3VLNA

Human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
239
structure length
239
Chain Sequence
GESARSLGKGSAPPGPVPEGSIRIYSMRFSPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase omega-1
publication title Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 239
sequence length 239
ec nomenclature ec 1.20.4.2: Methylarsonate reductase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vlnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vlnA01
2MBTA 3UVTA 3ZIJA 4TVEA 1YEPA 1M9BA 4IBPA 1A2JA 1X9WB 4KE3A 4MH2A 4OCEA 2OJLA 4XCSA 3GFKA 1WPIA 4N30A 2H6YA 4AJ6A 3LXTA 4RQRA 3N5OA 2V41A 4WETA 3U5RE 5D73A 3UBLA 3QFAC 4XRAA 1EWXA 1XOBA 6GSXA 4Q5RA 2GSSA 4XS6A 2C0DA 1G6WA 4MPGA 4AJ7A 3IAM2 5IMCA 1QMVA 3PR8A 1NHOA 3LFLA 4F0BA 2DIZA 3ZTLA 4I5QA 1N8JA 1YKCA 1WOUA 5ECSA 3H79A 4FIWA 4MJEA 2VL2A 5DAKB 1J08A 2NPBA 2LUSA 1MDJA 3ZVJA 5IO2A 3C8EA 2H6ZA 5F05A 3TRXA 2P0GA 4EUYA 5CRHA 4Q5QA 2VIMA 3W8SA 3EU3A 1X9SB 4AGSA 1X5CA 1ZCPA 1O7UA 2YWNA 3DD3A 3IAS2 2HSNB 2ZUPA 5GSTA 3D4MA 17GSA 2E7PA 1YJ6A 1T4YA 4JRRA 5C00A 3QAWA 3PGTA 2L59A 2IMDA 1PX6A 3PPUA 2IN3A 2JADA 1PN9A 1GWCA 1RK4A 3DXBA 2PWJA 1BG5A 5ECQB 3ZRDA 1TRWA 4GTUA 2AUVA 1B48A 2O87A 1AW9A 5B7CA 4XS1A 1K0NA 4HUAA 2K8SA 4RI7A 2HI7A 4HS1A 3M9KA 3FEUA 5IO0A 3VWWA 4IP1A 4LLRA 1GTIA 1A8YA 2MBSA 3FZ5A 2VLVA 3D5JA 4POKA 4POMA 2RM5A 1MEKA 2LNSA 4PQIA 2FA8A 1OE7A 4N0VA 3GHAA 1W4VA 1SK2A 2H72A 4GRFA 3VPQA 1BQ7A 2GLRA 5J5NA 1LJRA 1GULA 4E8EA 1TDIA 1U3IA 2F51A 4I2TA 1N2AA 3F6FA 2O8VB 4NHZA 2AAWA 4K7OA 2N5FA 3K8NA 2H76A 4PGTA 2LJRA 5CP1A 2H75A 1E6BA 1F2EA 5IOXA 4YQMA 1OVNA 1XIYA 1V9WA 4DVCA 4MZBA 4V2MA 4RUVA 3L4NA 2MMOA 1SKSB 5ECMB 1DE1A 4WEYA 1GRXA 2VUPA 2XPEA 3H8QA 4WXTA 2C80A 1B9YC 4V2NA 1O8WA 4BA7A 4KCAA 4GQCA 3RBTA 3GNJA 3FR9A 1QUWA 4K0GA 3VURA 4GSSA 1XFLA 4J2FA 2NBSA 4TRXA 2PU9C 1G0TA 2HZEB 3VWUA 2KP1A 1ERTA 2N5BA 1PMTA 4EO3A 5ID2B 2K8VA 5L71A 11GSA 4EDYA 1PA3A 4PURA 1XBSA 2H66A 1EZKA 3TJJA 2H1DA 4HU9A 5ELGA 4HI7A 5A4UA 3FKFA 2RUFA 4ECCA 2C0EA 2J23A 4K2DA 1EOGA 4MZWA 6GSYA 1WJKA 3LJRA 2LNTA 4ZB6A 3F3RA 1T1VA 1YZXA 5KN1A 1GNWA 1AAZA 2REMA 3KZQA 1FVKA 3M9JA 4TXVA 1HQOA 4MPFA 3A3TA 5HFKA 3APOA 3HZ8A 2HRKB 1GSYA 5EPFA 3BCKA 2DMMA 2WDUA 1B4QA 4MF5A 1DUGA 3ZVJD 3KM6A 2HSMB 1TK8B 2DMLA 1YY7A 2R4VA 4ZL8A 1Y6EA 4JE1A 1UN2A 3EWLA 2JZRA 3DRNA 4GXZA 3ZREA 2HSHA 22GSA 1SENA 2WS2A 4ML1A 4IS0A 2GZZA 1UVZA 1SYXA 4HZ4A 2WGRA 1AQVA 1OYJA 2E2MA 3ZMLA 3LQ7A 2LJKA 3LEFA 3HJMA 1DE2A 1THXA 3HVSA 2LKUA 1JZDA 5D9WA 1OC9B 3P8WA 2L5OA 1SJIA 2DLXA 4KH7A 4MMMA 4DEJA 2HNLA 5F06A 3D22A 1OKTA 4HDEA 4XS4B 2LQQA 2R37A 5CRGA 3D0ZA 3L9SA 4ZL9A 1U3AA 1PKWA 4TR3A 3HZ4A 5FWGA 4GF0A 2MMAA 4KW6A 1RQMA 2LRTA 3OR5A 2GSTA 1ST9A 5A5KA 5ECLB 3FZAA 2YJHA 2YP6A 2QGVA 4F0CA 4KSOA 5ABRA 4BWSA 2YOIA 2LRCA 4HEA2 3VFIA 4AF2A 1IYIA 4CDOA 2ALBA 3BJ5A 1QFNA 4NPBA 4GCIA 2B5EA 2DIYA 4XHMA 1XWGA 4TR1B 1K0AA 5DALB 5G5EA 4OMVA 3C7MA 1JHBA 3WD6A 4K0NA 4OFTA 5JCGA 3TOUA 2H30A 3APQA 5DCHA 1TI3A 2NDOA 2YZHA 5D93A 1VF1A 1R26A 3UMAA 1K0BA 4IELA 2RLIA 2LSTA 1GTAA 3US3A 2VD1A 3GL5A 4JEDA 5HR1A 3GN3A 3QAVA 4FH8A 1XWKA 4PTSA 3CSHA 1WRYA 3GKNA 3A2WA 3QAGA 3TB2A 4HOJA 5HR3A 3ZMKA 2GTUA 1HD2A 4G19A 4YQUA 3DIEA 5DDLA 2HZEA 1JLWA 2YNXA 3TRQA 3HVVA 1TU8A 4KUNA 4IJIA 3VWXA 5F07A 5ID2A 5DBQA 3NOFA 3GH9A 1MD4A 2VD0A 3IA1A 5CRDA 2WCIA 3FR3A 3TGZA 3KH7A 2C3TA 1XW9A 5F0GA 2JU5A 4PNGA 1WMJA 4O5RA 3UVHA 4POBA 1AUCA 5KN0A 3ZFBA 16GSA 3GTUB 2JZTA 4FQUA 3VPTA 2DSAA 4EVMA 5IMAA 4NAXA 5IMFA 4QL9A 2ON7A 1GSUA 5B6NA 3GMFA 2DJ2A 2IPAA 2HRKA 2QC7A 3KH9A 2KLXA 2XBQA 4TKYA 4KGIA 5ELAA 3HYPA 1T4ZA 1VRSD 5CYYA 9GSSA 5JWOB 2JSZA 3FZ9A 2HSMA 2C3QA 5GZZB 4EE0A 4PQHA 5AGYA 1A8LA 3IR4A 1GLPA 3MNGA 3UARA 2FUG2 4N11A 4MZCA 5B8BA 1G7EA 1M2DA 3GH6A 4ECJA 5G1LA 3HY2A 4JU5A 1ZGNA 2KHPA 1Q98A 3D21A 6GSTA 2E2GA 3LYPA 1BJXA 3ZYWA 4XRDA 1EEJA 4OWYA 1C72A 2F8FA 2YCDA 3KCMA 2OE1A 4MA9A 1TK0B 4K1FA 4KNDA 3KP9A 2L4CA 1OC9A 3UIWA 1PD21 3PINA 3TJGA 4YQVA 3APSA 3NIVA 5D96A 1TOFA 1Q4JA 2KOKA 1K0DA 1Z9HA 3QDNA 4MP4A 4XS4A 2YWIA 1TW9A 1SL1B 3DYRA 3FHKA 1XWBA 3GKXA 2IIYA 1SKRB 2FWFA 4ECBA 2CAQA 2OE0A 2IMIA 1USBA 2PMTA 2NVLA 1M7TA 3MSZA 2YWMA 4F9ZA 1J9BA 1ZZYA 5E59A 2VOCA 5HFIA 18GSA 5G1KA 2DJ1A 2L4QA 1T8EB 4FYCA 2PERA 5DCGA 5EVOA 3GKKA 2FWGA 3GURA 1ACVA 4BPYA 4I97A 2O89A 3GV1A 4WR4A 4WR5A 4TR1A 2DJKA 3R2QA 5DALA 1TU7A 5G5FA 1AQWA 3ZIVA 4IP6A 1GSDA 3TRPA 4MLYA 3DGQA 1T00A 2HXKA 1W89A 3QFBC 4HU7A 2JL4A 1B8XA 5GAPD 2WJUA 4ECIA 2JZSA 2OA7A 1Y25A 2YZUA 1PL1A 1GP1A 1F3BA 3TKSE 5IIZA 19GSA 3M8NA 4K9ZA 1EP8A 4X1UA 5E4WA 2IMFA 2YPMA 3RPPA 2LV3A 4WBJA 4TR0A 4TOPA 1PQNA 4IHUA 3CMIA 3RAZA 3WGDA 3CRTA 2B3SA 3ED3A 3H1NA 4L5OA 4NHWA 2VAFA 3HXSA 3TKSC 2DC5A 4WKWA 5B6MA 3I6AA 4ZIJA 4HQZA 2FY6A 4KA0A 1TJDA 1GL8A 2ES7A 3EMPA 1PL2A 3EC3A 6GSWA 1M9AA 1FAAA 5COHA 1A0FA 2RIIA 1T3BA 1Z5YE 3TOTA 4BL7B 2FA4A 2CZ3A 3HVXA 1JZWA 3CSJA 4OCFA 3RHBA 2HRFA 2FCHA 2F9SA 2I9HA 2CAIA 3GTUA 4D73B 2R5GA 2A4VA 2LJAA 3IXRA 3C1SA 3FYGA 1XOAA 3FR6A 4HZ2A 3GUSA 3W8JA 1SL0B 4ZB9A 1FB0A 3CSIA 5KN3A 3QOUA 2CA8A 4DSSA 5JWRB 3BD2A 2X64A 4KF9A 1TKDB 2A2RA 1TTZA 5J9BA 4KCEA 1GUKA 1EV9A 2HT9A 1S3AA 3LGCA 2G0FA 3WT2A 1M0UA 2CX3A 1XW5A 1T7PB 4Q5FA 1ZMAA 2H0GA 3L78A 1R5PA 2K18A 3HA9A 2HQTA 1YEXA 1K3LA 1EGOA 3O76A 1X5DA 2CVDA 2G2QA 4EC0A 3GSSA 2PVOC 3IC8A 2AYTA 2J9HA 2TRXA 1RW1A 4NWYA 1K3OA 5G2ZA 5DAKA 3KP8A 4V2LA 2YJ7A 3H4KA 1BEDA 3RHCA 2TIRA 2B5XA 5GAND 4TN8A 4RI6A 1FOVA 5HR2A 4NXIA 1K0CA 1ZYEA 3QCPA 2X99A 5B8AA 5D9TA 7GSSA 4IKHA 5G31A 3A5WA 2K9FA 3ERGA 2YV9A 2MZCA 2KUCA 2I3YA 1NW2A 3BOAA 3Q6OA 1FVJA 1PGTA 3TJFA 3TKPA 4BVXB 1YDKA 3KD0A 3C73A 5JCUA 1F9MA 5CO3A 3GIXA 5LCZA 2OADA 2OACA 1V40A 4KSMA 4FO5A 3CXGA 1GNEA 1TI1A 3E0UA 3IK7A 4KDUA 2MYGA 2H1BA 2N5AA 3LWAA 1FG4A 1XCCA 3F4SA 3HJOA 1KBNA 4BWQA 1ABAA 1U87A 3W6GA 1M99A 2V32A 3F4RA 1OE8A 1HNBA 3KMOA 3P90A 1GLQA 5LD0A 5D9XA 2LEGA 2H19A 4FYUA 2K6VA 3IOSA 5IMVA 4BVYB 4XTSA 3LYKA 5HQPA 3LG6A 4YAPA 1URMA 3IPZA 2L57A 3N9JA 1K3YA 1YQ1A 4YH2A 4PQ1A 2XBIA 1AXDA 1PSQA 5AIVA 4ZBDA 1S3DA 4DSQA 3ERFA 2FLSA 1S3CA 3A2XA 3KTLA 1I9DA 1O81A 4BL7A 4EDZA 1MD3A 4X43A 3C71A 2HLSA 2AV4A 1HYUA 6GSUA 1XWCA 4MK3A 3D4TA 3KGKA 3J7Yk 4ZBBA 2VM2A 1XVWA 1V2AA 4NMUA 4D73A 4MF6A 1SD9A 1J0FA 3GX8A 5DQSA 2ON5A 3HKRA 4WF5A 3SBCA 1O8XA 4PUFC 1ERWA 1OC8A 3VK9A 2YV7A 2IL3A 1KNGA 1TP9A 2QSIA 2OKAA 2AHEA 2FHEA 5FT3A 1A2LA 3IV4A 2EC4A 1TRVA 3VWVA 2VLTA 2BJXA 1TRUA 1EV4A 3LSZA 1BX9A 1R7HA 1Z7PA 5ECKB 1QGVA 3DKSA 2I81A 3QR6A 2B7KA 3PH9A 3GRXA 1LU4A 3WGEA 4I6XA 3VI7A 4E8HA 3HDCA 2WRTA 5ECNB 2H8LA 3EYTA 3HJPA 2C4JA 3F8UA 3WGXA 2IMEA 3ZFLA 3WT1A 2DJ3A 1OC3A 3TCOA 2BTOT 2YWOA 1PX7A 2P5QA 4ID0A 1ILOA 3F9UA 5ECIB 3UOMA 2LS5A 4LMVA 3ME7A 2H1GA 4O92A 2JSYA 3GKMA 4ULXA 3TJBA 2V2GA 5DVBA 1AC1A 2F8AA 1GSEA 4ZILA 2H1AA 2PVQA 3O3TA 1TRSA 5DQYA 4IQAA 3R3EA 3I43A 3TKRA 4MDCA 4O7HA 2GSQA 2OBKA 5JWQB 3L0HA 4IVFA 4CW9A 3G7IA 4BVXA 3UBKA 3U6VA 2V6KA 2PPTA 1F3AA 2I4AA 5IM9A 2LRNA 3UL3A 2BMXA 1GSFA 4DSRA 4ZXGA 1U88A 1SJZA 1PRXA 4HJMA 2P31A 4CHSA 5IPHA 5KN2A 4JBBA 2R3XA 5IOWA 3L9UA 4IGJA 3ZZXA 1EGRA 3WYWA 4WF4A 4XIHA 1Z6NA 4EXJA 3RDWA 5ECPB 2HSYA 1QXHA 4QQ7A 3F3QA 2GQKA 3RPNA 2M72A 1TK5B 1FB6A 4MH3A 5ECRB 4G10A 1X5EA 1GUMA 3P7XA 4OFNA 4OD7A 5ENUA 1FO5A 1NSWA 5CNWA 3TJKA 2LTKA 3JCML 4O32A 4G2EA 4ILFA 3L9VA 3G7YA 5ECOB 2H01A 1MTCA 3ME8A 4BVYA 2VO4A 2GVPA 1Z7RA 2H74A 2HZFA 5IMDA 1QQ2A 1U6TA 2CX4A 2DJJA 2EIRA 2WFCA 2H6XA 1LBKA 1MDIA 2TRCP 4F2IA 2Z9SA 2A2SA 2PUKC 4L5LA 5EL8A 1OKDA 3QPMA 4MF7A 2H0HA 5AIXA 1ON4A 1A23A 1F37A 3DVWA 2DJ0A 1OAZA 6GSSA 1F6MC 3TDGA 1JLVA 2V6OA 3BBYA 2R2JA 3DWVA 3ZITA 3EU4A 1DSBA 1XZOA 1G7OA 1GTUA 2HRAA 3CRUA 1YF0A 3KJYA 4KAEA 1M2AA 2M46A 4I8BA 2ZNMA 5A4WA 1KEBA 3F6DA 3TUEA 2FWEA 4EF0A 1HNCA 4GQFA 5AISA 4OFMA 2FWHA 2XHFA 4TW5A 3AY8A 2B7JA 3EURA 4USSA 1H75A 1ERVA 1JZRA 1AIUA 2RM6A 4NV2A 2B6MA 5IMZA 4F82A 2XPDA 2JACA 4V1Ag 5GSSA 1ZL9A 4WBRD 4KB3A 5BMUA 2O85A 2HYXA 3DMLA 2VL9A 3Q18A 1GUHA 3CBUA 1XXUA 3CTGA 2GT5A 1VGLA 2VCQA 1H4OA 2M80A 3GX0A 4H86A 5DJMA 4KDXA 3FRCA 2VL3A 1XPVA 4K8MA 20GSA 2C3NA 3E3EA 2H0IA 2CQ9A 3IBHA 2IFQB 4F03A 2RUEA 4PNFA 3Q74A 2GSRA 4TXOB 1ML6A 2EIOA 1VF4A 3E9JB 4TR4A 3V1WA 2IWTA 1ZOFA 2VCWA 2C0FA 4EKZA 3IK9A 2CVBA 4JR6A 2CT6A 3IC4A 5F8BA 2X8GA 2L6DA 4HJ2A 1MDKA 1HNAA 3UEMA 5AN1A 2OBIA 3IE3A 4GSTA 1E2YA 4LL4B 4LL1B 3ERWA 3BCIA 2CZ2A 4LMWA 1WWJA 2L5LA 3GYKA 2QKEA 1UC7A 3CTFA 3HHVA 2I1UA 1VF2A 1GTBA 4FYBA 5IQYA 3EVIA 3IRAA 2WZ9A 4K6XA 4G0IA 1SJ6A 5CAXA 1KTEA 1XVQA 1SL2B 1A24A 4MCUA 2MMNA 4V1Ap 1IYHA 4G0KA 3F0IA 3GA4A 5LNKe 4HQSA 2VCZA 1JZOA 1R5AA 4OO5A 1UA5A 2VL2C 1O85A 2VCVA 3C1RA 4ISDA 1K0MA 4ZBAA 2GT6A 3F4TA 4JR4A 3MWHA 4P3YB 2CVKA 1SK1A 1XWAA 1EOHA 3I69A 1X0RA 4ZB8A 4IN0A 2X8CA 2B5YA 2C8UA 3ZL5A 4MJAA 2PN8A 2OE3A 1A0RP 4GSNA 3NZNA 3D6IA 2VLUA 1B9XC 2V1MA 4K7IA 3IDVA 3KEBA 2H70A 4Z7XA 4PX1A 4LA1A 2D2ZA 5J41A 1WE0A 2UZ8A 3MDKA 5H5RA 1ZYQB 4L8EA 2GZPA 1DBYA 4PXOA 4J57E 5CRWA 4POLA 4AJ8A 2MMZA 1K0OA 5A4VA 2YN1A 4PUAA 3FZ4A 3GSTA 5FHIA 5H5QA 3G9BA 2B1KA 2ZCTA 4KX4A 2XC2A 1GSSA 3LORA 3IHQA 2E0QA 2WB9A 5D9VA 3VI5A 3DVXA 4ACSA 3LXZA 2WULA 3FW2A 1WIKA 1O73A 3GL3A 4KDYA 10GSA 2B1LA 3F63A 4GWRA 5J3RA 3VLNA 4EL1A 1SU9A 4QL7A 4L0UA 1YKAA 1WP0A 1FHEA 4NV5A 3G7JA 2KP2A 4N0ZA 5J9CA 1AQXA 3TKQA 1V57A 2C1YA 5EY6A 3QMXA 2GQMA 2FD3A 1NHYA 2HE3A 4IQ1A 2NTOA 2HFDA 2P5RA 1NM3A 1GH2A 2H73A 3Q19A 1B4PA 4MJBA 1EEMA 2IFQA 5CREA 2AJQB 1YF1A 3HD5A 5IPGA 1I5GA 4MABA 3H93A 4TXOA 14GSA 2CV4A 1V58A 2O7KA 1SD8A 5H5SA 3DEXA 3S9FA 4IW9A 3KXOA 2IJYA 3UAPA 5DJLA 1BAYA 1O6JA 4K7NA 2AB6A 3KMNA 3FY7A 2PGTA 8GSSA 2GS3A 2GDRA 1TXXA 2GQLA 4RQXA 3I9V2 2IMKA 2H71A 4ZL7A 2PBJA 5D8IA 3EMXA 1VF3A 2FNOA 1EP7A 2C0GA 3M0FA 1CQHA 3O6TA 3J7Yb 1JFUA 5INYA 3EINA 1XW6A 3ZLPA 4L0WA 3P2AA 3SWLA 4IJ3A 3A2VA 3M1GA 2LQOA 3KTBA 2EIQA 5KEJA 1QK8A 2L6CA 2GGTA 3TKSA 1SK0A 3CYNA 1BYEA 4G9HA 2X8HA 4G0LA 5HFGA 5JCWA 3QD9A 2FGXA 2R6KA 1A2MA 1V98A 2GZYA 3FK8A 3EE2A 12GSA 5ECHB 1R4WA 5G30A 4I2UA 1PKZA 4X0XA 1X9MB 1M2BA 3ISOA 1THOA 4ML6A 1ERUA 4YAVA 5C04A 13GSA 4N10A 4OO4A 1Z3EA 3UJ1A 2VCXA 4JZQA 4J56E 2VCTA 5HR0A 3KIJA 4GLTA 1G6YA 1GSQA 5J4UA 1FW1A 1CQGA 2HRNA 2F3MA 3HCZA 3MAKA 3M3MA 1SKWB 4MJCA 1Z6MA 4Q5NA 4DSSB 6GSVA 1SYRA 2DBCA 2VM1A 2YANA
