3VLNA

Human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
239
structure length
239
Chain Sequence
GESARSLGKGSAPPGPVPEGSIRIYSMRFSPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase omega-1
publication title Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 239
sequence length 239
ec nomenclature ec 1.20.4.2: Methylarsonate reductase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vlnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vlnA01
4EF0A 5CRGA 2I1UA 2HSYA 5KN1A 4OFNA 4TVEA 2YNXA 1GSFA 3ZZXA 4OCFA 3O76A 4L8EA 4HS1A 1X9SB 2CT6A 3GTUA 5DALA 2JSYA 4KCEA 5GZZB 1SD8A 2VIMA 3O6TA 2CAQA 3FYGA 5B7CA 1O8XA 5J3RA 1TKDB 4RI7A 2YZHA 5ELAA 1YY7A 4YQMA 1GULA 4L5LA 3R3EA 2L6DA 4K6XA 3RHCA 4KB3A 4Z7XA 3TKSA 4TXOA 2C0DA 3V1WA 3MAKA 1QQ2A 2LJAA 2AB6A 3DXBA 1GSUA 1THOA 1BJXA 2H1BA 2HRNA 1YEXA 5HFKA 1A8LA 4RUVA 4G9HA 1ERUA 2RM6A 1AQWA 5HR1A 1S3DA 4NMUA 5ECQB 2NDOA 3QOUA 4GQCA 3ZITA 1V2AA 1M7TA 1XBSA 1GWCA 1FHEA 3D4TA 3BBYA 2WCIA 3HVSA 1GSDA 5ECOB 4Q5FA 2H76A 4WBJA 4MLYA 2BMXA 5ENUA 1GSSA 4IJ3A 1W89A 3EMXA 2VL9A 2CZ2A 3ERWA 1Z5YE 3L78A 4MA9A 3VWXA 5D73A 4AGSA 1ZGNA 6GSVA 2AV4A 4CDOA 2VCZA 4XS1A 3CSHA 3H8QA 4LL1B 4O5RA 1TRWA 1VF1A 2H6ZA 2GSSA 2GQLA 3DRNA 2GTUA 5AN1A 1OE7A 1FW1A 2N5AA 3QFBC 1WJKA 5H5RA 4H86A 5DJLA 3LG6A 2BTOT 2XC2A 5KEJA 5IO2A 4ZBBA 2CQ9A 1PX6A 2ES7A 2H73A 4D73A 2QSIA 4TR1A 4HI7A 3M0FA 1U87A 3UBLA 2L5OA 2R6KA 6GSTA 4PNFA 4WKWA 3FK8A 4XRDA 1U88A 4ECBA 2FHEA 1EV4A 5CRHA 3C8EA 1T00A 3FRCA 3IE3A 1X0RA 1K3LA 2E2GA 3UEMA 1GL8A 1VF4A 5CRWA 5A5KA 1EP8A 2B3SA 2YANA 5IOXA 3R2QA 3TDGA 2LSTA 2CV4A 4TOPA 2H72A 2L4QA 2JU5A 2F8FA 2DJ2A 3D4MA 3J7Yb 2GQKA 3QAWA 1EZKA 3HVXA 1AC1A 2GZYA 2IMIA 3Q19A 3WT2A 5IM9A 3GYKA 3GX0A 5JCUA 3G9BA 2LUSA 4K9ZA 1M2DA 2FY6A 4NWYA 2L4CA 3VWWA 4ILFA 1TJDA 2VD1A 5ECHB 4V1Ag 1PD21 2DJKA 2AYTA 2L59A 1KNGA 1JFUA 2V2GA 4POBA 2CVKA 5F06A 5CNWA 2GZPA 3KH7A 4EVMA 4MJCA 4BVYA 3WGXA 1HQOA 4AJ8A 4KNDA 3FR6A 1Z7RA 2B7KA 1TK8B 3KTBA 1YEPA 6GSWA 3HY2A 2OBKA 1GLQA 4ML1A 3A2VA 3EWLA 1UC7A 1V9WA 5LCZA 1XOAA 4F82A 4PXOA 1VRSD 2AHEA 5ECMB 3G7JA 4GXZA 4WF5A 4BPYA 1NHYA 3EMPA 20GSA 2V1MA 1T4YA 3IOSA 3UBKA 3BOAA 1OC9B 2MYGA 3GKMA 1U6TA 3OR5A 3RHBA 3GNJA 2H0IA 3HHVA 1I5GA 3LXTA 4HZ4A 2PPTA 4GRFA 2C80A 2FA8A 2G0FA 3CBUA 2B1LA 4IGJA 1DSBA 4FH8A 3HA9A 1O7UA 2FCHA 4EKZA 3LFLA 5ABRA 4NHWA 5ECSA 3KXOA 3GTUB 4ZB8A 1J9BA 2P5QA 5IPHA 1R4WA 1Q98A 1ZOFA 2FA4A 3GSTA 1TW9A 3KMOA 4MH3A 4JU5A 1A8YA 1TI1A 2R4VA 3HYPA 4MH2A 1O73A 3M8NA 1EV9A 4KCAA 4TXOB 4E8HA 3KM6A 3GKKA 4IP6A 1PGTA 1F6MC 1OVNA 1ON4A 2KP1A 3LSZA 1AAZA 3KZQA 18GSA 4N0VA 1OAZA 2PBJA 1BEDA 1X5DA 2FUG2 4HEA2 4MZWA 5KN3A 2RLIA 2IL3A 2C8UA 2M46A 3UL3A 4NAXA 2LRNA 3SBCA 5AIXA 3NZNA 4IS0A 3WYWA 2ON5A 3TKSE 3F9UA 4MZCA 5HR0A 3UOMA 3QAGA 4I5QA 5IMZA 5IIZA 2EIOA 2K9FA 3BCIA 2IN3A 1JZDA 1J08A 3CTGA 1QK8A 3I9V2 6GSUA 3P2AA 3F4RA 1ST9A 3J7Yk 1SJIA 5D9VA 2PMTA 5DQSA 2VLUA 1GTAA 4HOJA 5EL8A 1FVJA 2IMEA 3HJOA 4P3YB 4IW9A 2DMMA 2O89A 4XS6A 1HNBA 4TR1B 4DSRA 4HUAA 1A2LA 3CRUA 3F6FA 4ECCA 1GTBA 5GAPD 5CO3A 4IP1A 4WXTA 3FEUA 3QFAC 4ECJA 3F0IA 4MMMA 2GLRA 3O3TA 5H5SA 3S9FA 3CSIA 2DIZA 2IJYA 2L57A 4GSSA 5GSSA 2WDUA 1AQVA 3VI7A 5LNKe 2FWGA 4XIHA 2IMKA 3TKSC 1AQXA 4GLTA 2WB9A 1GNEA 3TKQA 4N30A 3F63A 1JLVA 1ERWA 3HD5A 4Q5NA 2ON7A 3HJPA 1GTUA 2PU9C 5CREA 1M2BA 1A2MA 3M1GA 1MDJA 1K0MA 2DBCA 3IDVA 4PQHA 4F03A 4YQVA 5JWRB 4LMVA 1B4PA 4MJBA 1TP9A 1DUGA 4K0NA 4OCEA 1AUCA 2XBIA 1JLWA 3GUSA 4ECIA 4TRXA 1X5CA 4FYCA 2ZCTA 3ZLPA 1YKCA 2E2MA 2WRTA 2WULA 3DVXA 1KTEA 3L4NA 1SL2B 3MWHA 1B8XA 2H71A 1N2AA 1OC9A 4MF6A 4BVYB 2R3XA 2M80A 5DCHA 1SENA 4BL7A 3E9JB 4V1Ap 5FT3A 3D0ZA 2A2RA 1SL1B 4HQZA 2CA8A 5ECNB 2V6OA 4KA0A 4HU9A 3QR6A 2DC5A 2VO4A 1ERVA 4JBBA 2REMA 4HJ2A 3GL3A 1K0CA 3GKXA 1O85A 3FZ9A 4JZQA 1KBNA 1RK4A 1XWBA 1X9WB 3IC4A 3RDWA 7GSSA 3FKFA 1VF3A 5J4UA 4Q5QA 3A2WA 3KGKA 3FR3A 2KUCA 1K3OA 2IMFA 5ECIB 1R26A 3G7IA 2A4VA 1SL0B 5EY6A 1MTCA 1GSQA 4YH2A 2RIIA 4KGIA 6GSSA 1QGVA 2HRKA 1XW9A 2MMOA 4G19A 2H6YA 2HI7A 4X0XA 4FYBA 1U3IA 1V40A 1TI3A 1VGLA 2PVQA 4QL9A 1WRYA 4IJIA 1EGRA 4KUNA 4J56E 1PKZA 1Y25A 1A2JA 2FLSA 2IMDA 1QUWA 1ZCPA 2DJ3A 5BMUA 1VF2A 2L6CA 2GVPA 4BWQA 5D9WA 4IHUA 1T1VA 4KF9A 2CZ3A 3P7XA 2H74A 3UIWA 4GWRA 1EEJA 2X99A 1YDKA 3E0UA 4TKYA 3F6DA 1YF1A 2C3TA 1ERTA 3KP9A 3VPTA 2JACA 2FWEA 2YN1A 1WIKA 3US3A 3D21A 5A4VA 1PSQA 1FOVA 1SYXA 1T3BA 1WE0A 4LA1A 1T4ZA 3ERGA 3EINA 2HXKA 3BD2A 2GSTA 1EOHA 4DSSA 5FHIA 3UARA 3FZ5A 5A4UA 1OYJA 5HQPA 3APOA 1K3YA 4XRAA 1TU8A 5G30A 2PWJA 4TN8A 1GRXA 5IQYA 2V6KA 3VK9A 2GQMA 5IMCA 5DVBA 3EVIA 5IMFA 5ID2A 2H1DA 3CXGA 1G6YA 4Q5RA 2IWTA 1HNCA 4MK3A 2VLTA 4V2NA 4HJMA 4F0BA 2X64A 5IO0A 4YAVA 5B6NA 1CQHA 2VL3A 3TKRA 3KD0A 2C3NA 4F0CA 3ZL5A 1HYUA 4ZBDA 4XCSA 3ZVJA 4PQIA 2VL2A 2YJHA 3IV4A 1PKWA 3L9SA 6GSXA 1Z6MA 3ME8A 1E6BA 2H0HA 3HCZA 5E59A 2YV7A 4CW9A 1UA5A 3IK9A 3HZ8A 2GSQA 4K0GA 4USSA 3GKNA 1TRVA 1BAYA 3DIEA 2YP6A 2R5GA 2YWOA 1IYIA 3D22A 1NHOA 2RM5A 3TOTA 5IMAA 3BCKA 3VURA 3A5WA 4JR6A 4I6XA 3TCOA 2MMZA 1PX7A 4V2LA 4POMA 2KLXA 4IELA 4WF4A 1TRUA 2R2JA 2WFCA 3IA1A 5AISA 3EU3A 3F4SA 3LWAA 1DBYA 1Z7PA 2OKAA 2VUPA 4L5OA 4OO5A 3FY7A 3U6VA 1NW2A 2B5XA 1A0RP 1WP0A 4ACSA 4MPGA 3IAM2 1GTIA 2HE3A 2LJKA 3MSZA 1BG5A 3PR8A 3I69A 3TJKA 1XWAA 5DQYA 3GSSA 1K0BA 2X8GA 1JZOA 1GNWA 1GSEA 3DD3A 4JRRA 2DSAA 4ISDA 1JHBA 1IYHA 6GSYA 3LQ7A 4EDZA 1HD2A 3GFKA 4QQ7A 5DBQA 2JZRA 1XWCA 1N8JA 3ZRDA 1LJRA 1F9MA 2LRTA 2O87A 4JEDA 1FG4A 2D2ZA 2YOIA 1S3CA 4MDCA 5JCGA 4BL7B 1YZXA 1ILOA 5CAXA 4MF7A 1QFNA 1SU9A 1SKWB 5HR3A 1QXHA 2H66A 5DDLA 11GSA 2I4AA 2I3YA 4EUYA 5IOWA 1M99A 3APQA 5JCWA 3D6IA 1PRXA 4DVCA 2K8VA 4WR5A 3RPPA 5EVOA 2LQQA 2OE3A 2WJUA 3IK7A 2VCTA 1MEKA 2GT5A 2DIYA 1TK5B 3QMXA 2VAFA 2X8CA 1XIYA 1F3BA 2EC4A 4FO5A 1OKDA 5F0GA 4TXVA 2HQTA 1DE2A 1SJ6A 2HRKB 4OFMA 3VLNA 1SYRA 1ABAA 3IHQA 2H8LA 2VCXA 2V41A 4TR3A 1WOUA 4MJEA 2B6MA 3AY8A 4K7IA 3LJRA 3UJ1A 2NPBA 4ZXGA 1MDKA 2C0FA 3DMLA 3SWLA 3GH9A 3CSJA 3ZYWA 4L0WA 3RPNA 3TRXA 2H75A 4J57E 2DMLA 1J0FA 4K1FA 4O92A 2GGTA 1TK0B 1F37A 1Y6EA 4KDUA 2HRAA 4GQFA 2C3QA 2VD0A 4OWYA 3FR9A 4MABA 1XWGA 1EP7A 3NIVA 1V57A 1B9YC 4K8MA 2F51A 13GSA 2HYXA 5D96A 4TR0A 3L9UA 4V2MA 3LGCA 2WS2A 4KH7A 1EEMA 3TUEA 3ZVJD 3F3QA 1TTZA 2F9SA 2TRCP 1F2EA 4NPBA 1Q4JA 3QD9A 3ED3A 1URMA 4O32A 3A3TA 5JWQB 3TKPA 1B4QA 5HR2A 2H1AA 5DAKA 2CVBA 3IR4A 3WD6A 1DE1A 4DSSB 2GSRA 1XOBA 3PPUA 2F3MA 4YAPA 4ZIJA 4I2TA 5G5FA 5L71A 4GCIA 4JR4A 3TRQA 5CRDA 2P0GA 2HSNB 3ZTLA 8GSSA 4KDXA 5ECLB 2DJ1A 2M72A 3QAVA 3FW2A 5ID2B 2MMAA 5G31A 3CTFA 3ME7A 5G1KA 3I43A 4NV5A 2VM2A 5D9TA 1C72A 1BQ7A 5J41A 2RUEA 2LQOA 3G7YA 2LKUA 2HNLA 1FB0A 5KN2A 2PN8A 4N10A 5E4WA 3C7MA 3ZREA 2B1KA 3EU4A 1X5EA 4WETA 4XS4B 2J9HA 3VFIA 2LNTA 1GLPA 2HSHA 3HVVA 3QDNA 2HT9A 4BA7A 2XPEA 4AJ6A 3UVHA 4BWSA 3IPZA 1M0UA 3HJMA 4PTSA 3P90A 2HSMA 5GSTA 5C04A 1QMVA 1KEBA 4HZ2A 2I81A 5H5QA 2C4JA 1OE8A 3HDCA 4QL7A 3KCMA 4XHMA 3M9KA 3ZIJA 3IC8A 4IN0A 3DGQA 1R5PA 2TRXA 4ZILA 2YJ7A 3LYPA 4MZBA 1Z9HA 9GSSA 2OACA 1ZZYA 5DJMA 3W6GA 4G0LA 3EE2A 2BJXA 4WEYA 1O8WA 4K7OA 3VWUA 2K18A 3TJFA 5G5EA 4K7NA 4I8BA 2HFDA 4MPFA 2P5RA 1EOGA 2N5FA 1GSYA 1K0NA 2YV9A 4MCUA 2PUKC 1K0OA 1I9DA 4EDYA 1SK2A 1W4VA 4WBRD 3Q18A 3DYRA 3GV1A 1K0DA 2G2QA 3HXSA 4DEJA 2IPAA 4KSOA 2OA7A 2HZEB 3TJGA 3MDKA 2MZCA 3C1RA 4OO4A 4ML6A 3LORA 2QKEA 1GUKA 1PL2A 4E8EA 3MNGA 2A2SA 1PMTA 1XZOA 1K0AA 2CX3A 4MP4A 2FNOA 1XW5A 4GF0A 5F07A 2F8AA 3HKRA 1TDIA 1YQ1A 1WPIA 1SD9A 1USBA 1YKAA 2H30A 2VL2C 3PINA 2C1YA 1M9AA 4WR4A 1LBKA 3IXRA 3NOFA 1YJ6A 2OBIA 4TW5A 3FHKA 2GT6A 1SK0A 1ACVA 4NXIA 2NBSA 3Q74A 1PQNA 4I2UA 2AUVA 5G2ZA 4CHSA 1E2YA 2ALBA 3WGEA 5G1LA 5DCGA 4TR4A 1SKRB 2H19A 2GS3A 2FWHA 4EO3A 1GUMA 4ZBAA 1FAAA 4PX1A 1YF0A 3TJBA 4PUAA 1XPVA 5IPGA 3LXZA 1G7OA 4ULXA 2E0QA 19GSA 3GMFA 1ZYQB 1TOFA 3GURA 4PUFC 2O85A 1Z3EA 1H75A 1A24A 2DJJA 3IRAA 2KOKA 3VPQA 1RW1A 3HZ4A 2H1GA 4LLRA 1PL1A 1M2AA 2Z9SA 3C1SA 3LYKA 2PERA 2O8VB 1MDIA 12GSA 4YQUA 3TB2A 1V58A 4PURA 4XTSA 3PGTA 2YWMA 5B8AA 4G2EA 2EIQA 1TU7A 3TJJA 2X8HA 4BVXA 2IFQB 2YWIA 3RBTA 2DLXA 1X9MB 3F8UA 4LMWA 1XVQA 5DAKB 4POKA 3GX8A 1B9XC 1GUHA 1SJZA 2VOCA 5ELGA 4KX4A 4XS4A 1R5AA 3QCPA 4K2DA 3H4KA 1G6WA 17GSA 3GL5A 2H6XA 3ZMLA 1XXUA 1O81A 4MJAA 3RAZA 2VCQA 4ZB6A 5IMDA 1A23A 4N11A 4RQRA 3GN3A 1TRSA 2QC7A 4X1UA 2LS5A 3APSA 3EURA 2YWNA 3DWVA 3W8SA 4O7HA 1EGOA 1A0FA 2MBTA 2K8SA 1BX9A 2YCDA 2XPDA 4ZL7A 2PVOC 2ZUPA 5CYYA 3DEXA 1O6JA 3CRTA 4IQ1A 1B48A 1UVZA 1UN2A 3GHAA 14GSA 4EXJA 4GSNA 4IKHA 5J9BA 1AXDA 1CQGA 5A4WA 5B6MA 2JADA 3GRXA 4LL4B 2C0EA 3UAPA 4AJ7A 2HSMB 4MF5A 3ZIVA 1R7HA 4G10A 1WWJA 4RI6A 3D5JA 22GSA 2JSZA 5F8BA 1SKSB 4ID0A 5HFGA 3KP8A 3M3MA 1LU4A 2YPMA 1ZMAA 2GDRA 2FWFA 2VM1A 1U3AA 3Q6OA 1PN9A 2AAWA 1THXA 2HLSA 2HZEA 4KSMA 3F3RA 4DSQA 4AF2A 2C0GA 3KIJA 1NM3A 3H79A 2P31A 5CP1A 3UMAA 4J2FA 3IBHA 1XVWA 1AIUA 1GH2A 3KMNA 3L9VA 3KJYA 5INYA 4PNGA 1ML6A 2ZNMA 5JWOB 2LV3A 2L5LA 5ECRB 2H01A 2OJLA 2CX4A 5D9XA 2YZUA 1JZRA 3JCML 5EPFA 1GP1A 3E3EA 4HQSA 1MD3A 2VCVA 5DALB 2LEGA 1XW6A 5F05A 3C73A 5D8IA 4EE0A 3UVTA 2J23A 4G0IA 5IMVA 1XCCA 4I97A 1XWKA 2QGVA 4POLA 3LEFA 3U5RE 2JZTA 3A2XA 3TGZA 3M9JA 1SK1A 3WGDA 5AGYA 2HRFA 3CYNA 1FB6A 2V32A 2LRCA 2OADA 3PH9A 4OD7A 2B7JA 3WT1A 2JL4A 1T7PB 3TOUA 1H4OA 16GSA 4NV2A 4PGTA 3DVWA 4ZL9A 5HFIA 2B5EA 2H0GA 2OE1A 3DKSA 2AJQB 1F3AA 2KHPA 1G0TA 2E7PA 2LJRA 2K6VA 4EC0A 1WMJA 2WGRA 1RQMA 5FWGA 4IBPA 4OMVA 2LTKA 3H93A 2MBSA 4F9ZA 4X43A 2N5BA 2CVDA 2DJ0A 3KEBA 5C00A 2B5YA 5ECPB 2I9HA 3K8NA 4HDEA 4GSTA 5GAND 3VI5A 5AIVA 1AW9A 2IFQA 5COHA 4ZB9A 4F2IA 3ZMKA 2HZFA 4HU7A 4JE1A 3GIXA 4GTUA 1NSWA 1TXXA 2JZSA 3FZ4A 3ZFBA 2H70A 2VCWA 2VLVA 4FYUA 4ZL8A 3KTLA 3L0HA 1G7EA 1EWXA 2XHFA 4D73B 2NVLA 4FQUA 5B8BA 2FGXA 4IVFA 3I6AA 2R37A 2WZ9A 2XBQA 4FIWA 3N9JA 1HNAA 1FO5A 4KAEA 3N5OA 3C71A 4BVXB 10GSA 3KH9A 3GH6A 1ZYEA 1OKTA 1PA3A 4KW6A 4KE3A 3EYTA 4IQAA 2IIYA 4PQ1A 2LNSA 5J9CA 3ERFA 2EIRA 4EL1A 4N0ZA 2TIRA 4NHZA 2UZ8A 1OC8A 1BYEA 1MD4A 3P8WA 4L0UA 1M9BA 2KP2A 1ZL9A 3EC3A 3QPMA 3F4TA 2MMNA 2NTOA 5J5NA 2GZZA 5LD0A 1S3AA 1FVKA 4G0KA 1T8EB 5ECKB 4RQXA 4KDYA 2CAIA 3GA4A 1V98A 3IAS2 4OFTA 3H1NA 1OC3A 3CMIA 5D93A 1Z6NA 2FD3A 3VWVA 2OE0A 3BJ5A 2PGTA 1XFLA 5KN0A 3ISOA 2RUFA 3W8JA 3ZFLA 2O7KA 3TRPA 1JZWA 3FZAA
