1FHEA

Glutathione transferase (fh47) from fasciola hepatica
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
214
structure length
214
Chain Sequence
PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE TRANSFERASE
publication title Crystallization, structural determination and analysis of a novel parasite vaccine candidate: Fasciola hepatica glutathione S-transferase.
pubmed doi rcsb
source organism Fasciola hepatica
molecule tags Transferase
total genus 57
structure length 214
sequence length 214
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1fheA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fheA01
4RUVA 3US3A 1QXHA 2IJYA 5FHIA 3F6FA 3ZIVA 6GSSA 2IMFA 2HSNB 1XWCA 2QC7A 4YAPA 3GSTA 5DALA 1GNWA 5G31A 2B3SA 5CRDA 2LJRA 4O32A 1GLPA 2GZPA 2EIRA 5DCGA 8GSSA 3VI5A 1ACVA 2H6XA 3VFIA 2OE3A 5C00A 1T3BA 2LKUA 2LV3A 4V2MA 3KJYA 4MLYA 2LTKA 3RPNA 4WF4A 2GLRA 2J9HA 4GWRA 2XPEA 2L6CA 5HR1A 1XFLA 5CRGA 2H1DA 3UARA 4IP1A 4ECBA 3GA4A 5D9WA 2X8HA 3TRPA 4K2DA 1OC3A 2R4VA 1JLWA 2R6KA 5JWQB 3CRTA 1MDKA 1V57A 1KTEA 4QL9A 4TXOA 5IPGA 2YP6A 5GSTA 1WOUA 4GLTA 1GSFA 3CTFA 4DSSA 4ML1A 1GP1A 4PX1A 3ZVJA 5D9VA 3GH6A 3TJJA 1S3AA 3W8SA 4DEJA 2F9SA 4JE1A 1X5CA 1EOGA 1GSUA 4PNFA 4L5LA 2B5EA 1A24A 2HSMB 3H93A 2CVDA 4K7IA 2FWHA 3JCML 2E2GA 1VRSD 4EO3A 2DJJA 1WMJA 1FAAA 1WPIA 4USSA 2VD0A 2FLSA 2L57A 2OE1A 3O76A 2PVOC 3W8JA 2LQOA 4V2NA 5B7CA 2VL3A 4EE0A 2JZRA 5B8AA 2VL2C 1LU4A 4F0BA 3BBYA 1HD2A 3WT1A 2BTOT 3IBHA 4X1UA 2FWFA 4IGJA 2N5BA 4LL1B 1R26A 1GSDA 3VLNA 1F3BA 5CNWA 5KN0A 1TKDB 5DCHA 1O81A 2VL2A 3E9JB 2HZFA 5G1KA 2H0GA 2VLTA 4OFTA 4HJ2A 1GTBA 5EL8A 3J7Yk 2C1YA 2VM1A 1X9SB 1F3AA 4N0ZA 1EGRA 4WR4A 3ZFLA 1R5AA 2IMDA 2I3YA 2NBSA 2MMZA 1XZOA 2R3XA 2PWJA 1AXDA 4OO4A 1A2MA 1GSYA 2HRFA 1OKDA 2A2SA 4IHUA 3VWWA 5H5SA 3UJ1A 2JZSA 3UMAA 4PQ1A 3ERWA 5ECLB 1NW2A 1IYIA 1F9MA 3HJOA 5DAKA 1VGLA 2V2GA 1OKTA 6GSTA 1GH2A 5L71A 4MJAA 3C73A 1JZDA 3IV4A 3DXBA 2DJ3A 2CX3A 2IMEA 2VCZA 1K0MA 2YZUA 4IVFA 4K0GA 1ERUA 4ECJA 2QSIA 3FEUA 4PNGA 4I5QA 3BCIA 2MMOA 3HVSA 2ES7A 4FQUA 2FUG2 5DQYA 3R3EA 1TK8B 2VM2A 4MZCA 2O89A 2LRCA 4ZB8A 2O8VB 3BJ5A 3UVHA 4ZIJA 1HQOA 2WS2A 4NV2A 3KTBA 2B6MA 4HDEA 1ZL9A 1R5PA 1AW9A 4K9ZA 1WE0A 1GTIA 3GKNA 5CO3A 2H71A 3ERFA 5IPHA 4ZB9A 3GL3A 1F2EA 5AISA 11GSA 4KF9A 1GSEA 2H8LA 2HZEA 2FCHA 1YEPA 1GSSA 2GQKA 2WJUA 5C04A 1XWGA 1SL0B 2YV9A 3UOMA 5J9BA 1E6BA 1GWCA 4HOJA 5HR2A 3GNJA 4EF0A 4ZL9A 4O5RA 1GTUA 3TKSC 2LS5A 3FKFA 4BVYA 2O7KA 4WF5A 3KGKA 2F8FA 2NPBA 3KTLA 2FD3A 2XPDA 1FO5A 3MWHA 4BL7A 5IMAA 2IIYA 1N8JA 2TRXA 3EURA 4DSQA 5JWRB 1Z6MA 2V1MA 1B9YC 3DD3A 3GMFA 5FT3A 1KEBA 2F8AA 3WYWA 4HU9A 2YOIA 1RK4A 2WULA 4EDZA 3O6TA 4ZB6A 1O7UA 2F51A 3TKSA 3IDVA 5CRWA 4BVYB 3FZAA 4BWSA 1M9BA 2IPAA 3IA1A 3QAGA 1TU8A 4F0CA 3D0ZA 4IS0A 4BL7B 5JCUA 4KDUA 2HNLA 2X8CA 3HVXA 1NHOA 1ML6A 3VWUA 4FYUA 3KIJA 2HRKB 4GTUA 1K0AA 2A4VA 5GZZB 1YJ6A 2WGRA 1HNCA 2JACA 3CSIA 2H30A 2HXKA 4XS1A 3L9SA 5F06A 6GSYA 5AIXA 5JCWA 1ERTA 4BWQA 5ECNB 2H19A 2H1GA 1N2AA 2PVQA 5J5NA 4IKHA 2H76A 2KP1A 2VCXA 2RM5A 3U6VA 3FZ5A 2E7PA 2GTUA 4ISDA 3ED3A 1B4QA 2X8GA 2OA7A 3DGQA 3BD2A 2TIRA 4MP4A 3HD5A 4LLRA 4OWYA 1SKRB 3LYPA 2DJKA 4PUAA 4IELA 2YWIA 5IOXA 4PGTA 1MD3A 2GGTA 2VLVA 1JFUA 3L78A 2ON7A 1H4OA 1MTCA 5D73A 4YQMA 1OVNA 3M3MA 3LG6A 3MAKA 3E3EA 1M0UA 4TOPA 1QFNA 3BCKA 3GKKA 1XW9A 4Q5NA 5A4UA 4WBRD 2EIQA 1URMA 4I8BA 10GSA 2IMIA 5IQYA 1XVQA 3HJPA 3EINA 4AJ6A 5B6MA 1V40A 4KE3A 1J08A 2VCTA 5G30A 2YWMA 3RDWA 22GSA 1M7TA 2WRTA 4G0LA 1K3YA 1X0RA 3IRAA 3RHCA 4GXZA 1SYXA 3DVXA 3RAZA 4EXJA 4AJ8A 1ZGNA 1BYEA 4O7HA 2C0GA 1YQ1A 4NWYA 5ECIB 3UVTA 1JZRA 5IMFA 3GHAA 3GX8A 1XIYA 1TK5B 2LNSA 4F2IA 3UL3A 2H1BA 4X43A 4JU5A 3KP8A 1Q4JA 4POLA 4N30A 2GSRA 5JWOB 1SJZA 2JU5A 4NV5A 3EMPA 3P90A 2V6OA 1ZOFA 2OBKA 1XW6A 4NHWA 1UN2A 3TB2A 1X5DA 3LORA 1YDKA 2R2JA 3O3TA 4HEA2 2IFQA 5G5EA 4V1Ap 2E0QA 3F3RA 4G2EA 4G0KA 4CHSA 4FO5A 3P7XA 5J4UA 4KA0A 4JEDA 2DC5A 4MPGA 1LJRA 1BG5A 4CDOA 3VWXA 1XW5A 4TR1A 4MABA 3CSHA 4IW9A 1ILOA 2HYXA 3ZL5A 2GS3A 1XPVA 2K18A 3HCZA 5KN2A 4K7NA 1U87A 2IFQB 3TKPA 3KZQA 4FYBA 3RBTA 1SL2B 5ECSA 1PA3A 3ZYWA 4MF5A 1U3AA 4ECCA 1X9MB 2YPMA 1DBYA 4GQCA 3E0UA 1E2YA 1PX7A 3WGXA 3EYTA 2IMKA 2JZTA 1TRUA 2C80A 3F4TA 5DALB 1M99A 3I43A 1ZYEA 1K0OA 1HNBA 4K7OA 2P5RA 19GSA 2M46A 3H8QA 3KP9A 2XHFA 3EC3A 4JR6A 2NTOA 4ZBBA 3KEBA 1BJXA 2I81A 5ECKB 2F3MA 4WR5A 1M2AA 5IMDA 3PINA 1Z7PA 3I6AA 3BOAA 4E8EA 4K0NA 2DMLA 2GZZA 2GQMA 1C72A 4RQRA 3GFKA 2HQTA 3A2VA 3KH7A 2K8SA 3F9UA 3FZ9A 4X0XA 1XWAA 3VURA 1T7PB 2MZCA 3GKMA 4TXOB 1XWKA 2D2ZA 5ID2A 2B1KA 5B8BA 4DSSB 4CW9A 4OD7A 4MDCA 2L5LA 2KLXA 1OC9A 2DBCA 5E59A 4ZBDA 5IMCA 2L4CA 2AYTA 1ON4A 4K8MA 2V32A 3MSZA 1B4PA 4HQZA 1A23A 4HI7A 4Q5FA 2YV7A 2YJ7A 1I5GA 1UA5A 3DWVA 2MBTA 1BAYA 5ID2B 2REMA 2LUSA 2R37A 3ERGA 3IK9A 16GSA 1ERVA 1QMVA 5DBQA 2QKEA 3CTGA 5D96A 4D73A 1USBA 4PQIA 1X5EA 2LRNA 1K0CA 2E2MA 4KCEA 5IM9A 4GCIA 1EEMA 1LBKA 1TW9A 4Q5RA 2MYGA 4I97A 3FR6A 1GSQA 5J9CA 3WT2A 5IMZA 5FWGA 1GUKA 4G0IA 1GTAA 5E4WA 3M8NA 5INYA 2B5XA 4RI6A 1EEJA 1BQ7A 3GUSA 2GSQA 4HQSA 2H6YA 5DQSA 2M80A 3M9KA 4MMMA 3DYRA 1GULA 3HZ8A 4GRFA 4NXIA 3TRXA 1YZXA 3UEMA 4YAVA 3ZMLA 1TJDA 4KDXA 4V1Ag 1G6WA 3TKQA 1MDIA 1W89A 3FY7A 3TOTA 3KH9A 3SBCA 5IIZA 3QFAC 3NIVA 1PMTA 5ECOB 2VD1A 1QUWA 4LL4B 4G10A 3FW2A 2GT6A 2KUCA 3A3TA 1O8XA 3QMXA 3QFBC 5DDLA 2R5GA 3DRNA 3QDNA 4XRDA 3IR4A 1YKAA 5DJMA 1XOBA 3TJFA 5DAKB 4IJ3A 1A2JA 1A8LA 3DIEA 3GV1A 2B7JA 5AGYA 3FYGA 4TVEA 2CVBA 5G1LA 5F8BA 4MPFA 3IAM2 4Q5QA 1FB6A 1SJIA 3F3QA 4ID0A 2ZCTA 3EU3A 4HU7A 1XXUA 1RQMA 4O92A 3FZ4A 3LGCA 2X99A 1TRWA 4TRXA 1NSWA 4RI7A 2IL3A 1QK8A 1TRSA 2C0DA 1T1VA 4EUYA 1K3LA 1OC8A 3V1WA 4EDYA 2PN8A 3W6GA 4MJCA 4WKWA 1ABAA 2C3QA 1OAZA 3CYNA 4I2UA 4YH2A 3AY8A 1EWXA 1AQVA 2VCVA 2WFCA 2HZEB 3HYPA 2YNXA 2K6VA 3KD0A 1EV9A 2LJKA 3GX0A 2H0IA 2LSTA 1YKCA 1PQNA 4L8EA 2YWNA 3ME7A 4KDYA 1G6YA 4MK3A 1SJ6A 2H1AA 4HUAA 2A2RA 5J41A 4LA1A 3HVVA 2OE0A 3I69A 3S9FA 3TCOA 4FH8A 4OCFA 2G0FA 1PKZA 4ZILA 3G7YA 1DSBA 2B1LA 1VF1A 3WGDA 1NM3A 3C1RA 3L0HA 3HKRA 1U3IA 1T4YA 3TKRA 1XCCA 4IJIA 2Z9SA 2H0HA 20GSA 2GQLA 2ZNMA 1B9XC 3HJMA 1GUHA 4I2TA 2H01A 2CX4A 2H73A 5ENUA 5JCGA 2AJQB 3GTUA 3LJRA 4KB3A 3J7Yb 1SENA 2C0FA 1A0RP 3H4KA 5LNKe 3FRCA 1A8YA 4J2FA 5HR0A 1WIKA 2VUPA 5LD0A 4MA9A 3LXZA 1J9BA 1TDIA 2DLXA 3NZNA 3NOFA 1THOA 1AIUA 2L6DA 4TW5A 3Q74A 4XS6A 1VF4A 4OFNA 3CBUA 1QQ2A 4PUFC 2ZUPA 1UC7A 2B5YA 2MMNA 2VOCA 3HA9A 4AF2A 3C7MA 2H74A 2P5QA 3N9JA 2KOKA 1S3CA 3A5WA 1V58A 1G7EA 3VI7A 3IC4A 3TKSE 2K9FA 1W4VA 2KP2A 1WP0A 4XS4A 1FVKA 4P3YB 5CYYA 6GSUA 1J0FA 4MZBA 4HJMA 2WCIA 5CREA 3ZVJD 1M2BA 3ZFBA 3IK7A 4KSOA 5EPFA 3LFLA 4IP6A 3IPZA 1SD8A 3MNGA 3D22A 1F37A 3RHBA 4PTSA 2PU9C 2UZ8A 3F63A 1I9DA 2AHEA 1GNEA 3GH9A 4XS4B 1RW1A 2HSHA 5EY6A 2DMMA 3IXRA 3TOUA 1SYRA 3P2AA 3HDCA 3DVWA 3C8EA 4GSTA 3VK9A 3WGEA 2DJ0A 1Z9HA 2OADA 1EOHA 2CAIA 5HQPA 1Z6NA 3GSSA 2DSAA 2LNTA 2XC2A 3TJBA 2BJXA 1SK0A 5BMUA 1VF2A 1ERWA 4WETA 1A2LA 1JZOA 2CAQA 3FK8A 3SWLA 4IN0A 4F82A 2FA4A 4AJ7A 3IHQA 1B8XA 3ME8A 1YF0A 1MD4A 5HFGA 5G2ZA 2LRTA 5LCZA 4DSRA 2JADA 4PURA 3QOUA 3GL5A 4MF7A 2YN1A 3QAWA 3EVIA 4TR4A 4TR3A 4MZWA 1FOVA 4DVCA 1PX6A 1FW1A 1T00A 1Z3EA 2I9HA 1BEDA 1O6JA 3KM6A 1G0TA 4OCEA 3LSZA 2H66A 1U6TA 4IQAA 9GSSA 5HR3A 4E8HA 2X64A 4GF0A 3QR6A 3M9JA 2XBQA 4ACSA 2OJLA 4TR1B 1MEKA 3EMXA 4WXTA 6GSXA 2L59A 3CRUA 3QD9A 4J56E 3ZREA 1UVZA 4KX4A 2H70A 5CP1A 1M2DA 2DIZA 4EVMA 1CQGA 5AIVA 3M1GA 5D9TA 2QGVA 3APQA 4KGIA 2K8VA 1OYJA 1TTZA 1O8WA 2FHEA 3EU4A 3ZRDA 5DJLA 2HI7A 1JLVA 4F03A 2AV4A 2BMXA 2GVPA 2GSTA 3G9BA 5G5FA 3D6IA 3DEXA 2CZ2A 3H1NA 5KN3A 4L0UA 2P0GA 2CV4A 4XCSA 18GSA 1T8EB 3DMLA 1DUGA 3F0IA 2AAWA 3QAVA 1QGVA 4L5OA 2AUVA 3ISOA 1AUCA 2HSMA 4K1FA 3ZMKA 3WD6A 2PUKC 5F05A 4EKZA 3VPTA 2HE3A 1OE7A 2M72A 4POMA 2VAFA 1S3DA 4PQHA 1TK0B 3L9UA 2RM6A 1HYUA 2GT5A 3K8NA 3TDGA 3GYKA 4TKYA 1XOAA 5GAND 4MJBA 2FY6A 2HFDA 1K0BA 2RIIA 2VLUA 1SKSB 2AB6A 4FIWA 2RLIA 5HFKA 5IOWA 4ULXA 1H75A 3N5OA 2H72A 1T4ZA 3HZ4A 4JRRA 2PMTA 3ZIJA 2IN3A 4EL1A 1SKWB 2C4JA 3P8WA 2MBSA 2PPTA 4IBPA 2L4QA 5GAPD 1TP9A 5ECPB 4POKA 4TN8A 1OC9B 2HRAA 3GIXA 3G7IA 1Z5YE 1G7OA 1PGTA 1THXA 1TI3A 4EC0A 3GKXA 3C1SA 2I1UA 3DKSA 1AQWA 1PL1A 5HFIA 4GSSA 5D9XA 4HS1A 1FVJA 1SU9A 3L9VA 4KUNA 3TGZA 2PERA 4XTSA 4BPYA 4ZBAA 4XRAA 2OKAA 2TRCP 1FHEA 3QPMA 1O73A 2VCWA 3L4NA 2FNOA 3UBLA 4D73B 4RQXA 4ILFA 4H86A 4HZ4A 4ZXGA 1TXXA 1ZZYA 3VPQA 1DE2A 2LJAA 1AC1A 3ZZXA 5H5QA 1Y25A 2PBJA 2O85A 4BVXA 1EGOA 3IOSA 4QQ7A 4QL7A 5ELAA 3UIWA 2VL9A 4FYCA 3M0FA 4KCAA 4ZL8A 4J57E 4K6XA 3HXSA 5ECRB 3TJGA 2P31A 1SL1B 2YWOA 5J3RA 1PD21 2FWEA 2JSZA 5A4WA 1ZCPA 5KN1A 3A2XA 4BVXB 4L0WA 1XVWA 4V2LA 3D21A 2LEGA 1SD9A 2WDUA 4LMWA 3UBKA 3TJKA 4N0VA 3EWLA 2ALBA 1PKWA 13GSA 1EP8A 1EP7A 1R7HA 3APSA 1XWBA 5AN1A 3RPPA 1X9WB 3UAPA 3GURA 3LWAA 3TRQA 2HT9A 3D4TA 3KXOA 1EV4A 1TOFA 14GSA 3F4RA 3QCPA 1CQHA 4WEYA 2WZ9A 1PSQA 3Q18A 2EC4A 12GSA 2VIMA 5F0GA 2H75A 3U5RE 3D4MA 2HRNA 4KH7A 2HLSA 1U88A 2YCDA 1PL2A 4OO5A 4JBBA 3LQ7A 3CSJA 1WWJA 2DJ1A 2JL4A 3FR3A 4AGSA 2JSYA 2KHPA 4NPBA 4PXOA 1TI1A 3F4SA 1V9WA 2NVLA 3KMNA 1WRYA 2CA8A 4MH3A 1EZKA 5H5RA 1GLQA 2L5OA 2GZYA 1TRVA 3MDKA 5ELGA 1YEXA 3C71A 1Z7RA 3CMIA 5B6NA 5D93A 1KBNA 2CT6A 4N10A 3IAS2 2HRKA 2VCQA 2O87A 2C3TA 2WB9A 2I4AA 1JHBA 1FB0A 1ZYQB 2YJHA 3PPUA 3APOA 2YANA 2ON5A 1ZMAA 1K3OA 5EVOA 1YF1A 1V98A 2H6ZA 3G7JA 2VO4A 2CQ9A 1PN9A 5IO0A 3F6DA 2CVKA 1Q98A 3HY2A 1A0FA 3GRXA 6GSVA 1SK2A 1K0DA 5ECHB 1AQXA 3PR8A 3CXGA 4MJEA 5COHA 4BA7A 3Q19A 4YQVA 4POBA 2HSYA 1Y6EA 5F07A 1OE8A 3VWVA 2J23A 4WBJA 1GUMA 1KNGA 2YZHA 3KMOA 4NMUA 5IO2A 4XIHA 1WJKA 2OBIA 3EE2A 2V6KA 5GSSA 3ZITA 4KAEA 3GTUB 3OR5A 4GQFA 2LQQA 4OMVA 2XBIA 2OACA 1K0NA 1ST9A 3FHKA 2MMAA 2FGXA 2NDOA 4MF6A 3IE3A 1DE1A 4I6XA 1V2AA 1HNAA 1VF3A 7GSSA 5IMVA 3TUEA 2C3NA 3HHVA 5ABRA 1MDJA 4KW6A 4NAXA 4KNDA 1F6MC 3F8UA 17GSA 4F9ZA 4Z7XA 2FA8A 4ML6A 2RUEA 4OFMA 3I9V2 1SK1A 4NHZA 3FR9A 3KCMA 4YQUA 3IC8A 2EIOA 5CRHA 5CAXA 2DIYA 2C0EA 1IYHA 3R2QA 1XBSA 5A5KA 1AAZA 5A4VA 3A2WA 2GDRA 2B7KA 4IQ1A 4N11A 4HZ2A 1R4WA 2V41A 1JZWA 4ZL7A 1B48A 1YY7A 4KSMA 2IWTA 2FWGA 3H79A 5KEJA 1O85A 4JZQA 4JR4A 1TU7A 3LEFA 2CZ3A 3PGTA 6GSWA 4G19A 3ZTLA 2GSSA 1BX9A 2C8UA 5ECMB 1NHYA 2N5FA 5DVBA 4TR0A 4TXVA 4G9HA 3Q6OA 2G2QA 4XHMA 5ECQB 3PH9A 2RUFA 4GSNA 3GN3A 4MH2A 2N5AA 5D8IA 2PGTA 1GRXA 1PRXA 2DJ2A 4MCUA 3LYKA 1GL8A 3LXTA 3D5JA 4LMVA 1M9AA 3ZLPA 1FG4A 4ECIA
