1FHEA

Glutathione transferase (fh47) from fasciola hepatica
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
214
structure length
214
Chain Sequence
PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE TRANSFERASE
publication title Crystallization, structural determination and analysis of a novel parasite vaccine candidate: Fasciola hepatica glutathione S-transferase.
pubmed doi rcsb
source organism Fasciola hepatica
total genus 57
structure length 214
sequence length 214
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1fheA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fheA01
2CV4A 3M0FA 1U6TA 2PUKC 2FWGA 1CQGA 2ON5A 2QGVA 3TUEA 2L5LA 3TRQA 2REMA 2ZCTA 4OFNA 3ZTLA 1MTCA 3P2AA 4CHSA 2H71A 2FWFA 4G10A 2WFCA 2NTOA 3TRPA 2KUCA 3HJOA 3LQ7A 2FD3A 1MDIA 4TR4A 5ECIB 2I1UA 3FW2A 4EKZA 1BJXA 1R4WA 2LQQA 2C4JA 4J57E 4KF9A 3UBLA 1F2EA 1TK0B 3NIVA 4BPYA 3HVXA 4E8EA 2F8FA 2YPMA 5J5NA 3OR5A 1GH2A 4BVYA 1Z6NA 1SU9A 3TKRA 2GSRA 1SJIA 3F4SA 5ECSA 1FO5A 4ZBDA 2HYXA 2K8SA 4N11A 2VD1A 4LL1B 2MBTA 2HSNB 2NPBA 1XW9A 2JACA 2WDUA 1GWCA 2CQ9A 3HJMA 5H5QA 1M99A 2H74A 1JZRA 3LFLA 3KMNA 2E7PA 3S9FA 3IAM2 4IHUA 4D73B 2HSMA 1TI3A 3HXSA 3ME8A 5DDLA 2GVPA 2DJ2A 1PQNA 2HRKA 5ECOB 3V1WA 5D8IA 2GQMA 3DWVA 4H86A 2IWTA 2C8UA 3P90A 2KOKA 2PGTA 1GUHA 1M2BA 1NM3A 1FB6A 2IPAA 2G2QA 3Q74A 1XOBA 4TR1A 1GLPA 1MEKA 2IFQB 2N5FA 3C1SA 4FO5A 2HRFA 1BG5A 2H0IA 3CYNA 5ID2A 3GL5A 1F37A 1ZOFA 4MPGA 3BBYA 4NWYA 4ID0A 1S3CA 1DSBA 3L9SA 4ECBA 5J9CA 2O7KA 2JZRA 3F4RA 2V32A 3NZNA 3ISOA 3D4MA 4IP1A 3GFKA 4G0LA 1RK4A 3I9V2 5ABRA 3M9KA 1ERTA 2VLTA 5DQYA 1GP1A 3EYTA 3TCOA 1SK0A 5IO2A 3APOA 3FR9A 1Z7RA 3HD5A 3VWVA 5C04A 4F0CA 2GSQA 3GURA 4Q5QA 2L57A 4KCEA 4WETA 1GL8A 1VF2A 1ZMAA 1YDKA 1Z7PA 1VF3A 4BA7A 2DJ1A 2B7KA 1MDJA 1YEPA 5F0GA 1THOA 1SJZA 3GTUA 4F2IA 3BCIA 3BD2A 3ZITA 1HD2A 3KEBA 3KMOA 2J9HA 2JL4A 2HT9A 1HYUA 2X8HA 6GSUA 1OAZA 4XHMA 2FGXA 3LXTA 3I6AA 1HNBA 4EVMA 1H4OA 3UJ1A 4I2TA 5AISA 1GUMA 3ERFA 3DKSA 1SKWB 3FYGA 2P5RA 3TRXA 4V2NA 1YF0A 1BX9A 2C1YA 4I6XA 2Z9SA 1EWXA 4AGSA 2MMAA 5LNKe 2JSYA 1I9DA 2IMKA 3KD0A 1XW5A 2FNOA 2YANA 1XW6A 4ECCA 3KIJA 1JLVA 4K7NA 5AN1A 12GSA 2LJRA 1AIUA 1Q4JA 4IS0A 1T1VA 4WBJA 2H19A 1U88A 3CSJA 1DE2A 3CBUA 1X9SB 4KSOA 1M9AA 2AHEA 4ML1A 4EDYA 2H72A 4HU7A 4TR0A 2PERA 4ECIA 4F9ZA 1S3AA 2GSSA 1W4VA 3WGEA 1O6JA 4MZWA 5KN3A 2NBSA 1AQXA 2AYTA 3LWAA 1PX7A 3GHAA 2H1DA 2UZ8A 3GX0A 1MD3A 1QQ2A 5H5RA 2VCZA 3WGXA 5E4WA 16GSA 2B5XA 2PN8A 4ZB8A 2FWHA 4TR1B 3DRNA 3TJJA 3IC8A 4PX1A 3NOFA 1XOAA 9GSSA 3VLNA 11GSA 1SK1A 2VIMA 3QAWA 2PU9C 4NXIA 4X43A 4MMMA 3UEMA 1M2DA 4IJ3A 1K3OA 5HR1A 4L0UA 3EMPA 20GSA 4NV5A 2CA8A 2N5BA 3DEXA 4ZL7A 2H1BA 5C00A 2V6KA 3CTFA 1PD21 3CRTA 5J3RA 2TRXA 2KP2A 7GSSA 4X1UA 3L9UA 4GRFA 2L59A 1LJRA 5D93A 4HUAA 5AIXA 3RHCA 1QFNA 2WULA 2R6KA 3PPUA 5CO3A 3GSSA 3IR4A 4KDXA 2EIQA 3H93A 1CQHA 1WJKA 4IBPA 2WJUA 2OKAA 1X5DA 4K0NA 1EP8A 2O89A 1JZWA 1T7PB 2OE3A 4RQRA 3K8NA 4XS1A 1JZDA 1XWKA 5FWGA 4J56E 1VF4A 1YZXA 2VO4A 4N10A 4HQZA 4BVXA 3TJBA 2HQTA 2JZSA 5DJMA 2R5GA 3FR6A 4V2LA 4NMUA 4F82A 3W8JA 2WS2A 2HLSA 3HHVA 2VL2A 2HFDA 4DSSA 3KH7A 5IPGA 5CRGA 2F8AA 5AIVA 2OACA 3KM6A 3VWXA 3HJPA 4GQFA 4MJBA 5G30A 4E8HA 3EVIA 3J7Yb 4ULXA 3ZL5A 3TKSA 1AAZA 5BMUA 4CW9A 4JRRA 2DSAA 4MLYA 3QD9A 2FA4A 1K0BA 2H1GA 2WB9A 2G0FA 1MDKA 3HYPA 1ERVA 5D9TA 1JFUA 2NDOA 5ECKB 4EL1A 1AC1A 4KCAA 4LLRA 4TW5A 2QKEA 4WR5A 4BWSA 2LUSA 2V41A 1ERWA 4POKA 5DJLA 4NPBA 2VCQA 1YKCA 4PTSA 1XWCA 1PX6A 1Y25A 2TIRA 4AJ6A 3QPMA 4PURA 1GSDA 3L4NA 1C72A 3QR6A 2RUEA 3WYWA 2YWIA 3D4TA 4NAXA 5KN0A 3M9JA 4USSA 1GTAA 4ZBBA 2YNXA 2LQOA 2PPTA 3HY2A 2I81A 2LEGA 1DBYA 2C0FA 3GNJA 5D96A 5ENUA 3TDGA 1E6BA 5JWRB 4V1Ap 1ZL9A 2CAIA 4OMVA 3L9VA 4WBRD 1XFLA 3QDNA 1XVQA 1GNWA 2VCVA 6GSTA 1RQMA 2E0QA 4MJEA 5EVOA 3H79A 5G5FA 3VK9A 5A4UA 2OJLA 3M3MA 1YJ6A 4ZXGA 5IO0A 3GKMA 5FT3A 3EINA 10GSA 1KEBA 3PR8A 1SD8A 4ZBAA 2HE3A 4IJIA 4KH7A 3UAPA 4EC0A 2E2MA 3GKNA 4JBBA 4KB3A 5ECQB 2YV9A 5JCWA 1NW2A 3HKRA 4MF6A 1M7TA 2HZFA 4TXVA 8GSSA 3ZYWA 3KTBA 4ZIJA 4KDUA 4BVXB 3H4KA 4GSTA 2LNTA 4GLTA 1T00A 3EURA 2JSZA 2HRAA 2MZCA 2H1AA 4KA0A 3IHQA 2KLXA 3LSZA 4PUFC 1EGOA 4J2FA 4TRXA 3IK7A 3FHKA 3F0IA 2O8VB 2P5QA 4EO3A 3SWLA 3UIWA 4DSSB 5EPFA 4AJ8A 5F05A 3IOSA 2DC5A 4K0GA 5DVBA 2JZTA 4LMVA 1R7HA 3GV1A 1WRYA 1U3AA 1MD4A 3RHBA 1TRSA 3IE3A 3I43A 5IMZA 1K3LA 5GZZB 3Q6OA 4FH8A 4WEYA 5HR0A 1F9MA 1SL1B 4K7OA 4XTSA 2IN3A 4V1Ag 5ELGA 4TVEA 1LU4A 1PSQA 6GSWA 4IW9A 1B9XC 3DIEA 1KNGA 1B4PA 3DXBA 2VM2A 4KX4A 2VUPA 5F8BA 2AAWA 1WE0A 3DVXA 3QMXA 1FAAA 3UL3A 2L4QA 3ZRDA 4MP4A 3G7YA 1OKDA 2RM6A 1OKTA 1GSEA 3VPQA 5B6MA 2GZZA 1XWAA 3F3QA 3IRAA 3TB2A 2MMZA 1V98A 1TTZA 2TRCP 5CRHA 2H73A 2XPDA 1K0OA 1Z9HA 4O32A 3UBKA 1BQ7A 1WIKA 3ZVJA 4K6XA 2ON7A 3R2QA 2LV3A 2YWOA 1VRSD 2IL3A 2D2ZA 4G9HA 3ZMLA 3IK9A 1XZOA 5JCUA 4L0WA 1G6YA 3CSIA 2CZ2A 3HCZA 2WCIA 1UN2A 1G6WA 3IV4A 3LORA 1TK5B 3D6IA 2OE0A 4GCIA 2B1KA 2P31A 1USBA 3RAZA 1ERUA 2ZNMA 2YCDA 2JADA 2JU5A 2DLXA 2O85A 1QUWA 2LNSA 4ZB9A 2CVKA 3GH9A 4G0IA 4O92A 1THXA 4KUNA 2CT6A 3ZFBA 4FYUA 3M1GA 3FEUA 1TU7A 4MH3A 5IMAA 4OO5A 3TGZA 3VWWA 4I8BA 4MDCA 3EU3A 4RI6A 3UOMA 1EOHA 3LXZA 1JLWA 2VLVA 4WKWA 1SENA 3VPTA 1PL2A 2F3MA 1GTBA 3ERGA 3HVVA 1OE8A 2PMTA 2GGTA 3ZVJD 3GKXA 1F3BA 2DIZA 3APSA 4MZBA 2GDRA 3O6TA 3KJYA 5HFIA 4BVYB 2E2GA 4ML6A 4GSSA 5B8BA 2KHPA 2AB6A 1N8JA 5CRDA 3APQA 2C3NA 3DD3A 4FYBA 5F06A 3BOAA 1SKSB 4PQHA 1EZKA 1HNCA 1TKDB 1A0FA 1ZYEA 2H6XA 2QSIA 3KP8A 3LG6A 3W6GA 2LSTA 2R4VA 1QMVA 3SBCA 3KXOA 5A4VA 2HSMB 1SD9A 4XCSA 5A5KA 4I2UA 4O5RA 2HRKB 2DJ3A 1WPIA 3DGQA 2EIRA 4POLA 5J9BA 2H75A 2GT6A 1GSQA 6GSSA 2J23A 1HNAA 4KSMA 2A2RA 2BJXA 3WGDA 1XWBA 1X0RA 5IM9A 1UVZA 3ERWA 5IMCA 2CVDA 6GSYA 5DALA 1YY7A 4ZL8A 2DJ0A 1HQOA 5ID2B 3MSZA 5JCGA 2H30A 1K0DA 2VL2C 4KE3A 3TKPA 3GMFA 4XRDA 4L5OA 5DCGA 2VOCA 4FIWA 3IAS2 1T3BA 2HSHA 2FLSA 3UVTA 1SKRB 4YQVA 3KZQA 1ZYQB 1R26A 5GSSA 1ML6A 2H0GA 3TKSE 4ILFA 4HOJA 4RI7A 3Q18A 4BWQA 1A0RP 5D9WA 1OE7A 3US3A 4MK3A 2HNLA 4ZB6A 1QXHA 5DAKA 3TKSC 1X5CA 2X8CA 3HZ4A 2H8LA 1WP0A 3LGCA 4IKHA 4MCUA 1PKZA 1ZCPA 1X5EA 3TOTA 2CAQA 2WRTA 5A4WA 1BAYA 3WT1A 1B9YC 4G0KA 4TXOA 3C7MA 4DSRA 1AQWA 4DEJA 4KNDA 2YN1A 2YZUA 1K3YA 1ABAA 1GSUA 1G7EA 2DJKA 3GTUB 4ACSA 5F07A 4MH2A 2YV7A 1J08A 1TRUA 4Q5RA 1A8YA 2H0HA 1E2YA 2OE1A 3QFAC 1T8EB 3GL3A 3GA4A 4EXJA 2IMFA 1M9BA 1OVNA 3TJGA 2YP6A 1F6MC 5HR2A 2B3SA 4GXZA 3WT2A 3QFBC 1GNEA 3A2WA 1A8LA 4PGTA 3FRCA 4MF7A 1GSYA 4OO4A 2EC4A 3DMLA 1EV4A 4OCEA 5COHA 1QK8A 4ECJA 1K0MA 1DUGA 2ALBA 4Q5FA 1W89A 2VL3A 5ECLB 4YAPA 4BL7A 5IQYA 5DQSA 5J4UA 1A2LA 3ED3A 5L71A 2L5OA 2MMOA 3VURA 2FCHA 2C0DA 1R5PA 1TI1A 3KP9A 3EC3A 4PNFA 1KBNA 2B5YA 2GT5A 4QQ7A 5G1LA 4I97A 1GSSA 2K9FA 5INYA 1OC8A 3F4TA 1SL0B 4HJ2A 3A3TA 3LYPA 1TW9A 3RPPA 1SL2B 6GSVA 3CTGA 1VGLA 2IJYA 2CX4A 5D9XA 5DALB 5GAPD 2X64A 5CYYA 4ISDA 5CP1A 3VWUA 1TP9A 2LJAA 2A2SA 3KTLA 2DBCA 3GSTA 2DIYA 5GSTA 4V2MA 1OC9A 2M46A 1OC3A 4NHWA 1GUKA 1O8WA 2DMLA 2HZEA 5ECMB 4G2EA 1K0CA 2IMDA 4HJMA 3C8EA 5IMVA 3DYRA 5ECPB 5DAKB 5ECHB 5B6NA 4YH2A 1GULA 4NHZA 4TR3A 1IYHA 5FHIA 2I3YA 3J7Yk 5B8AA 1YQ1A 1A24A 1PMTA 1K0NA 1B8XA 2H76A 4FQUA 2YJHA 4Q5NA 3C1RA 3PH9A 4TXOB 1EV9A 5IPHA 1FB0A 2B5EA 1G0TA 1V2AA 2C80A 3EMXA 3D21A 4KDYA 4I5QA 2H6ZA 2V2GA 1IYIA 2X99A 4OCFA 3CMIA 2VCXA 1J9BA 1PL1A 3M8NA 3MWHA 2OADA 1GRXA 2DJJA 2I4AA 3CXGA 4EF0A 3C73A 4G19A 2LS5A 5G5EA 2V6OA 1SJ6A 3ZIVA 5HFKA 1EP7A 2M72A 2MYGA 2CZ3A 3HZ8A 2OA7A 2YOIA 2GQKA 3FZAA 3D0ZA 1SK2A 3FZ9A 2PWJA 5KN1A 2R3XA 2H70A 3R3EA 3MAKA 1TRWA 4WR4A 3BCKA 2I9HA 3GYKA 1NHYA 5IMFA 3ZLPA 2HSYA 2BTOT 1SYRA 1TJDA 2P0GA 4QL7A 3F9UA 4MABA 1XCCA 1V58A 4AJ7A 4HU9A 2FA8A 3A2XA 2C3QA 2B6MA 1ZZYA 3FZ4A 2GZYA 2VL9A 3IA1A 4EUYA 4PNGA 4Z7XA 1TU8A 2YWMA 4BL7B 1FG4A 17GSA 4WF5A 3EWLA 1URMA 1XXUA 2CVBA 3L78A 1A2JA 1ST9A 3UMAA 2VCTA 3HDCA 5ECRB 22GSA 1U3IA 2GQLA 2XPEA 2XBQA 1XPVA 5CRWA 4YQUA 2IMIA 4YAVA 13GSA 3W8SA 4PUAA 1S3DA 3E0UA 5H5SA 5ELAA 1GSFA 1O8XA 4LA1A 2VD0A 4MJAA 4IGJA 4IELA 1ACVA 1BEDA 2V1MA 2HXKA 2H6YA 2ZUPA 4OFTA 3QAVA 2FY6A 3P7XA 3GRXA 1TRVA 3FZ5A 3GN3A 2GS3A 4GSNA 1OC9B 3VFIA 3F8UA 4TN8A 3ZFLA 3GKKA 2HZEB 5KN2A 5CREA 3ZMKA 4LMWA 2AV4A 1EEJA 2LJKA 3QOUA 1DE1A 3IC4A 3ME7A 3Q19A 3G9BA 1V57A 4HZ4A 3FKFA 1AQVA 2PVOC 2YJ7A 1XVWA 3U5RE 3GX8A 5HFGA 3A5WA 4PQIA 3KCMA 4JEDA 4EE0A 4TKYA 1WWJA 4HEA2 4CDOA 3O76A 1NSWA 1AW9A 3ZIJA 4HQSA 4XIHA 5LCZA 1EOGA 1A23A 2RLIA 1KTEA 3WD6A 2O87A 2RUFA 3G7JA 2AUVA 6GSXA 1XIYA 5IOWA 2R37A 1N2AA 5EL8A 4K8MA 1FOVA 1PN9A 2VM1A 3H8QA 4HI7A 1A2MA 1U87A 1O7UA 2PBJA 1LBKA 5D9VA 1Q98A 5G2ZA 5LD0A 1Y6EA 1PA3A 1AXDA 1OYJA 4F0BA 1AUCA 3CRUA 3QCPA 3TKQA 4PQ1A 4KW6A 1YKAA 3F6FA 3UARA 3BJ5A 4KAEA 1FVKA 1ON4A 4JR4A 5CAXA 3ZREA 3RDWA 4FYCA 4HDEA 4WXTA 5KEJA 3GUSA 1EEMA 1EGRA 4JR6A 3QAGA 1GTUA 3PGTA 2KP1A 1SYXA 1Z5YE 5HQPA 4MPFA 1ZGNA 1TK8B 1M2AA 4K9ZA 5G1KA 2L6DA 4IN0A 2OBKA 3F63A 3GIXA 2RM5A 2WGRA 4RUVA 1BYEA 2IIYA 4DSQA 3CSHA 3MDKA 2N5AA 4L8EA 3IDVA 2C0GA 2L4CA 5IIZA 5CNWA 2X8GA 4JE1A 4IVFA 4KGIA 4N30A 5G31A 1RW1A 2AJQB 4XS6A 4OFMA 18GSA 1GLQA 3FK8A 3ZZXA 3LEFA 4LL4B 3IPZA 1NHOA 1UA5A 1B48A 4ZL9A 2YWNA 2A4VA 5DCHA 2GLRA 2XBIA 1V9WA 1YEXA 5D73A 4O7HA 2B1LA 4X0XA 2HI7A 2VAFA 1XWGA 4L5LA 2WZ9A 5J41A 4XS4A 2H66A 1ILOA 4OWYA 4POBA 2LRNA 2MBSA 5AGYA 4GTUA 4AF2A 4EDZA 14GSA 3A2VA 1F3AA 2FUG2 4K1FA 4MJCA 2XHFA 3HA9A 3D22A 4XRAA 5IMDA 3PINA 2K6VA 4IQ1A 2PVQA 2IMEA 3LYKA 2MMNA 2QC7A 2M80A 3DVWA 1XBSA 1Z3EA 3TOUA 3L0HA 1R5AA 3MNGA 1QGVA 1WMJA 3UVHA 4ZILA 1I5GA 1WOUA 3FR3A 1V40A 2EIOA 4N0VA 1VF1A 2K18A 4IP6A 2L6CA 1TDIA 5E59A 2NVLA 4YQMA 3VI5A 3RPNA 1JHBA 4GWRA 3TJKA 1M0UA 1B4QA 2LRCA 3GH6A 4POMA 4JZQA 4WF4A 3KH9A 5JWQB 2F51A 2F9SA 3U6VA 4MF5A 2OBIA 2VLUA 2FWEA 1G7OA 1YF1A 3E9JB 2C0EA 1O81A 1PKWA 4TOPA 1TXXA 2FHEA 1PRXA 3AY8A 2LRTA 4GQCA 1X9MB 2BMXA 5DBQA 4MZCA 2GSTA 4D73A 1GTIA 2R2JA 4DVCA 2LTKA 1FVJA 3IBHA 2XC2A 5HR3A 4JU5A 2C3TA 3FY7A 2LKUA 4F03A 4HS1A 5B7CA 3I69A 5EY6A 19GSA 4IQAA 3F3RA 3HVSA 4RQXA 3N9JA 3RBTA 1JZOA 4N0ZA 3EE2A 3F6DA 1T4YA 4P3YB 2IFQA 4K7IA 1TOFA 2RIIA 3P8WA 4HZ2A 1J0FA 2HRNA 2K8VA 3N5OA 4OD7A 2CX3A 5JWOB 2GZPA 1FHEA 3TJFA 4GF0A 1X9WB 1FW1A 3D5JA 2ES7A 2YZHA 3H1NA 3KGKA 2H01A 4K2DA 5GAND 3E3EA 4MA9A 1UC7A 2B7JA 1Z6MA 1T4ZA 1K0AA 3G7IA 3LJRA 2DMMA 1PGTA 3O3TA 1O85A 5IOXA 5ECNB 4PXOA 4QL9A 2VCWA 3VI7A 4NV2A 3IXRA 4XS4B 3JCML 2GTUA 3EU4A 3C71A 1H75A 1O73A