chains in the Genus database with same CATH superfamily
4EF0A 5CRGA 2I1UA 2HSYA 5KN1A 4OFNA 4TVEA 2YNXA 1GSFA 3ZZXA 4OCFA 3O76A 2O5VA 4L8EA 4HS1A 4CY8A 1X9SB 4X4JA 2CT6A 3GTUA 5DALA 2JSYA 4KCEA 5GZZB 1SD8A 2VIMA 3O6TA 2CAQA 1SVLA 3TU3B 3FYGA 4Z2RA 5B7CA 1O8XA 1BF5A 5J3RA 1TKDB 4RI7A 4Z2TA 2YZHA 5ELAA 1YY7A 1SVOA 4YQMA 3MYDA 1GULA 4L5LA 3R3EA 2L6DA 4K6XA 3RHCA 4KB3A 4Z7XA 3TKSA 4TXOA 2C0DA 3V1WA 3MAKA 1QQ2A 2LJAA 2AB6A 3DXBA 1GSUA 2R0GA 1THOA 1BJXA 2H1BA 4CY6A 2HRNA 1YEXA 1S3RA 5HFKA 1A8LA 4RUVA 4G9HA 1ERUA 2RM6A 2A2PA 1AQWA 5HR1A 1S3DA 4NMUA 5ECQB 2NDOA 3QOUA 4GQCA 3ZITA 1V2AA 1M7TA 1XBSA 1GWCA 1FHEA 3D4TA 3BBYA 4AKHA 2WCIA 3HVSA 1GSDA 5ECOB 4Q5FA 2H76A 4WBJA 4MLYA 2BMXA 5ENUA 1GSSA 4IJ3A 1W89A 3EMXA 2VL9A 2CZ2A 3ERWA 1Z5YE 3L78A 4MA9A 3VWXA 5D73A 4AGSA 1ZGNA 6GSVA 2AV4A 4CDOA 2VCZA 4XS1A 3CSHA 3H8QA 4LL1B 4O5RA 1TRWA 1N25A 1VF1A 2H6ZA 2GSSA 3DRNA 2GQLA 2GTUA 5AN1A 1OE7A 1FW1A 2N5AA 3QFBC 1WJKA 5H5RA 4H86A 5DJLA 3LG6A 2BTOT 2XC2A 5KEJA 5IO2A 4ZBBA 2CQ9A 2X4AA 1PX6A 2ES7A 2H73A 4D73A 2QSIA 4TR1A 4HI7A 3M0FA 1U87A 3UBLA 2L5OA 2R6KA 6GSTA 4PNFA 4WKWA 3FK8A 4XRDA 1U88A 4ECBA 2FHEA 1EV4A 5CRHA 3C8EA 1T00A 3FRCA 3IE3A 1X0RA 1K3LA 2E2GA 3UEMA 1GL8A 1VF4A 5CRWA 5A5KA 1EP8A 2B3SA 2YANA 1S4BP 4G01A 5IOXA 3R2QA 2QA1A 3TDGA 2LSTA 2CV4A 4TOPA 2H72A 2L4QA 2JU5A 5A34A 2F8FA 2DJ2A 3D4MA 3J7Yb 2GQKA 3QAWA 1EZKA 3HVXA 1AC1A 2GZYA 2IMIA 3Q19A 4AKIA 3WT2A 5IM9A 3GYKA 3GX0A 5JCUA 3G9BA 2LUSA 4K9ZA 1M2DA 2FY6A 4NWYA 2L4CA 3VWWA 4ILFA 1TJDA 2VD1A 5ECHB 4V1Ag 1PD21 2DJKA 2AYTA 2L59A 1KNGA 1JFUA 2WVZA 2V2GA 4POBA 2CVKA 5F06A 5CNWA 2GZPA 3KH7A 4EVMA 4MJCA 4BVYA 3WGXA 1HQOA 4AJ8A 4KNDA 3FR6A 1Z7RA 2B7KA 1TK8B 3KTBA 1YEPA 6GSWA 3HY2A 2OBKA 1GLQA 4ML1A 3A2VA 3EWLA 1UC7A 1V9WA 5LCZA 1XOAA 4F82A 4PXOA 3RFRC 1VRSD 2AHEA 5ECMB 3G7JA 4GXZA 4WF5A 4BPYA 1NHYA 3EMPA 4YKGA 20GSA 2V1MA 1T4YA 3IOSA 3UBKA 3BOAA 1OC9B 2MYGA 3GKMA 1U6TA 3OR5A 3RHBA 3GNJA 2H0IA 3HHVA 1I5GA 3LXTA 4HZ4A 2PPTA 4GRFA 2C80A 2FA8A 5J4YA 5BRTA 2G0FA 3CBUA 2B1LA 4IGJA 1DSBA 4FH8A 3HA9A 1O7UA 2FCHA 4EKZA 3FMWA 3LFLA 5ABRA 4NHWA 5ECSA 3KXOA 3GTUB 4ZB8A 1J9BA 2P5QA 5IPHA 1R4WA 1Q98A 1ZOFA 2FA4A 3GSTA 1TW9A 3KMOA 4MH3A 4JU5A 1A8YA 2WZSA 1TI1A 2R4VA 3HYPA 1PFOA 4MH2A 1O73A 3M8NA 1EV9A 4KCAA 4TXOB 4E8HA 3KM6A 3GKKA 4IP6A 1PGTA 1F6MC 1OVNA 1ON4A 2KP1A 3LSZA 1AAZA 3KZQA 18GSA 4N0VA 1OAZA 2PBJA 1BEDA 1X5DA 2FUG2 4HEA2 4MZWA 5KN3A 2RLIA 2IL3A 2C8UA 2M46A 3UL3A 4NAXA 2LRNA 3SBCA 5AIXA 3NZNA 4IS0A 3WYWA 1ZYPA 2ON5A 3TKSE 3F9UA 4MZCA 5HR0A 3UOMA 3QAGA 4AKGA 4I5QA 5IMZA 5IIZA 2EIOA 2K9FA 3BCIA 2IN3A 1JZDA 1J08A 3CTGA 1QK8A 3I9V2 6GSUA 3A5IA 3P2AA 3F4RA 1ST9A 3J7Yk 1SJIA 5D9VA 2PMTA 5DQSA 2VLUA 1GTAA 4HOJA 5EL8A 4PI0C 1FVJA 2IMEA 3HJOA 5J4VA 4P3YB 4IW9A 2DMMA 2O89A 4XS6A 1HNBA 4TR1B 4DSRA 2H1LA 4HUAA 1A2LA 3CRUA 3F6FA 4ECCA 1GTBA 5GAPD 5CO3A 4IP1A 4WXTA 3FEUA 3QFAC 4ECJA 3F0IA 4MMMA 2GLRA 3O3TA 5H5SA 3S9FA 3CSIA 2DIZA 2IJYA 2L57A 4GSSA 1FOHA 5GSSA 2WDUA 1AQVA 3VI7A 5LNKe 2FWGA 4XIHA 2IMKA 3TKSC 1AQXA 4GLTA 2WB9A 1GNEA 3TKQA 4N30A 3F63A 1JLVA 1ERWA 3HD5A 4Q5NA 2ON7A 4EIQA 1ZYNA 3HJPA 1GTUA 2PU9C 5CREA 1M2BA 1A2MA 3M1GA 1MDJA 1K0MA 2DBCA 3IDVA 5A34B 4PQHA 4F03A 4YQVA 5JWRB 4LMVA 1B4PA 4MJBA 1Y1UA 1TP9A 1DUGA 1TXUA 4K0NA 4OCEA 1AUCA 2XBIA 1JLWA 3GUSA 3IHGA 4ECIA 4TRXA 1X5CA 4FYCA 2ZCTA 3ZLPA 1YKCA 2E2MA 2WRTA 2WULA 3DVXA 1SVMA 1KTEA 2UV8G 3L4NA 1SL2B 3MWHA 1B8XA 2H71A 1N2AA 1OC9A 4O5QA 4MF6A 4BVYB 2R3XA 2M80A 5DCHA 1SENA 4BL7A 3E9JB 4V1Ap 5FT3A 3D0ZA 2A2RA 1SL1B 1PN0A 4HQZA 2CA8A 5ECNB 2V6OA 4KA0A 4HU9A 3QR6A 2DC5A 2VO4A 1ERVA 4GDFA 4JBBA 2REMA 4HJ2A 3GL3A 1K0CA 3GKXA 1O85A 3FZ9A 4JZQA 1KBNA 4MNNA 1RK4A 1XWBA 1X9WB 5J40A 3IC4A 3RDWA 7GSSA 3FKFA 1VF3A 5J4UA 4Q5QA 3A2WA 3KGKA 3FR3A 2KUCA 1K3OA 2IMFA 5ECIB 1R26A 3G7IA 2A4VA 1SL0B 5EY6A 1MTCA 1GSQA 4YH2A 2RIIA 4KGIA 6GSSA 1QGVA 2HRKA 1XW9A 2MMOA 4G19A 2H6YA 2HI7A 4X0XA 4FYBA 1U3IA 1V40A 1TI3A 1VGLA 2PVQA 4QL9A 1WRYA 4IJIA 2WW3A 4KUNA 1EGRA 2QA2A 4J56E 1PKZA 1Y25A 1A2JA 2FLSA 2IMDA 1QUWA 1ZCPA 2DJ3A 5BMUA 1VF2A 2L6CA 2GVPA 4BWQA 5D9WA 4IHUA 1T1VA 4KF9A 4K5SA 2CZ3A 3P7XA 2H74A 3UIWA 4GWRA 1EEJA 2X99A 1YDKA 3E0UA 4TKYA 3F6DA 1YF1A 2C3TA 1ERTA 4PI2C 3KP9A 3VPTA 2JACA 2FWEA 2DKHA 2YN1A 1WIKA 3US3A 3D21A 5A4VA 1PSQA 1FOVA 1SYXA 1T3BA 1WE0A 4LA1A 1T4ZA 3ERGA 3EINA 2HXKA 3BD2A 2GSTA 1EOHA 4DSSA 5FHIA 3UARA 3FZ5A 5A4UA 1OYJA 5HQPA 3APOA 1K3YA 4XRAA 1TU8A 5G30A 2PWJA 4TN8A 1GRXA 5IQYA 2V6KA 3VK9A 2GQMA 5IMCA 1M3IA 5DVBA 2R0CA 3EVIA 5IMFA 5ID2A 2H1DA 3CXGA 1G6YA 4Q5RA 2IWTA 1HNCA 4MK3A 2VLTA 4V2NA 4HJMA 4F0BA 2X64A 5IO0A 4YAVA 5B6NA 1CQHA 2VL3A 4N3ZA 3TKRA 3KD0A 2C3NA 4F0CA 3ZL5A 1HYUA 4W66A 4ZBDA 4XCSA 3ZVJA 4PQIA 2VL2A 2YJHA 3IV4A 1PKWA 3L9SA 6GSXA 1Z6MA 3ME8A 1E6BA 2H0HA 3HCZA 5E59A 2YV7A 4CW9A 1UA5A 3IK9A 3HZ8A 2GSQA 4K0GA 4USSA 3GKNA 1TRVA 1BAYA 3DIEA 2YP6A 2R5GA 2YWOA 1IYIA 3D22A 1NHOA 2RM5A 3TOTA 5IMAA 3BCKA 3VURA 3A5WA 4JR6A 4I6XA 3TCOA 4BIKA 2MMZA 1PX7A 4V2LA 4POMA 2KLXA 4IELA 4WF4A 1TRUA 2R2JA 2WFCA 3IA1A 5AISA 3EU3A 3F4SA 3LWAA 1DBYA 2R0PA 1Z7PA 2OKAA 2VUPA 4L5OA 4OO5A 3FY7A 3U6VA 1NW2A 2B5XA 1A0RP 1WP0A 4ACSA 4MPGA 3IAM2 1GTIA 2HE3A 2LJKA 3MSZA 1BG5A 3PR8A 3I69A 3TJKA 1XWAA 5DQYA 3GSSA 1K0BA 2X8GA 5J47A 4FXYP 1JZOA 1GNWA 1GSEA 3DD3A 4JRRA 2DSAA 4ISDA 1JHBA 1IYHA 6GSYA 3LQ7A 4EDZA 1HD2A 3GFKA 4QQ7A 5DBQA 2JZRA 1XWCA 1N8JA 3ZRDA 1LJRA 1F9MA 2LRTA 2O87A 4JEDA 1FG4A 2D2ZA 2YOIA 1S3CA 4MDCA 5JCGA 4BL7B 2OT3A 1YZXA 1ILOA 5CAXA 4MF7A 1QFNA 1SU9A 1SKWB 2EFHA 5HR3A 1QXHA 2H66A 5DDLA 11GSA 2I4AA 2I3YA 4EUYA 5A5HA 5IOWA 1M99A 3APQA 5JCWA 3D6IA 1PRXA 4DVCA 2K8VA 4WR5A 3RPPA 5EVOA 2LQQA 1I1IP 2OE3A 2WJUA 3IK7A 2VCTA 1MEKA 2GT5A 2DIYA 1TK5B 3QMXA 2VAFA 2X8CA 1XIYA 1F3BA 2EC4A 4FO5A 1OKDA 5F0GA 4TXVA 2HQTA 1DE2A 1SJ6A 2HRKB 4OFMA 3VLNA 1SYRA 1ABAA 3IHQA 4Z2UA 2H8LA 2VCXA 4QMKA 2V41A 4TR3A 1WOUA 4MJEA 2B6MA 3AY8A 4K7IA 3LJRA 3UJ1A 2NPBA 4ZXGA 1MDKA 2C0FA 3DMLA 3SWLA 3GH9A 3CSJA 3ZYWA 4L0WA 3RPNA 3TRXA 5BMUB 2H75A 4J57E 2DMLA 1J0FA 4K1FA 4O92A 2GGTA 1TK0B 1F37A 1Y6EA 4KDUA 2HRAA 4EIPA 4GQFA 2C3QA 2VD0A 4OWYA 3FR9A 4MABA 1XWGA 1EP7A 3NIVA 1V57A 1B9YC 4K8MA 2F51A 13GSA 2HYXA 5D96A 4TR0A 3L9UA 4V2MA 3LGCA 2WS2A 2WVXA 4KH7A 1EEMA 3TUEA 3ZVJD 3F3QA 1TTZA 2F9SA 2TRCP 1F2EA 4NPBA 1Q4JA 3QD9A 3ED3A 1URMA 4O32A 3A3TA 5JWQB 3TKPA 1B4QA 5HR2A 2H1AA 5DAKA 2CVBA 3IR4A 3WD6A 1DE1A 4DSSB 2GSRA 1XOBA 3PPUA 2F3MA 4YAPA 4ZIJA 4I2TA 5G5FA 5L71A 4GCIA 4JR4A 3TRQA 5CRDA 2P0GA 2HSNB 3ZTLA 8GSSA 4KDXA 5ECLB 2DJ1A 2M72A 3QAVA 3FW2A 5ID2B 2MMAA 5G31A 3CTFA 3ME7A 5G1KA 3I43A 4NV5A 2VM2A 5D9TA 1C72A 1BQ7A 5J41A 4O5UA 2RUEA 2LQOA 3G7YA 2LKUA 2EFEA 2HNLA 1FB0A 5KN2A 2O3EA 2PN8A 4N10A 5E4WA 3C7MA 3ZREA 2B1KA 3EU4A 1X5EA 4WETA 4XS4B 2J9HA 3VFIA 2LNTA 4K5RA 1GLPA 2HSHA 3HVVA 3QDNA 1BG1A 2HT9A 4BA7A 2XPEA 4AJ6A 3UVHA 4BWSA 3IPZA 1M0UA 3HJMA 4PTSA 3P90A 2HSMA 5GSTA 5C04A 1QMVA 1KEBA 3EPTA 4HZ2A 2I81A 5H5QA 2C4JA 1OE8A 3HDCA 4QL7A 3KCMA 4XHMA 3M9KA 2X49A 3ZIJA 3IC8A 4IN0A 3DGQA 1R5PA 2TRXA 4ZILA 2YJ7A 3LYPA 4MZBA 1Z9HA 1YVLA 9GSSA 2OACA 1ZZYA 5DJMA 3W6GA 4G0LA 3EE2A 2BJXA 4WEYA 1O8WA 4K7OA 3VWUA 2K18A 3TJFA 5G5EA 4K7NA 4I8BA 2HFDA 4MPFA 2P5RA 3RGBC 1EOGA 2N5FA 4AI6A 1GSYA 1K0NA 2YV9A 4MCUA 2PUKC 1K0OA 1I9DA 4EDYA 1SK2A 2WW0A 1W4VA 4WBRD 3Q18A 2O36A 3DYRA 3GV1A 1K0DA 2G2QA 3HXSA 4DEJA 2IPAA 4KSOA 2OA7A 2HZEB 3TJGA 3MDKA 2MZCA 3C1RA 4OO4A 4ML6A 3LORA 2QKEA 1GUKA 1PL2A 4E8EA 3MNGA 2A2SA 1PMTA 1XZOA 1K0AA 2CX3A 4MP4A 2FNOA 1XG8A 5A5HB 1XW5A 4GF0A 5F07A 2F8AA 3HKRA 1TDIA 1YQ1A 1WPIA 1SD9A 1USBA 1YKAA 2H30A 2VL2C 3PINA 2C1YA 1M9AA 4WR4A 1LBKA 3IXRA 3NOFA 1YJ6A 2EFDA 2OBIA 4TW5A 3FHKA 2GT6A 1SK0A 1ACVA 4NXIA 2NBSA 3Q74A 1PQNA 4I2UA 2AUVA 5G2ZA 4CHSA 1E2YA 2ALBA 3WGEA 5G1LA 5DCGA 4TR4A 1SKRB 2H19A 2GS3A 2FWHA 4EO3A 1GUMA 4PHZC 4ZBAA 1FAAA 5KOWA 4PX1A 1YF0A 3TJBA 4PUAA 1XPVA 5IPGA 3LXZA 1G7OA 4ULXA 2E0QA 19GSA 3GMFA 1ZYQB 1TOFA 3GURA 4PUFC 2O85A 1Z3EA 1H75A 1A24A 2DJJA 3IRAA 2KOKA 3VPQA 1RW1A 2A4HA 3HZ4A 2HSNA 2H1GA 4LLRA 1PL1A 4YKFA 1M2AA 2Z9SA 3C1SA 3LYKA 2PERA 2WW1A 2O8VB 1MDIA 12GSA 4YQUA 3TB2A 1V58A 2WVXB 4PURA 4XTSA 3PGTA 2YWMA 5B8AA 4G2EA 2EIQA 1TU7A 3TJJA 2X8HA 4BVXA 2IFQB 2YWIA 3RBTA 2DLXA 1X9MB 3F8UA 4LMWA 1XVQA 5DAKB 4POKA 5A1NB 3GX8A 1B9XC 1GUHA 1SJZA 2VOCA 5ELGA 4KX4A 4XS4A 1R5AA 3QCPA 4K2DA 3H4KA 1G6WA 17GSA 3GL5A 2H6XA 3ZMLA 1XXUA 1O81A 4MJAA 3RAZA 2VCQA 4ZB6A 5IMDA 1A23A 4N11A 4RQRA 3MIXA 3GN3A 1TRSA 2QC7A 4X1UA 2WVYA 2LS5A 3APSA 3EURA 2VKZG 2YWNA 3DWVA 3W8SA 4O7HA 1EGOA 1A0FA 2MBTA 2K8SA 1BX9A 2YCDA 2XPDA 4ZL7A 2PVOC 2ZUPA 4E68A 5CYYA 4AKXB 3DEXA 1O6JA 3CRTA 4IQ1A 1B48A 1UVZA 1UN2A 3GHAA 14GSA 4EXJA 4GSNA 4IKHA 5J9BA 1AXDA 1CQGA 5A4WA 3HVNA 5B6MA 2JADA 3GRXA 4LL4B 2C0EA 3UAPA 4AJ7A 2HSMB 4MF5A 3ZIVA 1R7HA 4G10A 1WWJA 4RI6A 3D5JA 22GSA 2JSZA 5F8BA 1M3JA 1SKSB 4ID0A 5HFGA 3KP8A 3M3MA 1LU4A 2YPMA 1ZMAA 2GDRA 3CQFA 2FWFA 2VM1A 1U3AA 3Q6OA 1PN9A 2AAWA 1THXA 2HLSA 2HZEA 4KSMA 3F3RA 4DSQA 4AF2A 2C0GA 3KIJA 1NM3A 3H79A 2P31A 5CP1A 3UMAA 4J2FA 3IBHA 1XVWA 1AIUA 