4Q5FA

Crystal structure of the glutathione s-transferase from ascaris lumbricoides
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
205
Chain Sequence
PQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVDGEVLAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKVLKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADLVITDSLASWESLIPDFLSGHLQLKKYIEHVRELPNIKKWIAERPKTPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase 1
publication title Crystal Structure of the Glutathione S-transferase from Ascaris lumbricoides
rcsb
source organism Ascaris suum
total genus 70
structure length 205
sequence length 205
chains with identical sequence D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4q5fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4q5fA01
2X8CA 4N10A 2IMFA 1O8WA 1ON4A 1ZZYA 2HRFA 2RM6A 2H1DA 1NM3A 2I81A 3G9BA 4IBPA 3FY7A 3FKFA 1UN2A 4TVEA 4EUYA 2PGTA 2GZZA 1B48A 3DKSA 2DC5A 2VCZA 3QAVA 4OWYA 3TUEA 4AGSA 4GF0A 4IHUA 4IP1A 19GSA 11GSA 3Q6OA 4WBRD 1BEDA 4POKA 4K0NA 2VCXA 5D73A 3M8NA 5G30A 3CTGA 2DJJA 3HCZA 4MA9A 2I1UA 3QFAC 4K0GA 3MDKA 4IW9A 4XRAA 2PPTA 2L6DA 2R4VA 3GX8A 4TRXA 5FWGA 1U6TA 4DEJA 6GSVA 4BA7A 3CYNA 1KBNA 5HFKA 4FIWA 4KSOA 5AIVA 6GSXA 4MF7A 2VL3A 3W8JA 3ZTLA 1GSDA 5G5FA 1RW1A 4USSA 5ECKB 2CVDA 5JCUA 2PBJA 2O89A 4AJ7A 3IOSA 5IO0A 1HNBA 5DDLA 5J5NA 4LMVA 3GKNA 3ZMKA 2LNSA 2X99A 3LFLA 2WZ9A 4EE0A 4ILFA 1GTUA 2H6XA 4JEDA 3GTUB 2JSYA 3P8WA 1TRSA 1EGRA 5ECOB 4BWQA 4PQHA 3O76A 2FHEA 1ILOA 4J2FA 1NW2A 2FA8A 3F9UA 3KZQA 5D9WA 2VCQA 4GSSA 5KN3A 2YWNA 2IJYA 1K3OA 4MPGA 5ECMB 4ZL8A 2L57A 2WULA 1C72A 1WRYA 3RHBA 1THXA 1X5EA 3MWHA 1KNGA 3TKQA 3HXSA 2L59A 3A5WA 5IM9A 3PINA 2RUEA 2HRKA 3TRQA 5JCWA 2JZRA 1Y25A 5ELAA 1PSQA 4PNFA 2AV4A 2LNTA 2H66A 1X9MB 2AJQB 1ZGNA 4WR4A 3NOFA 2OJLA 2P0GA 1OC9A 1A24A 1ERTA 5H5SA 4BPYA 5EVOA 3N5OA 4IQ1A 3EU4A 4Q5NA 4OFMA 4HQSA 13GSA 5CO3A 4DVCA 2CZ3A 3A2WA 5G31A 2OADA 3L4NA 1AUCA 2P5RA 3LXZA 3KD0A 2TRXA 3EVIA 2H75A 2LUSA 2F9SA 1WJKA 3KH9A 4XTSA 3D21A 2E2GA 1FVKA 3IAS2 3FYGA 2B1KA 2C0EA 2VLTA 2OE1A 3W8SA 2N5AA 3IV4A 2DJ3A 3TKSC 4EVMA 1MDJA 2L5LA 3V1WA 3BCKA 2E7PA 1KEBA 5IO2A 3DIEA 2CAIA 3GL3A 1T8EB 5IOWA 4V2MA 1TXXA 4XCSA 3HVVA 1VGLA 1O7UA 4ZILA 5J4UA 1V57A 2AHEA 2LJKA 3VI7A 1QK8A 2LV3A 2VAFA 3GKKA 4TW5A 3EMPA 2H1BA 3ZFLA 4I6XA 3Q19A 4NWYA 1AQVA 3QAWA 5AGYA 3HVXA 4MMMA 1YQ1A 2H01A 1J08A 5KN1A 3TGZA 2PUKC 3GUSA 3LSZA 4ZB9A 1S3CA 3A2VA 1TRWA 2LTKA 4K8MA 1AW9A 4NV5A 3C71A 1Y6EA 5C00A 1CQGA 4HJMA 2IMIA 4NAXA 1V40A 4KUNA 4ZXGA 4GQCA 4RUVA 3HZ4A 3ZYWA 4TR0A 4GLTA 2FWEA 1OAZA 2HSHA 7GSSA 1FG4A 1MTCA 3CMIA 2K8SA 5JWRB 1XBSA 1EP7A 2KHPA 4KDUA 2VLUA 4Q5QA 4AF2A 10GSA 2VL2A 3DD3A 3F4TA 3PR8A 4MZWA 2C0GA 3GA4A 4FO5A 3TKSE 4TR4A 1X5CA 2FNOA 3TCOA 2JZSA 3M9KA 5IIZA 2MYGA 4LLRA 3HVSA 2WB9A 3KXOA 2GSRA 1M9AA 4XS4A 3FHKA 5D9TA 5CRGA 4MLYA 2VCTA 1K3LA 4KDYA 4HI7A 3RAZA 3LORA 2DJ2A 2A2SA 4EXJA 3I6AA 3IR4A 1VRSD 2B7KA 3EYTA 4OO5A 2JL4A 1TOFA 1UC7A 3ZLPA 3QR6A 4LL4B 1DE2A 4WF5A 4KB3A 1XOBA 3ZVJA 2GVPA 4FYBA 2H30A 2A2RA 1F2EA 2RIIA 4BL7A 2GT5A 3IDVA 5B8BA 4D73B 5H5QA 1PL2A 1OC9B 1URMA 3FEUA 1CQHA 1XW6A 2LEGA 4XS1A 1Z7RA 2F8AA 4MJCA 1DE1A 3H1NA 2FUG2 3VPQA 5AIXA 4YAPA 3F3RA 2L5OA 3GX0A 2FCHA 5ECIB 4QL7A 1G7OA 3QCPA 2C3QA 1XWKA 5CREA 2OE0A 4MJAA 4GCIA 3F0IA 3EMXA 2V32A 1EP8A 3L9UA 2AAWA 3L9VA 1NHOA 1X9WB 1ZOFA 4ZBDA 2K18A 3HD5A 2ALBA 5KN2A 1O73A 4F03A 5ECSA 4BVYA 1ST9A 3BOAA 1SENA 5CAXA 4ZBAA 1WP0A 4I5QA 1ZMAA 2YWOA 2V2GA 4KGIA 2GT6A 4ZBBA 3QDNA 1TRUA 2LKUA 3HJPA 5IOXA 1BYEA 2FWFA 1X9SB 2A4VA 2H0IA 1WE0A 5CP1A 1GLPA 2HFDA 2VM2A 3WGDA 1EOHA 2XC2A 1AAZA 4TKYA 2NPBA 4PQ1A 1PX7A 1T1VA 4G2EA 2CAQA 2NVLA 2YPMA 1EV9A 5J3RA 3IAM2 1GSYA 1SK2A 1A2JA 1K0AA 1ERWA 3A3TA 4O7HA 4IJ3A 3ERWA 1GTIA 4IJIA 2YN1A 4TXOA 4BVXA 5G1LA 5JCGA 3DVWA 5ENUA 1GSQA 2O85A 2DMMA 5J41A 1EGOA 1BAYA 2O7KA 2J9HA 1F3BA 2PN8A 5IMCA 2FGXA 2R2JA 4GSNA 2PWJA 2CT6A 4L0WA 4MABA 1ZYEA 5A4WA 1Z9HA 1SD9A 4TR1A 2NTOA 2KP1A 4N0ZA 1GULA 1QUWA 1K0NA 2V6OA 2VO4A 5ECPB 4V1Ap 3GKMA 1F9MA 3UEMA 4HOJA 1A8LA 4KNDA 1PN9A 4CDOA 1WPIA 2XBQA 3ZIVA 3ZIJA 4K9ZA 2H0GA 4L5OA 3C73A 4E8EA 2FA4A 2IWTA 1B9YC 4RQRA 2CQ9A 1BG5A 3CSJA 4K7IA 2C1YA 4RI7A 3L0HA 4WKWA 2VCWA 4G0IA 1Z5YE 1GNEA 2CX3A 2H6YA 3DVXA 2CVBA 1G0TA 5GAND 1GTBA 2Z9SA 1TU8A 5IMFA 3ZFBA 3TJJA 1A2MA 2IIYA 1YEPA 1TI1A 1AQXA 3ZRDA 5DAKA 2VCVA 3CSHA 2R37A 3E3EA 4LMWA 5GZZB 1QMVA 1TK0B 4POBA 4ML1A 4KE3A 3E0UA 5JWOB 3AY8A 3NZNA 3QOUA 2WGRA 2RLIA 3F6DA 3ME7A 3LWAA 4MP4A 2V41A 1VF4A 5IPHA 3TRPA 1TP9A 1K0MA 5GAPD 1G6YA 1M2BA 3UOMA 5INYA 5ELGA 5HQPA 4IS0A 2M80A 2DMLA 3ZZXA 4I2TA 5CRWA 3D0ZA 2GGTA 3U6VA 3O3TA 1FO5A 1B4PA 4G0KA 4HU7A 2DJ1A 4NXIA 5HR1A 3I43A 3L9SA 3QMXA 5DCGA 4O32A 2YJ7A 4JR6A 1FVJA 4KF9A 3GV1A 4WXTA 2IFQB 2P5QA 1YY7A 1R26A 1GUMA 4BVYB 2PVQA 6GSWA 3KM6A 2EIQA 1OC3A 4DSSA 4IKHA 4POMA 4FH8A 1GSFA 3CRTA 4L8EA 4YAVA 3UMAA 1AIUA 1GSUA 3D22A 4KX4A 5IMAA 3FK8A 2HSNB 4LA1A 4V1Ag 2VL2C 5E59A 1PKWA 1YKCA 1H75A 3H8QA 4GWRA 3EE2A 1PMTA 1HNAA 3GH9A 2H74A 3DXBA 1PQNA 5IMDA 18GSA 3DMLA 3RPNA 3D4TA 2ON7A 2ZNMA 4GTUA 5ECRB 4N11A 2X8GA 1MD3A 3OR5A 1FB6A 5G1KA 4TXOB 4BVXB 2HSYA 4PUFC 2ON5A 3LGCA 2MBSA 3KTLA 3HHVA 1ML6A 2H71A 2B5XA 3G7IA 1TKDB 2KOKA 4GSTA 4PX1A 4CHSA 4HJ2A 1AC1A 1IYIA 1V58A 2RM5A 3TKRA 1KTEA 1JZWA 3CTFA 2EC4A 1THOA 3UAPA 2XHFA 3ZITA 5J9CA 4RQXA 2H6ZA 4J57E 22GSA 1UA5A 2I3YA 3CRUA 3QD9A 3KMNA 6GSSA 2J23A 1B9XC 3C8EA 4N0VA 5EY6A 4HUAA 1GH2A 4H86A 1PGTA 2GTUA 3EWLA 2L4CA 4ECIA 1XW5A 1WIKA 5G5EA 2H1AA 1U3AA 5DQSA 2XPDA 1PA3A 4HQZA 1F37A 3GHAA 5BMUA 1JZDA 2MMNA 3FW2A 12GSA 5LD0A 5DJMA 1DBYA 3GRXA 2YOIA 5G2ZA 3GYKA 1GRXA 5DJLA 2OE3A 3F4SA 2LRNA 3IRAA 3IE3A 1VF1A 4MK3A 3DEXA 1USBA 2DIYA 1AQWA 2QSIA 2VM1A 5D9VA 1B8XA 5DALA 3IC4A 2MMOA 1YKAA 1GLQA 2LJAA 3KTBA 5HFIA 2CA8A 1HNCA 2B3SA 2LS5A 2LSTA 3TB2A 4PNGA 5D8IA 4HZ2A 5A5KA 1E2YA 1J9BA 3WGEA 3M3MA 2ZCTA 2HE3A 4IP6A 1X0RA 3FZ4A 3UVTA 1XXUA 4I8BA 2LRTA 1O6JA 2X8HA 2R6KA 3WYWA 3VPTA 1K0OA 2L4QA 3Q18A 1U88A 1TJDA 3ERFA 1R4WA 1NSWA 3F6FA 3APQA 4F0CA 3CSIA 17GSA 4PGTA 3KCMA 2VD1A 1A2LA 2PVOC 3RDWA 5DCHA 1QFNA 3UARA 3PH9A 1MD4A 4FYUA 5EL8A 2K9FA 5A4VA 2GSQA 5FHIA 2V1MA 2HRKB 4AJ6A 2IPAA 5JWQB 2C4JA 3KEBA 2C80A 2TRCP 1JHBA 4ZL7A 1FW1A 2YZHA 3LEFA 2YP6A 2MMAA 4RI6A 4MJEA 2OBIA 4YQUA 2JADA 4HZ4A 4GQFA 4G10A 3E9JB 3APSA 3R2QA 2R5GA 5ECNB 3GL5A 1O8XA 1SJ6A 3UJ1A 3GKXA 1GWCA 5GSSA 1SKSB 3ZREA 2HZFA 1ERUA 4HEA2 4K2DA 4BWSA 1DSBA 4ZB8A 4Z7XA 3P90A 4QQ7A 5COHA 2PERA 3DYRA 5D9XA 3GTUA 1ERVA 1T4YA 2VL9A 3VURA 1XWCA 3HDCA 2B6MA 1XFLA 1W89A 1S3AA 4MZBA 2G0FA 1ZYQB 3M1GA 5LNKe 3FZ9A 2NDOA 1ABAA 3GSTA 5CRDA 5ABRA 2ZUPA 1R5AA 1SK0A 4WR5A 1W4VA 1F6MC 2FLSA 1FOVA 3IXRA 1XPVA 4ECCA 5F05A 4TR3A 1GNWA 4POLA 1QQ2A 3KP9A 3MAKA 4KCAA 2HZEA 4KH7A 1HYUA 4EF0A 4OFTA 2IMDA 1TTZA 1SK1A 4OFNA 2KP2A 2L6CA 1M0UA 1BQ7A 5ID2A 2HQTA 3VI5A 3CXGA 4DSQA 3I9V2 2R3XA 1M7TA 1G7EA 4WBJA 3ERGA 1FB0A 1E6BA 1VF2A 3LYKA 5ECLB 3IA1A 4GXZA 4FYCA 3FR6A 2RUFA 2DJ0A 2UZ8A 2PMTA 1RK4A 2YJHA 3U5RE 2YV9A 4YQVA 2VD0A 4E8HA 2AB6A 1PKZA 16GSA 3FRCA 5ECQB 4TXVA 5F8BA 2G2QA 1MEKA 3HZ8A 1YDKA 4YQMA 5HR0A 5D93A 1A0RP 4F0BA 4ULXA 4MH2A 1DUGA 2CV4A 3IK9A 5HR3A 4MH3A 2FWGA 3D5JA 3TDGA 2OBKA 3F63A 1EEJA 4EKZA 3HJOA 3G7JA 1M2DA 2YCDA 6GSUA 5AN1A 4TN8A 3FR3A 3BCIA 2O8VB 2GS3A 4QL9A 1YF1A 2KUCA 5KEJA 1T00A 1XIYA 2HRAA 2C0DA 4KAEA 4XS4B 5EPFA 2MZCA 4WEYA 1Z3EA 1WOUA 1X5DA 4MZCA 4O92A 3D6IA 1QXHA 1ZL9A 3KIJA 1PD21 1YF0A 4JRRA 1XZOA 4IVFA 2GQMA 5L71A 1GUKA 3SBCA 3VWUA 2FWHA 3IC8A 3KGKA 2HSMA 1K3YA 3US3A 3GFKA 1G6WA 3DWVA 4XS6A 3ED3A 1J0FA 2HI7A 2B7JA 1VF3A 5HFGA 4BL7B 2N5FA 2IMEA 2N5BA 3F4RA 5H5RA 3PGTA 2NBSA 3H79A 1H4OA 4AJ8A 1XWAA 5A4UA 4WETA 1UVZA 2JU5A 4OCEA 2LQQA 2M72A 2K6VA 5DVBA 1M99A 3EURA 3L78A 1TK8B 1XWGA 2QGVA 4PTSA 3K8NA 1S3DA 2I9HA 4NV2A 4OCFA 3VWWA 2MBTA 4KCEA 3FZ5A 3EC3A 2JSZA 2I4AA 3QPMA 1SJIA 1GSEA 3UIWA 3VWXA 2H8LA 2GSSA 2ES7A 1OC8A 4XIHA 4V2NA 1FHEA 2YZUA 2B5YA 1NHYA 4IN0A 1XOAA 2WJUA 3Q74A 3TRXA 2AUVA 3ZL5A 1SJZA 4ZIJA 4HU9A 3LG6A 3P2AA 2KLXA 5CYYA 1YJ6A 1EOGA 3BBYA 1T4ZA 2C3TA 4F2IA 4PXOA 4IELA 3WGXA 2HZEB 5AISA 2IN3A 2TIRA 4JBBA 1A23A 2HXKA 3W6GA 4FQUA 2OKAA 1JZRA 3UVHA 2YNXA 5ID2B 3RBTA 4ISDA 3ZVJD 3A2XA 2B1LA 3TKPA 4ZL9A 2VUPA 4D73A 3BJ5A 1XVQA 3S9FA 3DGQA 1Z6MA 3KH7A 4CW9A 1WMJA 3UL3A 1T3BA 3WT2A 4X0XA 5LCZA 3F3QA 1OVNA 3C1RA 4X1UA 4ZB6A 1EV4A 2LQOA 3ME8A 5KN0A 1HQOA 1Z7PA 2WS2A 3EINA 3J7Yb 4EDYA 1Z6NA 2QKEA 5B6MA 1PRXA 1TDIA 5F0GA 1M2AA 3TJGA 3SWLA 3EU3A 2HNLA 3GN3A 1TI3A 3HKRA 1O85A 2VLVA 1OKTA 4IGJA 4TR1B 2LRCA 2C3NA 4G0LA 4PUAA 3TJKA 3TJFA 1O81A 1K0CA 2XPEA 3F8UA 2JZTA 4NHZA 2GZPA 4IQAA 2F51A 1T7PB 4Q5RA 2REMA 4ACSA 4I2UA 5IPGA 4OMVA 4ECJA 1TW9A 3ISOA 20GSA 2E2MA 1Q4JA 4I97A 4HDEA 5CRHA 1TU7A 1SU9A 4X43A 3VLNA 5F06A 4EC0A 4ID0A 5IQYA 5IMZA 2HT9A 4N30A 4PURA 3VK9A 2HRNA 4L5LA 2IL3A 4L0UA 5DQYA 3IPZA 1B4QA 1XW9A 4P3YB 1GTAA 3TOTA 2OACA 2HSMB 2V6KA 3TJBA 3FZAA 3JCML 3R3EA 4JE1A 2VIMA 4OD7A 3I69A 1SYRA 1AXDA 2VOCA 4K7OA 4KW6A 3MSZA 4MDCA 3QAGA 5J9BA 1V2AA 3GURA 5DAKB 1FAAA 6GSTA 5HR2A 3WT1A 4KA0A 8GSSA 1A0FA 2H19A 1HD2A 4WF4A 1OE7A 4XHMA 4OO4A 1V9WA 1SKWB 3GNJA 2GZYA 2C0FA 5DBQA 3H4KA 4EO3A 2YWMA 3LJRA 2C8UA 4MCUA 4G9HA 1MDIA 4K7NA 2WCIA 2DBCA 1JFUA 2DIZA 1U3IA 3VWVA 1YEXA 1OKDA 2DLXA 2WFCA 2H72A 3RPPA 4JZQA 2XBIA 1N8JA 4KSMA 1R5PA 3IBHA 1U87A 1JZOA 6GSYA 1PX6A 5E4WA 2HYXA 1I5GA 1ZCPA 3NIVA 3APOA 4PQIA 2EIRA 1XWBA 2FY6A 4DSSB 2CVKA 3C1SA 4EL1A 1SKRB 1WWJA 5B6NA 5F07A 2EIOA 3KJYA 2CZ2A 3GMFA 1TK5B 4NHWA 1EEMA 3HYPA 3M0FA 2AYTA 4XRDA 4YH2A 2X64A 3TKSA 3D4MA 4ML6A 4MJBA 4NPBA 3HY2A 3ZMLA 2FD3A 1TRVA 1SD8A 2YWIA 1EWXA 2MMZA 3KMOA 3VFIA 4F82A 3HJMA 4LL1B 4J56E 3TOUA 1K0BA 1R7HA 1XCCA 1IYHA 2F8FA 4NMUA 4Q5FA 4MPFA 2LJRA 4G19A 1BX9A 3LQ7A 2H1GA 1SL2B 3H93A 2D2ZA 2HLSA 1I9DA 2B5EA 4K1FA 1GL8A 2BTOT 1JLWA 1ACVA 2IMKA 1LU4A 2H73A 1SYXA 4ECBA 2K8VA 4O5RA 1RQMA 2YV7A 3GH6A 3PPUA 1GSSA 4KDXA 3UBLA 4HS1A 2DJKA 2F3MA 2BJXA 1OYJA 1Q98A 2GSTA 5B8AA 1LJRA 3C7MA 5B7CA 1MDKA 1BJXA 1GUHA 1QGVA 2CX4A 3QFBC 1A8YA 2M46A 3MNGA 3LYPA 4V2LA 3HA9A 2IFQA 5CNWA 2PU9C 3N9JA 1GP1A 1LBKA 2WDUA 2WRTA 3DRNA 3GIXA 2OA7A 1SL0B 2H70A 5IMVA 3IK7A 4JU5A 3P7XA 4F9ZA 2GQLA 2JACA 4DSRA 4MF6A 1V98A 3IHQA 3KP8A 2P31A 3LXTA 2H76A 4GRFA 3GSSA 1K0DA 1EZKA 5GSTA 1PL1A 3O6TA 1JLVA 4TOPA 2YANA 2E0QA 1YZXA 4JR4A 1N2AA 1SL1B 4EDZA 3BD2A 3M9JA 3UBKA 5D96A 3CBUA 1XVWA 2GQKA 3J7Yk 2QC7A 1OE8A 1F3AA 3RHCA 9GSSA 4K6XA 14GSA 5ECHB 2GLRA 2BMXA 2GDRA 2DSAA 2H0HA 1M9BA 5FT3A 3FR9A 5C04A 4MF5A 3WD6A 2O87A 5DALB 3G7YA