chains in the Genus database with same CATH superfamily
4RUVA 3US3A 1QXHA 2IJYA 5FHIA 3F6FA 3ZIVA 6GSSA 2IMFA 2HSNB 1XWCA 2QC7A 4YAPA 3GSTA 5DALA 1GNWA 5G31A 2B3SA 5CRDA 2LJRA 4O32A 1GLPA 2GZPA 2EIRA 5DCGA 8GSSA 3VI5A 1ACVA 2H6XA 3VFIA 5BRTA 1PN0A 2OE3A 5C00A 1T3BA 2LKUA 2LV3A 4V2MA 3KJYA 4MLYA 2LTKA 3RPNA 4WF4A 4FXYP 2GLRA 2J9HA 4GWRA 2XPEA 2L6CA 4Z2TA 5HR1A 1XFLA 5CRGA 2H1DA 3UARA 4G01A 4IP1A 4ECBA 3GA4A 5D9WA 2X8HA 3TRPA 4K2DA 1OC3A 2R0GA 2R4VA 1JLWA 2R6KA 5JWQB 3CRTA 1MDKA 1V57A 1KTEA 4QL9A 4TXOA 5IPGA 2YP6A 5GSTA 1WOUA 4GLTA 1GSFA 3CTFA 4DSSA 4ML1A 1GP1A 4PX1A 3ZVJA 5D9VA 3GH6A 3TJJA 1S3AA 3W8SA 4DEJA 2F9SA 4JE1A 1X5CA 1EOGA 1GSUA 3FMWA 4PNFA 4L5LA 2B5EA 1A24A 2HSMB 2WVZA 3H93A 2CVDA 1ZYPA 4K7IA 2FWHA 3JCML 2E2GA 1FOHA 1VRSD 4EO3A 2DJJA 5J4YA 1WMJA 1FAAA 1WPIA 4USSA 2VD0A 2FLSA 2L57A 2OE1A 3O76A 2PVOC 3W8JA 2LQOA 4V2NA 5B7CA 2VL3A 4EE0A 2JZRA 5B8AA 2VL2C 1LU4A 4F0BA 3BBYA 2X49A 1HD2A 3WT1A 2BTOT 4ICYA 3IBHA 4X1UA 4AI6A 2FWFA 4IGJA 2N5BA 4LL1B 1R26A 1GSDA 3VLNA 1F3BA 5CNWA 5KN0A 1TKDB 3MIXA 5DCHA 1O81A 2VL2A 3E9JB 2HZFA 5G1KA 2H0GA 2VLTA 4OFTA 4HJ2A 1GTBA 5EL8A 3J7Yk 2C1YA 2VM1A 1X9SB 5A5HA 1F3AA 4N0ZA 1EGRA 4WR4A 4A5PA 3ZFLA 1R5AA 2IMDA 2I3YA 2NBSA 2MMZA 1XZOA 2R3XA 2PWJA 1AXDA 4OO4A 1A2MA 1GSYA 2HRFA 1OKDA 2A2SA 4IHUA 3VWWA 5H5SA 3UJ1A 2JZSA 3UMAA 4PQ1A 3ERWA 5ECLB 1NW2A 1IYIA 1F9MA 3HJOA 5DAKA 1VGLA 2V2GA 1OKTA 6GSTA 1GH2A 5L71A 4MJAA 3C73A 1JZDA 3IV4A 3DXBA 2DJ3A 2CX3A 2IMEA 2VCZA 1K0MA 2WW0A 2YZUA 4IVFA 4K0GA 1ERUA 4ECJA 2QSIA 3FEUA 4PNGA 1I1IP 4I5QA 3BCIA 2MMOA 3HVSA 2ES7A 4FQUA 2FUG2 5DQYA 3R3EA 1TK8B 4AKGA 2VM2A 4MZCA 2O89A 2LRCA 2O8VB 4ZB8A 3BJ5A 3UVHA 4ZIJA 1HQOA 2WS2A 4NV2A 3KTBA 2B6MA 4HDEA 1ZL9A 1R5PA 1AW9A 4HSCX 4K9ZA 1WE0A 1GTIA 3GKNA 5CO3A 2H71A 3ERFA 5IPHA 4ZB9A 3GL3A 1F2EA 5AISA 11GSA 4KF9A 1GSEA 2H8LA 2HZEA 2FCHA 1YEPA 1GSSA 2GQKA 2WJUA 4N3ZA 5C04A 1XWGA 1SL0B 2YV9A 3UOMA 5J9BA 1E6BA 1GWCA 4HOJA 5HR2A 3GNJA 4EF0A 4ZL9A 4O5RA 1GTUA 3TKSC 2LS5A 3FKFA 4BVYA 2O7KA 4WF5A 3KGKA 2F8FA 2NPBA 3KTLA 2FD3A 5J47A 2XPDA 1FO5A 2DKIA 3MWHA 4BL7A 5IMAA 2IIYA 1N8JA 2TRXA 3EURA 4DSQA 5JWRB 1Z6MA 2V1MA 1B9YC 5A1NB 3DD3A 3GMFA 4ZB7A 5FT3A 1KEBA 2F8AA 3WYWA 4HU9A 2YOIA 1RK4A 2WULA 4EDZA 3O6TA 4ZB6A 1O7UA 2F51A 3TKSA 3IDVA 4MNNA 5CRWA 4BVYB 3FZAA 4BWSA 1M9BA 2IPAA 3IA1A 3QAGA 1TU8A 4F0CA 3D0ZA 4IS0A 4BL7B 5JCUA 4KDUA 2HNLA 2X8CA 3HVXA 1NHOA 1ML6A 3VWUA 2WW2A 2R0PA 3HVNA 4FYUA 3KIJA 2HRKB 4GTUA 1K0AA 2A4VA 5GZZB 1YJ6A 2WGRA 1HNCA 2JACA 3CSIA 2H30A 2HXKA 4XS1A 3L9SA 5F06A 6GSYA 5AIXA 5JCWA 1ERTA 4BWQA 5ECNB 2H19A 2H1GA 1N2AA 2PVQA 5J5NA 4IKHA 2H76A 2KP1A 2VCXA 2RM5A 3U6VA 3FZ5A 2E7PA 2GTUA 4ISDA 3ED3A 1B4QA 2X8GA 2OA7A 3DGQA 3BD2A 2TIRA 4MP4A 3HD5A 4LLRA 4OWYA 1SKRB 3LYPA 2DJKA 4BIKA 4PUAA 4IELA 2YWIA 5IOXA 4PGTA 1MD3A 2GGTA 2VLVA 1JFUA 3L78A 2ON7A 1H4OA 1MTCA 5D73A 2A4HA 4YQMA 1OVNA 3M3MA 3LG6A 3MAKA 3E3EA 1M0UA 4TOPA 4K2XA 1QFNA 3BCKA 3GKKA 1XW9A 4Q5NA 5A4UA 4WBRD 2EIQA 1URMA 4I8BA 10GSA 2IMIA 5IQYA 1XVQA 3HJPA 3EINA 4AJ6A 5B6MA 1V40A 4KE3A 1J08A 2VCTA 5G30A 2YWMA 3RDWA 3IHGA 22GSA 1M7TA 2WRTA 4G0LA 1K3YA 1X0RA 3IRAA 3RHCA 4GXZA 1SYXA 3DVXA 3RAZA 4EXJA 4AJ8A 1ZGNA 1BYEA 4O7HA 2C0GA 1SVMA 1YQ1A 4NWYA 5ECIB 3UVTA 1JZRA 5IMFA 3GHAA 3GX8A 1XIYA 1YEWC 1TK5B 2LNSA 4F2IA 3UL3A 2H1BA 4X43A 2WVYA 3CQFA 4JU5A 3KP8A 1Q4JA 4POLA 1TXUA 4N30A 4PI0C 2GSRA 5JWOB 1SJZA 2JU5A 4NV5A 3EMPA 3P90A 2V6OA 1ZOFA 2OBKA 1XW6A 4NHWA 1UN2A 3TB2A 1Y1UA 1X5DA 3LORA 1YDKA 2R2JA 3O3TA 4HEA2 2IFQA 5G5EA 4V1Ap 2E0QA 3F3RA 4G2EA 4G0KA 4CHSA 4FO5A 3P7XA 5J4UA 4KA0A 4JEDA 2DC5A 4MPGA 1LJRA 1BG5A 4CDOA 3VWXA 1XW5A 4TR1A 4MABA 3CSHA 4IW9A 1ILOA 2HYXA 3ZL5A 2GS3A 2WZSA 1XPVA 2K18A 4AKIA 3HCZA 5KN2A 4K7NA 1U87A 2IFQB 3TKPA 3KZQA 4FYBA 3RBTA 1SL2B 5ECSA 1PA3A 3ZYWA 4MF5A 1U3AA 4ECCA 1X9MB 2YPMA 1DBYA 4GQCA 3E0UA 1E2YA 1PX7A 3WGXA 3EYTA 2IMKA 2JZTA 1TRUA 2C80A 3F4TA 5DALB 5J4VA 1M99A 3I43A 1ZYEA 1K0OA 1HNBA 4K7OA 2P5RA 19GSA 2M46A 3H8QA 3KP9A 2XHFA 3EC3A 4JR6A 2NTOA 4ZBBA 3KEBA 1BJXA 2I81A 5ECKB 1SVLA 2F3MA 4WR5A 1M2AA 5IMDA 3PINA 1Z7PA 3I6AA 3BOAA 4E8EA 4K0NA 2DMLA 2GZZA 2GQMA 1C72A 4RQRA 3GFKA 2HQTA 3A2VA 3KH7A 2K8SA 3F9UA 3FZ9A 4X0XA 1XWAA 3VURA 2QA2A 1T7PB 2MZCA 3GKMA 4TXOB 1XWKA 2D2ZA 5ID2A 2B1KA 5B8BA 4DSSB 4CW9A 4OD7A 4MDCA 4PI2C 2L5LA 2KLXA 1OC9A 2DBCA 5E59A 4ZBDA 5IMCA 2L4CA 2AYTA 1ON4A 4K8MA 2V32A 3MSZA 1B4PA 4HQZA 1A23A 4HI7A 4Q5FA 2YV7A 2YJ7A 1I5GA 1UA5A 3DWVA 2MBTA 1BAYA 4YKGA 5ID2B 2REMA 2LUSA 2R37A 3ERGA 2WW1A 3IK9A 16GSA 1ERVA 1QMVA 5DBQA 2QKEA 3CTGA 5D96A 4D73A 1USBA 4PQIA 1X5EA 2LRNA 1K0CA 2E2MA 4KCEA 5IM9A 4GCIA 1EEMA 1LBKA 1TW9A 4Q5RA 2MYGA 4I97A 3FR6A 1GSQA 5J9CA 3WT2A 5IMZA 5FWGA 1GUKA 4G0IA 1GTAA 5E4WA 3M8NA 5INYA 2B5XA 4RI6A 1EEJA 1BQ7A 3GUSA 2GSQA 4HQSA 2H6YA 5DQSA 2M80A 3M9KA 4MMMA 3DYRA 1GULA 3HZ8A 4GRFA 4NXIA 3TRXA 1YZXA 3UEMA 5A5HB 4YAVA 3ZMLA 1TJDA 4KDXA 4V1Ag 1G6WA 3TKQA 1MDIA 1W89A 3FY7A 3TOTA 3KH9A 3SBCA 5IIZA 3QFAC 3NIVA 1PMTA 5ECOB 2VD1A 1QUWA 4LL4B 4G10A 3FW2A 2GT6A 2KUCA 3A3TA 1O8XA 3QMXA 3QFBC 5DDLA 2R5GA 3DRNA 3QDNA 4XRDA 3IR4A 1YKAA 5DJMA 1XOBA 3TJFA 5DAKB 4IJ3A 1A2JA 1A8LA 3DIEA 3GV1A 2B7JA 5AGYA 2EFDA 3FYGA 4TVEA 2CVBA 2O36A 5G1LA 5F8BA 4MPFA 3IAM2 4GDFA 4Q5QA 1FB6A 1SJIA 3F3QA 4ID0A 2ZCTA 3EU3A 4HU7A 1XXUA 1RQMA 4O92A 3FZ4A 3LGCA 2X99A 3A5IA 1TRWA 4EIPA 4TRXA 1NSWA 4RI7A 2IL3A 1QK8A 1TRSA 2C0DA 1T1VA 4EUYA 1K3LA 1OC8A 3V1WA 4EDYA 2PN8A 3W6GA 4MJCA 4WKWA 1ABAA 2C3QA 1OAZA 3CYNA 4I2UA 3MYDA 4YH2A 2DKHA 3AY8A 1EWXA 1AQVA 2VCVA 2WFCA 4CY8A 2HZEB 3HYPA 2YNXA 2K6VA 3KD0A 1EV9A 2LJKA 3GX0A 2H0IA 2LSTA 1YKCA 1PQNA 4L8EA 2YWNA 3ME7A 4KDYA 1G6YA 4MK3A 1SJ6A 2H1AA 4HUAA 2A2RA 5J41A 4LA1A 3HVVA 2OE0A 3I69A 3S9FA 3TCOA 4FH8A 4OCFA 2G0FA 1PKZA 4ZILA 3G7YA 1DSBA 2B1LA 1VF1A 3WGDA 1NM3A 3C1RA 3L0HA 3HKRA 4EIQA 1U3IA 1T4YA 3TKRA 1XCCA 4IJIA 2Z9SA 2H0HA 20GSA 2GQLA 2ZNMA 2H1LA 1B9XC 3HJMA 1GUHA 4X4JA 5KOXA 4I2TA 2H01A 2CX4A 2H73A 5ENUA 5JCGA 2AJQB 3GTUA 3LJRA 4KB3A 3J7Yb 1SENA 2C0FA 1A0RP 3H4KA 5LNKe 3FRCA 1A8YA 4J2FA 5HR0A 1WIKA 2VUPA 5LD0A 4MA9A 3LXZA 1J9BA 1TDIA 2DLXA 3NZNA 3TU3B 3NOFA 1THOA 1AIUA 2L6DA 4TW5A 3Q74A 4XS6A 1VF4A 4OFNA 3CBUA 1QQ2A 4PUFC 2ZUPA 1UC7A 2B5YA 2MMNA 2VOCA 3HA9A 4AF2A 3C7MA 2H74A 2P5QA 5KOWA 3N9JA 2KOKA 1S3CA 3A5WA 1V58A 1G7EA 3VI7A 4YKFA 3IC4A 3TKSE 2K9FA 1W4VA 2KP2A 1WP0A 4XS4A 1FVKA 4P3YB 5CYYA 6GSUA 1J0FA 4MZBA 4HJMA 2WCIA 2EFEA 5CREA 3ZVJD 1M2BA 3ZFBA 3IK7A 4KSOA 5EPFA 3LFLA 4IP6A 3IPZA 1SD8A 3MNGA 2WVXA 3D22A 1F37A 3RHBA 4PTSA 2PU9C 2UZ8A 3F63A 1I9DA 2AHEA 1GNEA 3GH9A 4XS4B 1RW1A 2HSHA 5EY6A 2DMMA 3IXRA 3TOUA 1SYRA 3P2AA 3HDCA 3DVWA 3C8EA 4GSTA 3VK9A 3WGEA 2DJ0A 2A2PA 1Z9HA 2OADA 1EOHA 2CAIA 5HQPA 1Z6NA 3GSSA 2DSAA 2LNTA 2XC2A 3TJBA 2BJXA 1SK0A 5BMUA 1VF2A 1ERWA 4WETA 5A34A 1A2LA 1JZOA 2CAQA 3FK8A 3SWLA 4IN0A 4F82A 2FA4A 4AJ7A 3IHQA 1B8XA 3ME8A 1YF0A 1MD4A 5HFGA 5G2ZA 2LRTA 5LCZA 2VKZG 2JADA 4DSRA 1S3RA 4PURA 3QOUA 3GL5A 4MF7A 1SVOA 2YN1A 3QAWA 3EVIA 4TR4A 4TR3A 4MZWA 1FOVA 4DVCA 2HSNA 4CY6A 1PX6A 1FW1A 1T00A 4PHZC 1Z3EA 2I9HA 1BEDA 1XG8A 1O6JA 3KM6A 1G0TA 4OCEA 3LSZA 2H66A 1U6TA 4IQAA 9GSSA 5HR3A 4E8HA 2X64A 4K5RA 4GF0A 3QR6A 3M9JA 2XBQA 4ACSA 2OJLA 4TR1B 1MEKA 3EMXA 4WXTA 6GSXA 4AKXB 2L59A 3CRUA 3QD9A 4J56E 3ZREA 1UVZA 4KX4A 2H70A 5CP1A 1M2DA 2DIZA 4EVMA 1CQGA 5AIVA 3M1GA 5D9TA 2QGVA 3APQA 4KGIA 2K8VA 1OYJA 1TTZA 1O8WA 2FHEA 1BF5A 3EU4A 3ZRDA 5DJLA 2HI7A 1JLVA 4F03A 2AV4A 2BMXA 2GVPA 2GSTA 3G9BA 5G5FA 3D6IA 3DEXA 2CZ2A 3H1NA 5KN3A 4L0UA 2O3EA 2P0GA 2CV4A 4XCSA 18GSA 2OT3A 1T8EB 3DMLA 1DUGA 3F0IA 2AAWA 3QAVA 1QGVA 4L5OA 2AUVA 3ISOA 1AUCA 2HSMA 4K1FA 3ZMKA 2X4AA 3WD6A 2PUKC 5F05A 4EKZA 3VPTA 2HE3A 1OE7A 2M72A 4POMA 2VAFA 1S3DA 4PQHA 1TK0B 3L9UA 2RM6A 1HYUA 2GT5A 3K8NA 3TDGA 3GYKA 4TKYA 1XOAA 5GAND 4MJBA 2FY6A 2HFDA 1K0BA 2RIIA 2VLUA 1SKSB 2AB6A 4FIWA 4W66A 2RLIA 5HFKA 5IOWA 4ULXA 1H75A 4Z2UA 3N5OA 2H72A 1T4ZA 3HZ4A 4JRRA 2PMTA 3ZIJA 2IN3A 4EL1A 4O5QA 1SKWB 2C4JA 3P8WA 2MBSA 2EFCA 2PPTA 4IBPA 2L4QA 5GAPD 1TP9A 5ECPB 4POKA 4K5SA 4TN8A 1OC9B 2HRAA 3GIXA 3G7IA 1Z5YE 1G7OA 1PGTA 1THXA 1TI3A 4EC0A 3GKXA 3C1SA 2I1UA 3DKSA 1AQWA 1PL1A 5HFIA 4GSSA 2R0CA 5D9XA 4HS1A 1FVJA 1SU9A 3L9VA 4KUNA 3TGZA 2PERA 3RFRC 4XTSA 4BPYA 4ZBAA 4XRAA 2OKAA 2TRCP 1FHEA 3QPMA 1O73A 2VCWA 3L4NA 2FNOA 4O5UA 3UBLA 4D73B 4RQXA 1N25A 4ILFA 4H86A 4HZ4A 4ZXGA 1TXXA 1ZZYA 3VPQA 1DE2A 2LJAA 1AC1A 3ZZXA 5H5QA 1Y25A 2PBJA 2O85A 4BVXA 1EGOA 3IOSA 4QQ7A 4QL7A 5ELAA 3UIWA 2VL9A 4FYCA 3M0FA 4KCAA 4ZL8A 4J57E 4K6XA 3HXSA 5ECRB 2QA1A 3TJGA 2P31A 1SL1B 2YWOA 5J3RA 1PD21 2FWEA 2JSZA 5A4WA 1ZCPA 5KN1A 3A2XA 4BVXB 3RGBC 1M3IA 4L0WA 1XVWA 4V2LA 3D21A 2LEGA 1SD9A 2WDUA 4LMWA 3UBKA 3TJKA 4N0VA 3EWLA 2ALBA 1PKWA 13GSA 1EP8A 1EP7A 1R7HA 3APSA 1XWBA 5AN1A 2EFHA 3RPPA 1X9WB 3UAPA 3GURA 3LWAA 3TRQA 2HT9A 3D4TA 3KXOA 1EV4A 1TOFA 14GSA 1PFOA 3F4RA 3QCPA 1CQHA 4AKHA 4WEYA 2WZ9A 1PSQA 3Q18A 2EC4A 12GSA 