3VLNA

Human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
239
structure length
239
Chain Sequence
GESARSLGKGSAPPGPVPEGSIRIYSMRFSPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase omega-1
publication title Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 239
sequence length 239
ec nomenclature ec 1.20.4.2: Methylarsonate reductase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vlnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vlnA01
1K3OA 4AJ8A 3GUSA 4FYBA 2HYXA 2JSYA 1PA3A 1TP9A 2GZZA 3PH9A 5IMAA 1M2BA 2H1GA 4JZQA 3DVWA 3KIJA 3Q74A 1AXDA 4HU9A 3FZ9A 4EDYA 3KGKA 2KP2A 2R4VA 3P90A 2FWGA 3RBTA 3DVXA 1U87A 3Q18A 3A2XA 4L0WA 2VCTA 3HVXA 1KBNA 1OC9B 1FVJA 1AW9A 1OE8A 3IAM2 1Y25A 2PGTA 2H0GA 4HJ2A 4IGJA 3F9UA 3IAS2 3FR3A 4K8MA 3M9KA 2YWIA 1TI3A 1QK8A 3TRPA 1TOFA 3KXOA 1XW9A 4JR6A 1R5AA 4XTSA 4NWYA 1SD8A 3N5OA 1XOBA 2MBSA 3TKRA 2E2MA 3HD5A 3H93A 4J57E 4F9ZA 4NAXA 3LXZA 2DBCA 2H6YA 2XPEA 2OJLA 2RIIA 2BMXA 2CT6A 1J0FA 1THXA 1WE0A 1Y6EA 5F05A 1OKDA 1SJIA 3J7Yk 1FB0A 1JZRA 1WIKA 2CVBA 1T8EB 3KH7A 1ML6A 2GSRA 2TRCP 1V40A 3HJMA 1B9XC 3C73A 2ES7A 2GTUA 3F3QA 4EC0A 3EE2A 4N11A 4GSTA 4EL1A 1FAAA 2R3XA 1GNWA 2D2ZA 1XXUA 3WT2A 5DALB 1M99A 1BAYA 5B7CA 1EWXA 2B5YA 2GQKA 4GQCA 1GSEA 1MDJA 1Z7RA 1IYIA 5G5EA 1AQXA 3MAKA 2VIMA 3F63A 1OKTA 4HZ4A 4MK3A 1J08A 2MBTA 5EVOA 1S3AA 2PBJA 5G1KA 3LQ7A 4EE0A 4N0VA 4FQUA 2F8AA 2LRNA 4POMA 1WWJA 2WZ9A 3GX0A 3OR5A 3VURA 1O8XA 2VCXA 1V98A 1HNAA 2H0IA 4HU7A 3I9V2 2YNXA 3H79A 3CXGA 3QAWA 4IVFA 3NIVA 4ML6A 2CAQA 3EINA 3GN3A 5B8BA 1FOVA 2A2SA 2P31A 5J5NA 3A2WA 3J7Yb 1K0BA 3TKQA 3KCMA 1X9MB 5D9TA 2H76A 2LNTA 1J9BA 2YOIA 5ECKB 1EZKA 3GX8A 4OD7A 1ZZYA 5IMFA 2OBKA 3R2QA 3FEUA 3QAGA 1YF0A 5B8AA 1TK0B 4JEDA 3F6FA 1AIUA 2B7JA 4FO5A 1OYJA 2L6CA 1FO5A 3IA1A 2EIOA 4OCFA 2VOCA 3LXTA 1BEDA 5ID2B 1PRXA 2H6XA 1B4PA 4I97A 2HI7A 3GURA 2WS2A 1XW5A 4ZB9A 2N5FA 4X0XA 2LQQA 2IFQA 2GS3A 3QFAC 3DXBA 4P3YB 2C80A 2JZSA 1EEJA 4ZBBA 4OCEA 5JCGA 4HQSA 5CRHA 2IPAA 3D4TA 5CREA 1NW2A 3ZZXA 3TGZA 2WB9A 4WEYA 1F6MC 2YZHA 5AISA 3FYGA 2K8SA 4HOJA 2P0GA 3GSTA 5GAPD 5AN1A 1YKAA 2V2GA 1SL2B 3D4MA 1PL2A 4K1FA 2YJ7A 3HY2A 1PGTA 3FKFA 1HYUA 4OO5A 3A3TA 4MF6A 2OE3A 4XCSA 1V58A 1G6WA 4PTSA 1Z6MA 1MTCA 4KDUA 3HHVA 4XS4B 1JLWA 4PX1A 1IYHA 2MMOA 2VLUA 4KE3A 2DMLA 2NBSA 2FHEA 4TW5A 2N5BA 3C1RA 5LCZA 1ZCPA 1GLQA 4OFNA 4O5RA 1PL1A 4GF0A 2HSHA 3UL3A 4DEJA 3FR9A 2E7PA 4YH2A 5GSTA 1XFLA 2GZYA 1X0RA 4O7HA 4TVEA 2XC2A 4KW6A 4HEA2 1U3AA 4G2EA 5ECOB 3ZL5A 2O7KA 3LJRA 3ERWA 4TXVA 2K18A 1F9MA 4BVXB 3TOTA 4K7IA 1K0MA 4JRRA 2GT5A 3M0FA 2FA8A 2NDOA 2HZEB 1EP7A 1E2YA 4NV5A 1QUWA 3HJPA 2DIZA 3G7YA 11GSA 2CAIA 1G0TA 2N5AA 3RHCA 2PVOC 5DVBA 1GH2A 1YDKA 1W4VA 1XWBA 3QDNA 1EOGA 3IK9A 5IO2A 5H5RA 2HSNB 5DAKA 3QMXA 1GULA 1X5EA 2IMEA 4G19A 5KN1A 4LL4B 2YCDA 2ON7A 1QQ2A 5CRGA 3CTGA 3FK8A 4AGSA 2M80A 2TRXA 3KTLA 2XBQA 3TCOA 4EF0A 3QOUA 4J56E 2V41A 4MH2A 2YN1A 5IPGA 2O87A 3U6VA 3UIWA 1FG4A 1BG5A 1JZWA 4PXOA 5CRDA 4KCEA 2H1AA 3Q6OA 1ZYQB 2V32A 4KB3A 4IJ3A 4MCUA 2R5GA 4BVYA 1PX7A 1M9AA 1Q98A 3SBCA 4Z7XA 5LNKe 1PD21 4O32A 2UZ8A 4RI6A 5DQSA 1V2AA 2FA4A 6GSSA 2C3NA 4ZB8A 3GL3A 4ID0A 3QCPA 3CRTA 1PMTA 3PPUA 2CX3A 1W89A 4ML1A 4OWYA 2R6KA 2C3QA 2LS5A 5D9WA 4WKWA 4ISDA 1WPIA 5ECMB 5DDLA 1FB6A 4X1UA 2FLSA 1TRWA 2X99A 3E3EA 3CTFA 2FGXA 2PN8A 5AIXA 2LJRA 1SL1B 4KX4A 2DMMA 1HQOA 2BJXA 3QD9A 3L9UA 3ED3A 3BCIA 5FWGA 3LFLA 1UVZA 2HSMB 1Z3EA 2I81A 4WR5A 3TOUA 4TR1B 2H01A 1XVWA 3I6AA 5JWOB 4WF5A 2HXKA 3RPPA 3GKMA 5GAND 4L5LA 4IS0A 1K0DA 4IW9A 4X43A 2H66A 1B4QA 1FVKA 1R5PA 1Z5YE 2HSYA 3M3MA 2B1KA 4USSA 3APSA 3VWVA 4D73B 1UN2A 5H5SA 2HZEA 1WJKA 2HRKB 4PQ1A 5J9BA 2H6ZA 2E2GA 3RAZA 4K0GA 1GSDA 5CYYA 2QSIA 4OFMA 1U6TA 1M0UA 4YAVA 3EVIA 4POLA 5EPFA 3IE3A 3UBLA 4KCAA 1CQGA 2AV4A 1USBA 4Q5QA 1XZOA 4F2IA 4KA0A 4J2FA 2XPDA 4QQ7A 2VCWA 2LUSA 1O73A 2F3MA 3G9BA 4K7NA 2EIRA 3H4KA 1THOA 4E8HA 2GDRA 1MEKA 2VCVA 4I2UA 1ZGNA 5ELAA 4E8EA 5IM9A 2L6DA 2H1BA 1DBYA 2AB6A 3DD3A 4ZBAA 2XHFA 4K0NA 4TXOB 3L9VA 3ZFBA 5HR2A 1RK4A 4HDEA 5A4UA 2Z9SA 4ACSA 1EGOA 3DGQA 1JFUA 3ISOA 1SD9A 4KNDA 2AAWA 5J41A 2F51A 2A4VA 2TIRA 1SK0A 2M46A 3M1GA 3TKPA 5J9CA 1GTIA 3TUEA 1EEMA 3DYRA 4JBBA 2VD1A 1ACVA 1MDKA 1R26A 3P2AA 5IMVA 2H75A 2QKEA 1I9DA 3GKNA 1XVQA 1OE7A 1YY7A 3HYPA 5J3RA 4BL7B 1TK8B 1WOUA 4QL7A 5JCWA 1XBSA 1A0RP 1F37A 3WGXA 5D9XA 1F2EA 1TRSA 2MMZA 1TU8A 3QPMA 4POBA 2LQOA 5HFKA 3DMLA 1S3CA 1SKRB 1EV4A 3GA4A 2DJ2A 5CP1A 3HZ4A 4G9HA 5AGYA 4NHZA 1X9SB 1QXHA 2KP1A 1RQMA 1SYXA 4L8EA 3HKRA 5J4UA 2HT9A 1QFNA 1OAZA 1YKCA 1V57A 3TJKA 5ECHB 1YEPA 3WT1A 5INYA 5F07A 2H1DA 3IC8A 2CVDA 2PUKC 1GSYA 5B6MA 2MMAA 3DKSA 2GQLA 3QAVA 2HRKA 4EDZA 1A2JA 3KM6A 3FW2A 4IHUA 2DJ1A 22GSA 1G6YA 4NHWA 4V1Ap 3GTUB 2GVPA 4L0UA 2LKUA 3ZIVA 2MZCA 1OC9A 1T1VA 5DCHA 2AUVA 2C4JA 1AQWA 3BJ5A 5JWRB 2OKAA 3FZ5A 1BYEA 4FIWA 4IELA 1ABAA 3APQA 14GSA 3BOAA 2I3YA 3QFBC 2JZRA 2H72A 3GFKA 1XIYA 5F8BA 1XWGA 4JU5A 1WP0A 4MZCA 2VL2A 3TJJA 2OACA 4MZWA 1Q4JA 5E4WA 2HE3A 4YQVA 4ZILA 2LNSA 3CSHA 3W6GA 1QGVA 4NPBA 1TK5B 2O89A 1T4YA 2E0QA 3H8QA 3IXRA 3BD2A 1U3IA 1A0FA 1TI1A 5FT3A 2DJ3A 2B5XA 3D6IA 2LV3A 5E59A 3FZAA 2WGRA 4I2TA 1GTUA 4MF5A 1N2AA 4GSSA 2H71A 5DALA 13GSA 2OE1A 2LJKA 4I5QA 2ON5A 1B9YC 4F0BA 3WYWA 1XWCA 7GSSA 3TRQA 4I8BA 4LL1B 4OMVA 4WXTA 2EC4A 2WDUA 5KN3A 4BL7A 4IP6A 4G0IA 4DVCA 1GUKA 2DJ0A 2HRFA 1TW9A 1DE2A 2O85A 4EXJA 1ERUA 3PGTA 3UEMA 3CYNA 4MH3A 5GZZB 2G0FA 5KN0A 3HJOA 2CA8A 4MP4A 17GSA 2PVQA 5ECNB 4IKHA 3IDVA 2HFDA 5H5QA 2I9HA 3ZITA 5G1LA 1G7EA 5BMUA 4V2NA 3VK9A 2FWFA 4GQFA 5IOWA 4WBRD 4LLRA 4MDCA 3VWXA 4RUVA 3GHAA 2R37A 1M9BA 4ECCA 2L59A 1GRXA 4WF4A 2X8CA 5ENUA 3HCZA 5IIZA 5IQYA 4GWRA 1YQ1A 1OC8A 4YQUA 2JADA 2B1LA 3GTUA 4MPFA 4G0KA 5G5FA 3F4SA 4V2LA 3GKXA 1ZL9A 4FH8A 1YEXA 4GSNA 3TKSC 1XWKA 3UOMA 3I69A 3ZYWA 4XIHA 1B48A 2F8FA 2J23A 4FYUA 1K0NA 3RDWA 1G7OA 6GSTA 3KMNA 1GSFA 3IV4A 5JCUA 3UMAA 5ID2A 3GYKA 2B6MA 1TRVA 4IP1A 1GLPA 4WBJA 3HA9A 3LSZA 2RM6A 1ZMAA 1VF3A 2NVLA 2NTOA 3EU3A 3AY8A 9GSSA 5EL8A 3LYPA 2OBIA 3ZVJA 3L9SA 2DIYA 3KD0A 3GMFA 2OADA 1E6BA 4TRXA 4GLTA 2RUEA 2VM1A 2IMDA 5HR1A 4MJAA 4F0CA 2VUPA 2PPTA 3IPZA 4AJ7A 3NOFA 1LJRA 3L0HA 3G7IA 2KHPA 1F3BA 5IMZA 3DRNA 3ME7A 2BTOT 3LEFA 3D22A 3TKSA 1LU4A 1TXXA 2C1YA 4LMVA 2HRAA 3KEBA 4KUNA 2K8VA 1X9WB 5HQPA 4NV2A 4EUYA 2V1MA 2YWNA 4XS4A 4RQRA 3KZQA 4WR4A 2JZTA 1HD2A 2RLIA 2MMNA 1F3AA 2LRCA 1PKZA 4YQMA 1XOAA 5HR0A 2GGTA 4ILFA 4MJEA 2ZNMA 1K3YA 5D9VA 6GSWA 1XPVA 4EVMA 2QC7A 4MF7A 3D0ZA 2NPBA 3KP8A 5ELGA 2PERA 4TKYA 4KDXA 4G10A 3O76A 3LG6A 1VF2A 4O92A 4N0ZA 2GSSA 2EIQA 1GUMA 6GSVA 3MSZA 2XBIA 1K0AA 3ZTLA 4BVXA 1EV9A 4H86A 3VLNA 4Q5RA 2H73A 1SK2A 4ZL9A 1O81A 3GH9A 3TJBA 1VF4A 3SWLA 1U88A 3GL5A 4ZIJA 5ABRA 4ECIA 5IPHA 2PU9C 1YZXA 2I1UA 5HR3A 1XW6A 4RQXA 4GRFA 1M2DA 1DE1A 4HUAA 2YWMA 1ERTA 1AAZA 3F4TA 1HNCA 3E0UA 3P7XA 4DSSB 1YJ6A 2PWJA 4DSRA 1PQNA 5COHA 1UC7A 5HFIA 1Z7PA 3GSSA 3QR6A 2DJKA 2IMIA 2H74A 3UAPA 3L4NA 1VGLA 2LTKA 2H19A 5A4WA 3DEXA 3I43A 4KH7A 3A5WA 4F03A 3IC4A 5A5KA 3ZMLA 2H0HA 4N30A 2IMKA 2VLTA 4PURA 2B3SA 4TOPA 1NM3A 1TTZA 3EU4A 2IL3A 3IOSA 4XS6A 4N10A 1T7PB 3M8NA 4CW9A 3TRXA 3HDCA 1N8JA 4PGTA 1RW1A 2L5OA 2ALBA 2IFQB 3LGCA 1SK1A 3ZVJD 1GL8A 1Z9HA 3FR6A 4G0LA 5F0GA 1ZYEA 20GSA 3VPTA 3D21A 3N9JA 1B8XA 1XWAA 5ECLB 4AF2A 3ZRDA 5ECRB 2FUG2 4L5OA 1MD3A 1PSQA 18GSA 2IMFA 3U5RE 1AUCA 2FD3A 1GTBA 5AIVA 5G30A 2JU5A 4TR3A 3HXSA 2MYGA 2RM5A 3FRCA 1GSSA 1M2AA 2F9SA 3TB2A 3TDGA 5ECPB 5EY6A 4KSMA 2VAFA 1ZOFA 3FZ4A 1OVNA 2JL4A 1WRYA 3M9JA 5DBQA 6GSYA 2X8GA 1SKWB 5LD0A 3TJGA 2CQ9A 2H30A 5KEJA 3VWWA 5D93A 2OE0A 4TR4A 2WRTA 4HJMA 3L78A 4XRAA 2WCIA 5B6NA 3MDKA 2J9HA 1A8YA 4IBPA 16GSA 2WULA 3W8SA 12GSA 4XRDA 4MPGA 1NHOA 3IBHA 1VF1A 1ON4A 3UJ1A 2HZFA 2C8UA 2KLXA 2HSMA 4IQAA 4OFTA 4K6XA 2VL2C 1VRSD 4TR1A 2IWTA 2VM2A 1EGRA 1JZOA 1MD4A 4GCIA 1TKDB 4MZBA 3CBUA 3Q19A 2CZ2A 4ZL8A 1T3BA 4POKA 2FY6A 4NMUA 2CV4A 4IN0A 3PR8A 1BQ7A 2YWOA 3R3EA 1UA5A 3VI7A 4D73A 2VLVA 3FHKA 2YZUA 1JHBA 2IN3A 4CDOA 3F4RA 4Q5FA 1HNBA 1AQVA 2KUCA 2L4CA 2R2JA 2VL9A 2GLRA 4BWQA 5D96A 5GSSA 1YF1A 4EKZA 3UVTA 3EC3A 2DJJA 1R7HA 3UARA 1XCCA 10GSA 4JR4A 1OC3A 5CO3A 5A4VA 1O6JA 3MNGA 4I6XA 3ZMKA 4DSSA 1K0OA 2PMTA 1A24A 5L71A 1FHEA 5F06A 5CAXA 4TR0A 2GSQA 5KN2A 5DAKB 2YV7A 4KGIA 4MA9A 3US3A 1PX6A 3W8JA 3RPNA 3ZREA 1T4ZA 2C0GA 3ERGA 1Z6NA 4WETA 4TXOA 3UVHA 3MWHA 1R4WA 1SJZA 4PQHA 1X5CA 2C0FA 2LSTA 3LORA 2HNLA 2B7KA 4KDYA 1ST9A 4BVYB 3KMOA 3VPQA 4ZBDA 2JSZA 3K8NA 4PNFA 2DSAA 4CHSA 4RI7A 1A2LA 1NSWA 3LYKA 1SL0B 2A2RA 5IO0A 1GSQA 1TDIA 1EP8A 2RUFA 1SENA 2ZCTA 2ZUPA 1O7UA 1S3DA 2IIYA 1BJXA 1C72A 3EYTA 2WJUA 4IJIA 3F6DA 1CQHA 5DQYA 4K2DA 1URMA 5CNWA 3NZNA 4TN8A 4MMMA 5IMDA 4V2MA 4ZXGA 2L5LA 2FNOA 3ZLPA 2HRNA 1TJDA 5DJMA 2K9FA 3GKKA 1DSBA 3JCML 2C0DA 4AJ6A 4EO3A 3EMPA 4MABA 5IMCA 6GSXA 2H70A 1GWCA 4Q5NA 2C3TA 1SYRA 4QL9A 4ULXA 2P5RA 2VCZA 1A2MA 3RHBA 2L57A 1I5GA 4ECBA 1X5DA 2CX4A 2HLSA 2FWHA 2DC5A 1GUHA 1K0CA 5G31A 3WGEA 3WGDA 1DUGA 5DCGA 1ILOA 3BCKA 1SJ6A 4GTUA 4JE1A 3IR4A 2WFCA 1V9WA 2L4QA 4F82A 2HQTA 2O8VB 2V6OA 4PUAA 1FW1A 5DJLA 2YJHA 4PUFC 4V1Ag 4ZL7A 3UBKA 5CRWA 2OA7A 4HQZA 4NXIA 4DSQA 2FWEA 1ERWA 1JZDA 3LWAA 3CSIA 3ERFA 3KH9A 3C71A 2M72A 4FYCA 1KTEA 1LBKA 6GSUA 2GQMA 3APOA 3GIXA 3HZ8A 5JWQB 3HVVA 2AYTA 5D8IA 1SU9A 2B5EA 2YANA 3EURA 2I4AA 4OO4A 4HI7A 3TKSE 1EOHA 2DLXA 3CRUA 1TU7A 1H75A 2LEGA 4PQIA 4LA1A 3IK7A 1O8WA 2KOKA 4XS1A 3EWLA 2K6VA 3DIEA 1M7TA 3IHQA 3P8WA 1T00A 2G2QA 1PN9A 1JLVA 4KF9A 5G2ZA 4YAPA 4MJCA 3VFIA 2YP6A 1H4OA 4KSOA 4KAEA 2LJAA 3KP9A 4HZ2A 3V1WA 3C7MA 1GNEA 2GSTA 5D73A 4ZB6A 5C00A 5ECSA 2VD0A 2IJYA 4K9ZA 19GSA 1WMJA 4BWSA 4PNGA 3FY7A 2GT6A 3PINA 1MDIA 3TJFA 3S9FA 1GTAA 3F3RA 3O3TA 2CZ3A 2AJQB 1BX9A 1PKWA 2H8LA 4IQ1A 3GNJA 5IOXA 2YPMA 2P5QA 4XHMA 2VL3A 4BPYA 3VWUA 3D5JA 3C8EA 1A8LA 5ECIB 2REMA 2C0EA 4GXZA 2YV9A 3HVSA 1O85A 3CSJA 3VI5A 3ZIJA 2QGVA 1GSUA 1KNGA 2VCQA 2CVKA 3GV1A 1ERVA 2V6KA 3BBYA 2VO4A 2X8HA 1AC1A 5FHIA 3O6TA 4MLYA 3DWVA 5C04A 1A23A 1KEBA 1GP1A 2X64A 4ECJA 2JACA 3KJYA 3F0IA 3ME8A 4BA7A 4K7OA 2GZPA 3G7JA 5HFGA 3CMIA 4MJBA 3EMXA 4HS1A 1TRUA 2FCHA 8GSSA 3C1SA 4LMWA 3H1NA 3IRAA 2AHEA 1SKSB 2LRTA 3ZFLA 5ECQB 3WD6A 3E9JB 3KTBA 1QMVA 1NHYA 1K3LA 3GRXA 3F8UA 3A2VA 3GH6A
