  6GSU A;  1SJZ A;  4IP1 A;  4EXJ A;  1HYU A;  1PSQ A;  4DSQ A;  5DAL A;  1X5C A;  2L5L A;  1JFU A;  1O73 A;  4POB A;  3E3E A;  2YJH A;  5LNK e;  3CMI A;  1GNE A;  2DJ2 A;  5C00 A;  2J9H A;  2VL2 A;  2WW1 A;  3IC8 A;  3KP9 A;  2IME A;  2V1M A;  5CYY A;  4ZBD A;  1S3C A;  2LUS A;  4LA1 A;  3PR8 A;  2HYX A;  1SKS B;  5IO0 A;  2VL2 C;  2P5R A;  2JZT A;  1USB A;  4JR6 A;  2M46 A;  3H1N A;  2HSM A;  1WP0 A;  2LNS A;  5IMA A;  5KN0 A;  3P7X A;  1X5E A;  4TXO B;  3DEX A;  3KCM A;  4JR4 A;  3FY7 A;  1ZMA A;  4MF5 A;  2LS5 A;  3KP8 A;  2O87 A;  1ZYE A;  4RUV A;  4X0X A;  5A4W A;  3CHX C;  4XRD A;  4TN8 A;  3LXT A;  4G10 A;  3TJK A;  4AJ8 A;  3HVV A;  4IP6 A;  5KN1 A;  2HZE A;  1OC8 A;  5G30 A;  3H4K A;  1XPV A;  5HR0 A;  1M9A A;  2H6Z A;  1Q4J A;  2H0G A;  4PGT A;  2YZU A;  3LYP A;  3RDW A;  4K7I A;  1V40 A;  3G7Y A;  2DJK A;  4ILF A;  3M1G A;  2R0G A;  1OC3 A;  1Z9H A;  3VI5 A;  2H30 A;  2YCD A;  2KHP A;  4MH2 A;  2DIY A;  2WRT A;  1NW2 A;  4HZ2 A;  3LEF A;  3GA4 A;  3QPM A;  3QFA C;  2IMD A;  3UAP A;  1SYR A;  3F9U A;  1AQX A;  4PQH A;  5G1K A;  1V2A A;  3QMX A;  3UOM A;  4L0W A;  3M8N A;  4NPB A;  5ECM B;  3VK9 A;  2FWG A;  3DIE A;  4X1U A;  4IQA A;  5ECR B;  2VOC A;  4KCA A;  2WZ9 A;  4BWS A;  1DE1 A;  4KUN A;  3HXS A;  3KH7 A;  2BTO T;  1T4Z A;  2F8F A;  3KTB A;  1W89 A;  1F2E A;  2NBS A;  3FZ5 A;  4HQZ A;  2DLX A;  2H1B A;  5ID2 B;  4EC0 A;  1TK8 B;  1DSB A;  1UC7 A;  5E4W A;  4PX1 A;  3TU3 B;  3KEB A;  4HUA A;  4ECC A;  3FKF A;  4KDX A;  1TRV A;  2HFD A;  2RLI A;  1Z5Y E;  3SWL A;  1A8Y A;  1ML6 A;  3GFK A;  2YWN A;  2GTU A;  3ZL5 A;  1QQ2 A;  4N0Z A;  3GYK A;  5J41 A;  2L4C A;  4DEJ A;  2NVL A;  2VUP A;  3P8W A;  5IM9 A;  4JED A;  5AIV A;  1RQM A;  2EIO A;  4YQV A;  4PUA A;  2YWO A;  4KCE A;  2EFE A;  3QOU A;  3GSS A;  1WPI A;  1SVL A;  5EVO A;  3HJP A;  1S3A A;  1MD3 A;  3HCZ A;  4YAV A;  2O85 A;  1SKW B;  2H72 A;  4MPG A;  1GLP A;  3GNJ A;  3HA9 A;  4G19 A;  3QCP A;  2H71 A;  3VWV A;  5IOX A;  2C0G A;  3US3 A;  4J2F A;  2O36 A;  5ENU A;  5HR1 A;  1G7O A;  1GUL A;  3A2W A;  2WVX B;  1NSW A;  1S3R A;  4Q5N A;  1R26 A;  2L57 A;  4RQR A;  4WET A;  1FVK A;  5ELG A;  1ON4 A;  3TB2 A;  1UN2 A;  4K5R A;  4L0U A;  3ZML A;  4PI0 C;  1VGL A;  5HR2 A;  5KN2 A;  3EMX A;  3HHV A;  3W8J A;  4LL4 B;  5HFG A;  6GSS A;  1GSU A;  1I9D A;  2PMT A;  4N11 A;  4WBJ A;  4TR3 A;  4MA9 A;  2WB9 A;  2LJR A;  1XVW A;  3RHB A;  1JZR A;  1YQ1 A;  3J7Y k;  8GSS A;  2PN8 A;  1X5D A;  1B9X C;  4AKG A;  2YWI A;  4N3Z A;  3DD3 A;  2H0I A;  1ERV A;  1BG5 A;  3Q19 A;  4BL7 B;  2C1Y A;  2PPT A;  2GST A;  4EVM A;  3P90 A;  1MDK A;  3GL3 A;  5IOW A;  4HJ2 A;  5J9B