2VIMA 5F0GA 2H75A 3U5RE 3D4MA 2HRNA 4KH7A 2HLSA 1U88A 2YCDA 1PL2A 4OO5A 4JBBA 3LQ7A 5A1NA 3CSJA 1WWJA 2DJ1A 2JL4A 3FR3A 4AGSA 2JSYA 2KHPA 4NPBA 2UV8G 4PXOA 1TI1A 3F4SA 1M3JA 1V9WA 2NVLA 3KMNA 1WRYA 2CA8A 4MH3A 1EZKA 5H5RA 1GLQA 2L5OA 2GZYA 2O5VA 1TRVA 3MDKA 5ELGA 1YEXA 3C71A 1Z7RA 3CMIA 5B6NA 5D93A 1KBNA 2CT6A 4N10A 1YVLA 3IAS2 2HRKA 3HMJG 2VCQA 2O87A 2C3TA 2WB9A 2I4AA 1JHBA 1FB0A 1ZYQB 2YJHA 3PPUA 3APOA 2YANA 2ON5A 1ZMAA 4QMKA 1K3OA 5EVOA 1YF1A 1V98A 2H6ZA 3G7JA 2VO4A 2CQ9A 1PN9A 5IO0A 3F6DA 2CVKA 1Q98A 3HY2A 1A0FA 3GRXA 6GSVA 1SK2A 1K0DA 5ECHB 1AQXA 3PR8A 3CXGA 4MJEA 5COHA 4BA7A 3Q19A 4YQVA 4POBA 2HSYA 1Y6EA 5F07A 1OE8A 3VWVA 2J23A 4WBJA 1GUMA 1KNGA 2YZHA 3KMOA 4NMUA 5IO2A 4XIHA 1WJKA 2OBIA 3EE2A 2V6KA 5GSSA 1S4BP 3ZITA 4KAEA 3CHXC 3GTUB 3OR5A 4GQFA 2LQQA 4OMVA 2XBIA 2OACA 1K0NA 1ST9A 3FHKA 2MMAA 2FGXA 1ZYNA 2NDOA 4MF6A 3IE3A 5J40A 1DE1A 4I6XA 1V2AA 1HNAA 1VF3A 7GSSA 3CWGA 5IMVA 3TUEA 2C3NA 3HHVA 5ABRA 1MDJA 4KW6A 4NAXA 4KNDA 1F6MC 3F8UA 17GSA 4F9ZA 4Z7XA 2FA8A 4ML6A 2RUEA 4OFMA 3I9V2 1SK1A 4NHZA 3FR9A 3KCMA 4YQUA 3IC8A 2EIOA 5CRHA 5CAXA 2DIYA 2C0EA 1IYHA 3R2QA 1XBSA 5A5KA 1AAZA 5A4VA 3A2WA 2GDRA 2B7KA 4IQ1A 4N11A 4HZ2A 1R4WA 2V41A 2WVXB 1JZWA 4ZL7A 1B48A 1YY7A 4KSMA 2IWTA 4E68A 2FWGA 3H79A 5KEJA 1O85A 4JZQA 4JR4A 1TU7A 3LEFA 2CZ3A 3PGTA 6GSWA 4G19A 3ZTLA 2GSSA 1BX9A 3EPTA 2C8UA 2WW3A 5ECMB 4Z2RA 1NHYA 2N5FA 5DVBA 4TR0A 4TXVA 4G9HA 3Q6OA 5BMUB 2G2QA 4XHMA 5A34B 5ECQB 3PH9A 2RUFA 4GSNA 3GN3A 4MH2A 2N5AA 5D8IA 2PGTA 1GRXA 1PRXA 2DJ2A 4MCUA 3LYKA 1BG1A 1GL8A 3LXTA 3D5JA 4LMVA 1M9AA 3ZLPA 1FG4A 3LW9A 4ECIA
chains in the Genus database with same CATH topology
4RUVA 3US3A 1QXHA 2IJYA 5FHIA 3F6FA 3ZIVA 6GSSA 2IMFA 2HSNB 1XWCA 2QC7A 4YAPA 3GSTA 5DALA 1GNWA 5G31A 2B3SA 5CRDA 2LJRA 4O32A 1GLPA 2GZPA 2EIRA 5DCGA 8GSSA 3VI5A 1ACVA 2H6XA 3VFIA 5BRTA 1PN0A 2OE3A 5C00A 1T3BA 2LKUA 2LV3A 4V2MA 3KJYA 4MLYA 2LTKA 3RPNA 4WF4A 2GLRA 2J9HA 4GWRA 2XPEA 2L6CA 4Z2TA 5HR1A 1XFLA 5CRGA 2H1DA 3UARA 4G01A 4IP1A 4ECBA 3GA4A 5D9WA 2X8HA 3TRPA 4K2DA 1OC3A 2R0GA 2R4VA 1JLWA 2R6KA 5JWQB 3CRTA 1MDKA 1V57A 1KTEA 4QL9A 4TXOA 5IPGA 2YP6A 5GSTA 1WOUA 4GLTA 1GSFA 3CTFA 4DSSA 4ML1A 1GP1A 4PX1A 3ZVJA 5D9VA 3GH6A 3TJJA 1S3AA 3W8SA 4DEJA 2F9SA 4JE1A 1X5CA 1EOGA 1GSUA 3FMWA 4PNFA 4L5LA 2B5EA 1A24A 2HSMB 3H93A 2CVDA 1ZYPA 4K7IA 2FWHA 3JCML 2E2GA 1FOHA 1VRSD 4EO3A 2DJJA 5J4YA 1WMJA 1FAAA 1WPIA 4USSA 2VD0A 2FLSA 2L57A 2OE1A 3O76A 2PVOC 3W8JA 2LQOA 4V2NA 5B7CA 2VL3A 4EE0A 2JZRA 5B8AA 2VL2C 1LU4A 4F0BA 3BBYA 2X49A 1HD2A 3WT1A 2BTOT 4ICYA 3IBHA 4X1UA 4AI6A 2FWFA 4IGJA 2N5BA 4LL1B 1R26A 1GSDA 3VLNA 1F3BA 5CNWA 5KN0A 1TKDB 3MIXA 5DCHA 1O81A 2VL2A 3E9JB 2HZFA 5G1KA 2H0GA 2VLTA 4OFTA 4HJ2A 1GTBA 5EL8A 3J7Yk 2C1YA 2VM1A 1X9SB 5A5HA 1F3AA 4N0ZA 1EGRA 4WR4A 4A5PA 3ZFLA 1R5AA 2IMDA 2I3YA 2NBSA 2MMZA 1XZOA 2R3XA 2PWJA 1AXDA 4OO4A 1A2MA 1GSYA 2HRFA 1OKDA 2A2SA 4IHUA 3VWWA 5H5SA 3UJ1A 2JZSA 3UMAA 4PQ1A 3ERWA 5ECLB 1NW2A 1IYIA 1F9MA 3HJOA 5DAKA 1VGLA 2V2GA 1OKTA 6GSTA 1GH2A 5L71A 4MJAA 3C73A 1JZDA 3IV4A 3DXBA 2DJ3A 2CX3A 2IMEA 2VCZA 1K0MA 2YZUA 4IVFA 4K0GA 1ERUA 4ECJA 2QSIA 3FEUA 4PNGA 4I5QA 3BCIA 2MMOA 3HVSA 2ES7A 4FQUA 2FUG2 5DQYA 3R3EA 1TK8B 4AKGA 2VM2A 4MZCA 2O89A 2LRCA 4ZB8A 2O8VB 3BJ5A 3UVHA 4ZIJA 1HQOA 2WS2A 4NV2A 3KTBA 2B6MA 4HDEA 1ZL9A 1R5PA 1AW9A 4K9ZA 1WE0A 1GTIA 3GKNA 5CO3A 2H71A 3ERFA 5IPHA 4ZB9A 3GL3A 1F2EA 5AISA 11GSA 4KF9A 1GSEA 2H8LA 2HZEA 2FCHA 1YEPA 1GSSA 2GQKA 2WJUA 4N3ZA 5C04A 1XWGA 1SL0B 2YV9A 3UOMA 5J9BA 1E6BA 1GWCA 4HOJA 5HR2A 3GNJA 4EF0A 4ZL9A 4O5RA 1GTUA 3TKSC 2LS5A 3FKFA 4BVYA 2O7KA 4WF5A 3KGKA 2F8FA 2NPBA 3KTLA 2FD3A 5J47A 2XPDA 1FO5A 3MWHA 2DKIA 4BL7A 5IMAA 2IIYA 1N8JA 2TRXA 3EURA 4DSQA 5JWRB 1Z6MA 2V1MA 1B9YC 5A1NB 3DD3A 3GMFA 4ZB7A 5FT3A 1KEBA 2F8AA 3WYWA 4HU9A 2YOIA 1RK4A 2WULA 4EDZA 3O6TA 4ZB6A 1O7UA 2F51A 3TKSA 3IDVA 4MNNA 5CRWA 4BVYB 3FZAA 4BWSA 1M9BA 2IPAA 3IA1A 3QAGA 1TU8A 4F0CA 3D0ZA 4IS0A 4BL7B 5JCUA 4KDUA 2HNLA 2X8CA 3HVXA 1NHOA 1ML6A 3VWUA 2R0PA 4FYUA 3KIJA 2HRKB 4GTUA 1K0AA 2A4VA 5GZZB 1YJ6A 2WGRA 1HNCA 2JACA 3CSIA 2H30A 2HXKA 4XS1A 3L9SA 5F06A 6GSYA 5AIXA 5JCWA 1ERTA 4BWQA 5ECNB 2H19A 2H1GA 1N2AA 2PVQA 5J5NA 4IKHA 2H76A 2KP1A 2VCXA 2RM5A 3U6VA 3FZ5A 2E7PA 2GTUA 4ISDA 3ED3A 1B4QA 2X8GA 2OA7A 3DGQA 3BD2A 2TIRA 4MP4A 3HD5A 4LLRA 4OWYA 1SKRB 3LYPA 2DJKA 4PUAA 4IELA 2YWIA 5IOXA 4PGTA 1MD3A 2GGTA 2VLVA 1JFUA 3L78A 2ON7A 1H4OA 1MTCA 5D73A 2A4HA 4YQMA 1OVNA 3M3MA 3LG6A 3MAKA 3E3EA 1M0UA 4TOPA 4K2XA 1QFNA 3BCKA 3GKKA 1XW9A 4Q5NA 5A4UA 4WBRD 2EIQA 1URMA 4I8BA 10GSA 2IMIA 5IQYA 1XVQA 3HJPA 3EINA 4AJ6A 5B6MA 1V40A 4KE3A 1J08A 2VCTA 5G30A 2YWMA 3RDWA 3IHGA 22GSA 1M7TA 2WRTA 4G0LA 1K3YA 1X0RA 3IRAA 3RHCA 4GXZA 1SYXA 3DVXA 3RAZA 4EXJA 4AJ8A 1ZGNA 1BYEA 4O7HA 2C0GA 1SVMA 1YQ1A 4NWYA 5ECIB 3UVTA 1JZRA 5IMFA 3GHAA 3GX8A 1XIYA 1TK5B 2LNSA 4F2IA 3UL3A 2H1BA 4X43A 4JU5A 3KP8A 1Q4JA 4POLA 1TXUA 4N30A 2GSRA 5JWOB 1SJZA 2JU5A 4NV5A 3EMPA 3P90A 2V6OA 1ZOFA 2OBKA 1XW6A 4NHWA 1UN2A 3TB2A 1Y1UA 1X5DA 3LORA 1YDKA 2R2JA 3O3TA 4HEA2 2IFQA 5G5EA 4V1Ap 2E0QA 3F3RA 4G2EA 4G0KA 4CHSA 4FO5A 3P7XA 5J4UA 4KA0A 4JEDA 2DC5A 4MPGA 1LJRA 1BG5A 4CDOA 3VWXA 1XW5A 4TR1A 4MABA 3CSHA 4IW9A 1ILOA 2HYXA 3ZL5A 2GS3A 1XPVA 2K18A 4AKIA 3HCZA 5KN2A 4K7NA 1U87A 2IFQB 3TKPA 3KZQA 4FYBA 3RBTA 1SL2B 5ECSA 1PA3A 3ZYWA 4MF5A 1U3AA 4ECCA 1X9MB 2YPMA 1DBYA 4GQCA 3E0UA 1E2YA 1PX7A 3WGXA 3EYTA 2IMKA 2JZTA 1TRUA 2C80A 3F4TA 5DALB 5J4VA 1M99A 3I43A 1ZYEA 1K0OA 1HNBA 4K7OA 2P5RA 19GSA 2M46A 3H8QA 3KP9A 2XHFA 3EC3A 4JR6A 2NTOA 4ZBBA 3KEBA 1BJXA 2I81A 5ECKB 1SVLA 2F3MA 4WR5A 1M2AA 5IMDA 3PINA 1Z7PA 3I6AA 3BOAA 4E8EA 4K0NA 2DMLA 2GZZA 2GQMA 1C72A 4RQRA 3GFKA 2HQTA 3A2VA 3KH7A 2K8SA 3F9UA 3FZ9A 4X0XA 1XWAA 3VURA 2QA2A 1T7PB 2MZCA 3GKMA 4TXOB 1XWKA 2D2ZA 5ID2A 2B1KA 5B8BA 4DSSB 4CW9A 4OD7A 4MDCA 2L5LA 2KLXA 1OC9A 2DBCA 5E59A 4ZBDA 5IMCA 2L4CA 2AYTA 1ON4A 4K8MA 2V32A 3MSZA 1B4PA 4HQZA 1A23A 4HI7A 4Q5FA 2YV7A 2YJ7A 1I5GA 1UA5A 3DWVA 2MBTA 1BAYA 4YKGA 5ID2B 2REMA 2LUSA 2R37A 3ERGA 3IK9A 16GSA 1ERVA 1QMVA 5DBQA 2QKEA 3CTGA 5D96A 4D73A 1USBA 4PQIA 1X5EA 2LRNA 1K0CA 2E2MA 4KCEA 5IM9A 4GCIA 1EEMA 1LBKA 1TW9A 4Q5RA 2MYGA 4I97A 3FR6A 1GSQA 5J9CA 3WT2A 5IMZA 5FWGA 1GUKA 4G0IA 1GTAA 5E4WA 3M8NA 5INYA 2B5XA 4RI6A 1EEJA 1BQ7A 3GUSA 2GSQA 4HQSA 2H6YA 5DQSA 2M80A 3M9KA 4MMMA 3DYRA 1GULA 3HZ8A 4GRFA 4NXIA 3TRXA 1YZXA 3UEMA 5A5HB 4YAVA 3ZMLA 1TJDA 4KDXA 4V1Ag 1G6WA 3TKQA 1MDIA 1W89A 3FY7A 3TOTA 3KH9A 3SBCA 5IIZA 3QFAC 3NIVA 1PMTA 5ECOB 2VD1A 1QUWA 4LL4B 4G10A 3FW2A 2GT6A 2KUCA 3A3TA 1O8XA 3QMXA 3QFBC 5DDLA 2R5GA 3DRNA 3QDNA 4XRDA 3IR4A 1YKAA 5DJMA 1XOBA 3TJFA 5DAKB 4IJ3A 1A2JA 1A8LA 3DIEA 3GV1A 2B7JA 5AGYA 2EFDA 3FYGA 4TVEA 2CVBA 5G1LA 5F8BA 4MPFA 3IAM2 4GDFA 4Q5QA 1FB6A 1SJIA 3F3QA 4ID0A 2ZCTA 3EU3A 4HU7A 1XXUA 1RQMA 4O92A 3FZ4A 3LGCA 2X99A 3A5IA 1TRWA 4EIPA 4TRXA 1NSWA 4RI7A 2IL3A 1QK8A 1TRSA 2C0DA 1T1VA 4EUYA 1K3LA 1OC8A 3V1WA 4EDYA 2PN8A 3W6GA 4MJCA 4WKWA 1ABAA 2C3QA 1OAZA 3CYNA 4I2UA 3MYDA 4YH2A 2DKHA 3AY8A 1EWXA 1AQVA 2VCVA 2WFCA 4CY8A 2HZEB 3HYPA 2YNXA 2K6VA 3KD0A 1EV9A 2LJKA 3GX0A 2H0IA 2LSTA 1YKCA 1PQNA 4L8EA 2YWNA 3ME7A 4KDYA 1G6YA 4MK3A 1SJ6A 2H1AA 4HUAA 2A2RA 5J41A 4LA1A 3HVVA 2OE0A 3I69A 3S9FA 3TCOA 4FH8A 4OCFA 2G0FA 1PKZA 4ZILA 3G7YA 1DSBA 2B1LA 1VF1A 3WGDA 1NM3A 3C1RA 3L0HA 3HKRA 4EIQA 1U3IA 1T4YA 3TKRA 1XCCA 4IJIA 2Z9SA 2H0HA 20GSA 2GQLA 2ZNMA 2H1LA 1B9XC 3HJMA 1GUHA 4X4JA 5KOXA 4I2TA 2H01A 2CX4A 2H73A 5ENUA 5JCGA 2AJQB 3GTUA 3LJRA 4KB3A 3J7Yb 1SENA 2C0FA 1A0RP 3H4KA 5LNKe 3FRCA 1A8YA 4J2FA 5HR0A 1WIKA 2VUPA 5LD0A 4MA9A 3LXZA 1J9BA 1TDIA 2DLXA 3NZNA 3TU3B 3NOFA 1THOA 1AIUA 2L6DA 4TW5A 3Q74A 4XS6A 1VF4A 4OFNA 3CBUA 1QQ2A 4PUFC 2ZUPA 1UC7A 2B5YA 2MMNA 2VOCA 3HA9A 4AF2A 3C7MA 2H74A 2P5QA 5KOWA 3N9JA 2KOKA 1S3CA 3A5WA 1V58A 1G7EA 3VI7A 4YKFA 3IC4A 3TKSE 2K9FA 1W4VA 2KP2A 1WP0A 4XS4A 1FVKA 4P3YB 5CYYA 6GSUA 1J0FA 4MZBA 4HJMA 2WCIA 2EFEA 5CREA 3ZVJD 1M2BA 3ZFBA 3IK7A 4KSOA 5EPFA 3LFLA 4IP6A 3IPZA 1SD8A 3MNGA 3D22A 1F37A 3RHBA 4PTSA 2PU9C 2UZ8A 3F63A 1I9DA 2AHEA 1GNEA 3GH9A 4XS4B 1RW1A 2HSHA 5EY6A 2DMMA 3IXRA 3TOUA 1SYRA 3P2AA 3HDCA 3DVWA 3C8EA 4GSTA 3VK9A 3WGEA 2DJ0A 2A2PA 1Z9HA 2OADA 1EOHA 2CAIA 5HQPA 1Z6NA 3GSSA 2DSAA 2LNTA 2XC2A 3TJBA 2BJXA 1SK0A 5BMUA 1VF2A 1ERWA 4WETA 5A34A 1A2LA 1JZOA 2CAQA 3FK8A 3SWLA 4IN0A 4F82A 2FA4A 4AJ7A 3IHQA 1B8XA 3ME8A 1YF0A 1MD4A 5HFGA 5G2ZA 2LRTA 5LCZA 2VKZG 2JADA 4DSRA 4PURA 3QOUA 3GL5A 4MF7A 1SVOA 2YN1A 3QAWA 3EVIA 4TR4A 4TR3A 4MZWA 1FOVA 4DVCA 2HSNA 4CY6A 1PX6A 1FW1A 1T00A 1Z3EA 2I9HA 1BEDA 1O6JA 3KM6A 1G0TA 4OCEA 3LSZA 2H66A 1U6TA 4IQAA 9GSSA 5HR3A 4E8HA 2X64A 4K5RA 4GF0A 3QR6A 3M9JA 2XBQA 4ACSA 2OJLA 4TR1B 1MEKA 3EMXA 4WXTA 6GSXA 4AKXB 2L59A 3CRUA 3QD9A 4J56E 3ZREA 1UVZA 4KX4A 2H70A 5CP1A 1M2DA 2DIZA 4EVMA 1CQGA 5AIVA 3M1GA 5D9TA 2QGVA 3APQA 4KGIA 2K8VA 1OYJA 1TTZA 1O8WA 2FHEA 1BF5A 3EU4A 3ZRDA 5DJLA 2HI7A 1JLVA 4F03A 2AV4A 2BMXA 2GVPA 2GSTA 3G9BA 5G5FA 3D6IA 3DEXA 2CZ2A 3H1NA 5KN3A 4L0UA 2P0GA 2CV4A 4XCSA 18GSA 2OT3A 1T8EB 3DMLA 1DUGA 3F0IA 2AAWA 3QAVA 1QGVA 4L5OA 2AUVA 3ISOA 1AUCA 2HSMA 4K1FA 3ZMKA 2X4AA 3WD6A 2PUKC 5F05A 4EKZA 3VPTA 2HE3A 1OE7A 2M72A 4POMA 2VAFA 1S3DA 4PQHA 1TK0B 3L9UA 2RM6A 1HYUA 2GT5A 3K8NA 3TDGA 3GYKA 4TKYA 1XOAA 5GAND 4MJBA 2FY6A 2HFDA 1K0BA 2RIIA 2VLUA 1SKSB 2AB6A 4FIWA 4W66A 2RLIA 5HFKA 5IOWA 4ULXA 1H75A 4Z2UA 3N5OA 2H72A 1T4ZA 3HZ4A 4JRRA 2PMTA 3ZIJA 2IN3A 4EL1A 4O5QA 1SKWB 2C4JA 3P8WA 2MBSA 2EFCA 2PPTA 4IBPA 2L4QA 5GAPD 1TP9A 5ECPB 4POKA 4K5SA 4TN8A 1OC9B 2HRAA 3GIXA 3G7IA 1Z5YE 1G7OA 1PGTA 1THXA 1TI3A 4EC0A 3GKXA 3C1SA 2I1UA 3DKSA 1AQWA 1PL1A 5HFIA 4GSSA 2R0CA 