chains in the Genus database with same CATH superfamily
2X8CA 3MIXA 4N10A 2IMFA 1O8WA 1ON4A 1ZZYA 2HRFA 5KOWA 2RM6A 2H1DA 1NM3A 2I81A 3G9BA 4IBPA 3FY7A 3FKFA 1UN2A 4TVEA 4EUYA 2PGTA 2GZZA 1B48A 3DKSA 2DC5A 2VCZA 3QAVA 4OWYA 3TUEA 4AGSA 4GF0A 1N25A 4IHUA 4IP1A 19GSA 11GSA 1ZYPA 3Q6OA 4WBRD 1BEDA 4POKA 4K0NA 2VCXA 5D73A 3M8NA 5G30A 4A5PA 3CTGA 2DJJA 3HCZA 3IHGA 4MA9A 2I1UA 3QFAC 4K0GA 3MDKA 4IW9A 4XRAA 2PPTA 2L6DA 2R4VA 3GX8A 4TRXA 5FWGA 1U6TA 4DEJA 6GSVA 4BA7A 3CYNA 1KBNA 5HFKA 4FIWA 4KSOA 5AIVA 4YKFA 6GSXA 4MF7A 2VL3A 3W8JA 3ZTLA 1GSDA 5G5FA 1RW1A 4USSA 5ECKB 2CVDA 5JCUA 2PBJA 2O89A 4AJ7A 3IOSA 5IO0A 1HNBA 2X4AA 5DDLA 5J5NA 4LMVA 3GKNA 3ZMKA 2LNSA 2X99A 1XG8A 3LFLA 2WZ9A 4EE0A 4ILFA 1GTUA 2H6XA 4JEDA 4CY8A 3GTUB 2JSYA 3P8WA 1TRSA 1EGRA 2WW0A 5ECOB 4BWQA 4PQHA 3O76A 2FHEA 1ILOA 4J2FA 1NW2A 2FA8A 3F9UA 3KZQA 5D9WA 2VCQA 4GSSA 5KN3A 5A1NB 2YWNA 2IJYA 1K3OA 4MPGA 5ECMB 4ZL8A 2L57A 2WULA 1C72A 1WRYA 3RHBA 1THXA 1X5EA 3TU3B 3MWHA 1KNGA 3TKQA 3HXSA 2L59A 3A5WA 5IM9A 3PINA 2RUEA 2HRKA 3TRQA 5JCWA 2JZRA 1Y25A 5ELAA 1PSQA 4PNFA 2AV4A 2LNTA 2H66A 1X9MB 2AJQB 1ZGNA 4WR4A 3NOFA 2OJLA 2P0GA 1OC9A 1A24A 2A2PA 1ERTA 3RFRC 5H5SA 4BPYA 5EVOA 3N5OA 4IQ1A 3EU4A 4AKXB 4Q5NA 2O36A 4X4JA 4OFMA 4HQSA 13GSA 5CO3A 4DVCA 2CZ3A 3A2WA 5G31A 2OADA 3L4NA 1AUCA 2P5RA 3LXZA 3KD0A 2TRXA 3EVIA 1YEWC 2H75A 2LUSA 2F9SA 1WJKA 3KH9A 4XTSA 3D21A 2E2GA 1FVKA 3IAS2 3FYGA 2B1KA 2C0EA 2VLTA 2OE1A 3W8SA 2N5AA 3IV4A 2DJ3A 3TKSC 4EVMA 1MDJA 2L5LA 3V1WA 3BCKA 2E7PA 1KEBA 5IO2A 3DIEA 2CAIA 3GL3A 1T8EB 5IOWA 4V2MA 1TXXA 4XCSA 3HVVA 1VGLA 1O7UA 4ZILA 5J4UA 1V57A 2AHEA 2LJKA 3VI7A 1QK8A 2LV3A 3A5IA 2VAFA 3GKKA 4TW5A 3EMPA 2H1BA 3ZFLA 4I6XA 3Q19A 4NWYA 1AQVA 3QAWA 5AGYA 3HVXA 4MMMA 1YQ1A 2H01A 1J08A 2WW2A 5KN1A 3TGZA 2PUKC 3GUSA 3LSZA 4K5SA 1SVLA 4ZB9A 1S3CA 3A2VA 2WW1A 1TRWA 2LTKA 4K8MA 1AW9A 4NV5A 3C71A 1Y6EA 5C00A 2WZSA 1CQGA 4HJMA 2IMIA 4NAXA 1V40A 4Z2TA 4KUNA 4AKHA 4ZXGA 3CQFA 4GQCA 4RUVA 3HZ4A 3ZYWA 4TR0A 4GLTA 2FWEA 1OAZA 2HSHA 7GSSA 1FG4A 1MTCA 3CMIA 2K8SA 5JWRB 1XBSA 1EP7A 2KHPA 4KDUA 2VLUA 4Q5QA 4AF2A 10GSA 2VL2A 3DD3A 3F4TA 3PR8A 4MZWA 2C0GA 3GA4A 4FO5A 3TKSE 1TXUA 4TR4A 1X5CA 2FNOA 2DKIA 3TCOA 2JZSA 3M9KA 5IIZA 5J40A 2MYGA 4LLRA 3HVSA 2WB9A 3KXOA 2GSRA 1M9AA 4XS4A 3FHKA 5D9TA 5CRGA 4MLYA 2VCTA 1K3LA 4KDYA 4HI7A 3RAZA 3LORA 2DJ2A 2A2SA 4EXJA 3I6AA 3IR4A 1VRSD 2B7KA 3EYTA 4OO5A 2JL4A 1TOFA 1UC7A 3ZLPA 3QR6A 4LL4B 1DE2A 4WF5A 4KB3A 4EIPA 1XOBA 3ZVJA 2GVPA 4FYBA 2H30A 2A2RA 1F2EA 2RIIA 4BL7A 2GT5A 3IDVA 5B8BA 4D73B 5H5QA 1PL2A 1OC9B 1URMA 3FEUA 1CQHA 1XW6A 2LEGA 4XS1A 1Z7RA 2F8AA 4MJCA 1DE1A 3H1NA 2FUG2 3VPQA 5AIXA 4YAPA 3F3RA 2L5OA 3GX0A 2FCHA 4ICYA 5ECIB 3EPTA 4QL7A 1G7OA 3QCPA 2C3QA 1XWKA 5CREA 2OE0A 2WVXA 4MJAA 4GCIA 3F0IA 3EMXA 2V32A 1EP8A 3L9UA 2AAWA 3L9VA 1NHOA 1X9WB 1ZOFA 4ZBDA 2K18A 3HD5A 2ALBA 5KN2A 1O73A 4F03A 5ECSA 4BVYA 1ST9A 3BOAA 4Z2RA 1SENA 5CAXA 4ZBAA 1WP0A 4I5QA 1ZMAA 2YWOA 2V2GA 4KGIA 2GT6A 4ZBBA 3QDNA 2O3EA 1TRUA 2LKUA 3HJPA 5IOXA 1BYEA 2FWFA 1X9SB 2A4VA 2H0IA 1WE0A 5CP1A 1GLPA 2HFDA 2VM2A 3WGDA 1EOHA 2XC2A 1AAZA 4TKYA 2A4HA 2NPBA 4PQ1A 1PX7A 1T1VA 4G2EA 2CAQA 2NVLA 2YPMA 1EV9A 4W66A 5J3RA 3IAM2 1GSYA 1SK2A 1A2JA 1K0AA 1ERWA 3A3TA 4O7HA 4IJ3A 3ERWA 1GTIA 4IJIA 2YN1A 4TXOA 4BVXA 5G1LA 5JCGA 3DVWA 5ENUA 1GSQA 2O85A 2DMMA 5J41A 2WW3A 1EGOA 1BAYA 2O7KA 2J9HA 1F3BA 2PN8A 2EFEA 5IMCA 2FGXA 2R2JA 4GSNA 1FOHA 5A34B 2PWJA 2CT6A 4L0WA 4MABA 1Y1UA 1ZYEA 5A4WA 1Z9HA 1SD9A 4TR1A 2NTOA 2KP1A 4N0ZA 1GULA 1QUWA 1K0NA 2V6OA 2VO4A 5ECPB 4V1Ap 3GKMA 1F9MA 3UEMA 4HOJA 1A8LA 4KNDA 1PN9A 4CDOA 1WPIA 2XBQA 3ZIVA 3ZIJA 4K9ZA 2H0GA 4L5OA 3C73A 4E8EA 2FA4A 2EFHA 2IWTA 1B9YC 4RQRA 2CQ9A 1BG5A 3CSJA 1S4BP 4K7IA 2C1YA 5KOXA 4RI7A 3L0HA 4WKWA 2VCWA 2R0PA 4G0IA 1Z5YE 1GNEA 2CX3A 2H6YA 3DVXA 2CVBA 1G0TA 5GAND 1GTBA 2Z9SA 1TU8A 5IMFA 3ZFBA 3TJJA 1A2MA 2IIYA 1YEPA 5J4YA 1TI1A 1AQXA 3ZRDA 5DAKA 2VCVA 3CSHA 2R37A 3E3EA 4LMWA 5GZZB 1QMVA 1TK0B 4POBA 4ML1A 4KE3A 3E0UA 5JWOB 1PFOA 3AY8A 1ZYNA 3NZNA 3QOUA 2WGRA 2RLIA 3F6DA 3ME7A 2EFCA 3LWAA 4MP4A 2V41A 1VF4A 5IPHA 3MYDA 3TRPA 1TP9A 1K0MA 5GAPD 1G6YA 1M2BA 3UOMA 5INYA 5ELGA 5BRTA 5HQPA 4IS0A 2M80A 2DMLA 3ZZXA 4I2TA 5CRWA 3D0ZA 2GGTA 3U6VA 3O3TA 1FO5A 1B4PA 4G0KA 4HU7A 2DJ1A 4NXIA 5HR1A 3I43A 3L9SA 3QMXA 5DCGA 4O32A 2YJ7A 4JR6A 1FVJA 4KF9A 3GV1A 4WXTA 2IFQB 2P5QA 1YY7A 1R26A 1GUMA 4BVYB 2PVQA 6GSWA 3KM6A 2EIQA 1OC3A 4DSSA 4IKHA 4POMA 4FH8A 1GSFA 3CRTA 3FMWA 4L8EA 4YAVA 5J4VA 3UMAA 1AIUA 4GDFA 1GSUA 3D22A 4KX4A 5IMAA 3FK8A 2HSNB 4LA1A 4V1Ag 4PHZC 2VL2C 5E59A 1PKWA 1YKCA 1H75A 3H8QA 4GWRA 3EE2A 5A5HA 1PMTA 1HNAA 1I1IP 3GH9A 2H74A 3DXBA 1PQNA 1M3JA 5IMDA 18GSA 3DMLA 3RPNA 3D4TA 2ON7A 2ZNMA 4GTUA 5ECRB 4N11A 2X8GA 1MD3A 3OR5A 1FB6A 5G1KA 4TXOB 4BVXB 2HSYA 4PUFC 2ON5A 4E68A 3LGCA 2MBSA 3KTLA 3HHVA 1ML6A 2H71A 2B5XA 3G7IA 1TKDB 2KOKA 4GSTA 4PX1A 4CHSA 4HJ2A 1AC1A 1IYIA 1V58A 2RM5A 3TKRA 1KTEA 1JZWA 3CTFA 2EC4A 1THOA 3UAPA 2XHFA 3ZITA 5J9CA 4RQXA 2H6ZA 4J57E 22GSA 1UA5A 2I3YA 3CRUA 3QD9A 3KMNA 6GSSA 2QA1A 4YKGA 2J23A 1B9XC 3C8EA 4N0VA 5EY6A 4HUAA 1GH2A 4H86A 1PGTA 2GTUA 3EWLA 2L4CA 4ECIA 1BF5A 1XW5A 1WIKA 5G5EA 2H1AA 1U3AA 5DQSA 2XPDA 1SVMA 1PA3A 4HQZA 1F37A 3GHAA 5BMUA 1JZDA 1YVLA 2MMNA 3FW2A 12GSA 5LD0A 5DJMA 1DBYA 3GRXA 2YOIA 5G2ZA 3GYKA 1GRXA 5DJLA 2OE3A 3F4SA 4G01A 2LRNA 3IRAA 3IE3A 1VF1A 4MK3A 3DEXA 1USBA 2DIYA 1AQWA 2QSIA 4EIQA 2VM1A 5D9VA 1B8XA 4HSCX 5DALA 3IC4A 2MMOA 1YKAA 1GLQA 2LJAA 3KTBA 5HFIA 2CA8A 1HNCA 2B3SA 2LS5A 2LSTA 3TB2A 4PNGA 5D8IA 4HZ2A 5A5KA 1E2YA 1J9BA 3WGEA 3M3MA 2ZCTA 2HE3A 4IP6A 1X0RA 3FZ4A 3UVTA 1XXUA 4I8BA 2LRTA 1O6JA 2X8HA 2R6KA 2WVZA 3WYWA 3VPTA 1K0OA 2L4QA 3Q18A 1U88A 1TJDA 3ERFA 2VKZG 1R4WA 1NSWA 3F6FA 3APQA 4F0CA 3CSIA 17GSA 4PGTA 3KCMA 2VD1A 1A2LA 2PVOC 3RDWA 5DCHA 1QFNA 3UARA 3PH9A 1MD4A 4FYUA 5EL8A 2K9FA 5A4VA 2GSQA 5FHIA 2V1MA 2HRKB 4AJ6A 2IPAA 1BG1A 5JWQB 2C4JA 3KEBA 2C80A 2TRCP 1JHBA 4ZL7A 1FW1A 2YZHA 3LEFA 2YP6A 2MMAA 4RI6A 4MJEA 2OBIA 4YQUA 2JADA 4HZ4A 4GQFA 4G10A 3E9JB 3APSA 3R2QA 2R5GA 5ECNB 3GL5A 1O8XA 1SJ6A 3UJ1A 3GKXA 1GWCA 5GSSA 1SKSB 3ZREA 2HZFA 1ERUA 4HEA2 4K2DA 4BWSA 1DSBA 4ZB8A 4Z7XA 3P90A 4QQ7A 5COHA 2PERA 3DYRA 5D9XA 3GTUA 1ERVA 1T4YA 2VL9A 3VURA 1XWCA 4PI2C 3HDCA 2B6MA 1XFLA 1W89A 1S3AA 4MZBA 2G0FA 1ZYQB 3M1GA 4AI6A 5LNKe 3FZ9A 2NDOA 2X49A 1ABAA 3GSTA 5CRDA 5ABRA 2ZUPA 1R5AA 1SK0A 4WR5A 1W4VA 1F6MC 2FLSA 1M3IA 1FOVA 3IXRA 1XPVA 4ECCA 5F05A 4TR3A 1GNWA 4POLA 1QQ2A 3KP9A 3MAKA 4KCAA 2HZEA 4KH7A 1HYUA 4EF0A 1PN0A 4OFTA 2IMDA 1TTZA 1SK1A 4OFNA 2KP2A 2L6CA 1M0UA 1BQ7A 5ID2A 2HQTA 3VI5A 3CXGA 4DSQA 3I9V2 2R3XA 1M7TA 1G7EA 4WBJA 3ERGA 1FB0A 5BMUB 1SVOA 1E6BA 1VF2A 3LYKA 5ECLB 3IA1A 4GXZA 4FYCA 3FR6A 2RUFA 2DJ0A 2UZ8A 2PMTA 1RK4A 2YJHA 3U5RE 2YV9A 4YQVA 2VD0A 4E8HA 2AB6A 1PKZA 16GSA 3FRCA 5ECQB 3HVNA 4TXVA 5F8BA 2G2QA 1MEKA 3HZ8A 1YDKA 4YQMA 5HR0A 5D93A 1A0RP 4F0BA 4ULXA 4MH2A 1DUGA 2CV4A 3IK9A 5HR3A 4MH3A 2FWGA 3D5JA 3TDGA 2OBKA 2R0CA 3F63A 1EEJA 4EKZA 3HJOA 3G7JA 1M2DA 2YCDA 6GSUA 5AN1A 4TN8A 3FR3A 3BCIA 2O8VB 2GS3A 4QL9A 1YF1A 2KUCA 5KEJA 1T00A 1XIYA 2HRAA 2C0DA 4KAEA 4XS4B 5EPFA 2MZCA 4WEYA 1Z3EA 1WOUA 1X5DA 3HMJG 4MZCA 4O92A 3D6IA 1QXHA 1ZL9A 3KIJA 4O5QA 1PD21 1YF0A 1XZOA 4JRRA 4IVFA 2GQMA 5L71A 1GUKA 3SBCA 3VWUA 2FWHA 3IC8A 3KGKA 2HSMA 1K3YA 3US3A 3GFKA 1G6WA 3DWVA 4XS6A 3ED3A 1J0FA 2HI7A 2B7JA 1VF3A 5HFGA 4BL7B 2N5FA 2IMEA 2N5BA 3F4RA 5H5RA 3PGTA 2NBSA 3H79A 1H4OA 4AJ8A 1XWAA 5A4UA 4WETA 1UVZA 2JU5A 4CY6A 4OCEA 2LQQA 2M72A 2K6VA 5DVBA 1M99A 4O5UA 3EURA 3L78A 1TK8B 1XWGA 2QGVA 4PTSA 3K8NA 1S3DA 2I9HA 4NV2A 4OCFA 3VWWA 2MBTA 4KCEA 3FZ5A 3EC3A 2JSZA 2I4AA 3QPMA 2WVXB 1SJIA 1GSEA 3UIWA 3VWXA 2UV8G 2H8LA 2GSSA 2ES7A 1OC8A 4XIHA 4K2XA 4V2NA 1FHEA 2YZUA 2B5YA 1NHYA 4IN0A 1XOAA 2WJUA 3Q74A 3TRXA 2AUVA 3ZL5A 1SJZA 4ZIJA 4HU9A 3LG6A 3P2AA 2KLXA 5CYYA 1YJ6A 1EOGA 3BBYA 1T4ZA 2C3TA 4F2IA 4PXOA 4IELA 3WGXA 4PI0C 2HZEB 5AISA 2IN3A 2TIRA 4JBBA 1A23A 2HXKA 3W6GA 4FQUA 2OKAA 1JZRA 3UVHA 3CHXC 2YNXA 5ID2B 3RBTA 4ISDA 3ZVJD 3A2XA 2B1LA 3TKPA 4ZL9A 2VUPA 4D73A 2OT3A 3BJ5A 1XVQA 3S9FA 3DGQA 1Z6MA 3KH7A 4CW9A 1WMJA 3UL3A 1T3BA 3WT2A 4X0XA 5LCZA 3F3QA 1OVNA 3C1RA 4X1UA 4ZB6A 1EV4A 2LQOA 3ME8A 5KN0A 1HQOA 1Z7PA 2WS2A 3EINA 3J7Yb 4EDYA 1Z6NA 2QKEA 5B6MA 1PRXA 1TDIA 5F0GA 1M2AA 3TJGA 3SWLA 3EU3A 2HNLA 3GN3A 1TI3A 3HKRA 1O85A 2VLVA 1OKTA 4IGJA 4TR1B 2LRCA 2O5VA 2C3NA 4G0LA 4PUAA 3TJKA 3TJFA 1O81A 4K5RA 1K0CA 2XPEA 3F8UA 2JZTA 2WVYA 4NHZA 2GZPA 4IQAA 2F51A 1T7PB 4Q5RA 2REMA 4ACSA 4I2UA 5IPGA 4OMVA 4ECJA 2R0GA 1TW9A 3ISOA 20GSA 2E2MA 1Q4JA 4I97A 4HDEA 5CRHA 1TU7A 1SU9A 4X43A 3VLNA 5F06A 4EC0A 4ID0A 5IQYA 5IMZA 2HT9A 4N30A 4PURA 3VK9A 2HRNA 4L5LA 2IL3A 4L0UA 5DQYA 3IPZA 1B4QA 1XW9A 4P3YB 1GTAA 3TOTA 2OACA 4N3ZA 2HSMB 2V6KA 3TJBA 3FZAA 3JCML 3R3EA 