A;  3CSH A;  2H1L A;  4ECI A;  3C71 A;  2VLV A;  3I43 A;  1XWK A;  3CSJ A;  3OR5 A;  1X9M B;  4ZBB A;  4TKY A;  2DJJ A;  2HQT A;  2QA2 A;  1PKZ A;  4XS4 B;  3UVH A;  2PGT A;  3K8N A;  4WBR D;  2F51 A;  3GKX A;  1THO A;  4CY6 A;  1TI1 A;  3IV4 A;  2DKH A;  4ZIJ A;  4K1F A;  2GSQ A;  1Z7P A;  5CRH A;  3LQ7 A;  2GDR A;  1OYJ A;  4MNN A;  4KF9 A;  3D5J A;  4AKX B;  3AY8 A;  4MH3 A;  1OE8 A;  4PI2 C;  5DVB A;  4QL7 A;  3ZVJ D;  4JRR A;  13GS A;  2I4A A;  4ZL7 A;  4YAP A;  2FWF A;  4V1A p;  2CAI A;  2MBS A;  1GTA A;  3GX0 A;  1EV4 A;  1EP7 A;  1A24 A;  3GV1 A;  5DAL B;  5INY A;  5A4V A;  1SKR B;  2QKE A;  1R7H A;  4KA0 A;  4Q5Q A;  1YY7 A;  4LMW A;  4BPY A;  3TKS A;  3UBL A;  2YWM A;  1O7U A;  4KND A;  1Y6E A;  3F6D A;  3TJB A;  3U6V A;  2IMK A;  2GZP A;  4CW9 A;  2H74 A;  3N5O A;  1OKT A;  2QSI A;  5GZZ B;  1M3J A;  2X8G A;  2I9H A;  3D22 A;  4X4J A;  1TK0 B;  5F06 A;  1PX6 A;  3GX8 A;  3LYK A;  5DQS A;  4OWY A;  1ERW A;  2HSM B;  3ERG A;  1B9Y C;  2B5E A;  2EIQ A;  1QFN A;  3GST A;  4Z2T A;  3MWH A;  5B7C A;  1KNG A;  1VF4 A;  5HFK A;  1AIU A;  4OD7 A;  1O81 A;  4OO5 A;  4IN0 A;  1AXD A;  1K0O A;  2B5X A;  2FLS A;  2L59 A;  1WRY A;  1RK4 A;  4K7N A;  4Z2U A;  1ILO A;  2Z9S A;  2AB6 A;  5JCG A;  1HNA A;  1HQO A;  1OE7 A;  1HD2 A;  1GUM A;  5C04 A;  2HZE B;  1F9M A;  3GHA A;  4YKF A;  1BAY A;  4IEL A;  2PER A;  2IMI A;  3QR6 A;  2LJA A;  3S9F A;  1VF1 A;  4Q5R A;  2CVB A;  3TOU A;  5AIS A;  2K8S A;  3DYR A;  2X8C A;  1ACV A;  5D9X A;  5G31 A;  2VD1 A;  1BYE A;  1TU8 A;  1PKW A;  1PFO A;  3CWG A;  1O8W A;  3I9V 2;  2H01 A;  3EE2 A;  2WW0 A;  2F3M A;  1SL1 B;  2YJ7 A;  3KTL A;  1T7P B;  2CVD A;  1EWX A;  4WR5 A;  1Z6M A;  2YV9 A;  3TKS E;  3M9J A;  3WGE A;  6GSW A;  3W6G A;  3KXO A;  3HVN A;  4NWY A;  3CXG A;  1YVL A;  3ZZX A;  4K8M A;  1XWB A;  5EL8 A;  20GS A;  5KEJ A;  4MZB A;  1B48 A;  1SD8 A;  1QGV A;  5D9T A;  2R5G A;  4HZ4 A;  1VRS D;  2B5Y A;  5ABR A;  4YKG A;  1WIK A;  1YF1 A;  1NM3 A;  4PQI A;  5J4U A;  3F8U A;  4WXT A;  3LWA A;  2DIZ A;  3F6F A;  4OMV A;  4LLR A;  2C0D A;  4BVY A;  2H76 A;  1ZL9 A;  4E8H A;  2WFC A;  3VLN A;  2X49 A;  3IR4 A;  3RBT A;  1CQH A;  5IIZ A;  3F4T A;  3IHQ A;  1X9S B;  4ML1 A;  1WOU A;  3IA1 A;  4EF0 A;  4TR1 A;  1K0N A;  2HRA A;  2FA4 A;  19GS A;  4V2L A;  3ZRE A;  2REM A;  4LMV A;  1K3Y A;  2GSR A;  2WZS A;  2G2Q A;  3NZN A;  7GSS A;  1DBY A;  1BF5 A;  4K0N A;  3MAK A;  4KX4 A;  4HU7 A;  1SEN A;  4F2I A;  1TRS A;  1TDI A;  3I6A A;  1G0T A;  2HZF A;  3L9U A;  4V2N A;  2LRC A;  4ZB8 A;  5A1N A;  1QXH A;  1TXX A;  1S4B P;  5A5H A;  1TRU A;  1K0A A;  2PVQ A;  3BCK A;  3HDC A;  4PQ1 A;  1OC9 A;  3ERF