5D9XA 4HS1A 1FVJA 1SU9A 3L9VA 4KUNA 3TGZA 2PERA 4XTSA 4BPYA 4ZBAA 4XRAA 2OKAA 2TRCP 1FHEA 3QPMA 1O73A 2VCWA 3L4NA 2FNOA 4O5UA 3UBLA 4D73B 4RQXA 1N25A 4ILFA 4H86A 4HZ4A 4ZXGA 1TXXA 1ZZYA 3VPQA 1DE2A 2LJAA 1AC1A 3ZZXA 5H5QA 1Y25A 2PBJA 2O85A 4BVXA 1EGOA 3IOSA 4QQ7A 4QL7A 5ELAA 3UIWA 2VL9A 4FYCA 3M0FA 4KCAA 4ZL8A 4J57E 4K6XA 3HXSA 5ECRB 2QA1A 3TJGA 2P31A 1SL1B 2YWOA 5J3RA 1PD21 2FWEA 2JSZA 5A4WA 1ZCPA 5KN1A 3A2XA 4BVXB 4L0WA 1XVWA 4V2LA 3D21A 2LEGA 1SD9A 2WDUA 4LMWA 3UBKA 3TJKA 4N0VA 3EWLA 2ALBA 1PKWA 13GSA 1EP8A 1EP7A 1R7HA 3APSA 1XWBA 5AN1A 2EFHA 3RPPA 1X9WB 3UAPA 3GURA 3LWAA 3TRQA 2HT9A 3D4TA 3KXOA 1EV4A 1TOFA 14GSA 3F4RA 3QCPA 1CQHA 4AKHA 4WEYA 2WZ9A 1PSQA 3Q18A 2EC4A 12GSA 2VIMA 5F0GA 2H75A 3U5RE 3D4MA 2HRNA 4KH7A 2HLSA 1U88A 2YCDA 1PL2A 4OO5A 4JBBA 3LQ7A 5A1NA 3CSJA 1WWJA 2DJ1A 2JL4A 3FR3A 4AGSA 2JSYA 2KHPA 4NPBA 2UV8G 4PXOA 1TI1A 3F4SA 1V9WA 2NVLA 3KMNA 1WRYA 2CA8A 4MH3A 1EZKA 5H5RA 1GLQA 2L5OA 2GZYA 2O5VA 1TRVA 3MDKA 5ELGA 1YEXA 3C71A 1Z7RA 3CMIA 5B6NA 5D93A 1KBNA 2CT6A 4N10A 1YVLA 3IAS2 2HRKA 3HMJG 2VCQA 2O87A 2C3TA 2WB9A 2I4AA 1JHBA 1FB0A 1ZYQB 2YJHA 3PPUA 3APOA 2YANA 2ON5A 1ZMAA 4QMKA 1K3OA 5EVOA 1YF1A 1V98A 2H6ZA 3G7JA 2VO4A 2CQ9A 1PN9A 5IO0A 3F6DA 2CVKA 1Q98A 3HY2A 1A0FA 3GRXA 6GSVA 1SK2A 1K0DA 5ECHB 1AQXA 3PR8A 3CXGA 4MJEA 5COHA 4BA7A 3Q19A 4YQVA 4POBA 2HSYA 1Y6EA 5F07A 1OE8A 3VWVA 2J23A 4WBJA 1GUMA 1KNGA 2YZHA 3KMOA 4NMUA 5IO2A 4XIHA 1WJKA 2OBIA 3EE2A 2V6KA 5GSSA 3ZITA 4KAEA 3GTUB 3OR5A 4GQFA 2LQQA 4OMVA 2XBIA 2OACA 1K0NA 1ST9A 3FHKA 2MMAA 2FGXA 1ZYNA 2NDOA 4MF6A 3IE3A 5J40A 1DE1A 4I6XA 1V2AA 1HNAA 1VF3A 7GSSA 3CWGA 5IMVA 3TUEA 2C3NA 3HHVA 5ABRA 1MDJA 4KW6A 4NAXA 4KNDA 1F6MC 3F8UA 17GSA 4F9ZA 4Z7XA 2FA8A 4ML6A 2RUEA 4OFMA 3I9V2 1SK1A 4NHZA 3FR9A 3KCMA 4YQUA 3IC8A 2EIOA 5CRHA 5CAXA 2DIYA 2C0EA 1IYHA 3R2QA 1XBSA 5A5KA 1AAZA 5A4VA 3A2WA 2GDRA 2B7KA 4IQ1A 4N11A 4HZ2A 1R4WA 2V41A 1JZWA 4ZL7A 1B48A 1YY7A 4KSMA 2IWTA 4E68A 2FWGA 3H79A 5KEJA 1O85A 4JZQA 4JR4A 1TU7A 3LEFA 2CZ3A 3PGTA 6GSWA 4G19A 3ZTLA 2GSSA 1BX9A 3EPTA 2C8UA 5ECMB 4Z2RA 1NHYA 2N5FA 5DVBA 4TR0A 4TXVA 4G9HA 3Q6OA 5BMUB 2G2QA 4XHMA 5A34B 5ECQB 3PH9A 2RUFA 4GSNA 3GN3A 4MH2A 2N5AA 5D8IA 2PGTA 1GRXA 1PRXA 2DJ2A 4MCUA 3LYKA 1BG1A 1GL8A 3LXTA 3D5JA 4LMVA 1M9AA 3ZLPA 1FG4A 3LW9A 4ECIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RUV A;  3US3 A;  1QXH A;  2IJY A;  5FHI A;  3F6F A;  3ZIV A;  6GSS A;  2IMF A;  2HSN B;  1XWC A;  2QC7 A;  4YAP A;  3GST A;  5DAL A;  1GNW A;  5G31 A;  2B3S A;  5CRD A;  2LJR A;  4O32 A;  1GLP A;  2GZP A;  2EIR A;  5DCG A;  8GSS A;  3VI5 A;  1ACV A;  2H6X A;  3VFI A;  2OE3 A;  5C00 A;  1T3B A;  2LKU A;  2LV3 A;  4V2M A;  3KJY A;  4MLY A;  2LTK A;  3RPN A;  4WF4 A;  2GLR A;  2J9H A;  4GWR A;  2XPE A;  2L6C A;  5HR1 A;  1XFL A;  5CRG A;  2H1D A;  3UAR A;  4IP1 A;  4ECB A;  3GA4 A;  5D9W A;  2X8H A;  3TRP A;  4K2D A;  1OC3 A;  2R4V A;  1JLW A;  2R6K A;  5JWQ B;  3CRT A;  1MDK A;  1V57 A;  1KTE A;  4QL9 A;  4TXO A;  5IPG A;  2YP6 A;  5GST A;  1WOU A;  4GLT A;  1GSF A;  3CTF A;  4DSS A;  4ML1 A;  1GP1 A;  4PX1 A;  3ZVJ A;  5D9V A;  3GH6 A;  3TJJ A;  1S3A A;  3W8S A;  4DEJ A;  2F9S A;  4JE1 A;  1X5C A;  1EOG A;  1GSU A;  4PNF A;  4L5L A;  2B5E A;  1A24 A;  2HSM B;  3H93 A;  2CVD A;  4K7I A;  2FWH A;  3JCM L;  2E2G A;  1VRS D;  4EO3 A;  2DJJ A;  1WMJ A;  1FAA A;  1WPI A;  4USS A;  2VD0 A;  2FLS A;  2L57 A;  2OE1 A;  3O76 A;  2PVO C;  3W8J A;  2LQO A;  4V2N A;  5B7C A;  2VL3 A;  4EE0 A;  2JZR A;  5B8A A;  2VL2 C;  1LU4 A;  4F0B A;  3BBY A;  1HD2 A;  3WT1 A;  2BTO T;  3IBH A;  4X1U A;  2FWF A;  4IGJ A;  2N5B A;  4LL1 B;  1R26 A;  1GSD A;  3VLN A;  1F3B A;  5CNW A;  5KN0 A;  1TKD B;  5DCH A;  1O81 A;  2VL2 A;  3E9J B;  2HZF A;  5G1K A;  2H0G A;  2VLT A;  4OFT A;  4HJ2 A;  1GTB A;  5EL8 A;  3J7Y k;  2C1Y A;  2VM1 A;  1X9S B;  1F3A A;  4N0Z A;  1EGR A;  4WR4 A;  3ZFL A;  1R5A A;  2IMD A;  2I3Y A;  2NBS A;  2MMZ A;  1XZO A;  2R3X A;  2PWJ A;  1AXD A;  4OO4 A;  1A2M A;  1GSY A;  2HRF A;  1OKD A;  2A2S A;  4IHU A;  3VWW A;  5H5S A;  3UJ1 A;  2JZS A;  3UMA A;  4PQ1 A;  3ERW A;  5ECL B;  1NW2 A;  1IYI A;  1F9M A;  3HJO A;  5DAK A;  1VGL A;  2V2G A;  1OKT A;  6GST A;  1GH2 A;  5L71 A;  4MJA A;  3C73 A;  1JZD A;  3IV4 A;  3DXB A;  2DJ3 A;  2CX3 A;  2IME A;  2VCZ A;  1K0M A;  2YZU A;  4IVF A;  4K0G A;  1ERU A;  4ECJ A;  2QSI A;  3FEU A;  4PNG A;  4I5Q A;  3BCI A;  2MMO A;  3HVS A;  2ES7 A;  4FQU A;  2FUG 2;  5DQY A;  3R3E A;  1TK8 B;  2VM2 A;  4MZC A;  2O89 A;  2LRC A;  4ZB8 A;  2O8V B;  3BJ5 A;  3UVH A;  4ZIJ A;  1HQO A;  2WS2 A;  4NV2 A;  3KTB A;  2B6M A;  4HDE A;  1ZL9 A;  1R5P A;  1AW9 A;  4K9Z A;  1WE0 A;  1GTI A;  3GKN A;  5CO3 A;  2H71 A;  3ERF A;  5IPH A;  4ZB9 A;  3GL3 A;  1F2E A;  5AIS A;  11GS A;  4KF9 A;  1GSE A;  2H8L A;  2HZE A;  2FCH A;  1YEP A;  1GSS A;  2GQK A;  2WJU A;  5C04 A;  1XWG A;  1SL0 B;  2YV9 A;  3UOM A;  5J9B A;  1E6B A;  1GWC A;  4HOJ A;  5HR2 A;  3GNJ A;  4EF0 A;  4ZL9 A;  4O5R A;  1GTU A;  3TKS C;  2LS5 A;  3FKF A;  4BVY A;  2O7K A;  4WF5 A;  3KGK A;  2F8F A;  2NPB A;  3KTL A;  2FD3 A;  2XPD A;  1FO5 A;  3MWH A;  4BL7 A;  5IMA A;  2IIY A;  1N8J A;  2TRX A;  3EUR A;  4DSQ A;  5JWR B;  1Z6M A;  2V1M A;  1B9Y C;  3DD3 A;  3GMF A;  5FT3 A;  1KEB A;  2F8A A;  3WYW A;  4HU9 A;  2YOI A;  1RK4 A;  2WUL A;  4EDZ A;  3O6T A;  4ZB6 A;  1O7U A;  2F51 A;  3TKS A;  3IDV A;  5CRW A;  4BVY B;  3FZA A;  4BWS A;  1M9B A;  2IPA A;  3IA1 A;  3QAG A;  1TU8 A;  4F0C A;  3D0Z A;  4IS0 A;  4BL7 B;  5JCU A;  4KDU A;  2HNL A;  2X8C A;  3HVX A;  1NHO A;  1ML6 A;  3VWU A;  4FYU A;  3KIJ A;  2HRK B;  4GTU A;  1K0A A;  2A4V A;  5GZZ B;  1YJ6 A;  2WGR A;  1HNC A;  2JAC A;  3CSI A;  2H30 A;  2HXK A;  4XS1 A;  3L9S A;  5F06 A;  6GSY A;  5AIX A;  5JCW A;  1ERT A;  4BWQ A;  5ECN B;  2H19 A;  2H1G A;  1N2A A;  2PVQ A;  5J5N A;  4IKH A;  2H76 A;  2KP1 A;  2VCX A;  2RM5 A;  3U6V A;  3FZ5 A;  2E7P A;  2GTU A;  4ISD A;  3ED3 A;  1B4Q A;  2X8G A;  2OA7 A;  3DGQ A;  3BD2 A;  2TIR A;  4MP4 A;  3HD5 A;  4LLR A;  4OWY A;  1SKR B;  3LYP A;  2DJK A;  4PUA A;  4IEL A;  2YWI A;  5IOX A;  4PGT A;  1MD3 A;  2GGT A;  2VLV A;  1JFU A;  3L78 A;  2ON7 A;  1H4O A;  1MTC A;  5D73 A;  4YQM A;  1OVN A;  3M3M A;  3LG6 A;  3MAK A;  3E3E A;  1M0U A;  4TOP A;  1QFN A;  3BCK A;  3GKK A;  1XW9 A;  4Q5N A;  5A4U A;  4WBR D;  2EIQ A;  1URM A;  4I8B A;  10GS A;  2IMI A;  5IQY A;  1XVQ A;  3HJP A;  3EIN A;  4AJ6 A;  5B6M A;  1V40 A;  4KE3 A;  1J08 A;  2VCT A;  5G30 A;  2YWM A;  3RDW A;  22GS A;  1M7T A;  2WRT A;  4G0L A;  1K3Y A;  1X0R A;  3IRA A;  3RHC A;  4GXZ A;  1SYX A;  3DVX A;  3RAZ A;  4EXJ A;  4AJ8 A;  1ZGN A;  1BYE A;  4O7H A;  2C0G A;  1YQ1 A;  4NWY A;  5ECI B;  3UVT A;  1JZR A;  5IMF A;  3GHA A;  3GX8 A;  1XIY A;  1TK5 B;  2LNS A;  4F2I A;  3UL3 A;  2H1B A;  4X43 A;  4JU5 A;  3KP8 A;  1Q4J A;  4POL A;  4N30 A;  2GSR A;  5JWO B;  1SJZ A;  2JU5 A;  4NV5 A;  3EMP A;  3P90 A;  2V6O A;  1ZOF A;  2OBK A;  1XW6 A;  4NHW A;  1UN2 A;  3TB2 A;  1X5D A;  3LOR A;  1YDK A;  2R2J A;  3O3T A;  4HEA 2;  2IFQ A;  5G5E A;  4V1A p;  2E0Q A;  3F3R A;  4G2E A;  4G0K A;  4CHS A;  4FO5 A;  3P7X A;  5J4U A;  4KA0 A;  4JED A;  2DC5 A;  4MPG A;  1LJR A;  1BG5 A;  4CDO A;  3VWX A;  1XW5 A;  4TR1 A;  4MAB A;  3CSH A;  4IW9 A;  1ILO A;  2HYX A;  3ZL5 A;  2GS3 A;  1XPV A;  2K18 A;  3HCZ A;  5KN2 A;  4K7N A;  1U87 A;  2IFQ B;  3TKP A;  3KZQ A;  4FYB A;  3RBT A;  1SL2 B;  5ECS A;  1PA3 A;  3ZYW A;  4MF5 A;  1U3A A;  4ECC A;  1X9M B;  2YPM A;  1DBY A;  4GQC A;  3E0U A;  1E2Y A;  1PX7 A;  3WGX A;  3EYT A;  2IMK A;  2JZT A;  1TRU A;  2C80 A;  3F4T A;  5DAL B;  1M99 A;  3I43 A;  1ZYE A;  1K0O A;  1HNB A;  4K7O A;  2P5R A;  19GS A;  2M46 A;  3H8Q A;  3KP9 A;  2XHF A;  3EC3 A;  4JR6 A;  2NTO A;  4ZBB A;  3KEB A;  1BJX A;  2I81 A;  5ECK B;  2F3M A;  4WR5 A;  1M2A A;  5IMD A;  3PIN A;  1Z7P A;  3I6A A;  3BOA A;  4E8E A;  4K0N A;  2DML A;  2GZZ A;  2GQM A;  1C72 A;  4RQR A;  3GFK A;  2HQT A;  3A2V A;  3KH7 A;  2K8S A;  3F9U A;  3FZ9 A;  4X0X A;  1XWA A;  3VUR A;  1T7P B;  2MZC A;  3GKM A;  4TXO B;  1XWK A;  2D2Z A;  5ID2 A;  2B1K A;  5B8B A;  4DSS B;  4CW9 A;  4OD7 A;  4MDC A;  2L5L A;  2KLX A;  1OC9 A;  2DBC A;  5E59 A;  4ZBD A;  5IMC A;  2L4C A;  2AYT A;  1ON4 A;  4K8M A;  2V32 A;  3MSZ A;  1B4P A;  4HQZ A;  1A23 A;  4HI7 A;  4Q5F A;  2YV7 A;  2YJ7 A;  1I5G A;  1UA5 A;  3DWV A;  2MBT A;  1BAY A;  5ID2 B;  2REM A;  2LUS A;  2R37 A;  3ERG A;  3IK9 A;  16GS A;  1ERV A;  1QMV A;  5DBQ A;  2QKE A;  3CTG A;  5D96 A;  4D73 A;  1USB A;  4PQI A;  1X5E A;  2LRN A;  1K0C A;  2E2M A;  4KCE A;  5IM9 A;  4GCI A;  1EEM A;  1LBK A;  1TW9 A;  4Q5R A;  2MYG A;  4I97 A;  3FR6 A;  1GSQ A;  5J9C A;  3WT2 A;  5IMZ A;  5FWG A;  1GUK A;  4G0I A;  1GTA A;  5E4W A;  3M8N A;  5INY A;  2B5X A;  4RI6 A;  1EEJ A;  1BQ7 A;  3GUS A;  2GSQ A;  4HQS A;  2H6Y A;  5DQS A;  2M80 A;  3M9K A;  4MMM A;  3DYR A;  1GUL A;  3HZ8 A;  4GRF A;  4NXI A;  3TRX A;  1YZX A;  3UEM A;  4YAV A;  3ZML A;  1TJD A;  4KDX A;  4V1A g;  1G6W A;  3TKQ A;  1MDI A;  1W89 A;  3FY7 A;  3TOT A;  3KH9 A;  3SBC A;  5IIZ A;  3QFA C;  3NIV A;  1PMT A;  5ECO B;  2VD1 A;  1QUW A;  4LL4 B;  4G10 A;  3FW2 A;  2GT6 A;  2KUC A;  3A3T A;  1O8X A;  3QMX A;  3QFB C;  5DDL A;  2R5G A;  3DRN A;  3QDN A;  4XRD A;  3IR4 A;  1YKA A;  5DJM A;  1XOB A;  3TJF A;  5DAK B;  4IJ3 A;  1A2J A;  1A8L A;  3DIE A;  3GV1 A;  2B7J A;  5AGY A;  3FYG A;  4TVE A;  2CVB A;  5G1L A;  5F8B A;  4MPF A;  3IAM 2;  4Q5Q A;  1FB6 A;  1SJI