4ACSA

Crystal structure of mutant gst a2-2 with enhanced catalytic efficiency with azathioprine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
219
structure length
219
Chain Sequence
KPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMIGDLSFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE A2
publication title Structure-Based Redesign of Gst A2-2 for Enhanced Catalytic Efficiency with Azathioprine.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4acsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4acsA01
3HCZA 5DBQA 3RHCA 1TK0B 2RM6A 4QQ7A 4EF0A 1BG5A 3K8NA 1ACVA 2P31A 3F4TA 2WRTA 2EIQA 2O89A 3H93A 2GTUA 5IMVA 3CMIA 4MJCA 1EGOA 4GSSA 1XIYA 1FB6A 5GSTA 3HA9A 1DSBA 5LD0A 19GSA 4G10A 3GN3A 1Z6MA 4POKA 2RIIA 5F06A 2OA7A 4X1UA 3GA4A 1PL2A 3BJ5A 4KX4A 2FLSA 6GSYA 3TKSA 2E2GA 3GFKA 1GNEA 3D4MA 3GX8A 6GSTA 2FD3A 5BMUA 3TJJA 3EINA 2H66A 4O5RA 2WS2A 4HU7A 4IQ1A 2H8LA 2VD1A 2FWGA 4G0LA 3N5OA 2HSYA 2E7PA 2F8AA 2N5BA 2ZUPA 2LUSA 4IBPA 2B1LA 5LCZA 2XPEA 3FKFA 4I8BA 4PQIA 4ACSA 3CSIA 3LEFA 3VWWA 5E59A 5G5EA 1ZL9A 5ECPB 4JE1A 1TK8B 3ZMKA 4KDXA 2IMEA 1GUKA 3HVVA 4NXIA 2DMLA 3KTLA 1K0BA 3L0HA 4I2TA 10GSA 2ZCTA 4WKWA 1FG4A 2F9SA 1R5PA 4NWYA 2HNLA 1A2MA 2A4VA 3ERGA 2H6YA 3TRXA 4HI7A 2HYXA 1KBNA 4BPYA 4MF7A 1G7EA 2OE3A 2AV4A 3IAM2 1V40A 3VWXA 1V57A 2DIYA 2RUEA 1K0CA 3H8QA 2CAIA 3QOUA 1GLPA 4XS4A 4YQVA 2GLRA 4XHMA 4ZBDA 1GNWA 1G6YA 1F37A 2IL3A 2OKAA 1XBSA 4HQSA 5HR1A 3H1NA 3F3RA 1TP9A 3F4RA 1A2LA 1QQ2A 4MP4A 2A2SA 4POMA 2V6OA 1R5AA 2H19A 2C0GA 1V9WA 3GX0A 1Z6NA 2V41A 4GRFA 4KGIA 4G0KA 2GQLA 3FRCA 1ERWA 1JFUA 3UAPA 2I1UA 3F3QA 1M7TA 3FZ9A 3IC4A 3L9SA 1GSFA 3HJPA 4MZBA 4IHUA 2LRCA 2PPTA 3OR5A 2GQMA 2YJ7A 4PX1A 3CRTA 5IM9A 1RQMA 3TJGA 1YF0A 2IIYA 5AIVA 4BA7A 1FVJA 4PQHA 2DMMA 4E8HA 1TI3A 2V32A 2ZNMA 3IBHA 3C73A 3IRAA 4D73A 1GTAA 5IMCA 2VUPA 3HJOA 1PL1A 2C3QA 3TKQA 2JZSA 1YY7A 2VLUA 5IMZA 2HSMA 3D21A 5E4WA 4AJ6A 4BVYB 3BOAA 2V1MA 5FT3A 4OCFA 4KSOA 2K8VA 4JR4A 1WPIA 3TKPA 3CTGA 3KGKA 4POLA 3ZLPA 3DEXA 4L5OA 2FHEA 3G7IA 2E2MA 3UL3A 3GL5A 2YV9A 3BCKA 3F6FA 2RLIA 1DE2A 1WOUA 4Q5QA 3AY8A 5HFGA 1C72A 5KN0A 14GSA 2BMXA 3RBTA 2ON5A 3KP9A 2FCHA 2OADA 4N0VA 3GTUA 2LNTA 2RM5A 3KMOA 1QUWA 3M8NA 4F82A 3FR3A 1H75A 2VD0A 4G9HA 4EVMA 4BVXB 4O32A 1SKRB 1YKCA 3F8UA 2GZPA 4XS6A 4FYCA 1EOGA 3ZREA 5J4UA 5AGYA 1QGVA 3LWAA 1J9BA 4MDCA 1X5CA 4IN0A 4DSSA 4WEYA 1DE1A 2H70A 4F2IA 5EVOA 5GZZB 3KTBA 2I9HA 4L0UA 4PXOA 2DLXA 2WCIA 2YWMA 5AIXA 2AYTA 3KP8A 1GRXA 1BX9A 1I9DA 1NHOA 3UVTA 3UOMA 3VI5A 2JSYA 3LYPA 3VI7A 2RUFA 3TJBA 2YWIA 4LMWA 5D93A 3APOA 4HUAA 1SK1A 3R2QA 1SYRA 2R5GA 1T7PB 4MF5A 4X0XA 2EIOA 4GTUA 2H0HA 2EC4A 2DJ2A 1O7UA 1YJ6A 4POBA 1OVNA 4HU9A 1TOFA 2LQOA 3F4SA 4O92A 4HEA2 1A2JA 1A8YA 4KCAA 3W8SA 1XVQA 4KF9A 2YPMA 4RQXA 4J2FA 