A;  2K6V A;  4GQC A;  18GS A;  3FR6 A;  5CO3 A;  1AQW A;  1IYH A;  1N2A A;  4FYB A;  4TOP A;  1HNC A;  4KW6 A;  4JBB A;  4ZB7 A;  1A2M A;  3L0H A;  1A8L A;  2IIY A;  3D21 A;  5F0G A;  4AJ6 A;  1ZYQ B;  3M9K A;  1SU9 A;  1B4Q A;  1UA5 A;  3UAR A;  3Q74 A;  2JAC A;  1ERT A;  4USS A;  2XBI A;  2FD3 A;  1PN0 A;  3WGD A;  5IMC A;  4ML6 A;  4KSO A;  2CZ2 A;  4WEY A;  2QC7 A;  2O89 A;  1G7E A;  5DCH A;  1PA3 A;  3P2A A;  2CAQ A;  2GSS A;  2YNX A;  4NV5 A;  4IHU A;  2LRN A;  2GQK A;  3Q6O A;  1KTE A;  4TR4 A;  4N0V A;  1FW1 A;  2VM1 A;  2X8H A;  1TI3 A;  2GZY A;  1YKC A;  1YJ6 A;  4P3Y B;  5DDL A;  2R6K A;  4TXV A;  2V41 A;  3F3Q A;  4XHM A;  4HS1 A;  4MZC A;  4MK3 A;  5DQY A;  2NPB A;  1SVM A;  3LFL A;  1ZZY A;  5J4Y A;  2YPM A;  5KOX A;  1TRW A;  1J9B A;  2V6O A; 
#chains in the Genus database with same CATH homology
 5IMZ A;  3CRT A;  2OAC A;  1TU7 A;  3QAV A;  1EEM A;  4EIP A;  2B7K A;  2PUK C;  2ZUP A;  5B6M A;  2PBJ A;  2CT6 A;  4PUF C;  1XW6 A;  1DE2 A;  1PL2 A;  3VI7 A;  2OBI A;  1FB6 A;  3CTG A;  5JCU A;  5BRT A;  2EFD A;  2LQO A;  17GS A;  3D0Z A;  1A2J A;  4Z2R A;  3D4M A;  2P5Q A;  2V32 A;  5ECS A;  1GSS A;  1DUG A;  3ZMK A;  1F37 A;  3TJG A;  3EC3 A;  1HNB A;  3L4N A;  3IAM 2;  3QAW A;  2E2M A;  3HJO A;  2JZR A;  1XBS A;  14GS A;  2YAN A;  5ECK B;  1SD9 A;  3PPU A;  1PMT A;  1XVQ A;  4PNF A;  3DVX A;  1ERU A;  1IYI A;  4TR0 A;  5D8I A;  1ZGN A;  3ZFL A;  4H86 A;  3GL5 A;  4POM A;  2E7P A;  4F9Z A;  3TGZ A;  2NDO A;  2RM6 A;  3E0U A;  4EKZ A;  2R0P A;  4JZQ A;  3WT1 A;  5AIX A;  3O76 A;  5D93 A;  4EE0 A;  4ULX A;  1FVJ A;  5JCW A;  3TRQ A;  5ECI B;  3G7J A;  4YQM A;  2H6X A;  5F07 A;  4IBP A;  4L5O A;  2PU9 C;  1B8X A;  1QUW A;  3FMW A;  5J5N A;  3KIJ A;  1C72 A;  3A2X A;  3FHK A;  4I6X A;  1OKD A;  2IMF A;  1NHY A;  5ECN B;  1YDK A;  5ECH B;  1SK1 A;  4MF7 A;  1K3L A;  4IW9 A;  2FHE A;  3R2Q A;  3TKP A;  5L71 A;  3GTU A;  1EGO A;  1ABA A;  3RPP A;  4XS1 A;  1ZYP A;  2VL3 A;  4G2E A;  4F03 A;  1PRX A;  4N10 A;  1XW9 A;  5IMF A;  2L5O A;  3GUS A;  2CV4 A;  1PD2 1;  1WE0 A;  4HU9 A;  3SBC A;  4PXO A;  4BA7 A;  1A0R P;  3D4T A;  1O6J A;  1Y25 A;  2WDU A;  4K0G A;  3UMA A;  3MDK A;  4GCI A;  1F3A A;  2TIR A;  3GKM A;  2A2R A;  6GSX A;  1XZO A;  3F0I A;  5JWQ B;  2ZCT A;  5D96 A;  3ZRD A;  2ON5 A;  9GSS A;  3WD6 A;  1I5G A;  4EDZ A;  4DVC A;  1TOF A;  2M80 A;  2HE3 A;  5F8B A;  1SK2 A;  4TRX A;  5CRW A;  4I8B A;  2B7J A;  1XWC A;  1M2A A;  2H1A A;  1SL0 B;  1PX7 A;  3WYW A;  1FAA A;  2XPD A;  4MF6 A;  1A0F A;  3BJ5 A;  2MMZ A;  4OO4 A;  3ERW A;  1UVZ A;  2YP6 A;  1LBK A;  1GUH A;  2DMM A;  5IPH A;  6GST A;  5J47 A;  2GS3 A;  