A;  3F3Q A;  4ID0 A;  2ZCT A;  3EU3 A;  4HU7 A;  1XXU A;  1RQM A;  4O92 A;  3FZ4 A;  3LGC A;  2X99 A;  1TRW A;  4TRX A;  1NSW A;  4RI7 A;  2IL3 A;  1QK8 A;  1TRS A;  2C0D A;  1T1V A;  4EUY A;  1K3L A;  1OC8 A;  3V1W A;  4EDY A;  2PN8 A;  3W6G A;  4MJC A;  4WKW A;  1ABA A;  2C3Q A;  1OAZ A;  3CYN A;  4I2U A;  4YH2 A;  3AY8 A;  1EWX A;  1AQV A;  2VCV A;  2WFC A;  2HZE B;  3HYP A;  2YNX A;  2K6V A;  3KD0 A;  1EV9 A;  2LJK A;  3GX0 A;  2H0I A;  2LST A;  1YKC A;  1PQN A;  4L8E A;  2YWN A;  3ME7 A;  4KDY A;  1G6Y A;  4MK3 A;  1SJ6 A;  2H1A A;  4HUA A;  2A2R A;  5J41 A;  4LA1 A;  3HVV A;  2OE0 A;  3I69 A;  3S9F A;  3TCO A;  4FH8 A;  4OCF A;  2G0F A;  1PKZ A;  4ZIL A;  3G7Y A;  1DSB A;  2B1L A;  1VF1 A;  3WGD A;  1NM3 A;  3C1R A;  3L0H A;  3HKR A;  1U3I A;  1T4Y A;  3TKR A;  1XCC A;  4IJI A;  2Z9S A;  2H0H A;  20GS A;  2GQL A;  2ZNM A;  1B9X C;  3HJM A;  1GUH A;  4I2T A;  2H01 A;  2CX4 A;  2H73 A;  5ENU A;  5JCG A;  2AJQ B;  3GTU A;  3LJR A;  4KB3 A;  3J7Y b;  1SEN A;  2C0F A;  1A0R P;  3H4K A;  5LNK e;  3FRC A;  1A8Y A;  4J2F A;  5HR0 A;  1WIK A;  2VUP A;  5LD0 A;  4MA9 A;  3LXZ A;  1J9B A;  1TDI A;  2DLX A;  3NZN A;  3NOF A;  1THO A;  1AIU A;  2L6D A;  4TW5 A;  3Q74 A;  4XS6 A;  1VF4 A;  4OFN A;  3CBU A;  1QQ2 A;  4PUF C;  2ZUP A;  1UC7 A;  2B5Y A;  2MMN A;  2VOC A;  3HA9 A;  4AF2 A;  3C7M A;  2H74 A;  2P5Q A;  3N9J A;  2KOK A;  1S3C A;  3A5W A;  1V58 A;  1G7E A;  3VI7 A;  3IC4 A;  3TKS E;  2K9F A;  1W4V A;  2KP2 A;  1WP0 A;  4XS4 A;  1FVK A;  4P3Y B;  5CYY A;  6GSU A;  1J0F A;  4MZB A;  4HJM A;  2WCI A;  5CRE A;  3ZVJ D;  1M2B A;  3ZFB A;  3IK7 A;  4KSO A;  5EPF A;  3LFL A;  4IP6 A;  3IPZ A;  1SD8 A;  3MNG A;  3D22 A;  1F37 A;  3RHB A;  4PTS A;  2PU9 C;  2UZ8 A;  3F63 A;  1I9D A;  2AHE A;  1GNE A;  3GH9 A;  4XS4 B;  1RW1 A;  2HSH A;  5EY6 A;  2DMM A;  3IXR A;  3TOU A;  1SYR A;  3P2A A;  3HDC A;  3DVW A;  3C8E A;  4GST A;  3VK9 A;  3WGE A;  2DJ0 A;  1Z9H A;  2OAD A;  1EOH A;  2CAI A;  5HQP A;  1Z6N A;  3GSS A;  2DSA A;  2LNT A;  2XC2 A;  3TJB A;  2BJX A;  1SK0 A;  5BMU A;  1VF2 A;  1ERW A;  4WET A;  1A2L A;  1JZO A;  2CAQ A;  3FK8 A;  3SWL A;  4IN0 A;  4F82 A;  2FA4 A;  4AJ7 A;  3IHQ A;  1B8X A;  3ME8 A;  1YF0 A;  1MD4 A;  5HFG A;  5G2Z A;  2LRT A;  5LCZ A;  4DSR A;  2JAD A;  4PUR A;  3QOU A;  3GL5 A;  4MF7 A;  2YN1 A;  3QAW A;  3EVI A;  4TR4 A;  4TR3 A;  4MZW A;  1FOV A;  4DVC A;  1PX6 A;  1FW1 A;  1T00 A;  1Z3E A;  2I9H A;  1BED A;  1O6J A;  3KM6 A;  1G0T A;  4OCE A;  3LSZ A;  2H66 A;  1U6T A;  4IQA A;  9GSS A;  5HR3 A;  4E8H A;  2X64 A;  4GF0 A;  3QR6 A;  3M9J A;  2XBQ A;  4ACS A;  2OJL A;  4TR1 B;  1MEK A;  3EMX A;  4WXT A;  6GSX A;  2L59 A;  3CRU A;  3QD9 A;  4J56 E;  3ZRE A;  1UVZ A;  4KX4 A;  2H70 A;  5CP1 A;  1M2D A;  2DIZ A;  4EVM A;  1CQG A;  5AIV A;  3M1G A;  5D9T A;  2QGV A;  3APQ A;  4KGI A;  2K8V A;  1OYJ A;  1TTZ A;  1O8W A;  2FHE A;  3EU4 A;  3ZRD A;  5DJL A;  2HI7 A;  1JLV A;  4F03 A;  2AV4 A;  2BMX A;  2GVP A;  2GST A;  3G9B A;  5G5F A;  3D6I A;  3DEX A;  2CZ2 A;  3H1N A;  5KN3 A;  4L0U A;  2P0G A;  2CV4 A;  4XCS A;  18GS A;  1T8E B;  3DML A;  1DUG A;  3F0I A;  2AAW A;  3QAV A;  1QGV A;  4L5O A;  2AUV A;  3ISO A;  1AUC A;  2HSM A;  4K1F A;  3ZMK A;  3WD6 A;  2PUK C;  5F05 A;  4EKZ A;  3VPT A;  2HE3 A;  1OE7 A;  2M72 A;  4POM A;  2VAF A;  1S3D A;  4PQH A;  1TK0 B;  3L9U A;  2RM6 A;  1HYU A;  2GT5 A;  3K8N A;  3TDG A;  3GYK A;  4TKY A;  1XOA A;  5GAN D;  4MJB A;  2FY6 A;  2HFD A;  1K0B A;  2RII A;  2VLU A;  1SKS B;  2AB6 A;  4FIW A;  2RLI A;  5HFK A;  5IOW A;  4ULX A;  1H75 A;  3N5O A;  2H72 A;  1T4Z A;  3HZ4 A;  4JRR A;  2PMT A;  3ZIJ A;  2IN3 A;  4EL1 A;  1SKW B;  2C4J A;  3P8W A;  2MBS A;  2PPT A;  4IBP A;  2L4Q A;  5GAP D;  1TP9 A;  5ECP B;  4POK A;  4TN8 A;  1OC9 B;  2HRA A;  3GIX A;  3G7I A;  1Z5Y E;  1G7O A;  1PGT A;  1THX A;  1TI3 A;  4EC0 A;  3GKX A;  3C1S A;  2I1U A;  3DKS A;  1AQW A;  1PL1 A;  5HFI A;  4GSS A;  5D9X A;  4HS1 A;  1FVJ A;  1SU9 A;  3L9V A;  4KUN A;  3TGZ A;  2PER A;  4XTS A;  4BPY A;  4ZBA A;  4XRA A;  2OKA A;  2TRC P;  1FHE A;  3QPM A;  1O73 A;  2VCW A;  3L4N A;  2FNO A;  3UBL A;  4D73 B;  4RQX A;  4ILF A;  4H86 A;  4HZ4 A;  4ZXG A;  1TXX A;  1ZZY A;  3VPQ A;  1DE2 A;  2LJA A;  1AC1 A;  3ZZX A;  5H5Q A;  1Y25 A;  2PBJ A;  2O85 A;  4BVX A;  1EGO A;  3IOS A;  4QQ7 A;  4QL7 A;  5ELA A;  3UIW A;  2VL9 A;  4FYC A;  3M0F A;  4KCA A;  4ZL8 A;  4J57 E;  4K6X A;  3HXS A;  5ECR B;  3TJG A;  2P31 A;  1SL1 B;  2YWO A;  5J3R A;  1PD2 1;  2FWE A;  2JSZ A;  5A4W A;  1ZCP A;  5KN1 A;  3A2X A;  4BVX B;  4L0W A;  1XVW A;  4V2L A;  3D21 A;  2LEG A;  1SD9 A;  2WDU A;  4LMW A;  3UBK A;  3TJK A;  4N0V A;  3EWL A;  2ALB A;  1PKW A;  13GS A;  1EP8 A;  1EP7 A;  1R7H A;  3APS A;  1XWB A;  5AN1 A;  3RPP A;  1X9W B;  3UAP A;  3GUR A;  3LWA A;  3TRQ A;  2HT9 A;  3D4T A;  3KXO A;  1EV4 A;  1TOF A;  14GS A;  3F4R A;  3QCP A;  1CQH A;  4WEY A;  2WZ9 A;  1PSQ A;  3Q18 A;  2EC4 A;  12GS A;  2VIM A;  5F0G A;  2H75 A;  3U5R E;  3D4M A;  2HRN A;  4KH7 A;  2HLS A;  1U88 A;  2YCD A;  1PL2 A;  4OO5 A;  4JBB A;  3LQ7 A;  3CSJ A;  1WWJ A;  2DJ1 A;  2JL4 A;  3FR3 A;  4AGS A;  2JSY A;  2KHP A;  4NPB A;  4PXO A;  1TI1 A;  3F4S A;  1V9W A;  2NVL A;  3KMN A;  1WRY A;  2CA8 A;  4MH3 A;  1EZK A;  5H5R A;  1GLQ A;  2L5O A;  2GZY A;  1TRV A;  3MDK A;  5ELG A;  1YEX A;  3C71 A;  1Z7R A;  3CMI A;  5B6N A;  5D93 A;  1KBN A;  2CT6 A;  4N10 A;  3IAS 2;  2HRK A;  2VCQ A;  2O87 A;  2C3T A;  2WB9 A;  2I4A A;  1JHB A;  1FB0 A;  1ZYQ B;  2YJH A;  3PPU A;  3APO A;  2YAN A;  2ON5 A;  1ZMA A;  1K3O A;  5EVO A;  1YF1 A;  1V98 A;  2H6Z A;  3G7J A;  2VO4 A;  2CQ9 A;  1PN9 A;  5IO0 A;  3F6D A;  2CVK A;  1Q98 A;  3HY2 A;  1A0F A;  3GRX A;  6GSV A;  1SK2 A;  1K0D A;  5ECH B;  1AQX A;  3PR8 A;  3CXG A;  4MJE A;  5COH A;  4BA7 A;  3Q19 A;  4YQV A;  4POB A;  2HSY A;  1Y6E A;  5F07 A;  1OE8 A;  3VWV A;  2J23 A;  4WBJ A;  1GUM A;  1KNG A;  2YZH A;  3KMO A;  4NMU A;  5IO2 A;  4XIH A;  1WJK A;  2OBI A;  3EE2 A;  2V6K A;  5GSS A;  3ZIT A;  4KAE A;  3GTU B;  3OR5 A;  4GQF A;  2LQQ A;  4OMV A;  2XBI A;  2OAC A;  1K0N A;  1ST9 A;  3FHK A;  2MMA A;  2FGX A;  2NDO A;  4MF6 A;  3IE3 A;  1DE1 A;  4I6X A;  1V2A A;  1HNA A;  1VF3 A;  7GSS A;  5IMV A;  3TUE A;  2C3N A;  3HHV A;  5ABR A;  1MDJ A;  4KW6 A;  4NAX A;  4KND A;  1F6M C;  3F8U A;  17GS A;  4F9Z A;  4Z7X A;  2FA8 A;  4ML6 A;  2RUE A;  4OFM A;  3I9V 2;  1SK1 A;  4NHZ A;  3FR9 A;  3KCM A;  4YQU A;  3IC8 A;  2EIO A;  5CRH A;  5CAX A;  2DIY A;  2C0E A;  1IYH A;  3R2Q A;  1XBS A;  5A5K A;  1AAZ A;  5A4V A;  3A2W A;  2GDR A;  2B7K A;  4IQ1 A;  4N11 A;  4HZ2 A;  1R4W A;  2V41 A;  1JZW A;  4ZL7 A;  1B48 A;  1YY7 A;  4KSM A;  2IWT A;  2FWG A;  3H79 A;  5KEJ A;  1O85 A;  4JZQ A;  4JR4 A;  1TU7 A;  3LEF A;  2CZ3 A;  3PGT A;  6GSW A;  4G19 A;  3ZTL A;  2GSS A;  1BX9 A;  2C8U A;  5ECM B;  1NHY A;  2N5F A;  5DVB A;  4TR0 A;  4TXV A;  4G9H A;  3Q6O A;  2G2Q A;  4XHM A;  5ECQ B;  3PH9 A;  2RUF A;  4GSN A;  3GN3 A;  4MH2 A;  2N5A A;  5D8I A;  2PGT A;  1GRX A;  1PRX A;  2DJ2 A;  4MCU A;  3LYK A;  1GL8 A;  3LXT A;  3D5J A;  4LMV A;  1M9A A;  3ZLP A;  1FG4 A;  4ECI A; 
#chains in the Genus database with same CATH topology
 4RUV A;  3US3 A;  1QXH A;  2IJY A;  5FHI A;  3F6F A;  3ZIV A;  6GSS A;  2IMF A;  2HSN B;  1XWC A;  2QC7 A;  4YAP A;  3GST A;  5DAL A;  1GNW A;  5G31 A;  2B3S A;  5CRD A;  2LJR A;  4O32 A;  1GLP A;  2GZP A;  2EIR A;  5DCG A;  8GSS A;  3VI5 A;  1ACV A;  2H6X A;  3VFI A;  5BRT A;  1PN0 A;  2OE3 A;  5C00 A;  1T3B A;  2LKU A;  2LV3 A;  4V2M A;  3KJY A;  4MLY A;  2LTK A;  3RPN A;  4WF4 A;  4FXY P;  2GLR A;  2J9H A;  4GWR A;  2XPE A;  2L6C A;  4Z2T A;  5HR1 A;  1XFL A;  5CRG A;  2H1D A;  3UAR A;  4G01 A;  4IP1 A;  4ECB A;  3GA4 A;  5D9W A;  2X8H A;  3TRP A;  4K2D A;  1OC3 A;  2R0G A;  2R4V A;  1JLW A;  2R6K A;  5JWQ B;  3CRT A;  1MDK A;  1V57 A;  1KTE A;  4QL9 A;  4TXO A;  5IPG A;  2YP6 A;  5GST A;  1WOU A;  4GLT A;  1GSF A;  3CTF A;  4DSS A;  4ML1 A;  1GP1 A;  4PX1 A;  3ZVJ A;  5D9V A;  3GH6 A;  3TJJ A;  1S3A A;  3W8S A;  4DEJ A;  2F9S A;  4JE1 A;  1X5C A;  1EOG A;  1GSU A;  3FMW A;  4PNF A;  4L5L A;  2B5E A;  1A24 A;  2HSM B;  2WVZ A;  3H93 A;  2CVD A;  1ZYP A;  4K7I A;  2FWH A;  3JCM L;  2E2G A;  1FOH A;  1VRS D;  4EO3 A;  2DJJ A;  5J4Y A;  1WMJ A;  1FAA A;  1WPI A;  4USS A;  2VD0 A;  2FLS A;  2L57 A;  2OE1 A;  3O76 A;  2PVO C;  3W8J A;  2LQO A;  4V2N A;  5B7C A;  2VL3 A;  4EE0 A;  2JZR A;  5B8A A;  2VL2 C;  1LU4 A;  4F0B A;  3BBY A;  2X49 A;  1HD2 A;  3WT1 A;  2BTO T;  4ICY A;  3IBH A;  4X1U A;  4AI6 A;  2FWF A;  4IGJ A;  2N5B A;  4LL1 B;  1R26 A;  1GSD A;  3VLN A;  1F3B A;  5CNW A;  5KN0 A;  1TKD B;  3MIX A;  5DCH A;  1O81 A;  2VL2 A;  3E9J B;  2HZF A;  5G1K A;  2H0G A;  2VLT A;  4OFT A;  4HJ2 A;  1GTB A;  5EL8 A;  3J7Y k;  2C1Y A;  2VM1 A;  1X9S B;  5A5H A;  1F3A A;  4N0Z A;  1EGR A;  4WR4 A;  4A5P A;  3ZFL A;  1R5A A;  2IMD A;  2I3Y A;  2NBS A;  2MMZ A;  1XZO A;  2R3X A;  2PWJ A;  1AXD A;  4OO4 A;  1A2M A;  1GSY A;  2HRF A;  1OKD A;  2A2S A;  4IHU A;  3VWW A;  5H5S A;  3UJ1 A;  2JZS A;  3UMA A;  4PQ1 A;  3ERW A;  5ECL B;  1NW2 A;  1IYI A;  1F9M A;  3HJO A;  5DAK A;  1VGL A;  2V2G A;  1OKT A;  6GST A;  1GH2 A;  5L71 A;  4MJA A;  3C73 A;  1JZD A;  3IV4 A;  3DXB A;  2DJ3 A;  2CX3 A;  2IME A;  2VCZ A;  1K0M A;  2WW0 A;  2YZU A;  4IVF A;  4K0G A;  1ERU A;  4ECJ A;  2QSI A;  3FEU A;  4PNG A;  1I1I P;  4I5Q A;  3BCI A;  2MMO A;  3HVS