3VLNA

Human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
239
structure length
239
Chain Sequence
b'GESARSLGKGSAPPGPVPEGSIRIYSMRFSPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase omega-1
publication title Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 239
sequence length 239
ec nomenclature ec 1.20.4.2: Methylarsonate reductase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vlnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vlnA01
4RI6A 3VPQA 2I81A 2YPMA 4KCEA 4V1Ag 3ZIJA 3HVVA 2GS3A 4L5OA 1GTBA 2GSRA 4MF5A 1R5PA 2H0HA 4ZXGA 4PQ1A 1C72A 1WMJA 3LXTA 2F9SA 1GSFA 3TOTA 2OBKA 3VPTA 1EOHA 3TKSC 2FY6A 4CHSA 1O73A 1YF0A 1MDKA 4YQUA 2VL2A 1T1VA 3P2AA 2GT6A 3FK8A 2LJKA 1URMA 2FHEA 2ZNMA 2WJUA 5DCHA 3GKMA 1BYEA 1WPIA 1HD2A 3GFKA 1OC3A 4IVFA 4XRAA 3WT2A 3QMXA 1TRUA 5G31A 3QR6A 4EC0A 4TOPA 1T00A 4DSSB 2L5OA 4RQXA 4Q5NA 3D4TA 5IOXA 3PGTA 4PX1A 4ZBDA 4XS6A 1XBSA 5ECKB 2B5YA 2WDUA 4TW5A 3OR5A 3ERWA 4FH8A 2DIZA 1BJXA 5DDLA 4AJ7A 5J41A 1TRSA 1FVJA 3F3RA 3VK9A 1O85A 2WZ9A 5ECSA 1JFUA 4LMVA 5J9BA 3L9SA 3IPZA 3IBHA 1F9MA 1GSDA 2N5FA 2XBIA 3ME8A 3QCPA 1X5CA 3GV1A 2H70A 4WF4A 4NHWA 1F3BA 2GGTA 4XTSA 2XHFA 1S3CA 5DCGA 2PUKC 3G7JA 1YEPA 2F8AA 3LYPA 1QMVA 1LBKA 3HVXA 2DJJA 2HNLA 2MYGA 3PINA 3LORA 5ECRB 4MMMA 3TJFA 1YKCA 5ECOB 5FT3A 4ZBAA 2H71A 1Z3EA 1A24A 3RDWA 1BX9A 3ZREA 4O7HA 1GUMA 2VOCA 2L6CA 2GSQA 5ID2B 3KTBA 1Q4JA 1BEDA 2H6YA 1K0MA 1I5GA 3GA4A 5IIZA 3FZ9A 4GWRA 2FGXA 1XWCA 2FWFA 3GH6A 2REMA 4MPFA 5D96A 3GL5A 4RUVA 5FHIA 1MEKA 4NV5A 3DEXA 2C0FA 3IAS2 3IR4A 1FB0A 4OCEA 3TJGA 4IELA 3EVIA 2LQQA 4E8HA 3MSZA 5EVOA 3EYTA 3G9BA 4MZWA 4EDZA 1T7PB 3NIVA 2LEGA 1XVWA 3APSA 4EL1A 3GN3A 2A2RA 1M9AA 4HZ2A 2PWJA 4V1Ap 1TKDB 5DJLA 2D2ZA 1SKWB 4RI7A 2HSYA 7GSSA 3UVTA 5HFIA 4F82A 1XOBA 4YQMA 4YAPA 2CX3A 2P0GA 5DAKA 1OVNA 1OYJA 2PU9C 2HSNB 2PBJA 2O85A 4ECCA 3GRXA 2KP2A 2O7KA 4DEJA 4XIHA 1FOVA 3BBYA 3US3A 5ECLB 1HYUA 2FLSA 1TXXA 1SJZA 3ISOA 3L0HA 1BQ7A 3FZ4A 3WGXA 5B6MA 1A8LA 4WR5A 4KF9A 2OE3A 4IS0A 4EE0A 1M0UA 5DVBA 1EOGA 3D21A 4TKYA 1JHBA 4MA9A 1K0OA 3QD9A 3DXBA 5F8BA 1TTZA 2DMMA 2IN3A 1W89A 5CRWA 2VM1A 5ECPB 2FA4A 4G9HA 3KP9A 4WEYA 4L8EA 1X5EA 2NVLA 3Q19A 2HQTA 2IMIA 3MDKA 2K8VA 3M8NA 5DAKB 2R37A 4D73A 2PVOC 1K3YA 4FIWA 1TU8A 3QFAC 1TW9A 1ERWA 4ML6A 4YAVA 1XOAA 4MDCA 1B4QA 3VWVA 4AGSA 2IMDA 4BVXA 5IMFA 4BPYA 2CAQA 5DQYA 2BTOT 2ALBA 5ECIB 3Q74A 6GSXA 4I8BA 3CXGA 4GRFA 3QAVA 2HRFA 1SL0B 3AY8A 4KSOA 3IC8A 1USBA 3KXOA 2KLXA 2R3XA 4KUNA 4MJCA 1H75A 3FKFA 3ZMKA 2VCWA 4ECJA 4HJ2A 5D9XA 5KN1A 2HZFA 5JWOB 4KAEA 2MMNA 3IC4A 1O8WA 2C0GA 2HYXA 3RHCA 5HFKA 5LD0A 3ED3A 4L0WA 3BCIA 1ZZYA 3IV4A 5JCWA 1THOA 2XPDA 4D73B 2UZ8A 2FNOA 4KE3A 1QK8A 1T4ZA 1U88A 3M3MA 1A2LA 4I2TA 1KTEA 3IRAA 1BAYA 2OADA 1M2DA 5J3RA 2O8VB 3VWXA 4OWYA 3KJYA 5GSTA 2DJ1A 3EURA 1YZXA 1JLVA 3DD3A 4JR6A 5HR1A 4OMVA 1XZOA 4EUYA 1R4WA 3CRTA 4IW9A 3Q18A 3ZFBA 3I43A 3C71A 4JRRA 4Q5FA 3ZMLA 1VF2A 3APQA 4MJAA 3GX8A 1U3IA 4IJIA 5L71A 4N0VA 4MZCA 2YNXA 2B7KA 2YZUA 3M9KA 1TK8B 1X9WB 2H1DA 5ECNB 1G7OA 3PPUA 2L4CA 5G30A 2DJ3A 2L6DA 3F3QA 5IQYA 4AJ8A 1GRXA 3TRXA 2JACA 1M7TA 5COHA 1K0AA 5CAXA 2I9HA 3A2WA 1XIYA 3MNGA 4IHUA 1AW9A 2C3QA 2A4VA 2OACA 3DGQA 3LJRA 1FAAA 1PL2A 4PQIA 2PPTA 2O89A 2BJXA 5JWRB 3UIWA 2GVPA 1K3OA 5KN0A 3UBLA 2FUG2 2VO4A 4CW9A 4K1FA 2JZTA 3V1WA 4HUAA 1AXDA 1R26A 1GNWA 4KDYA 3VWWA 3QOUA 4ML1A 2GQLA 1YJ6A 1V58A 1GH2A 2VCZA 3WGEA 3ZLPA 3GUSA 4ZBBA 2B5EA 4TXOB 1WRYA 3EINA 3PR8A 2LRNA 3ZYWA 2GLRA 2JL4A 4KW6A 1V40A 22GSA 1X9SB 5BMUA 2RUFA 1XXUA 4JEDA 1MDJA 2YWOA 3N9JA 2HRNA 1XW6A 4PNFA 1GTIA 1IYHA 4JBBA 3F4RA 1MD4A 5D73A 3P7XA 2OBIA 1PMTA 2WFCA 3GMFA 3KM6A 1WWJA 1ZYEA 3G7YA 4AJ6A 3D4MA 2JADA 1MTCA 3LQ7A 3TCOA 2AHEA 2IJYA 2V2GA 1G6YA 3N5OA 2MBTA 2WS2A 3O76A 1BG5A 1SJIA 4DSSA 1GWCA 2AJQB 2R6KA 4TR0A 4PXOA 8GSSA 3GKNA 3L78A 3A3TA 2GSTA 5H5SA 4G0IA 3GHAA 1V9WA 2NPBA 4KNDA 5CNWA 1ABAA 4PUAA 3H4KA 2TRXA 3BD2A 4IJ3A 4MP4A 2AV4A 1R5AA 3IAM2 2HSMB 3TKQA 2H73A 2X8CA 3E9JB 1SK0A 3HJPA 3KP8A 4G0KA 5B6NA 3FR6A 6GSTA 4GQFA 4F2IA 5DALA 2QC7A 1NHYA 3UJ1A 3LSZA 3F6DA 1EV9A 5C04A 2LV3A 1CQGA 4IP6A 1N2AA 2RUEA 2QGVA 2YJHA 2CT6A 1XFLA 1M99A 2GDRA 2CZ2A 5D9VA 2CQ9A 1AAZA 1FO5A 3QDNA 3FYGA 5HR0A 3E3EA 1K0CA 4MH2A 16GSA 1GSUA 1Z7PA 1V2AA 3KMOA 3VI7A 1X0RA 3C1SA 2H1GA 3CBUA 5ENUA 4GXZA 5ID2A 2F3MA 3GURA 3UVHA 1ERVA 5ECMB 1G0TA 1PQNA 4OO5A 4POKA 5DALB 3LWAA 3VLNA 5D93A 3IK7A 2AAWA 3GNJA 1Y25A 5H5RA 3J7Yb 2MBSA 1PD21 5B8BA 1SD9A 3H8QA 3ZIVA 1DE1A 4V2NA 1CQHA 4NXIA 2B5XA 5H5QA 2LNSA 4MABA 4MH3A 4V2MA 1EGRA 5JCUA 2VD0A 2HRAA 1TU7A 5AIXA 5G5FA 2C80A 3P8WA 1N8JA 1TRVA 4HU7A 4F0BA 4HZ4A 1W4VA 4PUFC 1K3LA 1XVQA 2IMFA 4V2LA 1G6WA 1TI3A 4O92A 2I3YA 1A0RP 1GLQA 2R4VA 4K7IA 4XRDA 3VFIA 2OA7A 3UMAA 1YF1A 4N30A 1UN2A 2RM6A 1R7HA 2ZCTA 4DSRA 5CYYA 4TR3A 1Z6NA 1VF4A 1JZWA 4LMWA 2H76A 2VL9A 4GSTA 4GCIA 1FVKA 3KH9A 2O87A 2CVBA 2L4QA 2FA8A 4IQ1A 5A4WA 1SKSB 2N5AA 5E59A 5IOWA 1RQMA 3HDCA 2I1UA 1EEJA 4FYCA 3VURA 3BOAA 6GSUA 1GUHA 4DVCA 5C00A 2EIOA 4F0CA 4TN8A 2LRCA 6GSVA 3IDVA 2P5QA 2DJ0A 5AIVA 3TJKA 1KBNA 2L59A 2H30A 4RQRA 5G5EA 1JZOA 2QSIA 2IMEA 3KTLA 2YCDA 3ZFLA 3UL3A 1WIKA 2HRKA 2VIMA 1T4YA 3GKKA 1XW5A 3FY7A 2WRTA 3HY2A 3HJOA 1YKAA 1HNAA 2LKUA 2XBQA 2DJ2A 4K0GA 1THXA 2H74A 2JU5A 1PX7A 3FZ5A 2MMAA 3FEUA 3K8NA 4EF0A 3FRCA 2DSAA 5EPFA 3I69A 4I2UA 3HHVA 4JR4A 1F3AA 3IE3A 5HR2A 3KD0A 2KUCA 4WR4A 1PSQA 3VWUA 4NPBA 4CDOA 5D9WA 4ZILA 2F51A 3L9VA 4EO3A 3HA9A 3ZRDA 3C8EA 2HRKB 2GTUA 1NW2A 1SKRB 1FB6A 2IFQB 4USSA 3HVSA 1GSYA 4HJMA 4BL7A 5EL8A 3DVWA 4WETA 2WULA 3CMIA 1YQ1A 4FQUA 2H0IA 1J0FA 1EV4A 3TKSA 4OCFA 2LJRA 2VL2C 4EDYA 4PURA 2L5LA 1WJKA 2LJAA 12GSA 2YV7A 1A8YA 1GUKA 2VCVA 4O5RA 2HE3A 3EMXA 1PGTA 5DQSA 4XCSA 1ERUA 2IWTA 3TJBA 1OKTA 3ZL5A 4LL1B 3M0FA 4K8MA 4FYBA 1QUWA 3R2QA 3ERGA 4GSSA 2K18A 1PX6A 4BL7B 4JU5A 1B48A 5ABRA 1B9YC 4N11A 4POLA 2LS5A 5GAPD 2VCQA 3EC3A 2KHPA 3NOFA 2GQMA 4NHZA 2NDOA 2FD3A 2ON5A 4OFNA 3SBCA 4HI7A 3GSTA 3G7IA 5KN2A 2ES7A 4OFMA 4N10A 4BVYB 4ZIJA 18GSA 2K8SA 2VUPA 1PL1A 2V41A 2M80A 3KH7A 2H8LA 1OC8A 1U3AA 3H93A 1NHOA 2OJLA 3FR9A 4LL4B 2MMOA 2QKEA 4MCUA 1X5DA 2ON7A 5INYA 4AF2A 1SU9A 4PTSA 2EIRA 3F4TA 2GSSA 1QQ2A 3GL3A 3DVXA 3WYWA 2YWMA 3GKXA 4TXOA 3CYNA 2IPAA 4MJBA 2C1YA 3C7MA 2VLVA 2PGTA 2EIQA 4BWSA 3TRPA 4Z7XA 1VF1A 2KOKA 2GQKA 3ZVJD 5D9TA 4WBJA 4FO5A 3FR3A 4KDUA 5IMVA 3A2VA 2OE1A 2IMKA 1X9MB 1IYIA 1U87A 2GZYA 4TR1A 4NWYA 5AISA 3DMLA 1S3AA 5B7CA 3GX0A 2B1KA 2C0EA 2PMTA 2H66A 4MJEA 3ZITA 4KDXA 1TP9A 3KZQA 2VD1A 2CX4A 2VAFA 4DSQA 3D22A 3FHKA 1A2MA 3TKRA 1K0DA 1EP8A 1UA5A 3EWLA 3QFBC 1UVZA 1VRSD 4HQZA 4XS4B 1DUGA 1ACVA 1GTAA 4PNGA 2PN8A 2E2GA 1TDIA 2C3TA 3IK9A 5AN1A 5A5KA 1EWXA 4MF6A 2JSZA 5F06A 2BMXA 3JCML 2VLUA 4TR1B 1B4PA 4ULXA 2CVDA 3HYPA 5JWQB 1SK1A 3ZZXA 6GSWA 4L5LA 4GSNA 4HU9A 1JLWA 3DYRA 4IN0A 4K0NA 2Z9SA 1WP0A 1ZMAA 2HSMA 5GZZB 3H1NA 2TIRA 4POMA 4TR4A 3WT1A 3KMNA 2H0GA 4G0LA 4YQVA 1O6JA 4MK3A 2X99A 3IHQA 4ECBA 2G2QA 1OC9B 1HQOA 1Z6MA 3QPMA 1E6BA 1SENA 1AQWA 4JZQA 1XWGA 5ECHB 4K6XA 2RIIA 3WD6A 3TKSE 2GT5A 2H6ZA 5IO0A 2NTOA 1TRWA 3TKPA 3UOMA 4HQSA 4J56E 1ZYQB 4MZBA 1I9DA 3E0UA 5F07A 1WOUA 3LYKA 1YDKA 2KP1A 2YJ7A 3TUEA 1SL1B 1Z5YE 2IIYA 20GSA 2K6VA 4K7OA 2DIYA 4NV2A 4J2FA 4YH2A 1ON4A 4HS1A 4ECIA 2YZHA 5JCGA 3CTGA 2R5GA 4GQCA 4IBPA 2H01A 3L4NA 4X0XA 5IMAA 3CSHA 4KX4A 1Y6EA 3HJMA 2H6XA 2HI7A 3GSSA 3NZNA 2EC4A 3Q6OA 4TRXA 4WF5A 4NAXA 2HLSA 1EEMA 1F6MC 1SYXA 2JZRA 5IMZA 3WGDA 19GSA 2X8HA 4OD7A 2YP6A 3EU4A 4WKWA 2H75A 3S9FA 2B3SA 2V6OA 3CRUA 5B8AA 3HD5A 1XWBA 1QGVA 1PKZA 2M46A 3O3TA 2AB6A 2DJKA 3MWHA 2FWGA 5IO2A 3GTUA 3IA1A 3CSJA 1MD3A 1UC7A 2I4AA 4LLRA 1GSQA 3UBKA 3KEBA 3TDGA 5CREA 2CV4A 2N5BA 3UAPA 2VCXA 1FG4A 5IPGA 1S3DA 3IOSA 1EP7A 4IP1A 3GH9A 1J9BA 5HFGA 1QFNA 2WCIA 1FW1A 2K9FA 5HQPA 1DSBA 1VGLA 2B6MA 1TK5B 1NM3A 2HT9A 3D0ZA 1B9XC 1XWAA 5CP1A 4KA0A 3F0IA 1M9BA 1AC1A 2B7JA 3A2XA 1ZL9A 3ZVJA 3TJJA 3GTUB 2A2SA 3RHBA 3W8JA 5ELGA 2X8GA 3DWVA 1O7UA 1PRXA 2LSTA 1NSWA 1XPVA 1GL8A 2LQOA 1F2EA 2J9HA 2JZSA 3C1RA 2CAIA 4NMUA 2YWNA 4XHMA 1K0BA 3LXZA 4IQAA 1ST9A 4O32A 3LG6A 3O6TA 4HOJA 1EZKA 2PVQA 2J23A 3GIXA 4WXTA 2IL3A 2LTKA 1SL2B 1JZDA 3TGZA 1J08A 2MMZA 2M72A 2L57A 2C4JA 2P5RA 1A2JA 3GYKA 4LA1A 3F6FA 2HSHA 1YY7A 1JZRA 1O8XA 2VLTA 3FW2A 4K7NA 2XC2A 4ILFA 1SJ6A 1GSEA 2IFQA 5AGYA 3CTFA 2H19A 3EMPA 2X64A 1RW1A 3TOUA 1T8EB 4ACSA 3F8UA 1TK0B 4QQ7A 1G7EA 3TRQA 3QAWA 2LNTA 1ZGNA 9GSSA 1ML6A 11GSA 2F8FA 2DMLA 2ZUPA 5F0GA 2R2JA 2XPEA 3F63A 3KGKA 1RK4A 4ZL7A 4POBA 3I6AA 1HNCA 2YOIA 14GSA 5LNKe 4TVEA 2HFDA 1SD8A 1GTUA 1M2BA 1LJRA 4X43A 3VI5A 3IXRA 2WGRA 4K9ZA 3ERFA 2LRTA 4HDEA 3RAZA 5GAND 1Z7RA 2VM2A 4TXVA 1XCCA 4KSMA 3KIJA 1PKWA 4MF7A 1ILOA 3I9V2 1DE2A 17GSA 4IKHA 4KB3A 3RBTA 5FWGA 3APOA 5CRHA 5HR3A 4I97A 3DKSA 1V57A 2MZCA 1ZCPA 1H4OA 2OKAA 1KEBA 5EY6A 3D6IA 4BVYA 4EXJA 4X1UA 4G2EA 4ZB8A 4P3YB 3SWLA 4ZL9A 4MPGA 3ME7A 3CSIA 2FCHA 2RM5A 2G0FA 1ERTA 4I5QA 1O81A 2LUSA 3U6VA 3RPNA 4GLTA 2PERA 5G1LA 1GNEA 3DRNA 1F37A 3UARA 4OO4A 1MDIA 3LEFA 3ZTLA 4KH7A 1PN9A 2P31A 5CRDA 5LCZA 3M1GA 1WE0A 1XW9A 2FWHA 4K2DA 2YV9A 5A4VA 1OE8A 4ZL8A 3H79A 4PGTA 5J5NA 1V98A 5IMDA 1B8XA 1GP1A 4BVXB 3M9JA 2FWEA 4I6XA 3C73A 4PQHA 1A23A 4Q5RA 2YN1A 3MAKA 1TOFA 3J7Yk 1OE7A 2DC5A 1SK2A 1TI1A 2AUVA 2HXKA 4G10A 3KCMA 4ISDA 4BA7A 13GSA 1K0NA 10GSA 5G2ZA 3RPPA 2C0DA 5DBQA 3BCKA 3QAGA 6GSYA 5E4WA 3FZAA 4WBRD 2H1AA 1ZOFA 5ECQB 2GZZA 5KEJA 4XS4A 1DBYA 4L0UA 3A5WA 1GLPA 4G19A 2CA8A 5F05A 2E2MA 1FHEA 3D5JA 1AQVA 4OFTA 4XS1A 1KNGA 4Q5QA 1Z9HA 3R3EA 2HZEA 2C3NA 2TRCP 3HKRA 2C8UA 5CRGA 1LU4A 2YWIA 3L9UA 1AIUA 4E8EA 3W8SA 3HZ8A 3F9UA 2CZ3A 4H86A 5IMCA 4KGIA 2E7PA 4KCAA 2NBSA 5A4UA 3BJ5A 2CVKA 1YEXA 4BWQA 5J4UA 1AUCA 3PH9A 3EE2A 4F03A 3HZ4A 1U6TA 1GSSA 2V6KA 1OKDA 4N0ZA 2AYTA 4QL7A 4GTUA 5KN3A 2VCTA 5G1KA 1XWKA 3EU3A 1OC9A 1T3BA 2OE0A 3HXSA 1AQXA 2HZEB 2H72A 1PA3A 3UEMA 1EGOA 2B1LA 2YANA 2JSYA 3W6GA 2E0QA 4ZB6A 4FYUA 1Q98A 1OAZA 5DJMA 4MLYA 3LGCA 1HNBA 1QXHA 4GF0A 4ID0A 4HEA2 1SYRA 1E2YA 3DIEA 2RLIA 2VL3A 3LFLA 2WB9A 4ZB9A 2V1MA 2DBCA 3HCZA 4EVMA 1VF3A 3P90A 5ELAA 2DLXA 3F4SA 2GZPA 4QL9A 1M2AA 3TB2A 6GSSA 5D8IA 5J9CA 1GULA 4IGJA 5IPHA 5GSSA 5CO3A 3U5RE 4JE1A 4J57E 4EKZA 2V32A 4F9ZA 2H1BA 5IM9A 1A0FA 1TJDA