1AUCA 1J0FA 2I4AA 3V1WA 2FNOA 3QAWA 4DSRA 3LQ7A 5FHIA 3DKSA 1JZOA 4USSA 2V2GA 1PD21 2H01A 1Y6EA 3A2VA 3KH9A 1M0UA 4DEJA 1OC9A 1S3AA 1K0DA 4IGJA 2J9HA 4MA9A 2HT9A 2NPBA 2TIRA 4MZCA 1ZYEA 3GHAA 3UARA 4OFNA 1U3IA 2LJKA 4OMVA 3D0ZA 2AB6A 3ZYWA 1AW9A 1AQXA 2H0IA 2B6MA 2L4QA 4MLYA 3ZIJA 3TKRA 2OE1A 2DSAA 1FAAA 3SBCA 3IE3A 2GT6A 1E6BA 4F03A 3FK8A 3JCML 3HHVA 2CVKA 2K9FA 5B8BA 1WWJA 3HKRA 1ERUA 1XWCA 4I6XA 2LEGA 3QD9A 2H0GA 3G7JA 2HRAA 3I9V2 3FW2A 2E0QA 3NZNA 1PKWA 4ECJA 1O85A 4IS0A 1GL8A 1ZCPA 2KP1A 5D73A 5A4WA 4EDZA 3SWLA 3D22A 4G19A 4I2UA 2J23A 2LSTA 2O7KA 2QKEA 4V1Ag 2P0GA 3HXSA 2VL2C 2YZHA 5ELAA 3ZMLA 1M9AA 2UZ8A 2HLSA 4XS4B 1YEPA 2MBTA 1SENA 3TCOA 4N30A 5AISA 2MMNA 1THOA 5J3RA 3E9JB 1FOVA 4XTSA 3ZL5A 1MEKA 2KUCA 1XFLA 4PGTA 4L5LA 2WGRA 3QFAC 2PBJA 5ECNB 1AIUA 2G2QA 3G7YA 5ELGA 2P5QA 4MCUA 4KH7A 2QSIA 3LXTA 4GQCA 4EC0A 2H6ZA 5DAKA 3HVXA 2P5RA 2C0EA 5HR3A 2LRTA 1OAZA 4GLTA 3IR4A 4EE0A 2X8CA 1GTUA 2H1BA 2HFDA 5KN1A 3ED3A 2M72A 1OE8A 3U6VA 2D2ZA 1EP8A 1WE0A 6GSVA 4IQAA 1GSSA 1NHYA 1JLWA 1O81A 2H1AA 3RDWA 5AN1A 2IFQA 3U5RE 3VURA 2L57A 1CQHA 1SJZA 4TXOB 2TRCP 4TR3A 3PGTA 1U3AA 3GKXA 1V58A 4D73B 2L4CA 1HYUA 1X0RA 3KEBA 2JZTA 2HSMB 2HRKA 3HVSA 1S3CA 2CV4A 4LA1A 1JZWA 5IMAA 3GUSA 2JACA 2M80A 3VK9A 1WP0A 2ALBA 1N8JA 2B5EA 5ECIB 4ML1A 4OWYA 2L6DA 3ERWA 3BD2A 4K8MA 4GSNA 4K0GA 1BEDA 1ST9A 2MZCA 3FR9A 3PPUA 4JU5A 1GTIA 2XC2A 2R4VA 6GSXA 12GSA 2LNSA 3GV1A 1CQGA 4Q5NA 3GIXA 3LFLA 4WF5A 1F3BA 3GKMA 3VPTA 4I5QA 1GSEA 4WR5A 2LKUA 3GTUB 4NV5A 3S9FA 1U6TA 1PKZA 1I5GA 2F51A 1DUGA 2OBIA 4GXZA 2WULA 1O73A 5H5RA 3LYKA 2R2JA 1G0TA 1ZOFA 5ECKB 1EV4A 5CRDA 4RI6A 2JL4A 2VL9A 1TXXA 4OO4A 5ECHB 5ID2A 2GS3A 5B6MA 4DSSB 5CNWA 3TOUA 4N11A 3CRUA 1XW9A 2VCZA 1URMA 3MSZA 2XBIA 1A0RP 2WJUA 3UMAA 2C3NA 1UA5A 2CA8A 5A5KA 4XCSA 1X9WB 3C7MA 5CAXA 2FWEA 1GUMA 3A5WA 3F0IA 2NBSA 1XCCA 5CYYA 1ILOA 3H4KA 1O8XA 3US3A 1XW5A 3DXBA 4ZIJA 4F9ZA 5L71A 2WDUA 2DJ3A 3FZ5A 3P2AA 2BJXA 2F3MA 2AHEA 1OKDA 2PGTA 4IVFA 1OYJA 1ERTA 5H5SA 4TR1A 3ME8A 1TTZA 1B4QA 3CBUA 1AAZA 4NHZA 4ZBAA 1HNAA 1K3LA 2CAQA 4BWSA 2KHPA 2XBQA 4V1Ap 3I69A 2G0FA 1EWXA 3GH6A 3BBYA 4IELA 3WYWA 1SL0B 2VL2A 3DD3A 2C4JA 4JEDA 1HNCA 4MPGA 1FVKA 1M2DA 3GL3A 2H1GA 3DIEA 4TKYA 3IC8A 1OC9B 2C1YA 1SD9A 1MTCA 1F6MC 3FHKA 3EU4A 4KB3A 3L9VA 3GKKA 2GT5A 2FGXA 3VFIA 3QMXA 1UN2A 5EPFA 2N5FA 2H75A 3A3TA 4MJBA 5IIZA 3IOSA 1K0AA 1Z7PA 3QR6A 2GQKA 2PMTA 4TR0A 3EE2A 5D9TA 2H72A 3TOTA 4EDYA 2VCVA 4TOPA 3TGZA 2R3XA 1EZKA 1TRWA 1KTEA 4ZL8A 5J9BA 3IK9A 2LTKA 1VF4A 3ZRDA 4WR4A 1RW1A 13GSA 3I6AA 1T8EB 1XWBA 1B9XC 1ZMAA 1YEXA 1T1VA 3EMPA 4MK3A 4V2LA 1UC7A 2N5AA 1HQOA 2VCXA 4N10A 3TRQA 2BTOT 1EOHA 1TRSA 5IOWA 2LQQA 1PX7A 4GSTA 3O76A 4MJAA 4G0IA 2VLVA 5IPHA 3DGQA 1MD4A 3LXZA 1WRYA 6GSWA 5HR0A 2NDOA 3ISOA 1TRUA 1OC8A 1IYIA 