chains in the Genus database with same CATH superfamily
2CV4A 3M0FA 1U6TA 2PUKC 2FWGA 1CQGA 2ON5A 2QGVA 3TUEA 2L5LA 3TRQA 2REMA 2ZCTA 4OFNA 3ZTLA 1MTCA 3P2AA 4CHSA 2H71A 2FWFA 4G10A 1S3RA 2WFCA 2NTOA 3TRPA 2KUCA 3HJOA 3LQ7A 2FD3A 1MDIA 4TR4A 3EPTA 5ECIB 2I1UA 3FW2A 4EKZA 1BJXA 1R4WA 2LQQA 4CY8A 2C4JA 4J57E 4KF9A 3UBLA 1F2EA 1TK0B 3NIVA 4BPYA 3HVXA 4E8EA 2F8FA 3RFRC 2YPMA 5J5NA 3OR5A 1GH2A 4BVYA 1Z6NA 1SU9A 3TKRA 2GSRA 1SJIA 3F4SA 4YKFA 5ECSA 1FO5A 4ZBDA 2HYXA 2K8SA 4N11A 2VD1A 4LL1B 2MBTA 2HSNB 2NPBA 1XW9A 2JACA 2WDUA 1GWCA 2CQ9A 3HJMA 5H5QA 1M99A 2H74A 1JZRA 3KMNA 3LFLA 2E7PA 3S9FA 5J4VA 3IAM2 4IHUA 4D73B 5J47A 2HSMA 1TI3A 3HXSA 3ME8A 5DDLA 2GVPA 2DJ2A 1PQNA 2HRKA 5ECOB 3V1WA 3CQFA 2A4HA 5D8IA 2GQMA 3DWVA 4H86A 2IWTA 2C8UA 3P90A 1M3IA 2KOKA 2PGTA 1GUHA 1M2BA 1NM3A 1FB6A 2IPAA 2G2QA 3Q74A 1XOBA 4TR1A 1GLPA 1MEKA 5A1NA 2IFQB 2N5FA 3C1SA 3HVNA 4FO5A 2HRFA 1BG5A 1PN0A 2H0IA 3CYNA 5ID2A 3GL5A 1F37A 1ZOFA 4MPGA 3BBYA 4NWYA 4ID0A 1S3CA 1DSBA 3L9SA 4ECBA 1S4BP 5J9CA 2O7KA 2JZRA 3F4RA 4AI6A 2V32A 3NZNA 3ISOA 3D4MA 4IP1A 3GFKA 4G0LA 1RK4A 3I9V2 5ABRA 3M9KA 1ERTA 2VLTA 5DQYA 1GP1A 3EYTA 3TCOA 1SK0A 5IO2A 3APOA 3FR9A 1Z7RA 3HD5A 3VWVA 5C04A 4F0CA 2A2PA 2GSQA 3GURA 4Q5QA 2L57A 4KCEA 4WETA 1GL8A 1VF2A 1ZMAA 1YDKA 1Z7PA 1VF3A 4BA7A 2DJ1A 2B7KA 1MDJA 1YEPA 5F0GA 1THOA 1SJZA 3GTUA 4F2IA 3BCIA 2DKIA 3BD2A 3ZITA 1HD2A 2QA1A 3KEBA 3KMOA 2J9HA 2JL4A 2HT9A 1HYUA 2X8HA 4N3ZA 6GSUA 1OAZA 4XHMA 2FGXA 3LXTA 4HSCX 3I6AA 1HNBA 4G01A 4EVMA 1H4OA 3UJ1A 4I2TA 1YVLA 1GUMA 5AISA 3ERFA 3DKSA 1SKWB 3FYGA 2P5RA 3TRXA 4V2NA 1YF0A 1BX9A 2C1YA 4I6XA 2Z9SA 1EWXA 4AGSA 2MMAA 5LNKe 2JSYA 1I9DA 2IMKA 3KD0A 1XW5A 2FNOA 2YANA 1XW6A 4ECCA 3KIJA 1JLVA 4K7NA 5AN1A 12GSA 2LJRA 1AIUA 1Q4JA 4IS0A 1T1VA 4WBJA 2H19A 1U88A 3CSJA 1DE2A 3CBUA 1X9SB 4KSOA 1M9AA 2AHEA 4ML1A 4EDYA 2H72A 4HU7A 4TR0A 2PERA 1YEWC 4ECIA 4F9ZA 1S3AA 2GSSA 1W4VA 3WGEA 1O6JA 4MZWA 5KN3A 2NBSA 1AQXA 2AYTA 3LWAA 1PX7A 3MYDA 3GHAA 2H1DA 2UZ8A 3GX0A 1MD3A 1QQ2A 5H5RA 2VCZA 3WGXA 5E4WA 16GSA 2PN8A 2B5XA 4ZB8A 2FWHA 4TR1B 3DRNA 5A1NB 3TJJA 3IC8A 4PX1A 3NOFA 1XOAA 9GSSA 3VLNA 11GSA 1SK1A 2VIMA 3QAWA 2PU9C 4EIQA 4NXIA 4X43A 4MMMA 3UEMA 1M2DA 4IJ3A 1K3OA 5HR1A 4L0UA 3EMPA 20GSA 4NV5A 2CA8A 2N5BA 3DEXA 4ZL7A 2H1BA 5C00A 2V6KA 3CTFA 1PD21 3CRTA 5J3RA 2TRXA 2KP2A 7GSSA 4X1UA 3L9UA 4GRFA 2L59A 1LJRA 5D93A 4HUAA 5AIXA 3RHCA 1QFNA 5A34A 2WULA 2R6KA 3PPUA 5CO3A 3GSSA 3IR4A 4KDXA 2EIQA 3H93A 2WVXA 1CQHA 1WJKA 2OT3A 4IBPA 2WJUA 2OKAA 4AKXB 1X5DA 4K0NA 2R0CA 1EP8A 2O89A 1JZWA 1T7PB 2OE3A 4RQRA 3K8NA 4XS1A 1JZDA 1XWKA 5FWGA 4J56E 1VF4A 1YZXA 2VO4A 4N10A 4HQZA 4BVXA 3TJBA 2HQTA 2JZSA 5DJMA 2R5GA 3FR6A 4V2LA 4NMUA 4F82A 3W8JA 2WS2A 2HLSA 3HHVA 2VL2A 2HFDA 2O3EA 4DSSA 3FMWA 3KH7A 5IPGA 5CRGA 2F8AA 5AIVA 2OACA 3KM6A 3VWXA 3HJPA 4GQFA 4MJBA 5G30A 4E8HA 3EVIA 3J7Yb 4ULXA 3CWGA 3ZL5A 3TKSA 1AAZA 5BMUA 4CW9A 4JRRA 2DSAA 4MLYA 3QD9A 2FA4A 1K0BA 2H1GA 2WB9A 2G0FA 1MDKA 3HYPA 4PHZC 1ERVA 5D9TA 1JFUA 2NDOA 5ECKB 4EL1A 1AC1A 4KCAA 4LLRA 2H1LA 4TW5A 2QKEA 4WR5A 4BWSA 2LUSA 2V41A 1ERWA 4POKA 5DJLA 4NPBA 1I1IP 2VCQA 1YKCA 4PTSA 1XWCA 1PX6A 1Y25A 2TIRA 3LW9A 4AJ6A 3QPMA 4PURA 1GSDA 5J40A 2UV8G 3L4NA 1C72A 3QR6A 2RUEA 3WYWA 2YWIA 3D4TA 4NAXA 5KN0A 3M9JA 4USSA 1GTAA 4ZBBA 2YNXA 2LQOA 2PPTA 2WVZA 3HY2A 2I81A 2LEGA 1DBYA 2C0FA 3GNJA 5D96A 5ENUA 3TDGA 1E6BA 5JWRB 4V1Ap 1ZL9A 2CAIA 4OMVA 4AKGA 3L9VA 4WBRD 1XFLA 3QDNA 1XVQA 1GNWA 2VCVA 6GSTA 1RQMA 2E0QA 4MJEA 5EVOA 3H79A 5G5FA 3VK9A 5A4UA 2OJLA 5A34B 3M3MA 1YJ6A 4ZXGA 5IO0A 3GKMA 5FT3A 2WVXB 3EINA 3CHXC 10GSA 1KEBA 3PR8A 1SD8A 4ZBAA 2HE3A 4IJIA 1TXUA 4KH7A 3UAPA 4EC0A 2E2MA 3GKNA 4JBBA 4KB3A 5ECQB 2YV9A 2WW1A 5JCWA 1NW2A 3HKRA 4MF6A 1M7TA 2HZFA 4TXVA 8GSSA 3ZYWA 3KTBA 4ZIJA 4KDUA 4BVXB 3H4KA 4GSTA 2LNTA 4GLTA 1T00A 3EURA 4X4JA 2JSZA 3A5IA 2HRAA 2MZCA 2H1AA 4KA0A 3IHQA 2KLXA 2WZSA 3LSZA 4PUFC 1EGOA 4J2FA 4TRXA 3IK7A 3FHKA 3F0IA 2O8VB 2P5QA 4EO3A 3SWLA 3UIWA 4DSSB 5EPFA 4AJ8A 5F05A 3IOSA 2DC5A 4K0GA 5DVBA 2JZTA 4LMVA 1R7HA 3GV1A 1WRYA 1U3AA 5BMUB 1MD4A 3RHBA 1BF5A 1TRSA 3IE3A 3I43A 5IMZA 1K3LA 5GZZB 3Q6OA 4W66A 4FH8A 4WEYA 5HR0A 1F9MA 1SL1B 4K7OA 4XTSA 2IN3A 4V1Ag 5ELGA 4TVEA 1LU4A 1PSQA 6GSWA 4IW9A 1B9XC 3DIEA 1KNGA 1B4PA 2WW0A 3DXBA 2VM2A 4KX4A 2VUPA 5F8BA 2AAWA 1WE0A 3DVXA 3QMXA 1FAAA 3UL3A 2L4QA 3ZRDA 4MP4A 3G7YA 1OKDA 2RM6A 1OKTA 1GSEA 3VPQA 5B6MA 2GZZA 4Z2TA 1XWAA 3F3QA 3IRAA 3TB2A 2MMZA 1V98A 2X49A 1XG8A 1TTZA 2TRCP 5CRHA 2H73A 2XPDA 1K0OA 1Z9HA 4O32A 3UBKA 1BQ7A 1WIKA 4Z2RA 3ZVJA 4K6XA 2ON7A 3R2QA 2LV3A 2YWOA 1VRSD 2IL3A 2D2ZA 4G9HA 3ZMLA 3IK9A 1XZOA 5JCUA 4L0WA 1G6YA 3CSIA 2CZ2A 3HCZA 2WCIA 1UN2A 1G6WA 3IV4A 3LORA 1TK5B 3D6IA 2OE0A 4GCIA 2B1KA 2P31A 1USBA 4Z2UA 3RAZA 4O5UA 1ERUA 2ZNMA 2YCDA 2JADA 2JU5A 2DLXA 2O85A 1QUWA 2LNSA 4ZB9A 2CVKA 3GH9A 4G0IA 4O92A 1THXA 4KUNA 2CT6A 3ZFBA 4FYUA 3M1GA 3FEUA 1TU7A 4MH3A 5IMAA 4OO5A 3TGZA 3VWWA 4I8BA 4MDCA 1SVLA 3EU3A 4RI6A 3UOMA 1EOHA 3LXZA 1JLWA 2VLVA 4WKWA 1SENA 3VPTA 1PL2A 2F3MA 1GTBA 3ERGA 3HVVA 1OE8A 2PMTA 2GGTA 3ZVJD 3GKXA 1F3BA 2DIZA 3APSA 4MZBA 2GDRA 3O6TA 3KJYA 5HFIA 4BVYB 2E2GA 4ML6A 4GSSA 5B8BA 2KHPA 2AB6A 1N8JA 5CRDA 3APQA 2C3NA 3DD3A 4FYBA 5F06A 3BOAA 1SKSB 4PQHA 1EZKA 1HNCA 1TKDB 1A0FA 1ZYEA 2H6XA 2QSIA 3KP8A 3LG6A 3W6GA 2LSTA 2R4VA 1QMVA 3SBCA 3KXOA 5A4VA 2HSMB 4EIPA 1SD9A 4XCSA 5A5KA 4I2UA 4O5RA 2HRKB 2DJ3A 1WPIA 3DGQA 2EIRA 4POLA 5J9BA 2H75A 2GT6A 1GSQA 6GSSA 2WVYA 2J23A 1HNAA 4KSMA 2A2RA 2BJXA 3WGDA 1XWBA 1X0RA 5IM9A 1UVZA 3ERWA 5IMCA 2CVDA 6GSYA 5DALA 1YY7A 4ZL8A 2DJ0A 1HQOA 5ID2B 3MSZA 2DKHA 2H30A 1K0DA 2VL2C 5JCGA 4KE3A 3TKPA 3GMFA 4XRDA 4L5OA 5DCGA 2VOCA 4AKHA 4FIWA 3IAS2 1T3BA 2HSHA 2FLSA 3UVTA 1SKRB 4YQVA 3KZQA 1ZYQB 1R26A 5GSSA 1ML6A 2H0GA 3TKSE 4ILFA 4HOJA 4RI7A 4PI2C 3Q18A 4BWQA 1A0RP 5D9WA 5KOXA 1OE7A 3US3A 4MK3A 2HNLA 4ZB6A 1QXHA 5DAKA 2EFCA 3TKSC 1X5CA 2X8CA 3HZ4A 2H8LA 1WP0A 3LGCA 4IKHA 4MCUA 1PKZA 1ZCPA 1X5EA 3TOTA 2CAQA 2WRTA 5A4WA 1BAYA 3WT1A 4CY6A 1B9YC 4G0KA 4TXOA 3C7MA 4DSRA 1AQWA 4DEJA 4KNDA 2YN1A 2YZUA 1K3YA 1ABAA 2O36A 1GSUA 1PFOA 1G7EA 2DJKA 3GTUB 4ACSA 5F07A 4MH2A 2YV7A 1J08A 1TRUA 4O5QA 4Q5RA 4E68A 1A8YA 2H0HA 1E2YA 2OE1A 3QFAC 1T8EB 3GL3A 3GA4A 4EXJA 2IMFA 1M9BA 1OVNA 4ICYA 2R0PA 3TJGA 2YP6A 1F6MC 5HR2A 2B3SA 4GXZA 3WT2A 3QFBC 1GNEA 3A2WA 1A8LA 4PGTA 3FRCA 4MF7A 1GSYA 4OO4A 2EC4A 3DMLA 1EV4A 4OCEA 5COHA 1QK8A 2HSNA 4ECJA 1K0MA 1DUGA 2ALBA 4Q5FA 1W89A 2VL3A 5ECLB 4YAPA 4BL7A 5IQYA 5DQSA 5J4UA 1A2LA 3ED3A 5L71A 2L5OA 2MMOA 3VURA 2FCHA 2C0DA 4GDFA 1R5PA 1TI1A 3KP9A 3EC3A 4PNFA 1KBNA 2B5YA 2GT5A 4QQ7A 5G1LA 4I97A 1GSSA 2K9FA 5INYA 1OC8A 3F4TA 1SL0B 4HJ2A 3A3TA 3LYPA 1TW9A 3RPPA 1SL2B 6GSVA 3CTGA 1VGLA 2IJYA 2CX4A 5D9XA 5DALB 4AKIA 5GAPD 2X64A 5CYYA 4ISDA 5CP1A 3VWUA 1TP9A 2LJAA 2A2SA 3KTLA 2DBCA 3GSTA 2DIYA 5GSTA 4V2MA 1OC9A 2M46A 1OC3A 4NHWA 1GUKA 1O8WA 2DMLA 2HZEA 5ECMB 4G2EA 1K0CA 2IMDA 2WW2A 4HJMA 2EFEA 3C8EA 5IMVA 3DYRA 5ECPB 5DAKB 5ECHB 5B6NA 4YH2A 1GULA 4NHZA 4TR3A 1IYHA 5FHIA 2I3YA 1Y1UA 3J7Yk 5B8AA 1YQ1A 4K5RA 1A24A 1PMTA 5A5HA 1K0NA 1B8XA 2H76A 4FQUA 2YJHA 1BG1A 4Q5NA 3C1RA 3PH9A 4TXOB 1EV9A 5IPHA 1FB0A 2B5EA 1G0TA 1V2AA 2C80A 3EMXA 3D21A 4KDYA 4I5QA 4BIKA 2H6ZA 2V2GA 1IYIA 2X99A 4OCFA 3CMIA 2VCXA 1J9BA 1PL1A 3M8NA 3MWHA 2OADA 1GRXA 2DJJA 2I4AA 3CXGA 4EF0A 3C73A 4G19A 2LS5A 4PI0C 5G5EA 4MNNA 2V6OA 1SJ6A 3ZIVA 5HFKA 1EP7A 2M72A 2MYGA 2CZ3A 3HZ8A 2OA7A 2YOIA 2GQKA 2VKZG 3FZAA 3D0ZA 1SK2A 3FZ9A 2PWJA 5KN1A 2R3XA 2H70A 3R3EA 3MAKA 1TRWA 4WR4A 3BCKA 2I9HA 3GYKA 1NHYA 5IMFA 3ZLPA 2HSYA 2BTOT 1SYRA 1TJDA 2P0GA 4QL7A 3F9UA 4MABA 1XCCA 4A5PA 1V58A 4AJ7A 4HU9A 2FA8A 3A2XA 2C3QA 2B6MA 1ZZYA 3FZ4A 2GZYA 2VL9A 3IA1A 4EUYA 4PNGA 4Z7XA 1TU8A 2YWMA 4BL7B 1FG4A 17GSA 4WF5A 3EWLA 1URMA 1XXUA 2CVBA 3L78A 1A2JA 1ST9A 3UMAA 2VCTA 3HDCA 5ECRB 22GSA 1U3IA 2GQLA 2XPEA 2XBQA 1XPVA 5CRWA 4YQUA 2IMIA 4YAVA 13GSA 3W8SA 4PUAA 1S3DA 3E0UA 5H5SA 5ELAA 1GSFA 1O8XA 4LA1A 2VD0A 4MJAA 4IGJA 4IELA 3HMJG 1ACVA 1BEDA 2V1MA 2HXKA 2H6YA 2ZUPA 4OFTA 3QAVA 2FY6A 3P7XA 3GRXA 1TRVA 3FZ5A 3GN3A 1ZYNA 2GS3A 4GSNA 1OC9B 3VFIA 3TU3B 3F8UA 4TN8A 3ZFLA 3GKKA 2HZEB 5KN2A 5CREA 3ZMKA 4LMWA 2AV4A 1EEJA 2LJKA 1ZYPA 3QOUA 1DE1A 3IC4A 3ME7A 3Q19A 3G9BA 1V57A 4HZ4A 5A5HB 3FKFA 4K2XA 1AQVA 2PVOC 2YJ7A 1XVWA 3U5RE 3GX8A 5HFGA 3A5WA 4PQIA 3KCMA 4JEDA 4EE0A 4TKYA 1WWJA 4YKGA 4HEA2 4CDOA 3O76A 1NSWA 1AW9A 3ZIJA 4HQSA 4XIHA 5LCZA 4ZB7A 1EOGA 1A23A 2RLIA 1KTEA 3WD6A 2O87A 2RUFA 3G7JA 2AUVA 6GSXA 1XIYA 5IOWA 2R37A 1N2AA 5EL8A 4K8MA 1FOVA 1PN9A 2VM1A 3H8QA 4HI7A 1A2MA 1U87A 1O7UA 2PBJA 1LBKA 5D9VA 1Q98A 5G2ZA 5LD0A 1Y6EA 1PA3A 1AXDA 2EFDA 1OYJA 4F0BA 1AUCA 3CRUA 3QCPA 3TKQA 4PQ1A 4KW6A 1YKAA 3F6FA 3UARA 3BJ5A 4KAEA 1FVKA 1ON4A 4JR4A 5CAXA 3ZREA 3RDWA 4FYCA 4HDEA 4WXTA 5KEJA 3GUSA 1EEMA 1EGRA 4JR6A 1FOHA 4FXYP 3QAGA 1GTUA 3PGTA 2KP1A 1SYXA 2QA2A 1Z5YE 5BRTA 5HQPA 4MPFA 1ZGNA 1TK8B 1M2AA 4K9ZA 5G1KA 2L6DA 4IN0A 2OBKA 