chains in the Genus database with same CATH superfamily
4RI6A 3VPQA 2I81A 2YPMA 4KCEA 4V1Ag 3ZIJA 3HVVA 2GS3A 4L5OA 1GTBA 2GSRA 4MF5A 1R5PA 3HVNA 2H0HA 4ZXGA 4PQ1A 1C72A 5BMUB 1WMJA 3LXTA 2F9SA 1GSFA 3TOTA 2OBKA 3VPTA 1EOHA 3TKSC 2FY6A 4CHSA 4AI6A 2R0PA 1O73A 1YF0A 1MDKA 4YQUA 2VL2A 3RGBC 1T1VA 3P2AA 2GT6A 3FK8A 2LJKA 1URMA 2FHEA 2ZNMA 2WJUA 5DCHA 3GKMA 1BYEA 3EPTA 1WPIA 1HD2A 3GFKA 1OC3A 4IVFA 4XRAA 3WT2A 3QMXA 2R0GA 1TRUA 5G31A 5A1NA 3QR6A 4EC0A 4TOPA 1T00A 4DSSB 2L5OA 4RQXA 4Q5NA 5KOWA 3D4TA 5IOXA 3PGTA 4PX1A 4ZBDA 4XS6A 1XBSA 5ECKB 2B5YA 2WW1A 2WDUA 4TW5A 4K5SA 3OR5A 3ERWA 4FH8A 2DIZA 1BJXA 5DDLA 4AJ7A 5J41A 1TRSA 1FVJA 3F3RA 3VK9A 1O85A 2WZ9A 5ECSA 1JFUA 4LMVA 5J9BA 3L9SA 3IPZA 3IBHA 1F9MA 1GSDA 2N5FA 2XBIA 5A1NB 3ME8A 3QCPA 1X5CA 3GV1A 2H70A 4WF4A 4NHWA 4O5QA 1F3BA 2GGTA 4XTSA 2XHFA 1S3CA 5DCGA 2PUKC 3G7JA 1YEPA 2F8AA 3LYPA 1QMVA 1LBKA 3HVXA 2DJJA 2HNLA 2MYGA 3PINA 3LORA 5ECRB 4MMMA 3TJFA 1YKCA 5ECOB 5FT3A 4ZBAA 2H71A 1Z3EA 1A24A 3RDWA 1BX9A 3ZREA 4O7HA 1GUMA 2VOCA 2L6CA 2GSQA 5ID2B 3KTBA 1Q4JA 1BEDA 2H6YA 1K0MA 1I5GA 3GA4A 5IIZA 3FZ9A 4GWRA 2FGXA 1XWCA 2FWFA 3GH6A 2REMA 4MPFA 5D96A 3GL5A 4RUVA 5FHIA 1MEKA 4NV5A 3DEXA 2C0FA 3IAS2 3IR4A 1FB0A 4OCEA 3TJGA 4IELA 3EVIA 2LQQA 4E8HA 3MSZA 5EVOA 3EYTA 3G9BA 4MZWA 4EDZA 1T7PB 3NIVA 2O36A 2LEGA 5BRTA 1XVWA 3APSA 4EL1A 3GN3A 2A2RA 1M9AA 4HZ2A 2H1LA 2PWJA 4V1Ap 1TKDB 5DJLA 2D2ZA 1SKWB 4RI7A 2HSYA 7GSSA 3UVTA 5HFIA 4F82A 1XOBA 4YQMA 4YAPA 2CX3A 2P0GA 5DAKA 1OVNA 1OYJA 2PU9C 2HSNB 2PBJA 2O85A 4ECCA 4YKFA 3GRXA 2KP2A 4PHZC 2O7KA 4DEJA 4XIHA 1FOVA 3BBYA 3US3A 5ECLB 1HYUA 2FLSA 1TXXA 1SJZA 3ISOA 3L0HA 1BQ7A 3FZ4A 3WGXA 5B6MA 1A8LA 4WR5A 4KF9A 2OE3A 4IS0A 4QMKA 4EE0A 1M0UA 5DVBA 4EIQA 1EOGA 3D21A 4AKHA 4TKYA 1JHBA 2X4AA 4MA9A 1K0OA 3QD9A 3DXBA 5F8BA 1TTZA 2DMMA 2IN3A 1W89A 5CRWA 2VM1A 5ECPB 2FA4A 4G9HA 3KP9A 4WEYA 4L8EA 1X5EA 2NVLA 3Q19A 2HQTA 2IMIA 1M3IA 3MDKA 2K8VA 3M8NA 5DAKB 2R37A 4D73A 2PVOC 1K3YA 4FIWA 1TU8A 3QFAC 1TW9A 1ERWA 4ML6A 4YAVA 1XOAA 5A34B 4MDCA 1B4QA 2WW0A 3VWVA 4AGSA 2IMDA 4BVXA 5IMFA 4BPYA 2CAQA 5DQYA 2BTOT 2ALBA 5ECIB 3Q74A 6GSXA 4I8BA 1PN0A 3CXGA 4GRFA 3QAVA 2HRFA 1SL0B 3AY8A 4KSOA 3IC8A 1USBA 3KXOA 2KLXA 2R3XA 4KUNA 4MJCA 1H75A 3FKFA 3RFRC 3ZMKA 2VCWA 4ECJA 4HJ2A 5D9XA 5KN1A 2HZFA 5JWOB 4KAEA 2MMNA 3IC4A 1O8WA 2C0GA 5J4YA 2HYXA 3RHCA 5HFKA 5LD0A 3ED3A 4L0WA 3BCIA 1ZZYA 3IV4A 5JCWA 1THOA 2XPDA 4D73B 2UZ8A 2FNOA 4KE3A 1QK8A 1T4ZA 1U88A 3M3MA 1A2LA 4I2TA 1KTEA 3IRAA 1BAYA 2OADA 1M2DA 5J3RA 2O8VB 3VWXA 4OWYA 3KJYA 5GSTA 2DJ1A 3EURA 1YZXA 1JLVA 3DD3A 4JR6A 5HR1A 4OMVA 1XZOA 4EUYA 1R4WA 3CRTA 4IW9A 3Q18A 3ZFBA 3I43A 2X49A 3C71A 4JRRA 4Z2UA 4Q5FA 3ZMLA 1VF2A 3APQA 4MJAA 3GX8A 1U3IA 4IJIA 5L71A 4N0VA 4MZCA 2YNXA 2B7KA 2YZUA 3M9KA 1TK8B 1X9WB 2H1DA 5ECNB 1G7OA 3PPUA 2L4CA 5G30A 2DJ3A 2L6DA 3F3QA 5IQYA 4AJ8A 1GRXA 3TRXA 2JACA 1M7TA 5COHA 1K0AA 5CAXA 2I9HA 3A2WA 1XIYA 3MNGA 4IHUA 1AW9A 2C3QA 2A4HA 2A4VA 2OACA 3DGQA 3LJRA 1FAAA 1PL2A 2VKZG 4PQIA 2PPTA 2O89A 2BJXA 5JWRB 3UIWA 2GVPA 1K3OA 5KN0A 3UBLA 2FUG2 2VO4A 4CW9A 4K1FA 2JZTA 3V1WA 4HUAA 1AXDA 1R26A 1GNWA 4KDYA 3VWWA 3QOUA 4ML1A 2GQLA 1YJ6A 1V58A 1GH2A 2VCZA 3WGEA 3ZLPA 3GUSA 4ZBBA 2B5EA 4TXOB 1WRYA 3EINA 3PR8A 2LRNA 3ZYWA 2GLRA 2JL4A 4KW6A 1TXUA 1V40A 22GSA 1X9SB 5BMUA 2RUFA 1XXUA 4JEDA 1MDJA 2YWOA 3N9JA 2HRNA 1XW6A 4PNFA 1GTIA 1IYHA 4JBBA 3F4RA 1MD4A 5D73A 3P7XA 2OBIA 1PMTA 2WFCA 3GMFA 3KM6A 1WWJA 1ZYEA 3G7YA 4AJ6A 3D4MA 2JADA 1MTCA 3LQ7A 3TCOA 2AHEA 2IJYA 2V2GA 1G6YA 3N5OA 2MBTA 2WS2A 3O76A 1BG5A 4CY6A 1SJIA 4DSSA 1GWCA 2AJQB 4AKXB 2R6KA 4TR0A 4PXOA 8GSSA 3GKNA 3L78A 3A3TA 2GSTA 5H5SA 4G0IA 3GHAA 1V9WA 2NPBA 4KNDA 5CNWA 1ABAA 4PUAA 3H4KA 2TRXA 3BD2A 4IJ3A 4MP4A 2AV4A 1R5AA 3IAM2 2HSMB 1N25A 3TKQA 2H73A 2X8CA 3E9JB 1SK0A 3HJPA 3KP8A 4G0KA 5B6NA 3FR6A 6GSTA 4GQFA 4F2IA 5DALA 2QA2A 2QC7A 1NHYA 3UJ1A 2OT3A 3LSZA 2EFCA 3F6DA 1EV9A 5C04A 2LV3A 1CQGA 4IP6A 1N2AA 2RUEA 2QGVA 2WVZA 2YJHA 2CT6A 1XFLA 1M99A 2GDRA 2CZ2A 5D9VA 2CQ9A 1AAZA 1FO5A 3QDNA 3FYGA 5HR0A 3E3EA 1K0CA 4MH2A 16GSA 1GSUA 1Z7PA 1V2AA 3KMOA 3VI7A 1X0RA 3C1SA 2H1GA 3CBUA 5ENUA 4GXZA 5ID2A 2F3MA 3GURA 3UVHA 1ERVA 5ECMB 1G0TA 1PQNA 4OO5A 4POKA 5DALB 3LWAA 3VLNA 5D93A 3IK7A 2AAWA 3GNJA 1Y25A 5H5RA 3J7Yb 2MBSA 1PD21 5B8BA 1SD9A 3H8QA 1BG1A 3ZIVA 1DE1A 4V2NA 1CQHA 4EIPA 4NXIA 2B5XA 5H5QA 2LNSA 4MABA 4MH3A 4V2MA 1EGRA 5JCUA 2VD0A 2HRAA 1TU7A 2WZSA 5AIXA 5G5FA 2C80A 3P8WA 1N8JA 1TRVA 4HU7A 4F0BA 4HZ4A 1W4VA 4PUFC 1SVOA 1K3LA 1XVQA 2IMFA 2R0CA 4V2LA 1G6WA 1TI3A 4O92A 2I3YA 1A0RP 1GLQA 2R4VA 4K7IA 4XRDA 3VFIA 2OA7A 3UMAA 1YF1A 4N30A 1UN2A 2RM6A 3FMWA 1R7HA 2ZCTA 4DSRA 5J4VA 5CYYA 4TR3A 1Z6NA 1VF4A 1JZWA 4LMWA 2H76A 2VL9A 4GSTA 4GCIA 1FVKA 3KH9A 2O87A 2CVBA 2L4QA 2FA8A 2HSNA 4IQ1A 5A4WA 1SKSB 2N5AA 5E59A 5IOWA 1RQMA 3HDCA 2I1UA 1EEJA 1XG8A 3VURA 4FYCA 3BOAA 6GSUA 1GUHA 4DVCA 5C00A 2EIOA 4F0CA 4TN8A 2LRCA 6GSVA 3IDVA 2P5QA 2DJ0A 5AIVA 3TJKA 1KBNA 2L59A 2H30A 4RQRA 5G5EA 1JZOA 2QSIA 2IMEA 2UV8G 3KTLA 2YCDA 3ZFLA 3UL3A 1WIKA 2HRKA 2VIMA 1T4YA 3GKKA 1XW5A 3FY7A 2WRTA 3HY2A 3HJOA 1YKAA 1HNAA 2LKUA 2XBQA 2DJ2A 4K0GA 1THXA 2H74A 2JU5A 1PX7A 3FZ5A 2MMAA 5A34A 3FEUA 3K8NA 4EF0A 3FRCA 2DSAA 5EPFA 3I69A 4ZB7A 4I2UA 4Z2TA 3HHVA 4JR4A 1F3AA 3IE3A 1S4BP 5HR2A 3KD0A 4G01A 2KUCA 3CQFA 4WR4A 1PSQA 3VWUA 4NPBA 1ZYPA 4CDOA 5D9WA 4ZILA 2F51A 3L9VA 4EO3A 3HA9A 3ZRDA 3C8EA 2HRKB 2GTUA 1NW2A 1SKRB 1FB6A 2IFQB 4USSA 3HVSA 1GSYA 4HJMA 4BL7A 5EL8A 3DVWA 4WETA 2WULA 3CMIA 1YQ1A 4FQUA 1BF5A 2H0IA 1J0FA 1EV4A 3TKSA 4OCFA 2LJRA 2VL2C 4EDYA 4PURA 2L5LA 1WJKA 2LJAA 12GSA 2YV7A 1A8YA 1GUKA 2VCVA 4O5RA 2HE3A 3EMXA 1PGTA 5DQSA 4XCSA 1ERUA 2IWTA 3TJBA 1OKTA 3ZL5A 4LL1B 3M0FA 4AKIA 4K8MA 1YEWC 4FYBA 1QUWA 3R2QA 3ERGA 4GSSA 4YKGA 2K18A 1PX6A 2DKHA 4A5PA 4BL7B 4JU5A 1B48A 5ABRA 1B9YC 4N11A 1ZYNA 4POLA 2LS5A 5GAPD 2VCQA 3EC3A 2KHPA 3NOFA 2GQMA 4NHZA 2NDOA 1S3RA 2FD3A 2ON5A 4OFNA 3SBCA 4HI7A 3GSTA 3G7IA 5KN2A 2ES7A 4OFMA 4N10A 4BVYB 4ZIJA 18GSA 2K8SA 2VUPA 1PL1A 2V41A 2M80A 3KH7A 2H8LA 1OC8A 1U3AA 3H93A 1NHOA 2OJLA 2O3EA 3FR9A 4LL4B 2MMOA 2QKEA 4MCUA 1X5DA 2ON7A 5INYA 4AF2A 1M3JA 1SU9A 4PTSA 4X4JA 2EIRA 3F4TA 2GSSA 1QQ2A 3GL3A 3LW9A 3DVXA 3WYWA 2YWMA 3GKXA 4TXOA 3CYNA 2IPAA 4MJBA 2C1YA 3C7MA 2VLVA 2PGTA 5A5HB 2EIQA 2O5VA 4BWSA 3TRPA 4Z7XA 1VF1A 2KOKA 2GQKA 3ZVJD 5D9TA 4WBJA 4FO5A 3FR3A 4KDUA 5IMVA 3A2VA 2OE1A 4AKGA 2IMKA 1X9MB 1IYIA 1U87A 2GZYA 4TR1A 4N3ZA 4NWYA 5AISA 3DMLA 1S3AA 5B7CA 3GX0A 2B1KA 2C0EA 2PMTA 2H66A 4MJEA 3ZITA 4KDXA 1TP9A 3KZQA 2VD1A 2CX4A 2VAFA 4DSQA 3D22A 3FHKA 1SVLA 1A2MA 3TKRA 1K0DA 1EP8A 1UA5A 3EWLA 3QFBC 1UVZA 1VRSD 4HQZA 4XS4B 1DUGA 1ACVA 1GTAA 4PNGA 2PN8A 2E2GA 1TDIA 2C3TA 3IHGA 3IK9A 5AN1A 5A5KA 1EWXA 4MF6A 2JSZA 5F06A 2BMXA 4PI0C 3JCML 4W66A 3MYDA 2VLUA 4TR1B 1Y1UA 1B4PA 4ULXA 2CVDA 3HYPA 5JWQB 1SK1A 3ZZXA 6GSWA 4L5LA 4GSNA 4HU9A 1JLWA 2EFHA 3DYRA 4IN0A 1SVMA 4K0NA 2Z9SA 2QA1A 1WP0A 1ZMAA 2HSMA 5GZZB 3H1NA 2TIRA 4POMA 4TR4A 3WT1A 3KMNA 2H0GA 4G0LA 4YQVA 1O6JA 4MK3A 2X99A 3IHQA 4ECBA 2G2QA 1OC9B 1HQOA 1Z6MA 3QPMA 1E6BA 1SENA 1AQWA 4JZQA 1XWGA 5ECHB 4K6XA 2RIIA 4ICYA 3WD6A 3TKSE 2GT5A 2H6ZA 5IO0A 2NTOA 1TRWA 3TKPA 3UOMA 4HQSA 4PI2C 4J56E 1ZYQB 4MZBA 1I9DA 3E0UA 5F07A 1WOUA 3LYKA 1YDKA 2KP1A 2YJ7A 3TUEA 1SL1B 1Z5YE 2IIYA 20GSA 2K6VA 4K7OA 2DIYA 1FOHA 4NV2A 4J2FA 4YH2A 1ON4A 4HS1A 2WVXB 4ECIA 2YZHA 5JCGA 3CTGA 2R5GA 4GQCA 4IBPA 2H01A 3L4NA 4X0XA 5IMAA 3CSHA 4KX4A 1Y6EA 3HJMA 2H6XA 2HI7A 3GSSA 3NZNA 2EC4A 3Q6OA 4TRXA 4WF5A 4E68A 4NAXA 2HLSA 1EEMA 1F6MC 1SYXA 2JZRA 5IMZA 3WGDA 19GSA 2X8HA 4OD7A 2YP6A 3EU4A 4WKWA 2H75A 4K2XA 3S9FA 2B3SA 2V6OA 3CRUA 5B8AA 3HD5A 1XWBA 1QGVA 1PKZA 2M46A 3O3TA 2AB6A 2DJKA 3MWHA 4Z2RA 2FWGA 5IO2A 3GTUA 3IA1A 3CSJA 1MD3A 1UC7A 2I4AA 4LLRA 1GSQA 3UBKA 3KEBA 3TDGA 5CREA 2CV4A 2N5BA 3UAPA 2VCXA 1FG4A 5IPGA 1S3DA 3IOSA 1EP7A 4IP1A 3GH9A 1J9BA 5HFGA 1QFNA 2WCIA 1FW1A 2K9FA 5HQPA 1DSBA 1VGLA 2B6MA 1TK5B 5J40A 4GDFA 1NM3A 2HT9A 3D0ZA 1B9XC 1XWAA 5CP1A 4KA0A 3F0IA 1M9BA 1AC1A 2B7JA 3A2XA 5KOXA 1ZL9A 3ZVJA 3TJJA 3GTUB 2A2SA 3RHBA 1I1IP 3W8JA 5ELGA 2X8GA 3DWVA 1O7UA 1PRXA 2LSTA 1NSWA 1XPVA 1GL8A 2LQOA 1F2EA 2J9HA 2JZSA 3C1RA 2CAIA 4NMUA 2YWNA 4XHMA 1K0BA 3CWGA 3LXZA 4IQAA 1ST9A 4O32A 3LG6A 3O6TA 4HOJA 1EZKA 2PVQA 2J23A 3GIXA 4WXTA 2IL3A 2LTKA 1SL2B 1JZDA 3TGZA 1J08A 2MMZA 2M72A 2L57A 2C4JA 2P5RA 1A2JA 3GYKA 4LA1A 3A5IA 3F6FA 2HSHA 4CY8A 1YY7A 1JZRA 1O8XA 2VLTA 3FW2A 4K7NA 2XC2A 4ILFA 1SJ6A 1GSEA 2IFQA 5AGYA 3CTFA 2H19A 3EMPA 2X64A 1RW1A 3TOUA 1T8EB 4ACSA 3F8UA 1TK0B 4QQ7A 1G7EA 3TRQA 3QAWA 2LNTA 1ZGNA 9GSSA 1ML6A 11GSA 2F8FA 2DMLA 2ZUPA 5F0GA 2R2JA 2A2PA 2XPEA 4MNNA 3F63A 3KGKA 1RK4A 4ZL7A 4POBA 3I6AA 1HNCA 2YOIA 14GSA 5LNKe 1YVLA 4TVEA 2HFDA 1SD8A 1GTUA 1M2BA 2WW3A 1LJRA 4X43A 3VI5A 3TU3B 3IXRA 2WGRA 4K9ZA 3ERFA 2LRTA 4HDEA 3RAZA 5GAND 1Z7RA 2VM2A 4TXVA 2EFEA 1XCCA 4KSMA 1PFOA 3KIJA 1PKWA 4MF7A 1ILOA 2WVYA 3I9V2 1DE2A 17GSA 4IKHA 4KB3A 3RBTA 5FWGA 3APOA 4FXYP 5CRHA 5HR3A 4I97A 3DKSA 1V57A 2MZCA 1ZCPA 1H4OA 2OKAA 1KEBA 5EY6A 