2B1KA 1X9SB 3RPPA 3HD5A 2H1DA 2R6KA 3MAKA 1IYHA 5DCGA 1M2AA 2C3TA 3GH9A 5D8IA 2PERA 3O3TA 3Q19A 2YOIA 1NW2A 1YDKA 3ZFBA 1XXUA 2HZEA 2DBCA 3IXRA 3LG6A 2H74A 3M1GA 5KN2A 4HS1A 4TN8A 5ECOB 2NTOA 3FYGA 1GTBA 1PN9A 3IK7A 1HNBA 4L0WA 5DAKB 4E8EA 4PUAA 4OD7A 3EVIA 3MDKA 3PR8A 3E3EA 1JZRA 5D9XA 1PMTA 3NOFA 1O8WA 1GUHA 4ZL9A 2H76A 3PH9A 3ZITA 4ECIA 2IFQB 2QGVA 4FQUA 5KN3A 1VRSD 3EMXA 1T4YA 4Q5RA 2K18A 4LLRA 5D96A 5GAPD 2MMZA 2IN3A 2GSTA 3J7Yb 4Q5FA 1QXHA 3R3EA 2L5OA 2WFCA 4V2NA 4KNDA 4JR6A 1JHBA 1SKWB 1EV9A 2M46A 4NPBA 2HRKB 1FB0A 4K7IA 3GYKA 3TUEA 5F07A 3ZIVA 4TRXA 5G2ZA 3KZQA 4HDEA 2X64A 3C1SA 5C00A 4RQRA 3RAZA 11GSA 4CHSA 4FIWA 3EWLA 5J5NA 3UIWA 4I97A 2VIMA 4YQUA 3DMLA 1B48A 2XHFA 1U87A 4OFMA 3FZAA 1PA3A 1X5DA 1XZOA 2LS5A 3ZFLA 1NM3A 3CSJA 2YWNA 2O85A 2FWHA 4CDOA 3WGEA 1TK5B 2FY6A 3IV4A 2DJ1A 4KDUA 2HE3A 20GSA 5A4UA 5KEJA 3HZ8A 3WGXA 3EURA 2AJQB 3FR6A 4KA0A 1EGRA 1M99A 4KDYA 16GSA 4MH3A 1R26A 1TDIA 1YF1A 1GWCA 3M9KA 1V2AA 3P7XA 5G1KA 4KW6A 3BCIA 2MMOA 1W4VA 5LNKe 4LMVA 2B5YA 2VCWA 5ID2B 3EC3A 1KEBA 1T4ZA 1OE7A 2LV3A 4ULXA 3GSTA 2B3SA 2V6KA 2JSZA 4GCIA 1RK4A 3IAS2 5F8BA 1W89A 2HXKA 3D4TA 2YP6A 2HI7A 3APQA 5CRWA 3QAVA 3C71A 4WBJA 1SL1B 2AAWA 3WD6A 1QK8A 4F0BA 4MPFA 5ECLB 3ZVJD 5ABRA 4AGSA 4YAPA 5HQPA 3P90A 1K0NA 3Q18A 5IMFA 2HRFA 1F2EA 3A2WA 3QCPA 2X8GA 2CZ2A 3LORA 3MNGA 1QMVA 1ZGNA 4V2MA 3M0FA 1XWAA 2CVDA 2REMA 1K0OA 4HZ2A 4JZQA 4TR1B 3GKNA 1GLQA 1AC1A 4IJIA 2K8SA 5IMDA 1TKDB 2HQTA 2R37A 4KSMA 2FA4A 4GWRA 2PWJA 1XOAA 1F9MA 5C04A 2CT6A 4EL1A 17GSA 5ENUA 2O8VB 3CYNA 1Z7RA 5D9WA 4N0ZA 1MDJA 4ZL7A 2YCDA 1SJ6A 4TW5A 2ES7A 5DDLA 3M3MA 5DCHA 4FO5A 3LSZA 5DJLA 3D5JA 2FUG2 3IDVA 2GSRA 2CZ3A 6GSUA 2VCQA 2FWFA 1YQ1A 1XPVA 5B8AA 3ZZXA 4IW9A 2IWTA 4TXVA 5EL8A 2KOKA 2QC7A 5JWQB 2PN8A 2VLTA 1K3YA 1G6WA 4NHWA 2XPDA 2IJYA 3CXGA 3GRXA 4NV2A 1M9BA 4ZB6A 4BL7A 2JU5A 1R4WA 4ML6A 1QFNA 2C8UA 2VL3A 5COHA 5GSSA 4WF4A 1BAYA 4IKHA 1SK0A 4X43A 4Z7XA 3HDCA 4JRRA 4PURA 4K1FA 3M9JA 2DIZA 1UVZA 2O87A 2NVLA 1GULA 4J57E 2JZRA 5A4VA 2DJKA 2PUKC 3G9BA 2VCTA 4PQ1A 5G31A 1GSDA 1Z3EA 1A8LA 1EEMA 5D9VA 5ECQB 2VAFA 5INYA 4DSQA 2HZFA 5F05A 3KM6A 4EXJA 4IP1A 3HY2A 3UVHA 5DALA 1A23A 2ON7A 2EIRA 6GSSA 3KH7A 2GDRA 3LGCA 5CP1A 1FW1A 3NIVA 1VGLA 2H71A 1FHEA 1XVWA 3KD0A 2KP2A 1SK2A 4EUYA 2HZEB 2F8FA 4CW9A 5H5QA 1WMJA 2OBKA 3MWHA 4PUFC 1XWGA 4MABA 2VM2A 1FO5A 3J7Yk 2CX3A 3DVWA 1PX6A 1YKAA 4ECBA 1THXA 1PQNA 4XRAA 1GSYA 3IA1A 3UEMA 1YZXA 1SKSB 1Q98A 2IMKA 2VO4A 2JADA 2VOCA 3CSHA 1DBYA 3QPMA 4G2EA 2KLXA 1Z9HA 1OC3A 3Q74A 4HZ4A 2B7KA 3DYRA 3VWVA 2YV7A 4MZWA 2DJ0A 1AQWA 5JWOB 18GSA 3FY7A 4OCEA 3HYPA 5HR2A 4QL7A 1B9YC 8GSSA 5JCUA 1O6JA 1R7HA 3KJYA 3W8JA 1GP1A 3DVXA 3QAGA 1SD8A 4XIHA 4KCEA 1TW9A 4O7HA 2LJAA 4GQFA 2MYGA 4TXOA 4ILFA 2HSHA 3N9JA 4FYBA 2PU9C 3KMNA 2B5XA 