3F63A 3GIXA 2RM5A 5KOWA 2WGRA 4RUVA 1BYEA 2IIYA 4DSQA 3CSHA 3MDKA 2N5AA 4L8EA 3IDVA 2C0GA 2L4CA 2R0GA 5IIZA 5CNWA 2X8GA 4JE1A 4IVFA 4KGIA 4N30A 5G31A 1RW1A 2AJQB 4XS6A 4OFMA 1SVOA 18GSA 1GLQA 3FK8A 3ZZXA 3LEFA 4LL4B 1M3JA 3IPZA 1NHOA 1UA5A 1B48A 4ZL9A 4QMKA 2YWNA 2A4VA 5DCHA 2GLRA 2XBIA 1V9WA 1YEXA 5D73A 4O7HA 2B1LA 4X0XA 2HI7A 2VAFA 1XWGA 4L5LA 2WZ9A 5J41A 4XS4A 2H66A 1ILOA 4OWYA 4POBA 2LRNA 2MBSA 5AGYA 4GTUA 4AF2A 4EDZA 14GSA 3A2VA 1F3AA 2FUG2 4K1FA 4MJCA 2XHFA 3HA9A 3D22A 4XRAA 5IMDA 3PINA 2K6VA 4IQ1A 2PVQA 2IMEA 3LYKA 2MMNA 2QC7A 2M80A 3DVWA 1XBSA 1Z3EA 3TOUA 3L0HA 1R5AA 3MNGA 1QGVA 1WMJA 3UVHA 4ZILA 1I5GA 1WOUA 3FR3A 1V40A 2EIOA 4N0VA 1VF1A 2K18A 4IP6A 2EFHA 2L6CA 1TDIA 5E59A 2NVLA 4YQMA 3VI5A 3RPNA 1JHBA 4GWRA 3TJKA 1M0UA 1B4QA 2LRCA 2X4AA 5J4YA 3MIXA 3GH6A 4POMA 4JZQA 4WF4A 1N25A 3KH9A 5JWQB 2F51A 2F9SA 3U6VA 4MF5A 4K5SA 2OBIA 2VLUA 2FWEA 1G7OA 1YF1A 3E9JB 2C0EA 1O81A 1PKWA 4TOPA 1TXXA 2FHEA 1PRXA 3AY8A 2LRTA 4GQCA 1X9MB 2BMXA 5DBQA 4MZCA 2GSTA 4D73A 1GTIA 2R2JA 3RGBC 4DVCA 2LTKA 1FVJA 3IBHA 2XC2A 5HR3A 4JU5A 2C3TA 3FY7A 2LKUA 4F03A 4HS1A 5B7CA 3I69A 5EY6A 2WW3A 19GSA 1SVMA 4IQAA 3F3RA 3HVSA 4RQXA 3N9JA 3RBTA 1JZOA 4N0ZA 3EE2A 3F6DA 1T4YA 4P3YB 2IFQA 4K7IA 1TOFA 2RIIA 3P8WA 4HZ2A 3IHGA 1J0FA 2HRNA 2K8VA 3N5OA 2O5VA 4OD7A 2CX3A 5JWOB 2GZPA 1FHEA 3TJFA 4GF0A 1X9WB 1FW1A 3D5JA 2ES7A 2YZHA 3H1NA 3KGKA 2H01A 4K2DA 5GAND 3E3EA 4MA9A 1UC7A 2B7JA 1Z6MA 1T4ZA 1K0AA 3G7IA 3LJRA 2DMMA 1PGTA 3O3TA 1O85A 5IOXA 5ECNB 4PXOA 4QL9A 2VCWA 3VI7A 4NV2A 3IXRA 4XS4B 3JCML 2GTUA 3EU4A 3C71A 1H75A 1O73A
chains in the Genus database with same CATH topology
2CV4A 3M0FA 1U6TA 2PUKC 2FWGA 1CQGA 2ON5A 2QGVA 3TUEA 2L5LA 3TRQA 2REMA 2ZCTA 4OFNA 3ZTLA 1MTCA 3P2AA 4CHSA 2H71A 2FWFA 4G10A 2WFCA 2NTOA 3TRPA 2KUCA 3HJOA 3LQ7A 2FD3A 1MDIA 4TR4A 3EPTA 5ECIB 2I1UA 3FW2A 4EKZA 1BJXA 1R4WA 2LQQA 4CY8A 2C4JA 4J57E 4KF9A 3UBLA 1F2EA 1TK0B 3NIVA 4BPYA 3HVXA 4E8EA 2F8FA 2YPMA 5J5NA 3OR5A 1GH2A 4BVYA 1Z6NA 1SU9A 3TKRA 2GSRA 1SJIA 3F4SA 4YKFA 5ECSA 1FO5A 4ZBDA 2HYXA 2K8SA 4N11A 2VD1A 4LL1B 2MBTA 2HSNB 2NPBA 1XW9A 2JACA 2WDUA 1GWCA 2CQ9A 3HJMA 5H5QA 1M99A 2H74A 1JZRA 3LFLA 3KMNA 2E7PA 3S9FA 5J4VA 3IAM2 4IHUA 4D73B 5J47A 2HSMA 1TI3A 3HXSA 3ME8A 5DDLA 2GVPA 2DJ2A 1PQNA 2HRKA 5ECOB 3V1WA 2A4HA 5D8IA 2GQMA 3DWVA 4H86A 2IWTA 2C8UA 3P90A 2KOKA 2PGTA 1GUHA 1M2BA 1NM3A 1FB6A 2IPAA 2G2QA 3Q74A 1XOBA 4TR1A 1GLPA 1MEKA 5A1NA 2IFQB 2N5FA 3C1SA 4FO5A 2HRFA 1BG5A 1PN0A 2H0IA 3CYNA 5ID2A 3GL5A 1F37A 1ZOFA 4MPGA 3BBYA 4NWYA 4ID0A 1S3CA 1DSBA 3L9SA 4ECBA 5J9CA 2O7KA 2JZRA 3F4RA 4AI6A 2V32A 3NZNA 3ISOA 3D4MA 4IP1A 3GFKA 4G0LA 1RK4A 3I9V2 5ABRA 3M9KA 1ERTA 2VLTA 5DQYA 1GP1A 3EYTA 3TCOA 1SK0A 5IO2A 3APOA 3FR9A 1Z7RA 3HD5A 3VWVA 5C04A 4F0CA 2A2PA 2GSQA 3GURA 4Q5QA 2L57A 4KCEA 4WETA 1GL8A 1VF2A 1ZMAA 1YDKA 1Z7PA 1VF3A 4BA7A 2DJ1A 2B7KA 1MDJA 1YEPA 5F0GA 1THOA 1SJZA 3GTUA 4F2IA 3BCIA 2DKIA 3BD2A 3ZITA 1HD2A 2QA1A 3KEBA 3KMOA 2J9HA 2JL4A 2HT9A 1HYUA 2X8HA 4N3ZA 6GSUA 1OAZA 4XHMA 2FGXA 3LXTA 3I6AA 1HNBA 4G01A 4EVMA 1H4OA 3UJ1A 4I2TA 1YVLA 1GUMA 5AISA 3ERFA 3DKSA 1SKWB 3FYGA 2P5RA 3TRXA 4V2NA 1YF0A 1BX9A 2C1YA 4I6XA 2Z9SA 1EWXA 4AGSA 2MMAA 5LNKe 2JSYA 1I9DA 2IMKA 3KD0A 1XW5A 2FNOA 2YANA 1XW6A 4ECCA 3KIJA 1JLVA 4K7NA 5AN1A 12GSA 2LJRA 1AIUA 1Q4JA 4IS0A 1T1VA 4WBJA 2H19A 1U88A 3CSJA 1DE2A 3CBUA 1X9SB 4KSOA 1M9AA 2AHEA 4ML1A 4EDYA 2H72A 4HU7A 4TR0A 2PERA 4ECIA 4F9ZA 1S3AA 2GSSA 1W4VA 3WGEA 1O6JA 4MZWA 5KN3A 2NBSA 1AQXA 2AYTA 3LWAA 1PX7A 3MYDA 3GHAA 2H1DA 2UZ8A 3GX0A 1MD3A 1QQ2A 5H5RA 2VCZA 3WGXA 5E4WA 16GSA 2B5XA 2PN8A 4ZB8A 2FWHA 4TR1B 3DRNA 5A1NB 3TJJA 3IC8A 4PX1A 3NOFA 1XOAA 9GSSA 3VLNA 11GSA 1SK1A 2VIMA 3QAWA 2PU9C 4EIQA 4NXIA 4X43A 4MMMA 3UEMA 1M2DA 4IJ3A 1K3OA 5HR1A 4L0UA 3EMPA 20GSA 4NV5A 2CA8A 2N5BA 3DEXA 4ZL7A 2H1BA 5C00A 2V6KA 3CTFA 1PD21 3CRTA 5J3RA 2TRXA 2KP2A 7GSSA 4X1UA 3L9UA 4GRFA 2L59A 1LJRA 5D93A 4HUAA 5AIXA 3RHCA 1QFNA 5A34A 2WULA 2R6KA 3PPUA 5CO3A 3GSSA 3IR4A 4KDXA 2EIQA 3H93A 1CQHA 1WJKA 2OT3A 4IBPA 2WJUA 2OKAA 4AKXB 1X5DA 4K0NA 2R0CA 1EP8A 2O89A 1JZWA 1T7PB 2OE3A 4RQRA 3K8NA 4XS1A 1JZDA 1XWKA 5FWGA 4J56E 1VF4A 1YZXA 2VO4A 4N10A 4HQZA 4BVXA 3TJBA 2HQTA 2JZSA 5DJMA 2R5GA 3FR6A 4V2LA 4NMUA 4F82A 3W8JA 2WS2A 2HLSA 3HHVA 2VL2A 2HFDA 4DSSA 3FMWA 3KH7A 5IPGA 5CRGA 2F8AA 5AIVA 2OACA 3KM6A 3VWXA 3HJPA 4GQFA 4MJBA 5G30A 4E8HA 3EVIA 3J7Yb 4ULXA 3CWGA 3ZL5A 3TKSA 1AAZA 5BMUA 4CW9A 4JRRA 2DSAA 4MLYA 3QD9A 2FA4A 1K0BA 2H1GA 2WB9A 2G0FA 1MDKA 3HYPA 1ERVA 5D9TA 1JFUA 2NDOA 5ECKB 4EL1A 1AC1A 4KCAA 4LLRA 2H1LA 4TW5A 2QKEA 4WR5A 4BWSA 2LUSA 2V41A 1ERWA 4POKA 5DJLA 4NPBA 2VCQA 1YKCA 4PTSA 1XWCA 1PX6A 1Y25A 2TIRA 3LW9A 4AJ6A 3QPMA 4PURA 1GSDA 5J40A 2UV8G 3L4NA 1C72A 3QR6A 2RUEA 3WYWA 2YWIA 3D4TA 4NAXA 5KN0A 3M9JA 4USSA 1GTAA 4ZBBA 2YNXA 2LQOA 2PPTA 3HY2A 2I81A 2LEGA 1DBYA 2C0FA 3GNJA 5D96A 5ENUA 3TDGA 1E6BA 5JWRB 4V1Ap 1ZL9A 2CAIA 4OMVA 4AKGA 3L9VA 4WBRD 1XFLA 3QDNA 1XVQA 1GNWA 2VCVA 6GSTA 1RQMA 2E0QA 4MJEA 5EVOA 3H79A 5G5FA 3VK9A 5A4UA 2OJLA 5A34B 3M3MA 1YJ6A 4ZXGA 5IO0A 3GKMA 5FT3A 3EINA 10GSA 1KEBA 3PR8A 1SD8A 4ZBAA 2HE3A 4IJIA 1TXUA 4KH7A 3UAPA 4EC0A 2E2MA 3GKNA 4JBBA 4KB3A 5ECQB 2YV9A 5JCWA 1NW2A 3HKRA 4MF6A 1M7TA 2HZFA 4TXVA 8GSSA 3ZYWA 3KTBA 4ZIJA 4KDUA 4BVXB 3H4KA 4GSTA 2LNTA 4GLTA 1T00A 3EURA 4X4JA 2JSZA 3A5IA 2HRAA 2MZCA 2H1AA 4KA0A 3IHQA 2KLXA 3LSZA 4PUFC 1EGOA 4J2FA 4TRXA 3IK7A 3FHKA 3F0IA 2O8VB 2P5QA 4EO3A 3SWLA 3UIWA 4DSSB 5EPFA 4AJ8A 5F05A 3IOSA 2DC5A 4K0GA 5DVBA 2JZTA 4LMVA 1R7HA 3GV1A 1WRYA 1U3AA 5BMUB 1MD4A 3RHBA 1BF5A 1TRSA 3IE3A 3I43A 5IMZA 1K3LA 5GZZB 3Q6OA 4W66A 4FH8A 4WEYA 5HR0A 1F9MA 1SL1B 4K7OA 4XTSA 2IN3A 4V1Ag 5ELGA 4TVEA 1LU4A 1PSQA 6GSWA 4IW9A 1B9XC 3DIEA 1KNGA 1B4PA 3DXBA 2VM2A 4KX4A 2VUPA 5F8BA 2AAWA 1WE0A 3DVXA 3QMXA 1FAAA 3UL3A 2L4QA 3ZRDA 4MP4A 3G7YA 1OKDA 2RM6A 1OKTA 1GSEA 3VPQA 5B6MA 2GZZA 4Z2TA 1XWAA 3F3QA 3IRAA 3TB2A 2MMZA 1V98A 2X49A 1TTZA 2TRCP 5CRHA 2H73A 2XPDA 1K0OA 1Z9HA 4O32A 3UBKA 1BQ7A 1WIKA 4Z2RA 3ZVJA 4K6XA 2ON7A 3R2QA 2LV3A 2YWOA 1VRSD 2IL3A 2D2ZA 4G9HA 3ZMLA 3IK9A 1XZOA 5JCUA 4L0WA 1G6YA 3CSIA 2CZ2A 3HCZA 2WCIA 1UN2A 1G6WA 3IV4A 3LORA 1TK5B 3D6IA 2OE0A 4GCIA 2B1KA 2P31A 1USBA 4Z2UA 3RAZA 4O5UA 1ERUA 2ZNMA 2YCDA 2JADA 2JU5A 2DLXA 2O85A 1QUWA 2LNSA 4ZB9A 2CVKA 3GH9A 4G0IA 4O92A 1THXA 4KUNA 2CT6A 3ZFBA 4FYUA 3M1GA 3FEUA 1TU7A 4MH3A 5IMAA 4OO5A 3TGZA 3VWWA 4I8BA 4MDCA 1SVLA 3EU3A 4RI6A 3UOMA 1EOHA 3LXZA 1JLWA 2VLVA 4WKWA 1SENA 3VPTA 1PL2A 2F3MA 1GTBA 3ERGA 3HVVA 1OE8A 2PMTA 2GGTA 3ZVJD 3GKXA 1F3BA 2DIZA 3APSA 4MZBA 2GDRA 3O6TA 3KJYA 5HFIA 4BVYB 2E2GA 4ML6A 4GSSA 5B8BA 2KHPA 2AB6A 1N8JA 5CRDA 3APQA 2C3NA 3DD3A 4FYBA 5F06A 3BOAA 1SKSB 4PQHA 1EZKA 1HNCA 1TKDB 1A0FA 1ZYEA 2H6XA 2QSIA 3KP8A 3LG6A 3W6GA 2LSTA 2R4VA 1QMVA 3SBCA 3KXOA 5A4VA 2HSMB 4EIPA 1SD9A 4XCSA 5A5KA 4I2UA 4O5RA 2HRKB 2DJ3A 1WPIA 3DGQA 2EIRA 4POLA 5J9BA 2H75A 2GT6A 1GSQA 6GSSA 2J23A 1HNAA 4KSMA 2A2RA 2BJXA 3WGDA 1XWBA 1X0RA 5IM9A 1UVZA 3ERWA 5IMCA 2CVDA 6GSYA 5DALA 1YY7A 4ZL8A 2DJ0A 1HQOA 5ID2B 3MSZA 2DKHA 2H30A 1K0DA 2VL2C 5JCGA 4KE3A 3TKPA 3GMFA 4XRDA 4L5OA 5DCGA 2VOCA 4AKHA 4FIWA 3IAS2 1T3BA 2HSHA 2FLSA 3UVTA 1SKRB 4YQVA 3KZQA 1ZYQB 1R26A 5GSSA 1ML6A 2H0GA 3TKSE 4ILFA 4HOJA 4RI7A 3Q18A 4BWQA 1A0RP 5D9WA 5KOXA 1OE7A 3US3A 4MK3A 2HNLA 4ZB6A 1QXHA 5DAKA 2EFCA 3TKSC 1X5CA 2X8CA 3HZ4A 2H8LA 1WP0A 3LGCA 4IKHA 4MCUA 1PKZA 1ZCPA 1X5EA 3TOTA 2CAQA 2WRTA 5A4WA 1BAYA 3WT1A 4CY6A 1B9YC 4G0KA 4TXOA 3C7MA 4DSRA 1AQWA 4DEJA 4KNDA 2YN1A 2YZUA 1K3YA 1ABAA 1GSUA 1G7EA 2DJKA 3GTUB 4ACSA 5F07A 4MH2A 2YV7A 1J08A 1TRUA 4O5QA 4Q5RA 4E68A 1A8YA 2H0HA 1E2YA 2OE1A 3QFAC 1T8EB 3GL3A 3GA4A 4EXJA 2IMFA 1M9BA 1OVNA 4ICYA 2R0PA 3TJGA 2YP6A 1F6MC 5HR2A 2B3SA 4GXZA 3WT2A 3QFBC 1GNEA 3A2WA 1A8LA 4PGTA 3FRCA 4MF7A 1GSYA 4OO4A 2EC4A 3DMLA 1EV4A 4OCEA 5COHA 1QK8A 2HSNA 4ECJA 1K0MA 1DUGA 2ALBA 4Q5FA 1W89A 2VL3A 5ECLB 4YAPA 4BL7A 5IQYA 5DQSA 5J4UA 1A2LA 3ED3A 5L71A 2L5OA 2MMOA 3VURA 2FCHA 2C0DA 4GDFA 1R5PA 1TI1A 3KP9A 3EC3A 4PNFA 1KBNA 2B5YA 2GT5A 4QQ7A 5G1LA 4I97A 1GSSA 2K9FA 5INYA 1OC8A 3F4TA 1SL0B 4HJ2A 3A3TA 3LYPA 1TW9A 3RPPA 1SL2B 6GSVA 3CTGA 1VGLA 2IJYA 2CX4A 5D9XA 5DALB 4AKIA 5GAPD 2X64A 5CYYA 4ISDA 5CP1A 3VWUA 1TP9A 2LJAA 2A2SA 3KTLA 2DBCA 3GSTA 2DIYA 5GSTA 4V2MA 1OC9A 2M46A 1OC3A 4NHWA 1GUKA 1O8WA 2DMLA 2HZEA 5ECMB 4G2EA 1K0CA 2IMDA 4HJMA 2EFEA 3C8EA 5IMVA 3DYRA 5ECPB 5DAKB 5ECHB 5B6NA 4YH2A 1GULA 4NHZA 4TR3A 1IYHA 5FHIA 2I3YA 1Y1UA 3J7Yk 5B8AA 1YQ1A 4K5RA 1A24A 1PMTA 5A5HA 1K0NA 1B8XA 2H76A 4FQUA 2YJHA 1BG1A 4Q5NA 3C1RA 3PH9A 4TXOB 1EV9A 5IPHA 1FB0A 2B5EA 1G0TA 1V2AA 2C80A 3EMXA 3D21A 4KDYA 4I5QA 2H6ZA 2V2GA 1IYIA 2X99A 4OCFA 3CMIA 2VCXA 1J9BA 1PL1A 3M8NA 3MWHA 2OADA 1GRXA 2DJJA 2I4AA 3CXGA 4EF0A 3C73A 4G19A 2LS5A 5G5EA 4MNNA 2V6OA 1SJ6A 3ZIVA 5HFKA 1EP7A 2M72A 2MYGA 2CZ3A 3HZ8A 2OA7A 2YOIA 2GQKA 2VKZG 3FZAA 3D0ZA 1SK2A 3FZ9A 2PWJA 5KN1A 2R3XA 2H70A 3R3EA 3MAKA 1TRWA 4WR4A 3BCKA 2I9HA 3GYKA 1NHYA 5IMFA 3ZLPA 2HSYA 2BTOT 1SYRA 1TJDA 2P0GA 4QL7A 3F9UA 4MABA 1XCCA 4A5PA 1V58A 4AJ7A 4HU9A 2FA8A 3A2XA 2C3QA 2B6MA 1ZZYA 3FZ4A 2GZYA 2VL9A 3IA1A 4EUYA 4PNGA 4Z7XA 1TU8A 2YWMA 4BL7B 1FG4A 17GSA 4WF5A 3EWLA 1URMA 1XXUA 2CVBA 3L78A 1A2JA 1ST9A 3UMAA 2VCTA 3HDCA 5ECRB 22GSA 1U3IA 2GQLA 2XPEA 2XBQA 1XPVA 5CRWA 4YQUA 2IMIA 4YAVA 13GSA 3W8SA 4PUAA 1S3DA 3E0UA 5H5SA 5ELAA 1GSFA 1O8XA 4LA1A 2VD0A 4MJAA 4IGJA 4IELA 3HMJG 1ACVA 1BEDA 2V1MA 2HXKA 2H6YA 2ZUPA 4OFTA 3QAVA 2FY6A 3P7XA 3GRXA 1TRVA 3FZ5A 3GN3A 1ZYNA 2GS3A 4GSNA 1OC9B 3VFIA 3TU3B 3F8UA 4TN8A 3ZFLA 3GKKA 2HZEB 5KN2A 5CREA 3ZMKA 4LMWA 2AV4A 1EEJA 2LJKA 1ZYPA 3QOUA 1DE1A 3IC4A 3ME7A 