chains in the Genus database with same CATH superfamily
4G01A 2MBTA 3UVTA 3ZIJA 4TVEA 1YEPA 1M9BA 4IBPA 1A2JA 1X9WB 4KE3A 4MH2A 4OCEA 2OJLA 4XCSA 3GFKA 1WPIA 4N30A 2H6YA 4AJ6A 3LXTA 4RQRA 3N5OA 2V41A 4WETA 2WVZA 3U5RE 5D73A 3UBLA 3QFAC 4XRAA 1EWXA 1XOBA 6GSXA 4Q5RA 2GSSA 4XS6A 2C0DA 1G6WA 4MPGA 4AJ7A 3IAM2 5IMCA 1QMVA 3PR8A 1NHOA 3LFLA 4F0BA 2DIZA 3ZTLA 4I5QA 1N8JA 1YKCA 1WOUA 5ECSA 3LW9A 3H79A 4FIWA 4MJEA 2VL2A 5DAKB 1J08A 2NPBA 2LUSA 1MDJA 3ZVJA 5IO2A 3C8EA 2H6ZA 5F05A 3TRXA 2P0GA 4EUYA 5CRHA 4Q5QA 2VIMA 3W8SA 3EU3A 1X9SB 4AGSA 1X5CA 1ZCPA 1O7UA 2YWNA 3DD3A 3IAS2 2HSNB 2ZUPA 5GSTA 3D4MA 17GSA 2E7PA 1YJ6A 1T4YA 1M3IA 4JRRA 5C00A 3QAWA 3PGTA 5KOWA 2L59A 2IMDA 1PX6A 3PPUA 2IN3A 2JADA 1PN9A 1GWCA 1RK4A 3DXBA 2PWJA 1BG5A 5ECQB 3ZRDA 1TRWA 4GTUA 2AUVA 1B48A 2O87A 1AW9A 5B7CA 4XS1A 1K0NA 4HUAA 2K8SA 4RI7A 2HI7A 4HS1A 3M9KA 3FEUA 5IO0A 4QMKA 3VWWA 4IP1A 4LLRA 1GTIA 1A8YA 2MBSA 3FZ5A 2VLVA 3D5JA 4POKA 4POMA 2RM5A 1MEKA 2LNSA 4PQIA 2FA8A 1OE7A 4N0VA 3GHAA 1W4VA 1SK2A 2H72A 4GRFA 3VPQA 1BQ7A 2GLRA 5J5NA 1LJRA 1GULA 4E8EA 1TDIA 1U3IA 2F51A 4I2TA 1N2AA 3F6FA 2O8VB 4PI2C 4NHZA 2AAWA 1BG1A 4K7OA 2N5FA 3K8NA 2H76A 4PGTA 2LJRA 5CP1A 2H75A 4CY6A 1E6BA 1F2EA 5IOXA 4YQMA 1OVNA 1XIYA 1V9WA 4DVCA 4MZBA 4V2MA 4RUVA 3L4NA 2MMOA 1SKSB 5ECMB 1DE1A 4WEYA 1GRXA 2VUPA 2EFEA 2XPEA 3H8QA 4WXTA 2C80A 1B9YC 4V2NA 1O8WA 4BA7A 4W66A 4KCAA 2DKIA 4GQCA 3RBTA 3GNJA 4BIKA 3FR9A 1QUWA 4K0GA 3VURA 4GSSA 1XFLA 4J2FA 2NBSA 4TRXA 2PU9C 4AKXB 1G0TA 2HZEB 3VWUA 2KP1A 1ERTA 2N5BA 1PMTA 2QA1A 4EO3A 5ID2B 2K8VA 5L71A 11GSA 4EDYA 1PA3A 4PURA 1XBSA 2WVYA 2H66A 1EZKA 4N3ZA 4X4JA 3TJJA 2H1DA 4HU9A 5ELGA 4HI7A 5A4UA 3FKFA 2RUFA 4ECCA 2C0EA 2J23A 4K2DA 1EOGA 4MZWA 6GSYA 1WJKA 3LJRA 2LNTA 4ZB6A 5J4VA 3F3RA 1T1VA 1YZXA 5KN1A 1GNWA 1AAZA 2REMA 3KZQA 1FVKA 3M9JA 4TXVA 1HQOA 4MPFA 3A3TA 5HFKA 3APOA 3HZ8A 2HRKB 2HSNA 1GSYA 5EPFA 3BCKA 2EFCA 2WDUA 2DMMA 1B4QA 4MF5A 1DUGA 3ZVJD 3KM6A 2HSMB 5KOXA 1TK8B 2DMLA 1YY7A 2R4VA 4ZL8A 1Y6EA 4JE1A 1UN2A 3EWLA 2JZRA 3DRNA 4GXZA 3ZREA 2HSHA 22GSA 1SENA 2WS2A 4ML1A 4IS0A 2GZZA 1UVZA 1SYXA 4HZ4A 2R0PA 2WGRA 1AQVA 1OYJA 2E2MA 3ZMLA 3LQ7A 2LJKA 3LEFA 3HJMA 1DE2A 1THXA 3HVSA 2LKUA 1JZDA 5D9WA 1OC9B 3P8WA 2L5OA 1SJIA 2DLXA 4KH7A 4MMMA 4DEJA 2HNLA 5F06A 3D22A 1OKTA 4HDEA 4XS4B 2LQQA 2R37A 5CRGA 3D0ZA 3L9SA 4ZL9A 1U3AA 1PKWA 4TR3A 3HZ4A 5FWGA 4GF0A 2MMAA 4KW6A 1RQMA 2LRTA 3OR5A 2O5VA 5A5HB 2GSTA 1ST9A 5A5KA 5ECLB 3FZAA 2YJHA 2YP6A 2QGVA 4F0CA 4KSOA 5ABRA 4BWSA 2YOIA 2LRCA 4HEA2 3VFIA 4AF2A 1IYIA 4CDOA 2ALBA 3BJ5A 1QFNA 4NPBA 4GCIA 2B5EA 2DIYA 4XHMA 1XWGA 1I1IP 3FMWA 4TR1B 1K0AA 5DALB 5G5EA 4OMVA 3C7MA 1JHBA 3WD6A 4K0NA 4OFTA 5JCGA 3TOUA 2H30A 3APQA 5DCHA 1TI3A 2NDOA 2YZHA 5D93A 1VF1A 1R26A 3UMAA 1K0BA 4IELA 2RLIA 2LSTA 1GTAA 3US3A 3IHGA 2VD1A 3GL5A 4JEDA 5HR1A 3GN3A 3QAVA 4FH8A 1XWKA 4PTSA 3CSHA 1WRYA 4Z2TA 2X49A 3GKNA 3A2WA 3QAGA 3TB2A 4HOJA 5HR3A 3ZMKA 2GTUA 1HD2A 4G19A 4YQUA 3DIEA 5DDLA 2HZEA 1JLWA 2YNXA 3TRQA 3HVVA 1TU8A 3CQFA 4KUNA 4IJIA 3MYDA 1M3JA 3VWXA 5F07A 5ID2A 5A34B 5DBQA 5BRTA 3NOFA 3GH9A 4AKGA 1MD4A 2VD0A 3IA1A 5CRDA 2WCIA 3FR3A 3TGZA 3KH7A 4MNNA 2C3TA 1XW9A 5F0GA 2JU5A 4PNGA 2H1LA 1WMJA 4O5RA 3UVHA 4POBA 1AUCA 5KN0A 3ZFBA 4YKGA 16GSA 3GTUB 2JZTA 4FQUA 3VPTA 2DSAA 4EVMA 5IMAA 4NAXA 5IMFA 4QL9A 2ON7A 1GSUA 5B6NA 3GMFA 2DJ2A 2IPAA 2HRKA 2QC7A 3KH9A 2KLXA 2XBQA 4TKYA 4KGIA 5ELAA 3HYPA 1T4ZA 1VRSD 5CYYA 9GSSA 5JWOB 2JSZA 3FZ9A 2HSMA 2C3QA 5GZZB 4EE0A 4PQHA 5AGYA 1A8LA 3IR4A 1GLPA 3MNGA 3UARA 2FUG2 4N11A 4MZCA 5B8BA 1G7EA 1M2DA 3GH6A 4ECJA 5G1LA 3HY2A 4JU5A 1ZGNA 2KHPA 1Q98A 3D21A 6GSTA 2X4AA 2E2GA 3LYPA 1BJXA 3ZYWA 4XRDA 1EEJA 4OWYA 2WW0A 1C72A 2F8FA 2YCDA 3KCMA 2OE1A 4MA9A 4Z2UA 1TK0B 4K1FA 4KNDA 3KP9A 2L4CA 1OC9A 3UIWA 1PD21 3PINA 3TJGA 4YQVA 3APSA 3NIVA 5D96A 1TOFA 4AKIA 1Q4JA 2KOKA 1K0DA 1Z9HA 3QDNA 4MP4A 4XS4A 2YWIA 1TW9A 1SL1B 1SVLA 3DYRA 3HMJG 3FHKA 1XWBA 3GKXA 3A5IA 2IIYA 1SKRB 2FWFA 4ECBA 2CAQA 2OE0A 2IMIA 4Z2RA 1USBA 2PMTA 2VKZG 5A5HA 2NVLA 1M7TA 3MSZA 2YWMA 4F9ZA 1J9BA 1ZZYA 5E59A 4EIQA 2VOCA 5HFIA 18GSA 4GDFA 5G1KA 2DJ1A 2L4QA 1T8EB 4FYCA 2PERA 5DCGA 5EVOA 3GKKA 2FWGA 3GURA 1ACVA 4BPYA 4I97A 2O89A 3GV1A 4WR4A 4WR5A 4TR1A 2DJKA 1XG8A 3R2QA 5DALA 1TU7A 5G5FA 1AQWA 3ZIVA 4IP6A 1GSDA 3TRPA 3RGBC 3DGQA 4MLYA 4FXYP 1T00A 2HXKA 1W89A 3QFBC 4HU7A 2JL4A 1BF5A 1B8XA 5GAPD 2WJUA 4ECIA 2JZSA 2OA7A 1Y25A 1N25A 2YZUA 1PL1A 1GP1A 1F3BA 3TKSE 5IIZA 19GSA 3M8NA 4K9ZA 1EP8A 4X1UA 5E4WA 2IMFA 2DKHA 2YPMA 3RPPA 2LV3A 4WBJA 4TR0A 4TOPA 1PQNA 4IHUA 3CMIA 3RAZA 3WGDA 3CRTA 2B3SA 3ED3A 2UV8G 3H1NA 4L5OA 4NHWA 2VAFA 3HXSA 5A34A 2WW1A 3TKSC 2DC5A 4WKWA 5B6MA 3I6AA 4ZIJA 4HQZA 2FY6A 4KA0A 1TJDA 1GL8A 2ES7A 3EMPA 1PL2A 3EC3A 6GSWA 1M9AA 1FAAA 5COHA 1A0FA 2RIIA 1T3BA 1Z5YE 3TOTA 4BL7B 2FA4A 2CZ3A 3HVXA 1JZWA 3CSJA 4OCFA 5J40A 3RHBA 2HRFA 2FCHA 2F9SA 2I9HA 2CAIA 3GTUA 4D73B 2R5GA 2A4VA 2LJAA 3IXRA 3C1SA 3FYGA 1XOAA 3FR6A 4HZ2A 3GUSA 3W8JA 1SL0B 4ZB9A 2A4HA 2QA2A 1FB0A 2WW2A 3CSIA 5KN3A 3QOUA 2OT3A 2CA8A 4DSSA 5JWRB 3BD2A 2X64A 4KF9A 1TKDB 2A2RA 1TTZA 5J9BA 3RFRC 4KCEA 1GUKA 1EV9A 2HT9A 1S3AA 3LGCA 2G0FA 3WT2A 1M0UA 2CX3A 1XW5A 1T7PB 4Q5FA 1ZMAA 2H0GA 3L78A 3HA9A 1R5PA 2K18A 2HQTA 1YEXA 1K3LA 1EGOA 3O76A 1X5DA 2CVDA 2G2QA 4EC0A 3GSSA 2PVOC 3IC8A 2AYTA 2J9HA 2TRXA 1RW1A 4PHZC 4NWYA 1K3OA 5G2ZA 5DAKA 3KP8A 4V2LA 2YJ7A 3H4KA 1BEDA 3RHCA 2TIRA 2B5XA 5GAND 4TN8A 4RI6A 1FOVA 5HR2A 4NXIA 1K0CA 1ZYEA 3QCPA 2X99A 5B8AA 5D9TA 7GSSA 4IKHA 5G31A 3A5WA 2K9FA 3ERGA 2YV9A 2MZCA 2KUCA 2I3YA 1NW2A 3BOAA 4EIPA 3Q6OA 1FVJA 1PGTA 3TJFA 3TKPA 4BVXB 1YDKA 3KD0A 3C73A 5JCUA 1F9MA 5CO3A 3GIXA 5LCZA 2OADA 2OACA 1V40A 4KSMA 4FO5A 3CXGA 1GNEA 1TI1A 3E0UA 3IK7A 4KDUA 2MYGA 2H1BA 2N5AA 1TXUA 3LWAA 1FG4A 1XCCA 3F4SA 3HJOA 1KBNA 4BWQA 1ABAA 1U87A 3W6GA 1M99A 2V32A 3F4RA 1OE8A 1HNBA 3KMOA 3P90A 1GLQA 5LD0A 5D9XA 2LEGA 2H19A 4FYUA 2K6VA 3IOSA 5IMVA 4CY8A 4BVYB 4XTSA 3LYKA 5HQPA 3LG6A 4YAPA 1URMA 5J4YA 2L57A 3IPZA 3N9JA 1K3YA 1YQ1A 4YH2A 3TU3B 4PQ1A 3CHXC 2XBIA 1AXDA 1PSQA 5AIVA 4ZBDA 1S3DA 4DSQA 3ERFA 2FLSA 1S3CA 3A2XA 3KTLA 1I9DA 1O81A 4BL7A 4EDZA 1MD3A 5A1NB 4X43A 3C71A 2HLSA 2AV4A 1HYUA 6GSUA 1XWCA 4MK3A 3D4TA 3KGKA 3J7Yk 4ZBBA 2VM2A 1XVWA 1V2AA 4NMUA 4D73A 4AKHA 4MF6A 1SD9A 1J0FA 3GX8A 5DQSA 2ON5A 3HKRA 4WF5A 4K2XA 3SBCA 1O8XA 4PUFC 1ERWA 1OC8A 3VK9A 2YV7A 2IL3A 1KNGA 1TP9A 2QSIA 2OKAA 2AHEA 2FHEA 5FT3A 1A2LA 3IV4A 2EC4A 1TRVA 3VWVA 2VLTA 2BJXA 1TRUA 1EV4A 3LSZA 1BX9A 1R7HA 1Z7PA 5ECKB 1QGVA 3DKSA 2I81A 3QR6A 2B7KA 3PH9A 3GRXA 1LU4A 3WGEA 4O5QA 4I6XA 3VI7A 4E8HA 3HDCA 2WRTA 5BMUB 5ECNB 2H8LA 3EYTA 2O3EA 3HJPA 2C4JA 3F8UA 3WGXA 2IMEA 3ZFLA 3WT1A 2DJ3A 4ZB7A 1OC3A 3TCOA 2BTOT 2YWOA 1PX7A 2P5QA 3CWGA 4ID0A 1ILOA 3F9UA 5ECIB 3UOMA 2LS5A 4LMVA 3ME7A 2H1GA 4O92A 2JSYA 3GKMA 4ULXA 4A5PA 3TJBA 2V2GA 5DVBA 1AC1A 2F8AA 1GSEA 4ZILA 2H1AA 2PVQA 3O3TA 1TRSA 1SVOA 5DQYA 4IQAA 3R3EA 3I43A 3TKRA 4MDCA 4O7HA 2GSQA 2OBKA 5JWQB 3L0HA 4IVFA 4CW9A 3G7IA 4BVXA 3UBKA 3U6VA 2V6KA 2PPTA 1F3AA 2I4AA 5IM9A 2LRNA 3UL3A 2BMXA 1GSFA 4PI0C 4ZXGA 4DSRA 1U88A 1SJZA 1PRXA 4HJMA 2P31A 4CHSA 5IPHA 5KN2A 4JBBA 2R3XA 5IOWA 3L9UA 4IGJA 3ZZXA 1EGRA 3WYWA 1S4BP 4WF4A 1ZYNA 4XIHA 1Z6NA 4EXJA 3RDWA 5ECPB 2HSYA 1QXHA 4QQ7A 3F3QA 2GQKA 3RPNA 2M72A 1YVLA 2A2PA 1TK5B 1FB6A 4MH3A 5ECRB 4G10A 1X5EA 1GUMA 3P7XA 4OFNA 4OD7A 5ENUA 1FO5A 1NSWA 5CNWA 3TJKA 2LTKA 3JCML 4O32A 4G2EA 4ILFA 3L9VA 3G7YA 5ECOB 2H01A 1MTCA 3ME8A 4BVYA 2VO4A 2GVPA 1Z7RA 2H74A 5J47A 2HZFA 5IMDA 1QQ2A 1U6TA 2CX4A 2DJJA 2EIRA 2WFCA 2H6XA 1LBKA 1MDIA 2TRCP 4F2IA 2Z9SA 2A2SA 2PUKC 5A1NA 4L5LA 5EL8A 1OKDA 3QPMA 4MF7A 2H0HA 5AIXA 1ON4A 1A23A 1F37A 3DVWA 2DJ0A 1OAZA 6GSSA 1F6MC 3TDGA 1JLVA 2V6OA 3BBYA 2R2JA 3DWVA 3ZITA 3EU4A 1DSBA 1XZOA 1G7OA 1GTUA 2HRAA 3CRUA 1YF0A 3KJYA 4KAEA 1M2AA 2M46A 4I8BA 4O5UA 2ZNMA 5A4WA 1KEBA 3F6DA 3TUEA 2FWEA 4EF0A 1HNCA 4GQFA 5AISA 4OFMA 4YKFA 2FWHA 2XHFA 4TW5A 3AY8A 2B7JA 3EURA 4USSA 1H75A 1ERVA 1JZRA 1AIUA 2RM6A 4NV2A 2B6MA 5IMZA 4F82A 2XPDA 2JACA 4V1Ag 4ICYA 5GSSA 1ZL9A 4WBRD 4KB3A 1S3RA 5BMUA 2O85A 2HYXA 3DMLA 2VL9A 3Q18A 1GUHA 3CBUA 1XXUA 3CTGA 3HVNA 2GT5A 1VGLA 2VCQA 1H4OA 2M80A 3GX0A 4H86A 5DJMA 4KDXA 3FRCA 2EFDA 2VL3A 1XPVA 4K8MA 20GSA 2C3NA 3E3EA 2H0IA 2CQ9A 3IBHA 2IFQB 4F03A 2RUEA 4PNFA 3Q74A 2GSRA 4TXOB 1ML6A 2EIOA 1VF4A 3E9JB 4TR4A 3V1WA 2IWTA 1ZOFA 2VCWA 2C0FA 4EKZA 3IK9A 2CVBA 4JR6A 2CT6A 3IC4A 5F8BA 2X8GA 2L6DA 4HJ2A 1MDKA 1HNAA 3UEMA 5AN1A 4K5SA 2OBIA 3IE3A 4GSTA 1E2YA 4LL4B 4LL1B 3ERWA 3BCIA 2CZ2A 4LMWA 1WWJA 2L5LA 3GYKA 3EPTA 2QKEA 1UC7A 3CTFA 3HHVA 2I1UA 1VF2A 1GTBA 4FYBA 5IQYA 3EVIA 3IRAA 2WZ9A 4K6XA 2EFHA 4G0IA 1SJ6A 5CAXA 1KTEA 1XVQA 1SL2B 1A24A 4MCUA 2MMNA 4V1Ap 1IYHA 3GA4A 4G0KA 3F0IA 4HSCX 5LNKe 4HQSA 2VCZA 1YEWC 1JZOA 1R5AA 4OO5A 1UA5A 2VL2C 1O85A 2VCVA 3C1RA 4ISDA 1K0MA 2WZSA 4ZBAA 2GT6A 3F4TA 4JR4A 3MWHA 4P3YB 2CVKA 1SK1A 1XWAA 1EOHA 3I69A 1X0RA 4ZB8A 4IN0A 2X8CA 2B5YA 2C8UA 3ZL5A 4MJAA 2PN8A 2OE3A 1A0RP 4GSNA 3NZNA 3D6IA 2VLUA 1B9XC 2V1MA 4K7IA 3IDVA 3KEBA 2H70A 4Z7XA 