4JE1A 2VIMA 4OD7A 3I69A 1SYRA 1AXDA 2VOCA 4K7OA 4KW6A 3MSZA 4AKIA 4MDCA 3QAGA 5J9BA 1V2AA 3GURA 4QMKA 5DAKB 1FAAA 6GSTA 5HR2A 3WT1A 4KA0A 8GSSA 1A0FA 2H19A 1HD2A 4WF4A 2H1LA 1OE7A 4XHMA 4OO4A 1V9WA 1SKWB 3GNJA 2GZYA 2C0FA 5DBQA 3H4KA 4EO3A 2YWMA 3LJRA 5A34A 2C8UA 4MCUA 4G9HA 1MDIA 4K7NA 2WCIA 2DBCA 1JFUA 2DIZA 1U3IA 3VWVA 1YEXA 1OKDA 2DLXA 2WFCA 2H72A 3RPPA 4JZQA 2XBIA 1N8JA 4KSMA 1R5PA 3IBHA 1U87A 4MNNA 1JZOA 6GSYA 1PX6A 5E4WA 2HYXA 1I5GA 1ZCPA 3NIVA 3APOA 4PQIA 2EIRA 1XWBA 2FY6A 4DSSB 2CVKA 3C1SA 4EL1A 1SKRB 4Z2UA 1WWJA 5B6NA 5F07A 2EIOA 3KJYA 2CZ2A 3GMFA 1TK5B 4NHWA 1EEMA 3HYPA 3M0FA 2AYTA 4XRDA 4YH2A 2X64A 3TKSA 3D4MA 5J47A 4ML6A 4MJBA 4NPBA 3HY2A 3ZMLA 2FD3A 1TRVA 3CWGA 1SD8A 2YWIA 1EWXA 2MMZA 3KMOA 5A5HB 1S3RA 3VFIA 4F82A 3HJMA 4LL1B 4J56E 3TOUA 4FXYP 1K0BA 1R7HA 1XCCA 1IYHA 2F8FA 4NMUA 4Q5FA 4MPFA 2LJRA 4G19A 1BX9A 3LQ7A 2H1GA 1SL2B 3H93A 2D2ZA 2HLSA 1I9DA 2B5EA 2DKHA 4K1FA 1GL8A 2BTOT 1JLWA 1ACVA 2IMKA 1LU4A 2H73A 1SYXA 4ECBA 2K8VA 4O5RA 1RQMA 2YV7A 3GH6A 3PPUA 1GSSA 4KDXA 3UBLA 4HS1A 5A1NA 2DJKA 2F3MA 2BJXA 1OYJA 1Q98A 2GSTA 5B8AA 1LJRA 3C7MA 5B7CA 1MDKA 1BJXA 1GUHA 1QGVA 2CX4A 3QFBC 1A8YA 2M46A 2QA2A 3MNGA 3LYPA 4V2LA 3HA9A 2IFQA 5CNWA 2PU9C 3N9JA 1GP1A 1LBKA 2WDUA 2WRTA 3DRNA 3GIXA 2OA7A 1SL0B 2H70A 5IMVA 3IK7A 4JU5A 3P7XA 4F9ZA 2GQLA 2JACA 4DSRA 4MF6A 1V98A 3IHQA 3RGBC 3KP8A 2P31A 3LXTA 2H76A 4GRFA 3GSSA 1K0DA 2HSNA 1EZKA 5GSTA 1PL1A 3O6TA 1JLVA 4AKGA 4TOPA 2YANA 2E0QA 1YZXA 4JR4A 1N2AA 1SL1B 4EDZA 3BD2A 3M9JA 3UBKA 5D96A 3CBUA 1XVWA 2GQKA 3J7Yk 2QC7A 3LW9A 1OE8A 2EFDA 1F3AA 3RHCA 9GSSA 4ZB7A 4K6XA 14GSA 5ECHB 4BIKA 2GLRA 2BMXA 2GDRA 2DSAA 2H0HA 1M9BA 5FT3A 3FR9A 5C04A 4MF5A 3WD6A 2O87A 5DALB 3G7YA
chains in the Genus database with same CATH topology
2X8CA 3MIXA 4N10A 2IMFA 1O8WA 1ON4A 1ZZYA 2HRFA 5KOWA 2RM6A 2H1DA 1NM3A 2I81A 3G9BA 4IBPA 3FY7A 3FKFA 1UN2A 4TVEA 4EUYA 2PGTA 2GZZA 1B48A 3DKSA 2DC5A 2VCZA 3QAVA 4OWYA 3TUEA 4AGSA 4GF0A 1N25A 4IHUA 4IP1A 19GSA 11GSA 1ZYPA 3Q6OA 4WBRD 1BEDA 4POKA 4K0NA 2VCXA 5D73A 3M8NA 5G30A 4A5PA 3CTGA 2DJJA 3HCZA 3IHGA 4MA9A 2I1UA 3QFAC 4K0GA 3MDKA 4IW9A 4XRAA 2PPTA 2L6DA 2R4VA 3GX8A 4TRXA 5FWGA 1U6TA 4DEJA 6GSVA 4BA7A 3CYNA 1KBNA 5HFKA 4FIWA 4KSOA 5AIVA 4YKFA 6GSXA 4MF7A 2VL3A 3W8JA 3ZTLA 1GSDA 5G5FA 1RW1A 4USSA 5ECKB 2CVDA 5JCUA 2PBJA 2O89A 4AJ7A 3IOSA 5IO0A 1HNBA 2X4AA 5DDLA 5J5NA 4LMVA 3GKNA 3ZMKA 2LNSA 2X99A 3LFLA 2WZ9A 4EE0A 4ILFA 1GTUA 2H6XA 4JEDA 4CY8A 3GTUB 2JSYA 3P8WA 1TRSA 1EGRA 5ECOB 4BWQA 4PQHA 3O76A 2FHEA 1ILOA 4J2FA 1NW2A 2FA8A 3F9UA 3KZQA 5D9WA 2VCQA 4GSSA 5KN3A 5A1NB 2YWNA 2IJYA 1K3OA 4MPGA 5ECMB 4ZL8A 2L57A 2WULA 1C72A 1WRYA 3RHBA 1THXA 1X5EA 3TU3B 3MWHA 1KNGA 3TKQA 3HXSA 2L59A 3A5WA 5IM9A 3PINA 2RUEA 2HRKA 3TRQA 5JCWA 2JZRA 1Y25A 5ELAA 1PSQA 4PNFA 2AV4A 2LNTA 2H66A 1X9MB 2AJQB 1ZGNA 4WR4A 3NOFA 2OJLA 2P0GA 1OC9A 1A24A 2A2PA 1ERTA 5H5SA 4BPYA 5EVOA 3N5OA 4IQ1A 3EU4A 4AKXB 4Q5NA 4X4JA 4OFMA 4HQSA 13GSA 5CO3A 4DVCA 2CZ3A 3A2WA 5G31A 2OADA 3L4NA 1AUCA 2P5RA 3LXZA 3KD0A 2TRXA 3EVIA 2H75A 2LUSA 2F9SA 1WJKA 3KH9A 4XTSA 3D21A 2E2GA 1FVKA 3IAS2 3FYGA 2B1KA 2C0EA 2VLTA 2OE1A 3W8SA 2N5AA 3IV4A 2DJ3A 3TKSC 4EVMA 1MDJA 2L5LA 3V1WA 3BCKA 2E7PA 1KEBA 5IO2A 3DIEA 2CAIA 3GL3A 1T8EB 5IOWA 4V2MA 1TXXA 4XCSA 3HVVA 1VGLA 1O7UA 4ZILA 5J4UA 1V57A 2AHEA 2LJKA 3VI7A 1QK8A 2LV3A 3A5IA 2VAFA 3GKKA 4TW5A 3EMPA 2H1BA 3ZFLA 4I6XA 3Q19A 4NWYA 1AQVA 3QAWA 5AGYA 3HVXA 4MMMA 1YQ1A 2H01A 1J08A 5KN1A 3TGZA 2PUKC 3GUSA 3LSZA 4K5SA 1SVLA 4ZB9A 1S3CA 3A2VA 1TRWA 2LTKA 4K8MA 1AW9A 4NV5A 3C71A 1Y6EA 5C00A 1CQGA 4HJMA 2IMIA 4NAXA 1V40A 4Z2TA 4KUNA 4AKHA 4ZXGA 4GQCA 4RUVA 3HZ4A 3ZYWA 4TR0A 4GLTA 2FWEA 1OAZA 2HSHA 7GSSA 1FG4A 1MTCA 3CMIA 2K8SA 5JWRB 1XBSA 1EP7A 2KHPA 4KDUA 2VLUA 4Q5QA 4AF2A 10GSA 2VL2A 3DD3A 3F4TA 3PR8A 4MZWA 2C0GA 3GA4A 4FO5A 3TKSE 1TXUA 4TR4A 1X5CA 2FNOA 2DKIA 3TCOA 2JZSA 3M9KA 5IIZA 5J40A 2MYGA 4LLRA 3HVSA 2WB9A 3KXOA 2GSRA 1M9AA 4XS4A 3FHKA 5D9TA 5CRGA 4MLYA 2VCTA 1K3LA 4KDYA 4HI7A 3RAZA 3LORA 2DJ2A 2A2SA 4EXJA 3I6AA 3IR4A 1VRSD 2B7KA 3EYTA 4OO5A 2JL4A 1TOFA 1UC7A 3ZLPA 3QR6A 4LL4B 1DE2A 4WF5A 4KB3A 4EIPA 1XOBA 3ZVJA 2GVPA 4FYBA 2H30A 2A2RA 1F2EA 2RIIA 4BL7A 2GT5A 3IDVA 5B8BA 4D73B 5H5QA 1PL2A 1OC9B 1URMA 3FEUA 1CQHA 1XW6A 2LEGA 4XS1A 1Z7RA 2F8AA 4MJCA 1DE1A 3H1NA 2FUG2 3VPQA 5AIXA 4YAPA 3F3RA 2L5OA 3GX0A 2FCHA 4ICYA 5ECIB 3EPTA 4QL7A 1G7OA 3QCPA 2C3QA 1XWKA 5CREA 2OE0A 4MJAA 4GCIA 3F0IA 3EMXA 2V32A 1EP8A 3L9UA 2AAWA 3L9VA 1NHOA 1X9WB 1ZOFA 4ZBDA 2K18A 3HD5A 2ALBA 5KN2A 1O73A 4F03A 5ECSA 4BVYA 1ST9A 3BOAA 4Z2RA 1SENA 5CAXA 4ZBAA 1WP0A 4I5QA 1ZMAA 2YWOA 2V2GA 4KGIA 2GT6A 4ZBBA 3QDNA 1TRUA 2LKUA 3HJPA 5IOXA 1BYEA 2FWFA 1X9SB 2A4VA 2H0IA 1WE0A 5CP1A 1GLPA 2HFDA 2VM2A 3WGDA 1EOHA 2XC2A 1AAZA 4TKYA 2A4HA 2NPBA 4PQ1A 1PX7A 1T1VA 4G2EA 2CAQA 2NVLA 2YPMA 1EV9A 4W66A 5J3RA 3IAM2 1GSYA 1SK2A 1A2JA 1K0AA 1ERWA 3A3TA 4O7HA 4IJ3A 3ERWA 1GTIA 4IJIA 2YN1A 4TXOA 4BVXA 5G1LA 5JCGA 3DVWA 5ENUA 1GSQA 2O85A 2DMMA 5J41A 1EGOA 1BAYA 2O7KA 2J9HA 1F3BA 2PN8A 2EFEA 5IMCA 2FGXA 2R2JA 4GSNA 1FOHA 5A34B 2PWJA 2CT6A 4L0WA 4MABA 1Y1UA 1ZYEA 5A4WA 1Z9HA 1SD9A 4TR1A 2NTOA 2KP1A 4N0ZA 1GULA 1QUWA 1K0NA 2V6OA 2VO4A 5ECPB 4V1Ap 3GKMA 1F9MA 3UEMA 4HOJA 1A8LA 4KNDA 1PN9A 4CDOA 1WPIA 2XBQA 3ZIVA 3ZIJA 4K9ZA 2H0GA 4L5OA 3C73A 4E8EA 2FA4A 2EFHA 2IWTA 1B9YC 4RQRA 2CQ9A 1BG5A 3CSJA 4K7IA 2C1YA 5KOXA 4RI7A 3L0HA 4WKWA 2VCWA 2R0PA 4G0IA 1Z5YE 1GNEA 2CX3A 2H6YA 3DVXA 2CVBA 1G0TA 5GAND 1GTBA 2Z9SA 1TU8A 5IMFA 3ZFBA 3TJJA 1A2MA 2IIYA 1YEPA 5J4YA 1TI1A 1AQXA 3ZRDA 5DAKA 2VCVA 3CSHA 2R37A 3E3EA 4LMWA 5GZZB 1QMVA 1TK0B 4POBA 4ML1A 4KE3A 3E0UA 5JWOB 3AY8A 1ZYNA 3NZNA 3QOUA 2WGRA 2RLIA 3F6DA 3ME7A 2EFCA 3LWAA 4MP4A 2V41A 1VF4A 5IPHA 3MYDA 3TRPA 1TP9A 1K0MA 5GAPD 1G6YA 1M2BA 3UOMA 5INYA 5ELGA 5BRTA 5HQPA 4IS0A 2M80A 2DMLA 3ZZXA 4I2TA 5CRWA 3D0ZA 2GGTA 3U6VA 3O3TA 1FO5A 1B4PA 4G0KA 4HU7A 2DJ1A 4NXIA 5HR1A 3I43A 3L9SA 3QMXA 5DCGA 4O32A 2YJ7A 4JR6A 1FVJA 4KF9A 3GV1A 4WXTA 2IFQB 2P5QA 1YY7A 1R26A 1GUMA 4BVYB 2PVQA 6GSWA 3KM6A 2EIQA 1OC3A 4DSSA 4IKHA 4POMA 4FH8A 1GSFA 3CRTA 3FMWA 4L8EA 4YAVA 5J4VA 3UMAA 1AIUA 4GDFA 1GSUA 3D22A 4KX4A 5IMAA 3FK8A 2HSNB 4LA1A 4V1Ag 2VL2C 5E59A 1PKWA 1YKCA 1H75A 3H8QA 4GWRA 3EE2A 5A5HA 1PMTA 1HNAA 3GH9A 2H74A 3DXBA 1PQNA 5IMDA 18GSA 3DMLA 3RPNA 3D4TA 2ON7A 2ZNMA 4GTUA 5ECRB 4N11A 2X8GA 1MD3A 3OR5A 1FB6A 5G1KA 4TXOB 4BVXB 2HSYA 4PUFC 2ON5A 4E68A 3LGCA 2MBSA 3KTLA 3HHVA 1ML6A 2H71A 2B5XA 3G7IA 1TKDB 2KOKA 4GSTA 4PX1A 4CHSA 4HJ2A 1AC1A 1IYIA 1V58A 2RM5A 3TKRA 1KTEA 1JZWA 3CTFA 2EC4A 1THOA 3UAPA 2XHFA 3ZITA 5J9CA 4RQXA 2H6ZA 4J57E 22GSA 1UA5A 2I3YA 3CRUA 3QD9A 3KMNA 6GSSA 2QA1A 4YKGA 2J23A 1B9XC 3C8EA 4N0VA 5EY6A 4HUAA 1GH2A 4H86A 1PGTA 2GTUA 3EWLA 2L4CA 4ECIA 1BF5A 1XW5A 1WIKA 5G5EA 2H1AA 1U3AA 5DQSA 2XPDA 1SVMA 1PA3A 4HQZA 1F37A 3GHAA 5BMUA 1JZDA 1YVLA 2MMNA 3FW2A 12GSA 5LD0A 5DJMA 1DBYA 3GRXA 2YOIA 5G2ZA 3GYKA 1GRXA 5DJLA 2OE3A 3F4SA 4G01A 2LRNA 3IRAA 3IE3A 1VF1A 4MK3A 3DEXA 1USBA 2DIYA 1AQWA 2QSIA 4EIQA 2VM1A 5D9VA 1B8XA 5DALA 3IC4A 2MMOA 1YKAA 1GLQA 2LJAA 3KTBA 5HFIA 2CA8A 1HNCA 2B3SA 2LS5A 2LSTA 3TB2A 4PNGA 5D8IA 4HZ2A 5A5KA 1E2YA 1J9BA 3WGEA 3M3MA 2ZCTA 2HE3A 4IP6A 1X0RA 3FZ4A 3UVTA 1XXUA 4I8BA 2LRTA 1O6JA 2X8HA 2R6KA 3WYWA 3VPTA 1K0OA 2L4QA 3Q18A 1U88A 1TJDA 3ERFA 2VKZG 1R4WA 1NSWA 3F6FA 3APQA 4F0CA 3CSIA 17GSA 4PGTA 3KCMA 2VD1A 1A2LA 2PVOC 3RDWA 5DCHA 1QFNA 3UARA 3PH9A 1MD4A 4FYUA 5EL8A 2K9FA 5A4VA 2GSQA 5FHIA 2V1MA 2HRKB 4AJ6A 2IPAA 1BG1A 5JWQB 2C4JA 3KEBA 2C80A 2TRCP 1JHBA 4ZL7A 1FW1A 2YZHA 3LEFA 2YP6A 2MMAA 4RI6A 4MJEA 2OBIA 4YQUA 2JADA 4HZ4A 4GQFA 4G10A 3E9JB 3APSA 3R2QA 2R5GA 5ECNB 3GL5A 1O8XA 1SJ6A 3UJ1A 3GKXA 1GWCA 5GSSA 1SKSB 3ZREA 2HZFA 1ERUA 4HEA2 4K2DA 4BWSA 1DSBA 4ZB8A 4Z7XA 3P90A 4QQ7A 5COHA 2PERA 3DYRA 5D9XA 3GTUA 1ERVA 1T4YA 2VL9A 3VURA 1XWCA 3HDCA 2B6MA 1XFLA 1W89A 1S3AA 4MZBA 2G0FA 1ZYQB 3M1GA 4AI6A 5LNKe 3FZ9A 2NDOA 2X49A 1ABAA 3GSTA 5CRDA 5ABRA 2ZUPA 1R5AA 1SK0A 4WR5A 1W4VA 1F6MC 2FLSA 1FOVA 3IXRA 1XPVA 4ECCA 5F05A 4TR3A 1GNWA 4POLA 1QQ2A 3KP9A 3MAKA 4KCAA 2HZEA 4KH7A 1HYUA 4EF0A 1PN0A 4OFTA 2IMDA 1TTZA 1SK1A 4OFNA 2KP2A 2L6CA 1M0UA 1BQ7A 5ID2A 2HQTA 3VI5A 3CXGA 4DSQA 3I9V2 2R3XA 1M7TA 1G7EA 4WBJA 3ERGA 1FB0A 5BMUB 1SVOA 1E6BA 1VF2A 3LYKA 5ECLB 3IA1A 4GXZA 4FYCA 3FR6A 2RUFA 2DJ0A 2UZ8A 2PMTA 1RK4A 2YJHA 3U5RE 2YV9A 4YQVA 2VD0A 4E8HA 2AB6A 1PKZA 16GSA 3FRCA 5ECQB 4TXVA 5F8BA 2G2QA 1MEKA 3HZ8A 1YDKA 4YQMA 5HR0A 5D93A 1A0RP 4F0BA 4ULXA 4MH2A 1DUGA 2CV4A 3IK9A 5HR3A 4MH3A 2FWGA 3D5JA 3TDGA 2OBKA 2R0CA 3F63A 1EEJA 4EKZA 3HJOA 3G7JA 1M2DA 2YCDA 6GSUA 5AN1A 4TN8A 3FR3A 3BCIA 2O8VB 2GS3A 4QL9A 1YF1A 2KUCA 5KEJA 1T00A 1XIYA 2HRAA 2C0DA 4KAEA 4XS4B 5EPFA 2MZCA 4WEYA 1Z3EA 1WOUA 1X5DA 3HMJG 4MZCA 4O92A 3D6IA 1QXHA 1ZL9A 3KIJA 4O5QA 1PD21 1YF0A 1XZOA 4JRRA 4IVFA 2GQMA 5L71A 1GUKA 3SBCA 3VWUA 2FWHA 3IC8A 3KGKA 2HSMA 1K3YA 3US3A 3GFKA 1G6WA 3DWVA 4XS6A 3ED3A 1J0FA 2HI7A 2B7JA 1VF3A 5HFGA 4BL7B 2N5FA 2IMEA 2N5BA 3F4RA 5H5RA 3PGTA 2NBSA 3H79A 1H4OA 4AJ8A 1XWAA 5A4UA 4WETA 1UVZA 2JU5A 4CY6A 4OCEA 2LQQA 2M72A 2K6VA 5DVBA 1M99A 4O5UA 3EURA 3L78A 1TK8B 1XWGA 2QGVA 4PTSA 3K8NA 1S3DA 2I9HA 4NV2A 4OCFA 3VWWA 2MBTA 4KCEA 3FZ5A 3EC3A 2JSZA 2I4AA 3QPMA 1SJIA 1GSEA 3UIWA 3VWXA 2UV8G 2H8LA 2GSSA 2ES7A 1OC8A 4XIHA 4K2XA 4V2NA 1FHEA 2YZUA 2B5YA 1NHYA 4IN0A 1XOAA 2WJUA 3Q74A 3TRXA 2AUVA 3ZL5A 1SJZA 4ZIJA 4HU9A 3LG6A 3P2AA 2KLXA 5CYYA 1YJ6A 1EOGA 3BBYA 1T4ZA 2C3TA 4F2IA 4PXOA 4IELA 3WGXA 2HZEB 5AISA 2IN3A 2TIRA 4JBBA 1A23A 2HXKA 3W6GA 4FQUA 2OKAA 1JZRA 3UVHA 2YNXA 5ID2B 3RBTA 4ISDA 3ZVJD 3A2XA 2B1LA 3TKPA 4ZL9A 2VUPA 4D73A 2OT3A 3BJ5A 1XVQA 3S9FA 