1GH2A 3KMNA 3L9VA 3KJYA 5INYA 4PNGA 1ML6A 2ZNMA 5JWOB 2LV3A 2L5LA 5ECRB 2H01A 2OJLA 2CX4A 5D9XA 2YZUA 1JZRA 4HSCX 3JCML 5EPFA 1GP1A 3E3EA 4HQSA 1MD3A 2VCVA 5DALB 2LEGA 1XW6A 2WW2A 5F05A 3C73A 5D8IA 4EE0A 3UVTA 2J23A 4G0IA 5IMVA 1XCCA 4K2XA 4I97A 1XWKA 2QGVA 4POLA 3LEFA 3U5RE 2JZTA 2EFCA 3A2XA 3TGZA 3M9JA 1SK1A 3WGDA 5AGYA 2HRFA 3CYNA 1FB6A 2V32A 2LRCA 2OADA 3PH9A 4OD7A 2B7JA 3WT1A 2JL4A 1T7PB 3TOUA 1H4OA 16GSA 4NV2A 4PGTA 3DVWA 4ZL9A 5HFIA 2B5EA 2H0GA 2OE1A 3DKSA 2AJQB 1F3AA 2KHPA 1G0TA 2E7PA 3LW9A 2LJRA 4A5PA 2K6VA 4EC0A 1WMJA 2WGRA 1RQMA 5FWGA 4IBPA 4OMVA 2LTKA 3H93A 2MBSA 4F9ZA 4X43A 2N5BA 2CVDA 2DJ0A 3KEBA 5C00A 2B5YA 5ECPB 2I9HA 3HMJG 3K8NA 4HDEA 4GSTA 5GAND 3VI5A 5AIVA 1AW9A 2IFQA 5COHA 4ZB9A 4F2IA 3ZMKA 2HZFA 4HU7A 5A1NA 4JE1A 3GIXA 4GTUA 1NSWA 1TXXA 2JZSA 3FZ4A 3ZFBA 2H70A 2VCWA 2VLVA 4FYUA 4ZL8A 3KTLA 3L0HA 1G7EA 1EWXA 2XHFA 4D73B 2NVLA 4FQUA 5B8BA 2FGXA 4IVFA 4ICYA 3I6AA 2R37A 2WZ9A 2XBQA 4FIWA 3N9JA 1HNAA 1FO5A 4KAEA 3N5OA 3C71A 4BVXB 10GSA 3GH6A 3KH9A 1ZYEA 1OKTA 1PA3A 3CWGA 4KW6A 4KE3A 3EYTA 4IQAA 2IIYA 4PQ1A 2LNSA 5J9CA 3ERFA 2EIRA 4EL1A 4N0ZA 2TIRA 4NHZA 2UZ8A 1OC8A 1BYEA 1MD4A 3P8WA 5KOXA 4L0UA 1M9BA 2KP2A 1YEWC 1ZL9A 3EC3A 3QPMA 3F4TA 2MMNA 2DKIA 2NTOA 5J5NA 2GZZA 5LD0A 1S3AA 1FVKA 4G0KA 1T8EB 5ECKB 4RQXA 4KDYA 2CAIA 3GA4A 1V98A 3IAS2 4OFTA 3H1NA 1OC3A 3CMIA 5D93A 4ZB7A 1Z6NA 2FD3A 3VWVA 2OE0A 3BJ5A 2PGTA 3CHXC 1XFLA 5KN0A 3ISOA 2RUFA 3W8JA 3ZFLA 2O7KA 3TRPA 1JZWA 3FZAA
chains in the Genus database with same CATH topology
4EF0A 5CRGA 2I1UA 2HSYA 5KN1A 4OFNA 4TVEA 2YNXA 1GSFA 3ZZXA 4OCFA 3O76A 2O5VA 4L8EA 4HS1A 4CY8A 1X9SB 4X4JA 2CT6A 3GTUA 5DALA 2JSYA 4KCEA 5GZZB 1SD8A 2VIMA 3O6TA 2CAQA 1SVLA 3TU3B 3FYGA 4Z2RA 5B7CA 1O8XA 1BF5A 5J3RA 1TKDB 4RI7A 4Z2TA 2YZHA 5ELAA 1YY7A 1SVOA 4YQMA 3MYDA 1GULA 4L5LA 3R3EA 2L6DA 4K6XA 3RHCA 4KB3A 4Z7XA 3TKSA 4TXOA 2C0DA 3V1WA 3MAKA 1QQ2A 2LJAA 2AB6A 3DXBA 1GSUA 2R0GA 1THOA 1BJXA 2H1BA 4CY6A 2HRNA 1YEXA 5HFKA 1A8LA 4RUVA 4G9HA 1ERUA 2RM6A 2A2PA 1AQWA 5HR1A 1S3DA 4NMUA 5ECQB 2NDOA 3QOUA 4GQCA 3ZITA 1V2AA 1M7TA 1XBSA 1GWCA 1FHEA 3D4TA 3BBYA 4AKHA 2WCIA 3HVSA 1GSDA 5ECOB 4Q5FA 2H76A 4WBJA 4MLYA 2BMXA 5ENUA 1GSSA 4IJ3A 1W89A 3EMXA 2VL9A 2CZ2A 3ERWA 1Z5YE 3L78A 4MA9A 3VWXA 5D73A 4AGSA 1ZGNA 6GSVA 2AV4A 4CDOA 2VCZA 4XS1A 3CSHA 3H8QA 4LL1B 4O5RA 1TRWA 1N25A 1VF1A 2H6ZA 2GSSA 2GQLA 3DRNA 2GTUA 5AN1A 1OE7A 1FW1A 2N5AA 3QFBC 1WJKA 5H5RA 4H86A 5DJLA 3LG6A 2BTOT 2XC2A 5KEJA 5IO2A 4ZBBA 2CQ9A 2X4AA 1PX6A 2ES7A 2H73A 4D73A 2QSIA 4TR1A 4HI7A 3M0FA 1U87A 3UBLA 2L5OA 2R6KA 6GSTA 4PNFA 4WKWA 3FK8A 4XRDA 1U88A 4ECBA 2FHEA 1EV4A 5CRHA 3C8EA 1T00A 3FRCA 3IE3A 1X0RA 1K3LA 2E2GA 3UEMA 1GL8A 1VF4A 5CRWA 5A5KA 1EP8A 2B3SA 2YANA 4G01A 5IOXA 3R2QA 2QA1A 3TDGA 2LSTA 2CV4A 4TOPA 2H72A 2L4QA 2JU5A 5A34A 2F8FA 2DJ2A 3D4MA 3J7Yb 2GQKA 3QAWA 1EZKA 3HVXA 1AC1A 2GZYA 2IMIA 3Q19A 4AKIA 3WT2A 5IM9A 3GYKA 3GX0A 5JCUA 3G9BA 2LUSA 4K9ZA 1M2DA 2FY6A 4NWYA 2L4CA 3VWWA 4ILFA 1TJDA 2VD1A 5ECHB 4V1Ag 1PD21 2DJKA 2AYTA 2L59A 1KNGA 1JFUA 2V2GA 4POBA 2CVKA 5F06A 5CNWA 2GZPA 3KH7A 4EVMA 4MJCA 4BVYA 3WGXA 1HQOA 4AJ8A 4KNDA 3FR6A 1Z7RA 2B7KA 1TK8B 3KTBA 1YEPA 6GSWA 3HY2A 2OBKA 1GLQA 4ML1A 3A2VA 3EWLA 1UC7A 1V9WA 5LCZA 1XOAA 4F82A 4PXOA 1VRSD 2AHEA 5ECMB 3G7JA 4GXZA 4WF5A 4BPYA 1NHYA 3EMPA 4YKGA 20GSA 2V1MA 1T4YA 3IOSA 3UBKA 3BOAA 1OC9B 2MYGA 3GKMA 1U6TA 3OR5A 3RHBA 3GNJA 2H0IA 3HHVA 1I5GA 3LXTA 4HZ4A 2PPTA 4GRFA 2C80A 2FA8A 5J4YA 5BRTA 2G0FA 3CBUA 2B1LA 4IGJA 1DSBA 4FH8A 3HA9A 1O7UA 2FCHA 4EKZA 3FMWA 3LFLA 5ABRA 4NHWA 5ECSA 3KXOA 3GTUB 4ZB8A 1J9BA 2P5QA 5IPHA 1R4WA 1Q98A 1ZOFA 2FA4A 3GSTA 1TW9A 3KMOA 4MH3A 4JU5A 1A8YA 1TI1A 2R4VA 3HYPA 4MH2A 1O73A 3M8NA 1EV9A 4KCAA 4TXOB 4E8HA 3KM6A 3GKKA 4IP6A 1PGTA 1F6MC 1OVNA 1ON4A 2KP1A 3LSZA 1AAZA 3KZQA 18GSA 4N0VA 1OAZA 2PBJA 1BEDA 1X5DA 2FUG2 4HEA2 4MZWA 5KN3A 2RLIA 2IL3A 2C8UA 2M46A 3UL3A 4NAXA 2LRNA 3SBCA 5AIXA 3NZNA 4IS0A 3WYWA 1ZYPA 2ON5A 3TKSE 3F9UA 4MZCA 5HR0A 3UOMA 3QAGA 4AKGA 4I5QA 5IMZA 5IIZA 2EIOA 2K9FA 3BCIA 2IN3A 1JZDA 1J08A 3CTGA 1QK8A 3I9V2 6GSUA 3A5IA 3P2AA 3F4RA 1ST9A 3J7Yk 1SJIA 5D9VA 2PMTA 5DQSA 2VLUA 1GTAA 4HOJA 5EL8A 1FVJA 2IMEA 3HJOA 5J4VA 4P3YB 4IW9A 2DMMA 2O89A 4XS6A 1HNBA 4TR1B 4DSRA 2H1LA 4HUAA 1A2LA 3CRUA 3F6FA 4ECCA 1GTBA 5GAPD 5CO3A 4IP1A 4WXTA 3FEUA 3QFAC 4ECJA 3F0IA 4MMMA 2GLRA 3O3TA 5H5SA 3S9FA 3CSIA 2DIZA 2IJYA 2L57A 4GSSA 1FOHA 5GSSA 2WDUA 1AQVA 3VI7A 5LNKe 2FWGA 4XIHA 2IMKA 3TKSC 1AQXA 4GLTA 2WB9A 1GNEA 3TKQA 4N30A 3F63A 1JLVA 1ERWA 3HD5A 4Q5NA 2ON7A 4EIQA 1ZYNA 3HJPA 1GTUA 2PU9C 5CREA 1M2BA 1A2MA 3M1GA 1MDJA 1K0MA 2DBCA 3IDVA 5A34B 4PQHA 4F03A 4YQVA 5JWRB 4LMVA 1B4PA 4MJBA 1Y1UA 1TP9A 1DUGA 1TXUA 4K0NA 4OCEA 1AUCA 2XBIA 1JLWA 3GUSA 3IHGA 4ECIA 4TRXA 1X5CA 4FYCA 2ZCTA 3ZLPA 1YKCA 2E2MA 2WRTA 2WULA 3DVXA 1SVMA 1KTEA 2UV8G 3L4NA 1SL2B 3MWHA 1B8XA 2H71A 1N2AA 1OC9A 4O5QA 4MF6A 4BVYB 2R3XA 2M80A 5DCHA 1SENA 4BL7A 3E9JB 4V1Ap 5FT3A 3D0ZA 2A2RA 1SL1B 1PN0A 4HQZA 2CA8A 5ECNB 2V6OA 4KA0A 4HU9A 3QR6A 2DC5A 2VO4A 1ERVA 4GDFA 4JBBA 2REMA 4HJ2A 3GL3A 1K0CA 3GKXA 1O85A 3FZ9A 4JZQA 1KBNA 4MNNA 1RK4A 1XWBA 1X9WB 5J40A 3IC4A 3RDWA 7GSSA 3FKFA 1VF3A 5J4UA 4Q5QA 3A2WA 3KGKA 3FR3A 2KUCA 1K3OA 2IMFA 5ECIB 1R26A 3G7IA 2A4VA 1SL0B 5EY6A 1MTCA 1GSQA 4YH2A 2RIIA 4KGIA 6GSSA 1QGVA 2HRKA 1XW9A 2MMOA 4G19A 2H6YA 2HI7A 4X0XA 4FYBA 1U3IA 1V40A 1TI3A 1VGLA 2PVQA 4QL9A 1WRYA 4IJIA 1EGRA 4KUNA 2QA2A 4J56E 1PKZA 1Y25A 1A2JA 2FLSA 2IMDA 1QUWA 1ZCPA 2DJ3A 5BMUA 1VF2A 2L6CA 2GVPA 4BWQA 5D9WA 4IHUA 1T1VA 4KF9A 4K5SA 2CZ3A 3P7XA 2H74A 3UIWA 4GWRA 1EEJA 2X99A 1YDKA 3E0UA 4TKYA 3F6DA 1YF1A 2C3TA 1ERTA 3KP9A 3VPTA 2JACA 2FWEA 2DKHA 2YN1A 1WIKA 3US3A 3D21A 5A4VA 1PSQA 1FOVA 1SYXA 1T3BA 1WE0A 4LA1A 1T4ZA 3ERGA 3EINA 2HXKA 3BD2A 2GSTA 1EOHA 4DSSA 5FHIA 3UARA 3FZ5A 5A4UA 1OYJA 5HQPA 3APOA 1K3YA 4XRAA 1TU8A 5G30A 2PWJA 4TN8A 1GRXA 5IQYA 2V6KA 3VK9A 2GQMA 5IMCA 5DVBA 2R0CA 3EVIA 5IMFA 5ID2A 2H1DA 3CXGA 1G6YA 4Q5RA 2IWTA 1HNCA 4MK3A 2VLTA 4V2NA 4HJMA 4F0BA 2X64A 5IO0A 4YAVA 5B6NA 1CQHA 2VL3A 4N3ZA 3TKRA 3KD0A 2C3NA 4F0CA 3ZL5A 1HYUA 4W66A 4ZBDA 4XCSA 3ZVJA 4PQIA 2VL2A 2YJHA 3IV4A 1PKWA 3L9SA 6GSXA 1Z6MA 3ME8A 1E6BA 2H0HA 3HCZA 5E59A 2YV7A 4CW9A 1UA5A 3IK9A 3HZ8A 2GSQA 4K0GA 4USSA 3GKNA 1TRVA 1BAYA 3DIEA 2YP6A 2R5GA 2YWOA 1IYIA 3D22A 1NHOA 2RM5A 3TOTA 5IMAA 3BCKA 3VURA 3A5WA 4JR6A 4I6XA 3TCOA 2MMZA 1PX7A 4V2LA 4POMA 2KLXA 4IELA 4WF4A 1TRUA 2R2JA 2WFCA 3IA1A 5AISA 3EU3A 3F4SA 3LWAA 1DBYA 2R0PA 1Z7PA 2OKAA 2VUPA 4L5OA 4OO5A 3FY7A 3U6VA 1NW2A 2B5XA 1A0RP 1WP0A 4ACSA 4MPGA 3IAM2 1GTIA 2HE3A 2LJKA 3MSZA 1BG5A 3PR8A 3I69A 3TJKA 1XWAA 5DQYA 3GSSA 1K0BA 2X8GA 5J47A 1JZOA 1GNWA 1GSEA 3DD3A 4JRRA 2DSAA 4ISDA 1JHBA 1IYHA 6GSYA 3LQ7A 4EDZA 1HD2A 3GFKA 4QQ7A 5DBQA 2JZRA 1XWCA 1N8JA 3ZRDA 1LJRA 1F9MA 2LRTA 2O87A 4JEDA 1FG4A 2D2ZA 2YOIA 1S3CA 4MDCA 5JCGA 4BL7B 2OT3A 1YZXA 1ILOA 5CAXA 4MF7A 1QFNA 1SU9A 1SKWB 2EFHA 5HR3A 1QXHA 2H66A 5DDLA 11GSA 2I4AA 2I3YA 4EUYA 5A5HA 5IOWA 1M99A 3APQA 5JCWA 3D6IA 1PRXA 4DVCA 2K8VA 4WR5A 3RPPA 5EVOA 2LQQA 2OE3A 2WJUA 3IK7A 2VCTA 1MEKA 2GT5A 2DIYA 1TK5B 3QMXA 2VAFA 2X8CA 1XIYA 1F3BA 2EC4A 4FO5A 1OKDA 5F0GA 4TXVA 2HQTA 1DE2A 1SJ6A 2HRKB 4OFMA 3VLNA 1SYRA 1ABAA 3IHQA 4Z2UA 2H8LA 2VCXA 4QMKA 2V41A 4TR3A 1WOUA 4MJEA 2B6MA 3AY8A 4K7IA 3LJRA 3UJ1A 2NPBA 4ZXGA 1MDKA 2C0FA 3DMLA 3SWLA 3GH9A 3CSJA 3ZYWA 4L0WA 3RPNA 3TRXA 5BMUB 2H75A 4J57E 2DMLA 1J0FA 4K1FA 4O92A 2GGTA 1TK0B 1F37A 1Y6EA 4KDUA 2HRAA 4EIPA 4GQFA 2C3QA 2VD0A 4OWYA 3FR9A 4MABA 1XWGA 1EP7A 3NIVA 1V57A 1B9YC 4K8MA 2F51A 13GSA 2HYXA 5D96A 4TR0A 3L9UA 4V2MA 3LGCA 2WS2A 4KH7A 1EEMA 3TUEA 3ZVJD 3F3QA 1TTZA 2F9SA 2TRCP 1F2EA 4NPBA 1Q4JA 3QD9A 3ED3A 1URMA 4O32A 3A3TA 5JWQB 3TKPA 1B4QA 5HR2A 2H1AA 5DAKA 2CVBA 3IR4A 3WD6A 1DE1A 4DSSB 2GSRA 1XOBA 3PPUA 2F3MA 4YAPA 4ZIJA 4I2TA 5G5FA 5L71A 4GCIA 4JR4A 3TRQA 5CRDA 2P0GA 2HSNB 3ZTLA 8GSSA 4KDXA 5ECLB 2DJ1A 2M72A 3QAVA 3FW2A 5ID2B 2MMAA 5G31A 3CTFA 3ME7A 5G1KA 3I43A 4NV5A 2VM2A 5D9TA 1C72A 1BQ7A 5J41A 4O5UA 2RUEA 2LQOA 3G7YA 2LKUA 2EFEA 2HNLA 1FB0A 5KN2A 2PN8A 4N10A 5E4WA 3C7MA 3ZREA 2B1KA 3EU4A 1X5EA 4WETA 4XS4B 2J9HA 3VFIA 2LNTA 4K5RA 1GLPA 2HSHA 3HVVA 3QDNA 1BG1A 2HT9A 4BA7A 2XPEA 4AJ6A 3UVHA 4BWSA 3IPZA 1M0UA 3HJMA 4PTSA 3P90A 2HSMA 5GSTA 5C04A 1QMVA 1KEBA 3EPTA 4HZ2A 2I81A 5H5QA 2C4JA 1OE8A 3HDCA 4QL7A 3KCMA 4XHMA 3M9KA 2X49A 3ZIJA 3IC8A 4IN0A 3DGQA 1R5PA 2TRXA 4ZILA 2YJ7A 3LYPA 4MZBA 1Z9HA 1YVLA 9GSSA 2OACA 1ZZYA 5DJMA 3W6GA 4G0LA 3EE2A 2BJXA 4WEYA 1O8WA 4K7OA 3VWUA 2K18A 3TJFA 5G5EA 4K7NA 4I8BA 2HFDA 4MPFA 2P5RA 1EOGA 2N5FA 4AI6A 1GSYA 1K0NA 2YV9A 4MCUA 2PUKC 1K0OA 1I9DA 4EDYA 1SK2A 1W4VA 4WBRD 3Q18A 3DYRA 3GV1A 1K0DA 2G2QA 3HXSA 4DEJA 2IPAA 4KSOA 2OA7A 2HZEB 3TJGA 3MDKA 2MZCA 3C1RA 4OO4A 4ML6A 3LORA 2QKEA 1GUKA 1PL2A 4E8EA 3MNGA 2A2SA 1PMTA 1XZOA 1K0AA 2CX3A 4MP4A 2FNOA 5A5HB 1XW5A 4GF0A 5F07A 2F8AA 3HKRA 1TDIA 1YQ1A 1WPIA 1SD9A 1USBA 1YKAA 2H30A 2VL2C 3PINA 2C1YA 1M9AA 4WR4A 1LBKA 3IXRA 3NOFA 1YJ6A 2EFDA 2OBIA 4TW5A 3FHKA 2GT6A 1SK0A 1ACVA 4NXIA 2NBSA 3Q74A 1PQNA 4I2UA 2AUVA 5G2ZA 4CHSA 1E2YA 2ALBA 3WGEA 5G1LA 5DCGA 4TR4A 1SKRB 2H19A 2GS3A 2FWHA 4EO3A 1GUMA 4ZBAA 1FAAA 5KOWA 4PX1A 1YF0A 3TJBA 4PUAA 1XPVA 5IPGA 3LXZA 1G7OA 4ULXA 2E0QA 19GSA 3GMFA 1ZYQB 1TOFA 3GURA 4PUFC 2O85A 1Z3EA 1H75A 1A24A 2DJJA 3IRAA 2KOKA 3VPQA 1RW1A 2A4HA 3HZ4A 2HSNA 2H1GA 4LLRA 1PL1A 4YKFA 1M2AA 2Z9SA 3C1SA 3LYKA 2PERA 2O8VB 1MDIA 12GSA 4YQUA 3TB2A 1V58A 4PURA 4XTSA 3PGTA 2YWMA 5B8AA 4G2EA 2EIQA 1TU7A 3TJJA 2X8HA 4BVXA 2IFQB 2YWIA 3RBTA 2DLXA 1X9MB 3F8UA 4LMWA 1XVQA 5DAKB 4POKA 5A1NB 3GX8A 1B9XC 1GUHA 1SJZA 