chains in the Genus database with same CATH superfamily
1K3OA 4AJ8A 3GUSA 4FYBA 2HYXA 2JSYA 1PA3A 1TP9A 2GZZA 3PH9A 5IMAA 1M2BA 2H1GA 4JZQA 3DVWA 3KIJA 3Q74A 1AXDA 4HU9A 3FZ9A 4EDYA 3KGKA 2KP2A 2R4VA 3P90A 2FWGA 3RBTA 3DVXA 1U87A 3Q18A 3A2XA 4L0WA 2VCTA 3HVXA 1KBNA 1OC9B 1FVJA 1AW9A 1OE8A 3IAM2 1Y25A 2PGTA 2H0GA 4HJ2A 4IGJA 3F9UA 3IAS2 3FR3A 4K8MA 3M9KA 2YWIA 1TI3A 1QK8A 3TRPA 1TOFA 3KXOA 1XW9A 4JR6A 1R5AA 4XTSA 1PN0A 4NWYA 1SD8A 3N5OA 1XOBA 2MBSA 3TKRA 2E2MA 3HD5A 3H93A 4J57E 4F9ZA 4NAXA 3LXZA 2DBCA 2H6YA 2XPEA 4EIPA 2OJLA 2RIIA 2BMXA 2CT6A 1J0FA 1THXA 1WE0A 1Y6EA 5F05A 1OKDA 1SJIA 3J7Yk 1FB0A 1JZRA 1WIKA 4EIQA 2CVBA 1T8EB 3KH7A 1ML6A 2GSRA 2TRCP 1V40A 3HJMA 1B9XC 3C73A 2ES7A 2GTUA 3F3QA 4EC0A 3EE2A 4N11A 4GSTA 4EL1A 1FAAA 2R3XA 1GNWA 2D2ZA 1XXUA 3WT2A 5DALB 1M99A 1BAYA 5B7CA 1EWXA 4ICYA 2B5YA 2GQKA 4GQCA 1GSEA 1MDJA 1Z7RA 1IYIA 5G5EA 1AQXA 3MAKA 2VIMA 3F63A 1OKTA 4HZ4A 4MK3A 1J08A 2MBTA 5EVOA 1S3AA 2PBJA 5G1KA 3LQ7A 4EE0A 4N3ZA 4N0VA 4FQUA 2F8AA 2LRNA 4POMA 1WWJA 2WZ9A 3GX0A 3OR5A 2X4AA 3VURA 1O8XA 2VCXA 1V98A 1HNAA 2H0IA 4HU7A 3I9V2 2YNXA 3H79A 3CXGA 3QAWA 4IVFA 3NIVA 4ML6A 2CAQA 3EINA 3GN3A 5B8BA 1FOVA 2A2SA 2P31A 5J5NA 3A2WA 3J7Yb 1K0BA 3TKQA 3KCMA 1X9MB 5D9TA 3CHXC 2H76A 2LNTA 1J9BA 2YOIA 5ECKB 1EZKA 3GX8A 4OD7A 1ZZYA 5IMFA 2OBKA 3R2QA 3FEUA 3QAGA 3TU3B 2DKHA 1YF0A 5B8AA 1TK0B 4JEDA 3F6FA 1AIUA 2B7JA 4FO5A 1OYJA 2L6CA 1FO5A 4Z2TA 3IA1A 2EIOA 4OCFA 2VOCA 3LXTA 1BEDA 5ID2B 1PRXA 2H6XA 1B4PA 4I97A 2HI7A 3GURA 2WS2A 1XW5A 4ZB9A 2N5FA 4X0XA 2LQQA 2IFQA 2GS3A 3QFAC 3DXBA 4P3YB 4K5SA 2C80A 2JZSA 1EEJA 4ZBBA 4OCEA 5JCGA 4HQSA 5CRHA 2A4HA 4CY6A 2IPAA 3D4TA 4K5RA 5CREA 1NW2A 3ZZXA 3TGZA 2WB9A 4WEYA 1F6MC 2YZHA 5AISA 3FYGA 2K8SA 2WW0A 4HOJA 2P0GA 3GSTA 5GAPD 5AN1A 1YKAA 2V2GA 1SL2B 3D4MA 4AKIA 2QA2A 1PL2A 4K1FA 2YJ7A 3HY2A 1PGTA 3FKFA 1HYUA 4OO5A 3A3TA 4MF6A 2OE3A 5A1NA 4XCSA 1V58A 1G6WA 2EFEA 4PTSA 1Z6MA 1MTCA 4KDUA 3HHVA 4XS4B 1JLWA 4YKGA 4PX1A 1IYHA 2MMOA 2VLUA 4KE3A 2DMLA 2NBSA 2FHEA 4TW5A 2N5BA 3C1RA 5LCZA 1ZCPA 1GLQA 4AI6A 4OFNA 4O5RA 1PL1A 4GF0A 2HSHA 3UL3A 4DEJA 5A5HB 3FR9A 2E7PA 4YH2A 5GSTA 1XFLA 2GZYA 1X0RA 4O7HA 4TVEA 2XC2A 4KW6A 4HEA2 5BRTA 1U3AA 4G2EA 5ECOB 3ZL5A 2O7KA 3LJRA 3ERWA 4TXVA 2K18A 1F9MA 4BVXB 3TOTA 4K7IA 1K0MA 4JRRA 2GT5A 3M0FA 2FA8A 2NDOA 2HZEB 1EP7A 1E2YA 4NV5A 1QUWA 2H1LA 3HJPA 2DIZA 3G7YA 11GSA 2CAIA 1G0TA 2N5AA 5J4VA 3RHCA 2PVOC 5DVBA 1GH2A 3RFRC 1YDKA 1W4VA 1XWBA 3QDNA 1EOGA 3IK9A 5IO2A 5H5RA 2HSNB 5A34B 5DAKA 3QMXA 1GULA 1X5EA 2IMEA 4G19A 5KN1A 4LL4B 2YCDA 2ON7A 1QQ2A 5CRGA 3CTGA 3FK8A 4AGSA 2M80A 2TRXA 3KTLA 2XBQA 3TCOA 4EF0A 3QOUA 4J56E 2V41A 4MH2A 2YN1A 5IPGA 2O87A 2O5VA 3U6VA 3UIWA 1FG4A 1BG5A 1JZWA 2A2PA 4PXOA 5CRDA 4KCEA 2H1AA 3Q6OA 1ZYQB 2V32A 4KB3A 4IJ3A 4MCUA 2R5GA 4BVYA 1PX7A 1M9AA 2R0CA 1Q98A 3SBCA 4Z7XA 5LNKe 1PD21 4O32A 2UZ8A 4RI6A 5DQSA 1V2AA 2FA4A 6GSSA 2C3NA 4ZB8A 3GL3A 4ID0A 3QCPA 3CRTA 1PMTA 3PPUA 2CX3A 1W89A 4ML1A 4AKXB 4OWYA 2R6KA 2C3QA 2LS5A 5D9WA 4WKWA 4ISDA 1WPIA 2R0GA 4MNNA 5ECMB 5DDLA 1FB6A 4X1UA 2FLSA 1TRWA 2X99A 3A5IA 3E3EA 3CTFA 2FGXA 2PN8A 5AIXA 2WZSA 2LJRA 1SL1B 4KX4A 2DMMA 1HQOA 2BJXA 3QD9A 3L9UA 3ED3A 3BCIA 5FWGA 3LFLA 3CQFA 1UVZA 5A5HA 2HSMB 1Z3EA 2I81A 4WR5A 3TOUA 4TR1B 2H01A 1XVWA 3I6AA 5JWOB 4WF5A 2HXKA 3RPPA 3GKMA 5GAND 4L5LA 4IS0A 1K0DA 4IW9A 4X43A 2H66A 1B4QA 1FVKA 1R5PA 1Z5YE 2HSYA 3M3MA 2B1KA 4USSA 3APSA 3VWVA 4D73B 1UN2A 5H5SA 2HZEA 1WJKA 2HRKB 1N25A 4PQ1A 5J9BA 2H6ZA 2E2GA 3RAZA 4K0GA 1GSDA 5CYYA 2QSIA 4OFMA 1U6TA 4W66A 1M0UA 4YAVA 3EVIA 4POLA 5EPFA 3IE3A 3UBLA 4KCAA 1CQGA 2AV4A 1USBA 4Q5QA 5J40A 1XZOA 4F2IA 4KA0A 4J2FA 2XPDA 1ZYNA 4QQ7A 2VCWA 1YVLA 2LUSA 1O73A 2F3MA 3G9BA 4K7NA 2EIRA 3H4KA 1THOA 4E8HA 2GDRA 1MEKA 2VCVA 4I2UA 1ZGNA 5ELAA 4E8EA 5IM9A 2L6DA 2H1BA 1DBYA 5J4YA 2AB6A 3DD3A 4ZBAA 2XHFA 4K0NA 4TXOB 3L9VA 3ZFBA 5HR2A 1RK4A 4HDEA 5A4UA 2Z9SA 4ACSA 1EGOA 3DGQA 1JFUA 3ISOA 1SD9A 4KNDA 2AAWA 5J41A 2F51A 2A4VA 2TIRA 1SK0A 2M46A 3M1GA 3TKPA 5J9CA 1GTIA 3TUEA 1EEMA 3DYRA 4JBBA 2VD1A 1ACVA 1MDKA 1R26A 3P2AA 5IMVA 2H75A 2QKEA 5J47A 1I9DA 3GKNA 1XVQA 1OE7A 1YY7A 3HYPA 5J3RA 4BL7B 1TK8B 1WOUA 4QL7A 5JCWA 2O36A 1XBSA 1A0RP 1F37A 3WGXA 5D9XA 1F2EA 1TRSA 2MMZA 1TU8A 3QPMA 4POBA 2LQOA 5HFKA 3DMLA 1S3CA 1SKRB 1EV4A 3GA4A 2DJ2A 5CP1A 3HZ4A 4G9HA 5AGYA 4NHZA 1X9SB 1QXHA 2KP1A 4A5PA 1RQMA 5BMUB 1SYXA 4L8EA 3HKRA 5J4UA 2HT9A 1QFNA 1OAZA 1YKCA 1V57A 3TJKA 5ECHB 4HSCX 1YEPA 3WT1A 4K2XA 5INYA 5F07A 2H1DA 3IC8A 2CVDA 2PUKC 1GSYA 5B6MA 2MMAA 3DKSA 2GQLA 3QAVA 2HRKA 4EDZA 1A2JA 3KM6A 3FW2A 4IHUA 2DJ1A 22GSA 1G6YA 4NHWA 4V1Ap 3GTUB 2GVPA 4L0UA 2LKUA 3ZIVA 2MZCA 1OC9A 1T1VA 5DCHA 2AUVA 2C4JA 1AQWA 3BJ5A 3CWGA 5JWRB 2OKAA 3FZ5A 1BYEA 4FIWA 4IELA 1ABAA 3APQA 14GSA 3BOAA 1M3IA 2I3YA 3QFBC 2JZRA 4Z2RA 2H72A 3GFKA 1XIYA 5F8BA 1XWGA 4JU5A 4O5QA 1WP0A 4MZCA 2VL2A 3TJJA 2OACA 4MZWA 1Q4JA 5E4WA 2HE3A 4YQVA 4ZILA 2LNSA 3CSHA 3W6GA 1QGVA 4NPBA 1TK5B 2O89A 2WVYA 1T4YA 3H8QA 2E0QA 3IXRA 3BD2A 1U3IA 1A0FA 1TI1A 5FT3A 2DJ3A 2B5XA 3D6IA 2LV3A 5E59A 3FZAA 2WGRA 3RGBC 4I2TA 1GTUA 4MF5A 1N2AA 4GSSA 2H71A 5DALA 13GSA 2OE1A 2LJKA 4I5QA 2ON5A 1B9YC 4E68A 4F0BA 3WYWA 1XWCA 7GSSA 3TRQA 4I8BA 4LL1B 4OMVA 4WXTA 2EC4A 2WDUA 5KN3A 4BL7A 4IP6A 4G0IA 4DVCA 1GUKA 2DJ0A 2HRFA 1TW9A 1DE2A 2O85A 4EXJA 1ERUA 3PGTA 3UEMA 3CYNA 4MH3A 5GZZB 2G0FA 5KN0A 3HJOA 2WW1A 2CA8A 4MP4A 17GSA 2PVQA 5ECNB 4IKHA 4AKGA 3IDVA 2HFDA 5H5QA 2I9HA 3ZITA 5G1LA 1G7EA 5BMUA 4V2NA 3VK9A 2FWFA 4GQFA 5IOWA 4WBRD 4X4JA 4LLRA 4MDCA 3VWXA 4RUVA 3GHAA 2R37A 1M9BA 4ECCA 3FMWA 2L59A 1GRXA 2WW3A 4WF4A 2X8CA 5ENUA 3HCZA 5IIZA 5IQYA 4GWRA 1YQ1A 1OC8A 4YQUA 2JADA 2B1LA 3GTUA 4MPFA 1PFOA 4G0KA 5G5FA 4O5UA 3F4SA 4V2LA 3GKXA 1ZL9A 4FH8A 1YEXA 3MYDA 4GSNA 3TKSC 1XWKA 3UOMA 3I69A 3ZYWA 4XIHA 1B48A 2F8FA 2J23A 4FYUA 1K0NA 3RDWA 1G7OA 6GSTA 3KMNA 1GSFA 3IV4A 5JCUA 3UMAA 5ID2A 3GYKA 2B6MA 1TRVA 4IP1A 1GLPA 4WBJA 3HA9A 3LSZA 2RM6A 1ZMAA 1VF3A 2NVLA 2NTOA 3EU3A 3AY8A 9GSSA 5EL8A 3LYPA 2OBIA 3ZVJA 3L9SA 2DIYA 3KD0A 3GMFA 2OADA 1E6BA 4TRXA 4GLTA 2RUEA 2VM1A 2IMDA 5HR1A 4MJAA 4F0CA 2VUPA 2PPTA 3IPZA 4AJ7A 3NOFA 1LJRA 3L0HA 3G7IA 2KHPA 1F3BA 5IMZA 3DRNA 3ME7A 2BTOT 3LEFA 3D22A 3TKSA 1LU4A 2WVZA 5KOXA 1TXXA 2C1YA 4LMVA 2HRAA 3KEBA 4KUNA 2K8VA 1X9WB 5HQPA 2WW2A 4NV2A 4EUYA 2V1MA 2YWNA 4XS4A 4RQRA 3KZQA 4WR4A 2JZTA 1HD2A 2RLIA 2MMNA 1F3AA 2LRCA 1PKZA 4YQMA 1XOAA 5HR0A 2GGTA 1BF5A 4ILFA 4MJEA 2ZNMA 1K3YA 5D9VA 6GSWA 1XPVA 4EVMA 2EFHA 2QC7A 4MF7A 3D0ZA 2NPBA 3KP8A 1I1IP 5ELGA 2PERA 4TKYA 4KDXA 4G10A 3O76A 3LG6A 1VF2A 4O92A 4N0ZA 2GSSA 2EIQA 1GUMA 6GSVA 3MSZA 2XBIA 1K0AA 3ZTLA 4BVXA 1EV9A 4H86A 3VLNA 4Q5RA 2H73A 1SK2A 1M3JA 4ZL9A 3GH9A 1O81A 3TJBA 1VF4A 4FXYP 3SWLA 1U88A 3GL5A 4ZIJA 5ABRA 4ECIA 5IPHA 2PU9C 1YZXA 2I1UA 2EFDA 5HR3A 1XG8A 1XW6A 4RQXA 4GRFA 1M2DA 1DE1A 4HUAA 2YWMA 1ERTA 1AAZA 3F4TA 1HNCA 2HSNA 5A34A 3E0UA 3P7XA 4DSSB 1BG1A 1YJ6A 2O3EA 2PWJA 4DSRA 4ZB7A 1PQNA 5COHA 1UC7A 5HFIA 4QMKA 1Z7PA 3GSSA 3QR6A 2DJKA 2IMIA 2H74A 3UAPA 3L4NA 1VGLA 2LTKA 2H19A 5A4WA 3DEXA 3I43A 4KH7A 3A5WA 4F03A 3IC4A 5A5KA 3ZMLA 2EFCA 2H0HA 4N30A 1S4BP 2IMKA 2VLTA 4PURA 2B3SA 4TOPA 1NM3A 1TTZA 3EU4A 2IL3A 3IOSA 4XS6A 4N10A 1T7PB 3M8NA 4CW9A 3TRXA 3HDCA 1N8JA 4PGTA 1RW1A 2L5OA 2ALBA 2IFQB 3LGCA 1SK1A 3ZVJD 1GL8A 1Z9HA 3FR6A 4G0LA 5F0GA 1ZYEA 20GSA 4G01A 3VPTA 3D21A 1SVOA 3N9JA 2WVXB 1B8XA 1XWAA 5ECLB 4AF2A 3ZRDA 5ECRB 2FUG2 4L5OA 1MD3A 1PSQA 3LW9A 18GSA 2IMFA 3U5RE 1AUCA 2FD3A 1GTBA 1TXUA 5AIVA 5G30A 2JU5A 4TR3A 3HXSA 2MYGA 2RM5A 3FRCA 1GSSA 1M2AA 2F9SA 3TB2A 3TDGA 5ECPB 5EY6A 4KSMA 2VAFA 1ZOFA 3FZ4A 1OVNA 2JL4A 1WRYA 3M9JA 5DBQA 3MIXA 5A1NB 6GSYA 2X8GA 1SKWB 5LD0A 3TJGA 2CQ9A 2H30A 5KEJA 3VWWA 5D93A 2OE0A 4TR4A 2WRTA 4HJMA 3L78A 4XRAA 2WCIA 5B6NA 3MDKA 2J9HA 1A8YA 4IBPA 16GSA 2WULA 3W8SA 12GSA 4XRDA 4MPGA 1NHOA 3IBHA 1VF1A 1ON4A 3UJ1A 2HZFA 2C8UA 2KLXA 2HSMA 4IQAA 4OFTA 4K6XA 2VL2C 1VRSD 4TR1A 2IWTA 2VM2A 1EGRA 1JZOA 4YKFA 1MD4A 4GCIA 1TKDB 4MZBA 3CBUA 3Q19A 2CZ2A 4ZL8A 1T3BA 4POKA 2FY6A 4NMUA 2CV4A 2DKIA 4IN0A 3PR8A 4Z2UA 1BQ7A 2X49A 2YWOA 3R3EA 1UA5A 3VI7A 4PHZC 4D73A 2VLVA 3FHKA 2YZUA 1JHBA 2IN3A 4CDOA 3F4RA 4Q5FA 1HNBA 1AQVA 2KUCA 2L4CA 2R2JA 2VL9A 3IHGA 2GLRA 4BWQA 5D96A 5GSSA 1YF1A 4EKZA 3UVTA 3EC3A 2DJJA 1R7HA 3UARA 1XCCA 10GSA 4JR4A 1OC3A 5CO3A 5A4VA 1O6JA 3MNGA 4I6XA 3ZMKA 4DSSA 1K0OA 2PMTA 1A24A 5L71A 1FHEA 1SVLA 5F06A 5CAXA 4TR0A 1SVMA 2GSQA 5KN2A 5DAKB 2YV7A 4KGIA 4MA9A 3US3A 1PX6A 3W8JA 3RPNA 3ZREA 1T4ZA 2C0GA 3ERGA 1Z6NA 4WETA 4TXOA 3UVHA 3MWHA 1R4WA 1SJZA 4PQHA 1X5CA 2C0FA 2LSTA 3LORA 2HNLA 2B7KA 2R0PA 4KDYA 4PI0C 1ST9A 4BVYB 3KMOA 3VPQA 4ZBDA 2JSZA 3K8NA 4PNFA 2DSAA 4CHSA 4RI7A 1A2LA 2WVXA 1NSWA 3LYKA 1SL0B 2A2RA 5IO0A 1GSQA 1TDIA 1EP8A 2RUFA 1SENA 2ZCTA 2ZUPA 1O7UA 1S3DA 2IIYA 1BJXA 1C72A 3EYTA 2WJUA 1Y1UA 4IJIA 3F6DA 1CQHA 5DQYA 4K2DA 1URMA 5CNWA 3NZNA 4TN8A 4MMMA 5IMDA 4V2MA 4ZXGA 2L5LA 2FNOA 3ZLPA 2HRNA 3HVNA 1TJDA 5DJMA 2K9FA 3GKKA 1DSBA 3JCML 2C0DA 4AJ6A 4EO3A 3EMPA 4CY8A 4MABA 5IMCA 4PI2C 6GSXA 2H70A 1GWCA 