4ISDA 1SL2B 4HOJA 1MDIA 3QDNA 2OJLA 1ABAA 1U88A 4J56E 1ZZYA 4IJ3A 5ECSA 3KIJA 1LBKA 1X5EA 3WT2A 4PTSA 2L6CA 2IPAA 3GSSA 1PSQA 4ZILA 3IHQA 1OKTA 1VF2A 4NMUA 1VF1A 4LL1B 1ZYQB 1JLVA 2HRNA 1A24A 2GZYA 2GGTA 3CTFA 1ML6A 3DRNA 3RHBA 5GAND 3ZVJA 2CX4A 1T3BA 4ZB8A 2I81A 1NSWA 3ME7A 1TRVA 5JCWA 3Q6OA 1T00A 2H73A 3H79A 5DQSA 2YANA 4RUVA 5CREA 3RPNA 2YNXA 3GURA 1MDKA 3L4NA 5DVBA 1TI1A 5J9CA 3WT1A 2YN1A 2LRNA 5ECRB 2YJHA 1J08A 4ID0A 3W6GA 3TKSE 4HJ2A 3WGDA 5FWGA 2FA8A 4F0CA 5IOXA 5G30A 3F63A 1K3OA 4K6XA 3C1RA 4AJ7A 2HSNB 4NAXA 1TJDA 3KCMA 4ZXGA 2IMDA 3FZ4A 1K0MA 4K9ZA 1N2AA 4QL9A 3TKSC 4K7NA 5ECMB 1GSQA 1G7OA 3PINA 1SJIA 4KAEA 5IQYA 3APSA 2B7JA 4XRDA 4FYUA 5G1LA 4AF2A 2DJJA 4TR4A 22GSA 3LJRA 5CRGA 1SU9A 1GH2A 1TU7A 1Z5YE 3UJ1A 3C8EA 7GSSA 4K7OA 2OE0A 2GSQA 3GMFA 1HD2A 4WETA 1AXDA 2L5LA 1EEJA 2YZUA 1SYXA 4ZBBA 4WXTA 3VLNA 3L9UA 3F6DA 2H6XA 2TRXA 3VPQA 2C0FA 1XWKA 1TU8A 5B7CA 4IP6A 3TJKA 1V98A 5CO3A 2VM1A 3L78A 1F3AA 3HZ4A 4MF6A 5JCGA 4OFTA 2A2RA 2I3YA 3TB2A 3O6TA 3VWUA 1BYEA 5JWRB 4EO3A 4DVCA 2OACA 5HFKA 4GF0A 2WB9A 2MMAA 2YWOA 4KE3A 5IPGA 4PNFA 5DJMA 4BVYA 2CVBA 1Y25A 4YH2A 4HQZA 1KNGA 5J41A 4BL7B 1M2BA 4H86A 2C0DA 3TRPA 4L8EA 2X99A 2L59A 3UBKA 2X8HA 5CRHA 1ERVA 4YAVA 4MH2A 3ZTLA 4RI7A 4KUNA 5IO2A 2DC5A 3TDGA 1ON4A 1BJXA 4K2DA 4LL4B 9GSSA 1LU4A 1JZDA 4AJ8A 1WIKA 1MD3A 2WZ9A 1B8XA 4TVEA 4K0NA 3F9UA 1USBA 2CQ9A 4FH8A 1S3DA 4YQMA 1EP7A 5G5FA 3A2XA 3EYTA 2H30A 3QFBC 5B6NA 4BWQA 5DALB 1X9MB 3KXOA 3I43A 5F0GA 1E2YA 4P3YB 2PVQA 5HFIA 1VF3A 1WJKA 3ERFA 1Q4JA 4MJEA 4MMMA 3FEUA 1H4OA 4BVXA 1AQVA 3TJFA 2PVOC 3EU3A 3D6IA 1BQ7A 3HJMA 1PRXA 4JBBA 3P8WA 1XW6A 1B4PA 3IPZA 4ECCA 2GZZA 4HJMA 1LJRA 2GSSA 4ZB9A 4EKZA 5EY6A 4XS1A 2C80A 4OO5A 2MBSA 5IO0A 3E0UA 1PGTA 4PNGA 3GNJA 3DWVA 3UBLA 2IMFA 1A0FA 1XOBA 2K6VA 2LJRA 2Z9SA 4WBRD 2GVPA 2IMIA 2AUVA 5DQYA 1GSUA
chains in the Genus database with same CATH superfamily
3HCZA 5DBQA 3RHCA 1TK0B 2RM6A 4QQ7A 4EF0A 1BG5A 3K8NA 1ACVA 2P31A 3F4TA 2WRTA 2EIQA 2O89A 3H93A 2GTUA 5IMVA 3CMIA 4MJCA 1EGOA 4GSSA 1XIYA 1FB6A 5GSTA 3HA9A 1DSBA 5LD0A 19GSA 4G10A 3GN3A 1Z6MA 4POKA 2RIIA 5F06A 2OA7A 4X1UA 3GA4A 1PL2A 3BJ5A 4KX4A 2FLSA 6GSYA 3TKSA 2E2GA 3GFKA 1GNEA 3D4MA 2O36A 3GX8A 6GSTA 2FD3A 5BMUA 3TJJA 3EINA 2H66A 4O5RA 2WS2A 4HU7A 4IQ1A 2H8LA 2VD1A 2FWGA 4G0LA 3N5OA 2HSYA 2E7PA 2F8AA 2N5BA 2ZUPA 4K5SA 2R0PA 2LUSA 4IBPA 2B1LA 5LCZA 2XPEA 3FKFA 4I8BA 4PQIA 4ACSA 3CSIA 3LEFA 4PI0C 3VWWA 5E59A 5G5EA 1ZL9A 5ECPB 4JE1A 1TK8B 3ZMKA 4KDXA 2IMEA 1GUKA 3HVVA 4NXIA 2DMLA 3KTLA 1K0BA 3L0HA 4I2TA 10GSA 2ZCTA 4WKWA 1FG4A 4AI6A 2F9SA 1R5PA 4NWYA 1YVLA 2HNLA 1A2MA 2A4VA 3ERGA 2H6YA 3TRXA 4HI7A 2HYXA 1KBNA 4BPYA 4MF7A 1G7EA 2OE3A 2AV4A 3IAM2 1V40A 3VWXA 1V57A 2DIYA 2RUEA 1K0CA 3H8QA 2CAIA 3QOUA 1GLPA 4XS4A 4YQVA 2GLRA 4XHMA 