3D6IA 4BVYA 4EXJA 4X1UA 4G2EA 4ZB8A 4P3YB 3SWLA 4ZL9A 2EFDA 4MPGA 3ME7A 3CSIA 2FCHA 2RM5A 2G0FA 1ERTA 4I5QA 1O81A 2LUSA 3U6VA 2DKIA 3RPNA 4GLTA 2PERA 5G1LA 1GNEA 3DRNA 1F37A 3UARA 4OO4A 1MDIA 3LEFA 3ZTLA 4KH7A 1PN9A 2P31A 5CRDA 5LCZA 3M1GA 1WE0A 1XW9A 2FWHA 4K2DA 5A5HA 2YV9A 4K5RA 5A4VA 1OE8A 4ZL8A 3H79A 4PGTA 5J5NA 1V98A 5IMDA 1B8XA 1GP1A 4BVXB 3M9JA 2FWEA 4I6XA 3C73A 4PQHA 1A23A 4Q5RA 2YN1A 3MAKA 1TOFA 3J7Yk 1OE7A 2DC5A 4BIKA 1SK2A 1TI1A 2AUVA 2HXKA 4G10A 3KCMA 4ISDA 4BA7A 13GSA 1K0NA 10GSA 5G2ZA 3RPPA 2C0DA 5DBQA 3BCKA 3QAGA 6GSYA 5E4WA 3FZAA 4WBRD 2H1AA 1ZOFA 5ECQB 2GZZA 5KEJA 4XS4A 1DBYA 4L0UA 3A5WA 1GLPA 4G19A 2CA8A 5F05A 2E2MA 1FHEA 3D5JA 1AQVA 4OFTA 4XS1A 1KNGA 4Q5QA 1Z9HA 3R3EA 5J47A 2C3NA 2HZEA 2TRCP 3HKRA 2C8UA 5CRGA 1LU4A 2YWIA 3L9UA 1AIUA 4E8EA 3W8SA 3HZ8A 3F9UA 2WW2A 2CZ3A 4H86A 5IMCA 4KGIA 2E7PA 4KCAA 2NBSA 5A4UA 3BJ5A 2CVKA 1YEXA 4BWQA 5J4UA 1AUCA 3PH9A 3EE2A 4F03A 3HZ4A 1U6TA 1GSSA 2V6KA 1OKDA 4N0ZA 2AYTA 4QL7A 4GTUA 5KN3A 2VCTA 5G1KA 1XWKA 3EU3A 1OC9A 1T3BA 2OE0A 3HXSA 1AQXA 2HZEB 2H72A 1PA3A 3CHXC 3UEMA 1EGOA 2B1LA 2YANA 2JSYA 3W6GA 2E0QA 4ZB6A 1Q98A 4FYUA 1OAZA 5DJMA 4MLYA 3LGCA 1HNBA 1QXHA 4GF0A 4ID0A 4HEA2 1SYRA 4HSCX 1E2YA 3DIEA 2RLIA 2VL3A 3LFLA 2WB9A 4ZB9A 2V1MA 2DBCA 3HCZA 4EVMA 4O5UA 1VF3A 3P90A 5ELAA 2DLXA 3F4SA 2GZPA 4QL9A 1M2AA 2WVXA 3TB2A 6GSSA 5D8IA 5J9CA 1GULA 4IGJA 5IPHA 5GSSA 5CO3A 3U5RE 3MIXA 4JE1A 3HMJG 4J57E 4EKZA 2V32A 4F9ZA 2H1BA 5IM9A 1A0FA 1TJDA
chains in the Genus database with same CATH topology
4RI6A 3VPQA 2I81A 2YPMA 4KCEA 4V1Ag 3ZIJA 3HVVA 2GS3A 4L5OA 1GTBA 2GSRA 4MF5A 1R5PA 2H0HA 4ZXGA 4PQ1A 1C72A 5BMUB 1WMJA 3LXTA 2F9SA 1GSFA 3TOTA 2OBKA 3VPTA 1EOHA 3TKSC 2FY6A 4CHSA 4AI6A 2R0PA 1O73A 1YF0A 1MDKA 4YQUA 2VL2A 1T1VA 3P2AA 2GT6A 3FK8A 2LJKA 1URMA 2FHEA 2ZNMA 2WJUA 5DCHA 3GKMA 1BYEA 3EPTA 1WPIA 1HD2A 3GFKA 1OC3A 4IVFA 4XRAA 3WT2A 3QMXA 2R0GA 1TRUA 5G31A 5A1NA 3QR6A 4EC0A 4TOPA 1T00A 4DSSB 2L5OA 4RQXA 4Q5NA 5KOWA 3D4TA 5IOXA 3PGTA 4PX1A 4ZBDA 4XS6A 1XBSA 5ECKB 2B5YA 2WDUA 4TW5A 4K5SA 3OR5A 3ERWA 4FH8A 2DIZA 1BJXA 5DDLA 4AJ7A 5J41A 1TRSA 1FVJA 3F3RA 3VK9A 1O85A 2WZ9A 5ECSA 1JFUA 4LMVA 5J9BA 3L9SA 3IPZA 3IBHA 1F9MA 1GSDA 2N5FA 2XBIA 5A1NB 3ME8A 3QCPA 1X5CA 3GV1A 2H70A 4WF4A 4NHWA 4O5QA 1F3BA 2GGTA 4XTSA 2XHFA 1S3CA 5DCGA 2PUKC 3G7JA 1YEPA 2F8AA 3LYPA 1QMVA 1LBKA 3HVXA 2DJJA 2HNLA 2MYGA 3PINA 3LORA 5ECRB 4MMMA 3TJFA 1YKCA 5ECOB 5FT3A 4ZBAA 2H71A 1Z3EA 1A24A 3RDWA 1BX9A 3ZREA 4O7HA 1GUMA 2VOCA 2L6CA 2GSQA 5ID2B 3KTBA 1Q4JA 1BEDA 2H6YA 1K0MA 1I5GA 3GA4A 5IIZA 3FZ9A 4GWRA 2FGXA 1XWCA 2FWFA 3GH6A 2REMA 4MPFA 5D96A 3GL5A 4RUVA 5FHIA 1MEKA 4NV5A 3DEXA 2C0FA 3IAS2 3IR4A 1FB0A 4OCEA 3TJGA 4IELA 3EVIA 2LQQA 4E8HA 3MSZA 5EVOA 3EYTA 3G9BA 4MZWA 4EDZA 1T7PB 3NIVA 2LEGA 5BRTA 1XVWA 3APSA 4EL1A 3GN3A 2A2RA 1M9AA 4HZ2A 2H1LA 2PWJA 4V1Ap 1TKDB 5DJLA 2D2ZA 1SKWB 4RI7A 2HSYA 7GSSA 3UVTA 5HFIA 4F82A 1XOBA 4YQMA 4YAPA 2CX3A 2P0GA 5DAKA 1OVNA 1OYJA 2PU9C 2HSNB 2PBJA 2O85A 4ECCA 4YKFA 3GRXA 2KP2A 2O7KA 4DEJA 4XIHA 1FOVA 3BBYA 3US3A 5ECLB 1HYUA 2FLSA 1TXXA 1SJZA 3ISOA 3L0HA 1BQ7A 3FZ4A 3WGXA 5B6MA 1A8LA 4WR5A 4KF9A 2OE3A 4IS0A 4QMKA 4EE0A 1M0UA 5DVBA 4EIQA 1EOGA 3D21A 4AKHA 4TKYA 1JHBA 2X4AA 4MA9A 1K0OA 3QD9A 3DXBA 5F8BA 1TTZA 2DMMA 2IN3A 1W89A 5CRWA 2VM1A 5ECPB 2FA4A 4G9HA 3KP9A 4WEYA 4L8EA 1X5EA 2NVLA 3Q19A 2HQTA 2IMIA 3MDKA 2K8VA 3M8NA 5DAKB 2R37A 4D73A 2PVOC 1K3YA 4FIWA 1TU8A 3QFAC 1TW9A 1ERWA 4ML6A 4YAVA 1XOAA 5A34B 4MDCA 1B4QA 3VWVA 4AGSA 2IMDA 4BVXA 5IMFA 4BPYA 2CAQA 5DQYA 2BTOT 2ALBA 5ECIB 3Q74A 6GSXA 4I8BA 1PN0A 3CXGA 4GRFA 3QAVA 2HRFA 1SL0B 3AY8A 4KSOA 3IC8A 1USBA 3KXOA 2KLXA 2R3XA 4KUNA 4MJCA 1H75A 3FKFA 3ZMKA 2VCWA 4ECJA 4HJ2A 5D9XA 5KN1A 2HZFA 5JWOB 4KAEA 2MMNA 3IC4A 1O8WA 2C0GA 5J4YA 2HYXA 3RHCA 5HFKA 5LD0A 3ED3A 4L0WA 3BCIA 1ZZYA 3IV4A 5JCWA 1THOA 2XPDA 4D73B 2UZ8A 2FNOA 4KE3A 1QK8A 1T4ZA 1U88A 3M3MA 1A2LA 4I2TA 1KTEA 3IRAA 1BAYA 2OADA 1M2DA 5J3RA 2O8VB 3VWXA 4OWYA 3KJYA 5GSTA 2DJ1A 3EURA 1YZXA 1JLVA 3DD3A 4JR6A 5HR1A 4OMVA 1XZOA 4EUYA 1R4WA 3CRTA 4IW9A 3Q18A 3ZFBA 3I43A 2X49A 3C71A 4JRRA 4Z2UA 4Q5FA 3ZMLA 1VF2A 3APQA 4MJAA 3GX8A 1U3IA 4IJIA 5L71A 4N0VA 4MZCA 2YNXA 2B7KA 2YZUA 3M9KA 1TK8B 1X9WB 2H1DA 5ECNB 1G7OA 3PPUA 2L4CA 5G30A 2DJ3A 2L6DA 3F3QA 5IQYA 4AJ8A 1GRXA 3TRXA 2JACA 1M7TA 5COHA 1K0AA 5CAXA 2I9HA 3A2WA 1XIYA 3MNGA 4IHUA 1AW9A 2C3QA 2A4HA 2A4VA 2OACA 3DGQA 3LJRA 1FAAA 1PL2A 2VKZG 4PQIA 2PPTA 2O89A 2BJXA 5JWRB 3UIWA 2GVPA 1K3OA 5KN0A 3UBLA 2FUG2 2VO4A 4CW9A 4K1FA 2JZTA 3V1WA 4HUAA 1AXDA 1R26A 1GNWA 4KDYA 3VWWA 3QOUA 4ML1A 2GQLA 1YJ6A 1V58A 1GH2A 2VCZA 3WGEA 3ZLPA 3GUSA 4ZBBA 2B5EA 4TXOB 1WRYA 3EINA 3PR8A 2LRNA 3ZYWA 2GLRA 2JL4A 4KW6A 1TXUA 1V40A 22GSA 1X9SB 5BMUA 2RUFA 1XXUA 4JEDA 1MDJA 2YWOA 3N9JA 2HRNA 1XW6A 4PNFA 1GTIA 1IYHA 4JBBA 3F4RA 1MD4A 5D73A 3P7XA 2OBIA 1PMTA 2WFCA 3GMFA 3KM6A 1WWJA 1ZYEA 3G7YA 4AJ6A 3D4MA 2JADA 1MTCA 3LQ7A 3TCOA 2AHEA 2IJYA 2V2GA 1G6YA 3N5OA 2MBTA 2WS2A 3O76A 1BG5A 4CY6A 1SJIA 4DSSA 1GWCA 2AJQB 4AKXB 2R6KA 4TR0A 4PXOA 8GSSA 3GKNA 3L78A 3A3TA 2GSTA 5H5SA 4G0IA 3GHAA 1V9WA 2NPBA 4KNDA 5CNWA 1ABAA 4PUAA 3H4KA 2TRXA 3BD2A 4IJ3A 4MP4A 2AV4A 1R5AA 3IAM2 2HSMB 1N25A 3TKQA 2H73A 2X8CA 3E9JB 1SK0A 3HJPA 3KP8A 4G0KA 5B6NA 3FR6A 6GSTA 4GQFA 4F2IA 5DALA 2QA2A 2QC7A 1NHYA 3UJ1A 2OT3A 3LSZA 2EFCA 3F6DA 1EV9A 5C04A 2LV3A 1CQGA 4IP6A 1N2AA 2RUEA 2QGVA 2YJHA 2CT6A 1XFLA 1M99A 2GDRA 2CZ2A 5D9VA 2CQ9A 1AAZA 1FO5A 3QDNA 3FYGA 5HR0A 3E3EA 1K0CA 4MH2A 16GSA 1GSUA 1Z7PA 1V2AA 3KMOA 3VI7A 1X0RA 3C1SA 2H1GA 3CBUA 5ENUA 4GXZA 5ID2A 2F3MA 3GURA 3UVHA 1ERVA 5ECMB 1G0TA 1PQNA 4OO5A 4POKA 5DALB 3LWAA 3VLNA 5D93A 3IK7A 2AAWA 3GNJA 1Y25A 5H5RA 3J7Yb 2MBSA 1PD21 5B8BA 1SD9A 3H8QA 1BG1A 3ZIVA 1DE1A 4V2NA 1CQHA 4EIPA 4NXIA 2B5XA 5H5QA 2LNSA 4MABA 4MH3A 4V2MA 1EGRA 5JCUA 2VD0A 2HRAA 1TU7A 5AIXA 5G5FA 2C80A 3P8WA 1N8JA 1TRVA 4HU7A 4F0BA 4HZ4A 1W4VA 4PUFC 1SVOA 1K3LA 1XVQA 2IMFA 2R0CA 4V2LA 1G6WA 1TI3A 4O92A 2I3YA 1A0RP 1GLQA 2R4VA 4K7IA 4XRDA 3VFIA 2OA7A 3UMAA 1YF1A 4N30A 1UN2A 2RM6A 3FMWA 1R7HA 2ZCTA 4DSRA 5J4VA 5CYYA 4TR3A 1Z6NA 1VF4A 1JZWA 4LMWA 2H76A 2VL9A 4GSTA 4GCIA 1FVKA 3KH9A 2O87A 2CVBA 2L4QA 2FA8A 2HSNA 4IQ1A 5A4WA 1SKSB 2N5AA 5E59A 5IOWA 1RQMA 3HDCA 2I1UA 1EEJA 4FYCA 3VURA 3BOAA 6GSUA 1GUHA 4DVCA 5C00A 2EIOA 4F0CA 4TN8A 2LRCA 6GSVA 3IDVA 2P5QA 2DJ0A 5AIVA 3TJKA 1KBNA 2L59A 2H30A 4RQRA 5G5EA 1JZOA 2QSIA 2IMEA 2UV8G 3KTLA 2YCDA 3ZFLA 3UL3A 1WIKA 2HRKA 2VIMA 1T4YA 3GKKA 1XW5A 3FY7A 2WRTA 3HY2A 3HJOA 1YKAA 1HNAA 2LKUA 2XBQA 2DJ2A 4K0GA 1THXA 2H74A 2JU5A 1PX7A 3FZ5A 2MMAA 5A34A 3FEUA 3K8NA 4EF0A 3FRCA 2DSAA 5EPFA 3I69A 4ZB7A 4I2UA 4Z2TA 3HHVA 4JR4A 1F3AA 3IE3A 5HR2A 3KD0A 4G01A 2KUCA 4WR4A 1PSQA 3VWUA 4NPBA 1ZYPA 4CDOA 5D9WA 4ZILA 2F51A 3L9VA 4EO3A 3HA9A 3ZRDA 3C8EA 2HRKB 2GTUA 1NW2A 1SKRB 1FB6A 2IFQB 4USSA 3HVSA 1GSYA 4HJMA 4BL7A 5EL8A 3DVWA 4WETA 2WULA 3CMIA 1YQ1A 4FQUA 1BF5A 2H0IA 1J0FA 1EV4A 3TKSA 4OCFA 2LJRA 2VL2C 4EDYA 4PURA 2L5LA 1WJKA 2LJAA 12GSA 2YV7A 1A8YA 1GUKA 2VCVA 4O5RA 2HE3A 3EMXA 1PGTA 5DQSA 4XCSA 1ERUA 2IWTA 3TJBA 1OKTA 3ZL5A 4LL1B 3M0FA 4AKIA 4K8MA 4FYBA 1QUWA 3R2QA 3ERGA 4GSSA 4YKGA 2K18A 1PX6A 2DKHA 4A5PA 4BL7B 4JU5A 1B48A 5ABRA 1B9YC 4N11A 1ZYNA 4POLA 2LS5A 5GAPD 2VCQA 3EC3A 2KHPA 3NOFA 2GQMA 4NHZA 2NDOA 2FD3A 2ON5A 4OFNA 3SBCA 4HI7A 3GSTA 3G7IA 5KN2A 2ES7A 4OFMA 4N10A 4BVYB 4ZIJA 18GSA 2K8SA 2VUPA 1PL1A 2V41A 2M80A 3KH7A 2H8LA 1OC8A 1U3AA 3H93A 1NHOA 2OJLA 3FR9A 4LL4B 2MMOA 2QKEA 4MCUA 1X5DA 2ON7A 5INYA 4AF2A 1SU9A 4PTSA 4X4JA 2EIRA 3F4TA 2GSSA 1QQ2A 3GL3A 3LW9A 3DVXA 3WYWA 2YWMA 3GKXA 4TXOA 3CYNA 2IPAA 4MJBA 2C1YA 3C7MA 2VLVA 2PGTA 5A5HB 2EIQA 2O5VA 4BWSA 3TRPA 4Z7XA 1VF1A 2KOKA 2GQKA 3ZVJD 5D9TA 4WBJA 4FO5A 3FR3A 4KDUA 5IMVA 3A2VA 2OE1A 4AKGA 2IMKA 1X9MB 1IYIA 1U87A 2GZYA 4TR1A 4N3ZA 4NWYA 5AISA 3DMLA 1S3AA 5B7CA 3GX0A 2B1KA 2C0EA 2PMTA 2H66A 4MJEA 3ZITA 4KDXA 1TP9A 3KZQA 2VD1A 2CX4A 2VAFA 4DSQA 3D22A 3FHKA 1SVLA 1A2MA 3TKRA 1K0DA 1EP8A 1UA5A 3EWLA 3QFBC 1UVZA 1VRSD 4HQZA 4XS4B 1DUGA 1ACVA 1GTAA 4PNGA 2PN8A 2E2GA 1TDIA 2C3TA 3IHGA 3IK9A 5AN1A 5A5KA 1EWXA 4MF6A 2JSZA 5F06A 2BMXA 3JCML 4W66A 3MYDA 2VLUA 4TR1B 1Y1UA 1B4PA 4ULXA 2CVDA 3HYPA 5JWQB 1SK1A 3ZZXA 6GSWA 4L5LA 4GSNA 4HU9A 1JLWA 2EFHA 3DYRA 4IN0A 1SVMA 4K0NA 2Z9SA 2QA1A 1WP0A 1ZMAA 2HSMA 5GZZB 3H1NA 2TIRA 4POMA 4TR4A 3WT1A 3KMNA 2H0GA 4G0LA 4YQVA 1O6JA 4MK3A 2X99A 3IHQA 4ECBA 2G2QA 1OC9B 1HQOA 1Z6MA 3QPMA 1E6BA 1SENA 1AQWA 4JZQA 1XWGA 5ECHB 4K6XA 2RIIA 4ICYA 3WD6A 3TKSE 2GT5A 2H6ZA 5IO0A 2NTOA 1TRWA 3TKPA 3UOMA 4HQSA 4J56E 1ZYQB 4MZBA 1I9DA 3E0UA 5F07A 1WOUA 3LYKA 1YDKA 2KP1A 2YJ7A 3TUEA 1SL1B 1Z5YE 2IIYA 20GSA 2K6VA 4K7OA 2DIYA 1FOHA 4NV2A 4J2FA 4YH2A 1ON4A 4HS1A 4ECIA 2YZHA 5JCGA 3CTGA 2R5GA 4GQCA 4IBPA 2H01A 3L4NA 4X0XA 5IMAA 3CSHA 4KX4A 1Y6EA 3HJMA 2H6XA 2HI7A 3GSSA 3NZNA 2EC4A 3Q6OA 4TRXA 4WF5A 4E68A 4NAXA 2HLSA 1EEMA 1F6MC 1SYXA 2JZRA 5IMZA 3WGDA 19GSA 2X8HA 4OD7A 2YP6A 3EU4A 4WKWA 2H75A 4K2XA 3S9FA 2B3SA 2V6OA 3CRUA 5B8AA 3HD5A 1XWBA 1QGVA 1PKZA 2M46A 3O3TA 2AB6A 2DJKA 3MWHA 4Z2RA 2FWGA 5IO2A 3GTUA 3IA1A 3CSJA 1MD3A 1UC7A 2I4AA 4LLRA 1GSQA 3UBKA 3KEBA 3TDGA 5CREA 2CV4A 2N5BA 3UAPA 2VCXA 1FG4A 5IPGA 1S3DA 3IOSA 1EP7A 4IP1A 3GH9A 1J9BA 5HFGA 1QFNA 2WCIA 1FW1A 2K9FA 5HQPA 1DSBA 1VGLA 2B6MA 1TK5B 5J40A 4GDFA 1NM3A 2HT9A 3D0ZA 1B9XC 1XWAA 5CP1A 4KA0A 3F0IA 1M9BA 1AC1A 2B7JA 3A2XA 5KOXA 1ZL9A 3ZVJA 3TJJA 3GTUB 2A2SA 3RHBA 3W8JA 5ELGA 2X8GA 3DWVA 1O7UA 1PRXA 2LSTA 1NSWA 1XPVA 1GL8A 2LQOA 1F2EA 2J9HA 2JZSA 3C1RA 2CAIA 4NMUA 2YWNA 4XHMA 1K0BA 3CWGA 3LXZA 4IQAA 1ST9A 4O32A 3LG6A 3O6TA 4HOJA 1EZKA 2PVQA 