4Q5NA 2C3TA 1SYRA 4QL9A 4ULXA 1FOHA 2P5RA 2VCZA 4AKHA 1A2MA 3RHBA 2L57A 1I5GA 4ECBA 1X5DA 2CX4A 2HLSA 2FWHA 2DC5A 1GUHA 1K0CA 5G31A 3WGEA 3WGDA 1DUGA 5DCGA 1ILOA 3BCKA 1SJ6A 4GTUA 4JE1A 3IR4A 2WFCA 1V9WA 2L4QA 4F82A 2HQTA 2O8VB 2V6OA 4PUAA 1FW1A 5DJLA 2YJHA 4PUFC 4V1Ag 4ZL7A 3UBKA 5CRWA 2OA7A 4HQZA 4NXIA 4DSQA 2FWEA 1ERWA 4BIKA 1JZDA 3LWAA 3CSIA 3ERFA 2UV8G 3KH9A 2OT3A 3C71A 2M72A 4FYCA 4GDFA 1KTEA 1LBKA 6GSUA 2GQMA 3APOA 3GIXA 3HZ8A 5JWQB 3HVVA 2AYTA 5D8IA 1SU9A 2B5EA 2YANA 3EURA 2I4AA 4OO4A 4HI7A 3TKSE 1EOHA 2DLXA 3CRUA 1TU7A 1H75A 2LEGA 4PQIA 4LA1A 3IK7A 1O8WA 2KOKA 4XS1A 3EWLA 2K6VA 3DIEA 1M7TA 3IHQA 3HMJG 1YEWC 3P8WA 1T00A 2G2QA 1PN9A 1JLVA 4KF9A 5G2ZA 4YAPA 4MJCA 3VFIA 2YP6A 1H4OA 4KSOA 4KAEA 2LJAA 3EPTA 3KP9A 4HZ2A 3V1WA 3C7MA 1GNEA 2GSTA 5D73A 4ZB6A 5C00A 5ECSA 2VD0A 2IJYA 4K9ZA 19GSA 1WMJA 4BWSA 4PNGA 3FY7A 2GT6A 3PINA 1MDIA 2QA1A 3TJFA 3S9FA 1GTAA 1S3RA 3F3RA 3O3TA 2CZ3A 2AJQB 1BX9A 1PKWA 2H8LA 4IQ1A 3GNJA 5IOXA 2YPMA 2P5QA 5KOWA 4XHMA 1ZYPA 2VL3A 4BPYA 3VWUA 3D5JA 3C8EA 1A8LA 5ECIB 2REMA 2C0EA 4GXZA 2YV9A 3HVSA 1O85A 3CSJA 3VI5A 3ZIJA 2QGVA 1GSUA 1KNGA 2VCQA 2CVKA 3GV1A 1ERVA 2V6KA 3BBYA 2VO4A 2X8HA 1AC1A 5FHIA 3O6TA 4MLYA 3DWVA 5C04A 1A23A 1KEBA 1GP1A 2X64A 4ECJA 2JACA 3KJYA 3F0IA 3ME8A 4BA7A 4K7OA 2GZPA 3G7JA 5HFGA 3CMIA 4MJBA 3EMXA 4HS1A 1TRUA 2FCHA 8GSSA 3C1SA 4LMWA 3H1NA 3IRAA 2AHEA 1SKSB 2LRTA 3ZFLA 5ECQB 2VKZG 3WD6A 3E9JB 3KTBA 1QMVA 1NHYA 1K3LA 3GRXA 3F8UA 3A2VA 3GH6A
chains in the Genus database with same CATH topology
1K3OA 4AJ8A 3GUSA 4FYBA 2HYXA 2JSYA 1PA3A 1TP9A 2GZZA 3PH9A 5IMAA 1M2BA 2H1GA 4JZQA 3DVWA 3KIJA 3Q74A 1AXDA 4HU9A 3FZ9A 4EDYA 3KGKA 2KP2A 2R4VA 3P90A 2FWGA 3RBTA 3DVXA 1U87A 3Q18A 3A2XA 4L0WA 2VCTA 3HVXA 1KBNA 1OC9B 1FVJA 1AW9A 1OE8A 3IAM2 1Y25A 2PGTA 2H0GA 4HJ2A 4IGJA 3F9UA 3IAS2 3FR3A 4K8MA 3M9KA 2YWIA 1TI3A 1QK8A 3TRPA 1TOFA 3KXOA 1XW9A 4JR6A 1R5AA 4XTSA 1PN0A 4NWYA 1SD8A 3N5OA 1XOBA 2MBSA 3TKRA 2E2MA 3HD5A 3H93A 4J57E 4F9ZA 4NAXA 3LXZA 2DBCA 2H6YA 2XPEA 4EIPA 2OJLA 2RIIA 2BMXA 2CT6A 1J0FA 1THXA 1WE0A 1Y6EA 5F05A 1OKDA 1SJIA 3J7Yk 1FB0A 1JZRA 1WIKA 4EIQA 2CVBA 1T8EB 3KH7A 1ML6A 2GSRA 2TRCP 1V40A 3HJMA 1B9XC 3C73A 2ES7A 2GTUA 3F3QA 4EC0A 3EE2A 4N11A 4GSTA 4EL1A 1FAAA 2R3XA 1GNWA 2D2ZA 1XXUA 3WT2A 5DALB 1M99A 1BAYA 5B7CA 1EWXA 4ICYA 2B5YA 2GQKA 4GQCA 1GSEA 1MDJA 1Z7RA 1IYIA 5G5EA 1AQXA 3MAKA 2VIMA 3F63A 1OKTA 4HZ4A 4MK3A 1J08A 2MBTA 5EVOA 1S3AA 2PBJA 5G1KA 3LQ7A 4EE0A 4N3ZA 4N0VA 4FQUA 2F8AA 2LRNA 4POMA 1WWJA 2WZ9A 3GX0A 3OR5A 2X4AA 3VURA 1O8XA 2VCXA 1V98A 1HNAA 2H0IA 4HU7A 3I9V2 2YNXA 3H79A 3CXGA 3QAWA 4IVFA 3NIVA 4ML6A 2CAQA 3EINA 3GN3A 5B8BA 1FOVA 2A2SA 2P31A 5J5NA 3A2WA 3J7Yb 1K0BA 3TKQA 3KCMA 1X9MB 5D9TA 2H76A 2LNTA 1J9BA 2YOIA 5ECKB 1EZKA 3GX8A 4OD7A 1ZZYA 5IMFA 2OBKA 3R2QA 3FEUA 3QAGA 3TU3B 2DKHA 1YF0A 5B8AA 1TK0B 4JEDA 3F6FA 1AIUA 2B7JA 4FO5A 1OYJA 2L6CA 1FO5A 4Z2TA 3IA1A 2EIOA 4OCFA 2VOCA 3LXTA 1BEDA 5ID2B 1PRXA 2H6XA 1B4PA 4I97A 2HI7A 3GURA 2WS2A 1XW5A 4ZB9A 2N5FA 4X0XA 2LQQA 2IFQA 2GS3A 3QFAC 3DXBA 4P3YB 4K5SA 2C80A 2JZSA 1EEJA 4ZBBA 4OCEA 5JCGA 4HQSA 5CRHA 2A4HA 4CY6A 2IPAA 3D4TA 4K5RA 5CREA 1NW2A 3ZZXA 3TGZA 2WB9A 4WEYA 1F6MC 2YZHA 5AISA 3FYGA 2K8SA 4HOJA 2P0GA 3GSTA 5GAPD 5AN1A 1YKAA 2V2GA 1SL2B 3D4MA 4AKIA 2QA2A 1PL2A 4K1FA 2YJ7A 3HY2A 1PGTA 3FKFA 1HYUA 4OO5A 3A3TA 4MF6A 2OE3A 5A1NA 4XCSA 1V58A 1G6WA 2EFEA 4PTSA 1Z6MA 1MTCA 4KDUA 3HHVA 4XS4B 1JLWA 4YKGA 4PX1A 1IYHA 2MMOA 2VLUA 4KE3A 2DMLA 2NBSA 2FHEA 4TW5A 2N5BA 3C1RA 5LCZA 1ZCPA 1GLQA 4AI6A 4OFNA 4O5RA 1PL1A 4GF0A 2HSHA 3UL3A 4DEJA 5A5HB 3FR9A 2E7PA 4YH2A 5GSTA 1XFLA 2GZYA 1X0RA 4O7HA 4TVEA 2XC2A 4KW6A 4HEA2 5BRTA 1U3AA 4G2EA 5ECOB 3ZL5A 2O7KA 3LJRA 3ERWA 4TXVA 2K18A 1F9MA 4BVXB 3TOTA 4K7IA 1K0MA 4JRRA 2GT5A 3M0FA 2FA8A 2NDOA 2HZEB 1EP7A 1E2YA 4NV5A 1QUWA 2H1LA 3HJPA 2DIZA 3G7YA 11GSA 2CAIA 1G0TA 2N5AA 5J4VA 3RHCA 2PVOC 5DVBA 1GH2A 1YDKA 1W4VA 1XWBA 3QDNA 1EOGA 3IK9A 5IO2A 5H5RA 2HSNB 5A34B 5DAKA 3QMXA 1GULA 1X5EA 2IMEA 4G19A 5KN1A 4LL4B 2YCDA 2ON7A 1QQ2A 5CRGA 3CTGA 3FK8A 4AGSA 2M80A 2TRXA 3KTLA 2XBQA 3TCOA 4EF0A 3QOUA 4J56E 2V41A 4MH2A 2YN1A 5IPGA 2O87A 2O5VA 3U6VA 3UIWA 1FG4A 1BG5A 1JZWA 2A2PA 4PXOA 5CRDA 4KCEA 2H1AA 3Q6OA 1ZYQB 2V32A 4KB3A 4IJ3A 4MCUA 2R5GA 4BVYA 1PX7A 1M9AA 2R0CA 1Q98A 3SBCA 4Z7XA 5LNKe 1PD21 4O32A 2UZ8A 4RI6A 5DQSA 1V2AA 2FA4A 6GSSA 2C3NA 4ZB8A 3GL3A 4ID0A 3QCPA 3CRTA 1PMTA 3PPUA 2CX3A 1W89A 4ML1A 4AKXB 4OWYA 2R6KA 2C3QA 2LS5A 5D9WA 4WKWA 4ISDA 1WPIA 2R0GA 4MNNA 5ECMB 5DDLA 1FB6A 4X1UA 2FLSA 1TRWA 2X99A 3A5IA 3E3EA 3CTFA 2FGXA 2PN8A 5AIXA 2LJRA 1SL1B 4KX4A 2DMMA 1HQOA 2BJXA 3QD9A 3L9UA 3ED3A 3BCIA 5FWGA 3LFLA 1UVZA 5A5HA 2HSMB 1Z3EA 2I81A 4WR5A 3TOUA 4TR1B 2H01A 1XVWA 3I6AA 5JWOB 4WF5A 2HXKA 3RPPA 3GKMA 5GAND 4L5LA 4IS0A 1K0DA 4IW9A 4X43A 2H66A 1B4QA 1FVKA 1R5PA 1Z5YE 2HSYA 3M3MA 2B1KA 4USSA 3APSA 3VWVA 4D73B 1UN2A 5H5SA 2HZEA 1WJKA 2HRKB 1N25A 4PQ1A 5J9BA 2H6ZA 2E2GA 3RAZA 4K0GA 1GSDA 5CYYA 2QSIA 4OFMA 1U6TA 4W66A 1M0UA 4YAVA 3EVIA 4POLA 5EPFA 3IE3A 3UBLA 4KCAA 1CQGA 2AV4A 1USBA 4Q5QA 5J40A 1XZOA 4F2IA 4KA0A 4J2FA 2XPDA 1ZYNA 4QQ7A 2VCWA 1YVLA 2LUSA 1O73A 2F3MA 3G9BA 4K7NA 2EIRA 3H4KA 1THOA 4E8HA 2GDRA 1MEKA 2VCVA 4I2UA 1ZGNA 5ELAA 4E8EA 5IM9A 2L6DA 2H1BA 1DBYA 5J4YA 2AB6A 3DD3A 4ZBAA 2XHFA 4K0NA 4TXOB 3L9VA 3ZFBA 5HR2A 1RK4A 4HDEA 5A4UA 2Z9SA 4ACSA 1EGOA 3DGQA 1JFUA 3ISOA 1SD9A 4KNDA 2AAWA 5J41A 2F51A 2A4VA 2TIRA 1SK0A 2M46A 3M1GA 3TKPA 5J9CA 1GTIA 3TUEA 1EEMA 3DYRA 4JBBA 2VD1A 1ACVA 1MDKA 1R26A 3P2AA 5IMVA 2H75A 2QKEA 5J47A 1I9DA 3GKNA 1XVQA 1OE7A 1YY7A 3HYPA 5J3RA 4BL7B 1TK8B 1WOUA 4QL7A 5JCWA 1XBSA 1A0RP 1F37A 3WGXA 5D9XA 1F2EA 1TRSA 2MMZA 1TU8A 3QPMA 4POBA 2LQOA 5HFKA 3DMLA 1S3CA 1SKRB 1EV4A 3GA4A 2DJ2A 5CP1A 3HZ4A 4G9HA 5AGYA 4NHZA 1X9SB 1QXHA 2KP1A 4A5PA 1RQMA 5BMUB 1SYXA 4L8EA 3HKRA 5J4UA 2HT9A 1QFNA 1OAZA 1YKCA 1V57A 3TJKA 5ECHB 1YEPA 3WT1A 4K2XA 5INYA 5F07A 2H1DA 3IC8A 2CVDA 2PUKC 1GSYA 5B6MA 2MMAA 3DKSA 2GQLA 3QAVA 2HRKA 4EDZA 1A2JA 3KM6A 3FW2A 4IHUA 2DJ1A 22GSA 1G6YA 4NHWA 4V1Ap 3GTUB 2GVPA 4L0UA 2LKUA 3ZIVA 2MZCA 1OC9A 1T1VA 5DCHA 2AUVA 2C4JA 1AQWA 3BJ5A 3CWGA 5JWRB 2OKAA 3FZ5A 1BYEA 4FIWA 4IELA 1ABAA 3APQA 14GSA 3BOAA 2I3YA 3QFBC 2JZRA 4Z2RA 2H72A 3GFKA 1XIYA 5F8BA 1XWGA 4JU5A 4O5QA 1WP0A 4MZCA 2VL2A 3TJJA 2OACA 4MZWA 1Q4JA 5E4WA 2HE3A 4YQVA 4ZILA 2LNSA 3CSHA 3W6GA 1QGVA 4NPBA 1TK5B 2O89A 1T4YA 3H8QA 2E0QA 3IXRA 3BD2A 1U3IA 1A0FA 1TI1A 5FT3A 2DJ3A 2B5XA 3D6IA 2LV3A 5E59A 3FZAA 2WGRA 4I2TA 1GTUA 4MF5A 1N2AA 4GSSA 2H71A 5DALA 13GSA 2OE1A 2LJKA 4I5QA 2ON5A 1B9YC 4E68A 4F0BA 3WYWA 1XWCA 7GSSA 3TRQA 4I8BA 4LL1B 4OMVA 4WXTA 2EC4A 2WDUA 5KN3A 4BL7A 4IP6A 4G0IA 4DVCA 1GUKA 2DJ0A 2HRFA 1TW9A 1DE2A 2O85A 4EXJA 1ERUA 3PGTA 3UEMA 3CYNA 4MH3A 5GZZB 2G0FA 5KN0A 3HJOA 2CA8A 4MP4A 17GSA 2PVQA 5ECNB 4IKHA 4AKGA 3IDVA 2HFDA 5H5QA 2I9HA 3ZITA 5G1LA 1G7EA 5BMUA 4V2NA 3VK9A 2FWFA 4GQFA 5IOWA 4WBRD 4X4JA 4LLRA 4MDCA 3VWXA 4RUVA 3GHAA 2R37A 1M9BA 4ECCA 3FMWA 2L59A 1GRXA 4WF4A 2X8CA 5ENUA 3HCZA 5IIZA 5IQYA 4GWRA 1YQ1A 1OC8A 4YQUA 2JADA 2B1LA 3GTUA 4MPFA 4G0KA 5G5FA 4O5UA 3F4SA 4V2LA 3GKXA 1ZL9A 4FH8A 1YEXA 3MYDA 4GSNA 3TKSC 1XWKA 3UOMA 3I69A 3ZYWA 4XIHA 1B48A 2F8FA 2J23A 4FYUA 1K0NA 3RDWA 1G7OA 6GSTA 3KMNA 1GSFA 3IV4A 5JCUA 3UMAA 5ID2A 3GYKA 2B6MA 1TRVA 4IP1A 1GLPA 4WBJA 3HA9A 3LSZA 2RM6A 1ZMAA 1VF3A 2NVLA 2NTOA 3EU3A 3AY8A 9GSSA 5EL8A 3LYPA 2OBIA 3ZVJA 3L9SA 2DIYA 3KD0A 3GMFA 2OADA 1E6BA 4TRXA 4GLTA 2RUEA 2VM1A 2IMDA 5HR1A 4MJAA 4F0CA 2VUPA 2PPTA 3IPZA 4AJ7A 3NOFA 1LJRA 3L0HA 3G7IA 2KHPA 1F3BA 5IMZA 3DRNA 3ME7A 2BTOT 3LEFA 3D22A 3TKSA 1LU4A 5KOXA 1TXXA 2C1YA 4LMVA 2HRAA 3KEBA 4KUNA 2K8VA 1X9WB 5HQPA 4NV2A 4EUYA 2V1MA 2YWNA 4XS4A 4RQRA 3KZQA 4WR4A 2JZTA 1HD2A 2RLIA 2MMNA 1F3AA 2LRCA 1PKZA 4YQMA 1XOAA 5HR0A 2GGTA 1BF5A 4ILFA 4MJEA 2ZNMA 1K3YA 5D9VA 6GSWA 1XPVA 4EVMA 2EFHA 2QC7A 4MF7A 3D0ZA 2NPBA 3KP8A 5ELGA 2PERA 4TKYA 4KDXA 4G10A 3O76A 3LG6A 1VF2A 4O92A 4N0ZA 2GSSA 2EIQA 1GUMA 6GSVA 3MSZA 2XBIA 1K0AA 3ZTLA 4BVXA 1EV9A 4H86A 3VLNA 4Q5RA 2H73A 1SK2A 4ZL9A 1O81A 3GH9A 3TJBA 1VF4A 3SWLA 1U88A 3GL5A 4ZIJA 5ABRA 4ECIA 5IPHA 2PU9C 1YZXA 2I1UA 2EFDA 5HR3A 1XW6A 4RQXA 4GRFA 1M2DA 1DE1A 4HUAA 2YWMA 1ERTA 1AAZA 3F4TA 1HNCA 2HSNA 5A34A 3E0UA 3P7XA 4DSSB 1BG1A 1YJ6A 2PWJA 4DSRA 4ZB7A 1PQNA 5COHA 1UC7A 5HFIA 4QMKA 1Z7PA 3GSSA 3QR6A 2DJKA 2IMIA 2H74A 3UAPA 3L4NA 1VGLA 2LTKA 2H19A 5A4WA 3DEXA 3I43A 4KH7A 3A5WA 4F03A 3IC4A 5A5KA 3ZMLA 2EFCA 2H0HA 4N30A 2IMKA 2VLTA 4PURA 2B3SA 4TOPA 1NM3A 1TTZA 3EU4A 2IL3A 3IOSA 4XS6A 4N10A 1T7PB 3M8NA 4CW9A 3TRXA 3HDCA 1N8JA 4PGTA 1RW1A 2L5OA 2ALBA 2IFQB 3LGCA 1SK1A 3ZVJD 1GL8A 1Z9HA 3FR6A 4G0LA 5F0GA 1ZYEA 20GSA 4G01A 3VPTA 3D21A 1SVOA 3N9JA 1B8XA 1XWAA 5ECLB 4AF2A 3ZRDA 5ECRB 2FUG2 4L5OA 1MD3A 1PSQA 3LW9A 18GSA 2IMFA 3U5RE 1AUCA 2FD3A 1GTBA 1TXUA 5AIVA 5G30A 2JU5A 4TR3A 3HXSA 2MYGA 2RM5A 3FRCA 1GSSA 1M2AA 2F9SA 3TB2A 3TDGA 5ECPB 5EY6A 4KSMA 2VAFA 1ZOFA 3FZ4A 1OVNA 2JL4A 1WRYA 3M9JA 5DBQA 3MIXA 5A1NB 6GSYA 2X8GA 1SKWB 5LD0A 3TJGA 2CQ9A 2H30A 5KEJA 3VWWA 5D93A 2OE0A 4TR4A 2WRTA 4HJMA 3L78A 4XRAA 2WCIA 5B6NA 3MDKA 2J9HA 1A8YA 4IBPA 16GSA 2WULA 3W8SA 12GSA 4XRDA 4MPGA 1NHOA 3IBHA 1VF1A 1ON4A 3UJ1A 2HZFA 2C8UA 2KLXA 2HSMA 4IQAA 4OFTA 4K6XA 2VL2C 1VRSD 4TR1A 2IWTA 2VM2A 1EGRA 1JZOA 4YKFA 1MD4A 4GCIA 1TKDB 4MZBA 3CBUA 3Q19A 2CZ2A 4ZL8A 1T3BA 4POKA 2FY6A 4NMUA 2CV4A 2DKIA 4IN0A 3PR8A 4Z2UA 1BQ7A 2X49A 2YWOA 3R3EA 1UA5A 3VI7A 4D73A 2VLVA 3FHKA 2YZUA 1JHBA 2IN3A 4CDOA 3F4RA 4Q5FA 1HNBA 1AQVA 2KUCA 2L4CA 2R2JA 2VL9A 3IHGA 2GLRA 4BWQA 5D96A 5GSSA 1YF1A 4EKZA 3UVTA 3EC3A 2DJJA 1R7HA 3UARA 1XCCA 