4ZBDA 1GNWA 4GDFA 1G6YA 1F37A 2IL3A 2OKAA 1XBSA 4HQSA 5HR1A 3H1NA 3F3RA 1TP9A 3F4RA 1A2LA 1QQ2A 4BIKA 4MP4A 2A2SA 4POMA 2V6OA 1R5AA 2H19A 2C0GA 1V9WA 3GX0A 1Z6NA 2V41A 4GRFA 4KGIA 4G0KA 2GQLA 2OT3A 3FRCA 1ERWA 1JFUA 3UAPA 2I1UA 3F3QA 1M7TA 3FZ9A 3IC4A 3L9SA 1GSFA 3HJPA 4MZBA 4IHUA 3CQFA 2LRCA 2PPTA 3OR5A 2GQMA 2YJ7A 4PX1A 3CRTA 5IM9A 1RQMA 3TJGA 1S3RA 1YF0A 5A1NA 2IIYA 5AIVA 4BA7A 1FVJA 4PQHA 2DMMA 4E8HA 1TI3A 2V32A 2ZNMA 3IBHA 3HMJG 3C73A 3IRAA 4D73A 1GTAA 5IMCA 2VUPA 3HJOA 1PL1A 2C3QA 3TKQA 2JZSA 1YY7A 2VLUA 5IMZA 2HSMA 3D21A 5E4WA 4AJ6A 4BVYB 3BOAA 2V1MA 5FT3A 4OCFA 4KSOA 2K8VA 4JR4A 1WPIA 3TKPA 3CTGA 3KGKA 4POLA 3ZLPA 3DEXA 4L5OA 2FHEA 3G7IA 2E2MA 3UL3A 1SVMA 3GL5A 2YV9A 3BCKA 3F6FA 2RLIA 2QA2A 1DE2A 1WOUA 4Q5QA 3AY8A 5HFGA 1C72A 5KN0A 14GSA 2BMXA 3RBTA 2ON5A 3KP9A 2FCHA 2OADA 4N0VA 3GTUA 2LNTA 2RM5A 3KMOA 1QUWA 3M8NA 4F82A 3FR3A 1H75A 2VD0A 4G9HA 4EVMA 4BVXB 4O32A 1SKRB 1YKCA 3F8UA 2GZPA 4XS6A 4FYCA 1EOGA 3ZREA 5J4UA 4O5QA 5AGYA 1QGVA 1J9BA 3LWAA 4MDCA 1X5CA 4IN0A 4DSSA 4PHZC 4WEYA 1DE1A 2H70A 4F2IA 5EVOA 5GZZB 3KTBA 2O5VA 2QA1A 2I9HA 4L0UA 4PXOA 2DLXA 2WCIA 2YWMA 5AIXA 2AYTA 3KP8A 1GRXA 1BX9A 1I9DA 1NHOA 3UVTA 3UOMA 3VI5A 2JSYA 4YKFA 3LYPA 3VI7A 2RUFA 3TJBA 2YWIA 4LMWA 5D93A 3APOA 4HUAA 1SK1A 3R2QA 1SYRA 2R5GA 1T7PB 4MF5A 4X0XA 2EIOA 4GTUA 2H0HA 2EC4A 2DJ2A 1O7UA 1YJ6A 4POBA 1OVNA 5A34B 4Z2TA 4HU9A 1TOFA 2LQOA 3F4SA 4O92A 4HEA2 1A2JA 1A8YA 4KCAA 3W8SA 1XVQA 4KF9A 2YPMA 4RQXA 4J2FA 1AUCA 1J0FA 2I4AA 3V1WA 2FNOA 3QAWA 4DSRA 3LQ7A 5FHIA 3DKSA 1JZOA 4USSA 2V2GA 1PD21 2H01A 1Y6EA 3A2VA 3KH9A 1M0UA 4DEJA 1OC9A 1S3AA 1K0DA 4IGJA 2J9HA 4MA9A 2HT9A 2NPBA 2TIRA 5BMUB 4MZCA 1ZYEA 3GHAA 3UARA 4OFNA 1U3IA 2LJKA 4OMVA 3D0ZA 2AB6A 3ZYWA 1AW9A 4EIQA 1AQXA 2H0IA 2B6MA 2L4QA 4MLYA 3ZIJA 4Z2RA 3TKRA 2OE1A 2DSAA 1FAAA 3SBCA 3IE3A 2GT6A 1E6BA 4F03A 3FK8A 3JCML 3HHVA 2CVKA 2K9FA 5B8BA 1WWJA 3HKRA 1ERUA 1XWCA 5J4YA 4I6XA 2LEGA 3QD9A 2H0GA 3G7JA 2HRAA 3I9V2 3FW2A 2E0QA 3NZNA 1PKWA 4ECJA 1O85A 4IS0A 1Y1UA 2WVZA 4MNNA 1GL8A 1ZCPA 2KP1A 5D73A 5A4WA 4EDZA 3SWLA 3D22A 4G19A 2J23A 2LSTA 2O7KA 2QKEA 4I2UA 4V1Ag 2P0GA 3HXSA 2VL2C 2YZHA 5ELAA 3ZMLA 1M9AA 2UZ8A 2HLSA 4XS4B 1YEPA 2MBTA 1SENA 3TCOA 4N30A 5AISA 2MMNA 1THOA 5J3RA 1M3IA 3E9JB 1FOVA 4XTSA 3ZL5A 1MEKA 2KUCA 1XFLA 4PGTA 4L5LA 2WGRA 3QFAC 2PBJA 5ECNB 1AIUA 2G2QA 3G7YA 5ELGA 2P5QA 4MCUA 4KH7A 2QSIA 2WW0A 3LXTA 4GQCA 4EC0A 2H6ZA 5DAKA 3HVXA 2P5RA 2C0EA 5HR3A 2LRTA 1OAZA 4GLTA 3IR4A 4EE0A 2X8CA 1GTUA 2H1BA 2HFDA 5KN1A 3ED3A 2M72A 1OE8A 3U6VA 2D2ZA 1EP8A 1WE0A 6GSVA 4IQAA 1GSSA 1NHYA 1JLWA 1O81A 2H1AA 3RDWA 5AN1A 2IFQA 1PN0A 3VURA 2L57A 3U5RE 1CQHA 1SJZA 4TXOB 2TRCP 4TR3A 3PGTA 1U3AA 3GKXA 1V58A 4D73B 2L4CA 1HYUA 1X0RA 3KEBA 2JZTA 2HSMB 2HRKA 3HVSA 1S3CA 2CV4A 4LA1A 1JZWA 5IMAA 3GUSA 