2J23A 3GIXA 4WXTA 2IL3A 2LTKA 1SL2B 1JZDA 3TGZA 1J08A 2MMZA 2M72A 2L57A 2C4JA 2P5RA 1A2JA 3GYKA 4LA1A 3A5IA 3F6FA 2HSHA 4CY8A 1YY7A 1JZRA 1O8XA 2VLTA 3FW2A 4K7NA 2XC2A 4ILFA 1SJ6A 1GSEA 2IFQA 5AGYA 3CTFA 2H19A 3EMPA 2X64A 1RW1A 3TOUA 1T8EB 4ACSA 3F8UA 1TK0B 4QQ7A 1G7EA 3TRQA 3QAWA 2LNTA 1ZGNA 9GSSA 1ML6A 11GSA 2F8FA 2DMLA 2ZUPA 5F0GA 2R2JA 2A2PA 2XPEA 4MNNA 3F63A 3KGKA 1RK4A 4ZL7A 4POBA 3I6AA 1HNCA 2YOIA 14GSA 5LNKe 1YVLA 4TVEA 2HFDA 1SD8A 1GTUA 1M2BA 1LJRA 4X43A 3VI5A 3TU3B 3IXRA 2WGRA 4K9ZA 3ERFA 2LRTA 4HDEA 3RAZA 5GAND 1Z7RA 2VM2A 4TXVA 2EFEA 1XCCA 4KSMA 3KIJA 1PKWA 4MF7A 1ILOA 3I9V2 1DE2A 17GSA 4IKHA 4KB3A 3RBTA 5FWGA 3APOA 5CRHA 5HR3A 4I97A 3DKSA 1V57A 2MZCA 1ZCPA 1H4OA 2OKAA 1KEBA 5EY6A 3D6IA 4BVYA 4EXJA 4X1UA 4G2EA 4ZB8A 4P3YB 3SWLA 4ZL9A 2EFDA 4MPGA 3ME7A 3CSIA 2FCHA 2RM5A 2G0FA 1ERTA 4I5QA 1O81A 2LUSA 3U6VA 2DKIA 3RPNA 4GLTA 2PERA 5G1LA 1GNEA 3DRNA 1F37A 3UARA 4OO4A 1MDIA 3LEFA 3ZTLA 4KH7A 1PN9A 2P31A 5CRDA 5LCZA 3M1GA 1WE0A 1XW9A 2FWHA 4K2DA 5A5HA 2YV9A 4K5RA 5A4VA 1OE8A 4ZL8A 3H79A 4PGTA 5J5NA 1V98A 5IMDA 1B8XA 1GP1A 4BVXB 3M9JA 2FWEA 4I6XA 3C73A 4PQHA 1A23A 4Q5RA 2YN1A 3MAKA 1TOFA 3J7Yk 1OE7A 2DC5A 1SK2A 1TI1A 2AUVA 2HXKA 4G10A 3KCMA 4ISDA 4BA7A 13GSA 1K0NA 10GSA 5G2ZA 3RPPA 2C0DA 5DBQA 3BCKA 3QAGA 6GSYA 5E4WA 3FZAA 4WBRD 2H1AA 1ZOFA 5ECQB 2GZZA 5KEJA 4XS4A 1DBYA 4L0UA 3A5WA 1GLPA 4G19A 2CA8A 5F05A 2E2MA 1FHEA 3D5JA 1AQVA 4OFTA 4XS1A 1KNGA 4Q5QA 1Z9HA 3R3EA 5J47A 2C3NA 2HZEA 2TRCP 3HKRA 2C8UA 5CRGA 1LU4A 2YWIA 3L9UA 1AIUA 4E8EA 3W8SA 3HZ8A 3F9UA 2CZ3A 4H86A 5IMCA 4KGIA 2E7PA 4KCAA 2NBSA 5A4UA 3BJ5A 2CVKA 1YEXA 4BWQA 5J4UA 1AUCA 3PH9A 3EE2A 4F03A 3HZ4A 1U6TA 1GSSA 2V6KA 1OKDA 4N0ZA 2AYTA 4QL7A 4GTUA 5KN3A 2VCTA 5G1KA 1XWKA 3EU3A 1OC9A 1T3BA 2OE0A 3HXSA 1AQXA 2HZEB 2H72A 1PA3A 3UEMA 1EGOA 2B1LA 2YANA 2JSYA 3W6GA 2E0QA 4ZB6A 1Q98A 4FYUA 1OAZA 5DJMA 4MLYA 3LGCA 1HNBA 1QXHA 4GF0A 4ID0A 4HEA2 1SYRA 1E2YA 3DIEA 2RLIA 2VL3A 3LFLA 2WB9A 4ZB9A 2V1MA 2DBCA 3HCZA 4EVMA 4O5UA 1VF3A 3P90A 5ELAA 2DLXA 3F4SA 2GZPA 4QL9A 1M2AA 3TB2A 6GSSA 5D8IA 5J9CA 1GULA 4IGJA 5IPHA 5GSSA 5CO3A 3U5RE 3MIXA 4JE1A 3HMJG 4J57E 4EKZA 2V32A 4F9ZA 2H1BA 5IM9A 1A0FA 1TJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RI6 A;  3VPQ A;  2I81 A;  2YPM A;  4KCE A;  4V1A g;  3ZIJ A;  3HVV A;  2GS3 A;  4L5O A;  1GTB A;  2GSR A;  4MF5 A;  1R5P A;  2H0H A;  4ZXG A;  4PQ1 A;  1C72 A;  1WMJ A;  3LXT A;  2F9S A;  1GSF A;  3TOT A;  2OBK A;  3VPT A;  1EOH A;  3TKS C;  2FY6 A;  4CHS A;  1O73 A;  1YF0 A;  1MDK A;  4YQU A;  2VL2 A;  1T1V A;  3P2A A;  2GT6 A;  3FK8 A;  2LJK A;  1URM A;  2FHE A;  2ZNM A;  2WJU A;  5DCH A;  3GKM A;  1BYE A;  1WPI A;  1HD2 A;  3GFK A;  1OC3 A;  4IVF A;  4XRA A;  3WT2 A;  3QMX A;  1TRU A;  5G31 A;  3QR6 A;  4EC0 A;  4TOP A;  1T00 A;  4DSS B;  2L5O A;  4RQX A;  4Q5N A;  3D4T A;  5IOX A;  3PGT A;  4PX1 A;  4ZBD A;  4XS6 A;  1XBS A;  5ECK B;  2B5Y A;  2WDU A;  4TW5 A;  3OR5 A;  3ERW A;  4FH8 A;  2DIZ A;  1BJX A;  5DDL A;  4AJ7 A;  5J41 A;  1TRS A;  1FVJ A;  3F3R A;  3VK9 A;  1O85 A;  2WZ9 A;  5ECS A;  1JFU A;  4LMV A;  5J9B A;  3L9S A;  3IPZ A;  3IBH A;  1F9M A;  1GSD A;  2N5F A;  2XBI A;  3ME8 A;  3QCP A;  1X5C A;  3GV1 A;  2H70 A;  4WF4 A;  4NHW A;  1F3B A;  2GGT A;  4XTS A;  2XHF A;  1S3C A;  5DCG A;  2PUK C;  3G7J A;  1YEP A;  2F8A A;  3LYP A;  1QMV A;  1LBK A;  3HVX A;  2DJJ A;  2HNL A;  2MYG A;  3PIN A;  3LOR A;  5ECR B;  4MMM A;  3TJF A;  1YKC A;  5ECO B;  5FT3 A;  4ZBA A;  2H71 A;  1Z3E A;  1A24 A;  3RDW A;  1BX9 A;  3ZRE A;  4O7H A;  1GUM A;  2VOC A;  2L6C A;  2GSQ A;  5ID2 B;  3KTB A;  1Q4J A;  1BED A;  2H6Y A;  1K0M A;  1I5G A;  3GA4 A;  5IIZ A;  3FZ9 A;  4GWR A;  2FGX A;  1XWC A;  2FWF A;  3GH6 A;  2REM A;  4MPF A;  5D96 A;  3GL5 A;  4RUV A;  5FHI A;  1MEK A;  4NV5 A;  3DEX A;  2C0F A;  3IAS 2;  3IR4 A;  1FB0 A;  4OCE A;  3TJG A;  4IEL A;  3EVI A;  2LQQ A;  4E8H A;  3MSZ A;  5EVO A;  3EYT A;  3G9B A;  4MZW A;  4EDZ A;  1T7P B;  3NIV A;  2LEG A;  1XVW A;  3APS A;  4EL1 A;  3GN3 A;  2A2R A;  1M9A A;  4HZ2 A;  2PWJ A;  4V1A p;  1TKD B;  5DJL A;  2D2Z A;  1SKW B;  4RI7 A;  2HSY A;  7GSS A;  3UVT A;  5HFI A;  4F82 A;  1XOB A;  4YQM A;  4YAP A;  2CX3 A;  2P0G A;  5DAK A;  1OVN A;  1OYJ A;  2PU9 C;  2HSN B;  2PBJ A;  2O85 A;  4ECC A;  3GRX A;  2KP2 A;  2O7K A;  4DEJ A;  4XIH A;  1FOV A;  3BBY A;  3US3 A;  5ECL B;  1HYU A;  2FLS A;  1TXX A;  1SJZ A;  3ISO A;  3L0H A;  1BQ7 A;  3FZ4 A;  3WGX A;  5B6M A;  1A8L A;  4WR5 A;  4KF9 A;  2OE3 A;  4IS0 A;  4EE0 A;  1M0U A;  5DVB A;  1EOG A;  3D21 A;  4TKY A;  1JHB A;  4MA9 A;  1K0O A;  3QD9 A;  3DXB A;  5F8B A;  1TTZ A;  2DMM A;  2IN3 A;  1W89 A;  5CRW A;  2VM1 A;  5ECP B;  2FA4 A;  4G9H A;  3KP9 A;  4WEY A;  4L8E A;  1X5E A;  2NVL A;  3Q19 A;  2HQT A;  2IMI A;  3MDK A;  2K8V A;  3M8N A;  5DAK B;  2R37 A;  4D73 A;  2PVO C;  1K3Y A;  4FIW A;  1TU8 A;  3QFA C;  1TW9 A;  1ERW A;  4ML6 A;  4YAV A;  1XOA A;  4MDC A;  1B4Q A;  3VWV A;  4AGS A;  2IMD A;  4BVX A;  5IMF A;  4BPY A;  2CAQ A;  5DQY A;  2BTO T;  2ALB A;  5ECI B;  3Q74 A;  6GSX A;  4I8B A;  3CXG A;  4GRF A;  3QAV A;  2HRF A;  1SL0 B;  3AY8 A;  4KSO A;  3IC8 A;  1USB A;  3KXO A;  2KLX A;  2R3X A;  4KUN A;  4MJC A;  1H75 A;  3FKF A;  3ZMK A;  2VCW A;  4ECJ A;  4HJ2 A;  5D9X A;  5KN1 A;  2HZF A;  5JWO B;  4KAE A;  2MMN A;  3IC4 A;  1O8W A;  2C0G A;  2HYX A;  3RHC A;  5HFK A;  5LD0 A;  3ED3 A;  4L0W A;  3BCI A;  1ZZY A;  3IV4 A;  5JCW A;  1THO A;  2XPD A;  4D73 B;  2UZ8 A;  2FNO A;  4KE3 A;  1QK8 A;  1T4Z A;  1U88 A;  3M3M A;  1A2L A;  4I2T A;  1KTE A;  3IRA A;  1BAY A;  2OAD A;  1M2D A;  5J3R A;  2O8V B;  3VWX A;  4OWY A;  3KJY A;  5GST A;  2DJ1 A;  3EUR A;  1YZX A;  1JLV A;  3DD3 A;  4JR6 A;  5HR1 A;  4OMV A;  1XZO A;  4EUY A;  1R4W A;  3CRT A;  4IW9 A;  3Q18 A;  3ZFB A;  3I43 A;  3C71 A;  4JRR A;  4Q5F A;  3ZML A;  1VF2 A;  3APQ A;  4MJA A;  3GX8 A;  1U3I A;  4IJI A;  5L71 A;  4N0V A;  4MZC A;  2YNX A;  2B7K A;  2YZU A;  3M9K A;  1TK8 B;  1X9W B;  2H1D A;  5ECN B;  1G7O A;  3PPU A;  2L4C A;  5G30 A;  2DJ3 A;  2L6D A;  3F3Q A;  5IQY A;  4AJ8 A;  1GRX A;  3TRX A;  2JAC A;  1M7T A;  5COH A;  1K0A A;  5CAX A;  2I9H A;  3A2W A;  1XIY A;  3MNG A;  4IHU A;  1AW9 A;  2C3Q A;  2A4V A;  2OAC A;  3DGQ A;  3LJR A;  1FAA A;  1PL2 A;  4PQI A;  2PPT A;  2O89 A;  2BJX A;  5JWR B;  3UIW A;  2GVP A;  1K3O A;  5KN0 A;  3UBL A;  2FUG 2;  2VO4 A;  4CW9 A;  4K1F A;  2JZT A;  3V1W A;  4HUA A;  1AXD A;  1R26 A;  1GNW A;  4KDY A;  3VWW A;  3QOU A;  4ML1 A;  2GQL A;  1YJ6 A;  1V58 A;  1GH2 A;  2VCZ A;  3WGE A;  3ZLP A;  3GUS A;  4ZBB A;  2B5E A;  4TXO B;  1WRY A;  3EIN A;  3PR8 A;  2LRN A;  3ZYW A;  2GLR A;  2JL4 A;  4KW6 A;  1V40 A;  22GS A;  1X9S B;  5BMU A;  2RUF A;  1XXU A;  4JED A;  1MDJ A;  2YWO A;  3N9J A;  2HRN A;  1XW6 A;  4PNF A;  1GTI A;  1IYH A;  4JBB A;  3F4R A;  1MD4 A;  5D73 A;  3P7X A;  2OBI A;  1PMT A;  2WFC A;  3GMF A;  3KM6 A;  1WWJ A;  1ZYE A;  3G7Y A;  4AJ6 A;  3D4M A;  2JAD A;  1MTC A;  3LQ7 A;  3TCO A;  2AHE A;  2IJY A;  2V2G A;  1G6Y A;  3N5O A;  2MBT A;  2WS2 A;  3O76 A;  1BG5 A;  1SJI A;  4DSS A;  1GWC A;  2AJQ B;  2R6K A;  4TR0 A;  4PXO A;  8GSS A;  3GKN A;  3L78 A;  3A3T A;  2GST A;  5H5S A;  4G0I A;  3GHA A;  1V9W A;  2NPB A;  4KND A;  5CNW A;  1ABA A;  4PUA A;  3H4K A;  2TRX A;  3BD2 A;  4IJ3 A;  4MP4 A;  2AV4 A;  1R5A A;  3IAM 2;  2HSM B;  3TKQ A;  2H73 A;  2X8C A;  3E9J B;  1SK0 A;  3HJP A;  3KP8 A;  4G0K A;  5B6N A;  3FR6 A;  6GST A;  4GQF A;  4F2I A;  5DAL A;  2QC7 A;  1NHY A;  3UJ1 A;  3LSZ A;  3F6D A;  1EV9 A;  5C04 A;  2LV3 A;  1CQG A;  4IP6 A;  1N2A A;  2RUE A;  2QGV A;  2YJH A;  2CT6 A;  1XFL A;  1M99 A;  2GDR A;  2CZ2 A;  5D9V A;  2CQ9 A;  1AAZ A;  1FO5 A;  3QDN A;  3FYG A;  5HR0 A;  3E3E A;  1K0C A;  4MH2 A;  16GS A;  1GSU A;  1Z7P A;  1V2A A;  3KMO A;  3VI7 A;  1X0R A;  3C1S A;  2H1G A;  3CBU A;  5ENU A;  4GXZ A;  5ID2 A;  2F3M A;  3GUR A;  3UVH A;  1ERV A;  5ECM B;  1G0T A;  1PQN A;  4OO5 A;  4POK A;  5DAL B;  3LWA A;  3VLN A;  5D93 A;  3IK7 A;  2AAW A;  3GNJ A;  1Y25 A;  5H5R A;  3J7Y b;  2MBS A;  1PD2 1;  5B8B A;  1SD9 A;  3H8Q A;  3ZIV A;  1DE1 A;  4V2N A;  1CQH A;  4NXI A;  2B5X A;  5H5Q A;  2LNS A;  4MAB A;  4MH3 A;  4V2M A;  1EGR A;  5JCU A;  2VD0 A;  2HRA A;  1TU7 A;  5AIX A;  5G5F A;  2C80 A;  3P8W A;  1N8J A;  1TRV A;  4HU7 A;  4F0B A;  4HZ4 A;  1W4V A;  4PUF C;  1K3L A;  1XVQ A;  2IMF A;  4V2L A;  1G6W A;  1TI3 A;  4O92 A;  2I3Y A;  1A0R P;  1GLQ A;  2R4V A;  4K7I A;  4XRD A;  3VFI A;  2OA7 A;  3UMA A;  1YF1 A;  4N30 A;  1UN2 A;  2RM6 A;  1R7H A;  2ZCT A;  4DSR A;  5CYY A;  4TR3 A;  1Z6N A;  1VF4 A;  1JZW A;  4LMW A;  2H76 A;  2VL9 A;  4GST A;  4GCI A;  1FVK A;  3KH9 A;  2O87 A;  2CVB A;  2L4Q A;  2FA8 A;  4IQ1 A;  5A4W A;  1SKS B;  2N5A A;  5E59 A;  5IOW A;  1RQM A;  3HDC A;  2I1U A;  1EEJ A;  4FYC A;  3VUR A;  3BOA A;  6GSU A;  1GUH A;  4DVC A;  5C00 A;  2EIO A;  4F0C A;  4TN8 A;  2LRC A;  6GSV A;  3IDV A;  2P5Q A;  2DJ0 A;  5AIV A;  3TJK A;  1KBN A;  2L59 A;  2H30 A;  4RQR A;  5G5E A;  1JZO A;  2QSI A;  2IME A;  3KTL A;  2YCD A;  3ZFL A;  3UL3 A;  1WIK A;  2HRK A;  2VIM A;  1T4Y A;  3GKK A;  1XW5 A;  3FY7 A;  2WRT A;  3HY2 A;  3HJO A;  1YKA A;  1HNA A;  2LKU A;  2XBQ A;  2DJ2 A;  4K0G A;  1THX A;  2H74 A;  2JU5 A;  1PX7 A;  3FZ5 A;  2MMA A;  3FEU A;  3K8N A;  4EF0 A;  3FRC A;  2DSA A;  5EPF A;  3I69 A;  4I2U A;  3HHV A;  4JR4 A;  1F3A A;  3IE3 A;  5HR2 A;  3KD0 A;  2KUC A;  4WR4 A;  1PSQ A;  3VWU A;  4NPB