3DGQA 1Z6MA 3KH7A 4CW9A 1WMJA 3UL3A 1T3BA 3WT2A 4X0XA 5LCZA 3F3QA 1OVNA 3C1RA 4X1UA 4ZB6A 1EV4A 2LQOA 3ME8A 5KN0A 1HQOA 1Z7PA 2WS2A 3EINA 3J7Yb 4EDYA 1Z6NA 2QKEA 5B6MA 1PRXA 1TDIA 5F0GA 1M2AA 3TJGA 3SWLA 3EU3A 2HNLA 3GN3A 1TI3A 3HKRA 1O85A 2VLVA 1OKTA 4IGJA 4TR1B 2LRCA 2O5VA 2C3NA 4G0LA 4PUAA 3TJKA 3TJFA 1O81A 4K5RA 1K0CA 2XPEA 3F8UA 2JZTA 4NHZA 2GZPA 4IQAA 2F51A 1T7PB 4Q5RA 2REMA 4ACSA 4I2UA 5IPGA 4OMVA 4ECJA 2R0GA 1TW9A 3ISOA 20GSA 2E2MA 1Q4JA 4I97A 4HDEA 5CRHA 1TU7A 1SU9A 4X43A 3VLNA 5F06A 4EC0A 4ID0A 5IQYA 5IMZA 2HT9A 4N30A 4PURA 3VK9A 2HRNA 4L5LA 2IL3A 4L0UA 5DQYA 3IPZA 1B4QA 1XW9A 4P3YB 1GTAA 3TOTA 2OACA 4N3ZA 2HSMB 2V6KA 3TJBA 3FZAA 3JCML 3R3EA 4JE1A 2VIMA 4OD7A 3I69A 1SYRA 1AXDA 2VOCA 4K7OA 4KW6A 3MSZA 4AKIA 4MDCA 3QAGA 5J9BA 1V2AA 3GURA 4QMKA 5DAKB 1FAAA 6GSTA 5HR2A 3WT1A 4KA0A 8GSSA 1A0FA 2H19A 1HD2A 4WF4A 2H1LA 1OE7A 4XHMA 4OO4A 1V9WA 1SKWB 3GNJA 2GZYA 2C0FA 5DBQA 3H4KA 4EO3A 2YWMA 3LJRA 5A34A 2C8UA 4MCUA 4G9HA 1MDIA 4K7NA 2WCIA 2DBCA 1JFUA 2DIZA 1U3IA 3VWVA 1YEXA 1OKDA 2DLXA 2WFCA 2H72A 3RPPA 4JZQA 2XBIA 1N8JA 4KSMA 1R5PA 3IBHA 1U87A 4MNNA 1JZOA 6GSYA 1PX6A 5E4WA 2HYXA 1I5GA 1ZCPA 3NIVA 3APOA 4PQIA 2EIRA 1XWBA 2FY6A 4DSSB 2CVKA 3C1SA 4EL1A 1SKRB 4Z2UA 1WWJA 5B6NA 5F07A 2EIOA 3KJYA 2CZ2A 3GMFA 1TK5B 4NHWA 1EEMA 3HYPA 3M0FA 2AYTA 4XRDA 4YH2A 2X64A 3TKSA 3D4MA 5J47A 4ML6A 4MJBA 4NPBA 3HY2A 3ZMLA 2FD3A 1TRVA 3CWGA 1SD8A 2YWIA 1EWXA 2MMZA 3KMOA 5A5HB 3VFIA 4F82A 3HJMA 4LL1B 4J56E 3TOUA 1K0BA 1R7HA 1XCCA 1IYHA 2F8FA 4NMUA 4Q5FA 4MPFA 2LJRA 4G19A 1BX9A 3LQ7A 2H1GA 1SL2B 3H93A 2D2ZA 2HLSA 1I9DA 2B5EA 2DKHA 4K1FA 1GL8A 2BTOT 1JLWA 1ACVA 2IMKA 1LU4A 2H73A 1SYXA 4ECBA 2K8VA 4O5RA 1RQMA 2YV7A 3GH6A 3PPUA 1GSSA 4KDXA 3UBLA 4HS1A 5A1NA 2DJKA 2F3MA 2BJXA 1OYJA 1Q98A 2GSTA 5B8AA 1LJRA 3C7MA 5B7CA 1MDKA 1BJXA 1GUHA 1QGVA 2CX4A 3QFBC 1A8YA 2M46A 2QA2A 3MNGA 3LYPA 4V2LA 3HA9A 2IFQA 5CNWA 2PU9C 3N9JA 1GP1A 1LBKA 2WDUA 2WRTA 3DRNA 3GIXA 2OA7A 1SL0B 2H70A 5IMVA 3IK7A 4JU5A 3P7XA 4F9ZA 2GQLA 2JACA 4DSRA 4MF6A 1V98A 3IHQA 3KP8A 2P31A 3LXTA 2H76A 4GRFA 3GSSA 1K0DA 2HSNA 1EZKA 5GSTA 1PL1A 3O6TA 1JLVA 4AKGA 4TOPA 2YANA 2E0QA 1YZXA 4JR4A 1N2AA 1SL1B 4EDZA 3BD2A 3M9JA 3UBKA 5D96A 3CBUA 1XVWA 2GQKA 3J7Yk 2QC7A 3LW9A 1OE8A 2EFDA 1F3AA 3RHCA 9GSSA 4ZB7A 4K6XA 14GSA 5ECHB 2GLRA 2BMXA 2GDRA 2DSAA 2H0HA 1M9BA 5FT3A 3FR9A 5C04A 4MF5A 3WD6A 2O87A 5DALB 3G7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X8C A;  4N10 A;  2IMF A;  1O8W A;  1ON4 A;  1ZZY A;  2HRF A;  2RM6 A;  2H1D A;  1NM3 A;  2I81 A;  3G9B A;  4IBP A;  3FY7 A;  3FKF A;  1UN2 A;  4TVE A;  4EUY A;  2PGT A;  2GZZ A;  1B48 A;  3DKS A;  2DC5 A;  2VCZ A;  3QAV A;  4OWY A;  3TUE A;  4AGS A;  4GF0 A;  4IHU A;  4IP1 A;  19GS A;  11GS A;  3Q6O A;  4WBR D;  1BED A;  4POK A;  4K0N A;  2VCX A;  5D73 A;  3M8N A;  5G30 A;  3CTG A;  2DJJ A;  3HCZ A;  4MA9 A;  2I1U A;  3QFA C;  4K0G A;  3MDK A;  4IW9 A;  4XRA A;  2PPT A;  2L6D A;  2R4V A;  3GX8 A;  4TRX A;  5FWG A;  1U6T A;  4DEJ A;  6GSV A;  4BA7 A;  3CYN A;  1KBN A;  5HFK A;  4FIW A;  4KSO A;  5AIV A;  6GSX A;  4MF7 A;  2VL3 A;  3W8J A;  3ZTL A;  1GSD A;  5G5F A;  1RW1 A;  4USS A;  5ECK B;  2CVD A;  5JCU A;  2PBJ A;  2O89 A;  4AJ7 A;  3IOS A;  5IO0 A;  1HNB A;  5DDL A;  5J5N A;  4LMV A;  3GKN A;  3ZMK A;  2LNS A;  2X99 A;  3LFL A;  2WZ9 A;  4EE0 A;  4ILF A;  1GTU A;  2H6X A;  4JED A;  3GTU B;  2JSY A;  3P8W A;  1TRS A;  1EGR A;  5ECO B;  4BWQ A;  4PQH A;  3O76 A;  2FHE A;  1ILO A;  4J2F A;  1NW2 A;  2FA8 A;  3F9U A;  3KZQ A;  5D9W A;  2VCQ A;  4GSS A;  5KN3 A;  2YWN A;  2IJY A;  1K3O A;  4MPG A;  5ECM B;  4ZL8 A;  2L57 A;  2WUL A;  1C72 A;  1WRY A;  3RHB A;  1THX A;  1X5E A;  3MWH A;  1KNG A;  3TKQ A;  3HXS A;  2L59 A;  3A5W A;  5IM9 A;  3PIN A;  2RUE A;  2HRK A;  3TRQ A;  5JCW A;  2JZR A;  1Y25 A;  5ELA A;  1PSQ A;  4PNF A;  2AV4 A;  2LNT A;  2H66 A;  1X9M B;  2AJQ B;  1ZGN A;  4WR4 A;  3NOF A;  2OJL A;  2P0G A;  1OC9 A;  1A24 A;  1ERT A;  5H5S A;  4BPY A;  5EVO A;  3N5O A;  4IQ1 A;  3EU4 A;  4Q5N A;  4OFM A;  4HQS A;  13GS A;  5CO3 A;  4DVC A;  2CZ3 A;  3A2W A;  5G31 A;  2OAD A;  3L4N A;  1AUC A;  2P5R A;  3LXZ A;  3KD0 A;  2TRX A;  3EVI A;  2H75 A;  2LUS A;  2F9S A;  1WJK A;  3KH9 A;  4XTS A;  3D21 A;  2E2G A;  1FVK A;  3IAS 2;  3FYG A;  2B1K A;  2C0E A;  2VLT A;  2OE1 A;  3W8S A;  2N5A A;  3IV4 A;  2DJ3 A;  3TKS C;  4EVM A;  1MDJ A;  2L5L A;  3V1W A;  3BCK A;  2E7P A;  1KEB A;  5IO2 A;  3DIE A;  2CAI A;  3GL3 A;  1T8E B;  5IOW A;  4V2M A;  1TXX A;  4XCS A;  3HVV A;  1VGL A;  1O7U A;  4ZIL A;  5J4U A;  1V57 A;  2AHE A;  2LJK A;  3VI7 A;  1QK8 A;  2LV3 A;  2VAF A;  3GKK A;  4TW5 A;  3EMP A;  2H1B A;  3ZFL A;  4I6X A;  3Q19 A;  4NWY A;  1AQV A;  3QAW A;  5AGY A;  3HVX A;  4MMM A;  1YQ1 A;  2H01 A;  1J08 A;  5KN1 A;  3TGZ A;  2PUK C;  3GUS A;  3LSZ A;  4ZB9 A;  1S3C A;  3A2V A;  1TRW A;  2LTK A;  4K8M A;  1AW9 A;  4NV5 A;  3C71 A;  1Y6E A;  5C00 A;  1CQG A;  4HJM A;  2IMI A;  4NAX A;  1V40 A;  4KUN A;  4ZXG A;  4GQC A;  4RUV A;  3HZ4 A;  3ZYW A;  4TR0 A;  4GLT A;  2FWE A;  1OAZ A;  2HSH A;  7GSS A;  1FG4 A;  1MTC A;  3CMI A;  2K8S A;  5JWR B;  1XBS A;  1EP7 A;  2KHP A;  4KDU A;  2VLU A;  4Q5Q A;  4AF2 A;  10GS A;  2VL2 A;  3DD3 A;  3F4T A;  3PR8 A;  4MZW A;  2C0G A;  3GA4 A;  4FO5 A;  3TKS E;  4TR4 A;  1X5C A;  2FNO A;  3TCO A;  2JZS A;  3M9K A;  5IIZ A;  2MYG A;  4LLR A;  3HVS A;  2WB9 A;  3KXO A;  2GSR A;  1M9A A;  4XS4 A;  3FHK A;  5D9T A;  5CRG A;  4MLY A;  2VCT A;  1K3L A;  4KDY A;  4HI7 A;  3RAZ A;  3LOR A;  2DJ2 A;  2A2S A;  4EXJ A;  3I6A A;  3IR4 A;  1VRS D;  2B7K A;  3EYT A;  4OO5 A;  2JL4 A;  1TOF A;  1UC7 A;  3ZLP A;  3QR6 A;  4LL4 B;  1DE2 A;  4WF5 A;  4KB3 A;  1XOB A;  3ZVJ A;  2GVP A;  4FYB A;  2H30 A;  2A2R A;  1F2E A;  2RII A;  4BL7 A;  2GT5 A;  3IDV A;  5B8B A;  4D73 B;  5H5Q A;  1PL2 A;  1OC9 B;  1URM A;  3FEU A;  1CQH A;  1XW6 A;  2LEG A;  4XS1 A;  1Z7R A;  2F8A A;  4MJC A;  1DE1 A;  3H1N A;  2FUG 2;  3VPQ A;  5AIX A;  4YAP A;  3F3R A;  2L5O A;  3GX0 A;  2FCH A;  5ECI B;  4QL7 A;  1G7O A;  3QCP A;  2C3Q A;  1XWK A;  5CRE A;  2OE0 A;  4MJA A;  4GCI A;  3F0I A;  3EMX A;  2V32 A;  1EP8 A;  3L9U A;  2AAW A;  3L9V A;  1NHO A;  1X9W B;  1ZOF A;  4ZBD A;  2K18 A;  3HD5 A;  2ALB A;  5KN2 A;  1O73 A;  4F03 A;  5ECS A;  4BVY A;  1ST9 A;  3BOA A;  1SEN A;  5CAX A;  4ZBA A;  1WP0 A;  4I5Q A;  1ZMA A;  2YWO A;  2V2G A;  4KGI A;  2GT6 A;  4ZBB A;  3QDN A;  1TRU A;  2LKU A;  3HJP A;  5IOX A;  1BYE A;  2FWF A;  1X9S B;  2A4V A;  2H0I A;  1WE0 A;  5CP1 A;  1GLP A;  2HFD A;  2VM2 A;  3WGD A;  1EOH A;  2XC2 A;  1AAZ A;  4TKY A;  2NPB A;  4PQ1 A;  1PX7 A;  1T1V A;  4G2E A;  2CAQ A;  2NVL A;  2YPM A;  1EV9 A;  5J3R A;  3IAM 2;  1GSY A;  1SK2 A;  1A2J A;  1K0A A;  1ERW A;  3A3T A;  4O7H A;  4IJ3 A;  3ERW A;  1GTI A;  4IJI A;  2YN1 A;  4TXO A;  4BVX A;  5G1L A;  5JCG A;  3DVW A;  5ENU A;  1GSQ A;  2O85 A;  2DMM A;  5J41 A;  1EGO A;  1BAY A;  2O7K A;  2J9H A;  1F3B A;  2PN8 A;  5IMC A;  2FGX A;  2R2J A;  4GSN A;  2PWJ A;  2CT6 A;  4L0W A;  4MAB A;  1ZYE A;  5A4W A;  1Z9H A;  1SD9 A;  4TR1 A;  2NTO A;  2KP1 A;  4N0Z A;  1GUL A;  1QUW A;  1K0N A;  2V6O A;  2VO4 A;  5ECP B;  4V1A p;  3GKM A;  1F9M A;  3UEM A;  4HOJ A;  1A8L A;  4KND A;  1PN9 A;  4CDO A;  1WPI A;  2XBQ A;  3ZIV A;  3ZIJ A;  4K9Z A;  2H0G A;  4L5O A;  3C73 A;  4E8E A;  2FA4 A;  2IWT A;  1B9Y C;  4RQR A;  2CQ9 A;  1BG5 A;  3CSJ A;  4K7I A;  2C1Y A;  4RI7 A;  3L0H A;  4WKW A;  2VCW A;  4G0I A;  1Z5Y E;  1GNE A;  2CX3 A;  2H6Y A;  3DVX A;  2CVB A;  1G0T A;  5GAN D;  1GTB A;  2Z9S A;  1TU8 A;  5IMF A;  3ZFB A;  3TJJ A;  1A2M A;  2IIY A;  1YEP A;  1TI1 A;  1AQX A;  3ZRD A;  5DAK A;  2VCV A;  3CSH A;  2R37 A;  3E3E A;  4LMW A;  5GZZ B;  1QMV A;  1TK0 B;  4POB A;  4ML1 A;  4KE3 A;  3E0U A;  5JWO B;  3AY8 A;  3NZN A;  3QOU A;  2WGR A;  2RLI A;  3F6D A;  3ME7 A;  3LWA A;  4MP4 A;  2V41 A;  1VF4 A;  5IPH A;  3TRP A;  1TP9 A;  1K0M A;  5GAP D;  1G6Y A;  1M2B A;  3UOM A;  5INY A;  5ELG A;  5HQP A;  4IS0 A;  2M80 A;  2DML A;  3ZZX A;  4I2T A;  5CRW A;  3D0Z A;  2GGT A;  3U6V A;  3O3T A;  1FO5 A;  1B4P A;  4G0K A;  4HU7 A;  2DJ1 A;  4NXI A;  5HR1 A;  3I43 A;  3L9S A;  3QMX A;  5DCG A;  4O32 A;  2YJ7 A;  4JR6 A;  1FVJ A;  4KF9 A;  3GV1 A;  4WXT A;  2IFQ B;  2P5Q A;  1YY7 A;  1R26 A;  1GUM A;  4BVY B;  2PVQ A;  6GSW A;  3KM6 A;  2EIQ A;  1OC3 A;  4DSS A;  4IKH A;  4POM A;  4FH8 A;  1GSF A;  3CRT A;  4L8E A;  4YAV A;  3UMA A;  1AIU A;  1GSU A;  3D22 A;  4KX4 A;  5IMA A;  3FK8 A;  2HSN B;  4LA1 A;  4V1A g;  2VL2 C;  5E59 A;  1PKW A;  1YKC A;  1H75 A;  3H8Q A;  4GWR A;  3EE2 A;  1PMT A;  1HNA A;  3GH9 A;  2H74 A;  3DXB A;  1PQN A;  5IMD A;  18GS A;  3DML A;  3RPN A;  3D4T A;  2ON7 A;  2ZNM A;  4GTU A;  5ECR B;  4N11 A;  2X8G A;  1MD3 A;  3OR5 A;  1FB6 A;  5G1K A;  4TXO B;  4BVX B;  2HSY A;  4PUF C;  2ON5 A;  3LGC A;  2MBS A;  3KTL A;  3HHV A;  1ML6 A;  2H71 A;  2B5X A;  3G7I A;  1TKD B;  2KOK A;  4GST A;  4PX1 A;  4CHS A;  4HJ2 A;  1AC1 A;  1IYI A;  1V58 A;  2RM5 A;  3TKR A;  1KTE A;  1JZW A;  3CTF A;  2EC4 A;  1THO A;  3UAP A;  2XHF A;  3ZIT A;  5J9C A;  4RQX A;  2H6Z A;  4J57 E;  22GS A;  1UA5 A;  2I3Y A;  3CRU A;  3QD9 A;  3KMN A;  6GSS A;  2J23 A;  1B9X C;  3C8E A;  4N0V A;  5EY6 A;  4HUA A;  1GH2 A;  4H86 A;  1PGT A;  2GTU A;  3EWL A;  2L4C A;  4ECI A;  1XW5 A;  1WIK A;  5G5E A;  2H1A A;  1U3A A;  5DQS A;  2XPD A;  1PA3 A;  4HQZ A;  1F37 A;  3GHA A;  5BMU A;  1JZD A;  2MMN A;  3FW2 A;  12GS A;  5LD0 A;  5DJM A;  1DBY A;  3GRX A;  2YOI