4PX1A 4LA1A 2D2ZA 2WVXB 5J41A 1WE0A 2UZ8A 3MDKA 5H5RA 1ZYQB 4L8EA 2GZPA 1DBYA 4PXOA 4J57E 5CRWA 4POLA 4AJ8A 2MMZA 1K0OA 5A4VA 2YN1A 4PUAA 3FZ4A 3GSTA 5FHIA 5H5QA 3G9BA 2B1KA 2ZCTA 4KX4A 2XC2A 1GSSA 3LORA 3IHQA 2E0QA 2WB9A 5D9VA 3VI5A 3DVXA 4ACSA 3LXZA 2WULA 3FW2A 1WIKA 1O73A 3GL3A 4KDYA 10GSA 2B1LA 3F63A 4GWRA 5J3RA 3VLNA 4EL1A 2WW3A 1SU9A 4QL7A 4L0UA 1YKAA 1WP0A 1FHEA 4NV5A 3G7JA 2KP2A 4N0ZA 5J9CA 1AQXA 1ZYPA 3TKQA 1V57A 2C1YA 5EY6A 3QMXA 2GQMA 2FD3A 1NHYA 2HE3A 4IQ1A 2NTOA 2HFDA 2P5RA 1NM3A 1GH2A 2H73A 3Q19A 1B4PA 4MJBA 1EEMA 2IFQA 5CREA 2AJQB 1YF1A 3HD5A 5IPGA 1I5GA 4MABA 3H93A 4TXOA 14GSA 2CV4A 1V58A 2O7KA 1SD8A 5H5SA 3DEXA 4E68A 3S9FA 4IW9A 3KXOA 2IJYA 3UAPA 5DJLA 1BAYA 1O6JA 4K7NA 2AB6A 3KMNA 3FY7A 2PGTA 8GSSA 2GS3A 2GDRA 1TXXA 2GQLA 4RQXA 3I9V2 2IMKA 2R0GA 2H71A 4ZL7A 2PBJA 5D8IA 3EMXA 1VF3A 2FNOA 1EP7A 1PFOA 2C0GA 3M0FA 1CQHA 3O6TA 3J7Yb 1JFUA 5INYA 3EINA 1XW6A 3ZLPA 4L0WA 3MIXA 3P2AA 3SWLA 3A2VA 3KTBA 3M1GA 2LQOA 4IJ3A 2EIQA 5KEJA 1QK8A 2L6CA 2GGTA 4K5RA 3TKSA 1SK0A 3CYNA 1BYEA 4G9HA 2X8HA 4G0LA 5HFGA 5JCWA 3QD9A 2FGXA 2R6KA 1A2MA 1V98A 2O36A 2GZYA 3FK8A 3EE2A 4AI6A 12GSA 5ECHB 1R4WA 5G30A 4I2UA 1PKZA 4X0XA 1X9MB 1M2BA 3ISOA 1THOA 4ML6A 1ERUA 4YAVA 5C04A 13GSA 4N10A 4OO4A 1Z3EA 1FOHA 1PN0A 3UJ1A 2VCXA 4JZQA 4J56E 2VCTA 5HR0A 3KIJA 4GLTA 1Y1UA 1SVMA 1G6YA 1GSQA 2R0CA 5J4UA 1FW1A 1CQGA 2HRNA 2F3MA 3HCZA 3MAKA 3M3MA 1SKWB 4MJCA 1Z6MA 4Q5NA 4DSSB 2WVXA 6GSVA 1SYRA 2DBCA 2VM1A 2YANA
chains in the Genus database with same CATH topology
4G01A 2MBTA 3UVTA 3ZIJA 4TVEA 1YEPA 1M9BA 4IBPA 1A2JA 1X9WB 4KE3A 4MH2A 4OCEA 2OJLA 4XCSA 3GFKA 1WPIA 4N30A 2H6YA 4AJ6A 3LXTA 4RQRA 3N5OA 2V41A 4WETA 3U5RE 5D73A 3UBLA 3QFAC 4XRAA 1EWXA 1XOBA 6GSXA 4Q5RA 2GSSA 4XS6A 2C0DA 1G6WA 4MPGA 4AJ7A 3IAM2 5IMCA 1QMVA 3PR8A 1NHOA 3LFLA 4F0BA 2DIZA 3ZTLA 4I5QA 1N8JA 1YKCA 1WOUA 5ECSA 3LW9A 3H79A 4FIWA 4MJEA 2VL2A 5DAKB 1J08A 2NPBA 2LUSA 1MDJA 3ZVJA 5IO2A 3C8EA 2H6ZA 5F05A 3TRXA 2P0GA 4EUYA 5CRHA 4Q5QA 2VIMA 3W8SA 3EU3A 1X9SB 4AGSA 1X5CA 1ZCPA 1O7UA 2YWNA 3DD3A 3IAS2 2HSNB 2ZUPA 5GSTA 3D4MA 17GSA 2E7PA 1YJ6A 1T4YA 4JRRA 5C00A 3QAWA 3PGTA 5KOWA 2L59A 2IMDA 1PX6A 3PPUA 2IN3A 2JADA 1PN9A 1GWCA 1RK4A 3DXBA 2PWJA 1BG5A 5ECQB 3ZRDA 1TRWA 4GTUA 2AUVA 1B48A 2O87A 1AW9A 5B7CA 4XS1A 1K0NA 4HUAA 2K8SA 4RI7A 2HI7A 4HS1A 3M9KA 3FEUA 5IO0A 4QMKA 3VWWA 4IP1A 4LLRA 1GTIA 1A8YA 2MBSA 3FZ5A 2VLVA 3D5JA 4POKA 4POMA 2RM5A 1MEKA 2LNSA 4PQIA 2FA8A 1OE7A 4N0VA 3GHAA 1W4VA 1SK2A 2H72A 4GRFA 3VPQA 1BQ7A 2GLRA 5J5NA 1LJRA 1GULA 4E8EA 1TDIA 1U3IA 2F51A 4I2TA 1N2AA 3F6FA 2O8VB 4NHZA 2AAWA 1BG1A 4K7OA 2N5FA 3K8NA 2H76A 4PGTA 2LJRA 5CP1A 2H75A 4CY6A 1E6BA 1F2EA 5IOXA 4YQMA 1OVNA 1XIYA 1V9WA 4DVCA 4MZBA 4V2MA 4RUVA 3L4NA 2MMOA 1SKSB 5ECMB 1DE1A 4WEYA 1GRXA 2VUPA 2EFEA 2XPEA 3H8QA 4WXTA 2C80A 1B9YC 4V2NA 1O8WA 4BA7A 4W66A 4KCAA 2DKIA 4GQCA 3RBTA 3GNJA 3FR9A 1QUWA 4K0GA 3VURA 4GSSA 1XFLA 4J2FA 2NBSA 4TRXA 2PU9C 4AKXB 1G0TA 2HZEB 3VWUA 2KP1A 1ERTA 2N5BA 1PMTA 2QA1A 4EO3A 5ID2B 2K8VA 5L71A 11GSA 4EDYA 1PA3A 4PURA 1XBSA 2H66A 1EZKA 4N3ZA 4X4JA 3TJJA 2H1DA 4HU9A 5ELGA 4HI7A 5A4UA 3FKFA 2RUFA 4ECCA 2C0EA 2J23A 4K2DA 1EOGA 4MZWA 6GSYA 1WJKA 3LJRA 2LNTA 4ZB6A 5J4VA 3F3RA 1T1VA 1YZXA 5KN1A 1GNWA 1AAZA 2REMA 3KZQA 1FVKA 3M9JA 4TXVA 1HQOA 4MPFA 3A3TA 5HFKA 3APOA 3HZ8A 2HRKB 2HSNA 1GSYA 5EPFA 3BCKA 2EFCA 2WDUA 2DMMA 1B4QA 4MF5A 1DUGA 3ZVJD 3KM6A 2HSMB 5KOXA 1TK8B 2DMLA 1YY7A 2R4VA 4ZL8A 1Y6EA 4JE1A 1UN2A 3EWLA 2JZRA 3DRNA 4GXZA 3ZREA 2HSHA 22GSA 1SENA 2WS2A 4ML1A 4IS0A 2GZZA 1UVZA 1SYXA 4HZ4A 2R0PA 2WGRA 1AQVA 1OYJA 2E2MA 3ZMLA 3LQ7A 2LJKA 3LEFA 3HJMA 1DE2A 1THXA 3HVSA 2LKUA 1JZDA 5D9WA 1OC9B 3P8WA 2L5OA 1SJIA 2DLXA 4KH7A 4MMMA 4DEJA 2HNLA 5F06A 3D22A 1OKTA 4HDEA 4XS4B 2LQQA 2R37A 5CRGA 3D0ZA 3L9SA 4ZL9A 1U3AA 1PKWA 4TR3A 3HZ4A 5FWGA 4GF0A 2MMAA 4KW6A 1RQMA 2LRTA 3OR5A 2O5VA 5A5HB 2GSTA 1ST9A 5A5KA 5ECLB 3FZAA 2YJHA 2YP6A 2QGVA 4F0CA 4KSOA 5ABRA 4BWSA 2YOIA 2LRCA 4HEA2 3VFIA 4AF2A 1IYIA 4CDOA 2ALBA 3BJ5A 1QFNA 4NPBA 4GCIA 2B5EA 2DIYA 4XHMA 1XWGA 3FMWA 4TR1B 1K0AA 5DALB 5G5EA 4OMVA 3C7MA 1JHBA 3WD6A 4K0NA 4OFTA 5JCGA 3TOUA 2H30A 3APQA 5DCHA 1TI3A 2NDOA 2YZHA 5D93A 1VF1A 1R26A 3UMAA 1K0BA 4IELA 2RLIA 2LSTA 1GTAA 3US3A 3IHGA 2VD1A 3GL5A 4JEDA 5HR1A 3GN3A 3QAVA 4FH8A 1XWKA 4PTSA 3CSHA 1WRYA 4Z2TA 2X49A 3GKNA 3A2WA 3QAGA 3TB2A 4HOJA 5HR3A 3ZMKA 2GTUA 1HD2A 4G19A 4YQUA 3DIEA 5DDLA 2HZEA 1JLWA 2YNXA 3TRQA 3HVVA 1TU8A 4KUNA 4IJIA 3MYDA 3VWXA 5F07A 5ID2A 5A34B 5DBQA 5BRTA 3NOFA 3GH9A 4AKGA 1MD4A 2VD0A 3IA1A 5CRDA 2WCIA 3FR3A 3TGZA 3KH7A 4MNNA 2C3TA 1XW9A 5F0GA 2JU5A 4PNGA 2H1LA 1WMJA 4O5RA 3UVHA 4POBA 1AUCA 5KN0A 3ZFBA 4YKGA 16GSA 3GTUB 2JZTA 4FQUA 3VPTA 2DSAA 4EVMA 5IMAA 4NAXA 5IMFA 4QL9A 2ON7A 1GSUA 5B6NA 3GMFA 2DJ2A 2IPAA 2HRKA 2QC7A 3KH9A 2KLXA 2XBQA 4TKYA 4KGIA 5ELAA 3HYPA 1T4ZA 1VRSD 5CYYA 9GSSA 5JWOB 2JSZA 3FZ9A 2HSMA 2C3QA 5GZZB 4EE0A 4PQHA 5AGYA 1A8LA 3IR4A 1GLPA 3MNGA 3UARA 2FUG2 4N11A 4MZCA 5B8BA 1G7EA 1M2DA 3GH6A 4ECJA 5G1LA 3HY2A 4JU5A 1ZGNA 2KHPA 1Q98A 3D21A 6GSTA 2X4AA 2E2GA 3LYPA 1BJXA 3ZYWA 4XRDA 1EEJA 4OWYA 1C72A 2F8FA 2YCDA 3KCMA 2OE1A 4MA9A 4Z2UA 1TK0B 4K1FA 4KNDA 3KP9A 2L4CA 1OC9A 3UIWA 1PD21 3PINA 3TJGA 4YQVA 3APSA 3NIVA 5D96A 1TOFA 4AKIA 1Q4JA 2KOKA 1K0DA 1Z9HA 3QDNA 4MP4A 4XS4A 2YWIA 1TW9A 1SL1B 1SVLA 3DYRA 3HMJG 3FHKA 1XWBA 3GKXA 3A5IA 2IIYA 1SKRB 2FWFA 4ECBA 2CAQA 2OE0A 2IMIA 4Z2RA 1USBA 2PMTA 2VKZG 5A5HA 2NVLA 1M7TA 3MSZA 2YWMA 4F9ZA 1J9BA 1ZZYA 5E59A 4EIQA 2VOCA 5HFIA 18GSA 4GDFA 5G1KA 2DJ1A 2L4QA 1T8EB 4FYCA 2PERA 5DCGA 5EVOA 3GKKA 2FWGA 3GURA 1ACVA 4BPYA 4I97A 2O89A 3GV1A 4WR4A 4WR5A 4TR1A 2DJKA 3R2QA 5DALA 1TU7A 5G5FA 1AQWA 3ZIVA 4IP6A 1GSDA 3TRPA 4MLYA 3DGQA 1T00A 2HXKA 1W89A 3QFBC 4HU7A 2JL4A 1BF5A 1B8XA 5GAPD 2WJUA 4ECIA 2JZSA 2OA7A 1Y25A 1N25A 2YZUA 1PL1A 1GP1A 1F3BA 3TKSE 5IIZA 19GSA 3M8NA 4K9ZA 1EP8A 4X1UA 5E4WA 2IMFA 2DKHA 2YPMA 3RPPA 2LV3A 4WBJA 4TR0A 4TOPA 1PQNA 4IHUA 3CMIA 3RAZA 3WGDA 3CRTA 2B3SA 3ED3A 2UV8G 3H1NA 4L5OA 4NHWA 2VAFA 3HXSA 5A34A 3TKSC 2DC5A 4WKWA 5B6MA 3I6AA 4ZIJA 4HQZA 2FY6A 4KA0A 1TJDA 1GL8A 2ES7A 3EMPA 1PL2A 3EC3A 6GSWA 1M9AA 1FAAA 5COHA 1A0FA 2RIIA 1T3BA 1Z5YE 3TOTA 4BL7B 2FA4A 2CZ3A 3HVXA 1JZWA 3CSJA 4OCFA 5J40A 3RHBA 2HRFA 2FCHA 2F9SA 2I9HA 2CAIA 3GTUA 4D73B 2R5GA 2A4VA 2LJAA 3IXRA 3C1SA 3FYGA 1XOAA 3FR6A 4HZ2A 3GUSA 3W8JA 1SL0B 4ZB9A 2A4HA 2QA2A 1FB0A 3CSIA 5KN3A 3QOUA 2OT3A 2CA8A 4DSSA 5JWRB 3BD2A 2X64A 4KF9A 1TKDB 2A2RA 1TTZA 5J9BA 4KCEA 1GUKA 1EV9A 2HT9A 1S3AA 3LGCA 2G0FA 3WT2A 1M0UA 2CX3A 1XW5A 1T7PB 4Q5FA 1ZMAA 2H0GA 3L78A 3HA9A 1R5PA 2K18A 2HQTA 1YEXA 1K3LA 1EGOA 3O76A 1X5DA 2CVDA 2G2QA 4EC0A 3GSSA 2PVOC 3IC8A 2AYTA 2J9HA 2TRXA 1RW1A 4NWYA 1K3OA 5G2ZA 5DAKA 3KP8A 4V2LA 2YJ7A 3H4KA 1BEDA 3RHCA 2TIRA 2B5XA 5GAND 4TN8A 4RI6A 1FOVA 5HR2A 4NXIA 1K0CA 1ZYEA 3QCPA 2X99A 5B8AA 5D9TA 7GSSA 4IKHA 5G31A 3A5WA 2K9FA 3ERGA 2YV9A 2MZCA 2KUCA 2I3YA 1NW2A 3BOAA 4EIPA 3Q6OA 1FVJA 1PGTA 3TJFA 3TKPA 4BVXB 1YDKA 3KD0A 3C73A 5JCUA 1F9MA 5CO3A 3GIXA 5LCZA 2OADA 2OACA 1V40A 4KSMA 4FO5A 3CXGA 1GNEA 1TI1A 3E0UA 3IK7A 4KDUA 2MYGA 2H1BA 2N5AA 1TXUA 3LWAA 1FG4A 1XCCA 3F4SA 3HJOA 1KBNA 4BWQA 1ABAA 1U87A 3W6GA 1M99A 2V32A 3F4RA 1OE8A 1HNBA 3KMOA 3P90A 1GLQA 5LD0A 5D9XA 2LEGA 2H19A 4FYUA 2K6VA 3IOSA 5IMVA 4CY8A 4BVYB 4XTSA 3LYKA 5HQPA 3LG6A 4YAPA 1URMA 5J4YA 2L57A 3IPZA 3N9JA 1K3YA 1YQ1A 4YH2A 3TU3B 4PQ1A 2XBIA 1AXDA 1PSQA 5AIVA 4ZBDA 1S3DA 4DSQA 3ERFA 2FLSA 1S3CA 3A2XA 3KTLA 1I9DA 1O81A 4BL7A 4EDZA 1MD3A 5A1NB 4X43A 3C71A 2HLSA 2AV4A 1HYUA 6GSUA 1XWCA 4MK3A 3D4TA 3KGKA 3J7Yk 4ZBBA 2VM2A 1XVWA 1V2AA 4NMUA 4D73A 4AKHA 4MF6A 1SD9A 1J0FA 3GX8A 5DQSA 2ON5A 3HKRA 4WF5A 4K2XA 3SBCA 1O8XA 4PUFC 1ERWA 1OC8A 3VK9A 2YV7A 2IL3A 1KNGA 1TP9A 2QSIA 2OKAA 2AHEA 2FHEA 5FT3A 1A2LA 3IV4A 2EC4A 1TRVA 3VWVA 2VLTA 2BJXA 1TRUA 1EV4A 3LSZA 1BX9A 1R7HA 1Z7PA 5ECKB 1QGVA 3DKSA 2I81A 3QR6A 2B7KA 3PH9A 3GRXA 1LU4A 3WGEA 4O5QA 4I6XA 3VI7A 4E8HA 3HDCA 2WRTA 5BMUB 5ECNB 2H8LA 3EYTA 3HJPA 2C4JA 3F8UA 3WGXA 2IMEA 3ZFLA 3WT1A 2DJ3A 4ZB7A 1OC3A 3TCOA 2BTOT 2YWOA 1PX7A 2P5QA 3CWGA 4ID0A 1ILOA 3F9UA 5ECIB 3UOMA 2LS5A 4LMVA 3ME7A 2H1GA 4O92A 2JSYA 3GKMA 4ULXA 4A5PA 3TJBA 2V2GA 5DVBA 1AC1A 2F8AA 1GSEA 4ZILA 2H1AA 2PVQA 3O3TA 1TRSA 1SVOA 5DQYA 4IQAA 3R3EA 3I43A 3TKRA 4MDCA 4O7HA 2GSQA 2OBKA 5JWQB 3L0HA 4IVFA 4CW9A 3G7IA 4BVXA 3UBKA 3U6VA 2V6KA 2PPTA 1F3AA 2I4AA 5IM9A 2LRNA 3UL3A 2BMXA 1GSFA 4DSRA 4ZXGA 1U88A 1SJZA 1PRXA 4HJMA 2P31A 4CHSA 5IPHA 5KN2A 4JBBA 2R3XA 5IOWA 3L9UA 4IGJA 3ZZXA 1EGRA 3WYWA 4WF4A 1ZYNA 4XIHA 1Z6NA 4EXJA 3RDWA 5ECPB 2HSYA 1QXHA 4QQ7A 3F3QA 2GQKA 3RPNA 2M72A 1YVLA 2A2PA 1TK5B 1FB6A 4MH3A 5ECRB 4G10A 1X5EA 1GUMA 3P7XA 4OFNA 4OD7A 5ENUA 1FO5A 1NSWA 5CNWA 3TJKA 2LTKA 3JCML 4O32A 4G2EA 4ILFA 3L9VA 3G7YA 5ECOB 2H01A 1MTCA 3ME8A 4BVYA 2VO4A 2GVPA 1Z7RA 2H74A 5J47A 2HZFA 5IMDA 1QQ2A 1U6TA 2CX4A 2DJJA 2EIRA 2WFCA 2H6XA 1LBKA 1MDIA 2TRCP 4F2IA 2Z9SA 2A2SA 2PUKC 5A1NA 4L5LA 5EL8A 1OKDA 3QPMA 4MF7A 2H0HA 5AIXA 1ON4A 1A23A 1F37A 3DVWA 2DJ0A 1OAZA 6GSSA 1F6MC 3TDGA 1JLVA 2V6OA 3BBYA 2R2JA 3DWVA 3ZITA 3EU4A 1DSBA 1XZOA 1G7OA 1GTUA 2HRAA 3CRUA 1YF0A 3KJYA 4KAEA 1M2AA 2M46A 4I8BA 4O5UA 2ZNMA 5A4WA 1KEBA 3F6DA 3TUEA 2FWEA 4EF0A 1HNCA 4GQFA 5AISA 4OFMA 4YKFA 2FWHA 2XHFA 4TW5A 3AY8A 2B7JA 3EURA 4USSA 1H75A 1ERVA 1JZRA 1AIUA 2RM6A 4NV2A 2B6MA 5IMZA 4F82A 2XPDA 2JACA 4V1Ag 4ICYA 5GSSA 1ZL9A 4WBRD 4KB3A 5BMUA 2O85A 2HYXA 3DMLA 2VL9A 3Q18A 1GUHA 3CBUA 1XXUA 3CTGA 2GT5A 1VGLA 2VCQA 1H4OA 2M80A 3GX0A 4H86A 5DJMA 4KDXA 3FRCA 2EFDA 2VL3A 1XPVA 4K8MA 20GSA 2C3NA 3E3EA 2H0IA 2CQ9A 3IBHA 2IFQB 4F03A 2RUEA 