A;  4CDO A;  5D9W A;  4ZIL A;  2F51 A;  3L9V A;  4EO3 A;  3HA9 A;  3ZRD A;  3C8E A;  2HRK B;  2GTU A;  1NW2 A;  1SKR B;  1FB6 A;  2IFQ B;  4USS A;  3HVS A;  1GSY A;  4HJM A;  4BL7 A;  5EL8 A;  3DVW A;  4WET A;  2WUL A;  3CMI A;  1YQ1 A;  4FQU A;  2H0I A;  1J0F A;  1EV4 A;  3TKS A;  4OCF A;  2LJR A;  2VL2 C;  4EDY A;  4PUR A;  2L5L A;  1WJK A;  2LJA A;  12GS A;  2YV7 A;  1A8Y A;  1GUK A;  2VCV A;  4O5R A;  2HE3 A;  3EMX A;  1PGT A;  5DQS A;  4XCS A;  1ERU A;  2IWT A;  3TJB A;  1OKT A;  3ZL5 A;  4LL1 B;  3M0F A;  4K8M A;  4FYB A;  1QUW A;  3R2Q A;  3ERG A;  4GSS A;  2K18 A;  1PX6 A;  4BL7 B;  4JU5 A;  1B48 A;  5ABR A;  1B9Y C;  4N11 A;  4POL A;  2LS5 A;  5GAP D;  2VCQ A;  3EC3 A;  2KHP A;  3NOF A;  2GQM A;  4NHZ A;  2NDO A;  2FD3 A;  2ON5 A;  4OFN A;  3SBC A;  4HI7 A;  3GST A;  3G7I A;  5KN2 A;  2ES7 A;  4OFM A;  4N10 A;  4BVY B;  4ZIJ A;  18GS A;  2K8S A;  2VUP A;  1PL1 A;  2V41 A;  2M80 A;  3KH7 A;  2H8L A;  1OC8 A;  1U3A A;  3H93 A;  1NHO A;  2OJL A;  3FR9 A;  4LL4 B;  2MMO A;  2QKE A;  4MCU A;  1X5D A;  2ON7 A;  5INY A;  4AF2 A;  1SU9 A;  4PTS A;  2EIR A;  3F4T A;  2GSS A;  1QQ2 A;  3GL3 A;  3DVX A;  3WYW A;  2YWM A;  3GKX A;  4TXO A;  3CYN A;  2IPA A;  4MJB A;  2C1Y A;  3C7M A;  2VLV A;  2PGT A;  2EIQ A;  4BWS A;  3TRP A;  4Z7X A;  1VF1 A;  2KOK A;  2GQK A;  3ZVJ D;  5D9T A;  4WBJ A;  4FO5 A;  3FR3 A;  4KDU A;  5IMV A;  3A2V A;  2OE1 A;  2IMK A;  1X9M B;  1IYI A;  1U87 A;  2GZY A;  4TR1 A;  4NWY A;  5AIS A;  3DML A;  1S3A A;  5B7C A;  3GX0 A;  2B1K A;  2C0E A;  2PMT A;  2H66 A;  4MJE A;  3ZIT A;  4KDX A;  1TP9 A;  3KZQ A;  2VD1 A;  2CX4 A;  2VAF A;  4DSQ A;  3D22 A;  3FHK A;  1A2M A;  3TKR A;  1K0D A;  1EP8 A;  1UA5 A;  3EWL A;  3QFB C;  1UVZ A;  1VRS D;  4HQZ A;  4XS4 B;  1DUG A;  1ACV A;  1GTA A;  4PNG A;  2PN8 A;  2E2G A;  1TDI A;  2C3T A;  3IK9 A;  5AN1 A;  5A5K A;  1EWX A;  4MF6 A;  2JSZ A;  5F06 A;  2BMX A;  3JCM L;  2VLU A;  4TR1 B;  1B4P A;  4ULX A;  2CVD A;  3HYP A;  5JWQ B;  1SK1 A;  3ZZX A;  6GSW A;  4L5L A;  4GSN A;  4HU9 A;  1JLW A;  3DYR A;  4IN0 A;  4K0N A;  2Z9S A;  1WP0 A;  1ZMA A;  2HSM A;  5GZZ B;  3H1N A;  2TIR A;  4POM A;  4TR4 A;  3WT1 A;  3KMN A;  2H0G A;  4G0L A;  4YQV A;  1O6J A;  4MK3 A;  2X99 A;  3IHQ A;  4ECB A;  2G2Q A;  1OC9 B;  1HQO A;  1Z6M A;  3QPM A;  1E6B A;  1SEN A;  1AQW A;  4JZQ A;  1XWG A;  5ECH B;  4K6X A;  2RII A;  3WD6 A;  3TKS E;  2GT5 A;  2H6Z A;  5IO0 A;  2NTO A;  1TRW A;  3TKP A;  3UOM A;  4HQS A;  4J56 E;  1ZYQ B;  4MZB A;  1I9D A;  3E0U A;  5F07 A;  1WOU A;  3LYK A;  1YDK A;  2KP1 A;  2YJ7 A;  3TUE A;  1SL1 B;  1Z5Y E;  2IIY A;  20GS A;  2K6V A;  4K7O A;  2DIY A;  4NV2 A;  4J2F A;  4YH2 A;  1ON4 A;  4HS1 A;  4ECI A;  2YZH A;  5JCG A;  3CTG A;  2R5G A;  4GQC A;  4IBP A;  2H01 A;  3L4N A;  4X0X A;  5IMA A;  3CSH A;  4KX4 A;  1Y6E A;  3HJM A;  2H6X A;  2HI7 A;  3GSS A;  3NZN A;  2EC4 A;  3Q6O A;  4TRX A;  4WF5 A;  4NAX A;  2HLS A;  1EEM A;  1F6M C;  1SYX A;  2JZR A;  5IMZ A;  3WGD A;  19GS A;  2X8H A;  4OD7 A;  2YP6 A;  3EU4 A;  4WKW A;  2H75 A;  3S9F A;  2B3S A;  2V6O A;  3CRU A;  5B8A A;  3HD5 A;  1XWB A;  1QGV A;  1PKZ A;  2M46 A;  3O3T A;  2AB6 A;  2DJK A;  3MWH A;  2FWG A;  5IO2 A;  3GTU A;  3IA1 A;  3CSJ A;  1MD3 A;  1UC7 A;  2I4A A;  4LLR A;  1GSQ A;  3UBK A;  3KEB A;  3TDG A;  5CRE A;  2CV4 A;  2N5B A;  3UAP A;  2VCX A;  1FG4 A;  5IPG A;  1S3D A;  3IOS A;  1EP7 A;  4IP1 A;  3GH9 A;  1J9B A;  5HFG A;  1QFN A;  2WCI A;  1FW1 A;  2K9F A;  5HQP A;  1DSB A;  1VGL A;  2B6M A;  1TK5 B;  1NM3 A;  2HT9 A;  3D0Z A;  1B9X C;  1XWA A;  5CP1 A;  4KA0 A;  3F0I A;  1M9B A;  1AC1 A;  2B7J A;  3A2X A;  1ZL9 A;  3ZVJ A;  3TJJ A;  3GTU B;  2A2S A;  3RHB A;  3W8J A;  5ELG A;  2X8G A;  3DWV A;  1O7U A;  1PRX A;  2LST A;  1NSW A;  1XPV A;  1GL8 A;  2LQO A;  1F2E A;  2J9H A;  2JZS A;  3C1R A;  2CAI A;  4NMU A;  2YWN A;  4XHM A;  1K0B A;  3LXZ A;  4IQA A;  1ST9 A;  4O32 A;  3LG6 A;  3O6T A;  4HOJ A;  1EZK A;  2PVQ A;  2J23 A;  3GIX A;  4WXT A;  2IL3 A;  2LTK A;  1SL2 B;  1JZD A;  3TGZ A;  1J08 A;  2MMZ A;  2M72 A;  2L57 A;  2C4J A;  2P5R A;  1A2J A;  3GYK A;  4LA1 A;  3F6F A;  2HSH A;  1YY7 A;  1JZR A;  1O8X A;  2VLT A;  3FW2 A;  4K7N A;  2XC2 A;  4ILF A;  1SJ6 A;  1GSE A;  2IFQ A;  5AGY A;  3CTF A;  2H19 A;  3EMP A;  2X64 A;  1RW1 A;  3TOU A;  1T8E B;  4ACS A;  3F8U A;  1TK0 B;  4QQ7 A;  1G7E A;  3TRQ A;  3QAW A;  2LNT A;  1ZGN A;  9GSS A;  1ML6 A;  11GS A;  2F8F A;  2DML A;  2ZUP A;  5F0G A;  2R2J A;  2XPE A;  3F63 A;  3KGK A;  1RK4 A;  4ZL7 A;  4POB A;  3I6A A;  1HNC A;  2YOI A;  14GS A;  5LNK e;  4TVE A;  2HFD A;  1SD8 A;  1GTU A;  1M2B A;  1LJR A;  4X43 A;  3VI5 A;  3IXR A;  2WGR A;  4K9Z A;  3ERF A;  2LRT A;  4HDE A;  3RAZ A;  5GAN D;  1Z7R A;  2VM2 A;  4TXV A;  1XCC A;  4KSM A;  3KIJ A;  1PKW A;  4MF7 A;  1ILO A;  3I9V 2;  1DE2 A;  17GS A;  4IKH A;  4KB3 A;  3RBT A;  5FWG A;  3APO A;  5CRH A;  5HR3 A;  4I97 A;  3DKS A;  1V57 A;  2MZC A;  1ZCP A;  1H4O A;  2OKA A;  1KEB A;  5EY6 A;  3D6I A;  4BVY A;  4EXJ A;  4X1U A;  4G2E A;  4ZB8 A;  4P3Y B;  3SWL A;  4ZL9 A;  4MPG A;  3ME7 A;  3CSI A;  2FCH A;  2RM5 A;  2G0F A;  1ERT A;  4I5Q A;  1O81 A;  2LUS A;  3U6V A;  3RPN A;  4GLT A;  2PER A;  5G1L A;  1GNE A;  3DRN A;  1F37 A;  3UAR A;  4OO4 A;  1MDI A;  3LEF A;  3ZTL A;  4KH7 A;  1PN9 A;  2P31 A;  5CRD A;  5LCZ A;  3M1G A;  1WE0 A;  1XW9 A;  2FWH A;  4K2D A;  2YV9 A;  5A4V A;  1OE8 A;  4ZL8 A;  3H79 A;  4PGT A;  5J5N A;  1V98 A;  5IMD A;  1B8X A;  1GP1 A;  4BVX B;  3M9J A;  2FWE A;  4I6X A;  3C73 A;  4PQH A;  1A23 A;  4Q5R A;  2YN1 A;  3MAK A;  1TOF A;  3J7Y k;  1OE7 A;  2DC5 A;  1SK2 A;  1TI1 A;  2AUV A;  2HXK A;  4G10 A;  3KCM A;  4ISD A;  4BA7 A;  13GS A;  1K0N A;  10GS A;  5G2Z A;  3RPP A;  2C0D A;  5DBQ A;  3BCK A;  3QAG A;  6GSY A;  5E4W A;  3FZA A;  4WBR D;  2H1A A;  1ZOF A;  5ECQ B;  2GZZ A;  5KEJ A;  4XS4 A;  1DBY A;  4L0U A;  3A5W A;  1GLP A;  4G19 A;  2CA8 A;  5F05 A;  2E2M A;  1FHE A;  3D5J A;  1AQV A;  4OFT A;  4XS1 A;  1KNG A;  4Q5Q A;  1Z9H A;  3R3E A;  2HZE A;  2C3N A;  2TRC P;  3HKR A;  2C8U A;  5CRG A;  1LU4 A;  2YWI A;  3L9U A;  1AIU A;  4E8E A;  3W8S A;  3HZ8 A;  3F9U A;  2CZ3 A;  4H86 A;  5IMC A;  4KGI A;  2E7P A;  4KCA A;  2NBS A;  5A4U A;  3BJ5 A;  2CVK A;  1YEX A;  4BWQ A;  5J4U A;  1AUC A;  3PH9 A;  3EE2 A;  4F03 A;  3HZ4 A;  1U6T A;  1GSS A;  2V6K A;  1OKD A;  4N0Z A;  2AYT A;  4QL7 A;  4GTU A;  5KN3 A;  2VCT A;  5G1K A;  1XWK A;  3EU3 A;  1OC9 A;  1T3B A;  2OE0 A;  3HXS A;  1AQX A;  2HZE B;  2H72 A;  1PA3 A;  3UEM A;  1EGO A;  2B1L A;  2YAN A;  2JSY A;  3W6G A;  2E0Q A;  4ZB6 A;  4FYU A;  1Q98 A;  1OAZ A;  5DJM A;  4MLY A;  3LGC A;  1HNB A;  1QXH A;  4GF0 A;  4ID0 A;  4HEA 2;  1SYR A;  1E2Y A;  3DIE A;  2RLI A;  2VL3 A;  3LFL A;  2WB9 A;  4ZB9 A;  2V1M A;  2DBC A;  3HCZ A;  4EVM A;  1VF3 A;  3P90 A;  5ELA A;  2DLX A;  3F4S A;  2GZP A;  4QL9 A;  1M2A A;  3TB2 A;  6GSS A;  5D8I A;  5J9C A;  1GUL A;  4IGJ A;  5IPH A;  5GSS A;  5CO3 A;  3U5R E;  4JE1 A;  4J57 E;  4EKZ A;  2V32 A;  4F9Z A;  2H1B A;  5IM9 A;  1A0F A;  1TJD A; 
#chains in the Genus database with same CATH topology
 4RI6 A;  3VPQ A;  2I81 A;  2YPM A;  4KCE A;  4V1A g;  3ZIJ A;  3HVV A;  2GS3 A;  4L5O A;  1GTB A;  2GSR A;  4MF5 A;  1R5P A;  3HVN A;  2H0H A;  4ZXG A;  4PQ1 A;  1C72 A;  5BMU B;  1WMJ A;  3LXT A;  2F9S A;  1GSF A;  3TOT A;  2OBK A;  3VPT A;  1EOH A;  3TKS C;  2FY6 A;  4CHS A;  4AI6 A;  2R0P A;  1O73 A;  1YF0 A;  1MDK A;  4YQU A;  2VL2 A;  3RGB C;  1T1V A;  3P2A A;  2GT6 A;  3FK8 A;  2LJK A;  1URM A;  2FHE A;  2ZNM A;  2WJU A;  5DCH A;  3GKM A;  1BYE A;  3EPT A;  1WPI A;  1HD2 A;  3GFK A;  1OC3 A;  4IVF A;  4XRA A;  3WT2 A;  3QMX A;  2R0G A;  1TRU A;  5G31 A;  5A1N A;  3QR6 A;  4EC0 A;  4TOP A;  1T00 A;  4DSS B;  2L5O A;  4RQX A;  4Q5N A;  5KOW A;  3D4T A;  5IOX A;  3PGT A;  4PX1 A;  4ZBD A;  4XS6 A;  1XBS A;  5ECK B;  2B5Y A;  2WW1 A;  2WDU A;  4TW5 A;  4K5S A;  3OR5 A;  3ERW A;  4FH8 A;  2DIZ A;  1BJX A;  5DDL A;  4AJ7 A;  5J41 A;  1TRS A;  1FVJ A;  3F3R A;  3VK9 A;  1O85 A;  2WZ9 A;  5ECS A;  1JFU A;  4LMV A;  5J9B A;  3L9S A;  3IPZ A;  3IBH A;  1F9M A;  1GSD A;  2N5F A;  2XBI A;  5A1N B;  3ME8 A;  3QCP A;  1X5C A;  3GV1 A;  2H70 A;  4WF4 A;  4NHW A;  4O5Q A;  1F3B A;  2GGT A;  4XTS A;  2XHF A;  1S3C A;  5DCG A;  2PUK C;  3G7J A;  1YEP A;  2F8A A;  3LYP A;  1QMV A;  1LBK A;  3HVX A;  2DJJ A;  2HNL A;  2MYG A;  3PIN A;  3LOR A;  5ECR B;  4MMM A;  3TJF A;  1YKC A;  5ECO B;  5FT3 A;  4ZBA A;  2H71 A;  1Z3E A;  1A24 A;  3RDW A;  1BX9 A;  3ZRE A;  4O7H A;  1GUM A;  2VOC A;  2L6C A;  2GSQ A;  5ID2 B;  3KTB A;  1Q4J A;  1BED A;  2H6Y A;  1K0M A;  1I5G A;  3GA4 A;  5IIZ A;  3FZ9 A;  4GWR A;  2FGX A;  1XWC A;  2FWF A;  3GH6 A;  2REM A;  4MPF A;  5D96 A;  3GL5 A;  4RUV A;  5FHI A;  1MEK A;  4NV5 A;  3DEX A;  2C0F A;  3IAS 2;  3IR4 A;  1FB0 A;  4OCE A;  3TJG A;  4IEL A;  3EVI A;  2LQQ A;  4E8H A;  3MSZ A;  5EVO A;  3EYT A;  3G9B A;  4MZW A;  4EDZ A;  1T7P B;  3NIV A;  2O36 A;  2LEG A;  5BRT A;  1XVW A;  3APS A;  4EL1 A;  3GN3 A;  2A2R A;  1M9A A;  4HZ2 A;  2H1L A;  2PWJ A;  4V1A p;  1TKD B;  5DJL A;  2D2Z A;  1SKW B;  4RI7 A;  2HSY A;  7GSS A;  3UVT A;  5HFI A;  4F82 A;  1XOB A;  4YQM A;  4YAP A;  2CX3 A;  2P0G A;  5DAK A;  1OVN A;  1OYJ A;  2PU9 C;  2HSN B;  2PBJ A;  2O85 A;  4ECC A;  4YKF A;  3GRX A;  2KP2 A;  4PHZ C;  2O7K A;  4DEJ A;  4XIH A;  1FOV A;  3BBY A;  3US3 A;  5ECL B;  1HYU A;  2FLS