2VOCA 5ELGA 4KX4A 4XS4A 1R5AA 3QCPA 4K2DA 3H4KA 1G6WA 17GSA 3GL5A 2H6XA 3ZMLA 1XXUA 1O81A 4MJAA 3RAZA 2VCQA 4ZB6A 5IMDA 1A23A 4N11A 4RQRA 3MIXA 3GN3A 1TRSA 2QC7A 4X1UA 2LS5A 3APSA 3EURA 2VKZG 2YWNA 3DWVA 3W8SA 4O7HA 1EGOA 1A0FA 2MBTA 2K8SA 1BX9A 2YCDA 2XPDA 4ZL7A 2PVOC 2ZUPA 4E68A 5CYYA 4AKXB 3DEXA 1O6JA 3CRTA 4IQ1A 1B48A 1UVZA 1UN2A 3GHAA 14GSA 4EXJA 4GSNA 4IKHA 5J9BA 1AXDA 1CQGA 5A4WA 5B6MA 2JADA 3GRXA 4LL4B 2C0EA 3UAPA 4AJ7A 2HSMB 4MF5A 3ZIVA 1R7HA 4G10A 1WWJA 4RI6A 3D5JA 22GSA 2JSZA 5F8BA 1SKSB 4ID0A 5HFGA 3KP8A 3M3MA 1LU4A 2YPMA 1ZMAA 2GDRA 2FWFA 2VM1A 1U3AA 3Q6OA 1PN9A 2AAWA 1THXA 2HLSA 2HZEA 4KSMA 3F3RA 4DSQA 4AF2A 2C0GA 3KIJA 1NM3A 3H79A 2P31A 5CP1A 3UMAA 4J2FA 3IBHA 1XVWA 1AIUA 1GH2A 3KMNA 3L9VA 3KJYA 5INYA 4PNGA 1ML6A 2ZNMA 5JWOB 2LV3A 2L5LA 5ECRB 2H01A 2OJLA 2CX4A 5D9XA 2YZUA 1JZRA 3JCML 5EPFA 1GP1A 3E3EA 4HQSA 1MD3A 2VCVA 5DALB 2LEGA 1XW6A 5F05A 3C73A 5D8IA 4EE0A 3UVTA 2J23A 4G0IA 5IMVA 1XCCA 4K2XA 4I97A 1XWKA 2QGVA 4POLA 3LEFA 3U5RE 2JZTA 2EFCA 3A2XA 3TGZA 3M9JA 1SK1A 3WGDA 5AGYA 2HRFA 3CYNA 1FB6A 2V32A 2LRCA 2OADA 3PH9A 4OD7A 2B7JA 3WT1A 2JL4A 1T7PB 3TOUA 1H4OA 16GSA 4NV2A 4PGTA 3DVWA 4ZL9A 5HFIA 2B5EA 2H0GA 2OE1A 3DKSA 2AJQB 1F3AA 2KHPA 1G0TA 2E7PA 3LW9A 2LJRA 4A5PA 2K6VA 4EC0A 1WMJA 2WGRA 1RQMA 5FWGA 4IBPA 4OMVA 2LTKA 3H93A 2MBSA 4F9ZA 4X43A 2N5BA 2CVDA 2DJ0A 3KEBA 5C00A 2B5YA 5ECPB 2I9HA 3HMJG 3K8NA 4HDEA 4GSTA 5GAND 3VI5A 5AIVA 1AW9A 2IFQA 5COHA 4ZB9A 4F2IA 3ZMKA 2HZFA 4HU7A 5A1NA 4JE1A 3GIXA 4GTUA 1NSWA 1TXXA 2JZSA 3FZ4A 3ZFBA 2H70A 2VCWA 2VLVA 4FYUA 4ZL8A 3KTLA 3L0HA 1G7EA 1EWXA 2XHFA 4D73B 2NVLA 4FQUA 5B8BA 2FGXA 4IVFA 4ICYA 3I6AA 2R37A 2WZ9A 2XBQA 4FIWA 3N9JA 1HNAA 1FO5A 4KAEA 3N5OA 3C71A 4BVXB 10GSA 3KH9A 3GH6A 1ZYEA 1OKTA 1PA3A 3CWGA 4KW6A 4KE3A 3EYTA 4IQAA 2IIYA 4PQ1A 2LNSA 5J9CA 3ERFA 2EIRA 4EL1A 4N0ZA 2TIRA 4NHZA 2UZ8A 1OC8A 1BYEA 1MD4A 3P8WA 5KOXA 4L0UA 1M9BA 2KP2A 1ZL9A 3EC3A 3QPMA 3F4TA 2MMNA 2DKIA 2NTOA 5J5NA 2GZZA 5LD0A 1S3AA 1FVKA 4G0KA 1T8EB 5ECKB 4RQXA 4KDYA 2CAIA 3GA4A 1V98A 3IAS2 4OFTA 3H1NA 1OC3A 3CMIA 5D93A 4ZB7A 1Z6NA 2FD3A 3VWVA 2OE0A 3BJ5A 2PGTA 1XFLA 5KN0A 3ISOA 2RUFA 3W8JA 3ZFLA 2O7KA 3TRPA 1JZWA 3FZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EF0 A;  5CRG A;  2I1U A;  2HSY A;  5KN1 A;  4OFN A;  4TVE A;  2YNX A;  1GSF A;  3ZZX A;  4OCF A;  3O76 A;  4L8E A;  4HS1 A;  1X9S B;  2CT6 A;  3GTU A;  5DAL A;  2JSY A;  4KCE A;  5GZZ B;  1SD8 A;  2VIM A;  3O6T A;  2CAQ A;  3FYG A;  5B7C A;  1O8X A;  5J3R A;  1TKD B;  4RI7 A;  2YZH A;  5ELA A;  1YY7 A;  4YQM A;  1GUL A;  4L5L A;  3R3E A;  2L6D A;  4K6X A;  3RHC A;  4KB3 A;  4Z7X A;  3TKS A;  4TXO A;  2C0D A;  3V1W A;  3MAK A;  1QQ2 A;  2LJA A;  2AB6 A;  3DXB A;  1GSU A;  1THO A;  1BJX A;  2H1B A;  2HRN A;  1YEX A;  5HFK A;  1A8L A;  4RUV A;  4G9H A;  1ERU A;  2RM6 A;  1AQW A;  5HR1 A;  1S3D A;  4NMU A;  5ECQ B;  2NDO A;  3QOU A;  4GQC A;  3ZIT A;  1V2A A;  1M7T A;  1XBS A;  1GWC A;  1FHE A;  3D4T A;  3BBY A;  2WCI A;  3HVS A;  1GSD A;  5ECO B;  4Q5F A;  2H76 A;  4WBJ A;  4MLY A;  2BMX A;  5ENU A;  1GSS A;  4IJ3 A;  1W89 A;  3EMX A;  2VL9 A;  2CZ2 A;  3ERW A;  1Z5Y E;  3L78 A;  4MA9 A;  3VWX A;  5D73 A;  4AGS A;  1ZGN A;  6GSV A;  2AV4 A;  4CDO A;  2VCZ A;  4XS1 A;  3CSH A;  3H8Q A;  4LL1 B;  4O5R A;  1TRW A;  1VF1 A;  2H6Z A;  2GSS A;  2GQL A;  3DRN A;  2GTU A;  5AN1 A;  1OE7 A;  1FW1 A;  2N5A A;  3QFB C;  1WJK A;  5H5R A;  4H86 A;  5DJL A;  3LG6 A;  2BTO T;  2XC2 A;  5KEJ A;  5IO2 A;  4ZBB A;  2CQ9 A;  1PX6 A;  2ES7 A;  2H73 A;  4D73 A;  2QSI A;  4TR1 A;  4HI7 A;  3M0F A;  1U87 A;  3UBL A;  2L5O A;  2R6K A;  6GST A;  4PNF A;  4WKW A;  3FK8 A;  4XRD A;  1U88 A;  4ECB A;  2FHE A;  1EV4 A;  5CRH A;  3C8E A;  1T00 A;  3FRC A;  3IE3 A;  1X0R A;  1K3L A;  2E2G A;  3UEM A;  1GL8 A;  1VF4 A;  5CRW A;  5A5K A;  1EP8 A;  2B3S A;  2YAN A;  5IOX A;  3R2Q A;  3TDG A;  2LST A;  2CV4 A;  4TOP A;  2H72 A;  2L4Q A;  2JU5 A;  2F8F A;  2DJ2 A;  3D4M A;  3J7Y b;  2GQK A;  3QAW A;  1EZK A;  3HVX A;  1AC1 A;  2GZY A;  2IMI A;  3Q19 A;  3WT2 A;  5IM9 A;  3GYK A;  3GX0 A;  5JCU A;  3G9B A;  2LUS A;  4K9Z A;  1M2D A;  2FY6 A;  4NWY A;  2L4C A;  3VWW A;  4ILF A;  1TJD A;  2VD1 A;  5ECH B;  4V1A g;  1PD2 1;  2DJK A;  2AYT A;  2L59 A;  1KNG A;  1JFU A;  2V2G A;  4POB A;  2CVK A;  5F06 A;  5CNW A;  2GZP A;  3KH7 A;  4EVM A;  4MJC A;  4BVY A;  3WGX A;  1HQO A;  4AJ8 A;  4KND A;  3FR6 A;  1Z7R A;  2B7K A;  1TK8 B;  3KTB A;  1YEP A;  6GSW A;  3HY2 A;  2OBK A;  1GLQ A;  4ML1 A;  3A2V A;  3EWL A;  1UC7 A;  1V9W A;  5LCZ A;  1XOA A;  4F82 A;  4PXO A;  1VRS D;  2AHE A;  5ECM B;  3G7J A;  4GXZ A;  4WF5 A;  4BPY A;  1NHY A;  3EMP A;  20GS A;  2V1M A;  1T4Y A;  3IOS A;  3UBK A;  3BOA A;  1OC9 B;  2MYG A;  3GKM A;  1U6T A;  3OR5 A;  3RHB A;  3GNJ A;  2H0I A;  3HHV A;  1I5G A;  3LXT A;  4HZ4 A;  2PPT A;  4GRF A;  2C80 A;  2FA8 A;  2G0F A;  3CBU A;  2B1L A;  4IGJ A;  1DSB A;  4FH8 A;  3HA9 A;  1O7U A;  2FCH A;  4EKZ A;  3LFL A;  5ABR A;  4NHW A;  5ECS A;  3KXO A;  3GTU B;  4ZB8 A;  1J9B A;  2P5Q A;  5IPH A;  1R4W A;  1Q98 A;  1ZOF A;  2FA4 A;  3GST A;  1TW9 A;  3KMO A;  4MH3 A;  4JU5 A;  1A8Y A;  1TI1 A;  2R4V A;  3HYP A;  4MH2 A;  1O73 A;  3M8N A;  1EV9 A;  4KCA A;  4TXO B;  4E8H A;  3KM6 A;  3GKK A;  4IP6 A;  1PGT A;  1F6M C;  1OVN A;  1ON4 A;  2KP1 A;  3LSZ A;  1AAZ A;  3KZQ A;  18GS A;  4N0V A;  1OAZ A;  2PBJ A;  1BED A;  1X5D A;  2FUG 2;  4HEA 2;  4MZW A;  5KN3 A;  2RLI A;  2IL3 A;  2C8U A;  2M46 A;  3UL3 A;  4NAX A;  2LRN A;  3SBC A;  5AIX A;  3NZN A;  4IS0 A;  3WYW A;  2ON5 A;  3TKS E;  3F9U A;  4MZC A;  5HR0 A;  3UOM A;  3QAG A;  4I5Q A;  5IMZ A;  5IIZ A;  2EIO A;  2K9F A;  3BCI A;  2IN3 A;  1JZD A;  1J08 A;  3CTG A;  1QK8 A;  3I9V 2;  6GSU A;  3P2A A;  3F4R A;  1ST9 A;  3J7Y k;  1SJI A;  5D9V A;  2PMT A;  5DQS A;  2VLU A;  1GTA A;  4HOJ A;  5EL8 A;  1FVJ A;  2IME A;  3HJO A;  4P3Y B;  4IW9 A;  2DMM A;  2O89 A;  4XS6 A;  1HNB A;  4TR1 B;  4DSR A;  4HUA A;  1A2L A;  3CRU A;  3F6F A;  4ECC A;  1GTB A;  5GAP D;  5CO3 A;  4IP1 A;  4WXT A;  3FEU A;  3QFA C;  4ECJ A;  3F0I A;  4MMM A;  2GLR A;  3O3T A;  5H5S A;  3S9F A;  3CSI A;  2DIZ A;  2IJY A;  2L57 A;  4GSS A;  5GSS A;  2WDU A;  1AQV A;  3VI7 A;  5LNK e;  2FWG A;  4XIH A;  2IMK A;  3TKS C;  1AQX A;  4GLT A;  2WB9 A;  1GNE A;  3TKQ A;  4N30 A;  3F63 A;  1JLV A;  1ERW A;  3HD5 A;  4Q5N A;  2ON7 A;  3HJP A;  1GTU A;  2PU9 C;  5CRE A;  1M2B A;  1A2M A;  3M1G A;  1MDJ A;  1K0M A;  2DBC A;  3IDV A;  4PQH A;  4F03 A;  4YQV A;  5JWR B;  4LMV A;  1B4P A;  4MJB A;  1TP9 A;  1DUG A;  4K0N A;  4OCE A;  1AUC A;  2XBI A;  1JLW A;  3GUS A;  4ECI A;  4TRX A;  1X5C A;  4FYC A;  2ZCT A;  3ZLP A;  1YKC A;  2E2M A;  2WRT A;  2WUL A;  3DVX A;  1KTE A;  3L4N A;  1SL2 B;  3MWH A;  1B8X A;  2H71 A;  1N2A A;  1OC9 A;  4MF6 A;  4BVY B;  2R3X A;  2M80 A;  5DCH A;  1SEN A;  4BL7 A;  3E9J B;  4V1A p;  5FT3 A;  3D0Z A;  2A2R A;  1SL1 B;  4HQZ A;  2CA8 A;  5ECN B;  2V6O A;  4KA0 A;  4HU9 A;  3QR6 A;  2DC5 A;  2VO4 A;  1ERV A;  4JBB A;  2REM A;  4HJ2 A;  3GL3 A;  1K0C A;  3GKX A;  1O85 A;  3FZ9 A;  4JZQ A;  1KBN A;  1RK4 A;  1XWB A;  1X9W B;  3IC4 A;  3RDW A;  7GSS A;  3FKF A;  1VF3 A;  5J4U A;  4Q5Q A;  3A2W A;  3KGK A;  3FR3 A;  2KUC A;  1K3O A;  2IMF A;  5ECI B;  1R26 A;  3G7I A;  2A4V A;  1SL0 B;  5EY6 A;  1MTC A;  1GSQ A;  4YH2 A;  2RII A;  4KGI A;  6GSS A;  1QGV A;  2HRK A;  1XW9 A;  2MMO A;  4G19 A;  2H6Y A;  2HI7 A;  4X0X A;  4FYB A;  1U3I A;  1V40 A;  1TI3 A;  1VGL A;  2PVQ A;  4QL9 A;  1WRY A;  4IJI A;  1EGR A;  4KUN A;  4J56 E;  1PKZ A;  1Y25 A;  1A2J A;  2FLS A;  2IMD A;  1QUW A;  1ZCP A;  2DJ3 A;  5BMU A;  1VF2 A;  2L6C A;  2GVP A;  4BWQ A;  5D9W A;  4IHU A;  1T1V A;  4KF9 A;  2CZ3 A;  3P7X A;  2H74 A;  3UIW A;  4GWR A;  1EEJ A;  2X99 A;  1YDK A;  3E0U A;  4TKY A;  3F6D A;  1YF1 A;  2C3T A;  1ERT A;  3KP9 A;  3VPT A;  2JAC A;  2FWE A;  2YN1 A;  1WIK A;  3US3 A;  3D21 A;  5A4V A;  1PSQ A;  1FOV A;  1SYX A;  1T3B A;  1WE0 A;  4LA1 A;  1T4Z A;  3ERG A;  3EIN A;  2HXK A;  3BD2 A;  2GST A;  1EOH A;  4DSS A;  5FHI A;  3UAR A;  3FZ5 A;  5A4U A;  1OYJ A;  5HQP A;  3APO A;  1K3Y A;  4XRA A;  1TU8 A;  5G30 A;  2PWJ A;  4TN8 A;  1GRX A;  5IQY A;  2V6K A;  3VK9 A;  2GQM A;  5IMC A;  5DVB A;  3EVI A;  5IMF A;  5ID2 A;  2H1D A;  3CXG A;  1G6Y A;  4Q5R A;  2IWT A;  1HNC A;  4MK3 A;  2VLT A;  4V2N A;  4HJM A;  4F0B A;  2X64 A;  5IO0 A;  4YAV A;  5B6N A;  1CQH A;  2VL3 A;  3TKR A;  3KD0 A;  2C3N A;  4F0C A;  3ZL5 A;  1HYU A;  4ZBD A;  4XCS A;  3ZVJ A;  4PQI A;  2VL2 A;  2YJH A;  3IV4 A;  1PKW A;  3L9S A;  6GSX A;  1Z6M A;  3ME8 A;  1E6B A;  2H0H A;  3HCZ A;  5E59 A;  2YV7 A;  4CW9 A;  1UA5 A;  3IK9 A;  3HZ8 A;  2GSQ A;  4K0G A;  4USS A;  3GKN A;  1TRV A;  1BAY A;  3DIE A;  2YP6 A;  2R5G A;  2YWO A;  1IYI A;  3D22 A;  1NHO A;  2RM5 A;  3TOT A;  5IMA A;  3BCK A;  3VUR A;  3A5W A;  4JR6 A;  4I6X A;  3TCO A;  2MMZ A;  1PX7 A;  4V2L A;  4POM A;  2KLX A;  4IEL A;  4WF4 A;  1TRU A;  2R2J A;  2WFC A;  3IA1 A;  5AIS A;  3EU3 A;  3F4S A;  3LWA A;  1DBY A;  1Z7P A;  2OKA A;  2VUP A;  4L5O A;  4OO5 A;  3FY7 A;  3U6V A;  1NW2 A;  2B5X A;  1A0R P;  1WP0 A;  4ACS A;  4MPG A;  3IAM 2;  1GTI A;  2HE3 A;  2LJK A;  3MSZ A;  1BG5 A;  3PR8 A;  3I69 A;  3TJK A;  1XWA A;  5DQY A;  3GSS A;  1K0B A;  2X8G A;  1JZO A;  1GNW A;  1GSE A;  3DD3 A;  4JRR A;  2DSA A;  4ISD A;  1JHB A;  1IYH A;  6GSY A;  3LQ7 A;  4EDZ A;  1HD2 A;  3GFK A;  4QQ7 A;  5DBQ A;  2JZR A;  1XWC A;  1N8J