10GSA 4JR4A 1OC3A 5CO3A 5A4VA 1O6JA 3MNGA 4I6XA 3ZMKA 4DSSA 1K0OA 2PMTA 1A24A 5L71A 1FHEA 1SVLA 5F06A 5CAXA 4TR0A 1SVMA 2GSQA 5KN2A 5DAKB 2YV7A 4KGIA 4MA9A 3US3A 1PX6A 3W8JA 3RPNA 3ZREA 1T4ZA 2C0GA 3ERGA 1Z6NA 4WETA 4TXOA 3UVHA 3MWHA 1R4WA 1SJZA 4PQHA 1X5CA 2C0FA 2LSTA 3LORA 2HNLA 2B7KA 2R0PA 4KDYA 1ST9A 4BVYB 3KMOA 3VPQA 4ZBDA 2JSZA 3K8NA 4PNFA 2DSAA 4CHSA 4RI7A 1A2LA 1NSWA 3LYKA 1SL0B 2A2RA 5IO0A 1GSQA 1TDIA 1EP8A 2RUFA 1SENA 2ZCTA 2ZUPA 1O7UA 1S3DA 2IIYA 1BJXA 1C72A 3EYTA 2WJUA 1Y1UA 4IJIA 3F6DA 1CQHA 5DQYA 4K2DA 1URMA 5CNWA 3NZNA 4TN8A 4MMMA 5IMDA 4V2MA 4ZXGA 2L5LA 2FNOA 3ZLPA 2HRNA 1TJDA 5DJMA 2K9FA 3GKKA 1DSBA 3JCML 2C0DA 4AJ6A 4EO3A 3EMPA 4CY8A 4MABA 5IMCA 6GSXA 2H70A 1GWCA 4Q5NA 2C3TA 1SYRA 4QL9A 4ULXA 1FOHA 2P5RA 2VCZA 4AKHA 1A2MA 3RHBA 2L57A 1I5GA 4ECBA 1X5DA 2CX4A 2HLSA 2FWHA 2DC5A 1GUHA 1K0CA 5G31A 3WGEA 3WGDA 1DUGA 5DCGA 1ILOA 3BCKA 1SJ6A 4GTUA 4JE1A 3IR4A 2WFCA 1V9WA 2L4QA 4F82A 2HQTA 2O8VB 2V6OA 4PUAA 1FW1A 5DJLA 2YJHA 4PUFC 4V1Ag 4ZL7A 3UBKA 5CRWA 2OA7A 4HQZA 4NXIA 4DSQA 2FWEA 1ERWA 1JZDA 3LWAA 3CSIA 3ERFA 2UV8G 3KH9A 2OT3A 3C71A 2M72A 4FYCA 4GDFA 1KTEA 1LBKA 6GSUA 2GQMA 3APOA 3GIXA 3HZ8A 5JWQB 3HVVA 2AYTA 5D8IA 1SU9A 2B5EA 2YANA 3EURA 2I4AA 4OO4A 4HI7A 3TKSE 1EOHA 2DLXA 3CRUA 1TU7A 1H75A 2LEGA 4PQIA 4LA1A 3IK7A 1O8WA 2KOKA 4XS1A 3EWLA 2K6VA 3DIEA 1M7TA 3IHQA 3HMJG 3P8WA 1T00A 2G2QA 1PN9A 1JLVA 4KF9A 5G2ZA 4YAPA 4MJCA 3VFIA 2YP6A 1H4OA 4KSOA 4KAEA 2LJAA 3EPTA 3KP9A 4HZ2A 3V1WA 3C7MA 1GNEA 2GSTA 5D73A 4ZB6A 5C00A 5ECSA 2VD0A 2IJYA 4K9ZA 19GSA 1WMJA 4BWSA 4PNGA 3FY7A 2GT6A 3PINA 1MDIA 2QA1A 3TJFA 3S9FA 1GTAA 3F3RA 3O3TA 2CZ3A 2AJQB 1BX9A 1PKWA 2H8LA 4IQ1A 3GNJA 5IOXA 2YPMA 2P5QA 5KOWA 4XHMA 1ZYPA 2VL3A 4BPYA 3VWUA 3D5JA 3C8EA 1A8LA 5ECIB 2REMA 2C0EA 4GXZA 2YV9A 3HVSA 1O85A 3CSJA 3VI5A 3ZIJA 2QGVA 1GSUA 1KNGA 2VCQA 2CVKA 3GV1A 1ERVA 2V6KA 3BBYA 2VO4A 2X8HA 1AC1A 5FHIA 3O6TA 4MLYA 3DWVA 5C04A 1A23A 1KEBA 1GP1A 2X64A 4ECJA 2JACA 3KJYA 3F0IA 3ME8A 4BA7A 4K7OA 2GZPA 3G7JA 5HFGA 3CMIA 4MJBA 3EMXA 4HS1A 1TRUA 2FCHA 8GSSA 3C1SA 4LMWA 3H1NA 3IRAA 2AHEA 1SKSB 2LRTA 3ZFLA 5ECQB 2VKZG 3WD6A 3E9JB 3KTBA 1QMVA 1NHYA 1K3LA 3GRXA 3F8UA 3A2VA 3GH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3O A;  4AJ8 A;  3GUS A;  4FYB A;  2HYX A;  2JSY A;  1PA3 A;  1TP9 A;  2GZZ A;  3PH9 A;  5IMA A;  1M2B A;  2H1G A;  4JZQ A;  3DVW A;  3KIJ A;  3Q74 A;  1AXD A;  4HU9 A;  3FZ9 A;  4EDY A;  3KGK A;  2KP2 A;  2R4V A;  3P90 A;  2FWG A;  3RBT A;  3DVX A;  1U87 A;  3Q18 A;  3A2X A;  4L0W A;  2VCT A;  3HVX A;  1KBN A;  1OC9 B;  1FVJ A;  1AW9 A;  1OE8 A;  3IAM 2;  1Y25 A;  2PGT A;  2H0G A;  4HJ2 A;  4IGJ A;  3F9U A;  3IAS 2;  3FR3 A;  4K8M A;  3M9K A;  2YWI A;  1TI3 A;  1QK8 A;  3TRP A;  1TOF A;  3KXO A;  1XW9 A;  4JR6 A;  1R5A A;  4XTS A;  4NWY A;  1SD8 A;  3N5O A;  1XOB A;  2MBS A;  3TKR A;  2E2M A;  3HD5 A;  3H93 A;  4J57 E;  4F9Z A;  4NAX A;  3LXZ A;  2DBC A;  2H6Y A;  2XPE A;  2OJL A;  2RII A;  2BMX A;  2CT6 A;  1J0F A;  1THX A;  1WE0 A;  1Y6E A;  5F05 A;  1OKD A;  1SJI A;  3J7Y k;  1FB0 A;  1JZR A;  1WIK A;  2CVB A;  1T8E B;  3KH7 A;  1ML6 A;  2GSR A;  2TRC P;  1V40 A;  3HJM A;  1B9X C;  3C73 A;  2ES7 A;  2GTU A;  3F3Q A;  4EC0 A;  3EE2 A;  4N11 A;  4GST A;  4EL1 A;  1FAA A;  2R3X A;  1GNW A;  2D2Z A;  1XXU A;  3WT2 A;  5DAL B;  1M99 A;  1BAY A;  5B7C A;  1EWX A;  2B5Y A;  2GQK A;  4GQC A;  1GSE A;  1MDJ A;  1Z7R A;  1IYI A;  5G5E A;  1AQX A;  3MAK A;  2VIM A;  3F63 A;  1OKT A;  4HZ4 A;  4MK3 A;  1J08 A;  2MBT A;  5EVO A;  1S3A A;  2PBJ A;  5G1K A;  3LQ7 A;  4EE0 A;  4N0V A;  4FQU A;  2F8A A;  2LRN A;  4POM A;  1WWJ A;  2WZ9 A;  3GX0 A;  3OR5 A;  3VUR A;  1O8X A;  2VCX A;  1V98 A;  1HNA A;  2H0I A;  4HU7 A;  3I9V 2;  2YNX A;  3H79 A;  3CXG A;  3QAW A;  4IVF A;  3NIV A;  4ML6 A;  2CAQ A;  3EIN A;  3GN3 A;  5B8B A;  1FOV A;  2A2S A;  2P31 A;  5J5N A;  3A2W A;  3J7Y b;  1K0B A;  3TKQ A;  3KCM A;  1X9M B;  5D9T A;  2H76 A;  2LNT A;  1J9B A;  2YOI A;  5ECK B;  1EZK A;  3GX8 A;  4OD7 A;  1ZZY A;  5IMF A;  2OBK A;  3R2Q A;  3FEU A;  3QAG A;  1YF0 A;  5B8A A;  1TK0 B;  4JED A;  3F6F A;  1AIU A;  2B7J A;  4FO5 A;  1OYJ A;  2L6C A;  1FO5 A;  3IA1 A;  2EIO A;  4OCF A;  2VOC A;  3LXT A;  1BED A;  5ID2 B;  1PRX A;  2H6X A;  1B4P A;  4I97 A;  2HI7 A;  3GUR A;  2WS2 A;  1XW5 A;  4ZB9 A;  2N5F A;  4X0X A;  2LQQ A;  2IFQ A;  2GS3 A;  3QFA C;  3DXB A;  4P3Y B;  2C80 A;  2JZS A;  1EEJ A;  4ZBB A;  4OCE A;  5JCG A;  4HQS A;  5CRH A;  2IPA A;  3D4T A;  5CRE A;  1NW2 A;  3ZZX A;  3TGZ A;  2WB9 A;  4WEY A;  1F6M C;  2YZH A;  5AIS A;  3FYG A;  2K8S A;  4HOJ A;  2P0G A;  3GST A;  5GAP D;  5AN1 A;  1YKA A;  2V2G A;  1SL2 B;  3D4M A;  1PL2 A;  4K1F A;  2YJ7 A;  3HY2 A;  1PGT A;  3FKF A;  1HYU A;  4OO5 A;  3A3T A;  4MF6 A;  2OE3 A;  4XCS A;  1V58 A;  1G6W A;  4PTS A;  1Z6M A;  1MTC A;  4KDU A;  3HHV A;  4XS4 B;  1JLW A;  4PX1 A;  1IYH A;  2MMO A;  2VLU A;  4KE3 A;  2DML A;  2NBS A;  2FHE A;  4TW5 A;  2N5B A;  3C1R A;  5LCZ A;  1ZCP A;  1GLQ A;  4OFN A;  4O5R A;  1PL1 A;  4GF0 A;  2HSH A;  3UL3 A;  4DEJ A;  3FR9 A;  2E7P A;  4YH2 A;  5GST A;  1XFL A;  2GZY A;  1X0R A;  4O7H A;  4TVE A;  2XC2 A;  4KW6 A;  4HEA 2;  1U3A A;  4G2E A;  5ECO B;  3ZL5 A;  2O7K A;  3LJR A;  3ERW A;  4TXV A;  2K18 A;  1F9M A;  4BVX B;  3TOT A;  4K7I A;  1K0M A;  4JRR A;  2GT5 A;  3M0F A;  2FA8 A;  2NDO A;  2HZE B;  1EP7 A;  1E2Y A;  4NV5 A;  1QUW A;  3HJP A;  2DIZ A;  3G7Y A;  11GS A;  2CAI A;  1G0T A;  2N5A A;  3RHC A;  2PVO C;  5DVB A;  1GH2 A;  1YDK A;  1W4V A;  1XWB A;  3QDN A;  1EOG A;  3IK9 A;  5IO2 A;  5H5R A;  2HSN B;  5DAK A;  3QMX A;  1GUL A;  1X5E A;  2IME A;  4G19 A;  5KN1 A;  4LL4 B;  2YCD A;  2ON7 A;  1QQ2 A;  5CRG A;  3CTG A;  3FK8 A;  4AGS A;  2M80 A;  2TRX A;  3KTL A;  2XBQ A;  3TCO A;  4EF0 A;  3QOU A;  4J56 E;  2V41 A;  4MH2 A;  2YN1 A;  5IPG A;  2O87 A;  3U6V A;  3UIW A;  1FG4 A;  1BG5 A;  1JZW A;  4PXO A;  5CRD A;  4KCE A;  2H1A A;  3Q6O A;  1ZYQ B;  2V32 A;  4KB3 A;  4IJ3 A;  4MCU A;  2R5G A;  4BVY A;  1PX7 A;  1M9A A;  1Q98 A;  3SBC A;  4Z7X A;  5LNK e;  1PD2 1;  4O32 A;  2UZ8 A;  4RI6 A;  5DQS A;  1V2A A;  2FA4 A;  6GSS A;  2C3N A;  4ZB8 A;  3GL3 A;  4ID0 A;  3QCP A;  3CRT A;  1PMT A;  3PPU A;  2CX3 A;  1W89 A;  4ML1 A;  4OWY A;  2R6K A;  2C3Q A;  2LS5 A;  5D9W A;  4WKW A;  4ISD A;  1WPI A;  5ECM B;  5DDL A;  1FB6 A;  4X1U A;  2FLS A;  1TRW A;  2X99 A;  3E3E A;  3CTF A;  2FGX A;  2PN8 A;  5AIX A;  2LJR A;  1SL1 B;  4KX4 A;  2DMM A;  1HQO A;  2BJX A;  3QD9 A;  3L9U A;  3ED3 A;  3BCI A;  5FWG A;  3LFL A;  1UVZ A;  2HSM B;  1Z3E A;  2I81 A;  4WR5 A;  3TOU A;  4TR1 B;  2H01 A;  1XVW A;  3I6A A;  5JWO B;  4WF5 A;  2HXK A;  3RPP A;  3GKM A;  5GAN D;  4L5L A;  4IS0 A;  1K0D A;  4IW9 A;  4X43 A;  2H66 A;  1B4Q A;  1FVK A;  1R5P A;  1Z5Y E;  2HSY A;  3M3M A;  2B1K A;  4USS A;  3APS A;  3VWV A;  4D73 B;  1UN2 A;  5H5S A;  2HZE A;  1WJK A;  2HRK B;  4PQ1 A;  5J9B A;  2H6Z A;  2E2G A;  3RAZ A;  4K0G A;  1GSD A;  5CYY A;  2QSI A;  4OFM A;  1U6T A;  1M0U A;  4YAV A;  3EVI A;  4POL A;  5EPF A;  3IE3 A;  3UBL A;  4KCA A;  1CQG A;  2AV4 A;  1USB A;  4Q5Q A;  1XZO A;  4F2I A;  4KA0 A;  4J2F A;  2XPD A;  4QQ7 A;  2VCW A;  2LUS A;  1O73 A;  2F3M A;  3G9B A;  4K7N A;  2EIR A;  3H4K A;  1THO A;  4E8H A;  2GDR A;  1MEK A;  2VCV A;  4I2U A;  1ZGN A;  5ELA A;  4E8E A;  5IM9 A;  2L6D A;  2H1B A;  1DBY A;  2AB6 A;  3DD3 A;  4ZBA A;  2XHF A;  4K0N A;  4TXO B;  3L9V A;  3ZFB A;  5HR2 A;  1RK4 A;  4HDE A;  5A4U A;  2Z9S A;  4ACS A;  1EGO A;  3DGQ A;  1JFU A;  3ISO A;  1SD9 A;  4KND A;  2AAW A;  5J41 A;  2F51 A;  2A4V A;  2TIR A;  1SK0 A;  2M46 A;  3M1G A;  3TKP A;  5J9C A;  1GTI A;  3TUE A;  1EEM A;  3DYR A;  4JBB A;  2VD1 A;  1ACV A;  1MDK A;  1R26 A;  3P2A A;  5IMV A;  2H75 A;  2QKE A;  1I9D A;  3GKN A;  1XVQ A;  1OE7 A;  1YY7 A;  3HYP A;  5J3R A;  4BL7 B;  1TK8 B;  1WOU A;  4QL7 A;  5JCW A;  1XBS A;  1A0R P;  1F37 A;  3WGX A;  5D9X A;  1F2E A;  1TRS A;  2MMZ A;  1TU8 A;  3QPM A;  4POB A;  2LQO A;  5HFK A;  3DML A;  1S3C A;  1SKR B;  1EV4 A;  3GA4 A;  2DJ2 A;  5CP1 A;  3HZ4 A;  4G9H A;  5AGY A;  4NHZ A;  1X9S B;  1QXH A;  2KP1 A;  1RQM A;  1SYX A;  4L8E A;  3HKR A;  5J4U A;  2HT9 A;  1QFN A;  1OAZ A;  1YKC A;  1V57 A;  3TJK A;  5ECH B;  1YEP A;  3WT1 A;  5INY A;  5F07 A;  2H1D A;  3IC8 A;  2CVD A;  2PUK C;  1GSY A;  5B6M A;  2MMA A;  3DKS A;  2GQL A;  3QAV A;  2HRK A;  4EDZ A;  1A2J A;  3KM6 A;  3FW2 A;  4IHU A;  2DJ1 A;  22GS A;  1G6Y A;  4NHW A;  4V1A p;  3GTU B;  2GVP A;  4L0U A;  2LKU A;  3ZIV A;  2MZC A;  1OC9 A;  1T1V A;  5DCH A;  2AUV A;  2C4J A;  1AQW A;  3BJ5 A;  5JWR B;  2OKA A;  3FZ5 A;  1BYE A;  4FIW A;  4IEL A;  1ABA A;  3APQ A;  14GS A;  3BOA A;  2I3Y A;  3QFB C;  2JZR A;  2H72 A;  3GFK A;  1XIY A;  5F8B A;  1XWG A;  4JU5 A;  1WP0 A;  4MZC A;  2VL2 A;  3TJJ A;  2OAC A;  4MZW A;  1Q4J A;  5E4W A;  2HE3 A;  4YQV A;  4ZIL A;  2LNS A;  3CSH A;  3W6G A;  1QGV A;  4NPB A;  1TK5 B;  2O89 A;  1T4Y A;  2E0Q A;  3H8Q A;  3IXR A;  3BD2 A;  1U3I A;  1A0F A;  1TI1 A;  5FT3 A;  2DJ3 A;  2B5X A;  3D6I A;  2LV3 A;  5E59 A;  3FZA A;  2WGR A;  4I2T A;  1GTU A;  4MF5 A;  1N2A A;  4GSS A;  2H71 A;  5DAL A;  13GS A;  2OE1 A;  2LJK A;  4I5Q A;  2ON5 A;  1B9Y C;  4F0B A;  3WYW A;  1XWC A;  7GSS A;  3TRQ A;  4I8B A;  4LL1 B;  4OMV A;  4WXT A;  2EC4 A;  2WDU A;  5KN3 A;  4BL7 A;  4IP6 A;  4G0I A;  4DVC A;  1GUK A;  2DJ0 A;  2HRF A;  1TW9 A;  1DE2 A;  2O85 A;  4EXJ A;  1ERU A;  3PGT A;  3UEM A;  3CYN