2JACA 2M80A 3VK9A 1WP0A 2ALBA 5A5HA 2R0GA 1FOHA 1N8JA 2B5EA 5ECIB 4ML1A 4OWYA 2L6DA 3ERWA 3BD2A 4K8MA 4GSNA 4K0GA 1BEDA 1ST9A 2MZCA 4X4JA 2WZSA 3FR9A 3PPUA 4JU5A 1GTIA 2XC2A 2R4VA 6GSXA 12GSA 2LNSA 3GV1A 1CQGA 4Q5NA 3GIXA 3LFLA 4WF5A 1PFOA 1F3BA 3GKMA 3VPTA 4I5QA 1GSEA 4WR5A 2LKUA 3GTUB 4NV5A 3S9FA 1U6TA 1PKZA 1I5GA 2F51A 1DUGA 2OBIA 4GXZA 2WULA 1O73A 5H5RA 3LYKA 2R2JA 1G0TA 1ZOFA 5ECKB 1EV4A 5CRDA 4RI6A 2JL4A 2VL9A 1TXXA 4OO4A 5ECHB 5ID2A 1TXUA 2GS3A 5B6MA 5J4VA 4DSSB 5CNWA 3TOUA 4N11A 3CRUA 1XW9A 2VCZA 1URMA 3MSZA 2XBIA 1A0RP 2WJUA 3UMAA 2C3NA 1UA5A 2CA8A 5A5KA 4XCSA 1X9WB 3C7MA 5CAXA 2FWEA 1GUMA 3A5WA 3F0IA 2NBSA 1XCCA 5CYYA 1ILOA 3H4KA 1O8XA 3US3A 1XW5A 3DXBA 4ZIJA 4F9ZA 5L71A 2WDUA 2DJ3A 3FZ5A 3P2AA 2BJXA 2F3MA 2AHEA 1OKDA 2PGTA 4IVFA 1OYJA 1ERTA 5H5SA 4TR1A 3ME8A 1S4BP 1TTZA 1B4QA 3CBUA 1AAZA 4NHZA 4ZBAA 1HNAA 1K3LA 2CAQA 4BWSA 2KHPA 2XBQA 4V1Ap 3I69A 2G0FA 1EWXA 3MIXA 3GH6A 3BBYA 4IELA 4AKHA 3WYWA 1SL0B 2VL2A 3DD3A 2C4JA 4JEDA 1HNCA 4MPGA 1FVKA 1M2DA 3GL3A 2H1GA 3DIEA 4TKYA 3IC8A 1OC9B 2C1YA 1SD9A 1MTCA 1F6MC 3FHKA 3EU4A 4KB3A 3L9VA 3CHXC 3GKKA 2GT5A 2FGXA 3VFIA 3QMXA 1UN2A 5EPFA 2N5FA 2H75A 3A3TA 4MJBA 5IIZA 3IOSA 1K0AA 1Z7PA 3QR6A 2GQKA 2PMTA 4TR0A 3EE2A 4A5PA 5D9TA 2H72A 3TOTA 4EDYA 2VCVA 4TOPA 3TGZA 2R3XA 1EZKA 1TRWA 1N25A 1KTEA 3RFRC 4ZL8A 5J9BA 3IK9A 2LTKA 1VF4A 3ZRDA 4WR4A 1RW1A 13GSA 3I6AA 1T8EB 1XWBA 1B9XC 1ZMAA 1YEXA 1T1VA 3EMPA 4MK3A 4V2LA 1UC7A 1ZYPA 2N5AA 1HQOA 2VCXA 4N10A 3TRQA 2BTOT 1EOHA 1TRSA 5IOWA 2LQQA 1PX7A 4GSTA 3O76A 4ICYA 4MJAA 4G0IA 2VLVA 5IPHA 3DGQA 1MD4A 3LXZA 1WRYA 6GSWA 5HR0A 2NDOA 3ISOA 1TRUA 1OC8A 1IYIA 2B1KA 1X9SB 3RPPA 3HD5A 2H1DA 2R6KA 3MAKA 1IYHA 5DCGA 1M2AA 2A4HA 2C3TA 3GH9A 5D8IA 2PERA 3O3TA 3Q19A 2YOIA 1NW2A 1YDKA 3ZFBA 1XXUA 2HZEA 2DBCA 3IXRA 3LG6A 2H74A 3M1GA 4K2XA 4PI2C 3EPTA 5KN2A 4HS1A 4TN8A 5ECOB 2NTOA 3FYGA 1GTBA 1PN9A 3IK7A 1HNBA 4L0WA 5DAKB 4E8EA 4PUAA 4OD7A 3EVIA 3MDKA 3PR8A 3E3EA 1JZRA 5D9XA 1PMTA 3NOFA 1O8WA 1GUHA 4ZL9A 2H76A 5BRTA 2WVXA 3PH9A 3ZITA 4ECIA 2IFQB 2QGVA 4FQUA 5KN3A 1VRSD 3EMXA 1T4YA 4Q5RA 2K18A 4LLRA 5D96A 5GAPD 2MMZA 2IN3A 4CY8A 2GSTA 3J7Yb 4Q5FA 1QXHA 3R3EA 2L5OA 2WFCA 4V2NA 2VKZG 4KNDA 4JR6A 1JHBA 1SKWB 1EV9A 2M46A 4NPBA 2HRKB 1FB0A 4K7IA 3GYKA 5A5HB 3TUEA 5F07A 3ZIVA 4TRXA 5G2ZA 3KZQA 4HDEA 2X64A 3C1SA 5C00A 4RQRA 3RAZA 11GSA 4CHSA 4FIWA 3EWLA 5J5NA 3UIWA 4I97A 2VIMA 4YQUA 3DMLA 1B48A 2XHFA 1U87A 4OFMA 1BG1A 3FZAA 1PA3A 1X5DA 1XZOA 2LS5A 3ZFLA 4AKGA 1NM3A 3CSJA 2YWNA 2O85A 3HVNA 2FWHA 4EIPA 4CDOA 3WGEA 1TK5B 2FY6A 3IV4A 2DJ1A 4KDUA 2HE3A 20GSA 5A4UA 5KEJA 3HZ8A 3WGXA 3EURA 2AJQB 3FR6A 4KA0A 1EGRA 1M99A 4KDYA 16GSA 4MH3A 1R26A 1TDIA 1YF1A 1GWCA 3M9KA 1V2AA 3P7XA 5G1KA 4KW6A 3BCIA 2MMOA 1W4VA 5LNKe 4LMVA 2B5YA 2VCWA 5ID2B 3EC3A 1KEBA 