A;  1TXX A;  1SJZ A;  3ISO A;  3L0H A;  1BQ7 A;  3FZ4 A;  3WGX A;  5B6M A;  1A8L A;  4WR5 A;  4KF9 A;  2OE3 A;  4IS0 A;  4QMK A;  4EE0 A;  1M0U A;  5DVB A;  4EIQ A;  1EOG A;  3D21 A;  4AKH A;  4TKY A;  1JHB A;  2X4A A;  4MA9 A;  1K0O A;  3QD9 A;  3DXB A;  5F8B A;  1TTZ A;  2DMM A;  2IN3 A;  1W89 A;  5CRW A;  2VM1 A;  5ECP B;  2FA4 A;  4G9H A;  3KP9 A;  4WEY A;  4L8E A;  1X5E A;  2NVL A;  3Q19 A;  2HQT A;  2IMI A;  1M3I A;  3MDK A;  2K8V A;  3M8N A;  5DAK B;  2R37 A;  4D73 A;  2PVO C;  1K3Y A;  4FIW A;  1TU8 A;  3QFA C;  1TW9 A;  1ERW A;  4ML6 A;  4YAV A;  1XOA A;  5A34 B;  4MDC A;  1B4Q A;  2WW0 A;  3VWV A;  4AGS A;  2IMD A;  4BVX A;  5IMF A;  4BPY A;  2CAQ A;  5DQY A;  2BTO T;  2ALB A;  5ECI B;  3Q74 A;  6GSX A;  4I8B A;  1PN0 A;  3CXG A;  4GRF A;  3QAV A;  2HRF A;  1SL0 B;  3AY8 A;  4KSO A;  3IC8 A;  1USB A;  3KXO A;  2KLX A;  2R3X A;  4KUN A;  4MJC A;  1H75 A;  3FKF A;  3RFR C;  3ZMK A;  2VCW A;  4ECJ A;  4HJ2 A;  5D9X A;  5KN1 A;  2HZF A;  5JWO B;  4KAE A;  2MMN A;  3IC4 A;  1O8W A;  2C0G A;  5J4Y A;  2HYX A;  3RHC A;  5HFK A;  5LD0 A;  3ED3 A;  4L0W A;  3BCI A;  1ZZY A;  3IV4 A;  5JCW A;  1THO A;  2XPD A;  4D73 B;  2UZ8 A;  2FNO A;  4KE3 A;  1QK8 A;  1T4Z A;  1U88 A;  3M3M A;  1A2L A;  4I2T A;  1KTE A;  3IRA A;  1BAY A;  2OAD A;  1M2D A;  5J3R A;  2O8V B;  3VWX A;  4OWY A;  3KJY A;  5GST A;  2DJ1 A;  3EUR A;  1YZX A;  1JLV A;  3DD3 A;  4JR6 A;  5HR1 A;  4OMV A;  1XZO A;  4EUY A;  1R4W A;  3CRT A;  4IW9 A;  3Q18 A;  3ZFB A;  3I43 A;  2X49 A;  3C71 A;  4JRR A;  4Z2U A;  4Q5F A;  3ZML A;  1VF2 A;  3APQ A;  4MJA A;  3GX8 A;  1U3I A;  4IJI A;  5L71 A;  4N0V A;  4MZC A;  2YNX A;  2B7K A;  2YZU A;  3M9K A;  1TK8 B;  1X9W B;  2H1D A;  5ECN B;  1G7O A;  3PPU A;  2L4C A;  5G30 A;  2DJ3 A;  2L6D A;  3F3Q A;  5IQY A;  4AJ8 A;  1GRX A;  3TRX A;  2JAC A;  1M7T A;  5COH A;  1K0A A;  5CAX A;  2I9H A;  3A2W A;  1XIY A;  3MNG A;  4IHU A;  1AW9 A;  2C3Q A;  2A4H A;  2A4V A;  2OAC A;  3DGQ A;  3LJR A;  1FAA A;  1PL2 A;  2VKZ G;  4PQI A;  2PPT A;  2O89 A;  2BJX A;  5JWR B;  3UIW A;  2GVP A;  1K3O A;  5KN0 A;  3UBL A;  2FUG 2;  2VO4 A;  4CW9 A;  4K1F A;  2JZT A;  3V1W A;  4HUA A;  1AXD A;  1R26 A;  1GNW A;  4KDY A;  3VWW A;  3QOU A;  4ML1 A;  2GQL A;  1YJ6 A;  1V58 A;  1GH2 A;  2VCZ A;  3WGE A;  3ZLP A;  3GUS A;  4ZBB A;  2B5E A;  4TXO B;  1WRY A;  3EIN A;  3PR8 A;  2LRN A;  3ZYW A;  2GLR A;  2JL4 A;  4KW6 A;  1TXU A;  1V40 A;  22GS A;  1X9S B;  5BMU A;  2RUF A;  1XXU A;  4JED A;  1MDJ A;  2YWO A;  3N9J A;  2HRN A;  1XW6 A;  4PNF A;  1GTI A;  1IYH A;  4JBB A;  3F4R A;  1MD4 A;  5D73 A;  3P7X A;  2OBI A;  1PMT A;  2WFC A;  3GMF A;  3KM6 A;  1WWJ A;  1ZYE A;  3G7Y A;  4AJ6 A;  3D4M A;  2JAD A;  1MTC A;  3LQ7 A;  3TCO A;  2AHE A;  2IJY A;  2V2G A;  1G6Y A;  3N5O A;  2MBT A;  2WS2 A;  3O76 A;  1BG5 A;  4CY6 A;  1SJI A;  4DSS A;  1GWC A;  2AJQ B;  4AKX B;  2R6K A;  4TR0 A;  4PXO A;  8GSS A;  3GKN A;  3L78 A;  3A3T A;  2GST A;  5H5S A;  4G0I A;  3GHA A;  1V9W A;  2NPB A;  4KND A;  5CNW A;  1ABA A;  4PUA A;  3H4K A;  2TRX A;  3BD2 A;  4IJ3 A;  4MP4 A;  2AV4 A;  1R5A A;  3IAM 2;  2HSM B;  1N25 A;  3TKQ A;  2H73 A;  2X8C A;  3E9J B;  1SK0 A;  3HJP A;  3KP8 A;  4G0K A;  5B6N A;  3FR6 A;  6GST A;  4GQF A;  4F2I A;  5DAL A;  2QA2 A;  2QC7 A;  1NHY A;  3UJ1 A;  2OT3 A;  3LSZ A;  2EFC A;  3F6D A;  1EV9 A;  5C04 A;  2LV3 A;  1CQG A;  4IP6 A;  1N2A A;  2RUE A;  2QGV A;  2WVZ A;  2YJH A;  2CT6 A;  1XFL A;  1M99 A;  2GDR A;  2CZ2 A;  5D9V A;  2CQ9 A;  1AAZ A;  1FO5 A;  3QDN A;  3FYG A;  5HR0 A;  3E3E A;  1K0C A;  4MH2 A;  16GS A;  1GSU A;  1Z7P A;  1V2A A;  3KMO A;  3VI7 A;  1X0R A;  3C1S A;  2H1G A;  3CBU A;  5ENU A;  4GXZ A;  5ID2 A;  2F3M A;  3GUR A;  3UVH A;  1ERV A;  5ECM B;  1G0T A;  1PQN A;  4OO5 A;  4POK A;  5DAL B;  3LWA A;  3VLN A;  5D93 A;  3IK7 A;  2AAW A;  3GNJ A;  1Y25 A;  5H5R A;  3J7Y b;  2MBS A;  1PD2 1;  5B8B A;  1SD9 A;  3H8Q A;  1BG1 A;  3ZIV A;  1DE1 A;  4V2N A;  1CQH A;  4EIP A;  4NXI A;  2B5X A;  5H5Q A;  2LNS A;  4MAB A;  4MH3 A;  4V2M A;  1EGR A;  5JCU A;  2VD0 A;  2HRA A;  1TU7 A;  2WZS A;  5AIX A;  5G5F A;  2C80 A;  3P8W A;  1N8J A;  1TRV A;  4HU7 A;  4F0B A;  4HZ4 A;  1W4V A;  4PUF C;  1SVO A;  1K3L A;  1XVQ A;  2IMF A;  2R0C A;  4V2L A;  1G6W A;  1TI3 A;  4O92 A;  2I3Y A;  1A0R P;  1GLQ A;  2R4V A;  4K7I A;  4XRD A;  3VFI A;  2OA7 A;  3UMA A;  1YF1 A;  4N30 A;  1UN2 A;  2RM6 A;  3FMW A;  1R7H A;  2ZCT A;  4DSR A;  5J4V A;  5CYY A;  4TR3 A;  1Z6N A;  1VF4 A;  1JZW A;  4LMW A;  2H76 A;  2VL9 A;  4GST A;  4GCI A;  1FVK A;  3KH9 A;  2O87 A;  2CVB A;  2L4Q A;  2FA8 A;  2HSN A;  4IQ1 A;  5A4W A;  1SKS B;  2N5A A;  5E59 A;  5IOW A;  1RQM A;  3HDC A;  2I1U A;  1EEJ A;  1XG8 A;  3VUR A;  4FYC A;  3BOA A;  6GSU A;  1GUH A;  4DVC A;  5C00 A;  2EIO A;  4F0C A;  4TN8 A;  2LRC A;  6GSV A;  3IDV A;  2P5Q A;  2DJ0 A;  5AIV A;  3TJK A;  1KBN A;  2L59 A;  2H30 A;  4RQR A;  5G5E A;  1JZO A;  2QSI A;  2IME A;  2UV8 G;  3KTL A;  2YCD A;  3ZFL A;  3UL3 A;  1WIK A;  2HRK A;  2VIM A;  1T4Y A;  3GKK A;  1XW5 A;  3FY7 A;  2WRT A;  3HY2 A;  3HJO A;  1YKA A;  1HNA A;  2LKU A;  2XBQ A;  2DJ2 A;  4K0G A;  1THX A;  2H74 A;  2JU5 A;  1PX7 A;  3FZ5 A;  2MMA A;  5A34 A;  3FEU A;  3K8N A;  4EF0 A;  3FRC A;  2DSA A;  5EPF A;  3I69 A;  4ZB7 A;  4I2U A;  4Z2T A;  3HHV A;  4JR4 A;  1F3A A;  3IE3 A;  1S4B P;  5HR2 A;  3KD0 A;  4G01 A;  2KUC A;  3CQF A;  4WR4 A;  1PSQ A;  3VWU A;  4NPB A;  1ZYP A;  4CDO A;  5D9W A;  4ZIL A;  2F51 A;  3L9V A;  4EO3 A;  3HA9 A;  3ZRD A;  3C8E A;  2HRK B;  2GTU A;  1NW2 A;  1SKR B;  1FB6 A;  2IFQ B;  4USS A;  3HVS A;  1GSY A;  4HJM A;  4BL7 A;  5EL8 A;  3DVW A;  4WET A;  2WUL A;  3CMI A;  1YQ1 A;  4FQU A;  1BF5 A;  2H0I A;  1J0F A;  1EV4 A;  3TKS A;  4OCF A;  2LJR A;  2VL2 C;  4EDY A;  4PUR A;  2L5L A;  1WJK A;  2LJA A;  12GS A;  2YV7 A;  1A8Y A;  1GUK A;  2VCV A;  4O5R A;  2HE3 A;  3EMX A;  1PGT A;  5DQS A;  4XCS A;  1ERU A;  2IWT A;  3TJB A;  1OKT A;  3ZL5 A;  4LL1 B;  3M0F A;  4AKI A;  4K8M A;  1YEW C;  4FYB A;  1QUW A;  3R2Q A;  3ERG A;  4GSS A;  4YKG A;  2K18 A;  1PX6 A;  2DKH A;  4A5P A;  4BL7 B;  4JU5 A;  1B48 A;  5ABR A;  1B9Y C;  4N11 A;  1ZYN A;  4POL A;  2LS5 A;  5GAP D;  2VCQ A;  3EC3 A;  2KHP A;  3NOF A;  2GQM A;  4NHZ A;  2NDO A;  1S3R A;  2FD3 A;  2ON5 A;  4OFN A;  3SBC A;  4HI7 A;  3GST A;  3G7I A;  5KN2 A;  2ES7 A;  4OFM A;  4N10 A;  4BVY B;  4ZIJ A;  18GS A;  2K8S A;  2VUP A;  1PL1 A;  2V41 A;  2M80 A;  3KH7 A;  2H8L A;  1OC8 A;  1U3A A;  3H93 A;  1NHO A;  2OJL A;  2O3E A;  3FR9 A;  4LL4 B;  2MMO A;  2QKE A;  4MCU A;  1X5D A;  2ON7 A;  5INY A;  4AF2 A;  1M3J A;  1SU9 A;  4PTS A;  4X4J A;  2EIR A;  3F4T A;  2GSS A;  1QQ2 A;  3GL3 A;  3LW9 A;  3DVX A;  3WYW A;  2YWM A;  3GKX A;  4TXO A;  3CYN A;  2IPA A;  4MJB A;  2C1Y A;  3C7M A;  2VLV A;  2PGT A;  5A5H B;  2EIQ A;  2O5V A;  4BWS A;  3TRP A;  4Z7X A;  1VF1 A;  2KOK A;  2GQK A;  3ZVJ D;  5D9T A;  4WBJ A;  4FO5 A;  3FR3 A;  4KDU A;  5IMV A;  3A2V A;  2OE1 A;  4AKG A;  2IMK A;  1X9M B;  1IYI A;  1U87 A;  2GZY A;  4TR1 A;  4N3Z A;  4NWY A;  5AIS A;  3DML A;  1S3A A;  5B7C A;  3GX0 A;  2B1K A;  2C0E A;  2PMT A;  2H66 A;  4MJE A;  3ZIT A;  4KDX A;  1TP9 A;  3KZQ A;  2VD1 A;  2CX4 A;  2VAF A;  4DSQ A;  3D22 A;  3FHK A;  1SVL A;  1A2M A;  3TKR A;  1K0D A;  1EP8 A;  1UA5 A;  3EWL A;  3QFB C;  1UVZ A;  1VRS D;  4HQZ A;  4XS4 B;  1DUG A;  1ACV A;  1GTA A;  4PNG A;  2PN8 A;  2E2G A;  1TDI A;  2C3T A;  3IHG A;  3IK9 A;  5AN1 A;  5A5K A;  1EWX A;  4MF6 A;  2JSZ A;  5F06 A;  2BMX A;  4PI0 C;  3JCM L;  4W66 A;  3MYD A;  2VLU A;  4TR1 B;  1Y1U A;  1B4P A;  4ULX A;  2CVD A;  3HYP A;  5JWQ B;  1SK1 A;  3ZZX A;  6GSW A;  4L5L A;  4GSN A;  4HU9 A;  1JLW A;  2EFH A;  3DYR A;  4IN0 A;  1SVM A;  4K0N A;  2Z9S A;  2QA1 A;  1WP0 A;  1ZMA A;  2HSM A;  5GZZ B;  3H1N A;  2TIR A;  4POM A;  4TR4 A;  3WT1 A;  3KMN A;  2H0G A;  4G0L A;  4YQV A;  1O6J A;  4MK3 A;  2X99 A;  3IHQ A;  4ECB A;  2G2Q A;  1OC9 B;  1HQO A;  1Z6M A;  3QPM A;  1E6B A;  1SEN A;  1AQW A;  4JZQ A;  1XWG A;  5ECH B;  4K6X A;  2RII A;  4ICY A;  3WD6 A;  3TKS E;  2GT5 A;  2H6Z A;  5IO0 A;  2NTO A;  1TRW A;  3TKP A;  3UOM A;  4HQS A;  4PI2 C;  4J56 E;  1ZYQ B;  4MZB A;  1I9D A;  3E0U A;  5F07 A;  1WOU A;  3LYK A;  1YDK A;  2KP1 A;  2YJ7 A;  3TUE A;  1SL1 B;  1Z5Y E;  2IIY A;  20GS A;  2K6V A;  4K7O A;  2DIY A;  1FOH A;  4NV2 A;  4J2F A;  4YH2 A;  1ON4 A;  4HS1 A;  2WVX B;  4ECI A;  2YZH A;  5JCG A;  3CTG A;  2R5G A;  4GQC A;  4IBP A;  2H01 A;  3L4N A;  4X0X A;  5IMA A;  3CSH A;  4KX4 A;  1Y6E A;  3HJM A;  2H6X A;  2HI7 A;  3GSS A;  3NZN A;  2EC4 A;  3Q6O A;  4TRX A;  4WF5 A;  4E68 A;  4NAX A;  2HLS A;  1EEM A;  1F6M C;  1SYX A;  2JZR A;  5IMZ A;  3WGD A;  19GS A;  2X8H A;  4OD7 A;  2YP6 A;  3EU4 A;  4WKW A;  2H75 A;  4K2X A;  3S9F A;  2B3S A;  2V6O A;  3CRU A;  5B8A A;  3HD5 A;  1XWB A;  1QGV A;  1PKZ A;  2M46 A;  3O3T A;  2AB6 A;  2DJK A;  3MWH A;  4Z2R A;  2FWG A;  5IO2 A;  3GTU A;  3IA1 A;  3CSJ A;  1MD3 A;  1UC7 A;  2I4A A;  4LLR A;  1GSQ A;  3UBK A;  3KEB A;  3TDG A;  5CRE A;  2CV4 A;  2N5B A;  3UAP A;  2VCX A;  1FG4 A;  5IPG A;  1S3D A;  3IOS A;  1EP7 A;  4IP1 A;  3GH9 A;  1J9B A;  5HFG A;  1QFN A;  2WCI A;  1FW1 A;  2K9F A;  5HQP A;  1DSB A;  1VGL A;  2B6M A;  1TK5 B;  5J40 A;  4GDF A;  1NM3 A;  2HT9 A;  3D0Z A;  1B9X C;  1XWA A;  5CP1 A;  4KA0 A;  3F0I A;  1M9B A;  1AC1 A;  2B7J A;  3A2X A;  5KOX A;  1ZL9 A;  3ZVJ A;  3TJJ A;  3GTU B;  2A2S A;  3RHB A;  1I1I P;  3W8J A;  5ELG A;  2X8G A;  3DWV A;  1O7U A;  1PRX A;  2LST A;  1NSW A;  1XPV A;  1GL8 A;  2LQO A;  1F2E A;  2J9H A;  2JZS A;  3C1R A;  2CAI A;  4NMU A;  2YWN A;  4XHM A;  1K0B A;  3CWG A;  3LXZ A;  4IQA A;  1ST9 A;  4O32 A;  3LG6 A;  3O6T A;  4HOJ A;  1EZK A;  2PVQ A;  2J23 A;  3GIX A;  4WXT A;  2IL3 A;  2LTK A;  1SL2 B;  1JZD A;  3TGZ A;  1J08 A;  2MMZ A;  2M72 A;  2L57 A;  2C4J A;  2P5R A;  1A2J A;  3GYK A;  4LA1 A;  3A5I A;  3F6F A;  2HSH A;  4CY8 A;  1YY7 A;  1JZR A;  1O8X A;  2VLT A;  3FW2 A;  4K7N A;  2XC2 A;  4ILF A;  1SJ6 A;  1GSE A;  2IFQ A;  5AGY A;  3CTF A;  2H19 A;  3EMP A;  2X64 A;  1RW1 A;  3TOU A;  1T8E B;  4ACS A;  3F8U A;  1TK0 B;  4QQ7 A;  1G7E A;  3TRQ A;  3QAW A;  2LNT A;  1ZGN A;  9GSS A;  1ML6 A;  11GS A;  2F8F A;  2DML A;  2ZUP A;  5F0G A;  2R2J A;  2A2P A;  2XPE A;  4MNN A;  3F63 A;  3KGK A;  1RK4 A;  4ZL7 A;  4POB A;  3I6A A;  1HNC A;  2YOI A;  14GS A;  5LNK e;  1YVL A;  4TVE A;  2HFD A;  1SD8 A;  1GTU A;  1M2B A;  2WW3 A;  1LJR A;  4X43 A;  3VI5 A;  3TU3 B;  3IXR A;  2WGR A;  4K9Z A;  3ERF A;  2LRT A;  4HDE A;  3RAZ A;  5GAN D;  1Z7R A;  2VM2 A;  4TXV A;  2EFE A;  1XCC A;  4KSM A;  1PFO A;  3KIJ A;  1PKW A;  4MF7 A;  1ILO A;  2WVY A;  3I9V 2;  1DE2 A;  17GS A;  4IKH A;  4KB3 A;  3RBT A;  5FWG A;  3APO A;  4FXY P;  5CRH A;  5HR3 A;  4I97 A;  3DKS A;  1V57 A;  2MZC A;  1ZCP A;  1H4O A;  2OKA A;  1KEB A;  5EY6 A;  3D6I A;  4BVY A;  4EXJ A;  4X1U A;  4G2E A;  4ZB8 A;  4P3Y B;  3SWL A;  4ZL9 A;  2EFD A;  4MPG A;  3ME7 A;  3CSI A;  2FCH A;  2RM5 A;  2G0F A;  1ERT A;  4I5Q A;  1O81 A;  2LUS A;  3U6V A;  2DKI A;  3RPN A;  4GLT A;  2PER A;  5G1L A;  1GNE A;  3DRN A;  1F37 A;  3UAR A;  4OO4 A;  1MDI A;  3LEF A;  3ZTL A;  4KH7 A;  1PN9 A;  2P31 A;  5CRD A;  5LCZ A;  3M1G A;  1WE0 A;  1XW9 A;  2FWH A;  4K2D A;  5A5H A;  2YV9 A;  4K5R A;  5A4V A;  1OE8 A;  4ZL8 A;  3H79 A;  4PGT A;  5J5N A;  1V98 A;  5IMD A;  1B8X A;  1GP1 A;  4BVX B;  3M9J A;  2FWE A;  4I6X A;  3C73 A;  4PQH A;  1A23 A;  4Q5R A;  2YN1 A;  3MAK A;  1TOF A;  3J7Y k;  1OE7 A;  2DC5 A;  4BIK A;  1SK2 A;  1TI1 A;  2AUV A;  2HXK A;  4G10 A;  3KCM A;  4ISD A;  4BA7 A;  13GS A;  1K0N A;  10GS A;  5G2Z A;  3RPP A;  2C0D A;  5DBQ A;  3BCK A;  3QAG A;  6GSY A;  5E4W A;  3FZA A;  4WBR D;  2H1A A;  1ZOF A;  5ECQ B;  2GZZ A;  5KEJ A;  4XS4 A;  1DBY A;  4L0U A;  3A5W A;  1GLP A;  4G19 A;  2CA8 A;  5F05 A;  2E2M A;  1FHE A;  3D5J A;  1AQV A;  4OFT A;  4XS1 A;  1KNG A;  4Q5Q A;  1Z9H A;  3R3E A;  5J47 A;  2C3N A;  2HZE A;  2TRC P;  3HKR A;  2C8U A;  5CRG A;  1LU4 A;  2YWI A;  3L9U A;  1AIU A;  4E8E A;  3W8S A;  3HZ8 A;  3F9U A;  2WW2 A;  2CZ3 A;  4H86 A;  5IMC A;  4KGI A;  2E7P A;  4KCA A;  2NBS A;  5A4U A;  3BJ5 A;  2CVK A;  1YEX A;  4BWQ A;  5J4U A;  1AUC A;  3PH9 A;  3EE2 A;  4F03 A;  3HZ4 A;  1U6T A;  1GSS A;  2V6K A;  1OKD A;  4N0Z A;  2AYT A;  4QL7 A;  4GTU A;  5KN3 A;  2VCT A;  5G1K A;  1XWK A;  3EU3 A;  1OC9 A;  1T3B A;  2OE0 A;  3HXS A;  1AQX A;  2HZE B;  2H72 A;  1PA3 A;  3CHX C;  3UEM A;  1EGO A;  2B1L A;  2YAN A;  2JSY A;  3W6G A;  2E0Q A;  4ZB6 A;  1Q98 A;  4FYU A;  1OAZ A;  5DJM A;  4MLY A;  3LGC A;  1HNB A;  1QXH A;  4GF0 A;  4ID0 A;  4HEA 2;  1SYR A;  4HSC X;  1E2Y A;  3DIE A;  2RLI A;  2VL3 A;  3LFL A;  2WB9 A;  4ZB9 A;  2V1M A;  2DBC A;  3HCZ A;  4EVM A;  4O5U A;  1VF3 A;  3P90 A;  5ELA A;  2DLX A;  3F4S A;  2GZP A;  4QL9 A;  1M2A A;  2WVX A;  3TB2 A;  6GSS A;  5D8I A;  5J9C A;  1GUL A;  4IGJ A;  5IPH A;  5GSS A;  5CO3 A;  3U5R E;  3MIX A;  4JE1 A;  3HMJ G;  4J57 E;  4EKZ A;  2V32 A;  4F9Z A;  2H1B A;  5IM9 A;  1A0F A;  1TJD A; 
#chains in the Genus database with same CATH homology
 4RI6 A;  3VPQ A;  2I81 A;  2YPM A;  4KCE A;  4V1A g;  3ZIJ A;  3HVV A;  2GS3 A;  4L5O A;  1GTB A;  2GSR A;  4MF5 A;  1R5P A;  2H0H A;  4ZXG A;  4PQ1 A;  1C72 A;  5BMU B;  1WMJ A;  3LXT A;  2F9S A;  1GSF A;  3TOT A;  2OBK A;  3VPT A;  1EOH A;  3TKS C;  2FY6 A;  4CHS A;  4AI6 A;  2R0P A;  1O73 A;  1YF0 A;  1MDK A;  4YQU A;  2VL2 A;  1T1V A;  3P2A A;  2GT6 A;  3FK8 A;  2LJK A;  1URM A;  2FHE A;  2ZNM A;  2WJU A;  5DCH A;  3GKM A;  1BYE A;  3EPT A;  1WPI A;  1HD2 A;  3GFK A;  1OC3 A;  4IVF A;  4XRA A;  3WT2 A;  3QMX A;  2R0G A;  1TRU A;  5G31 A;  5A1N A;  3QR6 A;  4EC0 A;  4TOP A;  1T00 A;  4DSS B;  2L5O A;  4RQX A;  4Q5N A;  5KOW A;  3D4T A;  5IOX A;  3PGT A;  4PX1 A;  4ZBD A;  4XS6 A;  1XBS A;  5ECK B;  2B5Y A;  2WDU A;  4TW5 A;  4K5S A;  3OR5 A;  3ERW A;  4FH8 A;  2DIZ A;  1BJX A;  5DDL A;  4AJ7 A;  5J41 A;  1TRS A;  1FVJ A;  3F3R A;  3VK9 A;  1O85 A;  2WZ9 A;  5ECS A;  1JFU A;  4LMV A;  5J9B A;  3L9S A;  3IPZ A;  3IBH A;  1F9M A;  1GSD A;  2N5F A;  2XBI A;  5A1N B;  3ME8 A;  3QCP A;  1X5C A;  3GV1 A;  2H70 A;  4WF4 A;  4NHW A;  4O5Q A;  1F3B A;  2GGT A;  4XTS A;  2XHF A;  1S3C A;  5DCG A;  2PUK C;  3G7J A;  1YEP A;  2F8A A;  3LYP A;  1QMV A;  1LBK A;  3HVX A;  2DJJ A;  2HNL A;  2MYG A;  3PIN A;  3LOR A;  5ECR B;  4MMM A;  3TJF A;  1YKC A;  5ECO B;  5FT3 A;  4ZBA A;  2H71 A;  1Z3E A;  1A24 A;  3RDW A;  1BX9 A;  3ZRE A;  4O7H A;  1GUM A;  2VOC A;  2L6C A;  2GSQ A;  5ID2 B;  3KTB A;  1Q4J A;  1BED A;  2H6Y A;  1K0M A;  1I5G A;  3GA4 A;  5IIZ A;  3FZ9 A;  4GWR A;  2FGX A;  1XWC A;  2FWF A;  3GH6 A;  2REM A;  4MPF A;  5D96 A;  3GL5 A;  4RUV A;  5FHI A;  1MEK A;  4NV5 A;  3DEX A;  2C0F A;  3IAS 2;  3IR4 A;  1FB0 A;  4OCE A;  3TJG A;  4IEL A;  3EVI A;  2LQQ A;  4E8H A;  3MSZ A;  5EVO A;  3EYT A;  3G9B A;  4MZW A;  4EDZ A;  1T7P B;  3NIV A;  2LEG A;  5BRT A;  1XVW A;  3APS A;  4EL1 A;  3GN3 A;  2A2R A;  1M9A A;  4HZ2 A;  2H1L A;  2PWJ A;  4V1A p;  1TKD B;  5DJL A;  2D2Z A;  1SKW B;  4RI7 A;  2HSY A;  7GSS A;  3UVT A;  5HFI A;  4F82 A;  1XOB A;  4YQM A;  4YAP A;  2CX3 A;  2P0G A;  5DAK A;  1OVN A;  1OYJ A;  2PU9 C;  2HSN B;  2PBJ A;  2O85 A;  4ECC A;  4YKF A;  3GRX A;  2KP2 A;  2O7K A;  4DEJ A;  4XIH A;  1FOV A;  3BBY A;  3US3 A;  5ECL B;  1HYU A;  2FLS A;  1TXX A;  1SJZ A;  3ISO A;  3L0H A;  1BQ7 A;  3FZ4 A;  3WGX A;  5B6M A;  1A8L A;  4WR5 A;  4KF9 A;  2OE3 A;  4IS0 A;  4QMK A;  4EE0 A;  1M0U A;  5DVB A;  4EIQ A;  1EOG A;  3D21 A;  4AKH A;  4TKY A;  1JHB A;  2X4A A;  4MA9 A;  1K0O A;  3QD9 A;  3DXB A;  5F8B A;  1TTZ A;  2DMM A;  2IN3 A;  1W89 A;  5CRW A;  2VM1 A;  5ECP B;  2FA4 A;  4G9H A;  3KP9 A;  4WEY A;  4L8E A;  1X5E A;  2NVL A;  3Q19 A;  2HQT A;  2IMI A;  3MDK A;  2K8V A;  3M8N A;  5DAK B;  2R37 A;  4D73 A;  2PVO C;  1K3Y A;  4FIW A;  1TU8 A;  3QFA C;  1TW9 A;  1ERW A;  4ML6 A;  4YAV A;  1XOA A;  5A34 B;  4MDC A;  1B4Q A;  3VWV A;  4AGS A;  2IMD A;  4BVX A;  5IMF A;  4BPY A;  2CAQ A;  5DQY A;  2BTO T;  2ALB A;  5ECI B;  3Q74 A;  6GSX A;  4I8B A;  1PN0 A;  3CXG A;  4GRF A;  3QAV A;  2HRF A;  1SL0 B;  3AY8 A;  4KSO A;  3IC8 A;  1USB A;  3KXO A;  2KLX A;  2R3X A;  4KUN A;  4MJC A;  1H75 A;  3FKF A;  3ZMK A;  2VCW A;  4ECJ A;  4HJ2 A;  5D9X A;  5KN1 A;  2HZF A;  5JWO B;  4KAE A;  2MMN A;  3IC4 A;  1O8W A;  2C0G A;  5J4Y A;  2HYX A;  3RHC A;  5HFK A;  5LD0 A;  3ED3 A;  4L0W A;  3BCI A;  1ZZY A;  3IV4 A;  5JCW A;  1THO A;  2XPD A;  4D73 B;  2UZ8 A;  2FNO A;  4KE3 A;  1QK8 A;  1T4Z A;  1U88 A;  3M3M A;  1A2L A;  4I2T A;  1KTE A;  3IRA A;  1BAY A;  2OAD A;  1M2D A;  5J3R A;  2O8V B;  3VWX A;  4OWY A;  3KJY A;  5GST A;  2DJ1 A;  3EUR A;  1YZX A;  1JLV A;  3DD3 A;  4JR6 A;  5HR1 A;  4OMV A;  1XZO A;  4EUY A;  1R4W A;  3CRT A;  4IW9 A;  3Q18 A;  3ZFB A;  3I43 A;  2X49 A;  3C71 A;  4JRR A;  4Z2U A;  4Q5F A;  3ZML A;  1VF2 A;  3APQ A;  4MJA A;  3GX8 A;  1U3I A;  4IJI A;  5L71 A;  4N0V A;  4MZC A;  2YNX A;  2B7K A;  2YZU A;  3M9K A;  1TK8 B;  1X9W B;  2H1D A;  5ECN B;  1G7O A;  3PPU A;  2L4C A;  5G30 A;  2DJ3 A;  2L6D A;  3F3Q A;  5IQY A;  4AJ8 A;  1GRX A;  3TRX A;  2JAC A;  1M7T A;  5COH A;  1K0A A;  5CAX A;  2I9H A;  3A2W A;  1XIY A;  3MNG A;  4IHU A;  1AW9 A;  2C3Q A;  2A4H A;  2A4V A;  2OAC A;  3DGQ A;  3LJR A;  1FAA A;  1PL2 A;  2VKZ G;  4PQI A;  2PPT A;  2O89 A;  2BJX A;  5JWR B;  3UIW A;  2GVP A;  1K3O A;  5KN0 A;  3UBL A;  2FUG 2;  2VO4 A;  4CW9 A;  4K1F A;  2JZT A;  3V1W A;  4HUA A;  1AXD A;  1R26 A;  1GNW A;  4KDY A;  3VWW A;  3QOU A;  4ML1 A;  2GQL A;  1YJ6 A;  1V58 A;  1GH2 A;  2VCZ A;  3WGE A;  3ZLP A;  3GUS A;  4ZBB A;  2B5E A;  4TXO B;  1WRY A;  3EIN A;  3PR8 A;  2LRN A;  3ZYW A;  2GLR A;  2JL4 A;  4KW6 A;  1TXU A;  1V40 A;  22GS A;  1X9S B;  5BMU A;  2RUF A;  1XXU A;  4JED A;  1MDJ A;  2YWO A;  3N9J A;  2HRN A;  1XW6 A;  4PNF A;  1GTI A;  1IYH A;  4JBB A;  3F4R A;  1MD4 A;  5D73 A;  3P7X A;  2OBI A;  1PMT A;  2WFC A;  3GMF A;  3KM6 A;  1WWJ A;  1ZYE A;  3G7Y A;  4AJ6 A;  3D4M A;  2JAD A;  1MTC A;  3LQ7 A;  3TCO A;  2AHE A;  2IJY A;  2V2G A;  1G6Y A;  3N5O A;  2MBT A;  2WS2 A;  3O76 A;  1BG5 A;  4CY6 A;  1SJI A;  4DSS A;  1GWC A;  2AJQ B;  4AKX B;  2R6K A;  4TR0 A;  4PXO A;  8GSS A;  3GKN A;  3L78 A;  3A3T A;  2GST A;  5H5S A;  4G0I A;  3GHA A;  1V9W A;  2NPB A;  4KND A;  5CNW A;  1ABA A;  4PUA A;  3H4K A;  2TRX A;  3BD2 A;  4IJ3 A;  4MP4 A;  2AV4 A;  1R5A A;  3IAM 2;  2HSM B;  1N25 A;  3TKQ A;  2H73 A;  2X8C A;  3E9J B;  1SK0 A;  3HJP A;  3KP8 A;  4G0K A;  5B6N A;  3FR6 A;  6GST A;  4GQF A;  4F2I A;  5DAL A;  2QA2 A;  2QC7 A;  1NHY A;  3UJ1 A;  2OT3 A;  3LSZ A;  2EFC A;  3F6D A;  1EV9 A;  5C04 A;  2LV3 A;  1CQG A;  4IP6 A;  1N2A A;  2RUE A;  2QGV A;  2YJH A;  2CT6 A;  1XFL A;  1M99 A;  2GDR A;  2CZ2 A;  5D9V A;  2CQ9 