A;  5G2Z A;  3GYK A;  1GRX A;  5DJL A;  2OE3 A;  3F4S A;  2LRN A;  3IRA A;  3IE3 A;  1VF1 A;  4MK3 A;  3DEX A;  1USB A;  2DIY A;  1AQW A;  2QSI A;  2VM1 A;  5D9V A;  1B8X A;  5DAL A;  3IC4 A;  2MMO A;  1YKA A;  1GLQ A;  2LJA A;  3KTB A;  5HFI A;  2CA8 A;  1HNC A;  2B3S A;  2LS5 A;  2LST A;  3TB2 A;  4PNG A;  5D8I A;  4HZ2 A;  5A5K A;  1E2Y A;  1J9B A;  3WGE A;  3M3M A;  2ZCT A;  2HE3 A;  4IP6 A;  1X0R A;  3FZ4 A;  3UVT A;  1XXU A;  4I8B A;  2LRT A;  1O6J A;  2X8H A;  2R6K A;  3WYW A;  3VPT A;  1K0O A;  2L4Q A;  3Q18 A;  1U88 A;  1TJD A;  3ERF A;  1R4W A;  1NSW A;  3F6F A;  3APQ A;  4F0C A;  3CSI A;  17GS A;  4PGT A;  3KCM A;  2VD1 A;  1A2L A;  2PVO C;  3RDW A;  5DCH A;  1QFN A;  3UAR A;  3PH9 A;  1MD4 A;  4FYU A;  5EL8 A;  2K9F A;  5A4V A;  2GSQ A;  5FHI A;  2V1M A;  2HRK B;  4AJ6 A;  2IPA A;  5JWQ B;  2C4J A;  3KEB A;  2C80 A;  2TRC P;  1JHB A;  4ZL7 A;  1FW1 A;  2YZH A;  3LEF A;  2YP6 A;  2MMA A;  4RI6 A;  4MJE A;  2OBI A;  4YQU A;  2JAD A;  4HZ4 A;  4GQF A;  4G10 A;  3E9J B;  3APS A;  3R2Q A;  2R5G A;  5ECN B;  3GL5 A;  1O8X A;  1SJ6 A;  3UJ1 A;  3GKX A;  1GWC A;  5GSS A;  1SKS B;  3ZRE A;  2HZF A;  1ERU A;  4HEA 2;  4K2D A;  4BWS A;  1DSB A;  4ZB8 A;  4Z7X A;  3P90 A;  4QQ7 A;  5COH A;  2PER A;  3DYR A;  5D9X A;  3GTU A;  1ERV A;  1T4Y A;  2VL9 A;  3VUR A;  1XWC A;  3HDC A;  2B6M A;  1XFL A;  1W89 A;  1S3A A;  4MZB A;  2G0F A;  1ZYQ B;  3M1G A;  5LNK e;  3FZ9 A;  2NDO A;  1ABA A;  3GST A;  5CRD A;  5ABR A;  2ZUP A;  1R5A A;  1SK0 A;  4WR5 A;  1W4V A;  1F6M C;  2FLS A;  1FOV A;  3IXR A;  1XPV A;  4ECC A;  5F05 A;  4TR3 A;  1GNW A;  4POL A;  1QQ2 A;  3KP9 A;  3MAK A;  4KCA A;  2HZE A;  4KH7 A;  1HYU A;  4EF0 A;  4OFT A;  2IMD A;  1TTZ A;  1SK1 A;  4OFN A;  2KP2 A;  2L6C A;  1M0U A;  1BQ7 A;  5ID2 A;  2HQT A;  3VI5 A;  3CXG A;  4DSQ A;  3I9V 2;  2R3X A;  1M7T A;  1G7E A;  4WBJ A;  3ERG A;  1FB0 A;  1E6B A;  1VF2 A;  3LYK A;  5ECL B;  3IA1 A;  4GXZ A;  4FYC A;  3FR6 A;  2RUF A;  2DJ0 A;  2UZ8 A;  2PMT A;  1RK4 A;  2YJH A;  3U5R E;  2YV9 A;  4YQV A;  2VD0 A;  4E8H A;  2AB6 A;  1PKZ A;  16GS A;  3FRC A;  5ECQ B;  4TXV A;  5F8B A;  2G2Q A;  1MEK A;  3HZ8 A;  1YDK A;  4YQM A;  5HR0 A;  5D93 A;  1A0R P;  4F0B A;  4ULX A;  4MH2 A;  1DUG A;  2CV4 A;  3IK9 A;  5HR3 A;  4MH3 A;  2FWG A;  3D5J A;  3TDG A;  2OBK A;  3F63 A;  1EEJ A;  4EKZ A;  3HJO A;  3G7J A;  1M2D A;  2YCD A;  6GSU A;  5AN1 A;  4TN8 A;  3FR3 A;  3BCI A;  2O8V B;  2GS3 A;  4QL9 A;  1YF1 A;  2KUC A;  5KEJ A;  1T00 A;  1XIY A;  2HRA A;  2C0D A;  4KAE A;  4XS4 B;  5EPF A;  2MZC A;  4WEY A;  1Z3E A;  1WOU A;  1X5D A;  4MZC A;  4O92 A;  3D6I A;  1QXH A;  1ZL9 A;  3KIJ A;  1PD2 1;  1YF0 A;  4JRR A;  1XZO A;  4IVF A;  2GQM A;  5L71 A;  1GUK A;  3SBC A;  3VWU A;  2FWH A;  3IC8 A;  3KGK A;  2HSM A;  1K3Y A;  3US3 A;  3GFK A;  1G6W A;  3DWV A;  4XS6 A;  3ED3 A;  1J0F A;  2HI7 A;  2B7J A;  1VF3 A;  5HFG A;  4BL7 B;  2N5F A;  2IME A;  2N5B A;  3F4R A;  5H5R A;  3PGT A;  2NBS A;  3H79 A;  1H4O A;  4AJ8 A;  1XWA A;  5A4U A;  4WET A;  1UVZ A;  2JU5 A;  4OCE A;  2LQQ A;  2M72 A;  2K6V A;  5DVB A;  1M99 A;  3EUR A;  3L78 A;  1TK8 B;  1XWG A;  2QGV A;  4PTS A;  3K8N A;  1S3D A;  2I9H A;  4NV2 A;  4OCF A;  3VWW A;  2MBT A;  4KCE A;  3FZ5 A;  3EC3 A;  2JSZ A;  2I4A A;  3QPM A;  1SJI A;  1GSE A;  3UIW A;  3VWX A;  2H8L A;  2GSS A;  2ES7 A;  1OC8 A;  4XIH A;  4V2N A;  1FHE A;  2YZU A;  2B5Y A;  1NHY A;  4IN0 A;  1XOA A;  2WJU A;  3Q74 A;  3TRX A;  2AUV A;  3ZL5 A;  1SJZ A;  4ZIJ A;  4HU9 A;  3LG6 A;  3P2A A;  2KLX A;  5CYY A;  1YJ6 A;  1EOG A;  3BBY A;  1T4Z A;  2C3T A;  4F2I A;  4PXO A;  4IEL A;  3WGX A;  2HZE B;  5AIS A;  2IN3 A;  2TIR A;  4JBB A;  1A23 A;  2HXK A;  3W6G A;  4FQU A;  2OKA A;  1JZR A;  3UVH A;  2YNX A;  5ID2 B;  3RBT A;  4ISD A;  3ZVJ D;  3A2X A;  2B1L A;  3TKP A;  4ZL9 A;  2VUP A;  4D73 A;  3BJ5 A;  1XVQ A;  3S9F A;  3DGQ A;  1Z6M A;  3KH7 A;  4CW9 A;  1WMJ A;  3UL3 A;  1T3B A;  3WT2 A;  4X0X A;  5LCZ A;  3F3Q A;  1OVN A;  3C1R A;  4X1U A;  4ZB6 A;  1EV4 A;  2LQO A;  3ME8 A;  5KN0 A;  1HQO A;  1Z7P A;  2WS2 A;  3EIN A;  3J7Y b;  4EDY A;  1Z6N A;  2QKE A;  5B6M A;  1PRX A;  1TDI A;  5F0G A;  1M2A A;  3TJG A;  3SWL A;  3EU3 A;  2HNL A;  3GN3 A;  1TI3 A;  3HKR A;  1O85 A;  2VLV A;  1OKT A;  4IGJ A;  4TR1 B;  2LRC A;  2C3N A;  4G0L A;  4PUA A;  3TJK A;  3TJF A;  1O81 A;  1K0C A;  2XPE A;  3F8U A;  2JZT A;  4NHZ A;  2GZP A;  4IQA A;  2F51 A;  1T7P B;  4Q5R A;  2REM A;  4ACS A;  4I2U A;  5IPG A;  4OMV A;  4ECJ A;  1TW9 A;  3ISO A;  20GS A;  2E2M A;  1Q4J A;  4I97 A;  4HDE A;  5CRH A;  1TU7 A;  1SU9 A;  4X43 A;  3VLN A;  5F06 A;  4EC0 A;  4ID0 A;  5IQY A;  5IMZ A;  2HT9 A;  4N30 A;  4PUR A;  3VK9 A;  2HRN A;  4L5L A;  2IL3 A;  4L0U A;  5DQY A;  3IPZ A;  1B4Q A;  1XW9 A;  4P3Y B;  1GTA A;  3TOT A;  2OAC A;  2HSM B;  2V6K A;  3TJB A;  3FZA A;  3JCM L;  3R3E A;  4JE1 A;  2VIM A;  4OD7 A;  3I69 A;  1SYR A;  1AXD A;  2VOC A;  4K7O A;  4KW6 A;  3MSZ A;  4MDC A;  3QAG A;  5J9B A;  1V2A A;  3GUR A;  5DAK B;  1FAA A;  6GST A;  5HR2 A;  3WT1 A;  4KA0 A;  8GSS A;  1A0F A;  2H19 A;  1HD2 A;  4WF4 A;  1OE7 A;  4XHM A;  4OO4 A;  1V9W A;  1SKW B;  3GNJ A;  2GZY A;  2C0F A;  5DBQ A;  3H4K A;  4EO3 A;  2YWM A;  3LJR A;  2C8U A;  4MCU A;  4G9H A;  1MDI A;  4K7N A;  2WCI A;  2DBC A;  1JFU A;  2DIZ A;  1U3I A;  3VWV A;  1YEX A;  1OKD A;  2DLX A;  2WFC A;  2H72 A;  3RPP A;  4JZQ A;  2XBI A;  1N8J A;  4KSM A;  1R5P A;  3IBH A;  1U87 A;  1JZO A;  6GSY A;  1PX6 A;  5E4W A;  2HYX A;  1I5G A;  1ZCP A;  3NIV A;  3APO A;  4PQI A;  2EIR A;  1XWB A;  2FY6 A;  4DSS B;  2CVK A;  3C1S A;  4EL1 A;  1SKR B;  1WWJ A;  5B6N A;  5F07 A;  2EIO A;  3KJY A;  2CZ2 A;  3GMF A;  1TK5 B;  4NHW A;  1EEM A;  3HYP A;  3M0F A;  2AYT A;  4XRD A;  4YH2 A;  2X64 A;  3TKS A;  3D4M A;  4ML6 A;  4MJB A;  4NPB A;  3HY2 A;  3ZML A;  2FD3 A;  1TRV A;  1SD8 A;  2YWI A;  1EWX A;  2MMZ A;  3KMO A;  3VFI A;  4F82 A;  3HJM A;  4LL1 B;  4J56 E;  3TOU A;  1K0B A;  1R7H A;  1XCC A;  1IYH A;  2F8F A;  4NMU A;  4Q5F A;  4MPF A;  2LJR A;  4G19 A;  1BX9 A;  3LQ7 A;  2H1G A;  1SL2 B;  3H93 A;  2D2Z A;  2HLS A;  1I9D A;  2B5E A;  4K1F A;  1GL8 A;  2BTO T;  1JLW A;  1ACV A;  2IMK A;  1LU4 A;  2H73 A;  1SYX A;  4ECB A;  2K8V A;  4O5R A;  1RQM A;  2YV7 A;  3GH6 A;  3PPU A;  1GSS A;  4KDX A;  3UBL A;  4HS1 A;  2DJK A;  2F3M A;  2BJX A;  1OYJ A;  1Q98 A;  2GST A;  5B8A A;  1LJR A;  3C7M A;  5B7C A;  1MDK A;  1BJX A;  1GUH A;  1QGV A;  2CX4 A;  3QFB C;  1A8Y A;  2M46 A;  3MNG A;  3LYP A;  4V2L A;  3HA9 A;  2IFQ A;  5CNW A;  2PU9 C;  3N9J A;  1GP1 A;  1LBK A;  2WDU A;  2WRT A;  3DRN A;  3GIX A;  2OA7 A;  1SL0 B;  2H70 A;  5IMV A;  3IK7 A;  4JU5 A;  3P7X A;  4F9Z A;  2GQL A;  2JAC A;  4DSR A;  4MF6 A;  1V98 A;  3IHQ A;  3KP8 A;  2P31 A;  3LXT A;  2H76 A;  4GRF A;  3GSS A;  1K0D A;  1EZK A;  5GST A;  1PL1 A;  3O6T A;  1JLV A;  4TOP A;  2YAN A;  2E0Q A;  1YZX A;  4JR4 A;  1N2A A;  1SL1 B;  4EDZ A;  3BD2 A;  3M9J A;  3UBK A;  5D96 A;  3CBU A;  1XVW A;  2GQK A;  3J7Y k;  2QC7 A;  1OE8 A;  1F3A A;  3RHC A;  9GSS A;  4K6X A;  14GS A;  5ECH B;  2GLR A;  2BMX A;  2GDR A;  2DSA A;  2H0H A;  1M9B A;  5FT3 A;  3FR9 A;  5C04 A;  4MF5 A;  3WD6 A;  2O87 A;  5DAL B;  3G7Y A; 
#chains in the Genus database with same CATH topology
 2X8C A;  3MIX A;  4N10 A;  2IMF A;  1O8W A;  1ON4 A;  1ZZY A;  2HRF A;  5KOW A;  2RM6 A;  2H1D A;  1NM3 A;  2I81 A;  3G9B A;  4IBP A;  3FY7 A;  3FKF A;  1UN2 A;  4TVE A;  4EUY A;  2PGT A;  2GZZ A;  1B48 A;  3DKS A;  2DC5 A;  2VCZ A;  3QAV A;  4OWY A;  3TUE A;  4AGS A;  4GF0 A;  1N25 A;  4IHU A;  4IP1 A;  19GS A;  11GS A;  1ZYP A;  3Q6O A;  4WBR D;  1BED A;  4POK A;  4K0N A;  2VCX A;  5D73 A;  3M8N A;  5G30 A;  4A5P A;  3CTG A;  2DJJ A;  3HCZ A;  3IHG A;  4MA9 A;  2I1U A;  3QFA C;  4K0G A;  3MDK A;  4IW9 A;  4XRA A;  2PPT A;  2L6D A;  2R4V A;  3GX8 A;  4TRX A;  5FWG A;  1U6T A;  4DEJ A;  6GSV A;  4BA7 A;  3CYN A;  1KBN A;  5HFK A;  4FIW A;  4KSO A;  5AIV A;  4YKF A;  6GSX A;  4MF7 A;  2VL3 A;  3W8J A;  3ZTL A;  1GSD A;  5G5F A;  1RW1 A;  4USS A;  5ECK B;  2CVD A;  5JCU A;  2PBJ A;  2O89 A;  4AJ7 A;  3IOS A;  5IO0 A;  1HNB A;  2X4A A;  5DDL A;  5J5N A;  4LMV A;  3GKN A;  3ZMK A;  2LNS A;  2X99 A;  1XG8 A;  3LFL A;  2WZ9 A;  4EE0 A;  4ILF A;  1GTU A;  2H6X A;  4JED A;  4CY8 A;  3GTU B;  2JSY A;  3P8W A;  1TRS A;  1EGR A;  2WW0 A;  5ECO B;  4BWQ A;  4PQH A;  3O76 A;  2FHE A;  1ILO A;  4J2F A;  1NW2 A;  2FA8 A;  3F9U A;  3KZQ A;  5D9W A;  2VCQ A;  4GSS A;  5KN3 A;  5A1N B;  2YWN A;  2IJY A;  1K3O A;  4MPG A;  5ECM B;  4ZL8 A;  2L57 A;  2WUL A;  1C72 A;  1WRY A;  3RHB A;  1THX A;  1X5E A;  3TU3 B;  3MWH A;  1KNG A;  3TKQ A;  3HXS A;  2L59 A;  3A5W A;  5IM9 A;  3PIN A;  2RUE A;  2HRK A;  3TRQ A;  5JCW A;  2JZR A;  1Y25 A;  5ELA A;  1PSQ A;  4PNF A;  2AV4 A;  2LNT A;  2H66 A;  1X9M B;  2AJQ B;  1ZGN A;  4WR4 A;  3NOF A;  2OJL A;  2P0G A;  1OC9 A;  1A24 A;  2A2P A;  1ERT A;  3RFR C;  5H5S A;  4BPY A;  5EVO A;  3N5O A;  4IQ1 A;  3EU4 A;  4AKX B;  4Q5N A;  2O36 A;  4X4J A;  4OFM A;  4HQS A;  13GS A;  5CO3 A;  4DVC A;  2CZ3 A;  3A2W A;  5G31 A;  2OAD A;  3L4N A;  1AUC A;  2P5R A;  3LXZ A;  3KD0 A;  2TRX A;  3EVI A;  1YEW C;  2H75 A;  2LUS A;  2F9S A;  1WJK A;  3KH9 A;  4XTS A;  3D21 A;  2E2G A;  1FVK A;  3IAS 2;  3FYG A;  2B1K A;  2C0E A;  2VLT A;  2OE1 A;  3W8S A;  2N5A A;  3IV4 A;  2DJ3 A;  3TKS C;  4EVM A;  1MDJ A;  2L5L A;  3V1W A;  3BCK A;  2E7P A;  1KEB A;  5IO2 A;  3DIE A;  2CAI