1T4ZA 1OE7A 3CWGA 2LV3A 4ULXA 3GSTA 2B3SA 2V6KA 2JSZA 4GCIA 1RK4A 3IAS2 4ZB7A 5F8BA 1W89A 2HXKA 3D4TA 2YP6A 2HI7A 5J40A 3APQA 1I1IP 5CRWA 3QAVA 3C71A 4AKIA 4WBJA 1SL1B 2HSNA 2AAWA 4FXYP 3WD6A 1QK8A 4F0BA 4MPFA 5ECLB 2UV8G 3ZVJD 5ABRA 4YKGA 4AGSA 4YAPA 5HQPA 3P90A 1K0NA 3Q18A 5IMFA 2HRFA 1F2EA 3A2WA 3QCPA 2X8GA 2CZ2A 1XG8A 3LORA 5KOXA 3MNGA 1QMVA 1ZGNA 4V2MA 3M0FA 1XWAA 2CVDA 2REMA 1K0OA 4HZ2A 4JZQA 4TR1B 3GKNA 1GLQA 1AC1A 4IJIA 2K8SA 5IMDA 1TKDB 2HQTA 2R37A 4KSMA 2FA4A 2DKHA 4GWRA 2PWJA 1XOAA 1F9MA 5A1NB 5C04A 2CT6A 4EL1A 17GSA 5ENUA 2O8VB 3CYNA 1Z7RA 5D9WA 4N0ZA 2X4AA 1MDJA 4ZL7A 2YCDA 1SJ6A 4TW5A 2ES7A 5DDLA 3M3MA 5DCHA 4FO5A 3LSZA 5DJLA 3D5JA 1YEWC 2FUG2 3IDVA 2GSRA 2CZ3A 6GSUA 2VCQA 2FWFA 1YQ1A 1XPVA 5B8AA 3ZZXA 4IW9A 2IWTA 1M3JA 4TXVA 2WW1A 5EL8A 2KOKA 2QC7A 5JWQB 2PN8A 2EFCA 2VLTA 1K3YA 2H1LA 1G6WA 4NHWA 2XPDA 2IJYA 3CXGA 3GRXA 4NV2A 1M9BA 4ZB6A 4BL7A 2JU5A 1R4WA 4ML6A 1QFNA 2C8UA 2VL3A 5COHA 5GSSA 4WF4A 1BAYA 4IKHA 1SK0A 4X43A 4Z7XA 3HDCA 4JRRA 4PURA 4K1FA 3M9JA 2DIZA 1UVZA 2O87A 2NVLA 1GULA 4J57E 2JZRA 5A4VA 2DJKA 2PUKC 3G9BA 2VCTA 4PQ1A 5G31A 1GSDA 1Z3EA 1A8LA 1EEMA 5D9VA 5ECQB 2VAFA 5INYA 4DSQA 2HZFA 5F05A 2O3EA 3KM6A 4EXJA 4IP1A 3HY2A 3UVHA 5DALA 1A23A 2ON7A 2EIRA 6GSSA 3KH7A 2GDRA 3LGCA 5CP1A 1FW1A 3NIVA 1VGLA 2H71A 1FHEA 1XVWA 4CY6A 3KD0A 2KP2A 1SK2A 4EUYA 2HZEB 2F8FA 4CW9A 5H5QA 1WMJA 2OBKA 3MWHA 4PUFC 1XWGA 4MABA 2VM2A 1FO5A 3J7Yk 4AKXB 2CX3A 3DVWA 3MYDA 1PX6A 1YKAA 4ECBA 1THXA 1PQNA 4XRAA 1GSYA 3IA1A 3UEMA 1YZXA 1SKSB 2DKIA 1Q98A 2IMKA 2VO4A 2JADA 2VOCA 4W66A 3CSHA 1DBYA 3QPMA 4G2EA 5J47A 2KLXA 3A5IA 1Z9HA 1OC3A 3Q74A 4HZ4A 2WVXB 2B7KA 3DYRA 3VWVA 2YV7A 4MZWA 2DJ0A 1AQWA 5JWOB 18GSA 3FY7A 4OCEA 3HYPA 5HR2A 2EFEA 4QL7A 1B9YC 8GSSA 5JCUA 1O6JA 1R7HA 3KJYA 3W8JA 1GP1A 4QMKA 3QAGA 1SD8A 3DVXA 2EFDA 4XIHA 4KCEA 1TW9A 4O7HA 2LJAA 4GQFA 2MYGA 4TXOA 4ILFA 3RGBC 2HSHA 3N9JA 4FYBA 2PU9C 3KMNA 2B5XA 5KOWA 4ISDA 1SL2B 4HOJA 1MDIA 3QDNA 2OJLA 1ABAA 1U88A 4J56E 1ZZYA 4IJ3A 5ECSA 3KIJA 1LBKA 1X5EA 3WT2A 4PTSA 2L6CA 2IPAA 3GSSA 2A2PA 1PSQA 4ZILA 3IHQA 1OKTA 1VF2A 4NMUA 1VF1A 4LL1B 1ZYQB 1JLVA 2HRNA 1A24A 2GZYA 2GGTA 3CTFA 1ML6A 3DRNA 3RHBA 5GAND 3ZVJA 2CX4A 1T3BA 4ZB8A 2I81A 1NSWA 3ME7A 1TRVA 5JCWA 3Q6OA 1BF5A 1T00A 2H73A 3H79A 5DQSA 2YANA 4RUVA 5CREA 3RPNA 2YNXA 3GURA 1MDKA 3L4NA 5DVBA 1TI1A 5J9CA 3WT1A 2YN1A 2LRNA 5ECRB 2YJHA 1J08A 4ID0A 3W6GA 3TKSE 4HJ2A 3WGDA 5FWGA 2FA8A 4F0CA 5IOXA 5G30A 3F63A 1K3OA 4K6XA 3C1RA 4AJ7A 2HSNB 4NAXA 1TJDA 3KCMA 3LW9A 4ZXGA 2IMDA 3TU3B 3FZ4A 1K0MA 2WW2A 4K9ZA 1N2AA 4O5UA 4QL9A 3TKSC 4K7NA 5ECMB 1GSQA 1G7OA 3PINA 1SJIA 4KAEA 5IQYA 3APSA 4E68A 2B7JA 4XRDA 4FYUA 5G1LA 4AF2A 2DJJA 4TR4A 1SVLA 22GSA 3LJRA 5CRGA 1SU9A 1GH2A 1TU7A 1Z5YE 3UJ1A 3C8EA 7GSSA 4K7OA 2OE0A 3FMWA 2GSQA 