A;  1AAZ A;  1FO5 A;  3QDN A;  3FYG A;  5HR0 A;  3E3E A;  1K0C A;  4MH2 A;  16GS A;  1GSU A;  1Z7P A;  1V2A A;  3KMO A;  3VI7 A;  1X0R A;  3C1S A;  2H1G A;  3CBU A;  5ENU A;  4GXZ A;  5ID2 A;  2F3M A;  3GUR A;  3UVH A;  1ERV A;  5ECM B;  1G0T A;  1PQN A;  4OO5 A;  4POK A;  5DAL B;  3LWA A;  3VLN A;  5D93 A;  3IK7 A;  2AAW A;  3GNJ A;  1Y25 A;  5H5R A;  3J7Y b;  2MBS A;  1PD2 1;  5B8B A;  1SD9 A;  3H8Q A;  1BG1 A;  3ZIV A;  1DE1 A;  4V2N A;  1CQH A;  4EIP A;  4NXI A;  2B5X A;  5H5Q A;  2LNS A;  4MAB A;  4MH3 A;  4V2M A;  1EGR A;  5JCU A;  2VD0 A;  2HRA A;  1TU7 A;  5AIX A;  5G5F A;  2C80 A;  3P8W A;  1N8J A;  1TRV A;  4HU7 A;  4F0B A;  4HZ4 A;  1W4V A;  4PUF C;  1SVO A;  1K3L A;  1XVQ A;  2IMF A;  2R0C A;  4V2L A;  1G6W A;  1TI3 A;  4O92 A;  2I3Y A;  1A0R P;  1GLQ A;  2R4V A;  4K7I A;  4XRD A;  3VFI A;  2OA7 A;  3UMA A;  1YF1 A;  4N30 A;  1UN2 A;  2RM6 A;  3FMW A;  1R7H A;  2ZCT A;  4DSR A;  5J4V A;  5CYY A;  4TR3 A;  1Z6N A;  1VF4 A;  1JZW A;  4LMW A;  2H76 A;  2VL9 A;  4GST A;  4GCI A;  1FVK A;  3KH9 A;  2O87 A;  2CVB A;  2L4Q A;  2FA8 A;  2HSN A;  4IQ1 A;  5A4W A;  1SKS B;  2N5A A;  5E59 A;  5IOW A;  1RQM A;  3HDC A;  2I1U A;  1EEJ A;  4FYC A;  3VUR A;  3BOA A;  6GSU A;  1GUH A;  4DVC A;  5C00 A;  2EIO A;  4F0C A;  4TN8 A;  2LRC A;  6GSV A;  3IDV A;  2P5Q A;  2DJ0 A;  5AIV A;  3TJK A;  1KBN A;  2L59 A;  2H30 A;  4RQR A;  5G5E A;  1JZO A;  2QSI A;  2IME A;  2UV8 G;  3KTL A;  2YCD A;  3ZFL A;  3UL3 A;  1WIK A;  2HRK A;  2VIM A;  1T4Y A;  3GKK A;  1XW5 A;  3FY7 A;  2WRT A;  3HY2 A;  3HJO A;  1YKA A;  1HNA A;  2LKU A;  2XBQ A;  2DJ2 A;  4K0G A;  1THX A;  2H74 A;  2JU5 A;  1PX7 A;  3FZ5 A;  2MMA A;  5A34 A;  3FEU A;  3K8N A;  4EF0 A;  3FRC A;  2DSA A;  5EPF A;  3I69 A;  4ZB7 A;  4I2U A;  4Z2T A;  3HHV A;  4JR4 A;  1F3A A;  3IE3 A;  5HR2 A;  3KD0 A;  4G01 A;  2KUC A;  4WR4 A;  1PSQ A;  3VWU A;  4NPB A;  1ZYP A;  4CDO A;  5D9W A;  4ZIL A;  2F51 A;  3L9V A;  4EO3 A;  3HA9 A;  3ZRD A;  3C8E A;  2HRK B;  2GTU A;  1NW2 A;  1SKR B;  1FB6 A;  2IFQ B;  4USS A;  3HVS A;  1GSY A;  4HJM A;  4BL7 A;  5EL8 A;  3DVW A;  4WET A;  2WUL A;  3CMI A;  1YQ1 A;  4FQU A;  1BF5 A;  2H0I A;  1J0F A;  1EV4 A;  3TKS A;  4OCF A;  2LJR A;  2VL2 C;  4EDY A;  4PUR A;  2L5L A;  1WJK A;  2LJA A;  12GS A;  2YV7 A;  1A8Y A;  1GUK A;  2VCV A;  4O5R A;  2HE3 A;  3EMX A;  1PGT A;  5DQS A;  4XCS A;  1ERU A;  2IWT A;  3TJB A;  1OKT A;  3ZL5 A;  4LL1 B;  3M0F A;  4AKI A;  4K8M A;  4FYB A;  1QUW A;  3R2Q A;  3ERG A;  4GSS A;  4YKG A;  2K18 A;  1PX6 A;  2DKH A;  4A5P A;  4BL7 B;  4JU5 A;  1B48 A;  5ABR A;  1B9Y C;  4N11 A;  1ZYN A;  4POL A;  2LS5 A;  5GAP D;  2VCQ A;  3EC3 A;  2KHP A;  3NOF A;  2GQM A;  4NHZ A;  2NDO A;  2FD3 A;  2ON5 A;  4OFN A;  3SBC A;  4HI7 A;  3GST A;  3G7I A;  5KN2 A;  2ES7 A;  4OFM A;  4N10 A;  4BVY B;  4ZIJ A;  18GS A;  2K8S A;  2VUP A;  1PL1 A;  2V41 A;  2M80 A;  3KH7 A;  2H8L A;  1OC8 A;  1U3A A;  3H93 A;  1NHO A;  2OJL A;  3FR9 A;  4LL4 B;  2MMO A;  2QKE A;  4MCU A;  1X5D A;  2ON7 A;  5INY A;  4AF2 A;  1SU9 A;  4PTS A;  4X4J A;  2EIR A;  3F4T A;  2GSS A;  1QQ2 A;  3GL3 A;  3LW9 A;  3DVX A;  3WYW A;  2YWM A;  3GKX A;  4TXO A;  3CYN A;  2IPA A;  4MJB A;  2C1Y A;  3C7M A;  2VLV A;  2PGT A;  5A5H B;  2EIQ A;  2O5V A;  4BWS A;  3TRP A;  4Z7X A;  1VF1 A;  2KOK A;  2GQK A;  3ZVJ D;  5D9T A;  4WBJ A;  4FO5 A;  3FR3 A;  4KDU A;  5IMV A;  3A2V A;  2OE1 A;  4AKG A;  2IMK A;  1X9M B;  1IYI A;  1U87 A;  2GZY A;  4TR1 A;  4N3Z A;  4NWY A;  5AIS A;  3DML A;  1S3A A;  5B7C A;  3GX0 A;  2B1K A;  2C0E A;  2PMT A;  2H66 A;  4MJE A;  3ZIT A;  4KDX A;  1TP9 A;  3KZQ A;  2VD1 A;  2CX4 A;  2VAF A;  4DSQ A;  3D22 A;  3FHK A;  1SVL A;  1A2M A;  3TKR A;  1K0D A;  1EP8 A;  1UA5 A;  3EWL A;  3QFB C;  1UVZ A;  1VRS D;  4HQZ A;  4XS4 B;  1DUG A;  1ACV A;  1GTA A;  4PNG A;  2PN8 A;  2E2G A;  1TDI A;  2C3T A;  3IHG A;  3IK9 A;  5AN1 A;  5A5K A;  1EWX A;  4MF6 A;  2JSZ A;  5F06 A;  2BMX A;  3JCM L;  4W66 A;  3MYD A;  2VLU A;  4TR1 B;  1Y1U A;  1B4P A;  4ULX A;  2CVD A;  3HYP A;  5JWQ B;  1SK1 A;  3ZZX A;  6GSW A;  4L5L A;  4GSN A;  4HU9 A;  1JLW A;  2EFH A;  3DYR A;  4IN0 A;  1SVM A;  4K0N A;  2Z9S A;  2QA1 A;  1WP0 A;  1ZMA A;  2HSM A;  5GZZ B;  3H1N A;  2TIR A;  4POM A;  4TR4 A;  3WT1 A;  3KMN A;  2H0G A;  4G0L A;  4YQV A;  1O6J A;  4MK3 A;  2X99 A;  3IHQ A;  4ECB A;  2G2Q A;  1OC9 B;  1HQO A;  1Z6M A;  3QPM A;  1E6B A;  1SEN A;  1AQW A;  4JZQ A;  1XWG A;  5ECH B;  4K6X A;  2RII A;  4ICY A;  3WD6 A;  3TKS E;  2GT5 A;  2H6Z A;  5IO0 A;  2NTO A;  1TRW A;  3TKP A;  3UOM A;  4HQS A;  4J56 E;  1ZYQ B;  4MZB A;  1I9D A;  3E0U A;  5F07 A;  1WOU A;  3LYK A;  1YDK A;  2KP1 A;  2YJ7 A;  3TUE A;  1SL1 B;  1Z5Y E;  2IIY A;  20GS A;  2K6V A;  4K7O A;  2DIY A;  1FOH A;  4NV2 A;  4J2F A;  4YH2 A;  1ON4 A;  4HS1 A;  4ECI A;  2YZH A;  5JCG A;  3CTG A;  2R5G A;  4GQC A;  4IBP A;  2H01 A;  3L4N A;  4X0X A;  5IMA A;  3CSH A;  4KX4 A;  1Y6E A;  3HJM A;  2H6X A;  2HI7 A;  3GSS A;  3NZN A;  2EC4 A;  3Q6O A;  4TRX A;  4WF5 A;  4E68 A;  4NAX A;  2HLS A;  1EEM A;  1F6M C;  1SYX A;  2JZR A;  5IMZ A;  3WGD A;  19GS A;  2X8H A;  4OD7 A;  2YP6 A;  3EU4 A;  4WKW A;  2H75 A;  4K2X A;  3S9F A;  2B3S A;  2V6O A;  3CRU A;  5B8A A;  3HD5 A;  1XWB A;  1QGV A;  1PKZ A;  2M46 A;  3O3T A;  2AB6 A;  2DJK A;  3MWH A;  4Z2R A;  2FWG A;  5IO2 A;  3GTU A;  3IA1 A;  3CSJ A;  1MD3 A;  1UC7 A;  2I4A A;  4LLR A;  1GSQ A;  3UBK A;  3KEB A;  3TDG A;  5CRE A;  2CV4 A;  2N5B A;  3UAP A;  2VCX A;  1FG4 A;  5IPG A;  1S3D A;  3IOS A;  1EP7 A;  4IP1 A;  3GH9 A;  1J9B A;  5HFG A;  1QFN A;  2WCI A;  1FW1 A;  2K9F A;  5HQP A;  1DSB A;  1VGL A;  2B6M A;  1TK5 B;  5J40 A;  4GDF A;  1NM3 A;  2HT9 A;  3D0Z A;  1B9X C;  1XWA A;  5CP1 A;  4KA0 A;  3F0I A;  1M9B A;  1AC1 A;  2B7J A;  3A2X A;  5KOX A;  1ZL9 A;  3ZVJ A;  3TJJ A;  3GTU B;  2A2S A;  3RHB A;  3W8J A;  5ELG A;  2X8G A;  3DWV A;  1O7U A;  1PRX A;  2LST A;  1NSW A;  1XPV A;  1GL8 A;  2LQO A;  1F2E A;  2J9H A;  2JZS A;  3C1R A;  2CAI A;  4NMU A;  2YWN A;  4XHM A;  1K0B A;  3CWG A;  3LXZ A;  4IQA A;  1ST9 A;  4O32 A;  3LG6 A;  3O6T A;  4HOJ A;  1EZK A;  2PVQ A;  2J23 A;  3GIX A;  4WXT A;  2IL3 A;  2LTK A;  1SL2 B;  1JZD A;  3TGZ A;  1J08 A;  2MMZ A;  2M72 A;  2L57 A;  2C4J A;  2P5R A;  1A2J A;  3GYK A;  4LA1 A;  3A5I A;  3F6F A;  2HSH A;  4CY8 A;  1YY7 A;  1JZR A;  1O8X A;  2VLT A;  3FW2 A;  4K7N A;  2XC2 A;  4ILF A;  1SJ6 A;  1GSE A;  2IFQ A;  5AGY A;  3CTF A;  2H19 A;  3EMP A;  2X64 A;  1RW1 A;  3TOU A;  1T8E B;  4ACS A;  3F8U A;  1TK0 B;  4QQ7 A;  1G7E A;  3TRQ A;  3QAW A;  2LNT A;  1ZGN A;  9GSS A;  1ML6 A;  11GS A;  2F8F A;  2DML A;  2ZUP A;  5F0G A;  2R2J A;  2A2P A;  2XPE A;  4MNN A;  3F63 A;  3KGK A;  1RK4 A;  4ZL7 A;  4POB A;  3I6A A;  1HNC A;  2YOI A;  14GS A;  5LNK e;  1YVL A;  4TVE A;  2HFD A;  1SD8 A;  1GTU A;  1M2B A;  1LJR A;  4X43 A;  3VI5 A;  3TU3 B;  3IXR A;  2WGR A;  4K9Z A;  3ERF A;  2LRT A;  4HDE A;  3RAZ A;  5GAN D;  1Z7R A;  2VM2 A;  4TXV A;  2EFE A;  1XCC A;  4KSM A;  3KIJ A;  1PKW A;  4MF7 A;  1ILO A;  3I9V 2;  1DE2 A;  17GS A;  4IKH A;  4KB3 A;  3RBT A;  5FWG A;  3APO A;  5CRH A;  5HR3 A;  4I97 A;  3DKS A;  1V57 A;  2MZC A;  1ZCP A;  1H4O A;  2OKA A;  1KEB A;  5EY6 A;  3D6I A;  4BVY A;  4EXJ A;  4X1U A;  4G2E A;  4ZB8 A;  4P3Y B;  3SWL A;  4ZL9 A;  2EFD A;  4MPG A;  3ME7 A;  3CSI A;  2FCH A;  2RM5 A;  2G0F A;  1ERT A;  4I5Q A;  1O81 A;  2LUS A;  3U6V A;  2DKI A;  3RPN A;  4GLT A;  2PER A;  5G1L A;  1GNE A;  3DRN A;  1F37 A;  3UAR A;  4OO4 A;  1MDI A;  3LEF A;  3ZTL A;  4KH7 A;  1PN9 A;  2P31 A;  5CRD A;  5LCZ A;  3M1G A;  1WE0 A;  1XW9 A;  2FWH A;  4K2D A;  5A5H A;  2YV9 A;  4K5R A;  5A4V A;  1OE8 A;  4ZL8 A;  3H79 A;  4PGT A;  5J5N A;  1V98 A;  5IMD A;  1B8X A;  1GP1 A;  4BVX B;  3M9J A;  2FWE A;  4I6X A;  3C73 A;  4PQH A;  1A23 A;  4Q5R A;  2YN1 A;  3MAK A;  1TOF A;  3J7Y k;  1OE7 A;  2DC5 A;  1SK2 A;  1TI1 A;  2AUV A;  2HXK A;  4G10 A;  3KCM A;  4ISD A;  4BA7 A;  13GS A;  1K0N A;  10GS A;  5G2Z A;  3RPP A;  2C0D A;  5DBQ A;  3BCK A;  3QAG A;  6GSY A;  5E4W A;  3FZA A;  4WBR D;  2H1A A;  1ZOF A;  5ECQ B;  2GZZ A;  5KEJ A;  4XS4 A;  1DBY A;  4L0U A;  3A5W A;  1GLP A;  4G19 A;  2CA8 A;  5F05 A;  2E2M A;  1FHE A;  3D5J A;  1AQV A;  4OFT A;  4XS1 A;  1KNG A;  4Q5Q A;  1Z9H A;  3R3E A;  5J47 A;  2C3N A;  2HZE A;  2TRC P;  3HKR A;  2C8U A;  5CRG A;  1LU4 A;  2YWI A;  3L9U A;  1AIU A;  4E8E A;  3W8S A;  3HZ8 A;  3F9U A;  2CZ3 A;  4H86 A;  5IMC A;  4KGI A;  2E7P A;  4KCA A;  2NBS A;  5A4U A;  3BJ5 A;  2CVK A;  1YEX A;  4BWQ A;  5J4U A;  1AUC A;  3PH9 A;  3EE2 A;  4F03 A;  3HZ4 A;  1U6T A;  1GSS A;  2V6K A;  1OKD A;  4N0Z A;  2AYT A;  4QL7 A;  4GTU A;  5KN3 A;  2VCT A;  5G1K A;  1XWK A;  3EU3 A;  1OC9 A;  1T3B A;  2OE0 A;  3HXS A;  1AQX A;  2HZE B;  2H72 A;  1PA3 A;  3UEM A;  1EGO A;  2B1L A;  2YAN A;  2JSY A;  3W6G A;  2E0Q A;  4ZB6 A;  1Q98 A;  4FYU A;  1OAZ A;  5DJM A;  4MLY A;  3LGC A;  1HNB A;  1QXH A;  4GF0 A;  4ID0 A;  4HEA 2;  1SYR A;  1E2Y A;  3DIE A;  2RLI A;  2VL3 A;  3LFL A;  2WB9 A;  4ZB9 A;  2V1M A;  2DBC A;  3HCZ A;  4EVM A;  4O5U A;  1VF3 A;  3P90 A;  5ELA A;  2DLX A;  3F4S A;  2GZP A;  4QL9 A;  1M2A A;  3TB2 A;  6GSS A;  5D8I A;  5J9C A;  1GUL A;  4IGJ A;  5IPH A;  5GSS A;  5CO3 A;  3U5R E;  3MIX A;  4JE1 A;  3HMJ G;  4J57 E;  4EKZ A;  2V32 A;  4F9Z A;  2H1B A;  5IM9 A;  1A0F A;  1TJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...