A;  4MH3 A;  5GZZ B;  2G0F A;  5KN0 A;  3HJO A;  2CA8 A;  4MP4 A;  17GS A;  2PVQ A;  5ECN B;  4IKH A;  3IDV A;  2HFD A;  5H5Q A;  2I9H A;  3ZIT A;  5G1L A;  1G7E A;  5BMU A;  4V2N A;  3VK9 A;  2FWF A;  4GQF A;  5IOW A;  4WBR D;  4LLR A;  4MDC A;  3VWX A;  4RUV A;  3GHA A;  2R37 A;  1M9B A;  4ECC A;  2L59 A;  1GRX A;  4WF4 A;  2X8C A;  5ENU A;  3HCZ A;  5IIZ A;  5IQY A;  4GWR A;  1YQ1 A;  1OC8 A;  4YQU A;  2JAD A;  2B1L A;  3GTU A;  4MPF A;  4G0K A;  5G5F A;  3F4S A;  4V2L A;  3GKX A;  1ZL9 A;  4FH8 A;  1YEX A;  4GSN A;  3TKS C;  1XWK A;  3UOM A;  3I69 A;  3ZYW A;  4XIH A;  1B48 A;  2F8F A;  2J23 A;  4FYU A;  1K0N A;  3RDW A;  1G7O A;  6GST A;  3KMN A;  1GSF A;  3IV4 A;  5JCU A;  3UMA A;  5ID2 A;  3GYK A;  2B6M A;  1TRV A;  4IP1 A;  1GLP A;  4WBJ A;  3HA9 A;  3LSZ A;  2RM6 A;  1ZMA A;  1VF3 A;  2NVL A;  2NTO A;  3EU3 A;  3AY8 A;  9GSS A;  5EL8 A;  3LYP A;  2OBI A;  3ZVJ A;  3L9S A;  2DIY A;  3KD0 A;  3GMF A;  2OAD A;  1E6B A;  4TRX A;  4GLT A;  2RUE A;  2VM1 A;  2IMD A;  5HR1 A;  4MJA A;  4F0C A;  2VUP A;  2PPT A;  3IPZ A;  4AJ7 A;  3NOF A;  1LJR A;  3L0H A;  3G7I A;  2KHP A;  1F3B A;  5IMZ A;  3DRN A;  3ME7 A;  2BTO T;  3LEF A;  3D22 A;  3TKS A;  1LU4 A;  1TXX A;  2C1Y A;  4LMV A;  2HRA A;  3KEB A;  4KUN A;  2K8V A;  1X9W B;  5HQP A;  4NV2 A;  4EUY A;  2V1M A;  2YWN A;  4XS4 A;  4RQR A;  3KZQ A;  4WR4 A;  2JZT A;  1HD2 A;  2RLI A;  2MMN A;  1F3A A;  2LRC A;  1PKZ A;  4YQM A;  1XOA A;  5HR0 A;  2GGT A;  4ILF A;  4MJE A;  2ZNM A;  1K3Y A;  5D9V A;  6GSW A;  1XPV A;  4EVM A;  2QC7 A;  4MF7 A;  3D0Z A;  2NPB A;  3KP8 A;  5ELG A;  2PER A;  4TKY A;  4KDX A;  4G10 A;  3O76 A;  3LG6 A;  1VF2 A;  4O92 A;  4N0Z A;  2GSS A;  2EIQ A;  1GUM A;  6GSV A;  3MSZ A;  2XBI A;  1K0A A;  3ZTL A;  4BVX A;  1EV9 A;  4H86 A;  3VLN A;  4Q5R A;  2H73 A;  1SK2 A;  4ZL9 A;  1O81 A;  3GH9 A;  3TJB A;  1VF4 A;  3SWL A;  1U88 A;  3GL5 A;  4ZIJ A;  5ABR A;  4ECI A;  5IPH A;  2PU9 C;  1YZX A;  2I1U A;  5HR3 A;  1XW6 A;  4RQX A;  4GRF A;  1M2D A;  1DE1 A;  4HUA A;  2YWM A;  1ERT A;  1AAZ A;  3F4T A;  1HNC A;  3E0U A;  3P7X A;  4DSS B;  1YJ6 A;  2PWJ A;  4DSR A;  1PQN A;  5COH A;  1UC7 A;  5HFI A;  1Z7P A;  3GSS A;  3QR6 A;  2DJK A;  2IMI A;  2H74 A;  3UAP A;  3L4N A;  1VGL A;  2LTK A;  2H19 A;  5A4W A;  3DEX A;  3I43 A;  4KH7 A;  3A5W A;  4F03 A;  3IC4 A;  5A5K A;  3ZML A;  2H0H A;  4N30 A;  2IMK A;  2VLT A;  4PUR A;  2B3S A;  4TOP A;  1NM3 A;  1TTZ A;  3EU4 A;  2IL3 A;  3IOS A;  4XS6 A;  4N10 A;  1T7P B;  3M8N A;  4CW9 A;  3TRX A;  3HDC A;  1N8J A;  4PGT A;  1RW1 A;  2L5O A;  2ALB A;  2IFQ B;  3LGC A;  1SK1 A;  3ZVJ D;  1GL8 A;  1Z9H A;  3FR6 A;  4G0L A;  5F0G A;  1ZYE A;  20GS A;  3VPT A;  3D21 A;  3N9J A;  1B8X A;  1XWA A;  5ECL B;  4AF2 A;  3ZRD A;  5ECR B;  2FUG 2;  4L5O A;  1MD3 A;  1PSQ A;  18GS A;  2IMF A;  3U5R E;  1AUC A;  2FD3 A;  1GTB A;  5AIV A;  5G30 A;  2JU5 A;  4TR3 A;  3HXS A;  2MYG A;  2RM5 A;  3FRC A;  1GSS A;  1M2A A;  2F9S A;  3TB2 A;  3TDG A;  5ECP B;  5EY6 A;  4KSM A;  2VAF A;  1ZOF A;  3FZ4 A;  1OVN A;  2JL4 A;  1WRY A;  3M9J A;  5DBQ A;  6GSY A;  2X8G A;  1SKW B;  5LD0 A;  3TJG A;  2CQ9 A;  2H30 A;  5KEJ A;  3VWW A;  5D93 A;  2OE0 A;  4TR4 A;  2WRT A;  4HJM A;  3L78 A;  4XRA A;  2WCI A;  5B6N A;  3MDK A;  2J9H A;  1A8Y A;  4IBP A;  16GS A;  2WUL A;  3W8S A;  12GS A;  4XRD A;  4MPG A;  1NHO A;  3IBH A;  1VF1 A;  1ON4 A;  3UJ1 A;  2HZF A;  2C8U A;  2KLX A;  2HSM A;  4IQA A;  4OFT A;  4K6X A;  2VL2 C;  1VRS D;  4TR1 A;  2IWT A;  2VM2 A;  1EGR A;  1JZO A;  1MD4 A;  4GCI A;  1TKD B;  4MZB A;  3CBU A;  3Q19 A;  2CZ2 A;  4ZL8 A;  1T3B A;  4POK A;  2FY6 A;  4NMU A;  2CV4 A;  4IN0 A;  3PR8 A;  1BQ7 A;  2YWO A;  3R3E A;  1UA5 A;  3VI7 A;  4D73 A;  2VLV A;  3FHK A;  2YZU A;  1JHB A;  2IN3 A;  4CDO A;  3F4R A;  4Q5F A;  1HNB A;  1AQV A;  2KUC A;  2L4C A;  2R2J A;  2VL9 A;  2GLR A;  4BWQ A;  5D96 A;  5GSS A;  1YF1 A;  4EKZ A;  3UVT A;  3EC3 A;  2DJJ A;  1R7H A;  3UAR A;  1XCC A;  10GS A;  4JR4 A;  1OC3 A;  5CO3 A;  5A4V A;  1O6J A;  3MNG A;  4I6X A;  3ZMK A;  4DSS A;  1K0O A;  2PMT A;  1A24 A;  5L71 A;  1FHE A;  5F06 A;  5CAX A;  4TR0 A;  2GSQ A;  5KN2 A;  5DAK B;  2YV7 A;  4KGI A;  4MA9 A;  3US3 A;  1PX6 A;  3W8J A;  3RPN A;  3ZRE A;  1T4Z A;  2C0G A;  3ERG A;  1Z6N A;  4WET A;  4TXO A;  3UVH A;  3MWH A;  1R4W A;  1SJZ A;  4PQH A;  1X5C A;  2C0F A;  2LST A;  3LOR A;  2HNL A;  2B7K A;  4KDY A;  1ST9 A;  4BVY B;  3KMO A;  3VPQ A;  4ZBD A;  2JSZ A;  3K8N A;  4PNF A;  2DSA A;  4CHS A;  4RI7 A;  1A2L A;  1NSW A;  3LYK A;  1SL0 B;  2A2R A;  5IO0 A;  1GSQ A;  1TDI A;  1EP8 A;  2RUF A;  1SEN A;  2ZCT A;  2ZUP A;  1O7U A;  1S3D A;  2IIY A;  1BJX A;  1C72 A;  3EYT A;  2WJU A;  4IJI A;  3F6D A;  1CQH A;  5DQY A;  4K2D A;  1URM A;  5CNW A;  3NZN A;  4TN8 A;  4MMM A;  5IMD A;  4V2M A;  4ZXG A;  2L5L A;  2FNO A;  3ZLP A;  2HRN A;  1TJD A;  5DJM A;  2K9F A;  3GKK A;  1DSB A;  3JCM L;  2C0D A;  4AJ6 A;  4EO3 A;  3EMP A;  4MAB A;  5IMC A;  6GSX A;  2H70 A;  1GWC A;  4Q5N A;  2C3T A;  1SYR A;  4QL9 A;  4ULX A;  2P5R A;  2VCZ A;  1A2M A;  3RHB A;  2L57 A;  1I5G A;  4ECB A;  1X5D A;  2CX4 A;  2HLS A;  2FWH A;  2DC5 A;  1GUH A;  1K0C A;  5G31 A;  3WGE A;  3WGD A;  1DUG A;  5DCG A;  1ILO A;  3BCK A;  1SJ6 A;  4GTU A;  4JE1 A;  3IR4 A;  2WFC A;  1V9W A;  2L4Q A;  4F82 A;  2HQT A;  2O8V B;  2V6O A;  4PUA A;  1FW1 A;  5DJL A;  2YJH A;  4PUF C;  4V1A g;  4ZL7 A;  3UBK A;  5CRW A;  2OA7 A;  4HQZ A;  4NXI A;  4DSQ A;  2FWE A;  1ERW A;  1JZD A;  3LWA A;  3CSI A;  3ERF A;  3KH9 A;  3C71 A;  2M72 A;  4FYC A;  1KTE A;  1LBK A;  6GSU A;  2GQM A;  3APO A;  3GIX A;  3HZ8 A;  5JWQ B;  3HVV A;  2AYT A;  5D8I A;  1SU9 A;  2B5E A;  2YAN A;  3EUR A;  2I4A A;  4OO4 A;  4HI7 A;  3TKS E;  1EOH A;  2DLX A;  3CRU A;  1TU7 A;  1H75 A;  2LEG A;  4PQI A;  4LA1 A;  3IK7 A;  1O8W A;  2KOK A;  4XS1 A;  3EWL A;  2K6V A;  3DIE A;  1M7T A;  3IHQ A;  3P8W A;  1T00 A;  2G2Q A;  1PN9 A;  1JLV A;  4KF9 A;  5G2Z A;  4YAP A;  4MJC A;  3VFI A;  2YP6 A;  1H4O A;  4KSO A;  4KAE A;  2LJA A;  3KP9 A;  4HZ2 A;  3V1W A;  3C7M A;  1GNE A;  2GST A;  5D73 A;  4ZB6 A;  5C00 A;  5ECS A;  2VD0 A;  2IJY A;  4K9Z A;  19GS A;  1WMJ A;  4BWS A;  4PNG A;  3FY7 A;  2GT6 A;  3PIN A;  1MDI A;  3TJF A;  3S9F A;  1GTA A;  3F3R A;  3O3T A;  2CZ3 A;  2AJQ B;  1BX9 A;  1PKW A;  2H8L A;  4IQ1 A;  3GNJ A;  5IOX A;  2YPM A;  2P5Q A;  4XHM A;  2VL3 A;  4BPY A;  3VWU A;  3D5J A;  3C8E A;  1A8L A;  5ECI B;  2REM A;  2C0E A;  4GXZ A;  2YV9 A;  3HVS A;  1O85 A;  3CSJ A;  3VI5 A;  3ZIJ A;  2QGV A;  1GSU A;  1KNG A;  2VCQ A;  2CVK A;  3GV1 A;  1ERV A;  2V6K A;  3BBY A;  2VO4 A;  2X8H A;  1AC1 A;  5FHI A;  3O6T A;  4MLY A;  3DWV A;  5C04 A;  1A23 A;  1KEB A;  1GP1 A;  2X64 A;  4ECJ A;  2JAC A;  3KJY A;  3F0I A;  3ME8 A;  4BA7 A;  4K7O A;  2GZP A;  3G7J A;  5HFG A;  3CMI A;  4MJB A;  3EMX A;  4HS1 A;  1TRU A;  2FCH A;  8GSS A;  3C1S A;  4LMW A;  3H1N A;  3IRA A;  2AHE A;  1SKS B;  2LRT A;  3ZFL A;  5ECQ B;  3WD6 A;  3E9J B;  3KTB A;  1QMV A;  1NHY A;  1K3L A;  3GRX A;  3F8U A;  3A2V A;  3GH6 A; 
#chains in the Genus database with same CATH topology
 1K3O A;  4AJ8 A;  3GUS A;  4FYB A;  2HYX A;  2JSY A;  1PA3 A;  1TP9 A;  2GZZ A;  3PH9 A;  5IMA A;  1M2B A;  2H1G A;  4JZQ A;  3DVW A;  3KIJ A;  3Q74 A;  1AXD A;  4HU9 A;  3FZ9 A;  4EDY A;  3KGK A;  2KP2 A;  2R4V A;  3P90 A;  2FWG A;  3RBT A;  3DVX A;  1U87 A;  3Q18 A;  3A2X A;  4L0W A;  2VCT A;  3HVX A;  1KBN A;  1OC9 B;  1FVJ A;  1AW9 A;  1OE8 A;  3IAM 2;  1Y25 A;  2PGT A;  2H0G A;  4HJ2 A;  4IGJ A;  3F9U A;  3IAS 2;  3FR3 A;  4K8M A;  3M9K A;  2YWI A;  1TI3 A;  1QK8 A;  3TRP A;  1TOF A;  3KXO A;  1XW9 A;  4JR6 A;  1R5A A;  4XTS A;  1PN0 A;  4NWY A;  1SD8 A;  3N5O A;  1XOB A;  2MBS A;  3TKR A;  2E2M A;  3HD5 A;  3H93 A;  4J57 E;  4F9Z A;  4NAX A;  3LXZ A;  2DBC A;  2H6Y A;  2XPE A;  4EIP A;  2OJL A;  2RII A;  2BMX A;  2CT6 A;  1J0F A;  1THX A;  1WE0 A;  1Y6E A;  5F05 A;  1OKD A;  1SJI A;  3J7Y k;  1FB0 A;  1JZR A;  1WIK A;  4EIQ A;  2CVB A;  1T8E B;  3KH7 A;  1ML6 A;  2GSR A;  2TRC P;  1V40 A;  3HJM A;  1B9X C;  3C73 A;  2ES7 A;  2GTU A;  3F3Q A;  4EC0 A;  3EE2 A;  4N11 A;  4GST A;  4EL1 A;  1FAA A;  2R3X A;  1GNW A;  2D2Z A;  1XXU A;  3WT2 A;  5DAL B;  1M99 A;  1BAY A;  5B7C A;  1EWX A;  4ICY A;  2B5Y A;  2GQK A;  4GQC A;  1GSE A;  1MDJ A;  1Z7R A;  1IYI A;  5G5E A;  1AQX A;  3MAK A;  2VIM A;  3F63 A;  1OKT A;  4HZ4 A;  4MK3 A;  1J08 A;  2MBT A;  5EVO A;  1S3A A;  2PBJ A;  5G1K A;  3LQ7 A;  4EE0 A;  4N3Z A;  4N0V A;  4FQU A;  2F8A A;  2LRN A;  4POM A;  1WWJ A;  2WZ9 A;  3GX0 A;  3OR5 A;  2X4A A;  3VUR A;  1O8X A;  2VCX A;  1V98 A;  1HNA A;  2H0I A;  4HU7 A;  3I9V 2;  2YNX A;  3H79 A;  3CXG A;  3QAW A;  4IVF A;  3NIV A;  4ML6 A;  2CAQ A;  3EIN A;  3GN3 A;  5B8B A;  1FOV A;  2A2S A;  2P31 A;  5J5N A;  3A2W A;  3J7Y b;  1K0B A;  3TKQ A;  3KCM A;  1X9M B;  5D9T A;  3CHX C;  2H76 A;  2LNT A;  1J9B A;  2YOI A;  5ECK B;  1EZK A;  3GX8 A;  4OD7 A;  1ZZY A;  5IMF A;  2OBK A;  3R2Q A;  3FEU A;  3QAG A;  3TU3 B;  2DKH A;  1YF0 A;  5B8A A;  1TK0 B;  4JED A;  3F6F A;  1AIU A;  2B7J A;  4FO5 A;  1OYJ A;  2L6C A;  1FO5 A;  4Z2T A;  3IA1 A;  2EIO A;  4OCF A;  2VOC A;  3LXT A;  1BED A;  5ID2 B;  1PRX A;  2H6X A;  1B4P A;  4I97 A;  2HI7 A;  3GUR A;  2WS2 A;  1XW5 A;  4ZB9 A;  2N5F A;  4X0X A;  2LQQ A;  2IFQ A;  2GS3 A;  3QFA C;  3DXB A;  4P3Y B;  4K5S A;  2C80 A;  2JZS A;  1EEJ A;  4ZBB A;  4OCE A;  5JCG