4PNFA 3Q74A 2GSRA 4TXOB 1ML6A 2EIOA 1VF4A 3E9JB 4TR4A 3V1WA 2IWTA 1ZOFA 2VCWA 2C0FA 4EKZA 3IK9A 2CVBA 4JR6A 2CT6A 3IC4A 5F8BA 2X8GA 2L6DA 4HJ2A 1MDKA 1HNAA 3UEMA 5AN1A 4K5SA 2OBIA 3IE3A 4GSTA 1E2YA 4LL4B 4LL1B 3ERWA 3BCIA 2CZ2A 4LMWA 1WWJA 2L5LA 3GYKA 3EPTA 2QKEA 1UC7A 3CTFA 3HHVA 2I1UA 1VF2A 1GTBA 4FYBA 5IQYA 3EVIA 3IRAA 2WZ9A 4K6XA 2EFHA 4G0IA 1SJ6A 5CAXA 1KTEA 1XVQA 1SL2B 1A24A 4MCUA 2MMNA 4V1Ap 1IYHA 3GA4A 4G0KA 3F0IA 5LNKe 4HQSA 2VCZA 1JZOA 1R5AA 4OO5A 1UA5A 2VL2C 1O85A 2VCVA 3C1RA 4ISDA 1K0MA 4ZBAA 2GT6A 3F4TA 4JR4A 3MWHA 4P3YB 2CVKA 1SK1A 1XWAA 1EOHA 3I69A 1X0RA 4ZB8A 4IN0A 2X8CA 2B5YA 2C8UA 3ZL5A 4MJAA 2PN8A 2OE3A 1A0RP 4GSNA 3NZNA 3D6IA 2VLUA 1B9XC 2V1MA 4K7IA 3IDVA 3KEBA 2H70A 4Z7XA 4PX1A 4LA1A 2D2ZA 5J41A 1WE0A 2UZ8A 3MDKA 5H5RA 1ZYQB 4L8EA 2GZPA 1DBYA 4PXOA 4J57E 5CRWA 4POLA 4AJ8A 2MMZA 1K0OA 5A4VA 2YN1A 4PUAA 3FZ4A 3GSTA 5FHIA 5H5QA 3G9BA 2B1KA 2ZCTA 4KX4A 2XC2A 1GSSA 3LORA 3IHQA 2E0QA 2WB9A 5D9VA 3VI5A 3DVXA 4ACSA 3LXZA 2WULA 3FW2A 1WIKA 1O73A 3GL3A 4KDYA 10GSA 2B1LA 3F63A 4GWRA 5J3RA 3VLNA 4EL1A 1SU9A 4QL7A 4L0UA 1YKAA 1WP0A 1FHEA 4NV5A 3G7JA 2KP2A 4N0ZA 5J9CA 1AQXA 1ZYPA 3TKQA 1V57A 2C1YA 5EY6A 3QMXA 2GQMA 2FD3A 1NHYA 2HE3A 4IQ1A 2NTOA 2HFDA 2P5RA 1NM3A 1GH2A 2H73A 3Q19A 1B4PA 4MJBA 1EEMA 2IFQA 5CREA 2AJQB 1YF1A 3HD5A 5IPGA 1I5GA 4MABA 3H93A 4TXOA 14GSA 2CV4A 1V58A 2O7KA 1SD8A 5H5SA 3DEXA 4E68A 3S9FA 4IW9A 3KXOA 2IJYA 3UAPA 5DJLA 1BAYA 1O6JA 4K7NA 2AB6A 3KMNA 3FY7A 2PGTA 8GSSA 2GS3A 2GDRA 1TXXA 2GQLA 4RQXA 3I9V2 2IMKA 2R0GA 2H71A 4ZL7A 2PBJA 5D8IA 3EMXA 1VF3A 2FNOA 1EP7A 2C0GA 3M0FA 1CQHA 3O6TA 3J7Yb 1JFUA 5INYA 3EINA 1XW6A 3ZLPA 4L0WA 3MIXA 3P2AA 3SWLA 3A2VA 3KTBA 3M1GA 2LQOA 4IJ3A 2EIQA 5KEJA 1QK8A 2L6CA 2GGTA 4K5RA 3TKSA 1SK0A 3CYNA 1BYEA 4G9HA 2X8HA 4G0LA 5HFGA 5JCWA 3QD9A 2FGXA 2R6KA 1A2MA 1V98A 2GZYA 3FK8A 3EE2A 4AI6A 12GSA 5ECHB 1R4WA 5G30A 4I2UA 1PKZA 4X0XA 1X9MB 1M2BA 3ISOA 1THOA 4ML6A 1ERUA 4YAVA 5C04A 13GSA 4N10A 4OO4A 1Z3EA 1FOHA 1PN0A 3UJ1A 2VCXA 4JZQA 4J56E 2VCTA 5HR0A 3KIJA 4GLTA 1Y1UA 1SVMA 1G6YA 1GSQA 2R0CA 5J4UA 1FW1A 1CQGA 2HRNA 2F3MA 3HCZA 3MAKA 3M3MA 1SKWB 4MJCA 1Z6MA 4Q5NA 4DSSB 6GSVA 1SYRA 2DBCA 2VM1A 2YANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBT A;  3UVT A;  3ZIJ A;  4TVE A;  1YEP A;  1M9B A;  4IBP A;  1A2J A;  1X9W B;  4KE3 A;  4MH2 A;  4OCE A;  2OJL A;  4XCS A;  3GFK A;  1WPI A;  4N30 A;  2H6Y A;  4AJ6 A;  3LXT A;  4RQR A;  3N5O A;  2V41 A;  4WET A;  3U5R E;  5D73 A;  3UBL A;  3QFA C;  4XRA A;  1EWX A;  1XOB A;  6GSX A;  4Q5R A;  2GSS A;  4XS6 A;  2C0D A;  1G6W A;  4MPG A;  4AJ7 A;  3IAM 2;  5IMC A;  1QMV A;  3PR8 A;  1NHO A;  3LFL A;  4F0B A;  2DIZ A;  3ZTL A;  4I5Q A;  1N8J A;  1YKC A;  1WOU A;  5ECS A;  3H79 A;  4FIW A;  4MJE A;  2VL2 A;  5DAK B;  1J08 A;  2NPB A;  2LUS A;  1MDJ A;  3ZVJ A;  5IO2 A;  3C8E A;  2H6Z A;  5F05 A;  3TRX A;  2P0G A;  4EUY A;  5CRH A;  4Q5Q A;  2VIM A;  3W8S A;  3EU3 A;  1X9S B;  4AGS A;  1X5C A;  1ZCP A;  1O7U A;  2YWN A;  3DD3 A;  3IAS 2;  2HSN B;  2ZUP A;  5GST A;  3D4M A;  17GS A;  2E7P A;  1YJ6 A;  1T4Y A;  4JRR A;  5C00 A;  3QAW A;  3PGT A;  2L59 A;  2IMD A;  1PX6 A;  3PPU A;  2IN3 A;  2JAD A;  1PN9 A;  1GWC A;  1RK4 A;  3DXB A;  2PWJ A;  1BG5 A;  5ECQ B;  3ZRD A;  1TRW A;  4GTU A;  2AUV A;  1B48 A;  2O87 A;  1AW9 A;  5B7C A;  4XS1 A;  1K0N A;  4HUA A;  2K8S A;  4RI7 A;  2HI7 A;  4HS1 A;  3M9K A;  3FEU A;  5IO0 A;  3VWW A;  4IP1 A;  4LLR A;  1GTI A;  1A8Y A;  2MBS A;  3FZ5 A;  2VLV A;  3D5J A;  4POK A;  4POM A;  2RM5 A;  1MEK A;  2LNS A;  4PQI A;  2FA8 A;  1OE7 A;  4N0V A;  3GHA A;  1W4V A;  1SK2 A;  2H72 A;  4GRF A;  3VPQ A;  1BQ7 A;  2GLR A;  5J5N A;  1LJR A;  1GUL A;  4E8E A;  1TDI A;  1U3I A;  2F51 A;  4I2T A;  1N2A A;  3F6F A;  2O8V B;  4NHZ A;  2AAW A;  4K7O A;  2N5F A;  3K8N A;  2H76 A;  4PGT A;  2LJR A;  5CP1 A;  2H75 A;  1E6B A;  1F2E A;  5IOX A;  4YQM A;  1OVN A;  1XIY A;  1V9W A;  4DVC A;  4MZB A;  4V2M A;  4RUV A;  3L4N A;  2MMO A;  1SKS B;  5ECM B;  1DE1 A;  4WEY A;  1GRX A;  2VUP A;  2XPE A;  3H8Q A;  4WXT A;  2C80 A;  1B9Y C;  4V2N A;  1O8W A;  4BA7 A;  4KCA A;  4GQC A;  3RBT A;  3GNJ A;  3FR9 A;  1QUW A;  4K0G A;  3VUR A;  4GSS A;  1XFL A;  4J2F A;  2NBS A;  4TRX A;  2PU9 C;  1G0T A;  2HZE B;  3VWU A;  2KP1 A;  1ERT A;  2N5B A;  1PMT A;  4EO3 A;  5ID2 B;  2K8V A;  5L71 A;  11GS A;  4EDY A;  1PA3 A;  4PUR A;  1XBS A;  2H66 A;  1EZK A;  3TJJ A;  2H1D A;  4HU9 A;  5ELG A;  4HI7 A;  5A4U A;  3FKF A;  2RUF A;  4ECC A;  2C0E A;  2J23 A;  4K2D A;  1EOG A;  4MZW A;  6GSY A;  1WJK A;  3LJR A;  2LNT A;  4ZB6 A;  3F3R A;  1T1V A;  1YZX A;  5KN1 A;  1GNW A;  1AAZ A;  2REM A;  3KZQ A;  1FVK A;  3M9J A;  4TXV A;  1HQO A;  4MPF A;  3A3T A;  5HFK A;  3APO A;  3HZ8 A;  2HRK B;  1GSY A;  5EPF A;  3BCK A;  2DMM A;  2WDU A;  1B4Q A;  4MF5 A;  1DUG A;  3ZVJ D;  3KM6 A;  2HSM B;  1TK8 B;  2DML A;  1YY7 A;  2R4V A;  4ZL8 A;  1Y6E A;  4JE1 A;  1UN2 A;  3EWL A;  2JZR A;  3DRN A;  4GXZ A;  3ZRE A;  2HSH A;  22GS A;  1SEN A;  2WS2 A;  4ML1 A;  4IS0 A;  2GZZ A;  1UVZ A;  1SYX A;  4HZ4 A;  2WGR A;  1AQV A;  1OYJ A;  2E2M A;  3ZML A;  3LQ7 A;  2LJK A;  3LEF A;  3HJM A;  1DE2 A;  1THX A;  3HVS A;  2LKU A;  1JZD A;  5D9W A;  1OC9 B;  3P8W A;  2L5O A;  1SJI A;  2DLX A;  4KH7 A;  4MMM A;  4DEJ A;  2HNL A;  5F06 A;  3D22 A;  1OKT A;  4HDE A;  4XS4 B;  2LQQ A;  2R37 A;  5CRG A;  3D0Z A;  3L9S A;  4ZL9 A;  1U3A A;  1PKW A;  4TR3 A;  3HZ4 A;  5FWG A;  4GF0 A;  2MMA A;  4KW6 A;  1RQM A;  2LRT A;  3OR5 A;  2GST A;  1ST9 A;  5A5K A;  5ECL B;  3FZA A;  2YJH A;  2YP6 A;  2QGV A;  4F0C A;  4KSO A;  5ABR A;  4BWS A;  2YOI A;  2LRC A;  4HEA 2;  3VFI A;  4AF2 A;  1IYI A;  4CDO A;  2ALB A;  3BJ5 A;  1QFN A;  4NPB A;  4GCI A;  2B5E A;  2DIY A;  4XHM A;  1XWG A;  4TR1 B;  1K0A A;  5DAL B;  5G5E A;  4OMV A;  3C7M A;  1JHB A;  3WD6 A;  4K0N A;  4OFT A;  5JCG A;  3TOU A;  2H30 A;  3APQ A;  5DCH A;  1TI3 A;  2NDO A;  2YZH A;  5D93 A;  1VF1 A;  1R26 A;  3UMA A;  1K0B A;  4IEL A;  2RLI A;  2LST A;  1GTA A;  3US3 A;  2VD1 A;  3GL5 A;  4JED A;  5HR1 A;  3GN3 A;  3QAV A;  4FH8 A;  1XWK A;  4PTS A;  3CSH A;  1WRY A;  3GKN A;  3A2W A;  3QAG A;  3TB2 A;  4HOJ A;  5HR3 A;  3ZMK A;  2GTU A;  1HD2 A;  4G19 A;  4YQU A;  3DIE A;  5DDL A;  2HZE A;  1JLW A;  2YNX A;  3TRQ A;  3HVV A;  1TU8 A;  4KUN A;  4IJI A;  3VWX A;  5F07 A;  5ID2 A;  5DBQ A;  3NOF A;  3GH9 A;  1MD4 A;  2VD0 A;  3IA1 A;  5CRD A;  2WCI A;  3FR3 A;  3TGZ A;  3KH7 A;  2C3T A;  1XW9 A;  5F0G A;  2JU5 A;  4PNG A;  1WMJ A;  4O5R A;  3UVH A;  4POB A;  1AUC A;  5KN0 A;  3ZFB A;  16GS A;  3GTU B;  2JZT A;  4FQU A;  3VPT A;  2DSA A;  4EVM A;  5IMA A;  4NAX A;  5IMF A;  4QL9 A;  2ON7 A;  1GSU A;  5B6N A;  3GMF A;  2DJ2 A;  2IPA A;  2HRK A;  2QC7 A;  3KH9 A;  2KLX A;  2XBQ A;  4TKY A;  4KGI A;  5ELA A;  3HYP A;  1T4Z A;  1VRS D;  5CYY A;  9GSS A;  5JWO B;  2JSZ A;  3FZ9 A;  2HSM A;  2C3Q A;  5GZZ B;  4EE0 A;  4PQH A;  5AGY A;  1A8L A;  3IR4 A;  1GLP A;  3MNG A;  3UAR A;  2FUG 2;  4N11 A;  4MZC A;  5B8B A;  1G7E A;  1M2D A;  3GH6 A;  4ECJ A;  5G1L A;  3HY2 A;  4JU5 A;  1ZGN A;  2KHP A;  1Q98 A;  3D21 A;  6GST A;  2E2G A;  3LYP A;  1BJX A;  3ZYW A;  4XRD A;  1EEJ A;  4OWY A;  1C72 A;  2F8F A;  2YCD A;  3KCM A;  2OE1 A;  4MA9 A;  1TK0 B;  4K1F A;  4KND A;  3KP9 A;  2L4C A;  1OC9 A;  3UIW A;  1PD2 1;  3PIN A;  3TJG A;  4YQV A;  3APS A;  3NIV A;  5D96 A;  1TOF A;  1Q4J A;  2KOK A;  1K0D A;  1Z9H A;  3QDN A;  4MP4 A;  4XS4 A;  2YWI A;  1TW9 A;  1SL1 B;  3DYR A;  3FHK A;  1XWB A;  3GKX A;  2IIY A;  1SKR B;  2FWF A;  4ECB A;  2CAQ A;  2OE0 A;  2IMI A;  1USB A;  2PMT A;  2NVL A;  1M7T A;  3MSZ A;  2YWM A;  4F9Z A;  1J9B A;  1ZZY A;  5E59 A;  2VOC A;  5HFI A;  18GS A;  5G1K A;  2DJ1 A;  2L4Q A;  1T8E B;  4FYC A;  2PER A;  5DCG A;  5EVO A;  3GKK A;  2FWG A;  3GUR A;  1ACV A;  4BPY A;  4I97 A;  2O89 A;  3GV1 A;  4WR4 A;  4WR5 A;  4TR1 A;  2DJK A;  3R2Q A;  5DAL A;  1TU7 A;  5G5F A;  1AQW A;  3ZIV A;  4IP6 A;  1GSD A;  3TRP A;  4MLY A;  3DGQ A;  1T00 A;  2HXK A;  1W89 A;  3QFB C;  4HU7 A;  2JL4 A;  1B8X A;  5GAP D;  2WJU A;  4ECI A;  2JZS A;  2OA7 A;  1Y25 A;  2YZU A;  1PL1 A;  1GP1 A;  1F3B A;  3TKS E;  5IIZ A;  19GS A;  3M8N A;  4K9Z A;  1EP8 A;  4X1U A;  5E4W A;  2IMF A;  2YPM A;  3RPP A;  2LV3 A;  4WBJ A;  4TR0 A;  4TOP A;  1PQN A;  4IHU A;  3CMI A;  3RAZ A;  3WGD A;  3CRT A;  2B3S A;  3ED3 A;  3H1N A;  4L5O A;  4NHW A;  2VAF A;  3HXS A;  3TKS C;  2DC5 A;  4WKW A;  5B6M A;  3I6A A;  4ZIJ A;  4HQZ A;  2FY6 A;  4KA0 A;  1TJD A;  1GL8 A;  2ES7 A;  3EMP A;  1PL2 A;  3EC3 A;  6GSW A;  1M9A A;  1FAA A;  5COH A;  1A0F A;  2RII A;  1T3B A;  1Z5Y E;  3TOT A;  4BL7 B;  2FA4 A;  2CZ3 A;  3HVX A;  1JZW A;  3CSJ A;  4OCF A;  3RHB A;  2HRF A;  2FCH A;  2F9S A;  2I9H A;  2CAI A;  3GTU A;  4D73 B;  2R5G A;  2A4V A;  2LJA A;  3IXR A;  3C1S A;  3FYG A;  1XOA A;  3FR6 A;  4HZ2 A;  3GUS A;  3W8J A;  1SL0 B;  4ZB9 A;  1FB0 A;  3CSI A;  5KN3 A;  3QOU A;  2CA8 A;  4DSS A;  5JWR B;  3BD2 A;  2X64 A;  4KF9 A;  1TKD B;  2A2R A;  1TTZ A;  5J9B A;  4KCE A;  1GUK A;  1EV9 A;  2HT9 A;  1S3A A;  3LGC A;  2G0F A;  3WT2 A;  1M0U A;  2CX3 A;  1XW5 A;  1T7P B;  4Q5F A;  1ZMA A;  2H0G A;  3L78 A;  1R5P A;  2K18 A;  3HA9 A;  2HQT A;  1YEX A;  1K3L A;  1EGO A;  3O76 A;  1X5D A;  2CVD A;  2G2Q A;  4EC0 A;  3GSS A;  2PVO C;  3IC8 A;  2AYT A;  2J9H A;  2TRX A;  1RW1 A;  4NWY A;  1K3O A;  5G2Z A;  5DAK A;  3KP8 A;  4V2L A;  2YJ7 A;  3H4K A;  1BED A;  3RHC A;  2TIR A;  2B5X