3Q19A 3G9BA 1V57A 4HZ4A 5A5HB 3FKFA 4K2XA 1AQVA 2PVOC 2YJ7A 1XVWA 3U5RE 3GX8A 5HFGA 3A5WA 4PQIA 3KCMA 4JEDA 4EE0A 4TKYA 1WWJA 4YKGA 4HEA2 4CDOA 3O76A 1NSWA 1AW9A 3ZIJA 4HQSA 4XIHA 5LCZA 4ZB7A 1EOGA 1A23A 2RLIA 1KTEA 3WD6A 2O87A 2RUFA 3G7JA 2AUVA 6GSXA 1XIYA 5IOWA 2R37A 1N2AA 5EL8A 4K8MA 1FOVA 1PN9A 2VM1A 3H8QA 4HI7A 1A2MA 1U87A 1O7UA 2PBJA 1LBKA 5D9VA 1Q98A 5G2ZA 5LD0A 1Y6EA 1PA3A 1AXDA 2EFDA 1OYJA 4F0BA 1AUCA 3CRUA 3QCPA 3TKQA 4PQ1A 4KW6A 1YKAA 3F6FA 3UARA 3BJ5A 4KAEA 1FVKA 1ON4A 4JR4A 5CAXA 3ZREA 3RDWA 4FYCA 4HDEA 4WXTA 5KEJA 3GUSA 1EEMA 1EGRA 4JR6A 1FOHA 3QAGA 1GTUA 3PGTA 2KP1A 1SYXA 2QA2A 1Z5YE 5BRTA 5HQPA 4MPFA 1ZGNA 1TK8B 1M2AA 4K9ZA 5G1KA 2L6DA 4IN0A 2OBKA 3F63A 3GIXA 2RM5A 5KOWA 2WGRA 4RUVA 1BYEA 2IIYA 4DSQA 3CSHA 3MDKA 2N5AA 4L8EA 3IDVA 2C0GA 2L4CA 2R0GA 5IIZA 5CNWA 2X8GA 4JE1A 4IVFA 4KGIA 4N30A 5G31A 1RW1A 2AJQB 4XS6A 4OFMA 1SVOA 18GSA 1GLQA 3FK8A 3ZZXA 3LEFA 4LL4B 3IPZA 1NHOA 1UA5A 1B48A 4ZL9A 4QMKA 2YWNA 2A4VA 5DCHA 2GLRA 2XBIA 1V9WA 1YEXA 5D73A 4O7HA 2B1LA 4X0XA 2HI7A 2VAFA 1XWGA 4L5LA 2WZ9A 5J41A 4XS4A 2H66A 1ILOA 4OWYA 4POBA 2LRNA 2MBSA 5AGYA 4GTUA 4AF2A 4EDZA 14GSA 3A2VA 1F3AA 2FUG2 4K1FA 4MJCA 2XHFA 3HA9A 3D22A 4XRAA 5IMDA 3PINA 2K6VA 4IQ1A 2PVQA 2IMEA 3LYKA 2MMNA 2QC7A 2M80A 3DVWA 1XBSA 1Z3EA 3TOUA 3L0HA 1R5AA 3MNGA 1QGVA 1WMJA 3UVHA 4ZILA 1I5GA 1WOUA 3FR3A 1V40A 2EIOA 4N0VA 1VF1A 2K18A 4IP6A 2EFHA 2L6CA 1TDIA 5E59A 2NVLA 4YQMA 3VI5A 3RPNA 1JHBA 4GWRA 3TJKA 1M0UA 1B4QA 2LRCA 2X4AA 5J4YA 3MIXA 3GH6A 4POMA 4JZQA 4WF4A 1N25A 3KH9A 5JWQB 2F51A 2F9SA 3U6VA 4MF5A 4K5SA 2OBIA 2VLUA 2FWEA 1G7OA 1YF1A 3E9JB 2C0EA 1O81A 1PKWA 4TOPA 1TXXA 2FHEA 1PRXA 3AY8A 2LRTA 4GQCA 1X9MB 2BMXA 5DBQA 4MZCA 2GSTA 4D73A 1GTIA 2R2JA 4DVCA 2LTKA 1FVJA 3IBHA 2XC2A 5HR3A 4JU5A 2C3TA 3FY7A 2LKUA 4F03A 4HS1A 5B7CA 3I69A 5EY6A 19GSA 1SVMA 4IQAA 3F3RA 3HVSA 4RQXA 3N9JA 3RBTA 1JZOA 4N0ZA 3EE2A 3F6DA 1T4YA 4P3YB 2IFQA 4K7IA 1TOFA 2RIIA 3P8WA 4HZ2A 3IHGA 1J0FA 2HRNA 2K8VA 3N5OA 2O5VA 4OD7A 2CX3A 5JWOB 2GZPA 1FHEA 3TJFA 4GF0A 1X9WB 1FW1A 3D5JA 2ES7A 2YZHA 3H1NA 3KGKA 2H01A 4K2DA 5GAND 3E3EA 4MA9A 1UC7A 2B7JA 1Z6MA 1T4ZA 1K0AA 3G7IA 3LJRA 2DMMA 1PGTA 3O3TA 1O85A 5IOXA 5ECNB 4PXOA 4QL9A 2VCWA 3VI7A 4NV2A 3IXRA 4XS4B 3JCML 2GTUA 3EU4A 3C71A 1H75A 1O73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV4 A;  3M0F A;  1U6T A;  2PUK C;  2FWG A;  1CQG A;  2ON5 A;  2QGV A;  3TUE A;  2L5L A;  3TRQ A;  2REM A;  2ZCT A;  4OFN A;  3ZTL A;  1MTC A;  3P2A A;  4CHS A;  2H71 A;  2FWF A;  4G10 A;  2WFC A;  2NTO A;  3TRP A;  2KUC A;  3HJO A;  3LQ7 A;  2FD3 A;  1MDI A;  4TR4 A;  5ECI B;  2I1U A;  3FW2 A;  4EKZ A;  1BJX A;  1R4W A;  2LQQ A;  2C4J A;  4J57 E;  4KF9 A;  3UBL A;  1F2E A;  1TK0 B;  3NIV A;  4BPY A;  3HVX A;  4E8E A;  2F8F A;  2YPM A;  5J5N A;  3OR5 A;  1GH2 A;  4BVY A;  1Z6N A;  1SU9 A;  3TKR A;  2GSR A;  1SJI A;  3F4S A;  5ECS A;  1FO5 A;  4ZBD A;  2HYX A;  2K8S A;  4N11 A;  2VD1 A;  4LL1 B;  2MBT A;  2HSN B;  2NPB A;  1XW9 A;  2JAC A;  2WDU A;  1GWC A;  2CQ9 A;  3HJM A;  5H5Q A;  1M99 A;  2H74 A;  1JZR A;  3LFL A;  3KMN A;  2E7P A;  3S9F A;  3IAM 2;  4IHU A;  4D73 B;  2HSM A;  1TI3 A;  3HXS A;  3ME8 A;  5DDL A;  2GVP A;  2DJ2 A;  1PQN A;  2HRK A;  5ECO B;  3V1W A;  5D8I A;  2GQM A;  3DWV A;  4H86 A;  2IWT A;  2C8U A;  3P90 A;  2KOK A;  2PGT A;  1GUH A;  1M2B A;  1NM3 A;  1FB6 A;  2IPA A;  2G2Q A;  3Q74 A;  1XOB A;  4TR1 A;  1GLP A;  1MEK A;  2IFQ B;  2N5F A;  3C1S A;  4FO5 A;  2HRF A;  1BG5 A;  2H0I A;  3CYN A;  5ID2 A;  3GL5 A;  1F37 A;  1ZOF A;  4MPG A;  3BBY A;  4NWY A;  4ID0 A;  1S3C A;  1DSB A;  3L9S A;  4ECB A;  5J9C A;  2O7K A;  2JZR A;  3F4R A;  2V32 A;  3NZN A;  3ISO A;  3D4M A;  4IP1 A;  3GFK A;  4G0L A;  1RK4 A;  3I9V 2;  5ABR A;  3M9K A;  1ERT A;  2VLT A;  5DQY A;  1GP1 A;  3EYT A;  3TCO A;  1SK0 A;  5IO2 A;  3APO A;  3FR9 A;  1Z7R A;  3HD5 A;  3VWV A;  5C04 A;  4F0C A;  2GSQ A;  3GUR A;  4Q5Q A;  2L57 A;  4KCE A;  4WET A;  1GL8 A;  1VF2 A;  1ZMA A;  1YDK A;  1Z7P A;  1VF3 A;  4BA7 A;  2DJ1 A;  2B7K A;  1MDJ A;  1YEP A;  5F0G A;  1THO A;  1SJZ A;  3GTU A;  4F2I A;  3BCI A;  3BD2 A;  3ZIT A;  1HD2 A;  3KEB A;  3KMO A;  2J9H A;  2JL4 A;  2HT9 A;  1HYU A;  2X8H A;  6GSU A;  1OAZ A;  4XHM A;  2FGX A;  3LXT A;  3I6A A;  1HNB A;  4EVM A;  1H4O A;  3UJ1 A;  4I2T A;  5AIS A;  1GUM A;  3ERF A;  3DKS A;  1SKW B;  3FYG A;  2P5R A;  3TRX A;  4V2N A;  1YF0 A;  1BX9 A;  2C1Y A;  4I6X A;  2Z9S A;  1EWX A;  4AGS A;  2MMA A;  5LNK e;  2JSY A;  1I9D A;  2IMK A;  3KD0 A;  1XW5 A;  2FNO A;  2YAN A;  1XW6 A;  4ECC A;  3KIJ A;  1JLV A;  4K7N A;  5AN1 A;  12GS A;  2LJR A;  1AIU A;  1Q4J A;  4IS0 A;  1T1V A;  4WBJ A;  2H19 A;  1U88 A;  3CSJ A;  1DE2 A;  3CBU A;  1X9S B;  4KSO A;  1M9A A;  2AHE A;  4ML1 A;  4EDY A;  2H72 A;  4HU7 A;  4TR0 A;  2PER A;  4ECI A;  4F9Z A;  1S3A A;  2GSS A;  1W4V A;  3WGE A;  1O6J A;  4MZW A;  5KN3 A;  2NBS A;  1AQX A;  2AYT A;  3LWA A;  1PX7 A;  3GHA A;  2H1D A;  2UZ8 A;  3GX0 A;  1MD3 A;  1QQ2 A;  5H5R A;  2VCZ A;  3WGX A;  5E4W A;  16GS A;  2B5X A;  2PN8 A;  4ZB8 A;  2FWH A;  4TR1 B;  3DRN A;  3TJJ A;  3IC8 A;  4PX1 A;  3NOF A;  1XOA A;  9GSS A;  3VLN A;  11GS A;  1SK1 A;  2VIM A;  3QAW A;  2PU9 C;  4NXI A;  4X43 A;  4MMM A;  3UEM A;  1M2D A;  4IJ3 A;  1K3O A;  5HR1 A;  4L0U A;  3EMP A;  20GS A;  4NV5 A;  2CA8 A;  2N5B A;  3DEX A;  4ZL7 A;  2H1B A;  5C00 A;  2V6K A;  3CTF A;  1PD2 1;  3CRT A;  5J3R A;  2TRX A;  2KP2 A;  7GSS A;  4X1U A;  3L9U A;  4GRF A;  2L59 A;  1LJR A;  5D93 A;  4HUA A;  5AIX A;  3RHC A;  1QFN A;  2WUL A;  2R6K A;  3PPU A;  5CO3 A;  3GSS A;  3IR4 A;  4KDX A;  2EIQ A;  3H93 A;  1CQH A;  1WJK A;  4IBP A;  2WJU A;  2OKA A;  1X5D A;  4K0N A;  1EP8 A;  2O89 A;  1JZW A;  1T7P B;  2OE3 A;  4RQR A;  3K8N A;  4XS1 A;  1JZD A;  1XWK A;  5FWG A;  4J56 E;  1VF4 A;  1YZX A;  2VO4 A;  4N10 A;  4HQZ A;  4BVX A;  3TJB A;  2HQT A;  2JZS A;  5DJM A;  2R5G A;  3FR6 A;  4V2L A;  4NMU A;  4F82 A;  3W8J A;  2WS2 A;  2HLS A;  3HHV A;  2VL2 A;  2HFD A;  4DSS A;  3KH7 A;  5IPG A;  5CRG A;  2F8A A;  5AIV A;  2OAC A;  3KM6 A;  3VWX A;  3HJP A;  4GQF A;  4MJB A;  5G30 A;  4E8H A;  3EVI A;  3J7Y b;  4ULX A;  3ZL5 A;  3TKS A;  1AAZ A;  5BMU A;  4CW9 A;  4JRR A;  2DSA A;  4MLY A;  3QD9 A;  2FA4 A;  1K0B A;  2H1G A;  2WB9 A;  2G0F A;  1MDK A;  3HYP A;  1ERV A;  5D9T A;  1JFU A;  2NDO A;  5ECK B;  4EL1 A;  1AC1 A;  4KCA A;  4LLR A;  4TW5 A;  2QKE A;  4WR5 A;  4BWS A;  2LUS A;  2V41 A;  1ERW A;  4POK A;  5DJL A;  4NPB A;  2VCQ A;  1YKC A;  4PTS A;  1XWC A;  1PX6 A;  1Y25 A;  2TIR A;  4AJ6 A;  3QPM A;  4PUR A;  1GSD A;  3L4N A;  1C72 A;  3QR6 A;  2RUE A;  3WYW A;  2YWI A;  3D4T A;  4NAX A;  5KN0 A;  3M9J A;  4USS A;  1GTA A;  4ZBB A;  2YNX A;  2LQO A;  2PPT A;  3HY2 A;  2I81 A;  2LEG A;  1DBY A;  2C0F A;  3GNJ A;  5D96 A;  5ENU A;  3TDG A;  1E6B A;  5JWR B;  4V1A p;  1ZL9 A;  2CAI A;  4OMV A;  3L9V A;  4WBR D;  1XFL A;  3QDN A;  1XVQ A;  1GNW A;  2VCV A;  6GST A;  1RQM A;  2E0Q A;  4MJE A;  5EVO A;  3H79 A;  5G5F A;  3VK9 A;  5A4U A;  2OJL A;  3M3M A;  1YJ6 A;  4ZXG A;  5IO0 A;  3GKM A;  5FT3 A;  3EIN A;  10GS A;  1KEB A;  3PR8 A;  1SD8 A;  4ZBA A;  2HE3 A;  4IJI A;  4KH7 A;  3UAP A;  4EC0 A;  2E2M A;  3GKN A;  4JBB A;  4KB3 A;  5ECQ B;  2YV9 A;  5JCW A;  1NW2 A;  3HKR A;  4MF6 A;  1M7T A;  2HZF A;  4TXV A;  8GSS A;  3ZYW A;  3KTB A;  4ZIJ A;  4KDU A;  4BVX B;  3H4K A;  4GST A;  2LNT A;  4GLT A;  1T00 A;  3EUR A;  2JSZ A;  2HRA A;  2MZC A;  2H1A A;  4KA0 A;  3IHQ A;  2KLX A;  3LSZ A;  4PUF C;  1EGO A;  4J2F A;  4TRX A;  3IK7 A;  3FHK A;  3F0I A;  2O8V B;  2P5Q A;  4EO3 A;  3SWL A;  3UIW A;  4DSS B;  5EPF A;  4AJ8 A;  5F05 A;  3IOS A;  2DC5 A;  4K0G A;  5DVB A;  2JZT A;  4LMV A;  1R7H A;  3GV1 A;  1WRY A;  1U3A A;  1MD4 A;  3RHB A;  1TRS A;  3IE3 A;  3I43 A;  5IMZ A;  1K3L A;  5GZZ B;  3Q6O A;  4FH8 A;  4WEY A;  5HR0 A;  1F9M A;  1SL1 B;  4K7O A;  4XTS A;  2IN3 A;  4V1A g;  5ELG A;  4TVE A;  1LU4 A;  1PSQ A;  6GSW A;  4IW9 A;  1B9X C;  3DIE A;  1KNG A;  1B4P A;  3DXB A;  2VM2 A;  4KX4 A;  2VUP A;  5F8B A;  2AAW A;  1WE0 A;  3DVX A;  3QMX A;  1FAA A;  3UL3 A;  2L4Q A;  3ZRD A;  4MP4 A;  3G7Y A;  1OKD A;  2RM6 A;  1OKT A;  1GSE A;  3VPQ A;  5B6M A;  2GZZ A;  1XWA A;  3F3Q A;  3IRA A;  3TB2 A;  2MMZ A;  1V98 A;  1TTZ A;  2TRC P;  5CRH A;  2H73 A;  2XPD A;  1K0O A;  1Z9H A;  4O32 A;  3UBK A;  1BQ7 A;  1WIK A;  3ZVJ A;  4K6X A;  2ON7 A;  3R2Q A;  2LV3 A;  2YWO A;  1VRS D;  2IL3 A;  2D2Z A;  4G9H A;  3ZML A;  3IK9 A;  1XZO A;  5JCU A;  4L0W A;  1G6Y A;  3CSI A;  2CZ2 A;  3HCZ A;  2WCI A;  1UN2 A;  1G6W A;  3IV4 A;  3LOR A;  1TK5 B;  3D6I A;  2OE0 A;  4GCI A;  2B1K A;  2P31 A;  1USB A;  3RAZ A;  1ERU A;  2ZNM A;  2YCD A;  2JAD A;  2JU5 A;  2DLX A;  2O85 A;  1QUW A;  2LNS A;  4ZB9 A;  2CVK A;  3GH9 A;  4G0I A;  4O92 A;  1THX A;  4KUN A;  2CT6 A;  3ZFB A;  4FYU A;  3M1G A;  3FEU A;  1TU7 A;  4MH3 A;  5IMA A;  4OO5 A;  3TGZ A;  3VWW A;  4I8B A;  4MDC A;  3EU3 A;  4RI6 A;  3UOM A;  1EOH A;  3LXZ A;  1JLW A;  2VLV A;  4WKW A;  1SEN A;  3VPT A;  1PL2 A;  2F3M A;  1GTB A;  3ERG A;  3HVV A;  1OE8 A;  2PMT A;  2GGT A;  3ZVJ D;  3GKX A;  1F3B A;  2DIZ A;  3APS A;  4MZB A;  2GDR A;  3O6T A;  3KJY A;  5HFI A;  4BVY B;  2E2G A;  4ML6 A;  4GSS A;  5B8B A;  2KHP A;  2AB6 A;  1N8J A;  5CRD A;  3APQ A;  2C3N A;  3DD3 A;  4FYB A;  5F06 A;  3BOA A;  1SKS B;  4PQH A;  1EZK A;  1HNC A;  1TKD B;  1A0F A;  1ZYE A;  2H6X A;  2QSI A;  3KP8 A;  3LG6 A;  3W6G A;  2LST A;  2R4V A;  1QMV A;  