A;  4HQS A;  5CRH A;  2A4H A;  4CY6 A;  2IPA A;  3D4T A;  4K5R A;  5CRE A;  1NW2 A;  3ZZX A;  3TGZ A;  2WB9 A;  4WEY A;  1F6M C;  2YZH A;  5AIS A;  3FYG A;  2K8S A;  2WW0 A;  4HOJ A;  2P0G A;  3GST A;  5GAP D;  5AN1 A;  1YKA A;  2V2G A;  1SL2 B;  3D4M A;  4AKI A;  2QA2 A;  1PL2 A;  4K1F A;  2YJ7 A;  3HY2 A;  1PGT A;  3FKF A;  1HYU A;  4OO5 A;  3A3T A;  4MF6 A;  2OE3 A;  5A1N A;  4XCS A;  1V58 A;  1G6W A;  2EFE A;  4PTS A;  1Z6M A;  1MTC A;  4KDU A;  3HHV A;  4XS4 B;  1JLW A;  4YKG A;  4PX1 A;  1IYH A;  2MMO A;  2VLU A;  4KE3 A;  2DML A;  2NBS A;  2FHE A;  4TW5 A;  2N5B A;  3C1R A;  5LCZ A;  1ZCP A;  1GLQ A;  4AI6 A;  4OFN A;  4O5R A;  1PL1 A;  4GF0 A;  2HSH A;  3UL3 A;  4DEJ A;  5A5H B;  3FR9 A;  2E7P A;  4YH2 A;  5GST A;  1XFL A;  2GZY A;  1X0R A;  4O7H A;  4TVE A;  2XC2 A;  4KW6 A;  4HEA 2;  5BRT A;  1U3A A;  4G2E A;  5ECO B;  3ZL5 A;  2O7K A;  3LJR A;  3ERW A;  4TXV A;  2K18 A;  1F9M A;  4BVX B;  3TOT A;  4K7I A;  1K0M A;  4JRR A;  2GT5 A;  3M0F A;  2FA8 A;  2NDO A;  2HZE B;  1EP7 A;  1E2Y A;  4NV5 A;  1QUW A;  2H1L A;  3HJP A;  2DIZ A;  3G7Y A;  11GS A;  2CAI A;  1G0T A;  2N5A A;  5J4V A;  3RHC A;  2PVO C;  5DVB A;  1GH2 A;  3RFR C;  1YDK A;  1W4V A;  1XWB A;  3QDN A;  1EOG A;  3IK9 A;  5IO2 A;  5H5R A;  2HSN B;  5A34 B;  5DAK A;  3QMX A;  1GUL A;  1X5E A;  2IME A;  4G19 A;  5KN1 A;  4LL4 B;  2YCD A;  2ON7 A;  1QQ2 A;  5CRG A;  3CTG A;  3FK8 A;  4AGS A;  2M80 A;  2TRX A;  3KTL A;  2XBQ A;  3TCO A;  4EF0 A;  3QOU A;  4J56 E;  2V41 A;  4MH2 A;  2YN1 A;  5IPG A;  2O87 A;  2O5V A;  3U6V A;  3UIW A;  1FG4 A;  1BG5 A;  1JZW A;  2A2P A;  4PXO A;  5CRD A;  4KCE A;  2H1A A;  3Q6O A;  1ZYQ B;  2V32 A;  4KB3 A;  4IJ3 A;  4MCU A;  2R5G A;  4BVY A;  1PX7 A;  1M9A A;  2R0C A;  1Q98 A;  3SBC A;  4Z7X A;  5LNK e;  1PD2 1;  4O32 A;  2UZ8 A;  4RI6 A;  5DQS A;  1V2A A;  2FA4 A;  6GSS A;  2C3N A;  4ZB8 A;  3GL3 A;  4ID0 A;  3QCP A;  3CRT A;  1PMT A;  3PPU A;  2CX3 A;  1W89 A;  4ML1 A;  4AKX B;  4OWY A;  2R6K A;  2C3Q A;  2LS5 A;  5D9W A;  4WKW A;  4ISD A;  1WPI A;  2R0G A;  4MNN A;  5ECM B;  5DDL A;  1FB6 A;  4X1U A;  2FLS A;  1TRW A;  2X99 A;  3A5I A;  3E3E A;  3CTF A;  2FGX A;  2PN8 A;  5AIX A;  2WZS A;  2LJR A;  1SL1 B;  4KX4 A;  2DMM A;  1HQO A;  2BJX A;  3QD9 A;  3L9U A;  3ED3 A;  3BCI A;  5FWG A;  3LFL A;  3CQF A;  1UVZ A;  5A5H A;  2HSM B;  1Z3E A;  2I81 A;  4WR5 A;  3TOU A;  4TR1 B;  2H01 A;  1XVW A;  3I6A A;  5JWO B;  4WF5 A;  2HXK A;  3RPP A;  3GKM A;  5GAN D;  4L5L A;  4IS0 A;  1K0D A;  4IW9 A;  4X43 A;  2H66 A;  1B4Q A;  1FVK A;  1R5P A;  1Z5Y E;  2HSY A;  3M3M A;  2B1K A;  4USS A;  3APS A;  3VWV A;  4D73 B;  1UN2 A;  5H5S A;  2HZE A;  1WJK A;  2HRK B;  1N25 A;  4PQ1 A;  5J9B A;  2H6Z A;  2E2G A;  3RAZ A;  4K0G A;  1GSD A;  5CYY A;  2QSI A;  4OFM A;  1U6T A;  4W66 A;  1M0U A;  4YAV A;  3EVI A;  4POL A;  5EPF A;  3IE3 A;  3UBL A;  4KCA A;  1CQG A;  2AV4 A;  1USB A;  4Q5Q A;  5J40 A;  1XZO A;  4F2I A;  4KA0 A;  4J2F A;  2XPD A;  1ZYN A;  4QQ7 A;  2VCW A;  1YVL A;  2LUS A;  1O73 A;  2F3M A;  3G9B A;  4K7N A;  2EIR A;  3H4K A;  1THO A;  4E8H A;  2GDR A;  1MEK A;  2VCV A;  4I2U A;  1ZGN A;  5ELA A;  4E8E A;  5IM9 A;  2L6D A;  2H1B A;  1DBY A;  5J4Y A;  2AB6 A;  3DD3 A;  4ZBA A;  2XHF A;  4K0N A;  4TXO B;  3L9V A;  3ZFB A;  5HR2 A;  1RK4 A;  4HDE A;  5A4U A;  2Z9S A;  4ACS A;  1EGO A;  3DGQ A;  1JFU A;  3ISO A;  1SD9 A;  4KND A;  2AAW A;  5J41 A;  2F51 A;  2A4V A;  2TIR A;  1SK0 A;  2M46 A;  3M1G A;  3TKP A;  5J9C A;  1GTI A;  3TUE A;  1EEM A;  3DYR A;  4JBB A;  2VD1 A;  1ACV A;  1MDK A;  1R26 A;  3P2A A;  5IMV A;  2H75 A;  2QKE A;  5J47 A;  1I9D A;  3GKN A;  1XVQ A;  1OE7 A;  1YY7 A;  3HYP A;  5J3R A;  4BL7 B;  1TK8 B;  1WOU A;  4QL7 A;  5JCW A;  2O36 A;  1XBS A;  1A0R P;  1F37 A;  3WGX A;  5D9X A;  1F2E A;  1TRS A;  2MMZ A;  1TU8 A;  3QPM A;  4POB A;  2LQO A;  5HFK A;  3DML A;  1S3C A;  1SKR B;  1EV4 A;  3GA4 A;  2DJ2 A;  5CP1 A;  3HZ4 A;  4G9H A;  5AGY A;  4NHZ A;  1X9S B;  1QXH A;  2KP1 A;  4A5P A;  1RQM A;  5BMU B;  1SYX A;  4L8E A;  3HKR A;  5J4U A;  2HT9 A;  1QFN A;  1OAZ A;  1YKC A;  1V57 A;  3TJK A;  5ECH B;  4HSC X;  1YEP A;  3WT1 A;  4K2X A;  5INY A;  5F07 A;  2H1D A;  3IC8 A;  2CVD A;  2PUK C;  1GSY A;  5B6M A;  2MMA A;  3DKS A;  2GQL A;  3QAV A;  2HRK A;  4EDZ A;  1A2J A;  3KM6 A;  3FW2 A;  4IHU A;  2DJ1 A;  22GS A;  1G6Y A;  4NHW A;  4V1A p;  3GTU B;  2GVP A;  4L0U A;  2LKU A;  3ZIV A;  2MZC A;  1OC9 A;  1T1V A;  5DCH A;  2AUV A;  2C4J A;  1AQW A;  3BJ5 A;  3CWG A;  5JWR B;  2OKA A;  3FZ5 A;  1BYE A;  4FIW A;  4IEL A;  1ABA A;  3APQ A;  14GS A;  3BOA A;  1M3I A;  2I3Y A;  3QFB C;  2JZR A;  4Z2R A;  2H72 A;  3GFK A;  1XIY A;  5F8B A;  1XWG A;  4JU5 A;  4O5Q A;  1WP0 A;  4MZC A;  2VL2 A;  3TJJ A;  2OAC A;  4MZW A;  1Q4J A;  5E4W A;  2HE3 A;  4YQV A;  4ZIL A;  2LNS A;  3CSH A;  3W6G A;  1QGV A;  4NPB A;  1TK5 B;  2O89 A;  2WVY A;  1T4Y A;  3H8Q A;  2E0Q A;  3IXR A;  3BD2 A;  1U3I A;  1A0F A;  1TI1 A;  5FT3 A;  2DJ3 A;  2B5X A;  3D6I A;  2LV3 A;  5E59 A;  3FZA A;  2WGR A;  3RGB C;  4I2T A;  1GTU A;  4MF5 A;  1N2A A;  4GSS A;  2H71 A;  5DAL A;  13GS A;  2OE1 A;  2LJK A;  4I5Q A;  2ON5 A;  1B9Y C;  4E68 A;  4F0B A;  3WYW A;  1XWC A;  7GSS A;  3TRQ A;  4I8B A;  4LL1 B;  4OMV A;  4WXT A;  2EC4 A;  2WDU A;  5KN3 A;  4BL7 A;  4IP6 A;  4G0I A;  4DVC A;  1GUK A;  2DJ0 A;  2HRF A;  1TW9 A;  1DE2 A;  2O85 A;  4EXJ A;  1ERU A;  3PGT A;  3UEM A;  3CYN A;  4MH3 A;  5GZZ B;  2G0F A;  5KN0 A;  3HJO A;  2WW1 A;  2CA8 A;  4MP4 A;  17GS A;  2PVQ A;  5ECN B;  4IKH A;  4AKG A;  3IDV A;  2HFD A;  5H5Q A;  2I9H A;  3ZIT A;  5G1L A;  1G7E A;  5BMU A;  4V2N A;  3VK9 A;  2FWF A;  4GQF A;  5IOW A;  4WBR D;  4X4J A;  4LLR A;  4MDC A;  3VWX A;  4RUV A;  3GHA A;  2R37 A;  1M9B A;  4ECC A;  3FMW A;  2L59 A;  1GRX A;  2WW3 A;  4WF4 A;  2X8C A;  5ENU A;  3HCZ A;  5IIZ A;  5IQY A;  4GWR A;  1YQ1 A;  1OC8 A;  4YQU A;  2JAD A;  2B1L A;  3GTU A;  4MPF A;  1PFO A;  4G0K A;  5G5F A;  4O5U A;  3F4S A;  4V2L A;  3GKX A;  1ZL9 A;  4FH8 A;  1YEX A;  3MYD A;  4GSN A;  3TKS C;  1XWK A;  3UOM A;  3I69 A;  3ZYW A;  4XIH A;  1B48 A;  2F8F A;  2J23 A;  4FYU A;  1K0N A;  3RDW A;  1G7O A;  6GST A;  3KMN A;  1GSF A;  3IV4 A;  5JCU A;  3UMA A;  5ID2 A;  3GYK A;  2B6M A;  1TRV A;  4IP1 A;  1GLP A;  4WBJ A;  3HA9 A;  3LSZ A;  2RM6 A;  1ZMA A;  1VF3 A;  2NVL A;  2NTO A;  3EU3 A;  3AY8 A;  9GSS A;  5EL8 A;  3LYP A;  2OBI A;  3ZVJ A;  3L9S A;  2DIY A;  3KD0 A;  3GMF A;  2OAD A;  1E6B A;  4TRX A;  4GLT A;  2RUE A;  2VM1 A;  2IMD A;  5HR1 A;  4MJA A;  4F0C A;  2VUP A;  2PPT A;  3IPZ A;  4AJ7 A;  3NOF A;  1LJR A;  3L0H A;  3G7I A;  2KHP A;  1F3B A;  5IMZ A;  3DRN A;  3ME7 A;  2BTO T;  3LEF A;  3D22 A;  3TKS A;  1LU4 A;  2WVZ A;  5KOX A;  1TXX A;  2C1Y A;  4LMV A;  2HRA A;  3KEB A;  4KUN A;  2K8V A;  1X9W B;  5HQP A;  2WW2 A;  4NV2 A;  4EUY A;  2V1M A;  2YWN A;  4XS4 A;  4RQR A;  3KZQ A;  4WR4 A;  2JZT A;  1HD2 A;  2RLI A;  2MMN A;  1F3A A;  2LRC A;  1PKZ A;  4YQM A;  1XOA A;  5HR0 A;  2GGT A;  1BF5 A;  4ILF A;  4MJE A;  2ZNM A;  1K3Y A;  5D9V A;  6GSW A;  1XPV A;  4EVM A;  2EFH A;  2QC7 A;  4MF7 A;  3D0Z A;  2NPB A;  3KP8 A;  1I1I P;  5ELG A;  2PER A;  4TKY A;  4KDX A;  4G10 A;  3O76 A;  3LG6 A;  1VF2 A;  4O92 A;  4N0Z A;  2GSS A;  2EIQ A;  1GUM A;  6GSV A;  3MSZ A;  2XBI A;  1K0A A;  3ZTL A;  4BVX A;  1EV9 A;  4H86 A;  3VLN A;  4Q5R A;  2H73 A;  1SK2 A;  1M3J A;  4ZL9 A;  3GH9 A;  1O81 A;  3TJB A;  1VF4 A;  4FXY P;  3SWL A;  1U88 A;  3GL5 A;  4ZIJ A;  5ABR A;  4ECI A;  5IPH A;  2PU9 C;  1YZX A;  2I1U A;  2EFD A;  5HR3 A;  1XG8 A;  1XW6 A;  4RQX A;  4GRF A;  1M2D A;  1DE1 A;  4HUA A;  2YWM A;  1ERT A;  1AAZ A;  3F4T A;  1HNC A;  2HSN A;  5A34 A;  3E0U A;  3P7X A;  4DSS B;  1BG1 A;  1YJ6 A;  2O3E A;  2PWJ A;  4DSR A;  4ZB7 A;  1PQN A;  5COH A;  1UC7 A;  5HFI A;  4QMK A;  1Z7P A;  3GSS A;  3QR6 A;  2DJK A;  2IMI A;  2H74 A;  3UAP A;  3L4N A;  1VGL A;  2LTK A;  2H19 A;  5A4W A;  3DEX A;  3I43 A;  4KH7 A;  3A5W A;  4F03 A;  3IC4 A;  5A5K A;  3ZML A;  2EFC A;  2H0H A;  4N30 A;  1S4B P;  2IMK A;  2VLT A;  4PUR A;  2B3S A;  4TOP A;  1NM3 A;  1TTZ A;  3EU4 A;  2IL3 A;  3IOS A;  4XS6 A;  4N10 A;  1T7P B;  3M8N A;  4CW9 A;  3TRX A;  3HDC A;  1N8J A;  4PGT A;  1RW1 A;  2L5O A;  2ALB A;  2IFQ B;  3LGC A;  1SK1 A;  3ZVJ D;  1GL8 A;  1Z9H A;  3FR6 A;  4G0L A;  5F0G A;  1ZYE A;  20GS A;  4G01 A;  3VPT A;  3D21 A;  1SVO A;  3N9J A;  2WVX B;  1B8X A;  1XWA A;  5ECL B;  4AF2 A;  3ZRD A;  5ECR B;  2FUG 2;  4L5O A;  1MD3 A;  1PSQ A;  3LW9 A;  18GS A;  2IMF A;  3U5R E;  1AUC A;  2FD3 A;  1GTB A;  1TXU A;  5AIV A;  5G30 A;  2JU5 A;  4TR3 A;  3HXS A;  2MYG A;  2RM5 A;  3FRC A;  1GSS A;  1M2A A;  2F9S A;  3TB2 A;  3TDG A;  5ECP B;  5EY6 A;  4KSM A;  2VAF A;  1ZOF A;  3FZ4 A;  1OVN A;  2JL4 A;  1WRY A;  3M9J A;  5DBQ A;  3MIX A;  5A1N B;  6GSY A;  2X8G A;  1SKW B;  5LD0 A;  3TJG A;  2CQ9 A;  2H30 A;  5KEJ A;  3VWW A;  5D93 A;  2OE0 A;  4TR4 A;  2WRT A;  4HJM A;  3L78 A;  4XRA A;  2WCI A;  5B6N A;  3MDK A;  2J9H A;  1A8Y A;  4IBP A;  16GS A;  2WUL A;  3W8S A;  12GS A;  4XRD A;  4MPG A;  1NHO A;  3IBH A;  1VF1 A;  1ON4 A;  3UJ1 A;  2HZF A;  2C8U A;  2KLX A;  2HSM A;  4IQA A;  4OFT A;  4K6X A;  2VL2 C;  1VRS D;  4TR1 A;  2IWT A;  2VM2 A;  1EGR A;  1JZO A;  4YKF A;  1MD4 A;  4GCI A;  1TKD B;  4MZB A;  3CBU A;  3Q19 A;  2CZ2 A;  4ZL8 A;  1T3B A;  4POK A;  2FY6 A;  4NMU A;  2CV4 A;  2DKI A;  4IN0 A;  3PR8 