A;  3GL3 A;  1T8E B;  5IOW A;  4V2M A;  1TXX A;  4XCS A;  3HVV A;  1VGL A;  1O7U A;  4ZIL A;  5J4U A;  1V57 A;  2AHE A;  2LJK A;  3VI7 A;  1QK8 A;  2LV3 A;  3A5I A;  2VAF A;  3GKK A;  4TW5 A;  3EMP A;  2H1B A;  3ZFL A;  4I6X A;  3Q19 A;  4NWY A;  1AQV A;  3QAW A;  5AGY A;  3HVX A;  4MMM A;  1YQ1 A;  2H01 A;  1J08 A;  2WW2 A;  5KN1 A;  3TGZ A;  2PUK C;  3GUS A;  3LSZ A;  4K5S A;  1SVL A;  4ZB9 A;  1S3C A;  3A2V A;  2WW1 A;  1TRW A;  2LTK A;  4K8M A;  1AW9 A;  4NV5 A;  3C71 A;  1Y6E A;  5C00 A;  2WZS A;  1CQG A;  4HJM A;  2IMI A;  4NAX A;  1V40 A;  4Z2T A;  4KUN A;  4AKH A;  4ZXG A;  3CQF A;  4GQC A;  4RUV A;  3HZ4 A;  3ZYW A;  4TR0 A;  4GLT A;  2FWE A;  1OAZ A;  2HSH A;  7GSS A;  1FG4 A;  1MTC A;  3CMI A;  2K8S A;  5JWR B;  1XBS A;  1EP7 A;  2KHP A;  4KDU A;  2VLU A;  4Q5Q A;  4AF2 A;  10GS A;  2VL2 A;  3DD3 A;  3F4T A;  3PR8 A;  4MZW A;  2C0G A;  3GA4 A;  4FO5 A;  3TKS E;  1TXU A;  4TR4 A;  1X5C A;  2FNO A;  2DKI A;  3TCO A;  2JZS A;  3M9K A;  5IIZ A;  5J40 A;  2MYG A;  4LLR A;  3HVS A;  2WB9 A;  3KXO A;  2GSR A;  1M9A A;  4XS4 A;  3FHK A;  5D9T A;  5CRG A;  4MLY A;  2VCT A;  1K3L A;  4KDY A;  4HI7 A;  3RAZ A;  3LOR A;  2DJ2 A;  2A2S A;  4EXJ A;  3I6A A;  3IR4 A;  1VRS D;  2B7K A;  3EYT A;  4OO5 A;  2JL4 A;  1TOF A;  1UC7 A;  3ZLP A;  3QR6 A;  4LL4 B;  1DE2 A;  4WF5 A;  4KB3 A;  4EIP A;  1XOB A;  3ZVJ A;  2GVP A;  4FYB A;  2H30 A;  2A2R A;  1F2E A;  2RII A;  4BL7 A;  2GT5 A;  3IDV A;  5B8B A;  4D73 B;  5H5Q A;  1PL2 A;  1OC9 B;  1URM A;  3FEU A;  1CQH A;  1XW6 A;  2LEG A;  4XS1 A;  1Z7R A;  2F8A A;  4MJC A;  1DE1 A;  3H1N A;  2FUG 2;  3VPQ A;  5AIX A;  4YAP A;  3F3R A;  2L5O A;  3GX0 A;  2FCH A;  4ICY A;  5ECI B;  3EPT A;  4QL7 A;  1G7O A;  3QCP A;  2C3Q A;  1XWK A;  5CRE A;  2OE0 A;  2WVX A;  4MJA A;  4GCI A;  3F0I A;  3EMX A;  2V32 A;  1EP8 A;  3L9U A;  2AAW A;  3L9V A;  1NHO A;  1X9W B;  1ZOF A;  4ZBD A;  2K18 A;  3HD5 A;  2ALB A;  5KN2 A;  1O73 A;  4F03 A;  5ECS A;  4BVY A;  1ST9 A;  3BOA A;  4Z2R A;  1SEN A;  5CAX A;  4ZBA A;  1WP0 A;  4I5Q A;  1ZMA A;  2YWO A;  2V2G A;  4KGI A;  2GT6 A;  4ZBB A;  3QDN A;  2O3E A;  1TRU A;  2LKU A;  3HJP A;  5IOX A;  1BYE A;  2FWF A;  1X9S B;  2A4V A;  2H0I A;  1WE0 A;  5CP1 A;  1GLP A;  2HFD A;  2VM2 A;  3WGD A;  1EOH A;  2XC2 A;  1AAZ A;  4TKY A;  2A4H A;  2NPB A;  4PQ1 A;  1PX7 A;  1T1V A;  4G2E A;  2CAQ A;  2NVL A;  2YPM A;  1EV9 A;  4W66 A;  5J3R A;  3IAM 2;  1GSY A;  1SK2 A;  1A2J A;  1K0A A;  1ERW A;  3A3T A;  4O7H A;  4IJ3 A;  3ERW A;  1GTI A;  4IJI A;  2YN1 A;  4TXO A;  4BVX A;  5G1L A;  5JCG A;  3DVW A;  5ENU A;  1GSQ A;  2O85 A;  2DMM A;  5J41 A;  2WW3 A;  1EGO A;  1BAY A;  2O7K A;  2J9H A;  1F3B A;  2PN8 A;  2EFE A;  5IMC A;  2FGX A;  2R2J A;  4GSN A;  1FOH A;  5A34 B;  2PWJ A;  2CT6 A;  4L0W A;  4MAB A;  1Y1U A;  1ZYE A;  5A4W A;  1Z9H A;  1SD9 A;  4TR1 A;  2NTO A;  2KP1 A;  4N0Z A;  1GUL A;  1QUW A;  1K0N A;  2V6O A;  2VO4 A;  5ECP B;  4V1A p;  3GKM A;  1F9M A;  3UEM A;  4HOJ A;  1A8L A;  4KND A;  1PN9 A;  4CDO A;  1WPI A;  2XBQ A;  3ZIV A;  3ZIJ A;  4K9Z A;  2H0G A;  4L5O A;  3C73 A;  4E8E A;  2FA4 A;  2EFH A;  2IWT A;  1B9Y C;  4RQR A;  2CQ9 A;  1BG5 A;  3CSJ A;  1S4B P;  4K7I A;  2C1Y A;  5KOX A;  4RI7 A;  3L0H A;  4WKW A;  2VCW A;  2R0P A;  4G0I A;  1Z5Y E;  1GNE A;  2CX3 A;  2H6Y A;  3DVX A;  2CVB A;  1G0T A;  5GAN D;  1GTB A;  2Z9S A;  1TU8 A;  5IMF A;  3ZFB A;  3TJJ A;  1A2M A;  2IIY A;  1YEP A;  5J4Y A;  1TI1 A;  1AQX A;  3ZRD A;  5DAK A;  2VCV A;  3CSH A;  2R37 A;  3E3E A;  4LMW A;  5GZZ B;  1QMV A;  1TK0 B;  4POB A;  4ML1 A;  4KE3 A;  3E0U A;  5JWO B;  1PFO A;  3AY8 A;  1ZYN A;  3NZN A;  3QOU A;  2WGR A;  2RLI A;  3F6D A;  3ME7 A;  2EFC A;  3LWA A;  4MP4 A;  2V41 A;  1VF4 A;  5IPH A;  3MYD A;  3TRP A;  1TP9 A;  1K0M A;  5GAP D;  1G6Y A;  1M2B A;  3UOM A;  5INY A;  5ELG A;  5BRT A;  5HQP A;  4IS0 A;  2M80 A;  2DML A;  3ZZX A;  4I2T A;  5CRW A;  3D0Z A;  2GGT A;  3U6V A;  3O3T A;  1FO5 A;  1B4P A;  4G0K A;  4HU7 A;  2DJ1 A;  4NXI A;  5HR1 A;  3I43 A;  3L9S A;  3QMX A;  5DCG A;  4O32 A;  2YJ7 A;  4JR6 A;  1FVJ A;  4KF9 A;  3GV1 A;  4WXT A;  2IFQ B;  2P5Q A;  1YY7 A;  1R26 A;  1GUM A;  4BVY B;  2PVQ A;  6GSW A;  3KM6 A;  2EIQ A;  1OC3 A;  4DSS A;  4IKH A;  4POM A;  4FH8 A;  1GSF A;  3CRT A;  3FMW A;  4L8E A;  4YAV A;  5J4V A;  3UMA A;  1AIU A;  4GDF A;  1GSU A;  3D22 A;  4KX4 A;  5IMA A;  3FK8 A;  2HSN B;  4LA1 A;  4V1A g;  4PHZ C;  2VL2 C;  5E59 A;  1PKW A;  1YKC A;  1H75 A;  3H8Q A;  4GWR A;  3EE2 A;  5A5H A;  1PMT A;  1HNA A;  1I1I P;  3GH9 A;  2H74 A;  3DXB A;  1PQN A;  1M3J A;  5IMD A;  18GS A;  3DML A;  3RPN A;  3D4T A;  2ON7 A;  2ZNM A;  4GTU A;  5ECR B;  4N11 A;  2X8G A;  1MD3 A;  3OR5 A;  1FB6 A;  5G1K A;  4TXO B;  4BVX B;  2HSY A;  4PUF C;  2ON5 A;  4E68 A;  3LGC A;  2MBS A;  3KTL A;  3HHV A;  1ML6 A;  2H71 A;  2B5X A;  3G7I A;  1TKD B;  2KOK A;  4GST A;  4PX1 A;  4CHS A;  4HJ2 A;  1AC1 A;  1IYI A;  1V58 A;  2RM5 A;  3TKR A;  1KTE A;  1JZW A;  3CTF A;  2EC4 A;  1THO A;  3UAP A;  2XHF A;  3ZIT A;  5J9C A;  4RQX A;  2H6Z A;  4J57 E;  22GS A;  1UA5 A;  2I3Y A;  3CRU A;  3QD9 A;  3KMN A;  6GSS A;  2QA1 A;  4YKG A;  2J23 A;  1B9X C;  3C8E A;  4N0V A;  5EY6 A;  4HUA A;  1GH2 A;  4H86 A;  1PGT A;  2GTU A;  3EWL A;  2L4C A;  4ECI A;  1BF5 A;  1XW5 A;  1WIK A;  5G5E A;  2H1A A;  1U3A A;  5DQS A;  2XPD A;  1SVM A;  1PA3 A;  4HQZ A;  1F37 A;  3GHA A;  5BMU A;  1JZD A;  1YVL A;  2MMN A;  3FW2 A;  12GS A;  5LD0 A;  5DJM A;  1DBY A;  3GRX A;  2YOI A;  5G2Z A;  3GYK A;  1GRX A;  5DJL A;  2OE3 A;  3F4S A;  4G01 A;  2LRN A;  3IRA A;  3IE3 A;  1VF1 A;  4MK3 A;  3DEX A;  1USB A;  2DIY A;  1AQW A;  2QSI A;  4EIQ A;  2VM1 A;  5D9V A;  1B8X A;  4HSC X;  5DAL A;  3IC4 A;  2MMO A;  1YKA A;  1GLQ A;  2LJA A;  3KTB A;  5HFI A;  2CA8 A;  1HNC A;  2B3S A;  2LS5 A;  2LST A;  3TB2 A;  4PNG A;  5D8I A;  4HZ2 A;  5A5K A;  1E2Y A;  1J9B A;  3WGE A;  3M3M A;  2ZCT A;  2HE3 A;  4IP6 A;  1X0R A;  3FZ4 A;  3UVT A;  1XXU A;  4I8B A;  2LRT A;  1O6J A;  2X8H A;  2R6K A;  2WVZ A;  3WYW A;  3VPT A;  1K0O A;  2L4Q A;  3Q18 A;  1U88 A;  1TJD A;  3ERF A;  2VKZ G;  1R4W A;  1NSW A;  3F6F A;  3APQ A;  4F0C A;  3CSI A;  17GS A;  4PGT A;  3KCM A;  2VD1 A;  1A2L A;  2PVO C;  3RDW A;  5DCH A;  1QFN A;  3UAR A;  3PH9 A;  1MD4 A;  4FYU A;  5EL8 A;  2K9F A;  5A4V A;  2GSQ A;  5FHI A;  2V1M A;  2HRK B;  4AJ6 A;  2IPA A;  1BG1 A;  5JWQ B;  2C4J A;  3KEB A;  2C80 A;  2TRC P;  1JHB A;  4ZL7 A;  1FW1 A;  2YZH A;  3LEF A;  2YP6 A;  2MMA A;  4RI6 A;  4MJE A;  2OBI A;  4YQU A;  2JAD A;  4HZ4 A;  4GQF A;  4G10 A;  3E9J B;  3APS A;  3R2Q A;  2R5G A;  5ECN B;  3GL5 A;  1O8X A;  1SJ6 A;  3UJ1 A;  3GKX A;  1GWC A;  5GSS A;  1SKS B;  3ZRE A;  2HZF A;  1ERU A;  4HEA 2;  4K2D A;  4BWS A;  1DSB A;  4ZB8 A;  4Z7X A;  3P90 A;  4QQ7 A;  5COH A;  2PER A;  3DYR A;  5D9X A;  3GTU A;  1ERV A;  1T4Y A;  2VL9 A;  3VUR A;  1XWC A;  4PI2 C;  3HDC A;  2B6M A;  1XFL A;  1W89 A;  1S3A A;  4MZB A;  2G0F A;  1ZYQ B;  3M1G A;  4AI6 A;  5LNK e;  3FZ9 A;  2NDO A;  2X49 A;  1ABA A;  3GST A;  5CRD A;  5ABR A;  2ZUP A;  1R5A A;  1SK0 A;  4WR5 A;  1W4V A;  1F6M C;  2FLS A;  1M3I A;  1FOV A;  3IXR A;  1XPV A;  4ECC A;  5F05 A;  4TR3 A;  1GNW A;  4POL A;  1QQ2 A;  3KP9 A;  3MAK A;  4KCA A;  2HZE A;  4KH7 A;  1HYU A;  4EF0 A;  1PN0 A;  4OFT A;  2IMD A;  1TTZ A;  1SK1 A;  4OFN A;  2KP2 A;  2L6C A;  1M0U A;  1BQ7 A;  5ID2 A;  2HQT A;  3VI5 A;  3CXG A;  4DSQ A;  3I9V 2;  2R3X A;  1M7T A;  1G7E A;  4WBJ A;  3ERG A;  1FB0 A;  5BMU B;  1SVO A;  1E6B A;  1VF2 A;  3LYK A;  5ECL B;  3IA1 A;  4GXZ A;  4FYC A;  3FR6 A;  2RUF A;  2DJ0 A;  2UZ8 A;  2PMT A;  1RK4 A;  2YJH A;  3U5R E;  2YV9 A;  4YQV A;  2VD0 A;  4E8H A;  2AB6 A;  1PKZ A;  16GS A;  3FRC A;  5ECQ B;  3HVN A;  4TXV A;  5F8B A;  2G2Q A;  1MEK A;  3HZ8 A;  1YDK A;  4YQM A;  5HR0 A;  5D93 A;  1A0R P;  4F0B A;  4ULX A;  4MH2 A;  1DUG A;  2CV4 A;  3IK9 A;  5HR3 A;  4MH3 A;  2FWG A;  3D5J A;  3TDG A;  2OBK A;  2R0C A;  3F63 A;  1EEJ A;  4EKZ A;  3HJO A;  3G7J A;  1M2D A;  2YCD A;  6GSU A;  5AN1 A;  4TN8 A;  3FR3 A;  3BCI A;  2O8V B;  2GS3 A;  4QL9 A;  1YF1 A;  2KUC A;  5KEJ A;  1T00 A;  1XIY A;  2HRA A;  2C0D A;  4KAE A;  4XS4 B;  5EPF A;  2MZC A;  4WEY A;  1Z3E A;  1WOU A;  1X5D A;  3HMJ G;  4MZC A;  4O92 A;  3D6I A;  1QXH A;  1ZL9 A;  3KIJ A;  4O5Q A;  1PD2 1;  1YF0 A;  1XZO A;  4JRR A;  4IVF A;  2GQM A;  5L71 A;  1GUK A;  3SBC A;  3VWU A;  2FWH A;  3IC8 A;  3KGK A;  2HSM A;  1K3Y A;  3US3 A;  3GFK A;  1G6W A;  3DWV A;  4XS6 A;  3ED3 A;  1J0F A;  2HI7 A;  2B7J A;  1VF3 A;  5HFG A;  4BL7 B;  2N5F A;  2IME A;  2N5B A;  3F4R A;  5H5R A;  3PGT A;  2NBS A;  3H79 A;  1H4O A;  4AJ8 A;  1XWA A;  5A4U A;  4WET A;  1UVZ A;  2JU5 A;  4CY6 A;  4OCE A;  2LQQ A;  2M72 A;  2K6V A;  5DVB A;  1M99 A;  4O5U A;  3EUR A;  3L78 A;  1TK8 B;  1XWG A;  2QGV A;  4PTS A;  3K8N A;  1S3D A;  2I9H A;  4NV2 A;  4OCF A;  3VWW A;  2MBT A;  4KCE A;  3FZ5 A;  3EC3 A;  2JSZ A;  2I4A A;  3QPM A;  2WVX B;  1SJI A;  1GSE A;  3UIW A;  3VWX A;  2UV8 G;  2H8L A;  2GSS A;  2ES7 A;  1OC8 A;  4XIH A;  4K2X A;  4V2N A;  1FHE A;  2YZU A;  2B5Y A;  1NHY A;  4IN0 A;  1XOA A;  2WJU A;  3Q74 A;  3TRX A;  2AUV A;  3ZL5 A;  1SJZ A;  4ZIJ A;  4HU9 A;  3LG6 A;  3P2A A;  2KLX A;  5CYY A;  1YJ6 A;  1EOG A;  3BBY A;  1T4Z A;  2C3T A;  4F2I A;  4PXO A;  4IEL A;  3WGX A;  4PI0 C;  2HZE B;  5AIS A;  2IN3 A;  2TIR A;  4JBB A;  1A23 A;  2HXK A;  3W6G A;  4FQU A;  2OKA A;  1JZR A;  3UVH A;  3CHX C;  2YNX A;  5ID2 B;  3RBT A;  4ISD A;  3ZVJ D;  3A2X A;  2B1L A;  3TKP A;  4ZL9 A;  2VUP A;  4D73 A;  2OT3 A;  3BJ5 A;  1XVQ A;  3S9F A;  3DGQ A;  1Z6M A;  3KH7 A;  4CW9 A;  1WMJ A;  3UL3 A;  1T3B A;  3WT2 A;  4X0X A;  5LCZ A;  3F3Q A;  1OVN A;  3C1R A;  4X1U A;  4ZB6 A;  1EV4 A;  2LQO A;  3ME8 A;  5KN0 A;  1HQO A;  1Z7P A;  2WS2 A;  3EIN A;  3J7Y b;  4EDY A;  1Z6N A;  2QKE A;  5B6M A;  1PRX A;  1TDI A;  5F0G A;  1M2A A;  3TJG A;  3SWL A;  3EU3 A;  2HNL A;  3GN3 A;  1TI3 A;  3HKR A;  1O85 A;  2VLV A;  1OKT A;  4IGJ A;  4TR1 B;  2LRC A;  2O5V A;  2C3N A;  4G0L A;  4PUA A;  3TJK A;  3TJF A;  1O81 A;  4K5R A;  1K0C A;  2XPE A;  3F8U A;  2JZT A;  2WVY A;  4NHZ A;  2GZP A;  4IQA A;  2F51 A;  1T7P B;  4Q5R A;  2REM A;  4ACS A;  4I2U A;  5IPG A;  4OMV A;  4ECJ A;  2R0G A;  1TW9 A;  3ISO A;  20GS A;  2E2M A;  1Q4J A;  4I97 A;  4HDE A;  5CRH A;  1TU7 A;  1SU9 A;  4X43 A;  3VLN A;  5F06 A;  4EC0 A;  4ID0 A;  5IQY A;  5IMZ A;  2HT9 A;  4N30 A;  4PUR A;  3VK9 A;  2HRN A;  4L5L A;  2IL3 A;  4L0U A;  5DQY A;  3IPZ A;  1B4Q A;  1XW9 A;  4P3Y B;  1GTA A;  3TOT A;  2OAC A;  4N3Z A;  2HSM B;  2V6K A;  3TJB A;  3FZA A;  3JCM L;  3R3E A;  4JE1 A;  2VIM A;  4OD7 A;  3I69 A;  1SYR A;  1AXD A;  2VOC A;  4K7O A;  4KW6 A;  3MSZ A;  4AKI A;  4MDC A;  3QAG A;  5J9B A;  1V2A A;  3GUR A;  4QMK A;  5DAK B;  1FAA A;  6GST A;  5HR2 A;  3WT1 A;  4KA0 A;  8GSS A;  1A0F A;  2H19 A;  1HD2 A;  4WF4 A;  2H1L A;  1OE7 A;  4XHM A;  4OO4 A;  1V9W A;  1SKW B;  3GNJ A;  2GZY A;  2C0F A;  5DBQ A;  3H4K A;  4EO3 A;  2YWM A;  3LJR A;  5A34 A;  2C8U A;  4MCU A;  4G9H A;  1MDI A;  4K7N A;  2WCI A;  2DBC A;  1JFU A;  2DIZ A;  1U3I A;  3VWV A;  1YEX A;  1OKD A;  2DLX A;  2WFC A;  2H72 A;  3RPP A;  4JZQ A;  2XBI A;  1N8J A;  4KSM A;  1R5P A;  3IBH A;  1U87 A;  4MNN A;  1JZO A;  6GSY A;  1PX6 A;  5E4W A;  2HYX A;  1I5G A;  1ZCP A;  3NIV A;  3APO A;  4PQI A;  2EIR A;  1XWB A;  2FY6 A;  4DSS B;  2CVK A;  3C1S A;  4EL1 A;  1SKR B;  4Z2U A;  1WWJ A;  5B6N A;  5F07 A;  2EIO A;  3KJY A;  2CZ2 A;  3GMF A;  1TK5 B;  4NHW A;  1EEM A;  3HYP A;  3M0F A;  2AYT A;  4XRD A;  4YH2 A;  2X64 A;  3TKS A;  3D4M A;  5J47 A;  4ML6 A;  4MJB A;  4NPB A;  3HY2 A;  3ZML A;  2FD3 A;  1TRV A;  3CWG A;  1SD8 A;  2YWI A;  1EWX A;  2MMZ A;  3KMO A;  5A5H B;  1S3R A;  3VFI A;  4F82 A;  3HJM A;  4LL1 B;  4J56 E;  3TOU A;  4FXY P;  1K0B A;  1R7H A;  1XCC A;  1IYH A;  2F8F A;  4NMU A;  4Q5F A;  4MPF A;  2LJR A;  4G19 A;  1BX9 A;  3LQ7 A;  2H1G A;  1SL2 B;  3H93 A;  2D2Z A;  2HLS A;  1I9D A;  2B5E A;  2DKH A;  4K1F A;  1GL8 A;  2BTO T;  1JLW A;  1ACV A;  2IMK A;  1LU4 A;  2H73 A;  1SYX A;  4ECB A;  2K8V A;  4O5R A;  1RQM A;  2YV7 A;  3GH6 A;  3PPU A;  1GSS A;  4KDX A;  3UBL A;  4HS1 A;  5A1N A;  2DJK A;  2F3M A;  2BJX A;  1OYJ A;  1Q98 A;  2GST A;  5B8A A;  1LJR A;  3C7M A;  5B7C A;  1MDK A;  1BJX A;  1GUH A;  1QGV A;  2CX4 A;  3QFB C;  1A8Y A;  2M46 A;  2QA2 A;  3MNG A;  3LYP A;  4V2L A;  3HA9 A;  2IFQ A;  5CNW A;  2PU9 C;  3N9J A;  1GP1 A;  1LBK A;  2WDU A;  2WRT A;  3DRN A;  3GIX A;  2OA7 A;  1SL0 B;  2H70 A;  5IMV A;  3IK7 A;  4JU5 A;  3P7X A;  4F9Z A;  2GQL A;  2JAC A;  4DSR A;  4MF6 A;  1V98 A;  3IHQ A;  3RGB C;  3KP8 A;  2P31 A;  3LXT A;  2H76 A;  4GRF A;  3GSS A;  1K0D A;  2HSN A;  1EZK A;  5GST A;  1PL1 A;  3O6T A;  1JLV A;  4AKG A;  4TOP A;  2YAN A;  2E0Q A;  1YZX A;  4JR4 A;  1N2A A;  1SL1 B;  4EDZ A;  3BD2 A;  3M9J A;  3UBK A;  5D96 A;  3CBU A;  1XVW A;  2GQK A;  3J7Y k;  2QC7 A;  3LW9 A;  1OE8 A;  2EFD A;  1F3A A;  3RHC A;  9GSS A;  4ZB7 A;  4K6X A;  14GS A;  5ECH B;  4BIK A;  2GLR A;  2BMX A;  2GDR A;  2DSA A;  2H0H A;  1M9B A;  5FT3 A;  3FR9 A;  5C04 A;  4MF5 A;  3WD6 A;  2O87 A;  5DAL B;  3G7Y A; 
#chains in the Genus database with same CATH homology
 2X8C A;  3MIX A;  4N10 A;  2IMF A;  1O8W A;  1ON4 A;  1ZZY A;  2HRF A;  5KOW A;  2RM6 A;  2H1D A;  1NM3 A;  2I81 A;  3G9B A;  4IBP A;  3FY7 A;  3FKF A;  1UN2 A;  4TVE A;  4EUY A;  2PGT A;  2GZZ A;  1B48 A;  3DKS A;  2DC5 A;  2VCZ A;  3QAV A;  4OWY A;  3TUE A;  4AGS A;  4GF0 A;  1N25 A;  4IHU A;  4IP1 A;  19GS A;  11GS A;  1ZYP A;  3Q6O A;  4WBR D;  1BED A;  4POK A;  4K0N A;  2VCX A;  5D73 A;  3M8N A;  5G30 A;  4A5P A;  3CTG A;  2DJJ A;  3HCZ A;  3IHG A;  4MA9 A;  2I1U A;  3QFA C;  4K0G A;  3MDK A;  4IW9 A;  4XRA A;  2PPT A;  2L6D A;  2R4V A;  3GX8 A;  4TRX A;  5FWG A;  1U6T A;  4DEJ A;  6GSV A;  4BA7 A;  3CYN A;  1KBN A;  5HFK A;  4FIW A;  4KSO A;  5AIV A;  4YKF A;  6GSX A;  4MF7 A;  2VL3 A;  3W8J A;  3ZTL A;  1GSD A;  5G5F A;  1RW1 A;  4USS A;  5ECK B;  2CVD A;  5JCU A;  2PBJ A;  2O89 A;  4AJ7 A;  3IOS A;  5IO0 A;  1HNB A;  2X4A A;  5DDL A;  5J5N A;  4LMV A;  3GKN A;  3ZMK A;  2LNS A;  2X99 A;  3LFL A;  2WZ9 A;  4EE0 A;  4ILF A;  1GTU A;  2H6X A;  4JED A;  4CY8 A;  3GTU B;  2JSY A;  3P8W A;  1TRS A;  1EGR A;  5ECO B;  4BWQ A;  4PQH A;  3O76 A;  2FHE A;  1ILO A;  4J2F A;  1NW2 A;  2FA8 A;  3F9U A;  3KZQ A;  5D9W A;  2VCQ A;  4GSS A;  5KN3 A;  5A1N B;  2YWN A;  2IJY A;  1K3O A;  4MPG A;  5ECM B;  4ZL8 A;  2L57 A;  2WUL A;  1C72 A;  1WRY A;  3RHB A;  1THX A;  1X5E A;  3TU3 B;  3MWH A;  1KNG A;  3TKQ A;  3HXS A;  2L59 A;  3A5W A;  5IM9 A;  3PIN A;  2RUE A;  2HRK A;  3TRQ A;  5JCW A;  2JZR A;  1Y25 A;  5ELA A;  1PSQ A;  4PNF A;  2AV4 A;  2LNT A;  2H66 A;  1X9M B;  2AJQ B;  1ZGN A;  4WR4 A;  3NOF A;  2OJL A;  2P0G A;  1OC9 A;  1A24 A;  2A2P A;  1ERT A;  5H5S A;  4BPY A;  5EVO A;  3N5O A;  4IQ1 A;  3EU4 A;  4AKX B;  4Q5N A;  4X4J A;  4OFM A;  4HQS A;  13GS A;  5CO3 A;  4DVC A;  2CZ3 A;  3A2W A;  5G31 A;  2OAD A;  3L4N A;  1AUC A;  2P5R A;  3LXZ A;  3KD0 A;  2TRX A;  3EVI A;  2H75 A;  2LUS A;  2F9S A;  1WJK A;  3KH9 A;  4XTS A;  3D21 A;  2E2G A;  1FVK A;  3IAS 2;  3FYG A;  2B1K A;  2C0E A;  2VLT A;  2OE1 A;  3W8S A;  2N5A A;  3IV4 A;  2DJ3 A;  3TKS C;  4EVM A;  1MDJ A;  2L5L A;  3V1W A;  3BCK A;  2E7P A;  1KEB A;  5IO2 A;  3DIE A;  2CAI A;  3GL3 A;  1T8E B;  5IOW A;  4V2M A;  1TXX A;  4XCS A;  3HVV A;  1VGL A;  1O7U A;  4ZIL A;  5J4U A;  1V57 A;  2AHE A;  2LJK A;  3VI7 A;  1QK8 A;  2LV3 A;  3A5I A;  2VAF A;  3GKK A;  4TW5 A;  3EMP A;  2H1B A;  3ZFL A;  4I6X A;  3Q19 A;  4NWY A;  1AQV A;  3QAW A;  5AGY A;  3HVX A;  4MMM A;  1YQ1 A;  2H01 A;  1J08 A;  5KN1 A;  3TGZ A;  2PUK C;  3GUS A;  3LSZ A;  4K5S A;  1SVL A;  4ZB9 A;  1S3C A;  3A2V A;  1TRW A;  2LTK A;  4K8M A;  1AW9 A;  4NV5 A;  3C71 A;  1Y6E A;  5C00 A;  1CQG A;  4HJM A;  2IMI A;  4NAX A;  1V40 A;  4Z2T A;  4KUN A;  4AKH A;  4ZXG A;  4GQC A;  4RUV A;  3HZ4 A;  3ZYW A;  4TR0 A;  4GLT A;  2FWE A;  1OAZ A;  2HSH A;  7GSS A;  1FG4 A;  1MTC A;  3CMI A;  2K8S A;  5JWR B;  1XBS A;  1EP7 A;  2KHP A;  4KDU A;  2VLU A;  4Q5Q A;  4AF2 A;  10GS A;  2VL2 A;  3DD3 A;  3F4T A;  3PR8 A;  4MZW A;  2C0G A;  3GA4 A;  4FO5 A;  3TKS E;  1TXU A;  4TR4 A;  1X5C A;  2FNO A;  2DKI A;  3TCO A;  2JZS A;  3M9K A;  5IIZ A;  5J40 A;  2MYG A;  4LLR A;  3HVS A;  2WB9 A;  3KXO A;  2GSR A;  1M9A A;  4XS4 A;  3FHK A;  5D9T A;  5CRG A;  4MLY A;  2VCT A;  1K3L A;  4KDY A;  4HI7 A;  3RAZ A;  3LOR A;  2DJ2 A;  2A2S A;  4EXJ A;  3I6A A;  3IR4 A;  1VRS D;  2B7K A;  3EYT A;  4OO5 A;  2JL4 A;  1TOF A;  1UC7 A;  3ZLP A;  3QR6 A;  4LL4 B;  1DE2 A;  4WF5 A;  4KB3 A;  4EIP A;  1XOB A;  3ZVJ A;  2GVP A;  4FYB A;  2H30 A;  2A2R A;  1F2E A;  2RII A;  4BL7 A;  2GT5 A;  3IDV A;  5B8B A;  4D73 B;  5H5Q A;  1PL2 A;  1OC9 B;  1URM A;  3FEU A;  1CQH A;  1XW6 A;  2LEG A;  4XS1 A;  1Z7R A;  2F8A A;  4MJC A;  1DE1 A;  3H1N A;  2FUG 2;  3VPQ A;  5AIX A;  4YAP A;  3F3R A;  2L5O A;  3GX0 A;  2FCH A;  4ICY A;  5ECI B;  3EPT A;  4QL7 A;  1G7O A;  3QCP A;  2C3Q A;  1XWK A;  5CRE A;  2OE0 A;  4MJA A;  4GCI A;  3F0I A;  3EMX A;  2V32 A;  1EP8 A;  3L9U A;  2AAW A;  3L9V A;  1NHO A;  1X9W B;  1ZOF A;  4ZBD A;  2K18 A;  3HD5 A;  2ALB A;  5KN2 A;  1O73 A;  4F03 A;  5ECS A;  4BVY A;  1ST9 A;  3BOA A;  4Z2R A;  1SEN A;  5CAX A;  4ZBA A;  1WP0 A;  4I5Q A;  1ZMA A;  2YWO A;  2V2G A;  4KGI A;  2GT6 A;  4ZBB A;  3QDN A;  1TRU A;  2LKU A;  3HJP A;  5IOX A;  1BYE A;  2FWF A;  1X9S B;  2A4V A;  2H0I A;  1WE0 A;  5CP1 A;  1GLP A;  2HFD A;  2VM2 A;  3WGD A;  1EOH A;  2XC2 A;  1AAZ A;  4TKY A;  2A4H A;  2NPB A;  4PQ1 A;  1PX7 A;  1T1V A;  4G2E A;  2CAQ A;  2NVL A;  2YPM A;  1EV9 A;  4W66 A;  5J3R A;  3IAM 2;  1GSY A;  1SK2 A;  1A2J A;  1K0A A;  1ERW A;  3A3T A;  4O7H A;  4IJ3 A;  3ERW A;  1GTI A;  4IJI A;  2YN1 A;  4TXO A;  4BVX A;  5G1L A;  5JCG A;  3DVW A;  5ENU A;  1GSQ A;  2O85 A;  2DMM A;  5J41 A;  1EGO A;  1BAY A;  2O7K A;  2J9H A;  1F3B A;  2PN8 A;  2EFE A;  5IMC A;  2FGX A;  2R2J A;  4GSN A;  1FOH A;  5A34 B;  2PWJ A;  2CT6 A;  4L0W A;  4MAB A;  1Y1U A;  1ZYE A;  5A4W A;  1Z9H A;  1SD9 A;  4TR1 A;  2NTO A;  2KP1 A;  4N0Z A;  1GUL A;  1QUW A;  1K0N A;  2V6O A;  2VO4 A;  5ECP B;  4V1A p;  3GKM A;  1F9M A;  3UEM A;  4HOJ A;  1A8L A;  4KND A;  1PN9 A;  4CDO A;  1WPI A;  2XBQ A;  3ZIV A;  3ZIJ A;  4K9Z A;  2H0G A;  4L5O A;  3C73 A;  4E8E A;  2FA4 A;  2EFH A;  2IWT A;  1B9Y C;  4RQR A;  2CQ9 A;  1BG5 A;  3CSJ A;  4K7I A;  2C1Y A;  5KOX A;  4RI7 A;  3L0H A;  4WKW A;  2VCW A;  2R0P A;  4G0I A;  1Z5Y E;  1GNE A;  2CX3 A;  2H6Y A;  3DVX A;  2CVB A;  1G0T A;  5GAN D;  1GTB A;  2Z9S A;  1TU8 A;  5IMF A;  3ZFB A;  3TJJ A;  1A2M A;  2IIY A;  1YEP A;  5J4Y A;  1TI1 A;  1AQX A;  3ZRD A;  5DAK A;  2VCV A;  3CSH A;  2R37 A;  3E3E A;  4LMW A;  5GZZ B;  1QMV A;  1TK0 B;  4POB A;  4ML1 A;  4KE3 A;  3E0U A;  5JWO B;  3AY8 A;  