3SBC A;  3KXO A;  5A4V A;  2HSM B;  1SD9 A;  4XCS A;  5A5K A;  4I2U A;  4O5R A;  2HRK B;  2DJ3 A;  1WPI A;  3DGQ A;  2EIR A;  4POL A;  5J9B A;  2H75 A;  2GT6 A;  1GSQ A;  6GSS A;  2J23 A;  1HNA A;  4KSM A;  2A2R A;  2BJX A;  3WGD A;  1XWB A;  1X0R A;  5IM9 A;  1UVZ A;  3ERW A;  5IMC A;  2CVD A;  6GSY A;  5DAL A;  1YY7 A;  4ZL8 A;  2DJ0 A;  1HQO A;  5ID2 B;  3MSZ A;  5JCG A;  2H30 A;  1K0D A;  2VL2 C;  4KE3 A;  3TKP A;  3GMF A;  4XRD A;  4L5O A;  5DCG A;  2VOC A;  4FIW A;  3IAS 2;  1T3B A;  2HSH A;  2FLS A;  3UVT A;  1SKR B;  4YQV A;  3KZQ A;  1ZYQ B;  1R26 A;  5GSS A;  1ML6 A;  2H0G A;  3TKS E;  4ILF A;  4HOJ A;  4RI7 A;  3Q18 A;  4BWQ A;  1A0R P;  5D9W A;  1OE7 A;  3US3 A;  4MK3 A;  2HNL A;  4ZB6 A;  1QXH A;  5DAK A;  3TKS C;  1X5C A;  2X8C A;  3HZ4 A;  2H8L A;  1WP0 A;  3LGC A;  4IKH A;  4MCU A;  1PKZ A;  1ZCP A;  1X5E A;  3TOT A;  2CAQ A;  2WRT A;  5A4W A;  1BAY A;  3WT1 A;  1B9Y C;  4G0K A;  4TXO A;  3C7M A;  4DSR A;  1AQW A;  4DEJ A;  4KND A;  2YN1 A;  2YZU A;  1K3Y A;  1ABA A;  1GSU A;  1G7E A;  2DJK A;  3GTU B;  4ACS A;  5F07 A;  4MH2 A;  2YV7 A;  1J08 A;  1TRU A;  4Q5R A;  1A8Y A;  2H0H A;  1E2Y A;  2OE1 A;  3QFA C;  1T8E B;  3GL3 A;  3GA4 A;  4EXJ A;  2IMF A;  1M9B A;  1OVN A;  3TJG A;  2YP6 A;  1F6M C;  5HR2 A;  2B3S A;  4GXZ A;  3WT2 A;  3QFB C;  1GNE A;  3A2W A;  1A8L A;  4PGT A;  3FRC A;  4MF7 A;  1GSY A;  4OO4 A;  2EC4 A;  3DML A;  1EV4 A;  4OCE A;  5COH A;  1QK8 A;  4ECJ A;  1K0M A;  1DUG A;  2ALB A;  4Q5F A;  1W89 A;  2VL3 A;  5ECL B;  4YAP A;  4BL7 A;  5IQY A;  5DQS A;  5J4U A;  1A2L A;  3ED3 A;  5L71 A;  2L5O A;  2MMO A;  3VUR A;  2FCH A;  2C0D A;  1R5P A;  1TI1 A;  3KP9 A;  3EC3 A;  4PNF A;  1KBN A;  2B5Y A;  2GT5 A;  4QQ7 A;  5G1L A;  4I97 A;  1GSS A;  2K9F A;  5INY A;  1OC8 A;  3F4T A;  1SL0 B;  4HJ2 A;  3A3T A;  3LYP A;  1TW9 A;  3RPP A;  1SL2 B;  6GSV A;  3CTG A;  1VGL A;  2IJY A;  2CX4 A;  5D9X A;  5DAL B;  5GAP D;  2X64 A;  5CYY A;  4ISD A;  5CP1 A;  3VWU A;  1TP9 A;  2LJA A;  2A2S A;  3KTL A;  2DBC A;  3GST A;  2DIY A;  5GST A;  4V2M A;  1OC9 A;  2M46 A;  1OC3 A;  4NHW A;  1GUK A;  1O8W A;  2DML A;  2HZE A;  5ECM B;  4G2E A;  1K0C A;  2IMD A;  4HJM A;  3C8E A;  5IMV A;  3DYR A;  5ECP B;  5DAK B;  5ECH B;  5B6N A;  4YH2 A;  1GUL A;  4NHZ A;  4TR3 A;  1IYH A;  5FHI A;  2I3Y A;  3J7Y k;  5B8A A;  1YQ1 A;  1A24 A;  1PMT A;  1K0N A;  1B8X A;  2H76 A;  4FQU A;  2YJH A;  4Q5N A;  3C1R A;  3PH9 A;  4TXO B;  1EV9 A;  5IPH A;  1FB0 A;  2B5E A;  1G0T A;  1V2A A;  2C80 A;  3EMX A;  3D21 A;  4KDY A;  4I5Q A;  2H6Z A;  2V2G A;  1IYI A;  2X99 A;  4OCF A;  3CMI A;  2VCX A;  1J9B A;  1PL1 A;  3M8N A;  3MWH A;  2OAD A;  1GRX A;  2DJJ A;  2I4A A;  3CXG A;  4EF0 A;  3C73 A;  4G19 A;  2LS5 A;  5G5E A;  2V6O A;  1SJ6 A;  3ZIV A;  5HFK A;  1EP7 A;  2M72 A;  2MYG A;  2CZ3 A;  3HZ8 A;  2OA7 A;  2YOI A;  2GQK A;  3FZA A;  3D0Z A;  1SK2 A;  3FZ9 A;  2PWJ A;  5KN1 A;  2R3X A;  2H70 A;  3R3E A;  3MAK A;  1TRW A;  4WR4 A;  3BCK A;  2I9H A;  3GYK A;  1NHY A;  5IMF A;  3ZLP A;  2HSY A;  2BTO T;  1SYR A;  1TJD A;  2P0G A;  4QL7 A;  3F9U A;  4MAB A;  1XCC A;  1V58 A;  4AJ7 A;  4HU9 A;  2FA8 A;  3A2X A;  2C3Q A;  2B6M A;  1ZZY A;  3FZ4 A;  2GZY A;  2VL9 A;  3IA1 A;  4EUY A;  4PNG A;  4Z7X A;  1TU8 A;  2YWM A;  4BL7 B;  1FG4 A;  17GS A;  4WF5 A;  3EWL A;  1URM A;  1XXU A;  2CVB A;  3L78 A;  1A2J A;  1ST9 A;  3UMA A;  2VCT A;  3HDC A;  5ECR B;  22GS A;  1U3I A;  2GQL A;  2XPE A;  2XBQ A;  1XPV A;  5CRW A;  4YQU A;  2IMI A;  4YAV A;  13GS A;  3W8S A;  4PUA A;  1S3D A;  3E0U A;  5H5S A;  5ELA A;  1GSF A;  1O8X A;  4LA1 A;  2VD0 A;  4MJA A;  4IGJ A;  4IEL A;  1ACV A;  1BED A;  2V1M A;  2HXK A;  2H6Y A;  2ZUP A;  4OFT A;  3QAV A;  2FY6 A;  3P7X A;  3GRX A;  1TRV A;  3FZ5 A;  3GN3 A;  2GS3 A;  4GSN A;  1OC9 B;  3VFI A;  3F8U A;  4TN8 A;  3ZFL A;  3GKK A;  2HZE B;  5KN2 A;  5CRE A;  3ZMK A;  4LMW A;  2AV4 A;  1EEJ A;  2LJK A;  3QOU A;  1DE1 A;  3IC4 A;  3ME7 A;  3Q19 A;  3G9B A;  1V57 A;  4HZ4 A;  3FKF A;  1AQV A;  2PVO C;  2YJ7 A;  1XVW A;  3U5R E;  3GX8 A;  5HFG A;  3A5W A;  4PQI A;  3KCM A;  4JED A;  4EE0 A;  4TKY A;  1WWJ A;  4HEA 2;  4CDO A;  3O76 A;  1NSW A;  1AW9 A;  3ZIJ A;  4HQS A;  4XIH A;  5LCZ A;  1EOG A;  1A23 A;  2RLI A;  1KTE A;  3WD6 A;  2O87 A;  2RUF A;  3G7J A;  2AUV A;  6GSX A;  1XIY A;  5IOW A;  2R37 A;  1N2A A;  5EL8 A;  4K8M A;  1FOV A;  1PN9 A;  2VM1 A;  3H8Q A;  4HI7 A;  1A2M A;  1U87 A;  1O7U A;  2PBJ A;  1LBK A;  5D9V A;  1Q98 A;  5G2Z A;  5LD0 A;  1Y6E A;  1PA3 A;  1AXD A;  1OYJ A;  4F0B A;  1AUC A;  3CRU A;  3QCP A;  3TKQ A;  4PQ1 A;  4KW6 A;  1YKA A;  3F6F A;  3UAR A;  3BJ5 A;  4KAE A;  1FVK A;  1ON4 A;  4JR4 A;  5CAX A;  3ZRE A;  3RDW A;  4FYC A;  4HDE A;  4WXT A;  5KEJ A;  3GUS A;  1EEM A;  1EGR A;  4JR6 A;  3QAG A;  1GTU A;  3PGT A;  2KP1 A;  1SYX A;  1Z5Y E;  5HQP A;  4MPF A;  1ZGN A;  1TK8 B;  1M2A A;  4K9Z A;  5G1K A;  2L6D A;  4IN0 A;  2OBK A;  3F63 A;  3GIX A;  2RM5 A;  2WGR A;  4RUV A;  1BYE A;  2IIY A;  4DSQ A;  3CSH A;  3MDK A;  2N5A A;  4L8E A;  3IDV A;  2C0G A;  2L4C A;  5IIZ A;  5CNW A;  2X8G A;  4JE1 A;  4IVF A;  4KGI A;  4N30 A;  5G31 A;  1RW1 A;  2AJQ B;  4XS6 A;  4OFM A;  18GS A;  1GLQ A;  3FK8 A;  3ZZX A;  3LEF A;  4LL4 B;  3IPZ A;  1NHO A;  1UA5 A;  1B48 A;  4ZL9 A;  2YWN A;  2A4V A;  5DCH A;  2GLR A;  2XBI A;  1V9W A;  1YEX A;  5D73 A;  4O7H A;  2B1L A;  4X0X A;  2HI7 A;  2VAF A;  1XWG A;  4L5L A;  2WZ9 A;  5J41 A;  4XS4 A;  2H66 A;  1ILO A;  4OWY A;  4POB A;  2LRN A;  2MBS A;  5AGY A;  4GTU A;  4AF2 A;  4EDZ A;  14GS A;  3A2V A;  1F3A A;  2FUG 2;  4K1F A;  4MJC A;  2XHF A;  3HA9 A;  3D22 A;  4XRA A;  5IMD A;  3PIN A;  2K6V A;  4IQ1 A;  2PVQ A;  2IME A;  3LYK A;  2MMN A;  2QC7 A;  2M80 A;  3DVW A;  1XBS A;  1Z3E A;  3TOU A;  3L0H A;  1R5A A;  3MNG A;  1QGV A;  1WMJ A;  3UVH A;  4ZIL A;  1I5G A;  1WOU A;  3FR3 A;  1V40 A;  2EIO A;  4N0V A;  1VF1 A;  2K18 A;  4IP6 A;  2L6C A;  1TDI A;  5E59 A;  2NVL A;  4YQM A;  3VI5 A;  3RPN A;  1JHB A;  4GWR A;  3TJK A;  1M0U A;  1B4Q A;  2LRC A;  3GH6 A;  4POM A;  4JZQ A;  4WF4 A;  3KH9 A;  5JWQ B;  2F51 A;  2F9S A;  3U6V A;  4MF5 A;  2OBI A;  2VLU A;  2FWE A;  1G7O A;  1YF1 A;  3E9J B;  2C0E A;  1O81 A;  1PKW A;  4TOP A;  1TXX A;  2FHE A;  1PRX A;  3AY8 A;  2LRT A;  4GQC A;  1X9M B;  2BMX A;  5DBQ A;  4MZC A;  2GST A;  4D73 A;  1GTI A;  2R2J A;  4DVC A;  2LTK A;  1FVJ A;  3IBH A;  2XC2 A;  5HR3 A;  4JU5 A;  2C3T A;  3FY7 A;  2LKU A;  4F03 A;  4HS1 A;  5B7C A;  3I69 A;  5EY6 A;  19GS A;  4IQA A;  3F3R A;  3HVS A;  4RQX A;  3N9J A;  3RBT A;  1JZO A;  4N0Z A;  3EE2 A;  3F6D A;  1T4Y A;  4P3Y B;  2IFQ A;  4K7I A;  1TOF A;  2RII A;  3P8W A;  4HZ2 A;  1J0F A;  2HRN A;  2K8V A;  3N5O A;  4OD7 A;  2CX3 A;  5JWO B;  2GZP A;  1FHE A;  3TJF A;  4GF0 A;  1X9W B;  1FW1 A;  3D5J A;  2ES7 A;  2YZH A;  3H1N A;  3KGK A;  2H01 A;  4K2D A;  5GAN D;  3E3E A;  4MA9 A;  1UC7 A;  2B7J A;  1Z6M A;  1T4Z A;  1K0A A;  3G7I A;  3LJR A;  2DMM A;  1PGT A;  3O3T A;  1O85 A;  5IOX A;  5ECN B;  4PXO A;  4QL9 A;  2VCW A;  3VI7 A;  4NV2 A;  3IXR A;  4XS4 B;  3JCM L;  2GTU A;  3EU4 A;  3C71 A;  1H75 A;  1O73 A; 
#chains in the Genus database with same CATH topology
 2CV4 A;  3M0F A;  1U6T A;  2PUK C;  2FWG A;  1CQG A;  2ON5 A;  2QGV A;  3TUE A;  2L5L A;  3TRQ A;  2REM A;  2ZCT A;  4OFN A;  3ZTL A;  1MTC A;  3P2A A;  4CHS A;  2H71 A;  2FWF A;  4G10 A;  1S3R A;  2WFC A;  2NTO A;  3TRP A;  2KUC A;  3HJO A;  3LQ7 A;  2FD3 A;  1MDI A;  4TR4 A;  3EPT A;  5ECI B;  2I1U A;  3FW2 A;  4EKZ A;  1BJX A;  1R4W A;  2LQQ A;  4CY8 A;  2C4J A;  4J57 E;  4KF9 A;  3UBL A;  1F2E A;  1TK0 B;  3NIV A;  4BPY A;  3HVX A;  4E8E A;  2F8F A;  3RFR C;  2YPM A;  5J5N A;  3OR5 A;  1GH2 A;  4BVY A;  1Z6N A;  1SU9 A;  3TKR A;  2GSR A;  1SJI A;  3F4S A;  4YKF A;  5ECS A;  1FO5 A;  4ZBD A;  2HYX A;  2K8S A;  4N11 A;  2VD1 A;  4LL1 B;  2MBT A;  2HSN B;  2NPB A;  1XW9 A;  2JAC A;  2WDU A;  1GWC A;  2CQ9 A;  3HJM A;  5H5Q A;  1M99 A;  2H74 A;  1JZR A;  3KMN A;  3LFL A;  2E7P A;  3S9F A;  5J4V A;  3IAM 2;  4IHU A;  4D73 B;  5J47 A;  2HSM A;  1TI3 A;  3HXS A;  3ME8 A;  5DDL A;  2GVP A;  2DJ2 A;  1PQN A;  2HRK A;  5ECO B;  3V1W A;  3CQF A;  2A4H A;  5D8I A;  2GQM A;  3DWV A;  4H86 A;  2IWT A;  2C8U A;  3P90 A;  1M3I A;  2KOK A;  2PGT A;  1GUH A;  1M2B A;  1NM3 A;  1FB6 A;  2IPA A;  2G2Q A;  3Q74 A;  1XOB A;  4TR1 A;  1GLP A;  1MEK A;  5A1N A;  2IFQ B;  2N5F A;  3C1S A;  3HVN A;  4FO5 A;  2HRF A;  1BG5 A;  1PN0 A;  2H0I A;  3CYN A;  5ID2 A;  3GL5 A;  1F37 A;  1ZOF A;  4MPG A;  3BBY A;  4NWY A;  4ID0 A;  1S3C A;  1DSB A;  3L9S A;  4ECB A;  1S4B P;  5J9C A;  2O7K A;  2JZR A;  3F4R A;  4AI6 A;  2V32 A;  3NZN A;  3ISO A;  3D4M A;  4IP1 A;  3GFK A;  4G0L A;  1RK4 A;  3I9V 2;  5ABR A;  3M9K A;  1ERT A;  2VLT A;  5DQY A;  1GP1 A;  3EYT A;  3TCO A;  1SK0 A;  5IO2 A;  3APO A;  3FR9 A;  1Z7R A;  3HD5 A;  3VWV A;  5C04 A;  4F0C A;  2A2P A;  2GSQ A;  3GUR A;  4Q5Q A;  2L57 A;  4KCE A;  4WET A;  1GL8 A;  1VF2 A;  1ZMA A;  1YDK A;  1Z7P A;  1VF3 A;  4BA7 A;  2DJ1 A;  2B7K A;  1MDJ A;  1YEP A;  5F0G A;  1THO A;  1SJZ A;  3GTU A;  4F2I A;  3BCI A;  2DKI A;  3BD2 A;  3ZIT A;  1HD2 A;  2QA1 A;  3KEB A;  3KMO A;  2J9H A;  2JL4 A;  2HT9 A;  1HYU A;  2X8H A;  4N3Z A;  6GSU A;  1OAZ A;  4XHM A;  2FGX A;  3LXT A;  4HSC X;  3I6A A;  1HNB A;  4G01 A;  4EVM A;  1H4O A;  3UJ1 A;  4I2T A;  1YVL A;  1GUM A;  5AIS A;  3ERF A;  3DKS A;  1SKW B;  3FYG A;  2P5R A;  3TRX A;  