A;  2ES7 A;  4FQU A;  2FUG 2;  5DQY A;  3R3E A;  1TK8 B;  4AKG A;  2VM2 A;  4MZC A;  2O89 A;  2LRC A;  2O8V B;  4ZB8 A;  3BJ5 A;  3UVH A;  4ZIJ A;  1HQO A;  2WS2 A;  4NV2 A;  3KTB A;  2B6M A;  4HDE A;  1ZL9 A;  1R5P A;  1AW9 A;  4HSC X;  4K9Z A;  1WE0 A;  1GTI A;  3GKN A;  5CO3 A;  2H71 A;  3ERF A;  5IPH A;  4ZB9 A;  3GL3 A;  1F2E A;  5AIS A;  11GS A;  4KF9 A;  1GSE A;  2H8L A;  2HZE A;  2FCH A;  1YEP A;  1GSS A;  2GQK A;  2WJU A;  4N3Z A;  5C04 A;  1XWG A;  1SL0 B;  2YV9 A;  3UOM A;  5J9B A;  1E6B A;  1GWC A;  4HOJ A;  5HR2 A;  3GNJ A;  4EF0 A;  4ZL9 A;  4O5R A;  1GTU A;  3TKS C;  2LS5 A;  3FKF A;  4BVY A;  2O7K A;  4WF5 A;  3KGK A;  2F8F A;  2NPB A;  3KTL A;  2FD3 A;  5J47 A;  2XPD A;  1FO5 A;  2DKI A;  3MWH A;  4BL7 A;  5IMA A;  2IIY A;  1N8J A;  2TRX A;  3EUR A;  4DSQ A;  5JWR B;  1Z6M A;  2V1M A;  1B9Y C;  5A1N B;  3DD3 A;  3GMF A;  4ZB7 A;  5FT3 A;  1KEB A;  2F8A A;  3WYW A;  4HU9 A;  2YOI A;  1RK4 A;  2WUL A;  4EDZ A;  3O6T A;  4ZB6 A;  1O7U A;  2F51 A;  3TKS A;  3IDV A;  4MNN A;  5CRW A;  4BVY B;  3FZA A;  4BWS A;  1M9B A;  2IPA A;  3IA1 A;  3QAG A;  1TU8 A;  4F0C A;  3D0Z A;  4IS0 A;  4BL7 B;  5JCU A;  4KDU A;  2HNL A;  2X8C A;  3HVX A;  1NHO A;  1ML6 A;  3VWU A;  2WW2 A;  2R0P A;  3HVN A;  4FYU A;  3KIJ A;  2HRK B;  4GTU A;  1K0A A;  2A4V A;  5GZZ B;  1YJ6 A;  2WGR A;  1HNC A;  2JAC A;  3CSI A;  2H30 A;  2HXK A;  4XS1 A;  3L9S A;  5F06 A;  6GSY A;  5AIX A;  5JCW A;  1ERT A;  4BWQ A;  5ECN B;  2H19 A;  2H1G A;  1N2A A;  2PVQ A;  5J5N A;  4IKH A;  2H76 A;  2KP1 A;  2VCX A;  2RM5 A;  3U6V A;  3FZ5 A;  2E7P A;  2GTU A;  4ISD A;  3ED3 A;  1B4Q A;  2X8G A;  2OA7 A;  3DGQ A;  3BD2 A;  2TIR A;  4MP4 A;  3HD5 A;  4LLR A;  4OWY A;  1SKR B;  3LYP A;  2DJK A;  4BIK A;  4PUA A;  4IEL A;  2YWI A;  5IOX A;  4PGT A;  1MD3 A;  2GGT A;  2VLV A;  1JFU A;  3L78 A;  2ON7 A;  1H4O A;  1MTC A;  5D73 A;  2A4H A;  4YQM A;  1OVN A;  3M3M A;  3LG6 A;  3MAK A;  3E3E A;  1M0U A;  4TOP A;  4K2X A;  1QFN A;  3BCK A;  3GKK A;  1XW9 A;  4Q5N A;  5A4U A;  4WBR D;  2EIQ A;  1URM A;  4I8B A;  10GS A;  2IMI A;  5IQY A;  1XVQ A;  3HJP A;  3EIN A;  4AJ6 A;  5B6M A;  1V40 A;  4KE3 A;  1J08 A;  2VCT A;  5G30 A;  2YWM A;  3RDW A;  3IHG A;  22GS A;  1M7T A;  2WRT A;  4G0L A;  1K3Y A;  1X0R A;  3IRA A;  3RHC A;  4GXZ A;  1SYX A;  3DVX A;  3RAZ A;  4EXJ A;  4AJ8 A;  1ZGN A;  1BYE A;  4O7H A;  2C0G A;  1SVM A;  1YQ1 A;  4NWY A;  5ECI B;  3UVT A;  1JZR A;  5IMF A;  3GHA A;  3GX8 A;  1XIY A;  1YEW C;  1TK5 B;  2LNS A;  4F2I A;  3UL3 A;  2H1B A;  4X43 A;  2WVY A;  3CQF A;  4JU5 A;  3KP8 A;  1Q4J A;  4POL A;  1TXU A;  4N30 A;  4PI0 C;  2GSR A;  5JWO B;  1SJZ A;  2JU5 A;  4NV5 A;  3EMP A;  3P90 A;  2V6O A;  1ZOF A;  2OBK A;  1XW6 A;  4NHW A;  1UN2 A;  3TB2 A;  1Y1U A;  1X5D A;  3LOR A;  1YDK A;  2R2J A;  3O3T A;  4HEA 2;  2IFQ A;  5G5E A;  4V1A p;  2E0Q A;  3F3R A;  4G2E A;  4G0K A;  4CHS A;  4FO5 A;  3P7X A;  5J4U A;  4KA0 A;  4JED A;  2DC5 A;  4MPG A;  1LJR A;  1BG5 A;  4CDO A;  3VWX A;  1XW5 A;  4TR1 A;  4MAB A;  3CSH A;  4IW9 A;  1ILO A;  2HYX A;  3ZL5 A;  2GS3 A;  2WZS A;  1XPV A;  2K18 A;  4AKI A;  3HCZ A;  5KN2 A;  4K7N A;  1U87 A;  2IFQ B;  3TKP A;  3KZQ A;  4FYB A;  3RBT A;  1SL2 B;  5ECS A;  1PA3 A;  3ZYW A;  4MF5 A;  1U3A A;  4ECC A;  1X9M B;  2YPM A;  1DBY A;  4GQC A;  3E0U A;  1E2Y A;  1PX7 A;  3WGX A;  3EYT A;  2IMK A;  2JZT A;  1TRU A;  2C80 A;  3F4T A;  5DAL B;  5J4V A;  1M99 A;  3I43 A;  1ZYE A;  1K0O A;  1HNB A;  4K7O A;  2P5R A;  19GS A;  2M46 A;  3H8Q A;  3KP9 A;  2XHF A;  3EC3 A;  4JR6 A;  2NTO A;  4ZBB A;  3KEB A;  1BJX A;  2I81 A;  5ECK B;  1SVL A;  2F3M A;  4WR5 A;  1M2A A;  5IMD A;  3PIN A;  1Z7P A;  3I6A A;  3BOA A;  4E8E A;  4K0N A;  2DML A;  2GZZ A;  2GQM A;  1C72 A;  4RQR A;  3GFK A;  2HQT A;  3A2V A;  3KH7 A;  2K8S A;  3F9U A;  3FZ9 A;  4X0X A;  1XWA A;  3VUR A;  2QA2 A;  1T7P B;  2MZC A;  3GKM A;  4TXO B;  1XWK A;  2D2Z A;  5ID2 A;  2B1K A;  5B8B A;  4DSS B;  4CW9 A;  4OD7 A;  4MDC A;  4PI2 C;  2L5L A;  2KLX A;  1OC9 A;  2DBC A;  5E59 A;  4ZBD A;  5IMC A;  2L4C A;  2AYT A;  1ON4 A;  4K8M A;  2V32 A;  3MSZ A;  1B4P A;  4HQZ A;  1A23 A;  4HI7 A;  4Q5F A;  2YV7 A;  2YJ7 A;  1I5G A;  1UA5 A;  3DWV A;  2MBT A;  1BAY A;  4YKG A;  5ID2 B;  2REM A;  2LUS A;  2R37 A;  3ERG A;  2WW1 A;  3IK9 A;  16GS A;  1ERV A;  1QMV A;  5DBQ A;  2QKE A;  3CTG A;  5D96 A;  4D73 A;  1USB A;  4PQI A;  1X5E A;  2LRN A;  1K0C A;  2E2M A;  4KCE A;  5IM9 A;  4GCI A;  1EEM A;  1LBK A;  1TW9 A;  4Q5R A;  2MYG A;  4I97 A;  3FR6 A;  1GSQ A;  5J9C A;  3WT2 A;  5IMZ A;  5FWG A;  1GUK A;  4G0I A;  1GTA A;  5E4W A;  3M8N A;  5INY A;  2B5X A;  4RI6 A;  1EEJ A;  1BQ7 A;  3GUS A;  2GSQ A;  4HQS A;  2H6Y A;  5DQS A;  2M80 A;  3M9K A;  4MMM A;  3DYR A;  1GUL A;  3HZ8 A;  4GRF A;  4NXI A;  3TRX A;  1YZX A;  3UEM A;  5A5H B;  4YAV A;  3ZML A;  1TJD A;  4KDX A;  4V1A g;  1G6W A;  3TKQ A;  1MDI A;  1W89 A;  3FY7 A;  3TOT A;  3KH9 A;  3SBC A;  5IIZ A;  3QFA C;  3NIV A;  1PMT A;  5ECO B;  2VD1 A;  1QUW A;  4LL4 B;  4G10 A;  3FW2 A;  2GT6 A;  2KUC A;  3A3T A;  1O8X A;  3QMX A;  3QFB C;  5DDL A;  2R5G A;  3DRN A;  3QDN A;  4XRD A;  3IR4 A;  1YKA A;  5DJM A;  1XOB A;  3TJF A;  5DAK B;  4IJ3 A;  1A2J A;  1A8L A;  3DIE A;  3GV1 A;  2B7J A;  5AGY A;  2EFD A;  3FYG A;  4TVE A;  2CVB A;  2O36 A;  5G1L A;  5F8B A;  4MPF A;  3IAM 2;  4GDF A;  4Q5Q A;  1FB6 A;  1SJI A;  3F3Q A;  4ID0 A;  2ZCT A;  3EU3 A;  4HU7 A;  1XXU A;  1RQM A;  4O92 A;  3FZ4 A;  3LGC A;  2X99 A;  3A5I A;  1TRW A;  4EIP A;  4TRX A;  1NSW A;  4RI7 A;  2IL3 A;  1QK8 A;  1TRS A;  2C0D A;  1T1V A;  4EUY A;  1K3L A;  1OC8 A;  3V1W A;  4EDY A;  2PN8 A;  3W6G A;  4MJC A;  4WKW A;  1ABA A;  2C3Q A;  1OAZ A;  3CYN A;  4I2U A;  3MYD A;  4YH2 A;  2DKH A;  3AY8 A;  1EWX A;  1AQV A;  2VCV A;  2WFC A;  4CY8 A;  2HZE B;  3HYP A;  2YNX A;  2K6V A;  3KD0 A;  1EV9 A;  2LJK A;  3GX0 A;  2H0I A;  2LST A;  1YKC A;  1PQN A;  4L8E A;  2YWN A;  3ME7 A;  4KDY A;  1G6Y A;  4MK3 A;  1SJ6 A;  2H1A A;  4HUA A;  2A2R A;  5J41 A;  4LA1 A;  3HVV A;  2OE0 A;  3I69 A;  3S9F A;  3TCO A;  4FH8 A;  4OCF A;  2G0F A;  1PKZ A;  4ZIL A;  3G7Y A;  1DSB A;  2B1L A;  1VF1 A;  3WGD A;  1NM3 A;  3C1R A;  3L0H A;  3HKR A;  4EIQ A;  1U3I A;  1T4Y A;  3TKR A;  1XCC A;  4IJI A;  2Z9S A;  2H0H A;  20GS A;  2GQL A;  2ZNM A;  2H1L A;  1B9X C;  3HJM A;  1GUH A;  4X4J A;  5KOX A;  4I2T A;  2H01 A;  2CX4 A;  2H73 A;  5ENU A;  5JCG A;  2AJQ B;  3GTU A;  3LJR A;  4KB3 A;  3J7Y b;  1SEN A;  2C0F A;  1A0R P;  3H4K A;  5LNK e;  3FRC A;  1A8Y A;  4J2F A;  5HR0 A;  1WIK A;  2VUP A;  5LD0 A;  4MA9 A;  3LXZ A;  1J9B A;  1TDI A;  2DLX A;  3NZN A;  3TU3 B;  3NOF A;  1THO A;  1AIU A;  2L6D A;  4TW5 A;  3Q74 A;  4XS6 A;  1VF4 A;  4OFN A;  3CBU A;  1QQ2 A;  4PUF C;  2ZUP A;  1UC7 A;  2B5Y A;  2MMN A;  2VOC A;  3HA9 A;  4AF2 A;  3C7M A;  2H74 A;  2P5Q A;  5KOW A;  3N9J A;  2KOK A;  1S3C A;  3A5W A;  1V58 A;  1G7E A;  3VI7 A;  4YKF A;  3IC4 A;  3TKS E;  2K9F A;  1W4V A;  2KP2 A;  1WP0 A;  4XS4 A;  1FVK A;  4P3Y B;  5CYY A;  6GSU A;  1J0F A;  4MZB A;  4HJM A;  2WCI A;  2EFE A;  5CRE A;  3ZVJ D;  1M2B A;  3ZFB A;  3IK7 A;  4KSO A;  5EPF A;  3LFL A;  4IP6 A;  3IPZ A;  1SD8 A;  3MNG A;  2WVX A;  3D22 A;  1F37 A;  3RHB A;  4PTS A;  2PU9 C;  2UZ8 A;  3F63 A;  1I9D A;  2AHE A;  1GNE A;  3GH9 A;  4XS4 B;  1RW1 A;  2HSH A;  5EY6 A;  2DMM A;  3IXR A;  3TOU A;  1SYR A;  3P2A A;  3HDC A;  3DVW A;  3C8E A;  4GST A;  3VK9 A;  3WGE A;  2DJ0 A;  2A2P A;  1Z9H A;  2OAD A;  1EOH A;  2CAI A;  5HQP A;  1Z6N A;  3GSS A;  2DSA A;  2LNT A;  2XC2 A;  3TJB A;  2BJX A;  1SK0 A;  5BMU A;  1VF2 A;  1ERW A;  4WET A;  5A34 A;  1A2L A;  1JZO A;  2CAQ A;  3FK8 A;  3SWL A;  4IN0 A;  4F82 A;  2FA4 A;  4AJ7 A;  3IHQ A;  1B8X A;  3ME8 A;  1YF0 A;  1MD4 A;  5HFG A;  5G2Z A;  2LRT A;  5LCZ A;  2VKZ G;  2JAD A;  4DSR A;  1S3R A;  4PUR A;  3QOU A;  3GL5 A;  4MF7 A;  1SVO A;  2YN1 A;  3QAW A;  3EVI A;  4TR4 A;  4TR3 A;  4MZW A;  1FOV A;  4DVC A;  2HSN A;  4CY6 A;  1PX6 A;  1FW1 A;  1T00 A;  4PHZ C;  1Z3E A;  2I9H A;  1BED A;  1XG8 A;  1O6J A;  3KM6 A;  1G0T A;  4OCE A;  3LSZ A;  2H66 A;  1U6T A;  4IQA A;  9GSS A;  5HR3 A;  4E8H A;  2X64 A;  4K5R A;  4GF0 A;  3QR6 A;  3M9J A;  2XBQ A;  4ACS A;  2OJL A;  4TR1 B;  1MEK A;  3EMX A;  4WXT A;  6GSX A;  4AKX B;  2L59 A;  3CRU A;  3QD9 A;  4J56 E;  3ZRE A;  1UVZ A;  4KX4 A;  2H70 A;  5CP1 A;  1M2D A;  2DIZ A;  4EVM A;  1CQG A;  5AIV A;  3M1G A;  5D9T A;  2QGV A;  3APQ A;  4KGI A;  2K8V A;  1OYJ A;  1TTZ A;  1O8W A;  2FHE A;  1BF5 A;  3EU4 A;  3ZRD A;  5DJL A;  2HI7 A;  1JLV A;  4F03 A;  2AV4 A;  2BMX A;  2GVP A;  2GST A;  3G9B A;  5G5F A;  3D6I A;  3DEX A;  2CZ2 A;  3H1N A;  5KN3 A;  4L0U A;  2O3E A;  2P0G A;  2CV4 A;  4XCS A;  18GS A;  2OT3 A;  1T8E B;  3DML A;  1DUG A;  3F0I A;  2AAW A;  3QAV A;  1QGV A;  4L5O A;  2AUV A;  3ISO A;  1AUC A;  2HSM A;  4K1F A;  3ZMK A;  2X4A A;  3WD6 A;  2PUK C;  5F05 A;  4EKZ A;  3VPT A;  2HE3 A;  1OE7 A;  2M72 A;  4POM A;  2VAF A;  1S3D A;  4PQH A;  1TK0 B;  3L9U A;  2RM6 A;  1HYU A;  2GT5 A;  3K8N A;  3TDG A;  3GYK A;  4TKY A;  1XOA A;  5GAN D;  4MJB A;  2FY6 A;  2HFD A;  1K0B A;  2RII A;  2VLU A;  1SKS B;  2AB6 A;  4FIW A;  4W66 A;  2RLI A;  5HFK A;  5IOW A;  4ULX A;  1H75 A;  4Z2U A;  3N5O A;  2H72 A;  1T4Z A;  3HZ4 A;  4JRR A;  2PMT A;  3ZIJ A;  2IN3 A;  4EL1 A;  4O5Q A;  1SKW B;  2C4J A;  3P8W A;  2MBS A;  2EFC A;  2PPT A;  4IBP A;  2L4Q A;  5GAP D;  1TP9 A;  5ECP B;  