A;  3ZRD A;  1LJR A;  1F9M A;  2LRT A;  2O87 A;  4JED A;  1FG4 A;  2D2Z A;  2YOI A;  1S3C A;  4MDC A;  5JCG A;  4BL7 B;  1YZX A;  1ILO A;  5CAX A;  4MF7 A;  1QFN A;  1SU9 A;  1SKW B;  5HR3 A;  1QXH A;  2H66 A;  5DDL A;  11GS A;  2I4A A;  2I3Y A;  4EUY A;  5IOW A;  1M99 A;  3APQ A;  5JCW A;  3D6I A;  1PRX A;  4DVC A;  2K8V A;  4WR5 A;  3RPP A;  5EVO A;  2LQQ A;  2OE3 A;  2WJU A;  3IK7 A;  2VCT A;  1MEK A;  2GT5 A;  2DIY A;  1TK5 B;  3QMX A;  2VAF A;  2X8C A;  1XIY A;  1F3B A;  2EC4 A;  4FO5 A;  1OKD A;  5F0G A;  4TXV A;  2HQT A;  1DE2 A;  1SJ6 A;  2HRK B;  4OFM A;  3VLN A;  1SYR A;  1ABA A;  3IHQ A;  2H8L A;  2VCX A;  2V41 A;  4TR3 A;  1WOU A;  4MJE A;  2B6M A;  3AY8 A;  4K7I A;  3LJR A;  3UJ1 A;  2NPB A;  4ZXG A;  1MDK A;  2C0F A;  3DML A;  3SWL A;  3GH9 A;  3CSJ A;  3ZYW A;  4L0W A;  3RPN A;  3TRX A;  2H75 A;  4J57 E;  2DML A;  1J0F A;  4K1F A;  4O92 A;  2GGT A;  1TK0 B;  1F37 A;  1Y6E A;  4KDU A;  2HRA A;  4GQF A;  2C3Q A;  2VD0 A;  4OWY A;  3FR9 A;  4MAB A;  1XWG A;  1EP7 A;  3NIV A;  1V57 A;  1B9Y C;  4K8M A;  2F51 A;  13GS A;  2HYX A;  5D96 A;  4TR0 A;  3L9U A;  4V2M A;  3LGC A;  2WS2 A;  4KH7 A;  1EEM A;  3TUE A;  3ZVJ D;  3F3Q A;  1TTZ A;  2F9S A;  2TRC P;  1F2E A;  4NPB A;  1Q4J A;  3QD9 A;  3ED3 A;  1URM A;  4O32 A;  3A3T A;  5JWQ B;  3TKP A;  1B4Q A;  5HR2 A;  2H1A A;  5DAK A;  2CVB A;  3IR4 A;  3WD6 A;  1DE1 A;  4DSS B;  2GSR A;  1XOB A;  3PPU A;  2F3M A;  4YAP A;  4ZIJ A;  4I2T A;  5G5F A;  5L71 A;  4GCI A;  4JR4 A;  3TRQ A;  5CRD A;  2P0G A;  2HSN B;  3ZTL A;  8GSS A;  4KDX A;  5ECL B;  2DJ1 A;  2M72 A;  3QAV A;  3FW2 A;  5ID2 B;  2MMA A;  5G31 A;  3CTF A;  3ME7 A;  5G1K A;  3I43 A;  4NV5 A;  2VM2 A;  5D9T A;  1C72 A;  1BQ7 A;  5J41 A;  2RUE A;  2LQO A;  3G7Y A;  2LKU A;  2HNL A;  1FB0 A;  5KN2 A;  2PN8 A;  4N10 A;  5E4W A;  3C7M A;  3ZRE A;  2B1K A;  3EU4 A;  1X5E A;  4WET A;  4XS4 B;  2J9H A;  3VFI A;  2LNT A;  1GLP A;  2HSH A;  3HVV A;  3QDN A;  2HT9 A;  4BA7 A;  2XPE A;  4AJ6 A;  3UVH A;  4BWS A;  3IPZ A;  1M0U A;  3HJM A;  4PTS A;  3P90 A;  2HSM A;  5GST A;  5C04 A;  1QMV A;  1KEB A;  4HZ2 A;  2I81 A;  5H5Q A;  2C4J A;  1OE8 A;  3HDC A;  4QL7 A;  3KCM A;  4XHM A;  3M9K A;  3ZIJ A;  3IC8 A;  4IN0 A;  3DGQ A;  1R5P A;  2TRX A;  4ZIL A;  2YJ7 A;  3LYP A;  4MZB A;  1Z9H A;  9GSS A;  2OAC A;  1ZZY A;  5DJM A;  3W6G A;  4G0L A;  3EE2 A;  2BJX A;  4WEY A;  1O8W A;  4K7O A;  3VWU A;  2K18 A;  3TJF A;  5G5E A;  4K7N A;  4I8B A;  2HFD A;  4MPF A;  2P5R A;  1EOG A;  2N5F A;  1GSY A;  1K0N A;  2YV9 A;  4MCU A;  2PUK C;  1K0O A;  1I9D A;  4EDY A;  1SK2 A;  1W4V A;  4WBR D;  3Q18 A;  3DYR A;  3GV1 A;  1K0D A;  2G2Q A;  3HXS A;  4DEJ A;  2IPA A;  4KSO A;  2OA7 A;  2HZE B;  3TJG A;  3MDK A;  2MZC A;  3C1R A;  4OO4 A;  4ML6 A;  3LOR A;  2QKE A;  1GUK A;  1PL2 A;  4E8E A;  3MNG A;  2A2S A;  1PMT A;  1XZO A;  1K0A A;  2CX3 A;  4MP4 A;  2FNO A;  1XW5 A;  4GF0 A;  5F07 A;  2F8A A;  3HKR A;  1TDI A;  1YQ1 A;  1WPI A;  1SD9 A;  1USB A;  1YKA A;  2H30 A;  2VL2 C;  3PIN A;  2C1Y A;  1M9A A;  4WR4 A;  1LBK A;  3IXR A;  3NOF A;  1YJ6 A;  2OBI A;  4TW5 A;  3FHK A;  2GT6 A;  1SK0 A;  1ACV A;  4NXI A;  2NBS A;  3Q74 A;  1PQN A;  4I2U A;  2AUV A;  5G2Z A;  4CHS A;  1E2Y A;  2ALB A;  3WGE A;  5G1L A;  5DCG A;  4TR4 A;  1SKR B;  2H19 A;  2GS3 A;  2FWH A;  4EO3 A;  1GUM A;  4ZBA A;  1FAA A;  4PX1 A;  1YF0 A;  3TJB A;  4PUA A;  1XPV A;  5IPG A;  3LXZ A;  1G7O A;  4ULX A;  2E0Q A;  19GS A;  3GMF A;  1ZYQ B;  1TOF A;  3GUR A;  4PUF C;  2O85 A;  1Z3E A;  1H75 A;  1A24 A;  2DJJ A;  3IRA A;  2KOK A;  3VPQ A;  1RW1 A;  3HZ4 A;  2H1G A;  4LLR A;  1PL1 A;  1M2A A;  2Z9S A;  3C1S A;  3LYK A;  2PER A;  2O8V B;  1MDI A;  12GS A;  4YQU A;  3TB2 A;  1V58 A;  4PUR A;  4XTS A;  3PGT A;  2YWM A;  5B8A A;  4G2E A;  2EIQ A;  1TU7 A;  3TJJ A;  2X8H A;  4BVX A;  2IFQ B;  2YWI A;  3RBT A;  2DLX A;  1X9M B;  3F8U A;  4LMW A;  1XVQ A;  5DAK B;  4POK A;  3GX8 A;  1B9X C;  1GUH A;  1SJZ A;  2VOC A;  5ELG A;  4KX4 A;  4XS4 A;  1R5A A;  3QCP A;  4K2D A;  3H4K A;  1G6W A;  17GS A;  3GL5 A;  2H6X A;  3ZML A;  1XXU A;  1O81 A;  4MJA A;  3RAZ A;  2VCQ A;  4ZB6 A;  5IMD A;  1A23 A;  4N11 A;  4RQR A;  3GN3 A;  1TRS A;  2QC7 A;  4X1U A;  2LS5 A;  3APS A;  3EUR A;  2YWN A;  3DWV A;  3W8S A;  4O7H A;  1EGO A;  1A0F A;  2MBT A;  2K8S A;  1BX9 A;  2YCD A;  2XPD A;  4ZL7 A;  2PVO C;  2ZUP A;  5CYY A;  3DEX A;  1O6J A;  3CRT A;  4IQ1 A;  1B48 A;  1UVZ A;  1UN2 A;  3GHA A;  14GS A;  4EXJ A;  4GSN A;  4IKH A;  5J9B A;  1AXD A;  1CQG A;  5A4W A;  5B6M A;  2JAD A;  3GRX A;  4LL4 B;  2C0E A;  3UAP A;  4AJ7 A;  2HSM B;  4MF5 A;  3ZIV A;  1R7H A;  4G10 A;  1WWJ A;  4RI6 A;  3D5J A;  22GS A;  2JSZ A;  5F8B A;  1SKS B;  4ID0 A;  5HFG A;  3KP8 A;  3M3M A;  1LU4 A;  2YPM A;  1ZMA A;  2GDR A;  2FWF A;  2VM1 A;  1U3A A;  3Q6O A;  1PN9 A;  2AAW A;  1THX A;  2HLS A;  2HZE A;  4KSM A;  3F3R A;  4DSQ A;  4AF2 A;  2C0G A;  3KIJ A;  1NM3 A;  3H79 A;  2P31 A;  5CP1 A;  3UMA A;  4J2F A;  3IBH A;  1XVW A;  1AIU A;  1GH2 A;  3KMN A;  3L9V A;  3KJY A;  5INY A;  4PNG A;  1ML6 A;  2ZNM A;  5JWO B;  2LV3 A;  2L5L A;  5ECR B;  2H01 A;  2OJL A;  2CX4 A;  5D9X A;  2YZU A;  1JZR A;  3JCM L;  5EPF A;  1GP1 A;  3E3E A;  4HQS A;  1MD3 A;  2VCV A;  5DAL B;  2LEG A;  1XW6 A;  5F05 A;  3C73 A;  5D8I A;  4EE0 A;  3UVT A;  2J23 A;  4G0I A;  5IMV A;  1XCC A;  4I97 A;  1XWK A;  2QGV A;  4POL A;  3LEF A;  3U5R E;  2JZT A;  3A2X A;  3TGZ A;  3M9J A;  1SK1 A;  3WGD A;  5AGY A;  2HRF A;  3CYN A;  1FB6 A;  2V32 A;  2LRC A;  2OAD A;  3PH9 A;  4OD7 A;  2B7J A;  3WT1 A;  2JL4 A;  1T7P B;  3TOU A;  1H4O A;  16GS A;  4NV2 A;  4PGT A;  3DVW A;  4ZL9 A;  5HFI A;  2B5E A;  2H0G A;  2OE1 A;  3DKS A;  2AJQ B;  1F3A A;  2KHP A;  1G0T A;  2E7P A;  2LJR A;  2K6V A;  4EC0 A;  1WMJ A;  2WGR A;  1RQM A;  5FWG A;  4IBP A;  4OMV A;  2LTK A;  3H93 A;  2MBS A;  4F9Z A;  4X43 A;  2N5B A;  2CVD A;  2DJ0 A;  3KEB A;  5C00 A;  2B5Y A;  5ECP B;  2I9H A;  3K8N A;  4HDE A;  4GST A;  5GAN D;  3VI5 A;  5AIV A;  1AW9 A;  2IFQ A;  5COH A;  4ZB9 A;  4F2I A;  3ZMK A;  2HZF A;  4HU7 A;  4JE1 A;  3GIX A;  4GTU A;  1NSW A;  1TXX A;  2JZS A;  3FZ4 A;  3ZFB A;  2H70 A;  2VCW A;  2VLV A;  4FYU A;  4ZL8 A;  3KTL A;  3L0H A;  1G7E A;  1EWX A;  2XHF A;  4D73 B;  2NVL A;  4FQU A;  5B8B A;  2FGX A;  4IVF A;  3I6A A;  2R37 A;  2WZ9 A;  2XBQ A;  4FIW A;  3N9J A;  1HNA A;  1FO5 A;  4KAE A;  3N5O A;  3C71 A;  4BVX B;  10GS A;  3KH9 A;  3GH6 A;  1ZYE A;  1OKT A;  1PA3 A;  4KW6 A;  4KE3 A;  3EYT A;  4IQA A;  2IIY A;  4PQ1 A;  2LNS A;  5J9C A;  3ERF A;  2EIR A;  4EL1 A;  4N0Z A;  2TIR A;  4NHZ A;  2UZ8 A;  1OC8 A;  1BYE A;  1MD4 A;  3P8W A;  4L0U A;  1M9B A;  2KP2 A;  1ZL9 A;  3EC3 A;  3QPM A;  3F4T A;  2MMN A;  2NTO A;  5J5N A;  2GZZ A;  5LD0 A;  1S3A A;  1FVK A;  4G0K A;  1T8E B;  5ECK B;  4RQX A;  4KDY A;  2CAI A;  3GA4 A;  1V98 A;  3IAS 2;  4OFT A;  3H1N A;  1OC3 A;  3CMI A;  5D93 A;  1Z6N A;  2FD3 A;  3VWV A;  2OE0 A;  3BJ5 A;  2PGT A;  1XFL A;  5KN0 A;  3ISO A;  2RUF A;  3W8J A;  3ZFL A;  2O7K A;  3TRP A;  1JZW A;  3FZA A; 
#chains in the Genus database with same CATH topology
 4EF0 A;  5CRG A;  2I1U A;  2HSY A;  5KN1 A;  4OFN A;  4TVE A;  2YNX A;  1GSF A;  3ZZX A;  4OCF A;  3O76 A;  2O5V A;  4L8E A;  4HS1 A;  4CY8 A;  1X9S B;  4X4J A;  2CT6 A;  3GTU A;  5DAL A;  2JSY A;  4KCE A;  5GZZ B;  1SD8 A;  2VIM A;  3O6T A;  2CAQ A;  1SVL A;  3TU3 B;  3FYG A;  4Z2R A;  5B7C A;  1O8X A;  1BF5 A;  5J3R A;  1TKD B;  4RI7 A;  4Z2T A;  2YZH A;  5ELA A;  1YY7 A;  1SVO A;  4YQM A;  3MYD A;  1GUL A;  4L5L A;  3R3E A;  2L6D A;  4K6X A;  3RHC A;  4KB3 A;  4Z7X A;  3TKS A;  4TXO A;  2C0D A;  3V1W A;  3MAK A;  1QQ2 A;  2LJA A;  2AB6 A;  3DXB A;  1GSU A;  2R0G A;  1THO A;  1BJX A;  2H1B A;  4CY6 A;  2HRN A;  1YEX A;  1S3R A;  5HFK A;  1A8L A;  4RUV A;  4G9H A;  1ERU A;  2RM6 A;  2A2P A;  1AQW A;  5HR1 A;  1S3D A;  4NMU A;  5ECQ B;  2NDO A;  3QOU A;  4GQC A;  3ZIT A;  1V2A A;  1M7T A;  1XBS A;  1GWC A;  1FHE A;  3D4T A;  3BBY A;  4AKH A;  2WCI A;  3HVS A;  1GSD A;  5ECO B;  4Q5F A;  2H76 A;  4WBJ A;  4MLY A;  2BMX A;  5ENU A;  1GSS A;  4IJ3 A;  1W89 A;  3EMX A;  2VL9 A;  2CZ2 A;  3ERW A;  1Z5Y E;  3L78 A;  4MA9 A;  3VWX A;  5D73 A;  4AGS A;  1ZGN A;  6GSV A;  2AV4 A;  4CDO A;  2VCZ A;  4XS1 A;  3CSH A;  3H8Q A;  4LL1 B;  4O5R A;  1TRW A;  1N25 A;  1VF1 A;  2H6Z A;  2GSS A;  3DRN A;  2GQL A;  2GTU A;  5AN1 A;  1OE7 A;  1FW1 A;  2N5A A;  3QFB C;  1WJK A;  5H5R A;  4H86 A;  5DJL A;  3LG6 A;  2BTO T;  2XC2 A;  5KEJ A;  5IO2 A;  4ZBB A;  2CQ9 A;  2X4A A;  1PX6 A;  2ES7 A;  2H73 A;  4D73 A;  2QSI A;  4TR1 A;  4HI7 A;  3M0F A;  1U87 A;  3UBL A;  2L5O A;  2R6K A;  6GST A;  4PNF A;  4WKW A;  3FK8 A;  4XRD A;  1U88 A;  4ECB A;  2FHE A;  1EV4 A;  5CRH A;  3C8E A;  1T00 A;  3FRC A;  3IE3 A;  1X0R A;  1K3L A;  2E2G A;  3UEM A;  1GL8 A;  1VF4 A;  5CRW A;  5A5K A;  1EP8 A;  2B3S A;  2YAN A;  1S4B P;  4G01 A;  5IOX A;  3R2Q A;  2QA1 A;  3TDG A;  2LST A;  2CV4 A;  4TOP A;  2H72 A;  2L4Q A;  2JU5 A;  5A34 A;  2F8F A;  2DJ2 A;  3D4M A;  3J7Y b;  2GQK A;  3QAW A;  1EZK A;  3HVX A;  1AC1 A;  2GZY A;  2IMI A;  3Q19 A;  4AKI A;  3WT2 A;  5IM9 A;  3GYK A;  3GX0 A;  5JCU A;  3G9B A;  2LUS A;  4K9Z A;  1M2D A;  2FY6 A;  4NWY A;  2L4C A;  3VWW A;  4ILF A;  1TJD A;  2VD1 A;  5ECH B;  4V1A g;  1PD2 1;  2DJK A;  2AYT A;  2L59 A;  1KNG A;  1JFU A;  2WVZ A;  2V2G A;  4POB A;  2CVK A;  5F06 A;  5CNW A;  2GZP A;  3KH7 