4V2N A;  1YF0 A;  1BX9 A;  2C1Y A;  4I6X A;  2Z9S A;  1EWX A;  4AGS A;  2MMA A;  5LNK e;  2JSY A;  1I9D A;  2IMK A;  3KD0 A;  1XW5 A;  2FNO A;  2YAN A;  1XW6 A;  4ECC A;  3KIJ A;  1JLV A;  4K7N A;  5AN1 A;  12GS A;  2LJR A;  1AIU A;  1Q4J A;  4IS0 A;  1T1V A;  4WBJ A;  2H19 A;  1U88 A;  3CSJ A;  1DE2 A;  3CBU A;  1X9S B;  4KSO A;  1M9A A;  2AHE A;  4ML1 A;  4EDY A;  2H72 A;  4HU7 A;  4TR0 A;  2PER A;  1YEW C;  4ECI A;  4F9Z A;  1S3A A;  2GSS A;  1W4V A;  3WGE A;  1O6J A;  4MZW A;  5KN3 A;  2NBS A;  1AQX A;  2AYT A;  3LWA A;  1PX7 A;  3MYD A;  3GHA A;  2H1D A;  2UZ8 A;  3GX0 A;  1MD3 A;  1QQ2 A;  5H5R A;  2VCZ A;  3WGX A;  5E4W A;  16GS A;  2PN8 A;  2B5X A;  4ZB8 A;  2FWH A;  4TR1 B;  3DRN A;  5A1N B;  3TJJ A;  3IC8 A;  4PX1 A;  3NOF A;  1XOA A;  9GSS A;  3VLN A;  11GS A;  1SK1 A;  2VIM A;  3QAW A;  2PU9 C;  4EIQ A;  4NXI A;  4X43 A;  4MMM A;  3UEM A;  1M2D A;  4IJ3 A;  1K3O A;  5HR1 A;  4L0U A;  3EMP A;  20GS A;  4NV5 A;  2CA8 A;  2N5B A;  3DEX A;  4ZL7 A;  2H1B A;  5C00 A;  2V6K A;  3CTF A;  1PD2 1;  3CRT A;  5J3R A;  2TRX A;  2KP2 A;  7GSS A;  4X1U A;  3L9U A;  4GRF A;  2L59 A;  1LJR A;  5D93 A;  4HUA A;  5AIX A;  3RHC A;  1QFN A;  5A34 A;  2WUL A;  2R6K A;  3PPU A;  5CO3 A;  3GSS A;  3IR4 A;  4KDX A;  2EIQ A;  3H93 A;  2WVX A;  1CQH A;  1WJK A;  2OT3 A;  4IBP A;  2WJU A;  2OKA A;  4AKX B;  1X5D A;  4K0N A;  2R0C A;  1EP8 A;  2O89 A;  1JZW A;  1T7P B;  2OE3 A;  4RQR A;  3K8N A;  4XS1 A;  1JZD A;  1XWK A;  5FWG A;  4J56 E;  1VF4 A;  1YZX A;  2VO4 A;  4N10 A;  4HQZ A;  4BVX A;  3TJB A;  2HQT A;  2JZS A;  5DJM A;  2R5G A;  3FR6 A;  4V2L A;  4NMU A;  4F82 A;  3W8J A;  2WS2 A;  2HLS A;  3HHV A;  2VL2 A;  2HFD A;  2O3E A;  4DSS A;  3FMW A;  3KH7 A;  5IPG A;  5CRG A;  2F8A A;  5AIV A;  2OAC A;  3KM6 A;  3VWX A;  3HJP A;  4GQF A;  4MJB A;  5G30 A;  4E8H A;  3EVI A;  3J7Y b;  4ULX A;  3CWG A;  3ZL5 A;  3TKS A;  1AAZ A;  5BMU A;  4CW9 A;  4JRR A;  2DSA A;  4MLY A;  3QD9 A;  2FA4 A;  1K0B A;  2H1G A;  2WB9 A;  2G0F A;  1MDK A;  3HYP A;  4PHZ C;  1ERV A;  5D9T A;  1JFU A;  2NDO A;  5ECK B;  4EL1 A;  1AC1 A;  4KCA A;  4LLR A;  2H1L A;  4TW5 A;  2QKE A;  4WR5 A;  4BWS A;  2LUS A;  2V41 A;  1ERW A;  4POK A;  5DJL A;  4NPB A;  1I1I P;  2VCQ A;  1YKC A;  4PTS A;  1XWC A;  1PX6 A;  1Y25 A;  2TIR A;  3LW9 A;  4AJ6 A;  3QPM A;  4PUR A;  1GSD A;  5J40 A;  2UV8 G;  3L4N A;  1C72 A;  3QR6 A;  2RUE A;  3WYW A;  2YWI A;  3D4T A;  4NAX A;  5KN0 A;  3M9J A;  4USS A;  1GTA A;  4ZBB A;  2YNX A;  2LQO A;  2PPT A;  2WVZ A;  3HY2 A;  2I81 A;  2LEG A;  1DBY A;  2C0F A;  3GNJ A;  5D96 A;  5ENU A;  3TDG A;  1E6B A;  5JWR B;  4V1A p;  1ZL9 A;  2CAI A;  4OMV A;  4AKG A;  3L9V A;  4WBR D;  1XFL A;  3QDN A;  1XVQ A;  1GNW A;  2VCV A;  6GST A;  1RQM A;  2E0Q A;  4MJE A;  5EVO A;  3H79 A;  5G5F A;  3VK9 A;  5A4U A;  2OJL A;  5A34 B;  3M3M A;  1YJ6 A;  4ZXG A;  5IO0 A;  3GKM A;  5FT3 A;  2WVX B;  3EIN A;  3CHX C;  10GS A;  1KEB A;  3PR8 A;  1SD8 A;  4ZBA A;  2HE3 A;  4IJI A;  1TXU A;  4KH7 A;  3UAP A;  4EC0 A;  2E2M A;  3GKN A;  4JBB A;  4KB3 A;  5ECQ B;  2YV9 A;  2WW1 A;  5JCW A;  1NW2 A;  3HKR A;  4MF6 A;  1M7T A;  2HZF A;  4TXV A;  8GSS A;  3ZYW A;  3KTB A;  4ZIJ A;  4KDU A;  4BVX B;  3H4K A;  4GST A;  2LNT A;  4GLT A;  1T00 A;  3EUR A;  4X4J A;  2JSZ A;  3A5I A;  2HRA A;  2MZC A;  2H1A A;  4KA0 A;  3IHQ A;  2KLX A;  2WZS A;  3LSZ A;  4PUF C;  1EGO A;  4J2F A;  4TRX A;  3IK7 A;  3FHK A;  3F0I A;  2O8V B;  2P5Q A;  4EO3 A;  3SWL A;  3UIW A;  4DSS B;  5EPF A;  4AJ8 A;  5F05 A;  3IOS A;  2DC5 A;  4K0G A;  5DVB A;  2JZT A;  4LMV A;  1R7H A;  3GV1 A;  1WRY A;  1U3A A;  5BMU B;  1MD4 A;  3RHB A;  1BF5 A;  1TRS A;  3IE3 A;  3I43 A;  5IMZ A;  1K3L A;  5GZZ B;  3Q6O A;  4W66 A;  4FH8 A;  4WEY A;  5HR0 A;  1F9M A;  1SL1 B;  4K7O A;  4XTS A;  2IN3 A;  4V1A g;  5ELG A;  4TVE A;  1LU4 A;  1PSQ A;  6GSW A;  4IW9 A;  1B9X C;  3DIE A;  1KNG A;  1B4P A;  2WW0 A;  3DXB A;  2VM2 A;  4KX4 A;  2VUP A;  5F8B A;  2AAW A;  1WE0 A;  3DVX A;  3QMX A;  1FAA A;  3UL3 A;  2L4Q A;  3ZRD A;  4MP4 A;  3G7Y A;  1OKD A;  2RM6 A;  1OKT A;  1GSE A;  3VPQ A;  5B6M A;  2GZZ A;  4Z2T A;  1XWA A;  3F3Q A;  3IRA A;  3TB2 A;  2MMZ A;  1V98 A;  2X49 A;  1XG8 A;  1TTZ A;  2TRC P;  5CRH A;  2H73 A;  2XPD A;  1K0O A;  1Z9H A;  4O32 A;  3UBK A;  1BQ7 A;  1WIK A;  4Z2R A;  3ZVJ A;  4K6X A;  2ON7 A;  3R2Q A;  2LV3 A;  2YWO A;  1VRS D;  2IL3 A;  2D2Z A;  4G9H A;  3ZML A;  3IK9 A;  1XZO A;  5JCU A;  4L0W A;  1G6Y A;  3CSI A;  2CZ2 A;  3HCZ A;  2WCI A;  1UN2 A;  1G6W A;  3IV4 A;  3LOR A;  1TK5 B;  3D6I A;  2OE0 A;  4GCI A;  2B1K A;  2P31 A;  1USB A;  4Z2U A;  3RAZ A;  4O5U A;  1ERU A;  2ZNM A;  2YCD A;  2JAD A;  2JU5 A;  2DLX A;  2O85 A;  1QUW A;  2LNS A;  4ZB9 A;  2CVK A;  3GH9 A;  4G0I A;  4O92 A;  1THX A;  4KUN A;  2CT6 A;  3ZFB A;  4FYU A;  3M1G A;  3FEU A;  1TU7 A;  4MH3 A;  5IMA A;  4OO5 A;  3TGZ A;  3VWW A;  4I8B A;  4MDC A;  1SVL A;  3EU3 A;  4RI6 A;  3UOM A;  1EOH A;  3LXZ A;  1JLW A;  2VLV A;  4WKW A;  1SEN A;  3VPT A;  1PL2 A;  2F3M A;  1GTB A;  3ERG A;  3HVV A;  1OE8 A;  2PMT A;  2GGT A;  3ZVJ D;  3GKX A;  1F3B A;  2DIZ A;  3APS A;  4MZB A;  2GDR A;  3O6T A;  3KJY A;  5HFI A;  4BVY B;  2E2G A;  4ML6 A;  4GSS A;  5B8B A;  2KHP A;  2AB6 A;  1N8J A;  5CRD A;  3APQ A;  2C3N A;  3DD3 A;  4FYB A;  5F06 A;  3BOA A;  1SKS B;  4PQH A;  1EZK A;  1HNC A;  1TKD B;  1A0F A;  1ZYE A;  2H6X A;  2QSI A;  3KP8 A;  3LG6 A;  3W6G A;  2LST A;  2R4V A;  1QMV A;  3SBC A;  3KXO A;  5A4V A;  2HSM B;  4EIP A;  1SD9 A;  4XCS A;  5A5K A;  4I2U A;  4O5R A;  2HRK B;  2DJ3 A;  1WPI A;  3DGQ A;  2EIR A;  4POL A;  5J9B A;  2H75 A;  2GT6 A;  1GSQ A;  6GSS A;  2WVY A;  2J23 A;  1HNA A;  4KSM A;  2A2R A;  2BJX A;  3WGD A;  1XWB A;  1X0R A;  5IM9 A;  1UVZ A;  3ERW A;  5IMC A;  2CVD A;  6GSY A;  5DAL A;  1YY7 A;  4ZL8 A;  2DJ0 A;  1HQO A;  5ID2 B;  3MSZ A;  2DKH A;  2H30 A;  1K0D A;  2VL2 C;  5JCG A;  4KE3 A;  3TKP A;  3GMF A;  4XRD A;  4L5O A;  5DCG A;  2VOC A;  4AKH A;  4FIW A;  3IAS 2;  1T3B A;  2HSH A;  2FLS A;  3UVT A;  1SKR B;  4YQV A;  3KZQ A;  1ZYQ B;  1R26 A;  5GSS A;  1ML6 A;  2H0G A;  3TKS E;  4ILF A;  4HOJ A;  4RI7 A;  4PI2 C;  3Q18 A;  4BWQ A;  1A0R P;  5D9W A;  5KOX A;  1OE7 A;  3US3 A;  4MK3 A;  2HNL A;  4ZB6 A;  1QXH A;  5DAK A;  2EFC A;  3TKS C;  1X5C A;  2X8C A;  3HZ4 A;  2H8L A;  1WP0 A;  3LGC A;  4IKH A;  4MCU A;  1PKZ A;  1ZCP A;  1X5E A;  3TOT A;  2CAQ A;  2WRT A;  5A4W A;  1BAY A;  3WT1 A;  4CY6 A;  1B9Y C;  4G0K A;  4TXO A;  3C7M A;  4DSR A;  1AQW A;  4DEJ A;  4KND A;  2YN1 A;  2YZU A;  1K3Y A;  1ABA A;  2O36 A;  1GSU A;  1PFO A;  1G7E A;  2DJK A;  3GTU B;  4ACS A;  5F07 A;  4MH2 A;  2YV7 A;  1J08 A;  1TRU A;  4O5Q A;  4Q5R A;  4E68 A;  1A8Y A;  2H0H A;  1E2Y A;  2OE1 A;  3QFA C;  1T8E B;  3GL3 A;  3GA4 A;  4EXJ A;  2IMF A;  1M9B A;  1OVN A;  4ICY A;  2R0P A;  3TJG A;  2YP6 A;  1F6M C;  5HR2 A;  2B3S A;  4GXZ A;  3WT2 A;  3QFB C;  1GNE A;  3A2W A;  1A8L A;  4PGT A;  3FRC A;  4MF7 A;  1GSY A;  4OO4 A;  2EC4 A;  3DML A;  1EV4 A;  4OCE A;  5COH A;  1QK8 A;  2HSN A;  4ECJ A;  1K0M A;  1DUG A;  2ALB A;  4Q5F A;  1W89 A;  2VL3 A;  5ECL B;  4YAP A;  4BL7 A;  5IQY A;  5DQS A;  5J4U A;  1A2L A;  3ED3 A;  5L71 A;  2L5O A;  2MMO A;  3VUR A;  2FCH A;  2C0D A;  4GDF A;  1R5P A;  1TI1 A;  3KP9 A;  3EC3 A;  4PNF A;  1KBN A;  2B5Y A;  2GT5 A;  4QQ7 A;  5G1L A;  4I97 A;  1GSS A;  2K9F A;  5INY A;  1OC8 A;  3F4T A;  1SL0 B;  4HJ2 A;  3A3T A;  3LYP A;  1TW9 A;  3RPP A;  1SL2 B;  6GSV A;  3CTG A;  1VGL A;  2IJY A;  2CX4 A;  5D9X A;  5DAL B;  4AKI A;  5GAP D;  2X64 A;  5CYY A;  4ISD A;  5CP1 A;  3VWU A;  1TP9 A;  2LJA A;  2A2S A;  3KTL A;  2DBC A;  3GST A;  2DIY A;  5GST A;  4V2M A;  1OC9 A;  2M46 A;  1OC3 A;  4NHW A;  1GUK A;  1O8W A;  2DML A;  2HZE A;  5ECM B;  4G2E A;  1K0C A;  2IMD A;  2WW2 A;  4HJM A;  2EFE A;  3C8E A;  5IMV A;  3DYR A;  5ECP B;  5DAK B;  5ECH B;  5B6N A;  4YH2 A;  1GUL A;  4NHZ A;  4TR3 A;  1IYH A;  5FHI A;  2I3Y A;  1Y1U A;  3J7Y k;  5B8A A;  1YQ1 A;  4K5R A;  1A24 A;  1PMT A;  5A5H A;  1K0N A;  1B8X A;  2H76 A;  4FQU A;  2YJH A;  1BG1 A;  4Q5N A;  3C1R A;  3PH9 A;  4TXO B;  1EV9 A;  5IPH A;  1FB0 A;  2B5E A;  1G0T A;  1V2A A;  2C80 A;  3EMX A;  3D21 A;  4KDY A;  4I5Q A;  4BIK A;  2H6Z A;  2V2G A;  1IYI A;  2X99 A;  4OCF A;  3CMI A;  2VCX A;  1J9B A;  1PL1 A;  3M8N A;  3MWH A;  2OAD A;  1GRX A;  2DJJ A;  2I4A A;  3CXG A;  4EF0 A;  3C73 A;  4G19 A;  2LS5 A;  4PI0 C;  5G5E A;  4MNN A;  2V6O A;  1SJ6 A;  3ZIV A;  5HFK A;  1EP7 A;  2M72 A;  2MYG A;  2CZ3 A;  3HZ8 A;  2OA7 A;  2YOI A;  2GQK A;  2VKZ G;  3FZA A;  3D0Z A;  1SK2 A;  3FZ9 A;  2PWJ A;  5KN1 A;  2R3X A;  2H70 A;  3R3E A;  3MAK A;  1TRW A;  4WR4 A;  3BCK A;  2I9H A;  3GYK A;  1NHY A;  5IMF A;  3ZLP A;  2HSY A;  2BTO T;  1SYR A;  1TJD A;  2P0G A;  4QL7 A;  3F9U A;  4MAB A;  1XCC A;  4A5P A;  1V58 A;  4AJ7 A;  4HU9 A;  2FA8 A;  3A2X A;  2C3Q A;  2B6M A;  1ZZY A;  3FZ4 A;  2GZY A;  2VL9 A;  3IA1 A;  4EUY A;  4PNG A;  4Z7X A;  1TU8 A;  2YWM A;  4BL7 B;  1FG4 A;  17GS A;  4WF5 A;  3EWL A;  1URM A;  1XXU A;  2CVB A;  3L78 A;  1A2J A;  1ST9 A;  3UMA A;  2VCT A;  3HDC A;  5ECR B;  22GS A;  1U3I A;  2GQL A;  2XPE A;  2XBQ A;  1XPV A;  5CRW A;  4YQU A;  2IMI A;  4YAV A;  13GS A;  3W8S A;  4PUA A;  1S3D A;  3E0U A;  5H5S A;  5ELA A;  1GSF A;  1O8X A;  4LA1 A;  2VD0 A;  4MJA A;  4IGJ A;  4IEL A;  3HMJ G;  1ACV A;  1BED A;  2V1M A;  2HXK A;  2H6Y A;  2ZUP A;  4OFT A;  3QAV A;  