4POK A;  4K5S A;  4TN8 A;  1OC9 B;  2HRA A;  3GIX A;  3G7I A;  1Z5Y E;  1G7O A;  1PGT A;  1THX A;  1TI3 A;  4EC0 A;  3GKX A;  3C1S A;  2I1U A;  3DKS A;  1AQW A;  1PL1 A;  5HFI A;  4GSS A;  2R0C A;  5D9X A;  4HS1 A;  1FVJ A;  1SU9 A;  3L9V A;  4KUN A;  3TGZ A;  2PER A;  3RFR C;  4XTS A;  4BPY A;  4ZBA A;  4XRA A;  2OKA A;  2TRC P;  1FHE A;  3QPM A;  1O73 A;  2VCW A;  3L4N A;  2FNO A;  4O5U A;  3UBL A;  4D73 B;  4RQX A;  1N25 A;  4ILF A;  4H86 A;  4HZ4 A;  4ZXG A;  1TXX A;  1ZZY A;  3VPQ A;  1DE2 A;  2LJA A;  1AC1 A;  3ZZX A;  5H5Q A;  1Y25 A;  2PBJ A;  2O85 A;  4BVX A;  1EGO A;  3IOS A;  4QQ7 A;  4QL7 A;  5ELA A;  3UIW A;  2VL9 A;  4FYC A;  3M0F A;  4KCA A;  4ZL8 A;  4J57 E;  4K6X A;  3HXS A;  5ECR B;  2QA1 A;  3TJG A;  2P31 A;  1SL1 B;  2YWO A;  5J3R A;  1PD2 1;  2FWE A;  2JSZ A;  5A4W A;  1ZCP A;  5KN1 A;  3A2X A;  4BVX B;  3RGB C;  1M3I A;  4L0W A;  1XVW A;  4V2L A;  3D21 A;  2LEG A;  1SD9 A;  2WDU A;  4LMW A;  3UBK A;  3TJK A;  4N0V A;  3EWL A;  2ALB A;  1PKW A;  13GS A;  1EP8 A;  1EP7 A;  1R7H A;  3APS A;  1XWB A;  5AN1 A;  2EFH A;  3RPP A;  1X9W B;  3UAP A;  3GUR A;  3LWA A;  3TRQ A;  2HT9 A;  3D4T A;  3KXO A;  1EV4 A;  1TOF A;  14GS A;  1PFO A;  3F4R A;  3QCP A;  1CQH A;  4AKH A;  4WEY A;  2WZ9 A;  1PSQ A;  3Q18 A;  2EC4 A;  12GS A;  2VIM A;  5F0G A;  2H75 A;  3U5R E;  3D4M A;  2HRN A;  4KH7 A;  2HLS A;  1U88 A;  2YCD A;  1PL2 A;  4OO5 A;  4JBB A;  3LQ7 A;  5A1N A;  3CSJ A;  1WWJ A;  2DJ1 A;  2JL4 A;  3FR3 A;  4AGS A;  2JSY A;  2KHP A;  4NPB A;  2UV8 G;  4PXO A;  1TI1 A;  3F4S A;  1M3J A;  1V9W A;  2NVL A;  3KMN A;  1WRY A;  2CA8 A;  4MH3 A;  1EZK A;  5H5R A;  1GLQ A;  2L5O A;  2GZY A;  2O5V A;  1TRV A;  3MDK A;  5ELG A;  1YEX A;  3C71 A;  1Z7R A;  3CMI A;  5B6N A;  5D93 A;  1KBN A;  2CT6 A;  4N10 A;  1YVL A;  3IAS 2;  2HRK A;  3HMJ G;  2VCQ A;  2O87 A;  2C3T A;  2WB9 A;  2I4A A;  1JHB A;  1FB0 A;  1ZYQ B;  2YJH A;  3PPU A;  3APO A;  2YAN A;  2ON5 A;  1ZMA A;  4QMK A;  1K3O A;  5EVO A;  1YF1 A;  1V98 A;  2H6Z A;  3G7J A;  2VO4 A;  2CQ9 A;  1PN9 A;  5IO0 A;  3F6D A;  2CVK A;  1Q98 A;  3HY2 A;  1A0F A;  3GRX A;  6GSV A;  1SK2 A;  1K0D A;  5ECH B;  1AQX A;  3PR8 A;  3CXG A;  4MJE A;  5COH A;  4BA7 A;  3Q19 A;  4YQV A;  4POB A;  2HSY A;  1Y6E A;  5F07 A;  1OE8 A;  3VWV A;  2J23 A;  4WBJ A;  1GUM A;  1KNG A;  2YZH A;  3KMO A;  4NMU A;  5IO2 A;  4XIH A;  1WJK A;  2OBI A;  3EE2 A;  2V6K A;  5GSS A;  1S4B P;  3ZIT A;  4KAE A;  3CHX C;  3GTU B;  3OR5 A;  4GQF A;  2LQQ A;  4OMV A;  2XBI A;  2OAC A;  1K0N A;  1ST9 A;  3FHK A;  2MMA A;  2FGX A;  1ZYN A;  2NDO A;  4MF6 A;  3IE3 A;  5J40 A;  1DE1 A;  4I6X A;  1V2A A;  1HNA A;  1VF3 A;  7GSS A;  3CWG A;  5IMV A;  3TUE A;  2C3N A;  3HHV A;  5ABR A;  1MDJ A;  4KW6 A;  4NAX A;  4KND A;  1F6M C;  3F8U A;  17GS A;  4F9Z A;  4Z7X A;  2FA8 A;  4ML6 A;  2RUE A;  4OFM A;  3I9V 2;  1SK1 A;  4NHZ A;  3FR9 A;  3KCM A;  4YQU A;  3IC8 A;  2EIO A;  5CRH A;  5CAX A;  2DIY A;  2C0E A;  1IYH A;  3R2Q A;  1XBS A;  5A5K A;  1AAZ A;  5A4V A;  3A2W A;  2GDR A;  2B7K A;  4IQ1 A;  4N11 A;  4HZ2 A;  1R4W A;  2V41 A;  2WVX B;  1JZW A;  4ZL7 A;  1B48 A;  1YY7 A;  4KSM A;  2IWT A;  4E68 A;  2FWG A;  3H79 A;  5KEJ A;  1O85 A;  4JZQ A;  4JR4 A;  1TU7 A;  3LEF A;  2CZ3 A;  3PGT A;  6GSW A;  4G19 A;  3ZTL A;  2GSS A;  1BX9 A;  3EPT A;  2C8U A;  2WW3 A;  5ECM B;  4Z2R A;  1NHY A;  2N5F A;  5DVB A;  4TR0 A;  4TXV A;  4G9H A;  3Q6O A;  5BMU B;  2G2Q A;  4XHM A;  5A34 B;  5ECQ B;  3PH9 A;  2RUF A;  4GSN A;  3GN3 A;  4MH2 A;  2N5A A;  5D8I A;  2PGT A;  1GRX A;  1PRX A;  2DJ2 A;  4MCU A;  3LYK A;  1BG1 A;  1GL8 A;  3LXT A;  3D5J A;  4LMV A;  1M9A A;  3ZLP A;  1FG4 A;  3LW9 A;  4ECI A; 
#chains in the Genus database with same CATH homology
 4RUV A;  3US3 A;  1QXH A;  2IJY A;  5FHI A;  3F6F A;  3ZIV A;  6GSS A;  2IMF A;  2HSN B;  1XWC A;  2QC7 A;  4YAP A;  3GST A;  5DAL A;  1GNW A;  5G31 A;  2B3S A;  5CRD A;  2LJR A;  4O32 A;  1GLP A;  2GZP A;  2EIR A;  5DCG A;  8GSS A;  3VI5 A;  1ACV A;  2H6X A;  3VFI A;  5BRT A;  1PN0 A;  2OE3 A;  5C00 A;  1T3B A;  2LKU A;  2LV3 A;  4V2M A;  3KJY A;  4MLY A;  2LTK A;  3RPN A;  4WF4 A;  2GLR A;  2J9H A;  4GWR A;  2XPE A;  2L6C A;  4Z2T A;  5HR1 A;  1XFL A;  5CRG A;  2H1D A;  3UAR A;  4G01 A;  4IP1 A;  4ECB A;  3GA4 A;  5D9W A;  2X8H A;  3TRP A;  4K2D A;  1OC3 A;  2R0G A;  2R4V A;  1JLW A;  2R6K A;  5JWQ B;  3CRT A;  1MDK A;  1V57 A;  1KTE A;  4QL9 A;  4TXO A;  5IPG A;  2YP6 A;  5GST A;  1WOU A;  4GLT A;  1GSF A;  3CTF A;  4DSS A;  4ML1 A;  1GP1 A;  4PX1 A;  3ZVJ A;  5D9V A;  3GH6 A;  3TJJ A;  1S3A A;  3W8S A;  4DEJ A;  2F9S A;  4JE1 A;  1X5C A;  1EOG A;  1GSU A;  3FMW A;  4PNF A;  4L5L A;  2B5E A;  1A24 A;  2HSM B;  3H93 A;  2CVD A;  1ZYP A;  4K7I A;  2FWH A;  3JCM L;  2E2G A;  1FOH A;  1VRS D;  4EO3 A;  2DJJ A;  5J4Y A;  1WMJ A;  1FAA A;  1WPI A;  4USS A;  2VD0 A;  2FLS A;  2L57 A;  2OE1 A;  3O76 A;  2PVO C;  3W8J A;  2LQO A;  4V2N A;  5B7C A;  2VL3 A;  4EE0 A;  2JZR A;  5B8A A;  2VL2 C;  1LU4 A;  4F0B A;  3BBY A;  2X49 A;  1HD2 A;  3WT1 A;  2BTO T;  4ICY A;  3IBH A;  4X1U A;  4AI6 A;  2FWF A;  4IGJ A;  2N5B A;  4LL1 B;  1R26 A;  1GSD A;  3VLN A;  1F3B A;  5CNW A;  5KN0 A;  1TKD B;  3MIX A;  5DCH A;  1O81 A;  2VL2 A;  3E9J B;  2HZF A;  5G1K A;  2H0G A;  2VLT A;  4OFT A;  4HJ2 A;  1GTB A;  5EL8 A;  3J7Y k;  2C1Y A;  2VM1 A;  1X9S B;  5A5H A;  1F3A A;  4N0Z A;  1EGR A;  4WR4 A;  4A5P A;  3ZFL A;  1R5A A;  2IMD A;  2I3Y A;  2NBS A;  2MMZ A;  1XZO A;  2R3X A;  2PWJ A;  1AXD A;  4OO4 A;  1A2M A;  1GSY A;  2HRF A;  1OKD A;  2A2S A;  4IHU A;  3VWW A;  5H5S A;  3UJ1 A;  2JZS A;  3UMA A;  4PQ1 A;  3ERW A;  5ECL B;  1NW2 A;  1IYI A;  1F9M A;  3HJO A;  5DAK A;  1VGL A;  2V2G A;  1OKT A;  6GST A;  1GH2 A;  5L71 A;  4MJA A;  3C73 A;  1JZD A;  3IV4 A;  3DXB A;  2DJ3 A;  2CX3 A;  2IME A;  2VCZ A;  1K0M A;  2YZU A;  4IVF A;  4K0G A;  1ERU A;  4ECJ A;  2QSI A;  3FEU A;  4PNG A;  4I5Q A;  3BCI A;  2MMO A;  3HVS A;  2ES7 A;  4FQU A;  2FUG 2;  5DQY A;  3R3E A;  1TK8 B;  4AKG A;  2VM2 A;  4MZC A;  2O89 A;  2LRC A;  4ZB8 A;  2O8V B;  3BJ5 A;  3UVH A;  4ZIJ A;  1HQO A;  2WS2 A;  4NV2 A;  3KTB A;  2B6M A;  4HDE A;  1ZL9 A;  1R5P A;  1AW9 A;  4K9Z A;  1WE0 A;  1GTI A;  3GKN A;  5CO3 A;  2H71 A;  3ERF A;  5IPH A;  4ZB9 A;  3GL3 A;  1F2E A;  5AIS A;  11GS A;  4KF9 A;  1GSE A;  2H8L A;  2HZE A;  2FCH A;  1YEP A;  1GSS A;  2GQK A;  2WJU A;  4N3Z A;  5C04 A;  1XWG A;  1SL0 B;  2YV9 A;  3UOM A;  5J9B A;  1E6B A;  1GWC A;  4HOJ A;  5HR2 A;  3GNJ A;  4EF0 A;  4ZL9 A;  4O5R A;  1GTU A;  3TKS C;  2LS5 A;  3FKF A;  4BVY A;  2O7K A;  4WF5 A;  3KGK A;  2F8F A;  2NPB A;  3KTL A;  2FD3 A;  5J47 A;  2XPD A;  1FO5 A;  3MWH A;  2DKI A;  4BL7 A;  5IMA A;  2IIY A;  1N8J A;  2TRX A;  3EUR A;  4DSQ A;  5JWR B;  1Z6M A;  2V1M A;  1B9Y C;  5A1N B;  3DD3 A;  3GMF A;  4ZB7 A;  5FT3 A;  1KEB A;  2F8A A;  3WYW A;  4HU9 A;  2YOI A;  1RK4 A;  2WUL A;  4EDZ A;  3O6T A;  4ZB6 A;  1O7U A;  2F51 A;  3TKS A;  3IDV A;  4MNN A;  5CRW A;  4BVY B;  3FZA A;  4BWS A;  1M9B A;  2IPA A;  3IA1 A;  3QAG A;  1TU8 A;  4F0C A;  3D0Z A;  4IS0 A;  4BL7 B;  5JCU A;  4KDU A;  2HNL A;  2X8C A;  3HVX A;  1NHO A;  1ML6 A;  3VWU A;  2R0P A;  4FYU A;  3KIJ A;  2HRK B;  4GTU A;  1K0A A;  2A4V A;  5GZZ B;  1YJ6 A;  2WGR A;  1HNC A;  2JAC A;  3CSI A;  2H30 A;  2HXK A;  4XS1 A;  3L9S A;  5F06 A;  6GSY A;  5AIX A;  5JCW A;  1ERT A;  4BWQ A;  5ECN B;  2H19 A;  2H1G A;  1N2A A;  2PVQ A;  5J5N A;  4IKH A;  2H76 A;  2KP1 A;  2VCX A;  2RM5 A;  3U6V A;  3FZ5 A;  2E7P A;  2GTU A;  4ISD A;  3ED3 A;  1B4Q A;  2X8G A;  2OA7 A;  3DGQ A;  3BD2 A;  2TIR A;  4MP4 A;  3HD5 A;  4LLR A;  4OWY A;  1SKR B;  3LYP A;  2DJK A;  4PUA A;  4IEL A;  2YWI A;  5IOX A;  4PGT A;  1MD3 A;  2GGT A;  2VLV A;  1JFU A;  3L78 A;  2ON7 A;  1H4O A;  1MTC A;  5D73 A;  2A4H A;  4YQM A;  1OVN A;  3M3M A;  3LG6 A;  3MAK A;  3E3E A;  1M0U A;  4TOP A;  4K2X A;  1QFN A;  3BCK A;  3GKK A;  1XW9 A;  4Q5N A;  5A4U A;  4WBR D;  2EIQ A;  1URM A;  4I8B A;  10GS A;  2IMI A;  5IQY A;  1XVQ A;  3HJP A;  3EIN A;  4AJ6 A;  5B6M A;  1V40 A;  4KE3 A;  1J08 A;  2VCT A;  5G30 A;  2YWM A;  3RDW A;  3IHG A;  22GS A;  1M7T A;  2WRT A;  4G0L A;  1K3Y A;  1X0R A;  3IRA A;  3RHC A;  4GXZ A;  1SYX A;  3DVX A;  3RAZ A;  4EXJ A;  4AJ8 A;  1ZGN A;  1BYE A;  4O7H A;  2C0G A;  1SVM A;  1YQ1 A;  4NWY A;  5ECI B;  3UVT A;  1JZR A;  5IMF A;  3GHA A;  3GX8 A;  1XIY A;  1TK5 B;  2LNS A;  4F2I A;  3UL3 A;  2H1B A;  4X43 A;  4JU5 A;  3KP8 A;  1Q4J A;  4POL A;  1TXU A;  4N30 A;  2GSR A;  5JWO B;  1SJZ A;  2JU5 A;  4NV5 A;  3EMP A;  3P90 A;  2V6O A;  1ZOF A;  2OBK A;  1XW6 A;  4NHW A;  1UN2 A;  3TB2 A;  1Y1U A;  1X5D A;  3LOR A;  1YDK A;  2R2J A;  3O3T A;  4HEA 2;  2IFQ A;  5G5E A;  4V1A p;  2E0Q A;  3F3R A;  4G2E A;  4G0K A;  4CHS A;  4FO5 A;  3P7X A;  5J4U A;  4KA0 A;  4JED A;  2DC5 A;  4MPG A;  1LJR A;  1BG5 A;  4CDO A;  3VWX A;  1XW5 A;  4TR1 A;  4MAB A;  3CSH A;  4IW9 A;  1ILO A;  2HYX A;  3ZL5 A;  2GS3 A;  1XPV A;  2K18 A;  4AKI A;  3HCZ A;  5KN2 A;  4K7N A;  1U87 A;  2IFQ B;  3TKP A;  3KZQ A;  4FYB A;  3RBT A;  1SL2 B;  5ECS A;  1PA3 A;  3ZYW A;  4MF5 A;  1U3A A;  4ECC A;  1X9M B;  2YPM A;  1DBY A;  4GQC A;  3E0U A;  1E2Y A;  1PX7 A;  3WGX A;  3EYT A;  2IMK A;  2JZT A;  1TRU A;  2C80 A;  3F4T A;  5DAL B;  5J4V A;  1M99 A;  3I43 A;  1ZYE A;  1K0O A;  1HNB A;  4K7O A;  2P5R A;  19GS A;  2M46 A;  3H8Q A;  3KP9 A;  2XHF A;  3EC3 A;  4JR6 A;  2NTO A;  4ZBB A;  3KEB