A;  5GAN D;  4TN8 A;  4RI6 A;  1FOV A;  5HR2 A;  4NXI A;  1K0C A;  1ZYE A;  3QCP A;  2X99 A;  5B8A A;  5D9T A;  7GSS A;  4IKH A;  5G31 A;  3A5W A;  2K9F A;  3ERG A;  2YV9 A;  2MZC A;  2KUC A;  2I3Y A;  1NW2 A;  3BOA A;  3Q6O A;  1FVJ A;  1PGT A;  3TJF A;  3TKP A;  4BVX B;  1YDK A;  3KD0 A;  3C73 A;  5JCU A;  1F9M A;  5CO3 A;  3GIX A;  5LCZ A;  2OAD A;  2OAC A;  1V40 A;  4KSM A;  4FO5 A;  3CXG A;  1GNE A;  1TI1 A;  3E0U A;  3IK7 A;  4KDU A;  2MYG A;  2H1B A;  2N5A A;  3LWA A;  1FG4 A;  1XCC A;  3F4S A;  3HJO A;  1KBN A;  4BWQ A;  1ABA A;  1U87 A;  3W6G A;  1M99 A;  2V32 A;  3F4R A;  1OE8 A;  1HNB A;  3KMO A;  3P90 A;  1GLQ A;  5LD0 A;  5D9X A;  2LEG A;  2H19 A;  4FYU A;  2K6V A;  3IOS A;  5IMV A;  4BVY B;  4XTS A;  3LYK A;  5HQP A;  3LG6 A;  4YAP A;  1URM A;  3IPZ A;  2L57 A;  3N9J A;  1K3Y A;  1YQ1 A;  4YH2 A;  4PQ1 A;  2XBI A;  1AXD A;  1PSQ A;  5AIV A;  4ZBD A;  1S3D A;  4DSQ A;  3ERF A;  2FLS A;  1S3C A;  3A2X A;  3KTL A;  1I9D A;  1O81 A;  4BL7 A;  4EDZ A;  1MD3 A;  4X43 A;  3C71 A;  2HLS A;  2AV4 A;  1HYU A;  6GSU A;  1XWC A;  4MK3 A;  3D4T A;  3KGK A;  3J7Y k;  4ZBB A;  2VM2 A;  1XVW A;  1V2A A;  4NMU A;  4D73 A;  4MF6 A;  1SD9 A;  1J0F A;  3GX8 A;  5DQS A;  2ON5 A;  3HKR A;  4WF5 A;  3SBC A;  1O8X A;  4PUF C;  1ERW A;  1OC8 A;  3VK9 A;  2YV7 A;  2IL3 A;  1KNG A;  1TP9 A;  2QSI A;  2OKA A;  2AHE A;  2FHE A;  5FT3 A;  1A2L A;  3IV4 A;  2EC4 A;  1TRV A;  3VWV A;  2VLT A;  2BJX A;  1TRU A;  1EV4 A;  3LSZ A;  1BX9 A;  1R7H A;  1Z7P A;  5ECK B;  1QGV A;  3DKS A;  2I81 A;  3QR6 A;  2B7K A;  3PH9 A;  3GRX A;  1LU4 A;  3WGE A;  4I6X A;  3VI7 A;  4E8H A;  3HDC A;  2WRT A;  5ECN B;  2H8L A;  3EYT A;  3HJP A;  2C4J A;  3F8U A;  3WGX A;  2IME A;  3ZFL A;  3WT1 A;  2DJ3 A;  1OC3 A;  3TCO A;  2BTO T;  2YWO A;  1PX7 A;  2P5Q A;  4ID0 A;  1ILO A;  3F9U A;  5ECI B;  3UOM A;  2LS5 A;  4LMV A;  3ME7 A;  2H1G A;  4O92 A;  2JSY A;  3GKM A;  4ULX A;  3TJB A;  2V2G A;  5DVB A;  1AC1 A;  2F8A A;  1GSE A;  4ZIL A;  2H1A A;  2PVQ A;  3O3T A;  1TRS A;  5DQY A;  4IQA A;  3R3E A;  3I43 A;  3TKR A;  4MDC A;  4O7H A;  2GSQ A;  2OBK A;  5JWQ B;  3L0H A;  4IVF A;  4CW9 A;  3G7I A;  4BVX A;  3UBK A;  3U6V A;  2V6K A;  2PPT A;  1F3A A;  2I4A A;  5IM9 A;  2LRN A;  3UL3 A;  2BMX A;  1GSF A;  4DSR A;  4ZXG A;  1U88 A;  1SJZ A;  1PRX A;  4HJM A;  2P31 A;  4CHS A;  5IPH A;  5KN2 A;  4JBB A;  2R3X A;  5IOW A;  3L9U A;  4IGJ A;  3ZZX A;  1EGR A;  3WYW A;  4WF4 A;  4XIH A;  1Z6N A;  4EXJ A;  3RDW A;  5ECP B;  2HSY A;  1QXH A;  4QQ7 A;  3F3Q A;  2GQK A;  3RPN A;  2M72 A;  1TK5 B;  1FB6 A;  4MH3 A;  5ECR B;  4G10 A;  1X5E A;  1GUM A;  3P7X A;  4OFN A;  4OD7 A;  5ENU A;  1FO5 A;  1NSW A;  5CNW A;  3TJK A;  2LTK A;  3JCM L;  4O32 A;  4G2E A;  4ILF A;  3L9V A;  3G7Y A;  5ECO B;  2H01 A;  1MTC A;  3ME8 A;  4BVY A;  2VO4 A;  2GVP A;  1Z7R A;  2H74 A;  2HZF A;  5IMD A;  1QQ2 A;  1U6T A;  2CX4 A;  2DJJ A;  2EIR A;  2WFC A;  2H6X A;  1LBK A;  1MDI A;  2TRC P;  4F2I A;  2Z9S A;  2A2S A;  2PUK C;  4L5L A;  5EL8 A;  1OKD A;  3QPM A;  4MF7 A;  2H0H A;  5AIX A;  1ON4 A;  1A23 A;  1F37 A;  3DVW A;  2DJ0 A;  1OAZ A;  6GSS A;  1F6M C;  3TDG A;  1JLV A;  2V6O A;  3BBY A;  2R2J A;  3DWV A;  3ZIT A;  3EU4 A;  1DSB A;  1XZO A;  1G7O A;  1GTU A;  2HRA A;  3CRU A;  1YF0 A;  3KJY A;  4KAE A;  1M2A A;  2M46 A;  4I8B A;  2ZNM A;  5A4W A;  1KEB A;  3F6D A;  3TUE A;  2FWE A;  4EF0 A;  1HNC A;  4GQF A;  5AIS A;  4OFM A;  2FWH A;  2XHF A;  4TW5 A;  3AY8 A;  2B7J A;  3EUR A;  4USS A;  1H75 A;  1ERV A;  1JZR A;  1AIU A;  2RM6 A;  4NV2 A;  2B6M A;  5IMZ A;  4F82 A;  2XPD A;  2JAC A;  4V1A g;  5GSS A;  1ZL9 A;  4WBR D;  4KB3 A;  5BMU A;  2O85 A;  2HYX A;  3DML A;  2VL9 A;  3Q18 A;  1GUH A;  3CBU A;  1XXU A;  3CTG A;  2GT5 A;  1VGL A;  2VCQ A;  1H4O A;  2M80 A;  3GX0 A;  4H86 A;  5DJM A;  4KDX A;  3FRC A;  2VL3 A;  1XPV A;  4K8M A;  20GS A;  2C3N A;  3E3E A;  2H0I A;  2CQ9 A;  3IBH A;  2IFQ B;  4F03 A;  2RUE A;  4PNF A;  3Q74 A;  2GSR A;  4TXO B;  1ML6 A;  2EIO A;  1VF4 A;  3E9J B;  4TR4 A;  3V1W A;  2IWT A;  1ZOF A;  2VCW A;  2C0F A;  4EKZ A;  3IK9 A;  2CVB A;  4JR6 A;  2CT6 A;  3IC4 A;  5F8B A;  2X8G A;  2L6D A;  4HJ2 A;  1MDK A;  1HNA A;  3UEM A;  5AN1 A;  2OBI A;  3IE3 A;  4GST A;  1E2Y A;  4LL4 B;  4LL1 B;  3ERW A;  3BCI A;  2CZ2 A;  4LMW A;  1WWJ A;  2L5L A;  3GYK A;  2QKE A;  1UC7 A;  3CTF A;  3HHV A;  2I1U A;  1VF2 A;  1GTB A;  4FYB A;  5IQY A;  3EVI A;  3IRA A;  2WZ9 A;  4K6X A;  4G0I A;  1SJ6 A;  5CAX A;  1KTE A;  1XVQ A;  1SL2 B;  1A24 A;  4MCU A;  2MMN A;  4V1A p;  1IYH A;  4G0K A;  3F0I A;  3GA4 A;  5LNK e;  4HQS A;  2VCZ A;  1JZO A;  1R5A A;  4OO5 A;  1UA5 A;  2VL2 C;  1O85 A;  2VCV A;  3C1R A;  4ISD A;  1K0M A;  4ZBA A;  2GT6 A;  3F4T A;  4JR4 A;  3MWH A;  4P3Y B;  2CVK A;  1SK1 A;  1XWA A;  1EOH A;  3I69 A;  1X0R A;  4ZB8 A;  4IN0 A;  2X8C A;  2B5Y A;  2C8U A;  3ZL5 A;  4MJA A;  2PN8 A;  2OE3 A;  1A0R P;  4GSN A;  3NZN A;  3D6I A;  2VLU A;  1B9X C;  2V1M A;  4K7I A;  3IDV A;  3KEB A;  2H70 A;  4Z7X A;  4PX1 A;  4LA1 A;  2D2Z A;  5J41 A;  1WE0 A;  2UZ8 A;  3MDK A;  5H5R A;  1ZYQ B;  4L8E A;  2GZP A;  1DBY A;  4PXO A;  4J57 E;  5CRW A;  4POL A;  4AJ8 A;  2MMZ A;  1K0O A;  5A4V A;  2YN1 A;  4PUA A;  3FZ4 A;  3GST A;  5FHI A;  5H5Q A;  3G9B A;  2B1K A;  2ZCT A;  4KX4 A;  2XC2 A;  1GSS A;  3LOR A;  3IHQ A;  2E0Q A;  2WB9 A;  5D9V A;  3VI5 A;  3DVX A;  4ACS A;  3LXZ A;  2WUL A;  3FW2 A;  1WIK A;  1O73 A;  3GL3 A;  4KDY A;  10GS A;  2B1L A;  3F63 A;  4GWR A;  5J3R A;  3VLN A;  4EL1 A;  1SU9 A;  4QL7 A;  4L0U A;  1YKA A;  1WP0 A;  1FHE A;  4NV5 A;  3G7J A;  2KP2 A;  4N0Z A;  5J9C A;  1AQX A;  3TKQ A;  1V57 A;  2C1Y A;  5EY6 A;  3QMX A;  2GQM A;  2FD3 A;  1NHY A;  2HE3 A;  4IQ1 A;  2NTO A;  2HFD A;  2P5R A;  1NM3 A;  1GH2 A;  2H73 A;  3Q19 A;  1B4P A;  4MJB A;  1EEM A;  2IFQ A;  5CRE A;  2AJQ B;  1YF1 A;  3HD5 A;  5IPG A;  1I5G A;  4MAB A;  3H93 A;  4TXO A;  14GS A;  2CV4 A;  1V58 A;  2O7K A;  1SD8 A;  5H5S A;  3DEX A;  3S9F A;  4IW9 A;  3KXO A;  2IJY A;  3UAP A;  5DJL A;  1BAY A;  1O6J A;  4K7N A;  2AB6 A;  3KMN A;  3FY7 A;  2PGT A;  8GSS A;  2GS3 A;  2GDR A;  1TXX A;  2GQL A;  4RQX A;  3I9V 2;  2IMK A;  2H71 A;  4ZL7 A;  2PBJ A;  5D8I A;  3EMX A;  1VF3 A;  2FNO A;  1EP7 A;  2C0G A;  3M0F A;  1CQH A;  3O6T A;  3J7Y b;  1JFU A;  5INY A;  3EIN A;  1XW6 A;  3ZLP A;  4L0W A;  3P2A A;  3SWL A;  4IJ3 A;  3A2V A;  3M1G A;  2LQO A;  3KTB A;  2EIQ A;  5KEJ A;  1QK8 A;  2L6C A;  2GGT A;  3TKS A;  1SK0 A;  3CYN A;  1BYE A;  4G9H A;  2X8H A;  4G0L A;  5HFG A;  5JCW A;  3QD9 A;  2FGX A;  2R6K A;  1A2M A;  1V98 A;  2GZY A;  3FK8 A;  3EE2 A;  12GS A;  5ECH B;  1R4W A;  5G30 A;  4I2U A;  1PKZ A;  4X0X A;  1X9M B;  1M2B A;  3ISO A;  1THO A;  4ML6 A;  1ERU A;  4YAV A;  5C04 A;  13GS A;  4N10 A;  4OO4 A;  1Z3E A;  3UJ1 A;  2VCX A;  4JZQ A;  4J56 E;  2VCT A;  5HR0 A;  3KIJ A;  4GLT A;  1G6Y A;  1GSQ A;  5J4U A;  1FW1 A;  1CQG A;  2HRN A;  2F3M A;  3HCZ A;  3MAK A;  3M3M A;  1SKW B;  4MJC A;  1Z6M A;  4Q5N A;  4DSS B;  6GSV A;  1SYR A;  2DBC A;  2VM1 A;  2YAN A; 
#chains in the Genus database with same CATH topology
 4G01 A;  2MBT A;  3UVT A;  3ZIJ A;  4TVE A;  1YEP A;  1M9B A;  4IBP A;  1A2J A;  1X9W B;  4KE3 A;  4MH2 A;  4OCE A;  2OJL A;  4XCS A;  3GFK A;  1WPI A;  4N30 A;  2H6Y A;  4AJ6 A;  3LXT A;  4RQR A;  3N5O A;  2V41 A;  4WET A;  2WVZ A;  3U5R E;  5D73 A;  3UBL A;  3QFA C;  4XRA A;  1EWX A;  1XOB A;  6GSX A;  4Q5R A;  2GSS A;  4XS6 A;  2C0D A;  1G6W A;  4MPG A;  4AJ7 A;  3IAM 2;  5IMC A;  1QMV A;  3PR8 A;  1NHO A;  3LFL A;  4F0B A;  2DIZ A;  3ZTL A;  4I5Q A;  1N8J A;  1YKC A;  1WOU A;  5ECS A;  3LW9 A;  3H79 A;  4FIW A;  4MJE A;  2VL2 A;  5DAK B;  1J08 A;  2NPB A;  2LUS A;  1MDJ A;  3ZVJ A;  5IO2 A;  3C8E A;  2H6Z A;  5F05 A;  3TRX A;  2P0G A;  4EUY A;  5CRH A;  4Q5Q A;  2VIM A;  3W8S A;  3EU3 A;  1X9S B;  4AGS A;  1X5C A;  1ZCP A;  1O7U A;  2YWN A;  3DD3 A;  3IAS 2;  2HSN B;  2ZUP A;  5GST A;  3D4M A;  17GS A;  2E7P A;  1YJ6 A;  1T4Y A;  1M3I A;  4JRR A;  5C00 A;  3QAW A;  3PGT A;  5KOW A;  2L59 A;  2IMD A;  1PX6 A;  3PPU A;  2IN3 A;  2JAD A;  1PN9 A;  1GWC A;  1RK4 A;  3DXB A;  2PWJ A;  1BG5 A;  5ECQ B;  3ZRD A;  1TRW A;  4GTU A;  2AUV A;  1B48 A;  2O87 A;  1AW9 A;  5B7C A;  4XS1 A;  1K0N A;  4HUA A;  2K8S A;  4RI7 A;  2HI7 A;  4HS1 A;  3M9K A;  3FEU A;  5IO0 A;  4QMK A;  3VWW A;  4IP1 A;  4LLR A;  1GTI A;  1A8Y A;  2MBS A;  3FZ5 A;  2VLV A;  3D5J A;  4POK A;  4POM A;  2RM5 A;  1MEK A;  2LNS A;  4PQI A;  2FA8 A;  1OE7 A;  4N0V A;  3GHA A;  1W4V A;  1SK2 A;  2H72 A;  4GRF A;  3VPQ A;  1BQ7 A;  2GLR A;  5J5N A;  1LJR A;  1GUL A;  4E8E A;  1TDI A;  1U3I A;  2F51 A;  4I2T A;  1N2A A;  3F6F A;  2O8V B;  4PI2 C;  4NHZ A;  2AAW A;  1BG1 A;  4K7O A;  2N5F A;  3K8N A;  2H76 A;  4PGT A;  2LJR A;  5CP1 A;  2H75 A;  4CY6 A;  1E6B A;  1F2E A;  5IOX A;  4YQM A;  1OVN A;  1XIY A;  1V9W A;  4DVC A;  4MZB A;  4V2M A;  4RUV A;  3L4N A;  2MMO A;  1SKS B;  5ECM B;  1DE1 A;  4WEY A;  1GRX A;  2VUP A;  2EFE A;  2XPE A;  3H8Q A;  4WXT A;  2C80 A;  1B9Y C;  4V2N A;  1O8W A;  4BA7 A;  4W66 A;  4KCA A;  2DKI A;  4GQC A;  3RBT A;  3GNJ A;  4BIK A;  3FR9 A;  1QUW A;  4K0G A;  3VUR A;  4GSS A;  1XFL A;  4J2F A;  2NBS A;  4TRX A;  2PU9 C;  4AKX B;  1G0T A;  2HZE B;  3VWU A;  2KP1 A;  1ERT A;  2N5B A;  1PMT A;  2QA1 A;  4EO3 A;  5ID2 B;  2K8V A;  5L71 A;  11GS A;  4EDY A;  1PA3 A;  4PUR A;  1XBS A;  2WVY A;  2H66 A;  1EZK