2FY6 A;  3P7X A;  3GRX A;  1TRV A;  3FZ5 A;  3GN3 A;  1ZYN A;  2GS3 A;  4GSN A;  1OC9 B;  3VFI A;  3TU3 B;  3F8U A;  4TN8 A;  3ZFL A;  3GKK A;  2HZE B;  5KN2 A;  5CRE A;  3ZMK A;  4LMW A;  2AV4 A;  1EEJ A;  2LJK A;  1ZYP A;  3QOU A;  1DE1 A;  3IC4 A;  3ME7 A;  3Q19 A;  3G9B A;  1V57 A;  4HZ4 A;  5A5H B;  3FKF A;  4K2X A;  1AQV A;  2PVO C;  2YJ7 A;  1XVW A;  3U5R E;  3GX8 A;  5HFG A;  3A5W A;  4PQI A;  3KCM A;  4JED A;  4EE0 A;  4TKY A;  1WWJ A;  4YKG A;  4HEA 2;  4CDO A;  3O76 A;  1NSW A;  1AW9 A;  3ZIJ A;  4HQS A;  4XIH A;  5LCZ A;  4ZB7 A;  1EOG A;  1A23 A;  2RLI A;  1KTE A;  3WD6 A;  2O87 A;  2RUF A;  3G7J A;  2AUV A;  6GSX A;  1XIY A;  5IOW A;  2R37 A;  1N2A A;  5EL8 A;  4K8M A;  1FOV A;  1PN9 A;  2VM1 A;  3H8Q A;  4HI7 A;  1A2M A;  1U87 A;  1O7U A;  2PBJ A;  1LBK A;  5D9V A;  1Q98 A;  5G2Z A;  5LD0 A;  1Y6E A;  1PA3 A;  1AXD A;  2EFD A;  1OYJ A;  4F0B A;  1AUC A;  3CRU A;  3QCP A;  3TKQ A;  4PQ1 A;  4KW6 A;  1YKA A;  3F6F A;  3UAR A;  3BJ5 A;  4KAE A;  1FVK A;  1ON4 A;  4JR4 A;  5CAX A;  3ZRE A;  3RDW A;  4FYC A;  4HDE A;  4WXT A;  5KEJ A;  3GUS A;  1EEM A;  1EGR A;  4JR6 A;  1FOH A;  4FXY P;  3QAG A;  1GTU A;  3PGT A;  2KP1 A;  1SYX A;  2QA2 A;  1Z5Y E;  5BRT A;  5HQP A;  4MPF A;  1ZGN A;  1TK8 B;  1M2A A;  4K9Z A;  5G1K A;  2L6D A;  4IN0 A;  2OBK A;  3F63 A;  3GIX A;  2RM5 A;  5KOW A;  2WGR A;  4RUV A;  1BYE A;  2IIY A;  4DSQ A;  3CSH A;  3MDK A;  2N5A A;  4L8E A;  3IDV A;  2C0G A;  2L4C A;  2R0G A;  5IIZ A;  5CNW A;  2X8G A;  4JE1 A;  4IVF A;  4KGI A;  4N30 A;  5G31 A;  1RW1 A;  2AJQ B;  4XS6 A;  4OFM A;  1SVO A;  18GS A;  1GLQ A;  3FK8 A;  3ZZX A;  3LEF A;  4LL4 B;  1M3J A;  3IPZ A;  1NHO A;  1UA5 A;  1B48 A;  4ZL9 A;  4QMK A;  2YWN A;  2A4V A;  5DCH A;  2GLR A;  2XBI A;  1V9W A;  1YEX A;  5D73 A;  4O7H A;  2B1L A;  4X0X A;  2HI7 A;  2VAF A;  1XWG A;  4L5L A;  2WZ9 A;  5J41 A;  4XS4 A;  2H66 A;  1ILO A;  4OWY A;  4POB A;  2LRN A;  2MBS A;  5AGY A;  4GTU A;  4AF2 A;  4EDZ A;  14GS A;  3A2V A;  1F3A A;  2FUG 2;  4K1F A;  4MJC A;  2XHF A;  3HA9 A;  3D22 A;  4XRA A;  5IMD A;  3PIN A;  2K6V A;  4IQ1 A;  2PVQ A;  2IME A;  3LYK A;  2MMN A;  2QC7 A;  2M80 A;  3DVW A;  1XBS A;  1Z3E A;  3TOU A;  3L0H A;  1R5A A;  3MNG A;  1QGV A;  1WMJ A;  3UVH A;  4ZIL A;  1I5G A;  1WOU A;  3FR3 A;  1V40 A;  2EIO A;  4N0V A;  1VF1 A;  2K18 A;  4IP6 A;  2EFH A;  2L6C A;  1TDI A;  5E59 A;  2NVL A;  4YQM A;  3VI5 A;  3RPN A;  1JHB A;  4GWR A;  3TJK A;  1M0U A;  1B4Q A;  2LRC A;  2X4A A;  5J4Y A;  3MIX A;  3GH6 A;  4POM A;  4JZQ A;  4WF4 A;  1N25 A;  3KH9 A;  5JWQ B;  2F51 A;  2F9S A;  3U6V A;  4MF5 A;  4K5S A;  2OBI A;  2VLU A;  2FWE A;  1G7O A;  1YF1 A;  3E9J B;  2C0E A;  1O81 A;  1PKW A;  4TOP A;  1TXX A;  2FHE A;  1PRX A;  3AY8 A;  2LRT A;  4GQC A;  1X9M B;  2BMX A;  5DBQ A;  4MZC A;  2GST A;  4D73 A;  1GTI A;  2R2J A;  3RGB C;  4DVC A;  2LTK A;  1FVJ A;  3IBH A;  2XC2 A;  5HR3 A;  4JU5 A;  2C3T A;  3FY7 A;  2LKU A;  4F03 A;  4HS1 A;  5B7C A;  3I69 A;  5EY6 A;  2WW3 A;  19GS A;  1SVM A;  4IQA A;  3F3R A;  3HVS A;  4RQX A;  3N9J A;  3RBT A;  1JZO A;  4N0Z A;  3EE2 A;  3F6D A;  1T4Y A;  4P3Y B;  2IFQ A;  4K7I A;  1TOF A;  2RII A;  3P8W A;  4HZ2 A;  3IHG A;  1J0F A;  2HRN A;  2K8V A;  3N5O A;  2O5V A;  4OD7 A;  2CX3 A;  5JWO B;  2GZP A;  1FHE A;  3TJF A;  4GF0 A;  1X9W B;  1FW1 A;  3D5J A;  2ES7 A;  2YZH A;  3H1N A;  3KGK A;  2H01 A;  4K2D A;  5GAN D;  3E3E A;  4MA9 A;  1UC7 A;  2B7J A;  1Z6M A;  1T4Z A;  1K0A A;  3G7I A;  3LJR A;  2DMM A;  1PGT A;  3O3T A;  1O85 A;  5IOX A;  5ECN B;  4PXO A;  4QL9 A;  2VCW A;  3VI7 A;  4NV2 A;  3IXR A;  4XS4 B;  3JCM L;  2GTU A;  3EU4 A;  3C71 A;  1H75 A;  1O73 A; 
#chains in the Genus database with same CATH homology
 2CV4 A;  3M0F A;  1U6T A;  2PUK C;  2FWG A;  1CQG A;  2ON5 A;  2QGV A;  3TUE A;  2L5L A;  3TRQ A;  2REM A;  2ZCT A;  4OFN A;  3ZTL A;  1MTC A;  3P2A A;  4CHS A;  2H71 A;  2FWF A;  4G10 A;  2WFC A;  2NTO A;  3TRP A;  2KUC A;  3HJO A;  3LQ7 A;  2FD3 A;  1MDI A;  4TR4 A;  3EPT A;  5ECI B;  2I1U A;  3FW2 A;  4EKZ A;  1BJX A;  1R4W A;  2LQQ A;  4CY8 A;  2C4J A;  4J57 E;  4KF9 A;  3UBL A;  1F2E A;  1TK0 B;  3NIV A;  4BPY A;  3HVX A;  4E8E A;  2F8F A;  2YPM A;  5J5N A;  3OR5 A;  1GH2 A;  4BVY A;  1Z6N A;  1SU9 A;  3TKR A;  2GSR A;  1SJI A;  3F4S A;  4YKF A;  5ECS A;  1FO5 A;  4ZBD A;  2HYX A;  2K8S A;  4N11 A;  2VD1 A;  4LL1 B;  2MBT A;  2HSN B;  2NPB A;  1XW9 A;  2JAC A;  2WDU A;  1GWC A;  2CQ9 A;  3HJM A;  5H5Q A;  1M99 A;  2H74 A;  1JZR A;  3LFL A;  3KMN A;  2E7P A;  3S9F A;  5J4V A;  3IAM 2;  4IHU A;  4D73 B;  5J47 A;  2HSM A;  1TI3 A;  3HXS A;  3ME8 A;  5DDL A;  2GVP A;  2DJ2 A;  1PQN A;  2HRK A;  5ECO B;  3V1W A;  2A4H A;  5D8I A;  2GQM A;  3DWV A;  4H86 A;  2IWT A;  2C8U A;  3P90 A;  2KOK A;  2PGT A;  1GUH A;  1M2B A;  1NM3 A;  1FB6 A;  2IPA A;  2G2Q A;  3Q74 A;  1XOB A;  4TR1 A;  1GLP A;  1MEK A;  5A1N A;  2IFQ B;  2N5F A;  3C1S A;  4FO5 A;  2HRF A;  1BG5 A;  1PN0 A;  2H0I A;  3CYN A;  5ID2 A;  3GL5 A;  1F37 A;  1ZOF A;  4MPG A;  3BBY A;  4NWY A;  4ID0 A;  1S3C A;  1DSB A;  3L9S A;  4ECB A;  5J9C A;  2O7K A;  2JZR A;  3F4R A;  4AI6 A;  2V32 A;  3NZN A;  3ISO A;  3D4M A;  4IP1 A;  3GFK A;  4G0L A;  1RK4 A;  3I9V 2;  5ABR A;  3M9K A;  1ERT A;  2VLT A;  5DQY A;  1GP1 A;  3EYT A;  3TCO A;  1SK0 A;  5IO2 A;  3APO A;  3FR9 A;  1Z7R A;  3HD5 A;  3VWV A;  5C04 A;  4F0C A;  2A2P A;  2GSQ A;  3GUR A;  4Q5Q A;  2L57 A;  4KCE A;  4WET A;  1GL8 A;  1VF2 A;  1ZMA A;  1YDK A;  1Z7P A;  1VF3 A;  4BA7 A;  2DJ1 A;  2B7K A;  1MDJ A;  1YEP A;  5F0G A;  1THO A;  1SJZ A;  3GTU A;  4F2I A;  3BCI A;  2DKI A;  3BD2 A;  3ZIT A;  1HD2 A;  2QA1 A;  3KEB A;  3KMO A;  2J9H A;  2JL4 A;  2HT9 A;  1HYU A;  2X8H A;  4N3Z A;  6GSU A;  1OAZ A;  4XHM A;  2FGX A;  3LXT A;  3I6A A;  1HNB A;  4G01 A;  4EVM A;  1H4O A;  3UJ1 A;  4I2T A;  1YVL A;  1GUM A;  5AIS A;  3ERF A;  3DKS A;  1SKW B;  3FYG A;  2P5R A;  3TRX A;  4V2N A;  1YF0 A;  1BX9 A;  2C1Y A;  4I6X A;  2Z9S A;  1EWX A;  4AGS A;  2MMA A;  5LNK e;  2JSY A;  1I9D A;  2IMK A;  3KD0 A;  1XW5 A;  2FNO A;  2YAN A;  1XW6 A;  4ECC A;  3KIJ A;  1JLV A;  4K7N A;  5AN1 A;  12GS A;  2LJR A;  1AIU A;  1Q4J A;  4IS0 A;  1T1V A;  4WBJ A;  2H19 A;  1U88 A;  3CSJ A;  1DE2 A;  3CBU A;  1X9S B;  4KSO A;  1M9A A;  2AHE A;  4ML1 A;  4EDY A;  2H72 A;  4HU7 A;  4TR0 A;  2PER A;  4ECI A;  4F9Z A;  1S3A A;  2GSS A;  1W4V A;  3WGE A;  1O6J A;  4MZW A;  5KN3 A;  2NBS A;  1AQX A;  2AYT A;  3LWA A;  1PX7 A;  3MYD A;  3GHA A;  2H1D A;  2UZ8 A;  3GX0 A;  1MD3 A;  1QQ2 A;  5H5R A;  2VCZ A;  3WGX A;  5E4W A;  16GS A;  2B5X A;  2PN8 A;  4ZB8 A;  2FWH A;  4TR1 B;  3DRN A;  5A1N B;  3TJJ A;  3IC8 A;  4PX1 A;  3NOF A;  1XOA A;  9GSS A;  3VLN A;  11GS A;  1SK1 A;  2VIM A;  3QAW A;  2PU9 C;  4EIQ A;  4NXI A;  4X43 A;  4MMM A;  3UEM A;  1M2D A;  4IJ3 A;  1K3O A;  5HR1 A;  4L0U A;  3EMP A;  20GS A;  4NV5 A;  2CA8 A;  2N5B A;  3DEX A;  4ZL7 A;  2H1B A;  5C00 A;  2V6K A;  3CTF A;  1PD2 1;  3CRT A;  5J3R A;  2TRX A;  2KP2 A;  7GSS A;  4X1U A;  3L9U A;  4GRF A;  2L59 A;  1LJR A;  5D93 A;  4HUA A;  5AIX A;  3RHC A;  1QFN A;  5A34 A;  2WUL A;  2R6K A;  3PPU A;  5CO3 A;  3GSS A;  3IR4 A;  4KDX A;  2EIQ A;  3H93 A;  1CQH A;  1WJK A;  2OT3 A;  4IBP A;  2WJU A;  2OKA A;  4AKX B;  1X5D A;  4K0N A;  2R0C A;  1EP8 A;  2O89 A;  1JZW A;  1T7P B;  2OE3 A;  4RQR A;  3K8N A;  4XS1 A;  1JZD A;  1XWK A;  5FWG A;  4J56 E;  1VF4 A;  1YZX A;  2VO4 A;  4N10 A;  4HQZ A;  4BVX A;  3TJB A;  2HQT A;  2JZS A;  5DJM A;  2R5G A;  3FR6 A;  4V2L A;  4NMU A;  4F82 A;  3W8J A;  2WS2 A;  2HLS A;  3HHV A;  2VL2 A;  2HFD A;  4DSS A;  3FMW A;  3KH7 A;  5IPG A;  5CRG A;  2F8A A;  5AIV A;  2OAC A;  3KM6 A;  3VWX A;  3HJP A;  4GQF A;  4MJB A;  5G30 A;  4E8H A;  3EVI A;  3J7Y b;  4ULX A;  3CWG A;  3ZL5 A;  3TKS A;  1AAZ A;  5BMU A;  4CW9 A;  4JRR A;  2DSA A;  4MLY A;  3QD9 A;  2FA4 A;  1K0B A;  2H1G A;  2WB9 A;  2G0F A;  1MDK A;  3HYP A;  1ERV A;  5D9T A;  1JFU A;  2NDO A;  5ECK B;  4EL1 A;  1AC1 A;  4KCA A;  4LLR A;  2H1L A;  4TW5 A;  2QKE A;  4WR5 A;  4BWS A;  2LUS A;  2V41 A;  1ERW A;  4POK A;  5DJL A;  4NPB A;  2VCQ A;  1YKC A;  4PTS A;  1XWC A;  1PX6 A;  1Y25 A;  2TIR A;  3LW9 A;  4AJ6 A;  3QPM A;  4PUR A;  1GSD A;  5J40 A;  2UV8 G;  3L4N A;  1C72 A;  3QR6 A;  2RUE A;  3WYW A;  2YWI A;  3D4T A;  4NAX A;  5KN0 A;  3M9J A;  4USS A;  1GTA A;  4ZBB A;  2YNX A;  2LQO A;  2PPT A;  3HY2 A;  2I81 A;  2LEG A;  1DBY A;  2C0F A;  3GNJ A;  5D96 A;  5ENU A;  3TDG A;  1E6B A;  5JWR B;  4V1A p;  1ZL9 A;  2CAI A;  4OMV A;  4AKG A;  3L9V A;  4WBR D;  1XFL A;  3QDN A;  1XVQ A;  1GNW A;  2VCV A;  6GST A;  1RQM A;  2E0Q A;  4MJE A;  5EVO A;  3H79 A;  5G5F A;  3VK9 A;  5A4U A;  2OJL A;  5A34 B;  3M3M A;  1YJ6 A;  4ZXG A;  5IO0 A;  3GKM A;  5FT3 A;  3EIN A;  10GS A;  1KEB A;  3PR8 A;  1SD8 A;  4ZBA A;  2HE3 A;  4IJI A;  1TXU A;  4KH7 A;  3UAP A;  4EC0 A;  2E2M A;  3GKN A;  4JBB A;  4KB3 A;  5ECQ B;  2YV9 A;  5JCW A;  1NW2 A;  3HKR A;  4MF6 A;  1M7T A;  2HZF A;  4TXV A;  8GSS A;  3ZYW A;  3KTB A;  4ZIJ A;  4KDU A;  4BVX B;  3H4K A;  4GST A;  2LNT A;  4GLT A;  1T00 A;  3EUR A;  4X4J A;  2JSZ A;  3A5I A;  2HRA A;  2MZC A;  2H1A A;  4KA0 A;  3IHQ A;  2KLX A;  3LSZ A;  4PUF C;  1EGO A;  4J2F A;  4TRX A;  3IK7 A;  3FHK A;  3F0I A;  2O8V B;  2P5Q A;  4EO3 A;  3SWL A;  3UIW A;  4DSS B;  5EPF A;  4AJ8 A;  5F05 A;  3IOS A;  2DC5 A;  4K0G A;  5DVB A;  2JZT A;  4LMV A;  1R7H A;  3GV1 A;  1WRY