A;  4EVM A;  4MJC A;  4BVY A;  3WGX A;  1HQO A;  4AJ8 A;  4KND A;  3FR6 A;  1Z7R A;  2B7K A;  1TK8 B;  3KTB A;  1YEP A;  6GSW A;  3HY2 A;  2OBK A;  1GLQ A;  4ML1 A;  3A2V A;  3EWL A;  1UC7 A;  1V9W A;  5LCZ A;  1XOA A;  4F82 A;  4PXO A;  3RFR C;  1VRS D;  2AHE A;  5ECM B;  3G7J A;  4GXZ A;  4WF5 A;  4BPY A;  1NHY A;  3EMP A;  4YKG A;  20GS A;  2V1M A;  1T4Y A;  3IOS A;  3UBK A;  3BOA A;  1OC9 B;  2MYG A;  3GKM A;  1U6T A;  3OR5 A;  3RHB A;  3GNJ A;  2H0I A;  3HHV A;  1I5G A;  3LXT A;  4HZ4 A;  2PPT A;  4GRF A;  2C80 A;  2FA8 A;  5J4Y A;  5BRT A;  2G0F A;  3CBU A;  2B1L A;  4IGJ A;  1DSB A;  4FH8 A;  3HA9 A;  1O7U A;  2FCH A;  4EKZ A;  3FMW A;  3LFL A;  5ABR A;  4NHW A;  5ECS A;  3KXO A;  3GTU B;  4ZB8 A;  1J9B A;  2P5Q A;  5IPH A;  1R4W A;  1Q98 A;  1ZOF A;  2FA4 A;  3GST A;  1TW9 A;  3KMO A;  4MH3 A;  4JU5 A;  1A8Y A;  2WZS A;  1TI1 A;  2R4V A;  3HYP A;  1PFO A;  4MH2 A;  1O73 A;  3M8N A;  1EV9 A;  4KCA A;  4TXO B;  4E8H A;  3KM6 A;  3GKK A;  4IP6 A;  1PGT A;  1F6M C;  1OVN A;  1ON4 A;  2KP1 A;  3LSZ A;  1AAZ A;  3KZQ A;  18GS A;  4N0V A;  1OAZ A;  2PBJ A;  1BED A;  1X5D A;  2FUG 2;  4HEA 2;  4MZW A;  5KN3 A;  2RLI A;  2IL3 A;  2C8U A;  2M46 A;  3UL3 A;  4NAX A;  2LRN A;  3SBC A;  5AIX A;  3NZN A;  4IS0 A;  3WYW A;  1ZYP A;  2ON5 A;  3TKS E;  3F9U A;  4MZC A;  5HR0 A;  3UOM A;  3QAG A;  4AKG A;  4I5Q A;  5IMZ A;  5IIZ A;  2EIO A;  2K9F A;  3BCI A;  2IN3 A;  1JZD A;  1J08 A;  3CTG A;  1QK8 A;  3I9V 2;  6GSU A;  3A5I A;  3P2A A;  3F4R A;  1ST9 A;  3J7Y k;  1SJI A;  5D9V A;  2PMT A;  5DQS A;  2VLU A;  1GTA A;  4HOJ A;  5EL8 A;  4PI0 C;  1FVJ A;  2IME A;  3HJO A;  5J4V A;  4P3Y B;  4IW9 A;  2DMM A;  2O89 A;  4XS6 A;  1HNB A;  4TR1 B;  4DSR A;  2H1L A;  4HUA A;  1A2L A;  3CRU A;  3F6F A;  4ECC A;  1GTB A;  5GAP D;  5CO3 A;  4IP1 A;  4WXT A;  3FEU A;  3QFA C;  4ECJ A;  3F0I A;  4MMM A;  2GLR A;  3O3T A;  5H5S A;  3S9F A;  3CSI A;  2DIZ A;  2IJY A;  2L57 A;  4GSS A;  1FOH A;  5GSS A;  2WDU A;  1AQV A;  3VI7 A;  5LNK e;  2FWG A;  4XIH A;  2IMK A;  3TKS C;  1AQX A;  4GLT A;  2WB9 A;  1GNE A;  3TKQ A;  4N30 A;  3F63 A;  1JLV A;  1ERW A;  3HD5 A;  4Q5N A;  2ON7 A;  4EIQ A;  1ZYN A;  3HJP A;  1GTU A;  2PU9 C;  5CRE A;  1M2B A;  1A2M A;  3M1G A;  1MDJ A;  1K0M A;  2DBC A;  3IDV A;  5A34 B;  4PQH A;  4F03 A;  4YQV A;  5JWR B;  4LMV A;  1B4P A;  4MJB A;  1Y1U A;  1TP9 A;  1DUG A;  1TXU A;  4K0N A;  4OCE A;  1AUC A;  2XBI A;  1JLW A;  3GUS A;  3IHG A;  4ECI A;  4TRX A;  1X5C A;  4FYC A;  2ZCT A;  3ZLP A;  1YKC A;  2E2M A;  2WRT A;  2WUL A;  3DVX A;  1SVM A;  1KTE A;  2UV8 G;  3L4N A;  1SL2 B;  3MWH A;  1B8X A;  2H71 A;  1N2A A;  1OC9 A;  4O5Q A;  4MF6 A;  4BVY B;  2R3X A;  2M80 A;  5DCH A;  1SEN A;  4BL7 A;  3E9J B;  4V1A p;  5FT3 A;  3D0Z A;  2A2R A;  1SL1 B;  1PN0 A;  4HQZ A;  2CA8 A;  5ECN B;  2V6O A;  4KA0 A;  4HU9 A;  3QR6 A;  2DC5 A;  2VO4 A;  1ERV A;  4GDF A;  4JBB A;  2REM A;  4HJ2 A;  3GL3 A;  1K0C A;  3GKX A;  1O85 A;  3FZ9 A;  4JZQ A;  1KBN A;  4MNN A;  1RK4 A;  1XWB A;  1X9W B;  5J40 A;  3IC4 A;  3RDW A;  7GSS A;  3FKF A;  1VF3 A;  5J4U A;  4Q5Q A;  3A2W A;  3KGK A;  3FR3 A;  2KUC A;  1K3O A;  2IMF A;  5ECI B;  1R26 A;  3G7I A;  2A4V A;  1SL0 B;  5EY6 A;  1MTC A;  1GSQ A;  4YH2 A;  2RII A;  4KGI A;  6GSS A;  1QGV A;  2HRK A;  1XW9 A;  2MMO A;  4G19 A;  2H6Y A;  2HI7 A;  4X0X A;  4FYB A;  1U3I A;  1V40 A;  1TI3 A;  1VGL A;  2PVQ A;  4QL9 A;  1WRY A;  4IJI A;  2WW3 A;  4KUN A;  1EGR A;  2QA2 A;  4J56 E;  1PKZ A;  1Y25 A;  1A2J A;  2FLS A;  2IMD A;  1QUW A;  1ZCP A;  2DJ3 A;  5BMU A;  1VF2 A;  2L6C A;  2GVP A;  4BWQ A;  5D9W A;  4IHU A;  1T1V A;  4KF9 A;  4K5S A;  2CZ3 A;  3P7X A;  2H74 A;  3UIW A;  4GWR A;  1EEJ A;  2X99 A;  1YDK A;  3E0U A;  4TKY A;  3F6D A;  1YF1 A;  2C3T A;  1ERT A;  4PI2 C;  3KP9 A;  3VPT A;  2JAC A;  2FWE A;  2DKH A;  2YN1 A;  1WIK A;  3US3 A;  3D21 A;  5A4V A;  1PSQ A;  1FOV A;  1SYX A;  1T3B A;  1WE0 A;  4LA1 A;  1T4Z A;  3ERG A;  3EIN A;  2HXK A;  3BD2 A;  2GST A;  1EOH A;  4DSS A;  5FHI A;  3UAR A;  3FZ5 A;  5A4U A;  1OYJ A;  5HQP A;  3APO A;  1K3Y A;  4XRA A;  1TU8 A;  5G30 A;  2PWJ A;  4TN8 A;  1GRX A;  5IQY A;  2V6K A;  3VK9 A;  2GQM A;  5IMC A;  1M3I A;  5DVB A;  2R0C A;  3EVI A;  5IMF A;  5ID2 A;  2H1D A;  3CXG A;  1G6Y A;  4Q5R A;  2IWT A;  1HNC A;  4MK3 A;  2VLT A;  4V2N A;  4HJM A;  4F0B A;  2X64 A;  5IO0 A;  4YAV A;  5B6N A;  1CQH A;  2VL3 A;  4N3Z A;  3TKR A;  3KD0 A;  2C3N A;  4F0C A;  3ZL5 A;  1HYU A;  4W66 A;  4ZBD A;  4XCS A;  3ZVJ A;  4PQI A;  2VL2 A;  2YJH A;  3IV4 A;  1PKW A;  3L9S A;  6GSX A;  1Z6M A;  3ME8 A;  1E6B A;  2H0H A;  3HCZ A;  5E59 A;  2YV7 A;  4CW9 A;  1UA5 A;  3IK9 A;  3HZ8 A;  2GSQ A;  4K0G A;  4USS A;  3GKN A;  1TRV A;  1BAY A;  3DIE A;  2YP6 A;  2R5G A;  2YWO A;  1IYI A;  3D22 A;  1NHO A;  2RM5 A;  3TOT A;  5IMA A;  3BCK A;  3VUR A;  3A5W A;  4JR6 A;  4I6X A;  3TCO A;  4BIK A;  2MMZ A;  1PX7 A;  4V2L A;  4POM A;  2KLX A;  4IEL A;  4WF4 A;  1TRU A;  2R2J A;  2WFC A;  3IA1 A;  5AIS A;  3EU3 A;  3F4S A;  3LWA A;  1DBY A;  2R0P A;  1Z7P A;  2OKA A;  2VUP A;  4L5O A;  4OO5 A;  3FY7 A;  3U6V A;  1NW2 A;  2B5X A;  1A0R P;  1WP0 A;  4ACS A;  4MPG A;  3IAM 2;  1GTI A;  2HE3 A;  2LJK A;  3MSZ A;  1BG5 A;  3PR8 A;  3I69 A;  3TJK A;  1XWA A;  5DQY A;  3GSS A;  1K0B A;  2X8G A;  5J47 A;  4FXY P;  1JZO A;  1GNW A;  1GSE A;  3DD3 A;  4JRR A;  2DSA A;  4ISD A;  1JHB A;  1IYH A;  6GSY A;  3LQ7 A;  4EDZ A;  1HD2 A;  3GFK A;  4QQ7 A;  5DBQ A;  2JZR A;  1XWC A;  1N8J A;  3ZRD A;  1LJR A;  1F9M A;  2LRT A;  2O87 A;  4JED A;  1FG4 A;  2D2Z A;  2YOI A;  1S3C A;  4MDC A;  5JCG A;  4BL7 B;  2OT3 A;  1YZX A;  1ILO A;  5CAX A;  4MF7 A;  1QFN A;  1SU9 A;  1SKW B;  2EFH A;  5HR3 A;  1QXH A;  2H66 A;  5DDL A;  11GS A;  2I4A A;  2I3Y A;  4EUY A;  5A5H A;  5IOW A;  1M99 A;  3APQ A;  5JCW A;  3D6I A;  1PRX A;  4DVC A;  2K8V A;  4WR5 A;  3RPP A;  5EVO A;  2LQQ A;  1I1I P;  2OE3 A;  2WJU A;  3IK7 A;  2VCT A;  1MEK A;  2GT5 A;  2DIY A;  1TK5 B;  3QMX A;  2VAF A;  2X8C A;  1XIY A;  1F3B A;  2EC4 A;  4FO5 A;  1OKD A;  5F0G A;  4TXV A;  2HQT A;  1DE2 A;  1SJ6 A;  2HRK B;  4OFM A;  3VLN A;  1SYR A;  1ABA A;  3IHQ A;  4Z2U A;  2H8L A;  2VCX A;  4QMK A;  2V41 A;  4TR3 A;  1WOU A;  4MJE A;  2B6M A;  3AY8 A;  4K7I A;  3LJR A;  3UJ1 A;  2NPB A;  4ZXG A;  1MDK A;  2C0F A;  3DML A;  3SWL A;  3GH9 A;  3CSJ A;  3ZYW A;  4L0W A;  3RPN A;  3TRX A;  5BMU B;  2H75 A;  4J57 E;  2DML A;  1J0F A;  4K1F A;  4O92 A;  2GGT A;  1TK0 B;  1F37 A;  1Y6E A;  4KDU A;  2HRA A;  4EIP A;  4GQF A;  2C3Q A;  2VD0 A;  4OWY A;  3FR9 A;  4MAB A;  1XWG A;  1EP7 A;  3NIV A;  1V57 A;  1B9Y C;  4K8M A;  2F51 A;  13GS A;  2HYX A;  5D96 A;  4TR0 A;  3L9U A;  4V2M A;  3LGC A;  2WS2 A;  2WVX A;  4KH7 A;  1EEM A;  3TUE A;  3ZVJ D;  3F3Q A;  1TTZ A;  2F9S A;  2TRC P;  1F2E A;  4NPB A;  1Q4J A;  3QD9 A;  3ED3 A;  1URM A;  4O32 A;  3A3T A;  5JWQ B;  3TKP A;  1B4Q A;  5HR2 A;  2H1A A;  5DAK A;  2CVB A;  3IR4 A;  3WD6 A;  1DE1 A;  4DSS B;  2GSR A;  1XOB A;  3PPU A;  2F3M A;  4YAP A;  4ZIJ A;  4I2T A;  5G5F A;  5L71 A;  4GCI A;  4JR4 A;  3TRQ A;  5CRD A;  2P0G A;  2HSN B;  3ZTL A;  8GSS A;  4KDX A;  5ECL B;  2DJ1 A;  2M72 A;  3QAV A;  3FW2 A;  5ID2 B;  2MMA A;  5G31 A;  3CTF A;  3ME7 A;  5G1K A;  3I43 A;  4NV5 A;  2VM2 A;  5D9T A;  1C72 A;  1BQ7 A;  5J41 A;  4O5U A;  2RUE A;  2LQO A;  3G7Y A;  2LKU A;  2EFE A;  2HNL A;  1FB0 A;  5KN2 A;  2O3E A;  2PN8 A;  4N10 A;  5E4W A;  3C7M A;  3ZRE A;  2B1K A;  3EU4 A;  1X5E A;  4WET A;  4XS4 B;  2J9H A;  3VFI A;  2LNT A;  4K5R A;  1GLP A;  2HSH A;  3HVV A;  3QDN A;  1BG1 A;  2HT9 A;  4BA7 A;  2XPE A;  4AJ6 A;  3UVH A;  4BWS A;  3IPZ A;  1M0U A;  3HJM A;  4PTS A;  3P90 A;  2HSM A;  5GST A;  5C04 A;  1QMV A;  1KEB A;  3EPT A;  4HZ2 A;  2I81 A;  5H5Q A;  2C4J A;  1OE8 A;  3HDC A;  4QL7 A;  3KCM A;  4XHM A;  3M9K A;  2X49 A;  3ZIJ A;  3IC8 A;  4IN0 A;  3DGQ A;  1R5P A;  2TRX A;  4ZIL A;  2YJ7 A;  3LYP A;  4MZB A;  1Z9H A;  1YVL A;  9GSS A;  2OAC A;  1ZZY A;  5DJM A;  3W6G A;  4G0L A;  3EE2 A;  2BJX A;  4WEY A;  1O8W A;  4K7O A;  3VWU A;  2K18 A;  3TJF A;  5G5E A;  4K7N A;  4I8B A;  2HFD A;  4MPF A;  2P5R A;  3RGB C;  1EOG A;  2N5F A;  4AI6 A;  1GSY A;  1K0N A;  2YV9 A;  4MCU A;  2PUK C;  1K0O A;  1I9D A;  4EDY A;  1SK2 A;  2WW0 A;  1W4V A;  4WBR D;  3Q18 A;  2O36 A;  3DYR A;  3GV1 A;  1K0D A;  2G2Q A;  3HXS A;  4DEJ A;  2IPA A;  4KSO A;  2OA7 A;  2HZE B;  3TJG A;  3MDK A;  2MZC A;  3C1R A;  4OO4 A;  4ML6 A;  3LOR A;  2QKE A;  1GUK A;  1PL2 A;  4E8E A;  3MNG A;  2A2S A;  1PMT A;  1XZO A;  1K0A A;  2CX3 A;  4MP4 A;  2FNO A;  1XG8 A;  5A5H B;  1XW5 A;  4GF0 A;  5F07 A;  2F8A A;  3HKR A;  1TDI A;  1YQ1 A;  1WPI A;  1SD9 A;  1USB A;  1YKA A;  2H30 A;  2VL2 C;  3PIN A;  2C1Y A;  1M9A A;  4WR4 A;  1LBK A;  3IXR A;  3NOF A;  1YJ6 A;  2EFD A;  2OBI A;  4TW5 A;  3FHK A;  2GT6 A;  1SK0 A;  1ACV A;  4NXI A;  2NBS A;  3Q74 A;  1PQN A;  4I2U A;  2AUV A;  5G2Z A;  4CHS A;  1E2Y A;  2ALB A;  3WGE A;  5G1L A;  5DCG A;  4TR4 A;  1SKR B;  2H19 A;  2GS3 A;  2FWH A;  4EO3 A;  1GUM A;  4PHZ C;  4ZBA A;  1FAA A;  5KOW A;  4PX1 A;  1YF0 A;  3TJB A;  4PUA A;  1XPV A;  5IPG A;  3LXZ A;  1G7O A;  4ULX A;  2E0Q A;  19GS A;  3GMF A;  1ZYQ B;  1TOF A;  3GUR A;  4PUF C;  2O85 A;  1Z3E A;  1H75 A;  1A24 A;  2DJJ A;  3IRA A;  2KOK A;  3VPQ A;  1RW1 A;  2A4H A;  3HZ4 A;  2HSN A;  2H1G A;  4LLR A;  1PL1 A;  4YKF A;  1M2A A;  2Z9S A;  3C1S A;  3LYK