2GT5 A;  1FG4 A;  12GS A;  2MMO A;  1K0M A;  3FYG A;  1TKD B;  3R3E A;  11GS A;  2C3N A;  4MJB A;  1W4V A;  4YQU A;  4BVY B;  2FUG 2;  2JL4 A;  2MBT A;  3C7M A;  1RW1 A;  2LST A;  4MZW A;  5ELA A;  4G0K A;  3GH9 A;  2H19 A;  2AAW A;  4TR1 B;  4BWQ A;  2A4V A;  1XFL A;  2HRK A;  3UL3 A;  2OKA A;  3F4S A;  2I3Y A;  1EEJ A;  3CBU A;  2ON7 A;  3LG6 A;  2RUF A;  2DJ1 A;  4MDC A;  1URM A;  2H8L A;  2FNO A;  1GSE A;  5G5F A;  5GST A;  3RHC A;  4TW5 A;  1GSF A;  3NOF A;  4IJI A;  2VL9 A;  3GH6 A;  1YKA A;  2VCQ A;  1U87 A;  4DSR A;  3F63 A;  5A1N B;  1QMV A;  4PUR A;  5A5H B;  2OE0 A;  4AKH A;  2E2G A;  3MIX A;  1MDI A;  5GSS A;  1OC9 B;  4OCF A;  2R37 A;  2RM5 A;  3TKS C;  2AV4 A;  2PVO C;  1GL8 A;  3IC4 A;  1GTI A;  3BCI A;  4X43 A;  2P0G A;  1AQV A;  2QGV A;  2VCZ A;  2H70 A;  2C3Q A;  4D73 A;  1JZO A;  1G6W A;  3GRX A;  1M2D A;  4GQF A;  4NXI A;  3H93 A;  5CRD A;  4E8E A;  4GWR A;  4MLY A;  4O92 A;  5G2Z A;  4EO3 A;  2GQM A;  1PN9 A;  2IL3 A;  2C0F A;  2LKU A;  2X64 A;  2CX4 A;  5AN1 A;  1GP1 A;  3O6T A;  5IO2 A;  1Z3E A;  2F8A A;  1WJK A;  3KJY A;  2IFQ A;  2WCI A;  1K0D A;  3LSZ A;  2VCV A;  1ZCP A;  4WKW A;  3E9J B;  4NHW A;  3UVT A;  3ZFB A;  5J9C A;  1Z6N A;  4KGI A;  5HFI A;  3MYD A;  4ZL9 A;  4EL1 A;  5ECL B;  2BJX A;  3HY2 A;  3U5R E;  3QAG A;  5B8A A;  3KD0 A;  3C8E A;  1K3O A;  1SJI A;  1GLQ A;  5HQP A;  1XWG A;  4KAE A;  2OE1 A;  2R3X A;  2AYT A;  3TKR A;  3FEU A;  5D9W A;  1R4W A;  3CSI A;  3KH9 A;  1AAZ A;  1V9W A;  2DSA A;  4O5U A;  5LCZ A;  4RQX A;  1Y1U A;  3HYP A;  2H66 A;  1Q98 A;  3QDN A;  3VUR A;  1THX A;  2YN1 A;  4O7H A;  2HI7 A;  4GST A;  3VPQ A;  2DJ3 A;  3TJJ A;  1V58 A;  5GAP D;  3UIW A;  4ZXG A;  2UZ8 A;  2B1L A;  1XIY A;  22GS A;  2A4H A;  4TVE A;  2HSN A;  1B4P A;  3VPT A;  2FWE A;  1YEX A;  1KBN A;  1ZOF A;  4KH7 A;  1N8J A;  3DGQ A;  1TTZ A;  4XTS A;  1EOH A;  5H5R A;  4OFM A;  4K6X A;  1LU4 A;  4GRF A;  4GXZ A;  2OA7 A;  2CVK A;  5F05 A;  3EU3 A;  4ECJ A;  1T8E B;  1X0R A;  2JZS A;  2VM2 A;  4XIH A;  3FZA A;  3ZVJ A;  3TJF A;  5FT3 A;  4MJA A;  2IWT A;  2NTO A;  5G1L A;  3KMN A;  3ZIV A;  3TKQ A;  4I97 A;  3LXZ A;  3BD2 A;  2KUC A;  3GIX A;  4IQ1 A;  3IRA A;  4HOJ A;  1XOB A;  2RII A;  2B3S A;  4F0B A;  1XOA A;  4A5P A;  4KDY A;  1E2Y A;  3Q18 A;  2H6Y A;  2YZH A;  2HLS A;  3EWL A;  3DRN A;  4KE3 A;  4W66 A;  1WMJ A;  3A5W A;  1EP8 A;  5B8B A;  3TUE A;  1GNW A;  1K0B A;  4HEA 2;  3WGX A;  2R0C A;  3ED3 A;  3MSZ A;  4HJM A;  1U6T A;  4DSS A;  4ECB A;  2L6C A;  5G5E A;  1SVO A;  3HZ4 A;  4MAB A;  4K2X A;  3GTU B;  1FOV A;  3N9J A;  6GSV A;  1BED A;  2VCW A;  2D2Z A;  3G9B A;  3IDV A;  5DAK A;  1M9B A;  1M99 A;  4NAX A;  2BMX A;  1PL1 A;  1Z7R A;  2DKI A;  3IBH A;  1GWC A;  2ALB A;  1AC1 A;  4V2M A;  5J4V A;  4F82 A;  1FO5 A;  4ZIL A;  4MPF A;  2AUV A;  2P31 A;  3FRC A;  1JZW A;  1H75 A;  4IGJ A;  4EUY A;  1AUC A;  3ME7 A;  4XS6 A;  3RAZ A;  4ZBA A;  2OAD A;  5IPG A;  3J7Y b;  2O7K A;  1M7T A;  1OAZ A;  1MDJ A;  2GT6 A;  4L8E A;  3TCO A;  16GS A;  4BVX A;  2K9F A;  4JE1 A;  2VKZ G;  3BBY A;  4YH2 A;  3EMP A;  3EPT A;  3H79 A;  3DKS A;  4K2D A;  4KB3 A;  1SJ6 A;  2EC4 A;  2O5V A;  2HSH A;  2DC5 A;  2JAD A;  3GKN A;  3LGC A;  2QA1 A;  1SL2 B;  1T3B A;  3O3T A;  1GH2 A;  2HT9 A;  2IN3 A;  1XCC A;  4QQ7 A;  3APS A;  1U3A A;  2X4A A;  1YZX A;  3VWX A;  2HNL A;  4AGS A;  4MMM A;  5A34 A;  3TDG A;  4PTS A;  3VWU A;  2OBK A;  2VO4 A;  1EZK A;  1BG1 A;  3ZLP A;  1A2L A;  2G0F A;  1R5A A;  2JU5 A;  3A3T A;  2HRK B;  3ISO A;  2EIR A;  4GSS A;  2EFH A;  4NV2 A;  2XBQ A;  4KSM A;  2F9S A;  2N5A A;  2A2P A;  2VCT A;  5HR3 A;  2GQL A;  3QFB C;  3L78 A;  2C3T A;  4PNG A;  2C8U A;  2IJY A;  3FZ4 A;  3KZQ A;  1GSY A;  2I81 A;  5E59 A;  4HQS A;  1FOH A;  5BMU A;  3LW9 A;  3IE3 A;  1T00 A;  4QMK A;  2VLT A;  4OFT A;  2DJ0 A;  1YF0 A;  3L9V A;  2V6K A;  2YV7 A;  2HRF A;  2ES7 A;  2FCH A;  3HVX A;  1G6Y A;  3KM6 A;  1GTB A;  4RI6 A;  4O32 A;  1SYX A;  4CDO A;  3QD9 A;  5A5K A;  2CQ9 A;  1PGT A;  3HD5 A;  1GSQ A;  4D73 B;  5CNW A;  2OT3 A;  5D9V A;  5KN3 A;  2LTK A;  5DCG A;  3GKK A;  4V1A g;  2FWH A;  4I2T A;  4AI6 A;  1U88 A;  2UV8 G;  2LRT A;  5CRE A;  4CY8 A;  2X99 A;  3GUR A;  3GN3 A;  1T4Y A;  2IPA A;  4POL A;  2RUE A;  3UJ1 A;  3DML A;  5D73 A;  5EPF A;  4FH8 A;  4MJC A;  4G9H A;  2B6M A;  2H0H A;  3IK7 A;  2DML A;  1XW5 A;  2IFQ B;  3TRX A;  2EFC A;  2XHF A;  3CYN A;  5GAN D;  1T1V A;  1N25 A;  4ZB9 A;  2DBC A;  4TXO A;  4ISD A;  1BQ7 A;  1PQN A;  3NIV A;  1EOG A;  2GVP A;  1U3I A;  4GTU A;  2O8V B;  1AW9 A;  2B1K A;  3APQ A;  4NHZ A;  2OJL A;  4O5R A;  3C1S A;  2N5B A;  2E0Q A;  2H1G A;  4AKI A;  4E68 A;  4K5S A;  3JCM L;  4JU5 A;  5EY6 A;  3HZ8 A;  3FW2 A;  2LV3 A;  4POK A;  3CTF A;  1F6M C;  6GSY A;  3IXR A;  2VCX A;  3PGT A;  4FIW A;  4XRA A;  3V1W A;  5IMV A;  1TP9 A;  5DBQ A;  2LJK A;  3EYT A;  3PIN A;  1BJX A;  2AHE A;  3M3M A;  2J23 A;  3ZTL A;  5DJL A;  4IVF A;  3C1R A;  4ZL8 A;  1XXU A;  2HSN B;  3VWW A;  3DWV A;  1GRX A;  1GTU A;  1X9W B;  4IKH A;  3F4R A;  4FO5 A;  3FK8 A;  3ZYW A;  4GLT A;  2HSY A;  4ZB6 A;  4XCS A;  5CRG A;  1J0F A;  3LJR A;  4J56 E;  3APO A;  4MP4 A;  3KMO A;  3UBK A;  4HDE A;  1R5P A;  3A2V A;  2GLR A;  2WUL A;  4N30 A;  1YEP A;  4GF0 A;  4OFN A;  4AJ7 A;  5DJM A;  5COH A;  3C73 A;  3L9S A;  2WGR A;  3IAS 2;  