A;  4N3Z A;  4X4J A;  3TJJ A;  2H1D A;  4HU9 A;  5ELG A;  4HI7 A;  5A4U A;  3FKF A;  2RUF A;  4ECC A;  2C0E A;  2J23 A;  4K2D A;  1EOG A;  4MZW A;  6GSY A;  1WJK A;  3LJR A;  2LNT A;  4ZB6 A;  5J4V A;  3F3R A;  1T1V A;  1YZX A;  5KN1 A;  1GNW A;  1AAZ A;  2REM A;  3KZQ A;  1FVK A;  3M9J A;  4TXV A;  1HQO A;  4MPF A;  3A3T A;  5HFK A;  3APO A;  3HZ8 A;  2HRK B;  2HSN A;  1GSY A;  5EPF A;  3BCK A;  2EFC A;  2WDU A;  2DMM A;  1B4Q A;  4MF5 A;  1DUG A;  3ZVJ D;  3KM6 A;  2HSM B;  5KOX A;  1TK8 B;  2DML A;  1YY7 A;  2R4V A;  4ZL8 A;  1Y6E A;  4JE1 A;  1UN2 A;  3EWL A;  2JZR A;  3DRN A;  4GXZ A;  3ZRE A;  2HSH A;  22GS A;  1SEN A;  2WS2 A;  4ML1 A;  4IS0 A;  2GZZ A;  1UVZ A;  1SYX A;  4HZ4 A;  2R0P A;  2WGR A;  1AQV A;  1OYJ A;  2E2M A;  3ZML A;  3LQ7 A;  2LJK A;  3LEF A;  3HJM A;  1DE2 A;  1THX A;  3HVS A;  2LKU A;  1JZD A;  5D9W A;  1OC9 B;  3P8W A;  2L5O A;  1SJI A;  2DLX A;  4KH7 A;  4MMM A;  4DEJ A;  2HNL A;  5F06 A;  3D22 A;  1OKT A;  4HDE A;  4XS4 B;  2LQQ A;  2R37 A;  5CRG A;  3D0Z A;  3L9S A;  4ZL9 A;  1U3A A;  1PKW A;  4TR3 A;  3HZ4 A;  5FWG A;  4GF0 A;  2MMA A;  4KW6 A;  1RQM A;  2LRT A;  3OR5 A;  2O5V A;  5A5H B;  2GST A;  1ST9 A;  5A5K A;  5ECL B;  3FZA A;  2YJH A;  2YP6 A;  2QGV A;  4F0C A;  4KSO A;  5ABR A;  4BWS A;  2YOI A;  2LRC A;  4HEA 2;  3VFI A;  4AF2 A;  1IYI A;  4CDO A;  2ALB A;  3BJ5 A;  1QFN A;  4NPB A;  4GCI A;  2B5E A;  2DIY A;  4XHM A;  1XWG A;  1I1I P;  3FMW A;  4TR1 B;  1K0A A;  5DAL B;  5G5E A;  4OMV A;  3C7M A;  1JHB A;  3WD6 A;  4K0N A;  4OFT A;  5JCG A;  3TOU A;  2H30 A;  3APQ A;  5DCH A;  1TI3 A;  2NDO A;  2YZH A;  5D93 A;  1VF1 A;  1R26 A;  3UMA A;  1K0B A;  4IEL A;  2RLI A;  2LST A;  1GTA A;  3US3 A;  3IHG A;  2VD1 A;  3GL5 A;  4JED A;  5HR1 A;  3GN3 A;  3QAV A;  4FH8 A;  1XWK A;  4PTS A;  3CSH A;  1WRY A;  4Z2T A;  2X49 A;  3GKN A;  3A2W A;  3QAG A;  3TB2 A;  4HOJ A;  5HR3 A;  3ZMK A;  2GTU A;  1HD2 A;  4G19 A;  4YQU A;  3DIE A;  5DDL A;  2HZE A;  1JLW A;  2YNX A;  3TRQ A;  3HVV A;  1TU8 A;  3CQF A;  4KUN A;  4IJI A;  3MYD A;  1M3J A;  3VWX A;  5F07 A;  5ID2 A;  5A34 B;  5DBQ A;  5BRT A;  3NOF A;  3GH9 A;  4AKG A;  1MD4 A;  2VD0 A;  3IA1 A;  5CRD A;  2WCI A;  3FR3 A;  3TGZ A;  3KH7 A;  4MNN A;  2C3T A;  1XW9 A;  5F0G A;  2JU5 A;  4PNG A;  2H1L A;  1WMJ A;  4O5R A;  3UVH A;  4POB A;  1AUC A;  5KN0 A;  3ZFB A;  4YKG A;  16GS A;  3GTU B;  2JZT A;  4FQU A;  3VPT A;  2DSA A;  4EVM A;  5IMA A;  4NAX A;  5IMF A;  4QL9 A;  2ON7 A;  1GSU A;  5B6N A;  3GMF A;  2DJ2 A;  2IPA A;  2HRK A;  2QC7 A;  3KH9 A;  2KLX A;  2XBQ A;  4TKY A;  4KGI A;  5ELA A;  3HYP A;  1T4Z A;  1VRS D;  5CYY A;  9GSS A;  5JWO B;  2JSZ A;  3FZ9 A;  2HSM A;  2C3Q A;  5GZZ B;  4EE0 A;  4PQH A;  5AGY A;  1A8L A;  3IR4 A;  1GLP A;  3MNG A;  3UAR A;  2FUG 2;  4N11 A;  4MZC A;  5B8B A;  1G7E A;  1M2D A;  3GH6 A;  4ECJ A;  5G1L A;  3HY2 A;  4JU5 A;  1ZGN A;  2KHP A;  1Q98 A;  3D21 A;  6GST A;  2X4A A;  2E2G A;  3LYP A;  1BJX A;  3ZYW A;  4XRD A;  1EEJ A;  4OWY A;  2WW0 A;  1C72 A;  2F8F A;  2YCD A;  3KCM A;  2OE1 A;  4MA9 A;  4Z2U A;  1TK0 B;  4K1F A;  4KND A;  3KP9 A;  2L4C A;  1OC9 A;  3UIW A;  1PD2 1;  3PIN A;  3TJG A;  4YQV A;  3APS A;  3NIV A;  5D96 A;  1TOF A;  4AKI A;  1Q4J A;  2KOK A;  1K0D A;  1Z9H A;  3QDN A;  4MP4 A;  4XS4 A;  2YWI A;  1TW9 A;  1SL1 B;  1SVL A;  3DYR A;  3HMJ G;  3FHK A;  1XWB A;  3GKX A;  3A5I A;  2IIY A;  1SKR B;  2FWF A;  4ECB A;  2CAQ A;  2OE0 A;  2IMI A;  4Z2R A;  1USB A;  2PMT A;  2VKZ G;  5A5H A;  2NVL A;  1M7T A;  3MSZ A;  2YWM A;  4F9Z A;  1J9B A;  1ZZY A;  5E59 A;  4EIQ A;  2VOC A;  5HFI A;  18GS A;  4GDF A;  5G1K A;  2DJ1 A;  2L4Q A;  1T8E B;  4FYC A;  2PER A;  5DCG A;  5EVO A;  3GKK A;  2FWG A;  3GUR A;  1ACV A;  4BPY A;  4I97 A;  2O89 A;  3GV1 A;  4WR4 A;  4WR5 A;  4TR1 A;  2DJK A;  1XG8 A;  3R2Q A;  5DAL A;  1TU7 A;  5G5F A;  1AQW A;  3ZIV A;  4IP6 A;  1GSD A;  3TRP A;  3RGB C;  3DGQ A;  4MLY A;  4FXY P;  1T00 A;  2HXK A;  1W89 A;  3QFB C;  4HU7 A;  2JL4 A;  1BF5 A;  1B8X A;  5GAP D;  2WJU A;  4ECI A;  2JZS A;  2OA7 A;  1Y25 A;  1N25 A;  2YZU A;  1PL1 A;  1GP1 A;  1F3B A;  3TKS E;  5IIZ A;  19GS A;  3M8N A;  4K9Z A;  1EP8 A;  4X1U A;  5E4W A;  2IMF A;  2DKH A;  2YPM A;  3RPP A;  2LV3 A;  4WBJ A;  4TR0 A;  4TOP A;  1PQN A;  4IHU A;  3CMI A;  3RAZ A;  3WGD A;  3CRT A;  2B3S A;  3ED3 A;  2UV8 G;  3H1N A;  4L5O A;  4NHW A;  2VAF A;  3HXS A;  5A34 A;  2WW1 A;  3TKS C;  2DC5 A;  4WKW A;  5B6M A;  3I6A A;  4ZIJ A;  4HQZ A;  2FY6 A;  4KA0 A;  1TJD A;  1GL8 A;  2ES7 A;  3EMP A;  1PL2 A;  3EC3 A;  6GSW A;  1M9A A;  1FAA A;  5COH A;  1A0F A;  2RII A;  1T3B A;  1Z5Y E;  3TOT A;  4BL7 B;  2FA4 A;  2CZ3 A;  3HVX A;  1JZW A;  3CSJ A;  4OCF A;  5J40 A;  3RHB A;  2HRF A;  2FCH A;  2F9S A;  2I9H A;  2CAI A;  3GTU A;  4D73 B;  2R5G A;  2A4V A;  2LJA A;  3IXR A;  3C1S A;  3FYG A;  1XOA A;  3FR6 A;  4HZ2 A;  3GUS A;  3W8J A;  1SL0 B;  4ZB9 A;  2A4H A;  2QA2 A;  1FB0 A;  2WW2 A;  3CSI A;  5KN3 A;  3QOU A;  2OT3 A;  2CA8 A;  4DSS A;  5JWR B;  3BD2 A;  2X64 A;  4KF9 A;  1TKD B;  2A2R A;  1TTZ A;  5J9B A;  3RFR C;  4KCE A;  1GUK A;  1EV9 A;  2HT9 A;  1S3A A;  3LGC A;  2G0F A;  3WT2 A;  1M0U A;  2CX3 A;  1XW5 A;  1T7P B;  4Q5F A;  1ZMA A;  2H0G A;  3L78 A;  3HA9 A;  1R5P A;  2K18 A;  2HQT A;  1YEX A;  1K3L A;  1EGO A;  3O76 A;  1X5D A;  2CVD A;  2G2Q A;  4EC0 A;  3GSS A;  2PVO C;  3IC8 A;  2AYT A;  2J9H A;  2TRX A;  1RW1 A;  4PHZ C;  4NWY A;  1K3O A;  5G2Z A;  5DAK A;  3KP8 A;  4V2L A;  2YJ7 A;  3H4K A;  1BED A;  3RHC A;  2TIR A;  2B5X A;  5GAN D;  4TN8 A;  4RI6 A;  1FOV A;  5HR2 A;  4NXI A;  1K0C A;  1ZYE A;  3QCP A;  2X99 A;  5B8A A;  5D9T A;  7GSS A;  4IKH A;  5G31 A;  3A5W A;  2K9F A;  3ERG A;  2YV9 A;  2MZC A;  2KUC A;  2I3Y A;  1NW2 A;  3BOA A;  4EIP A;  3Q6O A;  1FVJ A;  1PGT A;  3TJF A;  3TKP A;  4BVX B;  1YDK A;  3KD0 A;  3C73 A;  5JCU A;  1F9M A;  5CO3 A;  3GIX A;  5LCZ A;  2OAD A;  2OAC A;  1V40 A;  4KSM A;  4FO5 A;  3CXG A;  1GNE A;  1TI1 A;  3E0U A;  3IK7 A;  4KDU A;  2MYG A;  2H1B A;  2N5A A;  1TXU A;  3LWA A;  1FG4 A;  1XCC A;  3F4S A;  3HJO A;  1KBN A;  4BWQ A;  1ABA A;  1U87 A;  3W6G A;  1M99 A;  2V32 A;  3F4R A;  1OE8 A;  1HNB A;  3KMO A;  3P90 A;  1GLQ A;  5LD0 A;  5D9X A;  2LEG A;  2H19 A;  4FYU A;  2K6V A;  3IOS A;  5IMV A;  4CY8 A;  4BVY B;  4XTS A;  3LYK A;  5HQP A;  3LG6 A;  4YAP A;  1URM A;  5J4Y A;  2L57 A;  3IPZ A;  3N9J A;  1K3Y A;  1YQ1 A;  4YH2 A;  3TU3 B;  4PQ1 A;  3CHX C;  2XBI A;  1AXD A;  1PSQ A;  5AIV A;  4ZBD A;  1S3D A;  4DSQ A;  3ERF A;  2FLS A;  1S3C A;  3A2X A;  3KTL A;  1I9D A;  1O81 A;  4BL7 A;  4EDZ A;  1MD3 A;  5A1N B;  4X43 A;  3C71 A;  2HLS A;  2AV4 A;  1HYU A;  6GSU A;  1XWC A;  4MK3 A;  3D4T A;  3KGK A;  3J7Y k;  4ZBB A;  2VM2 A;  1XVW A;  1V2A A;  4NMU A;  4D73 A;  4AKH A;  4MF6 A;  1SD9 A;  1J0F A;  3GX8 A;  5DQS A;  2ON5 A;  3HKR A;  4WF5 A;  4K2X A;  3SBC A;  1O8X A;  4PUF C;  1ERW A;  1OC8 A;  3VK9 A;  2YV7 A;  2IL3 A;  1KNG A;  1TP9 A;  2QSI A;  2OKA A;  2AHE A;  2FHE A;  5FT3 A;  1A2L A;  3IV4 A;  2EC4 A;  1TRV A;  3VWV A;  2VLT A;  2BJX A;  1TRU A;  1EV4 A;  3LSZ A;  1BX9 A;  1R7H A;  1Z7P A;  5ECK B;  1QGV A;  3DKS A;  2I81 A;  3QR6 A;  2B7K A;  3PH9 A;  3GRX A;  1LU4 A;  3WGE A;  4O5Q A;  4I6X A;  3VI7 A;  4E8H A;  3HDC A;  2WRT A;  5BMU B;  5ECN B;  2H8L A;  3EYT A;  2O3E A;  3HJP A;  2C4J A;  3F8U A;  3WGX A;  2IME A;  3ZFL A;  3WT1 A;  2DJ3 A;  4ZB7 A;  1OC3 A;  3TCO A;  2BTO T;  2YWO A;  1PX7 A;  2P5Q A;  3CWG A;  4ID0 A;  1ILO A;  3F9U A;  5ECI B;  3UOM A;  2LS5 A;  4LMV A;  3ME7 A;  2H1G A;  4O92 A;  2JSY A;  3GKM A;  4ULX A;  4A5P A;  3TJB A;  2V2G A;  5DVB A;  1AC1 A;  2F8A A;  1GSE A;  4ZIL A;  2H1A A;  2PVQ A;  3O3T A;  1TRS A;  1SVO A;  5DQY A;  4IQA A;  3R3E A;  3I43 A;  3TKR A;  4MDC A;  4O7H A;  2GSQ A;  2OBK A;  5JWQ B;  3L0H A;  4IVF A;  4CW9 A;  3G7I A;  4BVX A;  3UBK A;  3U6V A;  2V6K A;  2PPT A;  1F3A A;  2I4A A;  5IM9 A;  2LRN A;  3UL3 A;  2BMX A;  1GSF A;  4PI0 C;  4ZXG A;  4DSR A;  1U88 A;  1SJZ A;  1PRX A;  4HJM A;  2P31 A;  4CHS A;  5IPH A;  5KN2 A;  4JBB A;  2R3X A;  5IOW A;  3L9U A;  4IGJ A;  3ZZX A;  1EGR A;  3WYW A;  1S4B P;  4WF4 A;  1ZYN A;  4XIH A;  1Z6N A;  4EXJ A;  3RDW A;  5ECP B;  2HSY A;  1QXH A;  4QQ7 A;  3F3Q A;  2GQK A;  3RPN A;  2M72 A;  1YVL A;  2A2P A;  1TK5 B;  1FB6 A;  4MH3 A;  5ECR B;  4G10 A;  1X5E A;  1GUM A;  3P7X A;  4OFN A;  4OD7 A;  5ENU A;  1FO5 A;  1NSW A;  5CNW A;  3TJK A;  2LTK A;  3JCM L;  4O32 A;  4G2E A;  4ILF A;  3L9V A;  3G7Y A;  5ECO B;  2H01 A;  1MTC A;  3ME8 A;  4BVY A;  2VO4 A;  2GVP A;  1Z7R A;  2H74 A;  5J47 A;  2HZF A;  5IMD A;  1QQ2 A;  1U6T A;  2CX4 A;  2DJJ A;  2EIR A;  2WFC A;  2H6X A;  1LBK A;  1MDI A;  2TRC P;  4F2I A;  2Z9S A;  2A2S A;  2PUK C;  5A1N A;  4L5L A;  5EL8 A;  1OKD A;  3QPM A;  4MF7 A;  2H0H A;  5AIX A;  1ON4 A;  1A23 A;  1F37 A;  3DVW A;  2DJ0 A;  1OAZ A;  6GSS A;  1F6M C;  3TDG A;  1JLV A;  2V6O A;  3BBY A;  2R2J A;  3DWV A;  3ZIT A;  3EU4 A;  1DSB A;  1XZO A;  1G7O A;  1GTU A;  2HRA A;  3CRU A;  1YF0 A;  3KJY A;  4KAE A;  1M2A A;  2M46 A;  4I8B A;  4O5U A;  2ZNM A;  5A4W A;  1KEB A;  3F6D A;  3TUE A;  2FWE A;  4EF0 A;  1HNC A;  4GQF A;  5AIS A;  4OFM A;  4YKF A;  2FWH A;  2XHF A;  4TW5 A;  3AY8 A;  2B7J A;  3EUR A;  4USS A;  1H75 A;  1ERV A;  1JZR A;  1AIU A;  2RM6 A;  4NV2 A;  2B6M A;  5IMZ A;  4F82 A;  2XPD A;  2JAC A;  4V1A g;  4ICY A;  5GSS A;  1ZL9 A;  4WBR D;  4KB3 