1ZYN A;  3NZN A;  3QOU A;  2WGR A;  2RLI A;  3F6D A;  3ME7 A;  2EFC A;  3LWA A;  4MP4 A;  2V41 A;  1VF4 A;  5IPH A;  3MYD A;  3TRP A;  1TP9 A;  1K0M A;  5GAP D;  1G6Y A;  1M2B A;  3UOM A;  5INY A;  5ELG A;  5BRT A;  5HQP A;  4IS0 A;  2M80 A;  2DML A;  3ZZX A;  4I2T A;  5CRW A;  3D0Z A;  2GGT A;  3U6V A;  3O3T A;  1FO5 A;  1B4P A;  4G0K A;  4HU7 A;  2DJ1 A;  4NXI A;  5HR1 A;  3I43 A;  3L9S A;  3QMX A;  5DCG A;  4O32 A;  2YJ7 A;  4JR6 A;  1FVJ A;  4KF9 A;  3GV1 A;  4WXT A;  2IFQ B;  2P5Q A;  1YY7 A;  1R26 A;  1GUM A;  4BVY B;  2PVQ A;  6GSW A;  3KM6 A;  2EIQ A;  1OC3 A;  4DSS A;  4IKH A;  4POM A;  4FH8 A;  1GSF A;  3CRT A;  3FMW A;  4L8E A;  4YAV A;  5J4V A;  3UMA A;  1AIU A;  4GDF A;  1GSU A;  3D22 A;  4KX4 A;  5IMA A;  3FK8 A;  2HSN B;  4LA1 A;  4V1A g;  2VL2 C;  5E59 A;  1PKW A;  1YKC A;  1H75 A;  3H8Q A;  4GWR A;  3EE2 A;  5A5H A;  1PMT A;  1HNA A;  3GH9 A;  2H74 A;  3DXB A;  1PQN A;  5IMD A;  18GS A;  3DML A;  3RPN A;  3D4T A;  2ON7 A;  2ZNM A;  4GTU A;  5ECR B;  4N11 A;  2X8G A;  1MD3 A;  3OR5 A;  1FB6 A;  5G1K A;  4TXO B;  4BVX B;  2HSY A;  4PUF C;  2ON5 A;  4E68 A;  3LGC A;  2MBS A;  3KTL A;  3HHV A;  1ML6 A;  2H71 A;  2B5X A;  3G7I A;  1TKD B;  2KOK A;  4GST A;  4PX1 A;  4CHS A;  4HJ2 A;  1AC1 A;  1IYI A;  1V58 A;  2RM5 A;  3TKR A;  1KTE A;  1JZW A;  3CTF A;  2EC4 A;  1THO A;  3UAP A;  2XHF A;  3ZIT A;  5J9C A;  4RQX A;  2H6Z A;  4J57 E;  22GS A;  1UA5 A;  2I3Y A;  3CRU A;  3QD9 A;  3KMN A;  6GSS A;  2QA1 A;  4YKG A;  2J23 A;  1B9X C;  3C8E A;  4N0V A;  5EY6 A;  4HUA A;  1GH2 A;  4H86 A;  1PGT A;  2GTU A;  3EWL A;  2L4C A;  4ECI A;  1BF5 A;  1XW5 A;  1WIK A;  5G5E A;  2H1A A;  1U3A A;  5DQS A;  2XPD A;  1SVM A;  1PA3 A;  4HQZ A;  1F37 A;  3GHA A;  5BMU A;  1JZD A;  1YVL A;  2MMN A;  3FW2 A;  12GS A;  5LD0 A;  5DJM A;  1DBY A;  3GRX A;  2YOI A;  5G2Z A;  3GYK A;  1GRX A;  5DJL A;  2OE3 A;  3F4S A;  4G01 A;  2LRN A;  3IRA A;  3IE3 A;  1VF1 A;  4MK3 A;  3DEX A;  1USB A;  2DIY A;  1AQW A;  2QSI A;  4EIQ A;  2VM1 A;  5D9V A;  1B8X A;  5DAL A;  3IC4 A;  2MMO A;  1YKA A;  1GLQ A;  2LJA A;  3KTB A;  5HFI A;  2CA8 A;  1HNC A;  2B3S A;  2LS5 A;  2LST A;  3TB2 A;  4PNG A;  5D8I A;  4HZ2 A;  5A5K A;  1E2Y A;  1J9B A;  3WGE A;  3M3M A;  2ZCT A;  2HE3 A;  4IP6 A;  1X0R A;  3FZ4 A;  3UVT A;  1XXU A;  4I8B A;  2LRT A;  1O6J A;  2X8H A;  2R6K A;  3WYW A;  3VPT A;  1K0O A;  2L4Q A;  3Q18 A;  1U88 A;  1TJD A;  3ERF A;  2VKZ G;  1R4W A;  1NSW A;  3F6F A;  3APQ A;  4F0C A;  3CSI A;  17GS A;  4PGT A;  3KCM A;  2VD1 A;  1A2L A;  2PVO C;  3RDW A;  5DCH A;  1QFN A;  3UAR A;  3PH9 A;  1MD4 A;  4FYU A;  5EL8 A;  2K9F A;  5A4V A;  2GSQ A;  5FHI A;  2V1M A;  2HRK B;  4AJ6 A;  2IPA A;  1BG1 A;  5JWQ B;  2C4J A;  3KEB A;  2C80 A;  2TRC P;  1JHB A;  4ZL7 A;  1FW1 A;  2YZH A;  3LEF A;  2YP6 A;  2MMA A;  4RI6 A;  4MJE A;  2OBI A;  4YQU A;  2JAD A;  4HZ4 A;  4GQF A;  4G10 A;  3E9J B;  3APS A;  3R2Q A;  2R5G A;  5ECN B;  3GL5 A;  1O8X A;  1SJ6 A;  3UJ1 A;  3GKX A;  1GWC A;  5GSS A;  1SKS B;  3ZRE A;  2HZF A;  1ERU A;  4HEA 2;  4K2D A;  4BWS A;  1DSB A;  4ZB8 A;  4Z7X A;  3P90 A;  4QQ7 A;  5COH A;  2PER A;  3DYR A;  5D9X A;  3GTU A;  1ERV A;  1T4Y A;  2VL9 A;  3VUR A;  1XWC A;  3HDC A;  2B6M A;  1XFL A;  1W89 A;  1S3A A;  4MZB A;  2G0F A;  1ZYQ B;  3M1G A;  4AI6 A;  5LNK e;  3FZ9 A;  2NDO A;  2X49 A;  1ABA A;  3GST A;  5CRD A;  5ABR A;  2ZUP A;  1R5A A;  1SK0 A;  4WR5 A;  1W4V A;  1F6M C;  2FLS A;  1FOV A;  3IXR A;  1XPV A;  4ECC A;  5F05 A;  4TR3 A;  1GNW A;  4POL A;  1QQ2 A;  3KP9 A;  3MAK A;  4KCA A;  2HZE A;  4KH7 A;  1HYU A;  4EF0 A;  1PN0 A;  4OFT A;  2IMD A;  1TTZ A;  1SK1 A;  4OFN A;  2KP2 A;  2L6C A;  1M0U A;  1BQ7 A;  5ID2 A;  2HQT A;  3VI5 A;  3CXG A;  4DSQ A;  3I9V 2;  2R3X A;  1M7T A;  1G7E A;  4WBJ A;  3ERG A;  1FB0 A;  5BMU B;  1SVO A;  1E6B A;  1VF2 A;  3LYK A;  5ECL B;  3IA1 A;  4GXZ A;  4FYC A;  3FR6 A;  2RUF A;  2DJ0 A;  2UZ8 A;  2PMT A;  1RK4 A;  2YJH A;  3U5R E;  2YV9 A;  4YQV A;  2VD0 A;  4E8H A;  2AB6 A;  1PKZ A;  16GS A;  3FRC A;  5ECQ B;  4TXV A;  5F8B A;  2G2Q A;  1MEK A;  3HZ8 A;  1YDK A;  4YQM A;  5HR0 A;  5D93 A;  1A0R P;  4F0B A;  4ULX A;  4MH2 A;  1DUG A;  2CV4 A;  3IK9 A;  5HR3 A;  4MH3 A;  2FWG A;  3D5J A;  3TDG A;  2OBK A;  2R0C A;  3F63 A;  1EEJ A;  4EKZ A;  3HJO A;  3G7J A;  1M2D A;  2YCD A;  6GSU A;  5AN1 A;  4TN8 A;  3FR3 A;  3BCI A;  2O8V B;  2GS3 A;  4QL9 A;  1YF1 A;  2KUC A;  5KEJ A;  1T00 A;  1XIY A;  2HRA A;  2C0D A;  4KAE A;  4XS4 B;  5EPF A;  2MZC A;  4WEY A;  1Z3E A;  1WOU A;  1X5D A;  3HMJ G;  4MZC A;  4O92 A;  3D6I A;  1QXH A;  1ZL9 A;  3KIJ A;  4O5Q A;  1PD2 1;  1YF0 A;  1XZO A;  4JRR A;  4IVF A;  2GQM A;  5L71 A;  1GUK A;  3SBC A;  3VWU A;  2FWH A;  3IC8 A;  3KGK A;  2HSM A;  1K3Y A;  3US3 A;  3GFK A;  1G6W A;  3DWV A;  4XS6 A;  3ED3 A;  1J0F A;  2HI7 A;  2B7J A;  1VF3 A;  5HFG A;  4BL7 B;  2N5F A;  2IME A;  2N5B A;  3F4R A;  5H5R A;  3PGT A;  2NBS A;  3H79 A;  1H4O A;  4AJ8 A;  1XWA A;  5A4U A;  4WET A;  1UVZ A;  2JU5 A;  4CY6 A;  4OCE A;  2LQQ A;  2M72 A;  2K6V A;  5DVB A;  1M99 A;  4O5U A;  3EUR A;  3L78 A;  1TK8 B;  1XWG A;  2QGV A;  4PTS A;  3K8N A;  1S3D A;  2I9H A;  4NV2 A;  4OCF A;  3VWW A;  2MBT A;  4KCE A;  3FZ5 A;  3EC3 A;  2JSZ A;  2I4A A;  3QPM A;  1SJI A;  1GSE A;  3UIW A;  3VWX A;  2UV8 G;  2H8L A;  2GSS A;  2ES7 A;  1OC8 A;  4XIH A;  4K2X A;  4V2N A;  1FHE A;  2YZU A;  2B5Y A;  1NHY A;  4IN0 A;  1XOA A;  2WJU A;  3Q74 A;  3TRX A;  2AUV A;  3ZL5 A;  1SJZ A;  4ZIJ A;  4HU9 A;  3LG6 A;  3P2A A;  2KLX A;  5CYY A;  1YJ6 A;  1EOG A;  3BBY A;  1T4Z A;  2C3T A;  4F2I A;  4PXO A;  4IEL A;  3WGX A;  2HZE B;  5AIS A;  2IN3 A;  2TIR A;  4JBB A;  1A23 A;  2HXK A;  3W6G A;  4FQU A;  2OKA A;  1JZR A;  3UVH A;  2YNX A;  5ID2 B;  3RBT A;  4ISD A;  3ZVJ D;  3A2X A;  2B1L A;  3TKP A;  4ZL9 A;  2VUP A;  4D73 A;  2OT3 A;  3BJ5 A;  1XVQ A;  3S9F A;  3DGQ A;  1Z6M A;  3KH7 A;  4CW9 A;  1WMJ A;  3UL3 A;  1T3B A;  3WT2 A;  4X0X A;  5LCZ A;  3F3Q A;  1OVN A;  3C1R A;  4X1U A;  4ZB6 A;  1EV4 A;  2LQO A;  3ME8 A;  5KN0 A;  1HQO A;  1Z7P A;  2WS2 A;  3EIN A;  3J7Y b;  4EDY A;  1Z6N A;  2QKE A;  5B6M A;  1PRX A;  1TDI A;  5F0G A;  1M2A A;  3TJG A;  3SWL A;  3EU3 A;  2HNL A;  3GN3 A;  1TI3 A;  3HKR A;  1O85 A;  2VLV A;  1OKT A;  4IGJ A;  4TR1 B;  2LRC A;  2O5V A;  2C3N A;  4G0L A;  4PUA A;  3TJK A;  3TJF A;  1O81 A;  4K5R A;  1K0C A;  2XPE A;  3F8U A;  2JZT A;  4NHZ A;  2GZP A;  4IQA A;  2F51 A;  1T7P B;  4Q5R A;  2REM A;  4ACS A;  4I2U A;  5IPG A;  4OMV A;  4ECJ A;  2R0G A;  1TW9 A;  3ISO A;  20GS A;  2E2M A;  1Q4J A;  4I97 A;  4HDE A;  5CRH A;  1TU7 A;  1SU9 A;  4X43 A;  3VLN A;  5F06 A;  4EC0 A;  4ID0 A;  5IQY A;  5IMZ A;  2HT9 A;  4N30 A;  4PUR A;  3VK9 A;  2HRN A;  4L5L A;  2IL3 A;  4L0U A;  5DQY A;  3IPZ A;  1B4Q A;  1XW9 A;  4P3Y B;  1GTA A;  3TOT A;  2OAC A;  4N3Z A;  2HSM B;  2V6K A;  3TJB A;  3FZA A;  3JCM L;  3R3E A;  4JE1 A;  2VIM A;  4OD7 A;  3I69 A;  1SYR A;  1AXD A;  2VOC A;  4K7O A;  4KW6 A;  3MSZ A;  4AKI A;  4MDC A;  3QAG A;  5J9B A;  1V2A A;  3GUR A;  4QMK A;  5DAK B;  1FAA A;  6GST A;  5HR2 A;  3WT1 A;  4KA0 A;  8GSS A;  1A0F A;  2H19 A;  1HD2 A;  4WF4 A;  2H1L A;  1OE7 A;  4XHM A;  4OO4 A;  1V9W A;  1SKW B;  3GNJ A;  2GZY A;  2C0F A;  5DBQ A;  3H4K A;  4EO3 A;  2YWM A;  3LJR A;  5A34 A;  2C8U A;  4MCU A;  4G9H A;  1MDI A;  4K7N A;  2WCI A;  2DBC A;  1JFU A;  2DIZ A;  1U3I A;  3VWV A;  1YEX A;  1OKD A;  2DLX A;  2WFC A;  2H72 A;  3RPP A;  4JZQ A;  2XBI A;  1N8J A;  4KSM A;  1R5P A;  3IBH A;  1U87 A;  4MNN A;  1JZO A;  6GSY A;  1PX6 A;  5E4W A;  2HYX A;  1I5G A;  1ZCP A;  3NIV A;  3APO A;  4PQI A;  2EIR A;  1XWB A;  2FY6 A;  4DSS B;  2CVK A;  3C1S A;  4EL1 A;  1SKR B;  4Z2U A;  1WWJ A;  5B6N A;  5F07 A;  2EIO A;  3KJY A;  2CZ2 A;  3GMF A;  1TK5 B;  4NHW A;  1EEM A;  3HYP A;  3M0F A;  2AYT A;  4XRD A;  4YH2 A;  2X64 A;  3TKS A;  3D4M A;  5J47 A;  4ML6 A;  4MJB A;  4NPB A;  3HY2 A;  3ZML A;  2FD3 A;  1TRV A;  3CWG A;  1SD8 A;  2YWI A;  1EWX A;  2MMZ A;  3KMO A;  5A5H B;  3VFI A;  4F82 A;  3HJM A;  4LL1 B;  4J56 E;  3TOU A;  1K0B A;  1R7H A;  1XCC A;  1IYH A;  2F8F A;  4NMU A;  4Q5F A;  4MPF A;  2LJR A;  4G19 A;  1BX9 A;  3LQ7 A;  2H1G A;  1SL2 B;  3H93 A;  2D2Z A;  2HLS A;  1I9D A;  2B5E A;  2DKH A;  4K1F A;  1GL8 A;  2BTO T;  1JLW A;  1ACV A;  2IMK A;  1LU4 A;  2H73 A;  1SYX A;  4ECB A;  2K8V A;  4O5R A;  1RQM A;  2YV7 A;  3GH6 A;  3PPU A;  1GSS A;  4KDX A;  3UBL A;  4HS1 A;  5A1N A;  2DJK A;  2F3M A;  2BJX A;  1OYJ A;  1Q98 A;  2GST A;  5B8A A;  1LJR A;  3C7M A;  5B7C A;  1MDK A;  1BJX A;  1GUH A;  1QGV A;  2CX4 A;  3QFB C;  1A8Y A;  2M46 A;  2QA2 A;  3MNG A;  3LYP A;  4V2L A;  3HA9 A;  2IFQ A;  5CNW A;  2PU9 C;  3N9J A;  1GP1 A;  1LBK A;  2WDU A;  2WRT A;  3DRN A;  3GIX A;  2OA7 A;  1SL0 B;  2H70 A;  5IMV A;  3IK7 A;  4JU5 A;  3P7X A;  4F9Z A;  2GQL A;  2JAC A;  4DSR A;  4MF6 A;  1V98 A;  3IHQ A;  3KP8 A;  2P31 A;  3LXT A;  2H76 A;  4GRF A;  3GSS A;  1K0D A;  2HSN A;  1EZK A;  5GST A;  1PL1 A;  3O6T A;  1JLV A;  4AKG A;  4TOP A;  2YAN A;  2E0Q A;  1YZX A;  4JR4 A;  1N2A A;  1SL1 B;  4EDZ A;  3BD2 A;  3M9J A;  3UBK A;  5D96 A;  3CBU A;  1XVW A;  2GQK A;  3J7Y k;  2QC7 A;  3LW9 A;  1OE8 A;  2EFD A;  1F3A A;  3RHC A;  9GSS A;  4ZB7 A;  4K6X A;  14GS A;  5ECH B;  2GLR A;  2BMX A;  2GDR A;  2DSA A;  2H0H A;  1M9B A;  5FT3 A;  3FR9 A;  5C04 A;  4MF5 A;  3WD6 A;  2O87 A;  5DAL B;  3G7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...