2L6D A;  2VD0 A;  2CA8 A;  1MEK A;  1ZYN A;  2VIM A;  2MMN A;  5ID2 A;  1TXU A;  2N5F A;  2OE3 A;  2KOK A;  2KP1 A;  2GGT A;  1BX9 A;  4G0I A;  4EDY A;  3ZIT A;  1V57 A;  2FY6 A;  4Q5F A;  4IS0 A;  2HRN A;  3HKR A;  3IPZ A;  4DSS B;  1O8X A;  2XC2 A;  1FB0 A;  3IOS A;  4EIQ A;  1CQG A;  3CRU A;  3BOA A;  3IK9 A;  2C4J A;  1NHO A;  1TJD A;  2CX3 A;  2K8V A;  4MJE A;  1KEB A;  2JSZ A;  2H1D A;  3G7I A;  1K0C A;  1TK5 B;  1GSD A;  2LNT A;  4L5L A;  5DAK B;  4FYU A;  1F3B A;  3FZ9 A;  3LOR A;  3ZIJ A;  2C0E A;  4NMU A;  2CZ3 A;  3EVI A;  4F0C A;  1A23 A;  3HMJ G;  4GSN A;  4QL9 A;  1SK0 A;  4IJ3 A;  4G0L A;  4I2U A;  4MCU A;  5A4U A;  1XWA A;  1JZD A;  5H5S A;  5ECQ B;  10GS A;  3H8Q A;  3WT2 A;  5J3R A;  2R2J A;  5CP1 A;  2V2G A;  4O5Q A;  2WJU A;  1OVN A;  2TRC P;  1EGR A;  1JLW A;  4OCE A;  5JWR B;  2A2S A;  4HI7 A;  3ME8 A;  5ECO B;  3UEM A;  4FYC A;  1WWJ A;  4WF5 A;  5IQY A;  3F3R A;  3A5I A;  1JHB A;  2KP2 A;  4BVX B;  1O85 A;  2VLU A;  2C80 A;  5KOW A;  2M72 A;  5FWG A;  2XPE A;  3TRP A;  2JSY A;  3MNG A;  1MTC A;  4LL1 B;  2FGX A;  2H75 A;  4CHS A;  2LEG A;  4K9Z A;  2L4Q A;  3KGK A;  3I69 A;  4FQU A;  3FR9 A;  2MMA A;  2K18 A;  5B6N A;  1JLV A;  2VAF A;  1H4O A;  3W8S A;  3DXB A;  2PWJ A;  3D6I A;  3HVS A;  4BL7 A;  4WR4 A;  2FA8 A;  1ST9 A;  4ID0 A;  2AJQ B;  1EV9 A;  4RI7 A;  3TOT A;  2MYG A;  3EUR A;  5A34 B;  3VFI A;  3EIN A;  2GZZ A;  1GUK A;  2LQQ A;  2I1U A;  1E6B A;  4G01 A;  2HXK A;  2WS2 A;  4ICY A;  3M0F A;  1LJR A;  1V98 A;  3DVW A;  4Z7X A;  4XS4 A;  4AF2 A;  5IMD A;  1S3D A;  1M2B A;  1J08 A;  2YOI A;  1TW9 A;  1VF2 A;  5H5Q A;  2TRX A;  2KLX A;  1FHE A;  1M0U A;  1QK8 A;  5ECP B;  5JWO B;  2R4V A;  1MD4 A;  3PH9 A;  4ACS A;  3EU4 A;  5AGY A;  3FR3 A;  4WF4 A;  4GDF A;  5BMU B;  5CAX A;  4J57 E;  2MZC A;  3HJM A;  2H73 A;  4I5Q A;  2ZNM A;  5FHI A;  4KDU A;  5LD0 A;  1VF3 A;  3GMF A;  4K7O A;  5J40 A;  3IHG A;  3RPN A;  6GSU A;  1SJZ A;  4IP1 A;  4EXJ A;  1HYU A;  1PSQ A;  4DSQ A;  5DAL A;  1X5C A;  2L5L A;  1JFU A;  1O73 A;  4POB A;  3E3E A;  2YJH A;  5LNK e;  3CMI A;  1GNE A;  2DJ2 A;  5C00 A;  2J9H A;  2VL2 A;  3IC8 A;  3KP9 A;  2IME A;  2V1M A;  5CYY A;  4ZBD A;  1S3C A;  2LUS A;  4LA1 A;  3PR8 A;  2HYX A;  1SKS B;  5IO0 A;  2VL2 C;  2P5R A;  2JZT A;  1USB A;  4JR6 A;  2M46 A;  3H1N A;  2HSM A;  1WP0 A;  2LNS A;  5IMA A;  5KN0 A;  3P7X A;  1X5E A;  4TXO B;  3DEX A;  3KCM A;  4JR4 A;  3FY7 A;  1ZMA A;  4MF5 A;  2LS5 A;  3KP8 A;  2O87 A;  1ZYE A;  4RUV A;  4X0X A;  5A4W A;  4XRD A;  4TN8 A;  3LXT A;  4G10 A;  3TJK A;  4AJ8 A;  3HVV A;  4IP6 A;  5KN1 A;  2HZE A;  1OC8 A;  5G30 A;  3H4K A;  1XPV A;  5HR0 A;  