A;  4Z2U A;  1BQ7 A;  2X49 A;  2YWO A;  3R3E A;  1UA5 A;  3VI7 A;  4PHZ C;  4D73 A;  2VLV A;  3FHK A;  2YZU A;  1JHB A;  2IN3 A;  4CDO A;  3F4R A;  4Q5F A;  1HNB A;  1AQV A;  2KUC A;  2L4C A;  2R2J A;  2VL9 A;  3IHG A;  2GLR A;  4BWQ A;  5D96 A;  5GSS A;  1YF1 A;  4EKZ A;  3UVT A;  3EC3 A;  2DJJ A;  1R7H A;  3UAR A;  1XCC A;  10GS A;  4JR4 A;  1OC3 A;  5CO3 A;  5A4V A;  1O6J A;  3MNG A;  4I6X A;  3ZMK A;  4DSS A;  1K0O A;  2PMT A;  1A24 A;  5L71 A;  1FHE A;  1SVL A;  5F06 A;  5CAX A;  4TR0 A;  1SVM A;  2GSQ A;  5KN2 A;  5DAK B;  2YV7 A;  4KGI A;  4MA9 A;  3US3 A;  1PX6 A;  3W8J A;  3RPN A;  3ZRE A;  1T4Z A;  2C0G A;  3ERG A;  1Z6N A;  4WET A;  4TXO A;  3UVH A;  3MWH A;  1R4W A;  1SJZ A;  4PQH A;  1X5C A;  2C0F A;  2LST A;  3LOR A;  2HNL A;  2B7K A;  2R0P A;  4KDY A;  4PI0 C;  1ST9 A;  4BVY B;  3KMO A;  3VPQ A;  4ZBD A;  2JSZ A;  3K8N A;  4PNF A;  2DSA A;  4CHS A;  4RI7 A;  1A2L A;  2WVX A;  1NSW A;  3LYK A;  1SL0 B;  2A2R A;  5IO0 A;  1GSQ A;  1TDI A;  1EP8 A;  2RUF A;  1SEN A;  2ZCT A;  2ZUP A;  1O7U A;  1S3D A;  2IIY A;  1BJX A;  1C72 A;  3EYT A;  2WJU A;  1Y1U A;  4IJI A;  3F6D A;  1CQH A;  5DQY A;  4K2D A;  1URM A;  5CNW A;  3NZN A;  4TN8 A;  4MMM A;  5IMD A;  4V2M A;  4ZXG A;  2L5L A;  2FNO A;  3ZLP A;  2HRN A;  3HVN A;  1TJD A;  5DJM A;  2K9F A;  3GKK A;  1DSB A;  3JCM L;  2C0D A;  4AJ6 A;  4EO3 A;  3EMP A;  4CY8 A;  4MAB A;  5IMC A;  4PI2 C;  6GSX A;  2H70 A;  1GWC A;  4Q5N A;  2C3T A;  1SYR A;  4QL9 A;  4ULX A;  1FOH A;  2P5R A;  2VCZ A;  4AKH A;  1A2M A;  3RHB A;  2L57 A;  1I5G A;  4ECB A;  1X5D A;  2CX4 A;  2HLS A;  2FWH A;  2DC5 A;  1GUH A;  1K0C A;  5G31 A;  3WGE A;  3WGD A;  1DUG A;  5DCG A;  1ILO A;  3BCK A;  1SJ6 A;  4GTU A;  4JE1 A;  3IR4 A;  2WFC A;  1V9W A;  2L4Q A;  4F82 A;  2HQT A;  2O8V B;  2V6O A;  4PUA A;  1FW1 A;  5DJL A;  2YJH A;  4PUF C;  4V1A g;  4ZL7 A;  3UBK A;  5CRW A;  2OA7 A;  4HQZ A;  4NXI A;  4DSQ A;  2FWE A;  1ERW A;  4BIK A;  1JZD A;  3LWA A;  3CSI A;  3ERF A;  2UV8 G;  3KH9 A;  2OT3 A;  3C71 A;  2M72 A;  4FYC A;  4GDF A;  1KTE A;  1LBK A;  6GSU A;  2GQM A;  3APO A;  3GIX A;  3HZ8 A;  5JWQ B;  3HVV A;  2AYT A;  5D8I A;  1SU9 A;  2B5E A;  2YAN A;  3EUR A;  2I4A A;  4OO4 A;  4HI7 A;  3TKS E;  1EOH A;  2DLX A;  3CRU A;  1TU7 A;  1H75 A;  2LEG A;  4PQI A;  4LA1 A;  3IK7 A;  1O8W A;  2KOK A;  4XS1 A;  3EWL A;  2K6V A;  3DIE A;  1M7T A;  3IHQ A;  3HMJ G;  1YEW C;  3P8W A;  1T00 A;  2G2Q A;  1PN9 A;  1JLV A;  4KF9 A;  5G2Z A;  4YAP A;  4MJC A;  3VFI A;  2YP6 A;  1H4O A;  4KSO A;  4KAE A;  2LJA A;  3EPT A;  3KP9 A;  4HZ2 A;  3V1W A;  3C7M A;  1GNE A;  2GST A;  5D73 A;  4ZB6 A;  5C00 A;  5ECS A;  2VD0 A;  2IJY A;  4K9Z A;  19GS A;  1WMJ A;  4BWS A;  4PNG A;  3FY7 A;  2GT6 A;  3PIN A;  1MDI A;  2QA1 A;  3TJF A;  3S9F A;  1GTA A;  1S3R A;  3F3R A;  3O3T A;  2CZ3 A;  2AJQ B;  1BX9 A;  1PKW A;  2H8L A;  4IQ1 A;  3GNJ A;  5IOX A;  2YPM A;  2P5Q A;  5KOW A;  4XHM A;  1ZYP A;  2VL3 A;  4BPY A;  3VWU A;  3D5J A;  3C8E A;  1A8L A;  5ECI B;  2REM A;  2C0E A;  4GXZ A;  2YV9 A;  3HVS A;  1O85 A;  3CSJ A;  3VI5 A;  3ZIJ A;  2QGV A;  1GSU A;  1KNG A;  2VCQ A;  2CVK A;  3GV1 A;  1ERV A;  2V6K A;  3BBY A;  2VO4 A;  2X8H A;  1AC1 A;  5FHI A;  3O6T A;  4MLY A;  3DWV A;  5C04 A;  1A23 A;  1KEB A;  1GP1 A;  2X64 A;  4ECJ A;  2JAC A;  3KJY A;  3F0I A;  3ME8 A;  4BA7 A;  4K7O A;  2GZP A;  3G7J A;  5HFG A;  3CMI A;  4MJB A;  3EMX A;  4HS1 A;  1TRU A;  2FCH A;  8GSS A;  3C1S A;  4LMW A;  3H1N A;  3IRA A;  2AHE A;  1SKS B;  2LRT A;  3ZFL A;  5ECQ B;  2VKZ G;  3WD6 A;  3E9J B;  3KTB A;  1QMV A;  1NHY A;  1K3L A;  3GRX A;  3F8U A;  3A2V A;  3GH6 A; 
#chains in the Genus database with same CATH homology
 1K3O A;  4AJ8 A;  3GUS A;  4FYB A;  2HYX A;  2JSY A;  1PA3 A;  1TP9 A;  2GZZ A;  3PH9 A;  5IMA A;  1M2B A;  2H1G A;  4JZQ A;  3DVW A;  3KIJ A;  3Q74 A;  1AXD A;  4HU9 A;  3FZ9 A;  4EDY A;  3KGK A;  2KP2 A;  2R4V A;  3P90 A;  2FWG A;  3RBT A;  3DVX A;  1U87 A;  3Q18 A;  3A2X A;  4L0W A;  2VCT A;  3HVX A;  1KBN A;  1OC9 B;  1FVJ A;  1AW9 A;  1OE8 A;  3IAM 2;  1Y25 A;  2PGT A;  2H0G A;  4HJ2 A;  4IGJ A;  3F9U A;  3IAS 2;  3FR3 A;  4K8M A;  3M9K A;  2YWI A;  1TI3 A;  1QK8 A;  3TRP A;  1TOF A;  3KXO A;  1XW9 A;  4JR6 A;  1R5A A;  4XTS A;  1PN0 A;  4NWY A;  1SD8 A;  3N5O A;  1XOB A;  2MBS A;  3TKR A;  2E2M A;  3HD5 A;  3H93 A;  4J57 E;  4F9Z A;  4NAX A;  3LXZ A;  2DBC A;  2H6Y A;  2XPE A;  4EIP A;  2OJL A;  2RII A;  2BMX A;  2CT6 A;  1J0F A;  1THX A;  1WE0 A;  1Y6E A;  5F05 A;  1OKD A;  1SJI A;  3J7Y k;  1FB0 A;  1JZR A;  1WIK A;  4EIQ A;  2CVB A;  1T8E B;  3KH7 A;  1ML6 A;  2GSR A;  2TRC P;  1V40 A;  3HJM A;  1B9X C;  3C73 A;  2ES7 A;  2GTU A;  3F3Q A;  4EC0 A;  3EE2 A;  4N11 A;  4GST A;  4EL1 A;  1FAA A;  2R3X A;  1GNW A;  2D2Z A;  1XXU A;  3WT2 A;  5DAL B;  1M99 A;  1BAY A;  5B7C A;  1EWX A;  4ICY A;  2B5Y A;  2GQK A;  4GQC A;  1GSE A;  1MDJ A;  1Z7R A;  1IYI A;  5G5E A;  1AQX A;  3MAK A;  2VIM A;  3F63 A;  1OKT A;  4HZ4 A;  4MK3 A;  1J08 A;  2MBT A;  5EVO A;  1S3A A;  2PBJ A;  5G1K A;  3LQ7 A;  4EE0 A;  4N3Z A;  4N0V A;  4FQU A;  2F8A A;  2LRN A;  4POM A;  1WWJ A;  2WZ9 A;  3GX0 A;  3OR5 A;  2X4A A;  3VUR A;  1O8X A;  2VCX A;  1V98 A;  1HNA A;  2H0I A;  4HU7 A;  3I9V 2;  2YNX A;  3H79 A;  3CXG A;  3QAW A;  4IVF A;  3NIV A;  4ML6 A;  2CAQ A;  3EIN A;  3GN3 A;  5B8B A;  1FOV A;  2A2S A;  2P31 A;  5J5N A;  3A2W A;  3J7Y b;  1K0B A;  3TKQ A;  3KCM A;  1X9M B;  5D9T A;  2H76 A;  2LNT A;  1J9B A;  2YOI A;  5ECK B;  1EZK A;  3GX8 A;  4OD7 A;  1ZZY A;  5IMF A;  2OBK A;  3R2Q A;  3FEU A;  3QAG A;  3TU3 B;  2DKH A;  1YF0 A;  5B8A A;  1TK0 B;  4JED A;  3F6F A;  1AIU A;  2B7J A;  4FO5 A;  1OYJ A;  2L6C A;  1FO5 A;  4Z2T A;  3IA1 A;  2EIO A;  4OCF A;  2VOC A;  3LXT A;  1BED A;  5ID2 B;  1PRX A;  2H6X A;  1B4P A;  4I97 A;  2HI7 A;  3GUR A;  2WS2 A;  1XW5 A;  4ZB9 A;  2N5F A;  4X0X A;  2LQQ A;  2IFQ A;  2GS3 A;  3QFA C;  3DXB A;  4P3Y B;  4K5S A;  2C80 A;  2JZS A;  1EEJ A;  4ZBB A;  4OCE A;  5JCG A;  4HQS A;  5CRH A;  2A4H A;  4CY6 A;  2IPA A;  3D4T A;  4K5R A;  5CRE A;  1NW2 A;  3ZZX A;  3TGZ A;  2WB9 A;  4WEY A;  1F6M C;  2YZH A;  5AIS A;  3FYG A;  2K8S A;  4HOJ A;  2P0G A;  3GST A;  5GAP D;  5AN1 A;  1YKA A;  2V2G A;  1SL2 B;  3D4M A;  4AKI A;  2QA2 A;  1PL2 A;  4K1F A;  2YJ7 A;  3HY2 A;  1PGT A;  3FKF A;  1HYU A;  4OO5 A;  3A3T A;  4MF6 A;  2OE3 A;  5A1N A;  4XCS A;  1V58 A;  1G6W A;  2EFE A;  4PTS A;  1Z6M A;  1MTC A;  4KDU A;  3HHV A;  4XS4 B;  1JLW A;  4YKG A;  4PX1 A;  1IYH A;  2MMO A;  2VLU A;  4KE3 A;  2DML A;  2NBS A;  2FHE A;  4TW5 A;  2N5B A;  3C1R A;  5LCZ A;  1ZCP A;  1GLQ A;  4AI6 A;  4OFN A;  4O5R A;  1PL1 A;  4GF0 A;  2HSH A;  3UL3 A;  4DEJ A;  5A5H B;  3FR9 A;  2E7P A;  4YH2 A;  5GST A;  1XFL A;  2GZY A;  1X0R A;  4O7H A;  4TVE A;  2XC2 A;  4KW6 A;  4HEA 2;  5BRT A;  1U3A A;  4G2E A;  5ECO B;  3ZL5 A;  2O7K A;  3LJR A;  3ERW A;  4TXV A;  2K18 A;  1F9M A;  4BVX B;  3TOT A;  4K7I A;  1K0M A;  4JRR A;  2GT5 A;  3M0F A;  2FA8 A;  2NDO A;  2HZE B;  1EP7 A;  1E2Y A;  4NV5 A;  1QUW A;  2H1L A;  3HJP A;  2DIZ A;  3G7Y A;  11GS A;  2CAI A;  1G0T A;  2N5A A;  5J4V A;  3RHC A;  2PVO C;  5DVB A;  1GH2 A;  1YDK A;  1W4V A;  1XWB A;  3QDN A;  1EOG A;  3IK9 A;  5IO2 A;  5H5R A;  2HSN B;  5A34 B;  5DAK A;  3QMX A;  1GUL A;  1X5E A;  2IME A;  4G19 A;  5KN1 A;  4LL4 B;  2YCD A;  2ON7 A;  1QQ2 A;  5CRG A;  3CTG A;  3FK8 A;  4AGS A;  2M80 A;  2TRX A;  3KTL A;  2XBQ A;  3TCO A;  4EF0 A;  3QOU A;  4J56 E;  2V41 A;  4MH2 A;  2YN1 A;  5IPG A;  2O87 A;  2O5V A;  3U6V A;  3UIW A;  1FG4 A;  1BG5 A;  1JZW A;  2A2P A;  4PXO A;  5CRD A;  4KCE A;  2H1A A;  3Q6O A;  1ZYQ B;  2V32 A;  4KB3 A;  4IJ3 A;  4MCU A;  2R5G A;  4BVY A;  1PX7 A;  1M9A A;  2R0C A;  1Q98 A;  3SBC A;  4Z7X A;  5LNK e;  1PD2 1;  4O32 A;  2UZ8 A;  4RI6 A;  5DQS A;  1V2A A;  2FA4 A;  6GSS A;  2C3N A;  4ZB8 A;  3GL3 A;  4ID0 A;  3QCP A;  3CRT A;  1PMT A;  3PPU A;  2CX3 A;  1W89 A;  4ML1 A;  4AKX B;  4OWY A;  2R6K A;  2C3Q A;  2LS5 A;  5D9W A;  4WKW A;  4ISD A;  1WPI A;  2R0G A;  4MNN A;  5ECM B;  5DDL A;  1FB6 A;  4X1U A;  2FLS A;  1TRW A;  2X99 A;  3A5I A;  3E3E A;  3CTF A;  2FGX A;  2PN8 A;  5AIX A;  2LJR A;  1SL1 B;  4KX4 A;  2DMM A;  1HQO A;  2BJX A;  3QD9 A;  3L9U A;  3ED3 A;  3BCI A;  5FWG A;  3LFL A;  1UVZ A;  5A5H A;  2HSM B;  1Z3E A;  2I81 A;  4WR5 A;  3TOU A;  4TR1 B;  2H01 A;  1XVW A;  3I6A A;  5JWO B;  4WF5 A;  2HXK A;  3RPP A;  3GKM A;  5GAN D;  4L5L A;  4IS0 A;  1K0D A;  4IW9 A;  4X43 A;  2H66 A;  1B4Q A;  1FVK A;  1R5P A;  1Z5Y E;  2HSY A;  3M3M A;  2B1K A;  4USS A;  3APS A;  3VWV A;  4D73 B;  1UN2 A;  5H5S A;  2HZE A;  1WJK A;  2HRK B;  1N25 A;  4PQ1 A;  5J9B A;  2H6Z A;  2E2G A;  3RAZ A;  4K0G A;  1GSD A;  5CYY A;  2QSI A;  4OFM A;  1U6T A;  4W66 A;  1M0U A;  4YAV A;  3EVI A;  4POL A;  5EPF A;  3IE3 A;  3UBL A;  4KCA A;  1CQG A;  2AV4 A;  1USB A;  4Q5Q A;  5J40 A;  1XZO A;  4F2I A;  4KA0 A;  4J2F A;  2XPD A;  1ZYN A;  4QQ7 A;  2VCW A;  1YVL A;  2LUS A;  1O73 A;  2F3M A;  3G9B A;  4K7N A;  2EIR A;  3H4K A;  1THO A;  4E8H A;  2GDR A;  1MEK A;  2VCV A;  4I2U A;  1ZGN A;  5ELA A;  4E8E A;  5IM9 A;  2L6D A;  2H1B A;  1DBY A;  5J4Y A;  2AB6 A;  3DD3 A;  4ZBA A;  2XHF A;  4K0N A;  4TXO B;  3L9V A;  3ZFB A;  5HR2 A;  1RK4 A;  4HDE A;  5A4U A;  2Z9S A;  4ACS A;  1EGO A;  3DGQ A;  1JFU A;  3ISO A;  1SD9 A;  4KND A;  2AAW A;  5J41 A;  2F51 A;  2A4V A;  2TIR A;  1SK0 A;  2M46 