A;  1U3A A;  5BMU B;  1MD4 A;  3RHB A;  1BF5 A;  1TRS A;  3IE3 A;  3I43 A;  5IMZ A;  1K3L A;  5GZZ B;  3Q6O A;  4W66 A;  4FH8 A;  4WEY A;  5HR0 A;  1F9M A;  1SL1 B;  4K7O A;  4XTS A;  2IN3 A;  4V1A g;  5ELG A;  4TVE A;  1LU4 A;  1PSQ A;  6GSW A;  4IW9 A;  1B9X C;  3DIE A;  1KNG A;  1B4P A;  3DXB A;  2VM2 A;  4KX4 A;  2VUP A;  5F8B A;  2AAW A;  1WE0 A;  3DVX A;  3QMX A;  1FAA A;  3UL3 A;  2L4Q A;  3ZRD A;  4MP4 A;  3G7Y A;  1OKD A;  2RM6 A;  1OKT A;  1GSE A;  3VPQ A;  5B6M A;  2GZZ A;  4Z2T A;  1XWA A;  3F3Q A;  3IRA A;  3TB2 A;  2MMZ A;  1V98 A;  2X49 A;  1TTZ A;  2TRC P;  5CRH A;  2H73 A;  2XPD A;  1K0O A;  1Z9H A;  4O32 A;  3UBK A;  1BQ7 A;  1WIK A;  4Z2R A;  3ZVJ A;  4K6X A;  2ON7 A;  3R2Q A;  2LV3 A;  2YWO A;  1VRS D;  2IL3 A;  2D2Z A;  4G9H A;  3ZML A;  3IK9 A;  1XZO A;  5JCU A;  4L0W A;  1G6Y A;  3CSI A;  2CZ2 A;  3HCZ A;  2WCI A;  1UN2 A;  1G6W A;  3IV4 A;  3LOR A;  1TK5 B;  3D6I A;  2OE0 A;  4GCI A;  2B1K A;  2P31 A;  1USB A;  4Z2U A;  3RAZ A;  4O5U A;  1ERU A;  2ZNM A;  2YCD A;  2JAD A;  2JU5 A;  2DLX A;  2O85 A;  1QUW A;  2LNS A;  4ZB9 A;  2CVK A;  3GH9 A;  4G0I A;  4O92 A;  1THX A;  4KUN A;  2CT6 A;  3ZFB A;  4FYU A;  3M1G A;  3FEU A;  1TU7 A;  4MH3 A;  5IMA A;  4OO5 A;  3TGZ A;  3VWW A;  4I8B A;  4MDC A;  1SVL A;  3EU3 A;  4RI6 A;  3UOM A;  1EOH A;  3LXZ A;  1JLW A;  2VLV A;  4WKW A;  1SEN A;  3VPT A;  1PL2 A;  2F3M A;  1GTB A;  3ERG A;  3HVV A;  1OE8 A;  2PMT A;  2GGT A;  3ZVJ D;  3GKX A;  1F3B A;  2DIZ A;  3APS A;  4MZB A;  2GDR A;  3O6T A;  3KJY A;  5HFI A;  4BVY B;  2E2G A;  4ML6 A;  4GSS A;  5B8B A;  2KHP A;  2AB6 A;  1N8J A;  5CRD A;  3APQ A;  2C3N A;  3DD3 A;  4FYB A;  5F06 A;  3BOA A;  1SKS B;  4PQH A;  1EZK A;  1HNC A;  1TKD B;  1A0F A;  1ZYE A;  2H6X A;  2QSI A;  3KP8 A;  3LG6 A;  3W6G A;  2LST A;  2R4V A;  1QMV A;  3SBC A;  3KXO A;  5A4V A;  2HSM B;  4EIP A;  1SD9 A;  4XCS A;  5A5K A;  4I2U A;  4O5R A;  2HRK B;  2DJ3 A;  1WPI A;  3DGQ A;  2EIR A;  4POL A;  5J9B A;  2H75 A;  2GT6 A;  1GSQ A;  6GSS A;  2J23 A;  1HNA A;  4KSM A;  2A2R A;  2BJX A;  3WGD A;  1XWB A;  1X0R A;  5IM9 A;  1UVZ A;  3ERW A;  5IMC A;  2CVD A;  6GSY A;  5DAL A;  1YY7 A;  4ZL8 A;  2DJ0 A;  1HQO A;  5ID2 B;  3MSZ A;  2DKH A;  2H30 A;  1K0D A;  2VL2 C;  5JCG A;  4KE3 A;  3TKP A;  3GMF A;  4XRD A;  4L5O A;  5DCG A;  2VOC A;  4AKH A;  4FIW A;  3IAS 2;  1T3B A;  2HSH A;  2FLS A;  3UVT A;  1SKR B;  4YQV A;  3KZQ A;  1ZYQ B;  1R26 A;  5GSS A;  1ML6 A;  2H0G A;  3TKS E;  4ILF A;  4HOJ A;  4RI7 A;  3Q18 A;  4BWQ A;  1A0R P;  5D9W A;  5KOX A;  1OE7 A;  3US3 A;  4MK3 A;  2HNL A;  4ZB6 A;  1QXH A;  5DAK A;  2EFC A;  3TKS C;  1X5C A;  2X8C A;  3HZ4 A;  2H8L A;  1WP0 A;  3LGC A;  4IKH A;  4MCU A;  1PKZ A;  1ZCP A;  1X5E A;  3TOT A;  2CAQ A;  2WRT A;  5A4W A;  1BAY A;  3WT1 A;  4CY6 A;  1B9Y C;  4G0K A;  4TXO A;  3C7M A;  4DSR A;  1AQW A;  4DEJ A;  4KND A;  2YN1 A;  2YZU A;  1K3Y A;  1ABA A;  1GSU A;  1G7E A;  2DJK A;  3GTU B;  4ACS A;  5F07 A;  4MH2 A;  2YV7 A;  1J08 A;  1TRU A;  4O5Q A;  4Q5R A;  4E68 A;  1A8Y A;  2H0H A;  1E2Y A;  2OE1 A;  3QFA C;  1T8E B;  3GL3 A;  3GA4 A;  4EXJ A;  2IMF A;  1M9B A;  1OVN A;  4ICY A;  2R0P A;  3TJG A;  2YP6 A;  1F6M C;  5HR2 A;  2B3S A;  4GXZ A;  3WT2 A;  3QFB C;  1GNE A;  3A2W A;  1A8L A;  4PGT A;  3FRC A;  4MF7 A;  1GSY A;  4OO4 A;  2EC4 A;  3DML A;  1EV4 A;  4OCE A;  5COH A;  1QK8 A;  2HSN A;  4ECJ A;  1K0M A;  1DUG A;  2ALB A;  4Q5F A;  1W89 A;  2VL3 A;  5ECL B;  4YAP A;  4BL7 A;  5IQY A;  5DQS A;  5J4U A;  1A2L A;  3ED3 A;  5L71 A;  2L5O A;  2MMO A;  3VUR A;  2FCH A;  2C0D A;  4GDF A;  1R5P A;  1TI1 A;  3KP9 A;  3EC3 A;  4PNF A;  1KBN A;  2B5Y A;  2GT5 A;  4QQ7 A;  5G1L A;  4I97 A;  1GSS A;  2K9F A;  5INY A;  1OC8 A;  3F4T A;  1SL0 B;  4HJ2 A;  3A3T A;  3LYP A;  1TW9 A;  3RPP A;  1SL2 B;  6GSV A;  3CTG A;  1VGL A;  2IJY A;  2CX4 A;  5D9X A;  5DAL B;  4AKI A;  5GAP D;  2X64 A;  5CYY A;  4ISD A;  5CP1 A;  3VWU A;  1TP9 A;  2LJA A;  2A2S A;  3KTL A;  2DBC A;  3GST A;  2DIY A;  5GST A;  4V2M A;  1OC9 A;  2M46 A;  1OC3 A;  4NHW A;  1GUK A;  1O8W A;  2DML A;  2HZE A;  5ECM B;  4G2E A;  1K0C A;  2IMD A;  4HJM A;  2EFE A;  3C8E A;  5IMV A;  3DYR A;  5ECP B;  5DAK B;  5ECH B;  5B6N A;  4YH2 A;  1GUL A;  4NHZ A;  4TR3 A;  1IYH A;  5FHI A;  2I3Y A;  1Y1U A;  3J7Y k;  5B8A A;  1YQ1 A;  4K5R A;  1A24 A;  1PMT A;  5A5H A;  1K0N A;  1B8X A;  2H76 A;  4FQU A;  2YJH A;  1BG1 A;  4Q5N A;  3C1R A;  3PH9 A;  4TXO B;  1EV9 A;  5IPH A;  1FB0 A;  2B5E A;  1G0T A;  1V2A A;  2C80 A;  3EMX A;  3D21 A;  4KDY A;  4I5Q A;  2H6Z A;  2V2G A;  1IYI A;  2X99 A;  4OCF A;  3CMI A;  2VCX A;  1J9B A;  1PL1 A;  3M8N A;  3MWH A;  2OAD A;  1GRX A;  2DJJ A;  2I4A A;  3CXG A;  4EF0 A;  3C73 A;  4G19 A;  2LS5 A;  5G5E A;  4MNN A;  2V6O A;  1SJ6 A;  3ZIV A;  5HFK A;  1EP7 A;  2M72 A;  2MYG A;  2CZ3 A;  3HZ8 A;  2OA7 A;  2YOI A;  2GQK A;  2VKZ G;  3FZA A;  3D0Z A;  1SK2 A;  3FZ9 A;  2PWJ A;  5KN1 A;  2R3X A;  2H70 A;  3R3E A;  3MAK A;  1TRW A;  4WR4 A;  3BCK A;  2I9H A;  3GYK A;  1NHY A;  5IMF A;  3ZLP A;  2HSY A;  2BTO T;  1SYR A;  1TJD A;  2P0G A;  4QL7 A;  3F9U A;  4MAB A;  1XCC A;  4A5P A;  1V58 A;  4AJ7 A;  4HU9 A;  2FA8 A;  3A2X A;  2C3Q A;  2B6M A;  1ZZY A;  3FZ4 A;  2GZY A;  2VL9 A;  3IA1 A;  4EUY A;  4PNG A;  4Z7X A;  1TU8 A;  2YWM A;  4BL7 B;  1FG4 A;  17GS A;  4WF5 A;  3EWL A;  1URM A;  1XXU A;  2CVB A;  3L78 A;  1A2J A;  1ST9 A;  3UMA A;  2VCT A;  3HDC A;  5ECR B;  22GS A;  1U3I A;  2GQL A;  2XPE A;  2XBQ A;  1XPV A;  5CRW A;  4YQU A;  2IMI A;  4YAV A;  13GS A;  3W8S A;  4PUA A;  1S3D A;  3E0U A;  5H5S A;  5ELA A;  1GSF A;  1O8X A;  4LA1 A;  2VD0 A;  4MJA A;  4IGJ A;  4IEL A;  3HMJ G;  1ACV A;  1BED A;  2V1M A;  2HXK A;  2H6Y A;  2ZUP A;  4OFT A;  3QAV A;  2FY6 A;  3P7X A;  3GRX A;  1TRV A;  3FZ5 A;  3GN3 A;  1ZYN A;  2GS3 A;  4GSN A;  1OC9 B;  3VFI A;  3TU3 B;  3F8U A;  4TN8 A;  3ZFL A;  3GKK A;  2HZE B;  5KN2 A;  5CRE A;  3ZMK A;  4LMW A;  2AV4 A;  1EEJ A;  2LJK A;  1ZYP A;  3QOU A;  1DE1 A;  3IC4 A;  3ME7 A;  3Q19 A;  3G9B A;  1V57 A;  4HZ4 A;  5A5H B;  3FKF A;  4K2X A;  1AQV A;  2PVO C;  2YJ7 A;  1XVW A;  3U5R E;  3GX8 A;  5HFG A;  3A5W A;  4PQI A;  3KCM A;  4JED A;  4EE0 A;  4TKY A;  1WWJ A;  4YKG A;  4HEA 2;  4CDO A;  3O76 A;  1NSW A;  1AW9 A;  3ZIJ A;  4HQS A;  4XIH A;  5LCZ A;  4ZB7 A;  1EOG A;  1A23 A;  2RLI A;  1KTE A;  3WD6 A;  2O87 A;  2RUF A;  3G7J A;  2AUV A;  6GSX A;  1XIY A;  5IOW A;  2R37 A;  1N2A A;  5EL8 A;  4K8M A;  1FOV A;  1PN9 A;  2VM1 A;  3H8Q A;  4HI7 A;  1A2M A;  1U87 A;  1O7U A;  2PBJ A;  1LBK A;  5D9V A;  1Q98 A;  5G2Z A;  5LD0 A;  1Y6E A;  1PA3 A;  1AXD A;  2EFD A;  1OYJ A;  4F0B A;  1AUC A;  3CRU A;  3QCP A;  3TKQ A;  4PQ1 A;  4KW6 A;  1YKA A;  3F6F A;  3UAR A;  3BJ5 A;  4KAE A;  1FVK A;  1ON4 A;  4JR4 A;  5CAX A;  3ZRE A;  3RDW A;  4FYC A;  4HDE A;  4WXT A;  5KEJ A;  3GUS A;  1EEM A;  1EGR A;  4JR6 A;  1FOH A;  3QAG A;  1GTU A;  3PGT A;  2KP1 A;  1SYX A;  2QA2 A;  1Z5Y E;  5BRT A;  5HQP A;  4MPF A;  1ZGN A;  1TK8 B;  1M2A A;  4K9Z A;  5G1K A;  2L6D A;  4IN0 A;  2OBK A;  3F63 A;  3GIX A;  2RM5 A;  5KOW A;  2WGR A;  4RUV A;  1BYE A;  2IIY A;  4DSQ A;  3CSH A;  3MDK A;  2N5A A;  4L8E A;  3IDV A;  2C0G A;  2L4C A;  2R0G A;  5IIZ A;  5CNW A;  2X8G A;  4JE1 A;  4IVF A;  4KGI A;  4N30 A;  5G31 A;  1RW1 A;  2AJQ B;  4XS6 A;  4OFM A;  1SVO A;  18GS A;  1GLQ A;  3FK8 A;  3ZZX A;  3LEF A;  4LL4 B;  3IPZ A;  1NHO A;  1UA5 A;  1B48 A;  4ZL9 A;  4QMK A;  2YWN A;  2A4V A;  5DCH A;  2GLR A;  2XBI A;  1V9W A;  1YEX A;  5D73 A;  4O7H A;  2B1L A;  4X0X A;  2HI7 A;  2VAF A;  1XWG A;  4L5L A;  2WZ9 A;  5J41 A;  4XS4 A;  2H66 A;  1ILO A;  4OWY A;  4POB A;  2LRN A;  2MBS A;  5AGY A;  4GTU A;  4AF2 A;  4EDZ A;  14GS A;  3A2V A;  1F3A A;  2FUG 2;  4K1F A;  4MJC A;  2XHF A;  3HA9 A;  3D22 A;  4XRA A;  5IMD A;  3PIN A;  2K6V A;  4IQ1 A;  2PVQ A;  2IME A;  3LYK A;  2MMN A;  2QC7 A;  2M80 A;  3DVW A;  1XBS A;  1Z3E A;  3TOU A;  3L0H A;  1R5A A;  3MNG A;  1QGV A;  1WMJ A;  3UVH A;  4ZIL A;  1I5G A;  1WOU A;  3FR3 A;  1V40 A;  2EIO A;  4N0V A;  1VF1 A;  2K18 A;  4IP6 A;  2EFH A;  2L6C A;  1TDI A;  5E59 A;  2NVL A;  4YQM A;  3VI5 A;  3RPN A;  1JHB A;  4GWR A;  3TJK A;  1M0U A;  1B4Q A;  2LRC A;  2X4A A;  5J4Y A;  3MIX A;  3GH6 A;  4POM A;  4JZQ A;  4WF4 A;  1N25 A;  3KH9 A;  5JWQ B;  2F51 A;  2F9S A;  3U6V A;  4MF5 A;  4K5S A;  2OBI A;  2VLU A;  2FWE A;  1G7O A;  1YF1 A;  3E9J B;  2C0E A;  1O81 A;  1PKW A;  4TOP A;  1TXX A;  2FHE A;  1PRX A;  3AY8 A;  2LRT A;  4GQC A;  1X9M B;  2BMX A;  5DBQ A;  4MZC A;  2GST A;  4D73 A;  1GTI A;  2R2J A;  4DVC A;  2LTK A;  1FVJ A;  3IBH A;  2XC2 A;  5HR3 A;  4JU5 A;  2C3T A;  3FY7 A;  2LKU A;  4F03 A;  4HS1 A;  5B7C A;  3I69 A;  5EY6 A;  19GS A;  1SVM A;  4IQA A;  3F3R A;  3HVS A;  4RQX A;  3N9J A;  3RBT A;  1JZO A;  4N0Z A;  3EE2 A;  3F6D A;  1T4Y A;  4P3Y B;  2IFQ A;  4K7I A;  1TOF A;  2RII A;  3P8W A;  4HZ2 A;  3IHG A;  1J0F A;  2HRN A;  2K8V A;  3N5O A;  2O5V A;  4OD7 A;  2CX3 A;  5JWO B;  2GZP A;  1FHE A;  3TJF A;  4GF0 A;  1X9W B;  1FW1 A;  3D5J A;  2ES7 A;  2YZH A;  3H1N A;  3KGK A;  2H01 A;  4K2D A;  5GAN D;  3E3E A;  4MA9 A;  1UC7 A;  2B7J A;  1Z6M A;  1T4Z A;  1K0A A;  3G7I A;  3LJR A;  2DMM A;  1PGT A;  3O3T A;  1O85 A;  5IOX A;  5ECN B;  4PXO A;  4QL9 A;  2VCW A;  3VI7 A;  4NV2 A;  3IXR A;  4XS4 B;  3JCM L;  2GTU A;  3EU4 A;  3C71 A;  1H75 A;  1O73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...