A;  1BJX A;  2I81 A;  5ECK B;  1SVL A;  2F3M A;  4WR5 A;  1M2A A;  5IMD A;  3PIN A;  1Z7P A;  3I6A A;  3BOA A;  4E8E A;  4K0N A;  2DML A;  2GZZ A;  2GQM A;  1C72 A;  4RQR A;  3GFK A;  2HQT A;  3A2V A;  3KH7 A;  2K8S A;  3F9U A;  3FZ9 A;  4X0X A;  1XWA A;  3VUR A;  2QA2 A;  1T7P B;  2MZC A;  3GKM A;  4TXO B;  1XWK A;  2D2Z A;  5ID2 A;  2B1K A;  5B8B A;  4DSS B;  4CW9 A;  4OD7 A;  4MDC A;  2L5L A;  2KLX A;  1OC9 A;  2DBC A;  5E59 A;  4ZBD A;  5IMC A;  2L4C A;  2AYT A;  1ON4 A;  4K8M A;  2V32 A;  3MSZ A;  1B4P A;  4HQZ A;  1A23 A;  4HI7 A;  4Q5F A;  2YV7 A;  2YJ7 A;  1I5G A;  1UA5 A;  3DWV A;  2MBT A;  1BAY A;  4YKG A;  5ID2 B;  2REM A;  2LUS A;  2R37 A;  3ERG A;  3IK9 A;  16GS A;  1ERV A;  1QMV A;  5DBQ A;  2QKE A;  3CTG A;  5D96 A;  4D73 A;  1USB A;  4PQI A;  1X5E A;  2LRN A;  1K0C A;  2E2M A;  4KCE A;  5IM9 A;  4GCI A;  1EEM A;  1LBK A;  1TW9 A;  4Q5R A;  2MYG A;  4I97 A;  3FR6 A;  1GSQ A;  5J9C A;  3WT2 A;  5IMZ A;  5FWG A;  1GUK A;  4G0I A;  1GTA A;  5E4W A;  3M8N A;  5INY A;  2B5X A;  4RI6 A;  1EEJ A;  1BQ7 A;  3GUS A;  2GSQ A;  4HQS A;  2H6Y A;  5DQS A;  2M80 A;  3M9K A;  4MMM A;  3DYR A;  1GUL A;  3HZ8 A;  4GRF A;  4NXI A;  3TRX A;  1YZX A;  3UEM A;  5A5H B;  4YAV A;  3ZML A;  1TJD A;  4KDX A;  4V1A g;  1G6W A;  3TKQ A;  1MDI A;  1W89 A;  3FY7 A;  3TOT A;  3KH9 A;  3SBC A;  5IIZ A;  3QFA C;  3NIV A;  1PMT A;  5ECO B;  2VD1 A;  1QUW A;  4LL4 B;  4G10 A;  3FW2 A;  2GT6 A;  2KUC A;  3A3T A;  1O8X A;  3QMX A;  3QFB C;  5DDL A;  2R5G A;  3DRN A;  3QDN A;  4XRD A;  3IR4 A;  1YKA A;  5DJM A;  1XOB A;  3TJF A;  5DAK B;  4IJ3 A;  1A2J A;  1A8L A;  3DIE A;  3GV1 A;  2B7J A;  5AGY A;  2EFD A;  3FYG A;  4TVE A;  2CVB A;  5G1L A;  5F8B A;  4MPF A;  3IAM 2;  4GDF A;  4Q5Q A;  1FB6 A;  1SJI A;  3F3Q A;  4ID0 A;  2ZCT A;  3EU3 A;  4HU7 A;  1XXU A;  1RQM A;  4O92 A;  3FZ4 A;  3LGC A;  2X99 A;  3A5I A;  1TRW A;  4EIP A;  4TRX A;  1NSW A;  4RI7 A;  2IL3 A;  1QK8 A;  1TRS A;  2C0D A;  1T1V A;  4EUY A;  1K3L A;  1OC8 A;  3V1W A;  4EDY A;  2PN8 A;  3W6G A;  4MJC A;  4WKW A;  1ABA A;  2C3Q A;  1OAZ A;  3CYN A;  4I2U A;  3MYD A;  4YH2 A;  2DKH A;  3AY8 A;  1EWX A;  1AQV A;  2VCV A;  2WFC A;  4CY8 A;  2HZE B;  3HYP A;  2YNX A;  2K6V A;  3KD0 A;  1EV9 A;  2LJK A;  3GX0 A;  2H0I A;  2LST A;  1YKC A;  1PQN A;  4L8E A;  2YWN A;  3ME7 A;  4KDY A;  1G6Y A;  4MK3 A;  1SJ6 A;  2H1A A;  4HUA A;  2A2R A;  5J41 A;  4LA1 A;  3HVV A;  2OE0 A;  3I69 A;  3S9F A;  3TCO A;  4FH8 A;  4OCF A;  2G0F A;  1PKZ A;  4ZIL A;  3G7Y A;  1DSB A;  2B1L A;  1VF1 A;  3WGD A;  1NM3 A;  3C1R A;  3L0H A;  3HKR A;  4EIQ A;  1U3I A;  1T4Y A;  3TKR A;  1XCC A;  4IJI A;  2Z9S A;  2H0H A;  20GS A;  2GQL A;  2ZNM A;  2H1L A;  1B9X C;  3HJM A;  1GUH A;  4X4J A;  5KOX A;  4I2T A;  2H01 A;  2CX4 A;  2H73 A;  5ENU A;  5JCG A;  2AJQ B;  3GTU A;  3LJR A;  4KB3 A;  3J7Y b;  1SEN A;  2C0F A;  1A0R P;  3H4K A;  5LNK e;  3FRC A;  1A8Y A;  4J2F A;  5HR0 A;  1WIK A;  2VUP A;  5LD0 A;  4MA9 A;  3LXZ A;  1J9B A;  1TDI A;  2DLX A;  3NZN A;  3TU3 B;  3NOF A;  1THO A;  1AIU A;  2L6D A;  4TW5 A;  3Q74 A;  4XS6 A;  1VF4 A;  4OFN A;  3CBU A;  1QQ2 A;  4PUF C;  2ZUP A;  1UC7 A;  2B5Y A;  2MMN A;  2VOC A;  3HA9 A;  4AF2 A;  3C7M A;  2H74 A;  2P5Q A;  5KOW A;  3N9J A;  2KOK A;  1S3C A;  3A5W A;  1V58 A;  1G7E A;  3VI7 A;  4YKF A;  3IC4 A;  3TKS E;  2K9F A;  1W4V A;  2KP2 A;  1WP0 A;  4XS4 A;  1FVK A;  4P3Y B;  5CYY A;  6GSU A;  1J0F A;  4MZB A;  4HJM A;  2WCI A;  2EFE A;  5CRE A;  3ZVJ D;  1M2B A;  3ZFB A;  3IK7 A;  4KSO A;  5EPF A;  3LFL A;  4IP6 A;  3IPZ A;  1SD8 A;  3MNG A;  3D22 A;  1F37 A;  3RHB A;  4PTS A;  2PU9 C;  2UZ8 A;  3F63 A;  1I9D A;  2AHE A;  1GNE A;  3GH9 A;  4XS4 B;  1RW1 A;  2HSH A;  5EY6 A;  2DMM A;  3IXR A;  3TOU A;  1SYR A;  3P2A A;  3HDC A;  3DVW A;  3C8E A;  4GST A;  3VK9 A;  3WGE A;  2DJ0 A;  2A2P A;  1Z9H A;  2OAD A;  1EOH A;  2CAI A;  5HQP A;  1Z6N A;  3GSS A;  2DSA A;  2LNT A;  2XC2 A;  3TJB A;  2BJX A;  1SK0 A;  5BMU A;  1VF2 A;  1ERW A;  4WET A;  5A34 A;  1A2L A;  1JZO A;  2CAQ A;  3FK8 A;  3SWL A;  4IN0 A;  4F82 A;  2FA4 A;  4AJ7 A;  3IHQ A;  1B8X A;  3ME8 A;  1YF0 A;  1MD4 A;  5HFG A;  5G2Z A;  2LRT A;  5LCZ A;  2VKZ G;  2JAD A;  4DSR A;  4PUR A;  3QOU A;  3GL5 A;  4MF7 A;  1SVO A;  2YN1 A;  3QAW A;  3EVI A;  4TR4 A;  4TR3 A;  4MZW A;  1FOV A;  4DVC A;  2HSN A;  4CY6 A;  1PX6 A;  1FW1 A;  1T00 A;  1Z3E A;  2I9H A;  1BED A;  1O6J A;  3KM6 A;  1G0T A;  4OCE A;  3LSZ A;  2H66 A;  1U6T A;  4IQA A;  9GSS A;  5HR3 A;  4E8H A;  2X64 A;  4K5R A;  4GF0 A;  3QR6 A;  3M9J A;  2XBQ A;  4ACS A;  2OJL A;  4TR1 B;  1MEK A;  3EMX A;  4WXT A;  6GSX A;  4AKX B;  2L59 A;  3CRU A;  3QD9 A;  4J56 E;  3ZRE A;  1UVZ A;  4KX4 A;  2H70 A;  5CP1 A;  1M2D A;  2DIZ A;  4EVM A;  1CQG A;  5AIV A;  3M1G A;  5D9T A;  2QGV A;  3APQ A;  4KGI A;  2K8V A;  1OYJ A;  1TTZ A;  1O8W A;  2FHE A;  1BF5 A;  3EU4 A;  3ZRD A;  5DJL A;  2HI7 A;  1JLV A;  4F03 A;  2AV4 A;  2BMX A;  2GVP A;  2GST A;  3G9B A;  5G5F A;  3D6I A;  3DEX A;  2CZ2 A;  3H1N A;  5KN3 A;  4L0U A;  2P0G A;  2CV4 A;  4XCS A;  18GS A;  2OT3 A;  1T8E B;  3DML A;  1DUG A;  3F0I A;  2AAW A;  3QAV A;  1QGV A;  4L5O A;  2AUV A;  3ISO A;  1AUC A;  2HSM A;  4K1F A;  3ZMK A;  2X4A A;  3WD6 A;  2PUK C;  5F05 A;  4EKZ A;  3VPT A;  2HE3 A;  1OE7 A;  2M72 A;  4POM A;  2VAF A;  1S3D A;  4PQH A;  1TK0 B;  3L9U A;  2RM6 A;  1HYU A;  2GT5 A;  3K8N A;  3TDG A;  3GYK A;  4TKY A;  1XOA A;  5GAN D;  4MJB A;  2FY6 A;  2HFD A;  1K0B A;  2RII A;  2VLU A;  1SKS B;  2AB6 A;  4FIW A;  4W66 A;  2RLI A;  5HFK A;  5IOW A;  4ULX A;  1H75 A;  4Z2U A;  3N5O A;  2H72 A;  1T4Z A;  3HZ4 A;  4JRR A;  2PMT A;  3ZIJ A;  2IN3 A;  4EL1 A;  4O5Q A;  1SKW B;  2C4J A;  3P8W A;  2MBS A;  2EFC A;  2PPT A;  4IBP A;  2L4Q A;  5GAP D;  1TP9 A;  5ECP B;  4POK A;  4K5S A;  4TN8 A;  1OC9 B;  2HRA A;  3GIX A;  3G7I A;  1Z5Y E;  1G7O A;  1PGT A;  1THX A;  1TI3 A;  4EC0 A;  3GKX A;  3C1S A;  2I1U A;  3DKS A;  1AQW A;  1PL1 A;  5HFI A;  4GSS A;  2R0C A;  5D9X A;  4HS1 A;  1FVJ A;  1SU9 A;  3L9V A;  4KUN A;  3TGZ A;  2PER A;  4XTS A;  4BPY A;  4ZBA A;  4XRA A;  2OKA A;  2TRC P;  1FHE A;  3QPM A;  1O73 A;  2VCW A;  3L4N A;  2FNO A;  4O5U A;  3UBL A;  4D73 B;  4RQX A;  1N25 A;  4ILF A;  4H86 A;  4HZ4 A;  4ZXG A;  1TXX A;  1ZZY A;  3VPQ A;  1DE2 A;  2LJA A;  1AC1 A;  3ZZX A;  5H5Q A;  1Y25 A;  2PBJ A;  2O85 A;  4BVX A;  1EGO A;  3IOS A;  4QQ7 A;  4QL7 A;  5ELA A;  3UIW A;  2VL9 A;  4FYC A;  3M0F A;  4KCA A;  4ZL8 A;  4J57 E;  4K6X A;  3HXS A;  5ECR B;  2QA1 A;  3TJG A;  2P31 A;  1SL1 B;  2YWO A;  5J3R A;  1PD2 1;  2FWE A;  2JSZ A;  5A4W A;  1ZCP A;  5KN1 A;  3A2X A;  4BVX B;  4L0W A;  1XVW A;  4V2L A;  3D21 A;  2LEG A;  1SD9 A;  2WDU A;  4LMW A;  3UBK A;  3TJK A;  4N0V A;  3EWL A;  2ALB A;  1PKW A;  13GS A;  1EP8 A;  1EP7 A;  1R7H A;  3APS A;  1XWB A;  5AN1 A;  2EFH A;  3RPP A;  1X9W B;  3UAP A;  3GUR A;  3LWA A;  3TRQ A;  2HT9 A;  3D4T A;  3KXO A;  1EV4 A;  1TOF A;  14GS A;  3F4R A;  3QCP A;  1CQH A;  4AKH A;  4WEY A;  2WZ9 A;  1PSQ A;  3Q18 A;  2EC4 A;  12GS A;  2VIM A;  5F0G A;  2H75 A;  3U5R E;  3D4M A;  2HRN A;  4KH7 A;  2HLS A;  1U88 A;  2YCD A;  1PL2 A;  4OO5 A;  4JBB A;  3LQ7 A;  5A1N A;  3CSJ A;  1WWJ A;  2DJ1 A;  2JL4 A;  3FR3 A;  4AGS A;  2JSY A;  2KHP A;  4NPB A;  2UV8 G;  4PXO A;  1TI1 A;  3F4S A;  1V9W A;  2NVL A;  3KMN A;  1WRY A;  2CA8 A;  4MH3 A;  1EZK A;  5H5R A;  1GLQ A;  2L5O A;  2GZY A;  2O5V A;  1TRV A;  3MDK A;  5ELG A;  1YEX A;  3C71 A;  1Z7R A;  3CMI A;  5B6N A;  5D93 A;  1KBN A;  2CT6 A;  4N10 A;  1YVL A;  3IAS 2;  2HRK A;  3HMJ G;  2VCQ A;  2O87 A;  2C3T A;  2WB9 A;  2I4A A;  1JHB A;  1FB0 A;  1ZYQ B;  2YJH A;  3PPU A;  3APO A;  2YAN A;  2ON5 A;  1ZMA A;  4QMK A;  1K3O A;  5EVO A;  1YF1 A;  1V98 A;  2H6Z A;  3G7J A;  2VO4 A;  2CQ9 A;  1PN9 A;  5IO0 A;  3F6D A;  2CVK A;  1Q98 A;  3HY2 A;  1A0F A;  3GRX A;  6GSV A;  1SK2 A;  1K0D A;  5ECH B;  1AQX A;  3PR8 A;  3CXG A;  4MJE A;  5COH A;  4BA7 A;  3Q19 A;  4YQV A;  4POB A;  2HSY A;  1Y6E A;  5F07 A;  1OE8 A;  3VWV A;  2J23 A;  4WBJ A;  1GUM A;  1KNG A;  2YZH A;  3KMO A;  4NMU A;  5IO2 A;  4XIH A;  1WJK A;  2OBI A;  3EE2 A;  2V6K A;  5GSS A;  3ZIT A;  4KAE A;  3GTU B;  3OR5 A;  4GQF A;  2LQQ A;  4OMV A;  2XBI A;  2OAC A;  1K0N A;  1ST9 A;  3FHK A;  2MMA A;  2FGX A;  1ZYN A;  2NDO A;  4MF6 A;  3IE3 A;  5J40 A;  1DE1 A;  4I6X A;  1V2A A;  1HNA A;  1VF3 A;  7GSS A;  3CWG A;  5IMV A;  3TUE A;  2C3N A;  3HHV A;  5ABR A;  1MDJ A;  4KW6 A;  4NAX A;  4KND A;  1F6M C;  3F8U A;  17GS A;  4F9Z A;  4Z7X A;  2FA8 A;  4ML6 A;  2RUE A;  4OFM A;  3I9V 2;  1SK1 A;  4NHZ A;  3FR9 A;  3KCM A;  4YQU A;  3IC8 A;  2EIO A;  5CRH A;  5CAX A;  2DIY A;  2C0E A;  1IYH A;  3R2Q A;  1XBS A;  5A5K A;  1AAZ A;  5A4V A;  3A2W A;  2GDR A;  2B7K A;  4IQ1 A;  4N11 A;  4HZ2 A;  1R4W A;  2V41 A;  1JZW A;  4ZL7 A;  1B48 A;  1YY7 A;  4KSM A;  2IWT A;  4E68 A;  2FWG A;  3H79 A;  5KEJ A;  1O85 A;  4JZQ A;  4JR4 A;  1TU7 A;  3LEF A;  2CZ3 A;  3PGT A;  6GSW A;  4G19 A;  3ZTL A;  2GSS A;  1BX9 A;  3EPT A;  2C8U A;  5ECM B;  4Z2R A;  1NHY A;  2N5F A;  5DVB A;  4TR0 A;  4TXV A;  4G9H A;  3Q6O A;  5BMU B;  2G2Q A;  4XHM A;  5A34 B;  5ECQ B;  3PH9 A;  2RUF A;  4GSN A;  3GN3 A;  4MH2 A;  2N5A A;  5D8I A;  2PGT A;  1GRX A;  1PRX A;  2DJ2 A;  4MCU A;  3LYK A;  1BG1 A;  1GL8 A;  3LXT A;  3D5J A;  4LMV A;  1M9A A;  3ZLP A;  1FG4 A;  3LW9 A;  4ECI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...