A;  1S3R A;  5BMU A;  2O85 A;  2HYX A;  3DML A;  2VL9 A;  3Q18 A;  1GUH A;  3CBU A;  1XXU A;  3CTG A;  3HVN A;  2GT5 A;  1VGL A;  2VCQ A;  1H4O A;  2M80 A;  3GX0 A;  4H86 A;  5DJM A;  4KDX A;  3FRC A;  2EFD A;  2VL3 A;  1XPV A;  4K8M A;  20GS A;  2C3N A;  3E3E A;  2H0I A;  2CQ9 A;  3IBH A;  2IFQ B;  4F03 A;  2RUE A;  4PNF A;  3Q74 A;  2GSR A;  4TXO B;  1ML6 A;  2EIO A;  1VF4 A;  3E9J B;  4TR4 A;  3V1W A;  2IWT A;  1ZOF A;  2VCW A;  2C0F A;  4EKZ A;  3IK9 A;  2CVB A;  4JR6 A;  2CT6 A;  3IC4 A;  5F8B A;  2X8G A;  2L6D A;  4HJ2 A;  1MDK A;  1HNA A;  3UEM A;  5AN1 A;  4K5S A;  2OBI A;  3IE3 A;  4GST A;  1E2Y A;  4LL4 B;  4LL1 B;  3ERW A;  3BCI A;  2CZ2 A;  4LMW A;  1WWJ A;  2L5L A;  3GYK A;  3EPT A;  2QKE A;  1UC7 A;  3CTF A;  3HHV A;  2I1U A;  1VF2 A;  1GTB A;  4FYB A;  5IQY A;  3EVI A;  3IRA A;  2WZ9 A;  4K6X A;  2EFH A;  4G0I A;  1SJ6 A;  5CAX A;  1KTE A;  1XVQ A;  1SL2 B;  1A24 A;  4MCU A;  2MMN A;  4V1A p;  1IYH A;  3GA4 A;  4G0K A;  3F0I A;  4HSC X;  5LNK e;  4HQS A;  2VCZ A;  1YEW C;  1JZO A;  1R5A A;  4OO5 A;  1UA5 A;  2VL2 C;  1O85 A;  2VCV A;  3C1R A;  4ISD A;  1K0M A;  2WZS A;  4ZBA A;  2GT6 A;  3F4T A;  4JR4 A;  3MWH A;  4P3Y B;  2CVK A;  1SK1 A;  1XWA A;  1EOH A;  3I69 A;  1X0R A;  4ZB8 A;  4IN0 A;  2X8C A;  2B5Y A;  2C8U A;  3ZL5 A;  4MJA A;  2PN8 A;  2OE3 A;  1A0R P;  4GSN A;  3NZN A;  3D6I A;  2VLU A;  1B9X C;  2V1M A;  4K7I A;  3IDV A;  3KEB A;  2H70 A;  4Z7X A;  4PX1 A;  4LA1 A;  2D2Z A;  2WVX B;  5J41 A;  1WE0 A;  2UZ8 A;  3MDK A;  5H5R A;  1ZYQ B;  4L8E A;  2GZP A;  1DBY A;  4PXO A;  4J57 E;  5CRW A;  4POL A;  4AJ8 A;  2MMZ A;  1K0O A;  5A4V A;  2YN1 A;  4PUA A;  3FZ4 A;  3GST A;  5FHI A;  5H5Q A;  3G9B A;  2B1K A;  2ZCT A;  4KX4 A;  2XC2 A;  1GSS A;  3LOR A;  3IHQ A;  2E0Q A;  2WB9 A;  5D9V A;  3VI5 A;  3DVX A;  4ACS A;  3LXZ A;  2WUL A;  3FW2 A;  1WIK A;  1O73 A;  3GL3 A;  4KDY A;  10GS A;  2B1L A;  3F63 A;  4GWR A;  5J3R A;  3VLN A;  4EL1 A;  2WW3 A;  1SU9 A;  4QL7 A;  4L0U A;  1YKA A;  1WP0 A;  1FHE A;  4NV5 A;  3G7J A;  2KP2 A;  4N0Z A;  5J9C A;  1AQX A;  1ZYP A;  3TKQ A;  1V57 A;  2C1Y A;  5EY6 A;  3QMX A;  2GQM A;  2FD3 A;  1NHY A;  2HE3 A;  4IQ1 A;  2NTO A;  2HFD A;  2P5R A;  1NM3 A;  1GH2 A;  2H73 A;  3Q19 A;  1B4P A;  4MJB A;  1EEM A;  2IFQ A;  5CRE A;  2AJQ B;  1YF1 A;  3HD5 A;  5IPG A;  1I5G A;  4MAB A;  3H93 A;  4TXO A;  14GS A;  2CV4 A;  1V58 A;  2O7K A;  1SD8 A;  5H5S A;  3DEX A;  4E68 A;  3S9F A;  4IW9 A;  3KXO A;  2IJY A;  3UAP A;  5DJL A;  1BAY A;  1O6J A;  4K7N A;  2AB6 A;  3KMN A;  3FY7 A;  2PGT A;  8GSS A;  2GS3 A;  2GDR A;  1TXX A;  2GQL A;  4RQX A;  3I9V 2;  2IMK A;  2R0G A;  2H71 A;  4ZL7 A;  2PBJ A;  5D8I A;  3EMX A;  1VF3 A;  2FNO A;  1EP7 A;  1PFO A;  2C0G A;  3M0F A;  1CQH A;  3O6T A;  3J7Y b;  1JFU A;  5INY A;  3EIN A;  1XW6 A;  3ZLP A;  4L0W A;  3MIX A;  3P2A A;  3SWL A;  3A2V A;  3KTB A;  3M1G A;  2LQO A;  4IJ3 A;  2EIQ A;  5KEJ A;  1QK8 A;  2L6C A;  2GGT A;  4K5R A;  3TKS A;  1SK0 A;  3CYN A;  1BYE A;  4G9H A;  2X8H A;  4G0L A;  5HFG A;  5JCW A;  3QD9 A;  2FGX A;  2R6K A;  1A2M A;  1V98 A;  2O36 A;  2GZY A;  3FK8 A;  3EE2 A;  4AI6 A;  12GS A;  5ECH B;  1R4W A;  5G30 A;  4I2U A;  1PKZ A;  4X0X A;  1X9M B;  1M2B A;  3ISO A;  1THO A;  4ML6 A;  1ERU A;  4YAV A;  5C04 A;  13GS A;  4N10 A;  4OO4 A;  1Z3E A;  1FOH A;  1PN0 A;  3UJ1 A;  2VCX A;  4JZQ A;  4J56 E;  2VCT A;  5HR0 A;  3KIJ A;  4GLT A;  1Y1U A;  1SVM A;  1G6Y A;  1GSQ A;  2R0C A;  5J4U A;  1FW1 A;  1CQG A;  2HRN A;  2F3M A;  3HCZ A;  3MAK A;  3M3M A;  1SKW B;  4MJC A;  1Z6M A;  4Q5N A;  4DSS B;  2WVX A;  6GSV A;  1SYR A;  2DBC A;  2VM1 A;  2YAN A; 
#chains in the Genus database with same CATH homology
 4G01 A;  2MBT A;  3UVT A;  3ZIJ A;  4TVE A;  1YEP A;  1M9B A;  4IBP A;  1A2J A;  1X9W B;  4KE3 A;  4MH2 A;  4OCE A;  2OJL A;  4XCS A;  3GFK A;  1WPI A;  4N30 A;  2H6Y A;  4AJ6 A;  3LXT A;  4RQR A;  3N5O A;  2V41 A;  4WET A;  3U5R E;  5D73 A;  3UBL A;  3QFA C;  4XRA A;  1EWX A;  1XOB A;  6GSX A;  4Q5R A;  2GSS A;  4XS6 A;  2C0D A;  1G6W A;  4MPG A;  4AJ7 A;  3IAM 2;  5IMC A;  1QMV A;  3PR8 A;  1NHO A;  3LFL A;  4F0B A;  2DIZ A;  3ZTL A;  4I5Q A;  1N8J A;  1YKC A;  1WOU A;  5ECS A;  3LW9 A;  3H79 A;  4FIW A;  4MJE A;  2VL2 A;  5DAK B;  1J08 A;  2NPB A;  2LUS A;  1MDJ A;  3ZVJ A;  5IO2 A;  3C8E A;  2H6Z A;  5F05 A;  3TRX A;  2P0G A;  4EUY A;  5CRH A;  4Q5Q A;  2VIM A;  3W8S A;  3EU3 A;  1X9S B;  4AGS A;  1X5C A;  1ZCP A;  1O7U A;  2YWN A;  3DD3 A;  3IAS 2;  2HSN B;  2ZUP A;  5GST A;  3D4M A;  17GS A;  2E7P A;  1YJ6 A;  1T4Y A;  4JRR A;  5C00 A;  3QAW A;  3PGT A;  5KOW A;  2L59 A;  2IMD A;  1PX6 A;  3PPU A;  2IN3 A;  2JAD A;  1PN9 A;  1GWC A;  1RK4 A;  3DXB A;  2PWJ A;  1BG5 A;  5ECQ B;  3ZRD A;  1TRW A;  4GTU A;  2AUV A;  1B48 A;  2O87 A;  1AW9 A;  5B7C A;  4XS1 A;  1K0N A;  4HUA A;  2K8S A;  4RI7 A;  2HI7 A;  4HS1 A;  3M9K A;  3FEU A;  5IO0 A;  4QMK A;  3VWW A;  4IP1 A;  4LLR A;  1GTI A;  1A8Y A;  2MBS A;  3FZ5 A;  2VLV A;  3D5J A;  4POK A;  4POM A;  2RM5 A;  1MEK A;  2LNS A;  4PQI A;  2FA8 A;  1OE7 A;  4N0V A;  3GHA A;  1W4V A;  1SK2 A;  2H72 A;  4GRF A;  3VPQ A;  1BQ7 A;  2GLR A;  5J5N A;  1LJR A;  1GUL A;  4E8E A;  1TDI A;  1U3I A;  2F51 A;  4I2T A;  1N2A A;  3F6F A;  2O8V B;  4NHZ A;  2AAW A;  1BG1 A;  4K7O A;  2N5F A;  3K8N A;  2H76 A;  4PGT A;  2LJR A;  5CP1 A;  2H75 A;  4CY6 A;  1E6B A;  1F2E A;  5IOX A;  4YQM A;  1OVN A;  1XIY A;  1V9W A;  4DVC A;  4MZB A;  4V2M A;  4RUV A;  3L4N A;  2MMO A;  1SKS B;  5ECM B;  1DE1 A;  4WEY A;  1GRX A;  2VUP A;  2EFE A;  2XPE A;  3H8Q A;  4WXT A;  2C80 A;  1B9Y C;  4V2N A;  1O8W A;  4BA7 A;  4W66 A;  4KCA A;  2DKI A;  4GQC A;  3RBT A;  3GNJ A;  3FR9 A;  1QUW A;  4K0G A;  3VUR A;  4GSS A;  1XFL A;  4J2F A;  2NBS A;  4TRX A;  2PU9 C;  4AKX B;  1G0T A;  2HZE B;  3VWU A;  2KP1 A;  1ERT A;  2N5B A;  1PMT A;  2QA1 A;  4EO3 A;  5ID2 B;  2K8V A;  5L71 A;  11GS A;  4EDY A;  1PA3 A;  4PUR A;  1XBS A;  2H66 A;  1EZK A;  4N3Z A;  4X4J A;  3TJJ A;  2H1D A;  4HU9 A;  5ELG A;  4HI7 A;  5A4U A;  3FKF A;  2RUF A;  4ECC A;  2C0E A;  2J23 A;  4K2D A;  1EOG A;  4MZW A;  6GSY A;  1WJK A;  3LJR A;  2LNT A;  4ZB6 A;  5J4V A;  3F3R A;  1T1V A;  1YZX A;  5KN1 A;  1GNW A;  1AAZ A;  2REM A;  3KZQ A;  1FVK A;  3M9J A;  4TXV A;  1HQO A;  4MPF A;  3A3T A;  5HFK A;  3APO A;  3HZ8 A;  2HRK B;  2HSN A;  1GSY A;  5EPF A;  3BCK A;  2EFC A;  2WDU A;  2DMM A;  1B4Q A;  4MF5 A;  1DUG A;  3ZVJ D;  3KM6 A;  2HSM B;  5KOX A;  1TK8 B;  2DML A;  1YY7 A;  2R4V A;  4ZL8 A;  1Y6E A;  4JE1 A;  1UN2 A;  3EWL A;  2JZR A;  3DRN A;  4GXZ A;  3ZRE A;  2HSH A;  22GS A;  1SEN A;  2WS2 A;  4ML1 A;  4IS0 A;  2GZZ A;  1UVZ A;  1SYX A;  4HZ4 A;  2R0P A;  2WGR A;  1AQV A;  1OYJ A;  2E2M A;  3ZML A;  3LQ7 A;  2LJK A;  3LEF A;  3HJM A;  1DE2 A;  1THX A;  3HVS A;  2LKU A;  1JZD A;  5D9W A;  1OC9 B;  3P8W A;  2L5O A;  1SJI A;  2DLX A;  4KH7 A;  4MMM A;  4DEJ A;  2HNL A;  5F06 A;  3D22 A;  1OKT A;  4HDE A;  4XS4 B;  2LQQ A;  2R37 A;  5CRG A;  3D0Z A;  3L9S A;  4ZL9 A;  1U3A A;  1PKW A;  4TR3 A;  3HZ4 A;  5FWG A;  4GF0 A;  2MMA A;  4KW6 A;  1RQM A;  2LRT A;  3OR5 A;  2O5V A;  5A5H B;  2GST A;  1ST9 A;  5A5K A;  5ECL B;  3FZA A;  2YJH A;  2YP6 A;  2QGV A;  4F0C A;  4KSO A;  5ABR A;  4BWS A;  2YOI A;  2LRC A;  4HEA 2;  3VFI A;  4AF2 A;  1IYI A;  4CDO A;  2ALB A;  3BJ5 A;  1QFN A;  4NPB A;  4GCI A;  2B5E A;  2DIY A;  4XHM A;  1XWG A;  3FMW A;  4TR1 B;  1K0A A;  5DAL B;  5G5E A;  4OMV A;  3C7M A;  1JHB A;  3WD6 A;  4K0N A;  4OFT A;  5JCG A;  3TOU A;  2H30 A;  3APQ A;  5DCH A;  1TI3 A;  2NDO A;  2YZH A;  5D93 A;  1VF1 A;  1R26 A;  3UMA A;  1K0B A;  4IEL A;  2RLI A;  2LST A;  1GTA A;  3US3 A;  3IHG A;  2VD1 A;  3GL5 A;  4JED A;  5HR1 A;  3GN3 A;  3QAV A;  4FH8 A;  1XWK A;  4PTS A;  3CSH A;  1WRY A;  4Z2T A;  2X49 A;  3GKN A;  3A2W A;  3QAG A;  3TB2 A;  4HOJ A;  5HR3 A;  3ZMK A;  2GTU A;  1HD2 A;  4G19 A;  4YQU A;  3DIE A;  5DDL A;  2HZE A;  1JLW A;  2YNX A;  3TRQ A;  3HVV A;  1TU8 A;  4KUN A;  4IJI A;  3MYD A;  3VWX A;  5F07 A;  5ID2 A;  5A34 B;  5DBQ A;  5BRT A;  3NOF A;  3GH9 A;  4AKG A;  1MD4 A;  2VD0 A;  3IA1 A;  5CRD A;  2WCI A;  3FR3 A;  3TGZ A;  3KH7 A;  4MNN A;  2C3T A;  1XW9 A;  5F0G A;  2JU5 A;  4PNG A;  2H1L A;  1WMJ A;  4O5R A;  3UVH A;  4POB A;  1AUC A;  5KN0 A;  3ZFB A;  4YKG A;  16GS A;  3GTU B;  2JZT A;  4FQU A;  3VPT A;  2DSA A;  4EVM A;  5IMA A;  4NAX A;  5IMF A;  4QL9 A;  2ON7 A;  1GSU A;  5B6N A;  3GMF A;  2DJ2 A;  2IPA A;  2HRK A;  2QC7 A;  3KH9 A;  2KLX A;  2XBQ A;  4TKY A;  4KGI A;  5ELA A;  3HYP A;  1T4Z A;  1VRS D;  5CYY A;  9GSS A;  5JWO B;  2JSZ A;  3FZ9 A;  2HSM A;  2C3Q A;  5GZZ B;  4EE0 A;  4PQH A;  5AGY A;  1A8L A;  3IR4 A;  1GLP A;  3MNG A;  3UAR A;  2FUG 2;  4N11 A;  4MZC A;  5B8B A;  1G7E A;  1M2D A;  3GH6 A;  4ECJ A;  5G1L A;  3HY2 A;  4JU5 A;  1ZGN A;  2KHP A;  1Q98 A;  3D21 A;  6GST A;  2X4A A;  2E2G A;  3LYP A;  1BJX A;  3ZYW A;  4XRD A;  1EEJ A;  4OWY A;  1C72 A;  2F8F A;  2YCD A;  3KCM A;  2OE1 A;  4MA9 A;  4Z2U A;  1TK0 B;  4K1F A;  4KND A;  3KP9 A;  2L4C A;  1OC9 A;  3UIW A;  1PD2 1;  3PIN A;  3TJG A;  4YQV A;  3APS A;  3NIV A;  5D96 A;  1TOF A;  4AKI A;  1Q4J A;  2KOK A;  1K0D A;  1Z9H A;  3QDN A;  4MP4 A;  4XS4 A;  2YWI A;  1TW9 A;  1SL1 B;  1SVL A;  3DYR A;  3HMJ G;  3FHK A;  1XWB A;  3GKX A;  3A5I A;  2IIY A;  1SKR B;  2FWF A;  4ECB A;  2CAQ A;  2OE0 A;  2IMI A;  4Z2R A;  1USB A;  2PMT A;  2VKZ G;  5A5H