A;  3M1G A;  3TKP A;  5J9C A;  1GTI A;  3TUE A;  1EEM A;  3DYR A;  4JBB A;  2VD1 A;  1ACV A;  1MDK A;  1R26 A;  3P2A A;  5IMV A;  2H75 A;  2QKE A;  5J47 A;  1I9D A;  3GKN A;  1XVQ A;  1OE7 A;  1YY7 A;  3HYP A;  5J3R A;  4BL7 B;  1TK8 B;  1WOU A;  4QL7 A;  5JCW A;  1XBS A;  1A0R P;  1F37 A;  3WGX A;  5D9X A;  1F2E A;  1TRS A;  2MMZ A;  1TU8 A;  3QPM A;  4POB A;  2LQO A;  5HFK A;  3DML A;  1S3C A;  1SKR B;  1EV4 A;  3GA4 A;  2DJ2 A;  5CP1 A;  3HZ4 A;  4G9H A;  5AGY A;  4NHZ A;  1X9S B;  1QXH A;  2KP1 A;  4A5P A;  1RQM A;  5BMU B;  1SYX A;  4L8E A;  3HKR A;  5J4U A;  2HT9 A;  1QFN A;  1OAZ A;  1YKC A;  1V57 A;  3TJK A;  5ECH B;  1YEP A;  3WT1 A;  4K2X A;  5INY A;  5F07 A;  2H1D A;  3IC8 A;  2CVD A;  2PUK C;  1GSY A;  5B6M A;  2MMA A;  3DKS A;  2GQL A;  3QAV A;  2HRK A;  4EDZ A;  1A2J A;  3KM6 A;  3FW2 A;  4IHU A;  2DJ1 A;  22GS A;  1G6Y A;  4NHW A;  4V1A p;  3GTU B;  2GVP A;  4L0U A;  2LKU A;  3ZIV A;  2MZC A;  1OC9 A;  1T1V A;  5DCH A;  2AUV A;  2C4J A;  1AQW A;  3BJ5 A;  3CWG A;  5JWR B;  2OKA A;  3FZ5 A;  1BYE A;  4FIW A;  4IEL A;  1ABA A;  3APQ A;  14GS A;  3BOA A;  2I3Y A;  3QFB C;  2JZR A;  4Z2R A;  2H72 A;  3GFK A;  1XIY A;  5F8B A;  1XWG A;  4JU5 A;  4O5Q A;  1WP0 A;  4MZC A;  2VL2 A;  3TJJ A;  2OAC A;  4MZW A;  1Q4J A;  5E4W A;  2HE3 A;  4YQV A;  4ZIL A;  2LNS A;  3CSH A;  3W6G A;  1QGV A;  4NPB A;  1TK5 B;  2O89 A;  1T4Y A;  3H8Q A;  2E0Q A;  3IXR A;  3BD2 A;  1U3I A;  1A0F A;  1TI1 A;  5FT3 A;  2DJ3 A;  2B5X A;  3D6I A;  2LV3 A;  5E59 A;  3FZA A;  2WGR A;  4I2T A;  1GTU A;  4MF5 A;  1N2A A;  4GSS A;  2H71 A;  5DAL A;  13GS A;  2OE1 A;  2LJK A;  4I5Q A;  2ON5 A;  1B9Y C;  4E68 A;  4F0B A;  3WYW A;  1XWC A;  7GSS A;  3TRQ A;  4I8B A;  4LL1 B;  4OMV A;  4WXT A;  2EC4 A;  2WDU A;  5KN3 A;  4BL7 A;  4IP6 A;  4G0I A;  4DVC A;  1GUK A;  2DJ0 A;  2HRF A;  1TW9 A;  1DE2 A;  2O85 A;  4EXJ A;  1ERU A;  3PGT A;  3UEM A;  3CYN A;  4MH3 A;  5GZZ B;  2G0F A;  5KN0 A;  3HJO A;  2CA8 A;  4MP4 A;  17GS A;  2PVQ A;  5ECN B;  4IKH A;  4AKG A;  3IDV A;  2HFD A;  5H5Q A;  2I9H A;  3ZIT A;  5G1L A;  1G7E A;  5BMU A;  4V2N A;  3VK9 A;  2FWF A;  4GQF A;  5IOW A;  4WBR D;  4X4J A;  4LLR A;  4MDC A;  3VWX A;  4RUV A;  3GHA A;  2R37 A;  1M9B A;  4ECC A;  3FMW A;  2L59 A;  1GRX A;  4WF4 A;  2X8C A;  5ENU A;  3HCZ A;  5IIZ A;  5IQY A;  4GWR A;  1YQ1 A;  1OC8 A;  4YQU A;  2JAD A;  2B1L A;  3GTU A;  4MPF A;  4G0K A;  5G5F A;  4O5U A;  3F4S A;  4V2L A;  3GKX A;  1ZL9 A;  4FH8 A;  1YEX A;  3MYD A;  4GSN A;  3TKS C;  1XWK A;  3UOM A;  3I69 A;  3ZYW A;  4XIH A;  1B48 A;  2F8F A;  2J23 A;  4FYU A;  1K0N A;  3RDW A;  1G7O A;  6GST A;  3KMN A;  1GSF A;  3IV4 A;  5JCU A;  3UMA A;  5ID2 A;  3GYK A;  2B6M A;  1TRV A;  4IP1 A;  1GLP A;  4WBJ A;  3HA9 A;  3LSZ A;  2RM6 A;  1ZMA A;  1VF3 A;  2NVL A;  2NTO A;  3EU3 A;  3AY8 A;  9GSS A;  5EL8 A;  3LYP A;  2OBI A;  3ZVJ A;  3L9S A;  2DIY A;  3KD0 A;  3GMF A;  2OAD A;  1E6B A;  4TRX A;  4GLT A;  2RUE A;  2VM1 A;  2IMD A;  5HR1 A;  4MJA A;  4F0C A;  2VUP A;  2PPT A;  3IPZ A;  4AJ7 A;  3NOF A;  1LJR A;  3L0H A;  3G7I A;  2KHP A;  1F3B A;  5IMZ A;  3DRN A;  3ME7 A;  2BTO T;  3LEF A;  3D22 A;  3TKS A;  1LU4 A;  5KOX A;  1TXX A;  2C1Y A;  4LMV A;  2HRA A;  3KEB A;  4KUN A;  2K8V A;  1X9W B;  5HQP A;  4NV2 A;  4EUY A;  2V1M A;  2YWN A;  4XS4 A;  4RQR A;  3KZQ A;  4WR4 A;  2JZT A;  1HD2 A;  2RLI A;  2MMN A;  1F3A A;  2LRC A;  1PKZ A;  4YQM A;  1XOA A;  5HR0 A;  2GGT A;  1BF5 A;  4ILF A;  4MJE A;  2ZNM A;  1K3Y A;  5D9V A;  6GSW A;  1XPV A;  4EVM A;  2EFH A;  2QC7 A;  4MF7 A;  3D0Z A;  2NPB A;  3KP8 A;  5ELG A;  2PER A;  4TKY A;  4KDX A;  4G10 A;  3O76 A;  3LG6 A;  1VF2 A;  4O92 A;  4N0Z A;  2GSS A;  2EIQ A;  1GUM A;  6GSV A;  3MSZ A;  2XBI A;  1K0A A;  3ZTL A;  4BVX A;  1EV9 A;  4H86 A;  3VLN A;  4Q5R A;  2H73 A;  1SK2 A;  4ZL9 A;  1O81 A;  3GH9 A;  3TJB A;  1VF4 A;  3SWL A;  1U88 A;  3GL5 A;  4ZIJ A;  5ABR A;  4ECI A;  5IPH A;  2PU9 C;  1YZX A;  2I1U A;  2EFD A;  5HR3 A;  1XW6 A;  4RQX A;  4GRF A;  1M2D A;  1DE1 A;  4HUA A;  2YWM A;  1ERT A;  1AAZ A;  3F4T A;  1HNC A;  2HSN A;  5A34 A;  3E0U A;  3P7X A;  4DSS B;  1BG1 A;  1YJ6 A;  2PWJ A;  4DSR A;  4ZB7 A;  1PQN A;  5COH A;  1UC7 A;  5HFI A;  4QMK A;  1Z7P A;  3GSS A;  3QR6 A;  2DJK A;  2IMI A;  2H74 A;  3UAP A;  3L4N A;  1VGL A;  2LTK A;  2H19 A;  5A4W A;  3DEX A;  3I43 A;  4KH7 A;  3A5W A;  4F03 A;  3IC4 A;  5A5K A;  3ZML A;  2EFC A;  2H0H A;  4N30 A;  2IMK A;  2VLT A;  4PUR A;  2B3S A;  4TOP A;  1NM3 A;  1TTZ A;  3EU4 A;  2IL3 A;  3IOS A;  4XS6 A;  4N10 A;  1T7P B;  3M8N A;  4CW9 A;  3TRX A;  3HDC A;  1N8J A;  4PGT A;  1RW1 A;  2L5O A;  2ALB A;  2IFQ B;  3LGC A;  1SK1 A;  3ZVJ D;  1GL8 A;  1Z9H A;  3FR6 A;  4G0L A;  5F0G A;  1ZYE A;  20GS A;  4G01 A;  3VPT A;  3D21 A;  1SVO A;  3N9J A;  1B8X A;  1XWA A;  5ECL B;  4AF2 A;  3ZRD A;  5ECR B;  2FUG 2;  4L5O A;  1MD3 A;  1PSQ A;  3LW9 A;  18GS A;  2IMF A;  3U5R E;  1AUC A;  2FD3 A;  1GTB A;  1TXU A;  5AIV A;  5G30 A;  2JU5 A;  4TR3 A;  3HXS A;  2MYG A;  2RM5 A;  3FRC A;  1GSS A;  1M2A A;  2F9S A;  3TB2 A;  3TDG A;  5ECP B;  5EY6 A;  4KSM A;  2VAF A;  1ZOF A;  3FZ4 A;  1OVN A;  2JL4 A;  1WRY A;  3M9J A;  5DBQ A;  3MIX A;  5A1N B;  6GSY A;  2X8G A;  1SKW B;  5LD0 A;  3TJG A;  2CQ9 A;  2H30 A;  5KEJ A;  3VWW A;  5D93 A;  2OE0 A;  4TR4 A;  2WRT A;  4HJM A;  3L78 A;  4XRA A;  2WCI A;  5B6N A;  3MDK A;  2J9H A;  1A8Y A;  4IBP A;  16GS A;  2WUL A;  3W8S A;  12GS A;  4XRD A;  4MPG A;  1NHO A;  3IBH A;  1VF1 A;  1ON4 A;  3UJ1 A;  2HZF A;  2C8U A;  2KLX A;  2HSM A;  4IQA A;  4OFT A;  4K6X A;  2VL2 C;  1VRS D;  4TR1 A;  2IWT A;  2VM2 A;  1EGR A;  1JZO A;  4YKF A;  1MD4 A;  4GCI A;  1TKD B;  4MZB A;  3CBU A;  3Q19 A;  2CZ2 A;  4ZL8 A;  1T3B A;  4POK A;  2FY6 A;  4NMU A;  2CV4 A;  2DKI A;  4IN0 A;  3PR8 A;  4Z2U A;  1BQ7 A;  2X49 A;  2YWO A;  3R3E A;  1UA5 A;  3VI7 A;  4D73 A;  2VLV A;  3FHK A;  2YZU A;  1JHB A;  2IN3 A;  4CDO A;  3F4R A;  4Q5F A;  1HNB A;  1AQV A;  2KUC A;  2L4C A;  2R2J A;  2VL9 A;  3IHG A;  2GLR A;  4BWQ A;  5D96 A;  5GSS A;  1YF1 A;  4EKZ A;  3UVT A;  3EC3 A;  2DJJ A;  1R7H A;  3UAR A;  1XCC A;  10GS A;  4JR4 A;  1OC3 A;  5CO3 A;  5A4V A;  1O6J A;  3MNG A;  4I6X A;  3ZMK A;  4DSS A;  1K0O A;  2PMT A;  1A24 A;  5L71 A;  1FHE A;  1SVL A;  5F06 A;  5CAX A;  4TR0 A;  1SVM A;  2GSQ A;  5KN2 A;  5DAK B;  2YV7 A;  4KGI A;  4MA9 A;  3US3 A;  1PX6 A;  3W8J A;  3RPN A;  3ZRE A;  1T4Z A;  2C0G A;  3ERG A;  1Z6N A;  4WET A;  4TXO A;  3UVH A;  3MWH A;  1R4W A;  1SJZ A;  4PQH A;  1X5C A;  2C0F A;  2LST A;  3LOR A;  2HNL A;  2B7K A;  2R0P A;  4KDY A;  1ST9 A;  4BVY B;  3KMO A;  3VPQ A;  4ZBD A;  2JSZ A;  3K8N A;  4PNF A;  2DSA A;  4CHS A;  4RI7 A;  1A2L A;  1NSW A;  3LYK A;  1SL0 B;  2A2R A;  5IO0 A;  1GSQ A;  1TDI A;  1EP8 A;  2RUF A;  1SEN A;  2ZCT A;  2ZUP A;  1O7U A;  1S3D A;  2IIY A;  1BJX A;  1C72 A;  3EYT A;  2WJU A;  1Y1U A;  4IJI A;  3F6D A;  1CQH A;  5DQY A;  4K2D A;  1URM A;  5CNW A;  3NZN A;  4TN8 A;  4MMM A;  5IMD A;  4V2M A;  4ZXG A;  2L5L A;  2FNO A;  3ZLP A;  2HRN A;  1TJD A;  5DJM A;  2K9F A;  3GKK A;  1DSB A;  3JCM L;  2C0D A;  4AJ6 A;  4EO3 A;  3EMP A;  4CY8 A;  4MAB A;  5IMC A;  6GSX A;  2H70 A;  1GWC A;  4Q5N A;  2C3T A;  1SYR A;  4QL9 A;  4ULX A;  1FOH A;  2P5R A;  2VCZ A;  4AKH A;  1A2M A;  3RHB A;  2L57 A;  1I5G A;  4ECB A;  1X5D A;  2CX4 A;  2HLS A;  2FWH A;  2DC5 A;  1GUH A;  1K0C A;  5G31 A;  3WGE A;  3WGD A;  1DUG A;  5DCG A;  1ILO A;  3BCK A;  1SJ6 A;  4GTU A;  4JE1 A;  3IR4 A;  2WFC A;  1V9W A;  2L4Q A;  4F82 A;  2HQT A;  2O8V B;  2V6O A;  4PUA A;  1FW1 A;  5DJL A;  2YJH A;  4PUF C;  4V1A g;  4ZL7 A;  3UBK A;  5CRW A;  2OA7 A;  4HQZ A;  4NXI A;  4DSQ A;  2FWE A;  1ERW A;  1JZD A;  3LWA A;  3CSI A;  3ERF A;  2UV8 G;  3KH9 A;  2OT3 A;  3C71 A;  2M72 A;  4FYC A;  4GDF A;  1KTE A;  1LBK A;  6GSU A;  2GQM A;  3APO A;  3GIX A;  3HZ8 A;  5JWQ B;  3HVV A;  2AYT A;  5D8I A;  1SU9 A;  2B5E A;  2YAN A;  3EUR A;  2I4A A;  4OO4 A;  4HI7 A;  3TKS E;  1EOH A;  2DLX A;  3CRU A;  1TU7 A;  1H75 A;  2LEG A;  4PQI A;  4LA1 A;  3IK7 A;  1O8W A;  2KOK A;  4XS1 A;  3EWL A;  2K6V A;  3DIE A;  1M7T A;  3IHQ A;  3HMJ G;  3P8W A;  1T00 A;  2G2Q A;  1PN9 A;  1JLV A;  4KF9 A;  5G2Z A;  4YAP A;  4MJC A;  3VFI A;  2YP6 A;  1H4O A;  4KSO A;  4KAE A;  2LJA A;  3EPT A;  3KP9 A;  4HZ2 A;  3V1W A;  3C7M A;  1GNE A;  2GST A;  5D73 A;  4ZB6 A;  5C00 A;  5ECS A;  2VD0 A;  2IJY A;  4K9Z A;  19GS A;  1WMJ A;  4BWS A;  4PNG A;  3FY7 A;  2GT6 A;  3PIN A;  1MDI A;  2QA1 A;  3TJF A;  3S9F A;  1GTA A;  3F3R A;  3O3T A;  2CZ3 A;  2AJQ B;  1BX9 A;  1PKW A;  2H8L A;  4IQ1 A;  3GNJ A;  5IOX A;  2YPM A;  2P5Q A;  5KOW A;  4XHM A;  1ZYP A;  2VL3 A;  4BPY A;  3VWU A;  3D5J A;  3C8E A;  1A8L A;  5ECI B;  2REM A;  2C0E A;  4GXZ A;  2YV9 A;  3HVS A;  1O85 A;  3CSJ A;  3VI5 A;  3ZIJ A;  2QGV A;  1GSU A;  1KNG A;  2VCQ A;  2CVK A;  3GV1 A;  1ERV A;  2V6K A;  3BBY A;  2VO4 A;  2X8H A;  1AC1 A;  5FHI A;  3O6T A;  4MLY A;  3DWV A;  5C04 A;  1A23 A;  1KEB A;  1GP1 A;  2X64 A;  4ECJ A;  2JAC A;  3KJY A;  3F0I A;  3ME8 A;  4BA7 A;  4K7O A;  2GZP A;  3G7J A;  5HFG A;  3CMI A;  4MJB A;  3EMX A;  4HS1 A;  1TRU A;  2FCH A;  8GSS A;  3C1S A;  4LMW A;  3H1N A;  3IRA A;  2AHE A;  1SKS B;  2LRT A;  3ZFL A;  5ECQ B;  2VKZ G;  3WD6 A;  3E9J B;  3KTB A;  1QMV A;  1NHY A;  1K3L A;  3GRX A;  3F8U A;  3A2V A;  3GH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...