1M9A A;  2H6Z A;  1Q4J A;  2H0G A;  4PGT A;  2YZU A;  3LYP A;  3RDW A;  4K7I A;  1V40 A;  3G7Y A;  2DJK A;  4ILF A;  3M1G A;  2R0G A;  1OC3 A;  1Z9H A;  3VI5 A;  2H30 A;  2YCD A;  2KHP A;  4MH2 A;  2DIY A;  2WRT A;  1NW2 A;  4HZ2 A;  3LEF A;  3GA4 A;  3QPM A;  3QFA C;  2IMD A;  3UAP A;  1SYR A;  3F9U A;  1AQX A;  4PQH A;  5G1K A;  1V2A A;  3QMX A;  3UOM A;  4L0W A;  3M8N A;  4NPB A;  5ECM B;  3VK9 A;  2FWG A;  3DIE A;  4X1U A;  4IQA A;  5ECR B;  2VOC A;  4KCA A;  2WZ9 A;  4BWS A;  1DE1 A;  4KUN A;  3HXS A;  3KH7 A;  2BTO T;  1T4Z A;  2F8F A;  3KTB A;  1W89 A;  1F2E A;  2NBS A;  3FZ5 A;  4HQZ A;  2DLX A;  2H1B A;  5ID2 B;  4EC0 A;  1TK8 B;  1DSB A;  1UC7 A;  5E4W A;  4PX1 A;  3TU3 B;  3KEB A;  4HUA A;  4ECC A;  3FKF A;  4KDX A;  1TRV A;  2HFD A;  2RLI A;  1Z5Y E;  3SWL A;  1A8Y A;  1ML6 A;  3GFK A;  2YWN A;  2GTU A;  3ZL5 A;  1QQ2 A;  4N0Z A;  3GYK A;  5J41 A;  2L4C A;  4DEJ A;  2NVL A;  2VUP A;  3P8W A;  5IM9 A;  4JED A;  5AIV A;  1RQM A;  2EIO A;  4YQV A;  4PUA A;  2YWO A;  4KCE A;  2EFE A;  3QOU A;  3GSS A;  1WPI A;  1SVL A;  5EVO A;  3HJP A;  1S3A A;  1MD3 A;  3HCZ A;  4YAV A;  2O85 A;  1SKW B;  2H72 A;  4MPG A;  1GLP A;  3GNJ A;  3HA9 A;  4G19 A;  3QCP A;  2H71 A;  3VWV A;  5IOX A;  2C0G A;  3US3 A;  4J2F A;  5ENU A;  5HR1 A;  1G7O A;  1GUL A;  3A2W A;  1NSW A;  4Q5N A;  1R26 A;  2L57 A;  4RQR A;  4WET A;  1FVK A;  5ELG A;  1ON4 A;  3TB2 A;  1UN2 A;  4K5R A;  4L0U A;  3ZML A;  1VGL A;  5HR2 A;  5KN2 A;  3EMX A;  3HHV A;  3W8J A;  4LL4 B;  5HFG A;  6GSS A;  1GSU A;  1I9D A;  2PMT A;  4N11 A;  4WBJ A;  4TR3 A;  4MA9 A;  2WB9 A;  2LJR A;  1XVW A;  3RHB A;  1JZR A;  1YQ1 A;  3J7Y k;  8GSS A;  2PN8 A;  1X5D A;  1B9X C;  4AKG A;  2YWI A;  4N3Z A;  3DD3 A;  2H0I A;  1ERV A;  1BG5 A;  3Q19 A;  4BL7 B;  2C1Y A;  2PPT A;  2GST A;  4EVM A;  3P90 A;  1MDK A;  3GL3 A;  5IOW A;  4HJ2 A;  5J9B A;  3CSH A;  2H1L A;  4ECI A;  3C71 A;  2VLV A;  3I43 A;  1XWK A;  3CSJ A;  3OR5 A;  1X9M B;  4ZBB A;  4TKY A;  2DJJ A;  2HQT A;  2QA2 A;  1PKZ A;  4XS4 B;  3UVH A;  2PGT A;  3K8N A;  4WBR D;  2F51 A;  3GKX A;  1THO A;  4CY6 A;  1TI1 A;  3IV4 A;  2DKH A;  4ZIJ A;  4K1F A;  2GSQ A;  1Z7P A;  5CRH A;  3LQ7 A;  2GDR A;  1OYJ A;  4MNN A;  4KF9 A;  3D5J A;  4AKX B;  3AY8 A;  4MH3 A;  1OE8 A;  5DVB A;  4QL7 A;  3ZVJ D;  4JRR A;  13GS A;  2I4A A;  4ZL7 A;  4YAP A;  2FWF A;  4V1A p;  2CAI A;  2MBS A;  1GTA A;  3GX0 A;  1EV4 A;  1EP7 A;  1A24 A;  3GV1 A;  5DAL B;  5INY A;  5A4V A;  1SKR B;  2QKE A;  1R7H A;  4KA0 A;  4Q5Q A;  1YY7 A;  4LMW A;  4BPY A;  3TKS A;  3UBL A;  2YWM A;  1O7U A;  4KND A;  1Y6E A;  3F6D A;  3TJB A;  3U6V A;  2IMK A;  2GZP A;  4CW9 