A;  2NVL A;  1M7T A;  3MSZ A;  2YWM A;  4F9Z A;  1J9B A;  1ZZY A;  5E59 A;  4EIQ A;  2VOC A;  5HFI A;  18GS A;  4GDF A;  5G1K A;  2DJ1 A;  2L4Q A;  1T8E B;  4FYC A;  2PER A;  5DCG A;  5EVO A;  3GKK A;  2FWG A;  3GUR A;  1ACV A;  4BPY A;  4I97 A;  2O89 A;  3GV1 A;  4WR4 A;  4WR5 A;  4TR1 A;  2DJK A;  3R2Q A;  5DAL A;  1TU7 A;  5G5F A;  1AQW A;  3ZIV A;  4IP6 A;  1GSD A;  3TRP A;  4MLY A;  3DGQ A;  1T00 A;  2HXK A;  1W89 A;  3QFB C;  4HU7 A;  2JL4 A;  1BF5 A;  1B8X A;  5GAP D;  2WJU A;  4ECI A;  2JZS A;  2OA7 A;  1Y25 A;  1N25 A;  2YZU A;  1PL1 A;  1GP1 A;  1F3B A;  3TKS E;  5IIZ A;  19GS A;  3M8N A;  4K9Z A;  1EP8 A;  4X1U A;  5E4W A;  2IMF A;  2DKH A;  2YPM A;  3RPP A;  2LV3 A;  4WBJ A;  4TR0 A;  4TOP A;  1PQN A;  4IHU A;  3CMI A;  3RAZ A;  3WGD A;  3CRT A;  2B3S A;  3ED3 A;  2UV8 G;  3H1N A;  4L5O A;  4NHW A;  2VAF A;  3HXS A;  5A34 A;  3TKS C;  2DC5 A;  4WKW A;  5B6M A;  3I6A A;  4ZIJ A;  4HQZ A;  2FY6 A;  4KA0 A;  1TJD A;  1GL8 A;  2ES7 A;  3EMP A;  1PL2 A;  3EC3 A;  6GSW A;  1M9A A;  1FAA A;  5COH A;  1A0F A;  2RII A;  1T3B A;  1Z5Y E;  3TOT A;  4BL7 B;  2FA4 A;  2CZ3 A;  3HVX A;  1JZW A;  3CSJ A;  4OCF A;  5J40 A;  3RHB A;  2HRF A;  2FCH A;  2F9S A;  2I9H A;  2CAI A;  3GTU A;  4D73 B;  2R5G A;  2A4V A;  2LJA A;  3IXR A;  3C1S A;  3FYG A;  1XOA A;  3FR6 A;  4HZ2 A;  3GUS A;  3W8J A;  1SL0 B;  4ZB9 A;  2A4H A;  2QA2 A;  1FB0 A;  3CSI A;  5KN3 A;  3QOU A;  2OT3 A;  2CA8 A;  4DSS A;  5JWR B;  3BD2 A;  2X64 A;  4KF9 A;  1TKD B;  2A2R A;  1TTZ A;  5J9B A;  4KCE A;  1GUK A;  1EV9 A;  2HT9 A;  1S3A A;  3LGC A;  2G0F A;  3WT2 A;  1M0U A;  2CX3 A;  1XW5 A;  1T7P B;  4Q5F A;  1ZMA A;  2H0G A;  3L78 A;  3HA9 A;  1R5P A;  2K18 A;  2HQT A;  1YEX A;  1K3L A;  1EGO A;  3O76 A;  1X5D A;  2CVD A;  2G2Q A;  4EC0 A;  3GSS A;  2PVO C;  3IC8 A;  2AYT A;  2J9H A;  2TRX A;  1RW1 A;  4NWY A;  1K3O A;  5G2Z A;  5DAK A;  3KP8 A;  4V2L A;  2YJ7 A;  3H4K A;  1BED A;  3RHC A;  2TIR A;  2B5X A;  5GAN D;  4TN8 A;  4RI6 A;  1FOV A;  5HR2 A;  4NXI A;  1K0C A;  1ZYE A;  3QCP A;  2X99 A;  5B8A A;  5D9T A;  7GSS A;  4IKH A;  5G31 A;  3A5W A;  2K9F A;  3ERG A;  2YV9 A;  2MZC A;  2KUC A;  2I3Y A;  1NW2 A;  3BOA A;  4EIP A;  3Q6O A;  1FVJ A;  1PGT A;  3TJF A;  3TKP A;  4BVX B;  1YDK A;  3KD0 A;  3C73 A;  5JCU A;  1F9M A;  5CO3 A;  3GIX A;  5LCZ A;  2OAD A;  2OAC A;  1V40 A;  4KSM A;  4FO5 A;  3CXG A;  1GNE A;  1TI1 A;  3E0U A;  3IK7 A;  4KDU A;  2MYG A;  2H1B A;  2N5A A;  1TXU A;  3LWA A;  1FG4 A;  1XCC A;  3F4S A;  3HJO A;  1KBN A;  4BWQ A;  1ABA A;  1U87 A;  3W6G A;  1M99 A;  2V32 A;  3F4R A;  1OE8 A;  1HNB A;  3KMO A;  3P90 A;  1GLQ A;  5LD0 A;  5D9X A;  2LEG A;  2H19 A;  4FYU A;  2K6V A;  3IOS A;  5IMV A;  4CY8 A;  4BVY B;  4XTS A;  3LYK A;  5HQP A;  3LG6 A;  4YAP A;  1URM A;  5J4Y A;  2L57 A;  3IPZ A;  3N9J A;  1K3Y A;  1YQ1 A;  4YH2 A;  3TU3 B;  4PQ1 A;  2XBI A;  1AXD A;  1PSQ A;  5AIV A;  4ZBD A;  1S3D A;  4DSQ A;  3ERF A;  2FLS A;  1S3C A;  3A2X A;  3KTL A;  1I9D A;  1O81 A;  4BL7 A;  4EDZ A;  1MD3 A;  5A1N B;  4X43 A;  3C71 A;  2HLS A;  2AV4 A;  1HYU A;  6GSU A;  1XWC A;  4MK3 A;  3D4T A;  3KGK A;  3J7Y k;  4ZBB A;  2VM2 A;  1XVW A;  1V2A A;  4NMU A;  4D73 A;  4AKH A;  4MF6 A;  1SD9 A;  1J0F A;  3GX8 A;  5DQS A;  2ON5 A;  3HKR A;  4WF5 A;  4K2X A;  3SBC A;  1O8X A;  4PUF C;  1ERW A;  1OC8 A;  3VK9 A;  2YV7 A;  2IL3 A;  1KNG A;  1TP9 A;  2QSI A;  2OKA A;  2AHE A;  2FHE A;  5FT3 A;  1A2L A;  3IV4 A;  2EC4 A;  1TRV A;  3VWV A;  2VLT A;  2BJX A;  1TRU A;  1EV4 A;  3LSZ A;  1BX9 A;  1R7H A;  1Z7P A;  5ECK B;  1QGV A;  3DKS A;  2I81 A;  3QR6 A;  2B7K A;  3PH9 A;  3GRX A;  1LU4 A;  3WGE A;  4O5Q A;  4I6X A;  3VI7 A;  4E8H A;  3HDC A;  2WRT A;  5BMU B;  5ECN B;  2H8L A;  3EYT A;  3HJP A;  2C4J A;  3F8U A;  3WGX A;  2IME A;  3ZFL A;  3WT1 A;  2DJ3 A;  4ZB7 A;  1OC3 A;  3TCO A;  2BTO T;  2YWO A;  1PX7 A;  2P5Q A;  3CWG A;  4ID0 A;  1ILO A;  3F9U A;  5ECI B;  3UOM A;  2LS5 A;  4LMV A;  3ME7 A;  2H1G A;  4O92 A;  2JSY A;  3GKM A;  4ULX A;  4A5P A;  3TJB A;  2V2G A;  5DVB A;  1AC1 A;  2F8A A;  1GSE A;  4ZIL A;  2H1A A;  2PVQ A;  3O3T A;  1TRS A;  1SVO A;  5DQY A;  4IQA A;  3R3E A;  3I43 A;  3TKR A;  4MDC A;  4O7H A;  2GSQ A;  2OBK A;  5JWQ B;  3L0H A;  4IVF A;  4CW9 A;  3G7I A;  4BVX A;  3UBK A;  3U6V A;  2V6K A;  2PPT A;  1F3A A;  2I4A A;  5IM9 A;  2LRN A;  3UL3 A;  2BMX A;  1GSF A;  4DSR A;  4ZXG A;  1U88 A;  1SJZ A;  1PRX A;  4HJM A;  2P31 A;  4CHS A;  5IPH A;  5KN2 A;  4JBB A;  2R3X A;  5IOW A;  3L9U A;  4IGJ A;  3ZZX A;  1EGR A;  3WYW A;  4WF4 A;  1ZYN A;  4XIH A;  1Z6N A;  4EXJ A;  3RDW A;  5ECP B;  2HSY A;  1QXH A;  4QQ7 A;  3F3Q A;  2GQK A;  3RPN A;  2M72 A;  1YVL A;  2A2P A;  1TK5 B;  1FB6 A;  4MH3 A;  5ECR B;  4G10 A;  1X5E A;  1GUM A;  3P7X A;  4OFN A;  4OD7 A;  5ENU A;  1FO5 A;  1NSW A;  5CNW A;  3TJK A;  2LTK A;  3JCM L;  4O32 A;  4G2E A;  4ILF A;  3L9V A;  3G7Y A;  5ECO B;  2H01 A;  1MTC A;  3ME8 A;  4BVY A;  2VO4 A;  2GVP A;  1Z7R A;  2H74 A;  5J47 A;  2HZF A;  5IMD A;  1QQ2 A;  1U6T A;  2CX4 A;  2DJJ A;  2EIR A;  2WFC A;  2H6X A;  1LBK A;  1MDI A;  2TRC P;  4F2I A;  2Z9S A;  2A2S A;  2PUK C;  5A1N A;  4L5L A;  5EL8 A;  1OKD A;  3QPM A;  4MF7 A;  2H0H A;  5AIX A;  1ON4 A;  1A23 A;  1F37 A;  3DVW A;  2DJ0 A;  1OAZ A;  6GSS A;  1F6M C;  3TDG A;  1JLV A;  2V6O A;  3BBY A;  2R2J A;  3DWV A;  3ZIT A;  3EU4 A;  1DSB A;  1XZO A;  1G7O A;  1GTU A;  2HRA A;  3CRU A;  1YF0 A;  3KJY A;  4KAE A;  1M2A A;  2M46 A;  4I8B A;  4O5U A;  2ZNM A;  5A4W A;  1KEB A;  3F6D A;  3TUE A;  2FWE A;  4EF0 A;  1HNC A;  4GQF A;  5AIS A;  4OFM A;  4YKF A;  2FWH A;  2XHF A;  4TW5 A;  3AY8 A;  2B7J A;  3EUR A;  4USS A;  1H75 A;  1ERV A;  1JZR A;  1AIU A;  2RM6 A;  4NV2 A;  2B6M A;  5IMZ A;  4F82 A;  2XPD A;  2JAC A;  4V1A g;  4ICY A;  5GSS A;  1ZL9 A;  4WBR D;  4KB3 A;  5BMU A;  2O85 A;  2HYX A;  3DML A;  2VL9 A;  3Q18 A;  1GUH A;  3CBU A;  1XXU A;  3CTG A;  2GT5 A;  1VGL A;  2VCQ A;  1H4O A;  2M80 A;  3GX0 A;  4H86 A;  5DJM A;  4KDX A;  3FRC A;  2EFD A;  2VL3 A;  1XPV A;  4K8M A;  20GS A;  2C3N A;  3E3E A;  2H0I A;  2CQ9 A;  3IBH A;  2IFQ B;  4F03 A;  2RUE A;  4PNF A;  3Q74 A;  2GSR A;  4TXO B;  1ML6 A;  2EIO A;  1VF4 A;  3E9J B;  4TR4 A;  3V1W A;  2IWT A;  1ZOF A;  2VCW A;  2C0F A;  4EKZ A;  3IK9 A;  2CVB A;  4JR6 A;  2CT6 A;  3IC4 A;  5F8B A;  2X8G A;  2L6D A;  4HJ2 A;  1MDK A;  1HNA A;  3UEM A;  5AN1 A;  4K5S A;  2OBI A;  3IE3 A;  4GST A;  1E2Y A;  4LL4 B;  4LL1 B;  3ERW A;  3BCI A;  2CZ2 A;  4LMW A;  1WWJ A;  2L5L A;  3GYK A;  3EPT A;  2QKE A;  1UC7 A;  3CTF A;  3HHV A;  2I1U A;  1VF2 A;  1GTB A;  4FYB A;  5IQY A;  3EVI A;  3IRA A;  2WZ9 A;  4K6X A;  2EFH A;  4G0I A;  1SJ6 A;  5CAX A;  1KTE A;  1XVQ A;  1SL2 B;  1A24 A;  4MCU A;  2MMN A;  4V1A p;  1IYH A;  3GA4 A;  4G0K A;  3F0I A;  5LNK e;  4HQS A;  2VCZ A;  1JZO A;  1R5A A;  4OO5 A;  1UA5 A;  2VL2 C;  1O85 A;  2VCV A;  3C1R A;  4ISD A;  1K0M A;  4ZBA A;  2GT6 A;  3F4T A;  4JR4 A;  3MWH A;  4P3Y B;  2CVK A;  1SK1 A;  1XWA A;  1EOH A;  3I69 A;  1X0R A;  4ZB8 A;  4IN0 A;  2X8C A;  2B5Y A;  2C8U A;  3ZL5 A;  4MJA A;  2PN8 A;  2OE3 A;  1A0R P;  4GSN A;  3NZN A;  3D6I A;  2VLU A;  1B9X C;  2V1M A;  4K7I A;  3IDV A;  3KEB A;  2H70 A;  4Z7X A;  4PX1 A;  4LA1 A;  2D2Z A;  5J41 A;  1WE0 A;  2UZ8 A;  3MDK A;  5H5R A;  1ZYQ B;  4L8E A;  2GZP A;  1DBY A;  4PXO A;  4J57 E;  5CRW A;  4POL A;  4AJ8 A;  2MMZ A;  1K0O A;  5A4V A;  2YN1 A;  4PUA A;  3FZ4 A;  3GST A;  5FHI A;  5H5Q A;  3G9B A;  2B1K A;  2ZCT A;  4KX4 A;  2XC2 A;  1GSS A;  3LOR A;  3IHQ A;  2E0Q A;  2WB9 A;  5D9V A;  3VI5 A;  3DVX A;  4ACS A;  3LXZ A;  2WUL A;  3FW2 A;  1WIK A;  1O73 A;  3GL3 A;  4KDY A;  10GS A;  2B1L A;  3F63 A;  4GWR A;  5J3R A;  3VLN A;  4EL1 A;  1SU9 A;  4QL7 A;  4L0U A;  1YKA A;  1WP0 A;  1FHE A;  4NV5 A;  3G7J A;  2KP2 A;  4N0Z A;  5J9C A;  1AQX A;  1ZYP A;  3TKQ A;  1V57 A;  2C1Y A;  5EY6 A;  3QMX A;  2GQM A;  2FD3 A;  1NHY A;  2HE3 A;  4IQ1 A;  2NTO A;  2HFD A;  2P5R A;  1NM3 A;  1GH2 A;  2H73 A;  3Q19 A;  1B4P A;  4MJB A;  1EEM A;  2IFQ A;  5CRE A;  2AJQ B;  1YF1 A;  3HD5 A;  5IPG A;  1I5G A;  4MAB A;  3H93 A;  4TXO A;  14GS A;  2CV4 A;  1V58 A;  2O7K A;  1SD8 A;  5H5S A;  3DEX A;  4E68 A;  3S9F A;  4IW9 A;  3KXO A;  2IJY A;  3UAP A;  5DJL A;  1BAY A;  1O6J A;  4K7N A;  2AB6 A;  3KMN A;  3FY7 A;  2PGT A;  8GSS A;  2GS3 A;  2GDR A;  1TXX A;  2GQL A;  4RQX A;  3I9V 2;  2IMK A;  2R0G A;  2H71 A;  4ZL7 A;  2PBJ A;  5D8I A;  3EMX A;  1VF3 A;  2FNO A;  1EP7 A;  2C0G A;  3M0F A;  1CQH A;  3O6T A;  3J7Y b;  1JFU A;  5INY A;  3EIN A;  1XW6 A;  3ZLP A;  4L0W A;  3MIX A;  3P2A A;  3SWL A;  3A2V A;  3KTB A;  3M1G A;  2LQO A;  4IJ3 A;  2EIQ A;  5KEJ A;  1QK8 A;  2L6C A;  2GGT A;  4K5R A;  3TKS A;  1SK0 A;  3CYN A;  1BYE A;  4G9H A;  2X8H A;  4G0L A;  5HFG A;  5JCW A;  3QD9 A;  2FGX A;  2R6K A;  1A2M A;  1V98 A;  2GZY A;  3FK8 A;  3EE2 A;  4AI6 A;  12GS A;  5ECH B;  1R4W A;  5G30 A;  4I2U A;  1PKZ A;  4X0X A;  1X9M B;  1M2B A;  3ISO A;  1THO A;  4ML6 A;  1ERU A;  4YAV A;  5C04 A;  13GS A;  4N10 A;  4OO4 A;  1Z3E A;  1FOH A;  1PN0 A;  3UJ1 A;  2VCX A;  4JZQ A;  4J56 E;  2VCT A;  5HR0 A;  3KIJ A;  4GLT A;  1Y1U A;  1SVM A;  1G6Y A;  1GSQ A;  2R0C A;  5J4U A;  1FW1 A;  1CQG A;  2HRN A;  2F3M A;  3HCZ A;  3MAK A;  3M3M A;  1SKW B;  4MJC A;  1Z6M A;  4Q5N A;  4DSS B;  6GSV A;  1SYR A;  2DBC A;  2VM1 A;  2YAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...