A;  2PER A;  2WW1 A;  2O8V B;  1MDI A;  12GS A;  4YQU A;  3TB2 A;  1V58 A;  2WVX B;  4PUR A;  4XTS A;  3PGT A;  2YWM A;  5B8A A;  4G2E A;  2EIQ A;  1TU7 A;  3TJJ A;  2X8H A;  4BVX A;  2IFQ B;  2YWI A;  3RBT A;  2DLX A;  1X9M B;  3F8U A;  4LMW A;  1XVQ A;  5DAK B;  4POK A;  5A1N B;  3GX8 A;  1B9X C;  1GUH A;  1SJZ A;  2VOC A;  5ELG A;  4KX4 A;  4XS4 A;  1R5A A;  3QCP A;  4K2D A;  3H4K A;  1G6W A;  17GS A;  3GL5 A;  2H6X A;  3ZML A;  1XXU A;  1O81 A;  4MJA A;  3RAZ A;  2VCQ A;  4ZB6 A;  5IMD A;  1A23 A;  4N11 A;  4RQR A;  3MIX A;  3GN3 A;  1TRS A;  2QC7 A;  4X1U A;  2WVY A;  2LS5 A;  3APS A;  3EUR A;  2VKZ G;  2YWN A;  3DWV A;  3W8S A;  4O7H A;  1EGO A;  1A0F A;  2MBT A;  2K8S A;  1BX9 A;  2YCD A;  2XPD A;  4ZL7 A;  2PVO C;  2ZUP A;  4E68 A;  5CYY A;  4AKX B;  3DEX A;  1O6J A;  3CRT A;  4IQ1 A;  1B48 A;  1UVZ A;  1UN2 A;  3GHA A;  14GS A;  4EXJ A;  4GSN A;  4IKH A;  5J9B A;  1AXD A;  1CQG A;  5A4W A;  3HVN A;  5B6M A;  2JAD A;  3GRX A;  4LL4 B;  2C0E A;  3UAP A;  4AJ7 A;  2HSM B;  4MF5 A;  3ZIV A;  1R7H A;  4G10 A;  1WWJ A;  4RI6 A;  3D5J A;  22GS A;  2JSZ A;  5F8B A;  1M3J A;  1SKS B;  4ID0 A;  5HFG A;  3KP8 A;  3M3M A;  1LU4 A;  2YPM A;  1ZMA A;  2GDR A;  3CQF A;  2FWF A;  2VM1 A;  1U3A A;  3Q6O A;  1PN9 A;  2AAW A;  1THX A;  2HLS A;  2HZE A;  4KSM A;  3F3R A;  4DSQ A;  4AF2 A;  2C0G A;  3KIJ A;  1NM3 A;  3H79 A;  2P31 A;  5CP1 A;  3UMA A;  4J2F A;  3IBH A;  1XVW A;  1AIU A;  1GH2 A;  3KMN A;  3L9V A;  3KJY A;  5INY A;  4PNG A;  1ML6 A;  2ZNM A;  5JWO B;  2LV3 A;  2L5L A;  5ECR B;  2H01 A;  2OJL A;  2CX4 A;  5D9X A;  2YZU A;  1JZR A;  4HSC X;  3JCM L;  5EPF A;  1GP1 A;  3E3E A;  4HQS A;  1MD3 A;  2VCV A;  5DAL B;  2LEG A;  1XW6 A;  2WW2 A;  5F05 A;  3C73 A;  5D8I A;  4EE0 A;  3UVT A;  2J23 A;  4G0I A;  5IMV A;  1XCC A;  4K2X A;  4I97 A;  1XWK A;  2QGV A;  4POL A;  3LEF A;  3U5R E;  2JZT A;  2EFC A;  3A2X A;  3TGZ A;  3M9J A;  1SK1 A;  3WGD A;  5AGY A;  2HRF A;  3CYN A;  1FB6 A;  2V32 A;  2LRC A;  2OAD A;  3PH9 A;  4OD7 A;  2B7J A;  3WT1 A;  2JL4 A;  1T7P B;  3TOU A;  1H4O A;  16GS A;  4NV2 A;  4PGT A;  3DVW A;  4ZL9 A;  5HFI A;  2B5E A;  2H0G A;  2OE1 A;  3DKS A;  2AJQ B;  1F3A A;  2KHP A;  1G0T A;  2E7P A;  3LW9 A;  2LJR A;  4A5P A;  2K6V A;  4EC0 A;  1WMJ A;  2WGR A;  1RQM A;  5FWG A;  4IBP A;  4OMV A;  2LTK A;  3H93 A;  2MBS A;  4F9Z A;  4X43 A;  2N5B A;  2CVD A;  2DJ0 A;  3KEB A;  5C00 A;  2B5Y A;  5ECP B;  2I9H A;  3HMJ G;  3K8N A;  4HDE A;  4GST A;  5GAN D;  3VI5 A;  5AIV A;  1AW9 A;  2IFQ A;  5COH A;  4ZB9 A;  4F2I A;  3ZMK A;  2HZF A;  4HU7 A;  5A1N A;  4JE1 A;  3GIX A;  4GTU A;  1NSW A;  1TXX A;  2JZS A;  3FZ4 A;  3ZFB A;  2H70 A;  2VCW A;  2VLV A;  4FYU A;  4ZL8 A;  3KTL A;  3L0H A;  1G7E A;  1EWX A;  2XHF A;  4D73 B;  2NVL A;  4FQU A;  5B8B A;  2FGX A;  4IVF A;  4ICY A;  3I6A A;  2R37 A;  2WZ9 A;  2XBQ A;  4FIW A;  3N9J A;  1HNA A;  1FO5 A;  4KAE A;  3N5O A;  3C71 A;  4BVX B;  10GS A;  3GH6 A;  3KH9 A;  1ZYE A;  1OKT A;  1PA3 A;  3CWG A;  4KW6 A;  4KE3 A;  3EYT A;  4IQA A;  2IIY A;  4PQ1 A;  2LNS A;  5J9C A;  3ERF A;  2EIR A;  4EL1 A;  4N0Z A;  2TIR A;  4NHZ A;  2UZ8 A;  1OC8 A;  1BYE A;  1MD4 A;  3P8W A;  5KOX A;  4L0U A;  1M9B A;  2KP2 A;  1YEW C;  1ZL9 A;  3EC3 A;  3QPM A;  3F4T A;  2MMN A;  2DKI A;  2NTO A;  5J5N A;  2GZZ A;  5LD0 A;  1S3A A;  1FVK A;  4G0K A;  1T8E B;  5ECK B;  4RQX A;  4KDY A;  2CAI A;  3GA4 A;  1V98 A;  3IAS 2;  4OFT A;  3H1N A;  1OC3 A;  3CMI A;  5D93 A;  4ZB7 A;  1Z6N A;  2FD3 A;  3VWV A;  2OE0 A;  3BJ5 A;  2PGT A;  3CHX C;  1XFL A;  5KN0 A;  3ISO A;  2RUF A;  3W8J A;  3ZFL A;  2O7K A;  3TRP A;  1JZW A;  3FZA A; 
#chains in the Genus database with same CATH homology
 4EF0 A;  5CRG A;  2I1U A;  2HSY A;  5KN1 A;  4OFN A;  4TVE A;  2YNX A;  1GSF A;  3ZZX A;  4OCF A;  3O76 A;  2O5V A;  4L8E A;  4HS1 A;  4CY8 A;  1X9S B;  4X4J A;  2CT6 A;  3GTU A;  5DAL A;  2JSY A;  4KCE A;  5GZZ B;  1SD8 A;  2VIM A;  3O6T A;  2CAQ A;  1SVL A;  3TU3 B;  3FYG A;  4Z2R A;  5B7C A;  1O8X A;  1BF5 A;  5J3R A;  1TKD B;  4RI7 A;  4Z2T A;  2YZH A;  5ELA A;  1YY7 A;  1SVO A;  4YQM A;  3MYD A;  1GUL A;  4L5L A;  3R3E A;  2L6D A;  4K6X A;  3RHC A;  4KB3 A;  4Z7X A;  3TKS A;  4TXO A;  2C0D A;  3V1W A;  3MAK A;  1QQ2 A;  2LJA A;  2AB6 A;  3DXB A;  1GSU A;  2R0G A;  1THO A;  1BJX A;  2H1B A;  4CY6 A;  2HRN A;  1YEX A;  5HFK A;  1A8L A;  4RUV A;  4G9H A;  1ERU A;  2RM6 A;  2A2P A;  1AQW A;  5HR1 A;  1S3D A;  4NMU A;  5ECQ B;  2NDO A;  3QOU A;  4GQC A;  3ZIT A;  1V2A A;  1M7T A;  1XBS A;  1GWC A;  1FHE A;  3D4T A;  3BBY A;  4AKH A;  2WCI A;  3HVS A;  1GSD A;  5ECO B;  4Q5F A;  2H76 A;  4WBJ A;  4MLY A;  2BMX A;  5ENU A;  1GSS A;  4IJ3 A;  1W89 A;  3EMX A;  2VL9 A;  2CZ2 A;  3ERW A;  1Z5Y E;  3L78 A;  4MA9 A;  3VWX A;  5D73 A;  4AGS A;  1ZGN A;  6GSV A;  2AV4 A;  4CDO A;  2VCZ A;  4XS1 A;  3CSH A;  3H8Q A;  4LL1 B;  4O5R A;  1TRW A;  1N25 A;  1VF1 A;  2H6Z A;  2GSS A;  2GQL A;  3DRN A;  2GTU A;  5AN1 A;  1OE7 A;  1FW1 A;  2N5A A;  3QFB C;  1WJK A;  5H5R A;  4H86 A;  5DJL A;  3LG6 A;  2BTO T;  2XC2 A;  5KEJ A;  5IO2 A;  4ZBB A;  2CQ9 A;  2X4A A;  1PX6 A;  2ES7 A;  2H73 A;  4D73 A;  2QSI A;  4TR1 A;  4HI7 A;  3M0F A;  1U87 A;  3UBL A;  2L5O A;  2R6K A;  6GST A;  4PNF A;  4WKW A;  3FK8 A;  4XRD A;  1U88 A;  4ECB A;  2FHE A;  1EV4 A;  5CRH A;  3C8E A;  1T00 A;  3FRC A;  3IE3 A;  1X0R A;  1K3L A;  2E2G A;  3UEM A;  1GL8 A;  1VF4 A;  5CRW A;  5A5K A;  1EP8 A;  2B3S A;  2YAN A;  4G01 A;  5IOX A;  3R2Q A;  2QA1 A;  3TDG A;  2LST A;  2CV4 A;  4TOP A;  2H72 A;  2L4Q A;  2JU5 A;  5A34 A;  2F8F A;  2DJ2 A;  3D4M A;  3J7Y b;  2GQK A;  3QAW A;  1EZK A;  3HVX A;  1AC1 A;  2GZY A;  2IMI A;  3Q19 A;  4AKI A;  3WT2 A;  5IM9 A;  3GYK A;  3GX0 A;  5JCU A;  3G9B A;  2LUS A;  4K9Z A;  1M2D A;  2FY6 A;  4NWY A;  2L4C A;  3VWW A;  4ILF A;  1TJD A;  2VD1 A;  5ECH B;  4V1A g;  1PD2 1;  2DJK A;  2AYT A;  2L59 A;  1KNG A;  1JFU A;  2V2G A;  4POB A;  2CVK A;  5F06 A;  5CNW A;  2GZP A;  3KH7 A;  4EVM A;  4MJC A;  4BVY A;  3WGX A;  1HQO A;  4AJ8 A;  4KND A;  3FR6 A;  1Z7R A;  2B7K A;  1TK8 B;  3KTB A;  1YEP A;  6GSW A;  3HY2 A;  2OBK A;  1GLQ A;  4ML1 A;  3A2V A;  3EWL A;  1UC7 A;  1V9W A;  5LCZ A;  1XOA A;  4F82 A;  4PXO A;  1VRS D;  2AHE A;  5ECM B;  3G7J A;  4GXZ A;  4WF5 A;  4BPY A;  1NHY A;  3EMP A;  4YKG A;  20GS A;  2V1M A;  1T4Y A;  3IOS A;  3UBK A;  3BOA A;  1OC9 B;  2MYG A;  3GKM A;  1U6T A;  3OR5 A;  3RHB A;  3GNJ A;  2H0I A;  3HHV A;  1I5G A;  3LXT A;  4HZ4 A;  2PPT A;  4GRF A;  2C80 A;  2FA8 A;  5J4Y A;  5BRT A;  2G0F A;  3CBU A;  2B1L A;  4IGJ A;  1DSB A;  4FH8 A;  3HA9 A;  1O7U A;  2FCH A;  4EKZ A;  3FMW A;  3LFL A;  5ABR A;  4NHW A;  5ECS A;  3KXO A;  3GTU B;  4ZB8 A;  1J9B A;  2P5Q A;  5IPH A;  1R4W A;  1Q98 A;  1ZOF A;  2FA4 A;  3GST A;  1TW9 A;  3KMO A;  4MH3 A;  4JU5 A;  1A8Y A;  1TI1 A;  2R4V A;  3HYP A;  4MH2 A;  1O73 A;  3M8N A;  1EV9 A;  4KCA A;  4TXO B;  4E8H A;  3KM6 A;  3GKK A;  4IP6 A;  1PGT A;  1F6M C;  1OVN A;  1ON4 A;  2KP1 A;  3LSZ A;  1AAZ A;  3KZQ A;  18GS A;  4N0V A;  1OAZ A;  2PBJ A;  1BED A;  1X5D A;  2FUG 2;  4HEA 2;  4MZW A;  5KN3 A;  2RLI A;  2IL3 A;  2C8U A;  2M46 A;  3UL3 A;  4NAX A;  2LRN A;  3SBC A;  5AIX A;  3NZN A;  4IS0 A;  3WYW A;  1ZYP A;  2ON5 A;  3TKS E;  3F9U A;  4MZC A;  5HR0 A;  3UOM A;  3QAG A;  4AKG A;  4I5Q A;  5IMZ A;  5IIZ A;  2EIO A;  2K9F A;  3BCI A;  2IN3 A;  1JZD A;  1J08 A;  3CTG A;  1QK8 A;  3I9V 2;  6GSU A;  3A5I A;  3P2A A;  3F4R A;  1ST9 A;  3J7Y k;  1SJI A;  5D9V A;  2PMT A;  5DQS A;  2VLU A;  1GTA A;  4HOJ A;  5EL8 A;  1FVJ A;  2IME A;  3HJO A;  5J4V A;  4P3Y B;  4IW9 A;  2DMM A;  2O89 A;  4XS6 A;  1HNB A;  4TR1 B;  4DSR A;  2H1L A;  4HUA A;  1A2L A;  3CRU A;  3F6F A;  4ECC A;  1GTB A;  5GAP D;  5CO3 A;  4IP1 A;  4WXT A;  3FEU A;  3QFA C;  4ECJ A;  3F0I A;  4MMM A;  2GLR A;  3O3T A;  5H5S A;  3S9F A;  3CSI A;  2DIZ A;  2IJY A;  2L57 A;  4GSS A;  1FOH A;  5GSS A;  2WDU A;  1AQV A;  3VI7 A;  5LNK e;  2FWG A;  4XIH A;  2IMK A;  3TKS C;  1AQX A;  4GLT A;  2WB9 A;  1GNE A;  3TKQ A;  4N30 A;  3F63 A;  1JLV A;  1ERW A;  3HD5 A;  4Q5N A;  2ON7 A;  4EIQ A;  1ZYN A;  3HJP A;  1GTU A;  2PU9 C;  5CRE A;  1M2B A;  1A2M A;  3M1G A;  1MDJ A;  1K0M A;  2DBC A;  3IDV A;  5A34 B;  4PQH A;  4F03 A;  4YQV A;  5JWR B;  4LMV A;  1B4P A;  4MJB A;  1Y1U A;  1TP9 A;  1DUG A;  1TXU A;  4K0N A;  4OCE A;  1AUC A;  2XBI A;  1JLW A;  3GUS A;  3IHG A;  4ECI A;  4TRX A;  1X5C A;  4FYC A;  2ZCT A;  3ZLP A;  1YKC A;  2E2M A;  2WRT A;  2WUL A;  3DVX A;  1SVM A;  1KTE A;  2UV8 G;  3L4N A;  1SL2 B;  3MWH A;  1B8X A;  2H71 A;  1N2A A;  1OC9 A;  4O5Q A;  4MF6 A;  4BVY B;  2R3X A;  2M80 A;  5DCH A;  1SEN A;  4BL7 A;  3E9J B;  4V1A p;  5FT3 A;  3D0Z A;  2A2R A;  1SL1 B;  1PN0 A;  4HQZ A;  2CA8 A;  5ECN B;  2V6O A;  4KA0 A;  4HU9 A;  3QR6 A;  2DC5 A;  2VO4 A;  1ERV A;  4GDF A;  4JBB A;  2REM A;  4HJ2 A;  3GL3 A;  1K0C A;  3GKX A;  1O85 A;  3FZ9 A;  4JZQ A;  1KBN A;  4MNN A;  1RK4 A;  1XWB A;  1X9W B;  5J40 A;  3IC4 A;  3RDW A;  7GSS A;  3FKF A;  1VF3 A;  5J4U A;  4Q5Q A;  3A2W A;  3KGK A;  3FR3 A;  2KUC A;  1K3O A;  2IMF A;  5ECI B;  1R26 A;  3G7I A;  2A4V A;  1SL0 B;  5EY6 A;  1MTC A;  1GSQ A;  4YH2 A;  2RII A;  4KGI A;  6GSS A;  1QGV A;  2HRK A;  1XW9 A;  2MMO A;  4G19 A;  2H6Y A;  2HI7 A;  4X0X A;  4FYB A;  1U3I A;  1V40 A;  1TI3 A;  1VGL A;  2PVQ A;  4QL9 A;  1WRY A;  4IJI A;  1EGR A;  4KUN A;  2QA2 A;  4J56 E;  1PKZ A;  1Y25 A;  1A2J A;  2FLS A;  2IMD A;  1QUW A;  1ZCP A;  2DJ3 A;  5BMU A;  1VF2 A;  2L6C A;  2GVP A;  4BWQ A;  5D9W A;  4IHU A;  1T1V A;  4KF9 A;  4K5S A;  2CZ3 A;  3P7X A;  2H74 A;  3UIW A;  4GWR A;  1EEJ A;  2X99 A;  1YDK A;  3E0U A;  4TKY A;  3F6D A;  1YF1 A;  2C3T A;  1ERT A;  3KP9 A;  3VPT A;  2JAC A;  2FWE A;  2DKH A;  2YN1 A;  1WIK A;  3US3 A;  3D21 A;  5A4V A;  1PSQ A;  1FOV A;  1SYX A;  1T3B A;  1WE0 A;  4LA1 A;  1T4Z A;  3ERG A;  3EIN A;  2HXK A;  3BD2 A;  2GST A;  1EOH A;  4DSS A;  5FHI A;  3UAR A;  3FZ5 A;  5A4U A;  1OYJ A;  5HQP A;  3APO A;  1K3Y A;  4XRA A;  1TU8 A;  5G30 A;  2PWJ A;  4TN8 A;  1GRX A;  5IQY A;  2V6K A;  3VK9 A;  2GQM A;  5IMC A;  5DVB A;  2R0C A;  3EVI A;  5IMF A;  5ID2 A;  2H1D A;  3CXG A;  1G6Y A;  4Q5R A;  2IWT A;  1HNC A;  4MK3 A;  2VLT A;  4V2N A;  4HJM A;  4F0B A;  2X64 A;  5IO0 A;  4YAV A;  5B6N A;  1CQH A;  2VL3 A;  4N3Z A;  3TKR A;  3KD0 A;  2C3N A;  4F0C A;  3ZL5 A;  1HYU A;  4W66 A;  4ZBD A;  4XCS A;  3ZVJ A;  4PQI A;  2VL2 A;  2YJH A;  3IV4 A;  1PKW A;  3L9S A;  6GSX A;  1Z6M A;  3ME8 A;  1E6B A;  2H0H A;  3HCZ A;  5E59 A;  2YV7 A;  4CW9 A;  1UA5 A;  3IK9 A;  3HZ8 A;  2GSQ A;  4K0G A;  4USS A;  3GKN A;  1TRV A;  1BAY A;  3DIE A;  2YP6 A;  2R5G A;  2YWO A;  1IYI A;  3D22 A;  1NHO A;  2RM5 A;  3TOT A;  5IMA A;  3BCK A;  3VUR A;  3A5W A;  4JR6 A;  4I6X A;  3TCO A;  2MMZ A;  1PX7 A;  4V2L A;  4POM A;  2KLX A;  4IEL A;  4WF4 A;  1TRU A;  2R2J A;  2WFC A;  3IA1 A;  5AIS A;  3EU3 A;  3F4S A;  3LWA A;  1DBY A;  2R0P A;  1Z7P A;  2OKA A;  2VUP A;  4L5O A;  4OO5 A;  3FY7 A;  3U6V A;  1NW2 A;  2B5X A;  1A0R P;  1WP0 A;  4ACS A;  4MPG A;  3IAM 2;  1GTI A;  2HE3 A;  2LJK A;  3MSZ A;  1BG5 A;  3PR8 A;  3I69 A;  3TJK A;  1XWA A;  5DQY A;  3GSS A;  1K0B A;  2X8G A;  5J47 A;  1JZO A;  1GNW A;  1GSE A;  3DD3 A;  4JRR A;  2DSA A;  4ISD A;  1JHB A;  1IYH A;  6GSY A;  3LQ7 A;  4EDZ A;  1HD2 A;  3GFK A;  4QQ7 A;  5DBQ A;  2JZR A;  1XWC A;  1N8J A;  3ZRD A;  1LJR A;  1F9M A;  2LRT A;  2O87 A;  4JED A;  1FG4 A;  2D2Z A;  2YOI A;  1S3C A;  4MDC A;  5JCG A;  4BL7 B;  2OT3 A;  1YZX A;  1ILO A;  5CAX A;  4MF7 A;  1QFN A;  1SU9 A;  1SKW B;  2EFH A;  5HR3 A;  1QXH A;  2H66 A;  5DDL A;  11GS A;  2I4A A;  2I3Y A;  4EUY A;  5A5H A;  5IOW A;  1M99 A;  3APQ A;  5JCW A;  3D6I A;  1PRX A;  4DVC A;  2K8V A;  4WR5 A;  3RPP A;  5EVO A;  2LQQ A;  2OE3 A;  2WJU A;  3IK7 A;  2VCT A;  1MEK A;  2GT5 A;  2DIY A;  1TK5 B;  3QMX A;  2VAF A;  2X8C A;  1XIY A;  1F3B A;  2EC4 A;  4FO5 A;  1OKD A;  5F0G A;  4TXV A;  2HQT A;  1DE2 A;  1SJ6 A;  2HRK B;  4OFM A;  3VLN A;  1SYR A;  1ABA A;  3IHQ A;  4Z2U A;  2H8L A;  2VCX A;  4QMK A;  2V41 A;  4TR3 A;  1WOU A;  4MJE A;  2B6M A;  3AY8 A;  4K7I A;  3LJR A;  3UJ1 A;  2NPB A;  4ZXG A;  1MDK A;  2C0F A;  3DML A;  3SWL A;  3GH9 A;  3CSJ A;  3ZYW A;  4L0W A;  3RPN A;  3TRX A;  5BMU B;  2H75 A;  4J57 E;  2DML A;  1J0F A;  4K1F A;  4O92 A;  2GGT A;  1TK0 B;  1F37 A;  1Y6E A;  4KDU A;  2HRA A;  4EIP A;  4GQF A;  2C3Q A;  2VD0 A;  4OWY A;  3FR9 A;  4MAB A;  1XWG A;  1EP7 A;  3NIV A;  1V57 A;  1B9Y C;  4K8M A;  2F51 A;  13GS A;  2HYX A;  5D96 A;  4TR0 A;  3L9U A;  4V2M A;  3LGC A;  2WS2 A;  4KH7 A;  1EEM A;  3TUE A;  3ZVJ D;  3F3Q A;  1TTZ A;  2F9S A;  2TRC P;  1F2E A;  4NPB A;  1Q4J A;  3QD9 A;  3ED3 A;  1URM A;  4O32 A;  3A3T A;  5JWQ B;  3TKP A;  1B4Q A;  5HR2 A;  2H1A A;  5DAK A;  2CVB A;  3IR4 A;  3WD6 A;  1DE1 A;  4DSS B;  2GSR A;  1XOB A;  3PPU A;  2F3M A;  4YAP A;  4ZIJ A;  4I2T A;  5G5F A;  5L71 A;  4GCI A;  4JR4 A;  3TRQ A;  5CRD A;  2P0G A;  2HSN B;  3ZTL A;  8GSS A;  4KDX A;  5ECL B;  2DJ1 A;  2M72 A;  3QAV A;  3FW2 A;  5ID2 B;  2MMA A;  5G31 A;  3CTF A;  3ME7 A;  5G1K A;  3I43 A;  4NV5 A;  2VM2 A;  5D9T A;  1C72 A;  1BQ7 A;  5J41 A;  4O5U A;  2RUE A;  2LQO A;  3G7Y A;  2LKU A;  2EFE A;  2HNL A;  1FB0 A;  5KN2 A;  2PN8 A;  4N10 A;  5E4W A;  3C7M A;  3ZRE A;  2B1K A;  3EU4 A;  1X5E A;  4WET A;  4XS4 B;  2J9H A;  3VFI A;  2LNT A;  4K5R A;  1GLP A;  2HSH A;  3HVV A;  3QDN A;  1BG1 A;  2HT9 A;  4BA7 A;  2XPE A;  4AJ6 A;  3UVH A;  4BWS A;  3IPZ A;  1M0U A;  3HJM A;  4PTS A;  3P90 A;  2HSM A;  5GST A;  5C04 A;  1QMV A;  1KEB A;  3EPT A;  4HZ2 A;  2I81 A;  5H5Q A;  2C4J A;  1OE8 A;  3HDC A;  4QL7 A;  3KCM A;  4XHM A;  3M9K A;  2X49 A;  3ZIJ A;  3IC8 A;  4IN0 A;  3DGQ A;  1R5P A;  2TRX A;  4ZIL A;  2YJ7 A;  3LYP A;  4MZB A;  1Z9H A;  1YVL A;  9GSS A;  2OAC A;  1ZZY A;  5DJM A;  3W6G A;  4G0L A;  3EE2 A;  2BJX A;  4WEY A;  1O8W A;  4K7O A;  3VWU A;  2K18 A;  3TJF A;  5G5E A;  4K7N A;  4I8B A;  2HFD A;  4MPF A;  2P5R A;  1EOG A;  2N5F A;  4AI6 A;  1GSY A;  1K0N A;  2YV9 A;  4MCU A;  2PUK C;  1K0O A;  1I9D A;  4EDY A;  1SK2 A;  1W4V A;  4WBR D;  3Q18 A;  3DYR A;  3GV1 A;  1K0D A;  2G2Q A;  3HXS A;  4DEJ A;  2IPA A;  4KSO A;  2OA7 A;  2HZE B;  3TJG A;  3MDK A;  2MZC A;  3C1R A;  4OO4 A;  4ML6 A;  3LOR A;  2QKE A;  1GUK A;  1PL2 A;  4E8E A;  3MNG A;  2A2S A;  1PMT A;  1XZO A;  1K0A A;  2CX3 A;  4MP4 A;  2FNO A;  5A5H B;  1XW5 A;  4GF0 A;  5F07 A;  2F8A A;  3HKR A;  1TDI A;  1YQ1 A;  1WPI A;  1SD9 A;  1USB A;  1YKA A;  2H30 A;  2VL2 C;  3PIN A;  2C1Y A;  1M9A A;  4WR4 A;  1LBK A;  3IXR A;  3NOF A;  1YJ6 A;  2EFD A;  2OBI A;  4TW5 A;  3FHK A;  2GT6 A;  1SK0 A;  1ACV A;  4NXI A;  2NBS A;  3Q74 A;  1PQN A;  4I2U A;  2AUV A;  5G2Z A;  4CHS A;  1E2Y A;  2ALB A;  3WGE A;  5G1L A;  5DCG A;  4TR4 A;  1SKR B;  2H19 A;  2GS3 A;  2FWH A;  4EO3 A;  1GUM A;  4ZBA A;  1FAA A;  5KOW A;  4PX1 A;  1YF0 A;  3TJB A;  4PUA A;  1XPV A;  5IPG A;  3LXZ A;  1G7O A;  4ULX A;  2E0Q A;  19GS A;  3GMF A;  1ZYQ B;  1TOF A;  3GUR A;  4PUF C;  2O85 A;  1Z3E A;  1H75 A;  1A24 A;  2DJJ A;  3IRA A;  2KOK A;  3VPQ A;  1RW1 A;  2A4H A;  3HZ4 A;  2HSN A;  2H1G A;  4LLR A;  1PL1 A;  4YKF A;  1M2A A;  2Z9S A;  3C1S A;  3LYK A;  2PER A;  2O8V B;  1MDI A;  12GS A;  4YQU A;  3TB2 A;  1V58 A;  4PUR A;  4XTS A;  3PGT A;  2YWM A;  5B8A A;  4G2E A;  2EIQ A;  1TU7 A;  3TJJ A;  2X8H A;  4BVX A;  2IFQ B;  2YWI A;  3RBT A;  2DLX A;  1X9M B;  3F8U A;  4LMW A;  1XVQ A;  5DAK B;  4POK A;  5A1N B;  3GX8 A;  1B9X C;  1GUH A;  1SJZ A;  2VOC A;  5ELG A;  4KX4 A;  4XS4 A;  1R5A A;  3QCP A;  4K2D A;  3H4K A;  1G6W A;  17GS A;  3GL5 A;  2H6X A;  3ZML A;  1XXU A;  1O81 A;  4MJA A;  3RAZ A;  2VCQ A;  4ZB6 A;  5IMD A;  1A23 A;  4N11 A;  4RQR A;  3MIX A;  3GN3 A;  1TRS A;  2QC7 A;  4X1U A;  2LS5 A;  3APS A;  3EUR A;  2VKZ G;  2YWN A;  3DWV A;  3W8S A;  4O7H A;  1EGO A;  1A0F A;  2MBT A;  2K8S A;  1BX9 A;  2YCD A;  2XPD A;  4ZL7 A;  2PVO C;  2ZUP A;  4E68 A;  5CYY A;  4AKX B;  3DEX A;  1O6J A;  3CRT A;  4IQ1 A;  1B48 A;  1UVZ A;  1UN2 A;  3GHA A;  14GS A;  4EXJ A;  4GSN A;  4IKH A;  5J9B A;  1AXD A;  1CQG A;  5A4W A;  5B6M A;  2JAD A;  3GRX A;  4LL4 B;  2C0E A;  3UAP A;  4AJ7 A;  2HSM B;  4MF5 A;  3ZIV A;  1R7H A;  4G10 A;  1WWJ A;  4RI6 A;  3D5J A;  22GS A;  2JSZ A;  5F8B A;  1SKS B;  4ID0 A;  5HFG A;  3KP8 A;  3M3M A;  1LU4 A;  2YPM A;  1ZMA A;  2GDR A;  2FWF A;  2VM1 A;  1U3A A;  3Q6O A;  1PN9 A;  2AAW A;  1THX A;  2HLS A;  2HZE A;  4KSM A;  3F3R A;  4DSQ A;  4AF2 A;  2C0G A;  3KIJ A;  1NM3 A;  3H79 A;  2P31 A;  5CP1 A;  3UMA A;  4J2F A;  3IBH A;  1XVW A;  1AIU A;  1GH2 A;  3KMN A;  3L9V A;  3KJY A;  5INY A;  4PNG A;  1ML6 A;  2ZNM A;  5JWO B;  2LV3 A;  2L5L A;  5ECR B;  2H01 A;  2OJL A;  2CX4 A;  5D9X A;  2YZU A;  1JZR A;  3JCM L;  5EPF A;  1GP1 A;  3E3E A;  4HQS A;  1MD3 A;  2VCV A;  5DAL B;  2LEG A;  1XW6 A;  5F05 A;  3C73 A;  5D8I A;  4EE0 A;  3UVT A;  2J23 A;  4G0I A;  5IMV A;  1XCC A;  4K2X A;  4I97 A;  1XWK A;  2QGV A;  4POL A;  3LEF A;  3U5R E;  2JZT A;  2EFC A;  3A2X A;  3TGZ A;  3M9J A;  1SK1 A;  3WGD A;  5AGY A;  2HRF A;  3CYN A;  1FB6 A;  2V32 A;  2LRC A;  2OAD A;  3PH9 A;  4OD7 A;  2B7J A;  3WT1 A;  2JL4 A;  1T7P B;  3TOU A;  1H4O A;  16GS A;  4NV2 A;  4PGT A;  3DVW A;  4ZL9 A;  5HFI A;  2B5E A;  2H0G A;  2OE1 A;  3DKS A;  2AJQ B;  1F3A A;  2KHP A;  1G0T A;  2E7P A;  3LW9 A;  2LJR A;  4A5P A;  2K6V A;  4EC0 A;  1WMJ A;  2WGR A;  1RQM A;  5FWG A;  4IBP A;  4OMV A;  2LTK A;  3H93 A;  2MBS A;  4F9Z A;  4X43 A;  2N5B A;  2CVD A;  2DJ0 A;  3KEB A;  5C00 A;  2B5Y A;  5ECP B;  2I9H A;  3HMJ G;  3K8N A;  4HDE A;  4GST A;  5GAN D;  3VI5 A;  5AIV A;  1AW9 A;  2IFQ A;  5COH A;  4ZB9 A;  4F2I A;  3ZMK A;  2HZF A;  4HU7 A;  5A1N A;  4JE1 A;  3GIX A;  4GTU A;  1NSW A;  1TXX A;  2JZS A;  3FZ4 A;  3ZFB A;  2H70 A;  2VCW A;  2VLV A;  4FYU A;  4ZL8 A;  3KTL A;  3L0H A;  1G7E A;  1EWX A;  2XHF A;  4D73 B;  2NVL A;  4FQU A;  5B8B A;  2FGX A;  4IVF A;  4ICY A;  3I6A A;  2R37 A;  2WZ9 A;  2XBQ A;  4FIW A;  3N9J A;  1HNA A;  1FO5 A;  4KAE A;  3N5O A;  3C71 A;  4BVX B;  10GS A;  3KH9 A;  3GH6 A;  1ZYE A;  1OKT A;  1PA3 A;  3CWG A;  4KW6 A;  4KE3 A;  3EYT A;  4IQA A;  2IIY A;  4PQ1 A;  2LNS A;  5J9C A;  3ERF A;  2EIR A;  4EL1 A;  4N0Z A;  2TIR A;  4NHZ A;  2UZ8 A;  1OC8 A;  1BYE A;  1MD4 A;  3P8W A;  5KOX A;  4L0U A;  1M9B A;  2KP2 A;  1ZL9 A;  3EC3 A;  3QPM A;  3F4T A;  2MMN A;  2DKI A;  2NTO A;  5J5N A;  2GZZ A;  5LD0 A;  1S3A A;  1FVK A;  4G0K A;  1T8E B;  5ECK B;  4RQX A;  4KDY A;  2CAI A;  3GA4 A;  1V98 A;  3IAS 2;  4OFT A;  3H1N A;  1OC3 A;  3CMI A;  5D93 A;  4ZB7 A;  1Z6N A;  2FD3 A;  3VWV A;  2OE0 A;  3BJ5 A;  2PGT A;  1XFL A;  5KN0 A;  3ISO A;  2RUF A;  3W8J A;  3ZFL A;  2O7K A;  3TRP A;  1JZW A;  3FZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...