A;  2H74 A;  3N5O A;  1OKT A;  2QSI A;  5GZZ B;  2X8G A;  2I9H A;  3D22 A;  4X4J A;  1TK0 B;  5F06 A;  1PX6 A;  3GX8 A;  3LYK A;  5DQS A;  4OWY A;  1ERW A;  2HSM B;  3ERG A;  1B9Y C;  2B5E A;  2EIQ A;  1QFN A;  3GST A;  4Z2T A;  3MWH A;  5B7C A;  1KNG A;  1VF4 A;  5HFK A;  1AIU A;  4OD7 A;  1O81 A;  4OO5 A;  4IN0 A;  1AXD A;  1K0O A;  2B5X A;  2FLS A;  2L59 A;  1WRY A;  1RK4 A;  4K7N A;  4Z2U A;  1ILO A;  2Z9S A;  2AB6 A;  5JCG A;  1HNA A;  1HQO A;  1OE7 A;  1HD2 A;  1GUM A;  5C04 A;  2HZE B;  1F9M A;  3GHA A;  4YKF A;  1BAY A;  4IEL A;  2PER A;  2IMI A;  3QR6 A;  2LJA A;  3S9F A;  1VF1 A;  4Q5R A;  2CVB A;  3TOU A;  5AIS A;  2K8S A;  3DYR A;  2X8C A;  1ACV A;  5D9X A;  5G31 A;  2VD1 A;  1BYE A;  1TU8 A;  1PKW A;  3CWG A;  1O8W A;  3I9V 2;  2H01 A;  3EE2 A;  2F3M A;  1SL1 B;  2YJ7 A;  3KTL A;  1T7P B;  2CVD A;  1EWX A;  4WR5 A;  1Z6M A;  2YV9 A;  3TKS E;  3M9J A;  3WGE A;  6GSW A;  3W6G A;  3KXO A;  4NWY A;  3CXG A;  1YVL A;  3ZZX A;  4K8M A;  1XWB A;  5EL8 A;  20GS A;  5KEJ A;  4MZB A;  1B48 A;  1SD8 A;  1QGV A;  5D9T A;  2R5G A;  4HZ4 A;  1VRS D;  2B5Y A;  5ABR A;  4YKG A;  1WIK A;  1YF1 A;  1NM3 A;  4PQI A;  5J4U A;  3F8U A;  4WXT A;  3LWA A;  2DIZ A;  3F6F A;  4OMV A;  4LLR A;  2C0D A;  4BVY A;  2H76 A;  1ZL9 A;  4E8H A;  2WFC A;  3VLN A;  2X49 A;  3IR4 A;  3RBT A;  1CQH A;  5IIZ A;  3F4T A;  3IHQ A;  1X9S B;  4ML1 A;  1WOU A;  3IA1 A;  4EF0 A;  4TR1 A;  1K0N A;  2HRA A;  2FA4 A;  19GS A;  4V2L A;  3ZRE A;  2REM A;  4LMV A;  1K3Y A;  2GSR A;  2G2Q A;  3NZN A;  7GSS A;  1DBY A;  1BF5 A;  4K0N A;  3MAK A;  4KX4 A;  4HU7 A;  1SEN A;  4F2I A;  1TRS A;  1TDI A;  3I6A A;  1G0T A;  2HZF A;  3L9U A;  4V2N A;  2LRC A;  4ZB8 A;  5A1N A;  1QXH A;  1TXX A;  5A5H A;  1TRU A;  1K0A A;  2PVQ A;  3BCK A;  3HDC A;  4PQ1 A;  1OC9 A;  3ERF A;  2K6V A;  4GQC A;  18GS A;  3FR6 A;  5CO3 A;  1AQW A;  1IYH A;  1N2A A;  4FYB A;  4TOP A;  1HNC A;  4KW6 A;  4JBB A;  4ZB7 A;  1A2M A;  3L0H A;  1A8L A;  2IIY A;  3D21 A;  5F0G A;  4AJ6 A;  1ZYQ B;  3M9K A;  1SU9 A;  1B4Q A;  1UA5 A;  3UAR A;  3Q74 A;  2JAC A;  1ERT A;  4USS A;  2XBI A;  2FD3 A;  1PN0 A;  3WGD A;  5IMC A;  4ML6 A;  4KSO A;  2CZ2 A;  4WEY A;  2QC7 A;  2O89 A;  1G7E A;  5DCH A;  1PA3 A;  3P2A A;  2CAQ A;  2GSS A;  2YNX A;  4NV5 A;  4IHU A;  2LRN A;  2GQK A;  3Q6O A;  1KTE A;  4TR4 A;  4N0V A;  1FW1 A;  2VM1 A;  2X8H A;  1TI3 A;  2GZY A;  1YKC A;  1YJ6 A;  4P3Y B;  5DDL A;  2R6K A;  4TXV A;  2V41 A;  3F3Q A;  4XHM A;  4HS1 A;  4MZC A;  4MK3 A;  5DQY A;  2NPB A;  1SVM A;  3LFL A;  1ZZY A;  5J4Y A;  2YPM A;  5KOX A;  1TRW A;  1J9B A;  2V6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...