3GMFA 1HD2A 4WETA 1AXDA 2L5LA 1EEJA 2YZUA 1SYXA 4ZBBA 4WXTA 3VLNA 3L9UA 3F6DA 2H6XA 3IHGA 2TRXA 3VPQA 2C0FA 1XWKA 1TU8A 5B7CA 4IP6A 3TJKA 1V98A 5CO3A 2VM1A 3L78A 1F3AA 3HZ4A 4MF6A 5JCGA 4OFTA 2A2RA 2I3YA 3TB2A 3O6TA 3VWUA 1BYEA 5JWRB 4EO3A 4DVCA 2OACA 5HFKA 4GF0A 2WB9A 2MMAA 2YWOA 4KE3A 5IPGA 4PNFA 5DJMA 4BVYA 2CVBA 1Y25A 4YH2A 4HQZA 1KNGA 2X49A 5J41A 4BL7B 1M2BA 4H86A 2C0DA 3TRPA 4L8EA 4G01A 2X99A 2L59A 3UBKA 2X8HA 5CRHA 1ERVA 4YAVA 4MH2A 3ZTLA 4RI7A 4KUNA 5IO2A 2DC5A 3TDGA 1ON4A 1BJXA 4K2DA 4LL4B 9GSSA 1LU4A 1JZDA 4AJ8A 1WIKA 1MD3A 2WVYA 2WZ9A 1B8XA 4TVEA 4K0NA 3F9UA 1USBA 2CQ9A 4FH8A 1S3DA 4YQMA 1EP7A 5G5FA 3A2XA 3EYTA 2H30A 3QFBC 5B6NA 4BWQA 5DALB 1X9MB 3KXOA 3I43A 2EFHA 5F0GA 1E2YA 4HSCX 4P3YB 2PVQA 5HFIA 1VF3A 1WJKA 3ERFA 1Q4JA 4MJEA 4MMMA 3FEUA 1H4OA 4BVXA 4N3ZA 1AQVA 3TJFA 1SVOA 2R0CA 4K5RA 2PVOC 3EU3A 3D6IA 1BQ7A 3HJMA 1PRXA 4JBBA 3P8WA 1XW6A 1B4PA 3IPZA 4Z2UA 4ECCA 2GZZA 4HJMA 1LJRA 2GSSA 4ZB9A 4EKZA 5EY6A 4XS1A 2C80A 4OO5A 2MBSA 5IO0A 3E0UA 1PGTA 4PNGA 3GNJA 3DWVA 3UBLA 2IMFA 1A0FA 1XOBA 2K6VA 2LJRA 2Z9SA 4WBRD 2GVPA 2IMIA 2AUVA 2WW3A 5DQYA 1ZYNA 1GSUA 5A34A
chains in the Genus database with same CATH topology
3HCZA 5DBQA 3RHCA 1TK0B 2RM6A 4QQ7A 4EF0A 1BG5A 3K8NA 1ACVA 2P31A 3F4TA 2WRTA 2EIQA 2O89A 3H93A 2GTUA 5IMVA 3CMIA 4MJCA 1EGOA 4GSSA 1XIYA 1FB6A 5GSTA 3HA9A 1DSBA 5LD0A 19GSA 4G10A 3GN3A 1Z6MA 4POKA 2RIIA 5F06A 2OA7A 4X1UA 3GA4A 1PL2A 3BJ5A 4KX4A 2FLSA 6GSYA 3TKSA 2E2GA 3GFKA 1GNEA 3D4MA 3GX8A 6GSTA 2FD3A 5BMUA 3TJJA 3EINA 2H66A 4O5RA 2WS2A 4HU7A 4IQ1A 2H8LA 2VD1A 2FWGA 4G0LA 3N5OA 2HSYA 2E7PA 2F8AA 2N5BA 2ZUPA 4K5SA 2R0PA 2LUSA 4IBPA 2B1LA 5LCZA 2XPEA 3FKFA 4I8BA 4PQIA 4ACSA 3CSIA 3LEFA 3VWWA 5E59A 5G5EA 1ZL9A 5ECPB 4JE1A 1TK8B 3ZMKA 4KDXA 2IMEA 1GUKA 3HVVA 4NXIA 2DMLA 3KTLA 1K0BA 3L0HA 4I2TA 10GSA 2ZCTA 4WKWA 1FG4A 4AI6A 2F9SA 1R5PA 4NWYA 1YVLA 2HNLA 1A2MA 2A4VA 3ERGA 2H6YA 3TRXA 4HI7A 2HYXA 1KBNA 4BPYA 4MF7A 1G7EA 2OE3A 2AV4A 3IAM2 1V40A 3VWXA 1V57A 2DIYA 2RUEA 1K0CA 3H8QA 2CAIA 3QOUA 1GLPA 4XS4A 4YQVA 2GLRA 4XHMA 4ZBDA 1GNWA 4GDFA 1G6YA 1F37A 2IL3A 2OKAA 1XBSA 4HQSA 5HR1A 3H1NA 3F3RA 1TP9A 3F4RA 1A2LA 1QQ2A 4MP4A 2A2SA 4POMA 2V6OA 1R5AA 2H19A 2C0GA 1V9WA 3GX0A 1Z6NA 2V41A 4GRFA 4KGIA 4G0KA 2GQLA 2OT3A 3FRCA 1ERWA 1JFUA 3UAPA 2I1UA 3F3QA 1M7TA 3FZ9A 3IC4A 3L9SA 1GSFA 3HJPA 4MZBA 4IHUA 2LRCA 2PPTA 3OR5A 2GQMA 2YJ7A 4PX1A 3CRTA 5IM9A 1RQMA 3TJGA 1YF0A 5A1NA 2IIYA 5AIVA 4BA7A 1FVJA 4PQHA 2DMMA 4E8HA 1TI3A 2V32A 2ZNMA 3IBHA 3HMJG 3C73A 3IRAA 4D73A 1GTAA 5IMCA 2VUPA 3HJOA 1PL1A 2C3QA 3TKQA 2JZSA 1YY7A 2VLUA 5IMZA 2HSMA 3D21A 5E4WA 4AJ6A 4BVYB 3BOAA 2V1MA 5FT3A 4OCFA 4KSOA 2K8VA 4JR4A 1WPIA 3TKPA 3CTGA 3KGKA 4POLA 3ZLPA 3DEXA 4L5OA 2FHEA 3G7IA 2E2MA 3UL3A 1SVMA 3GL5A 2YV9A 3BCKA 3F6FA 2RLIA 2QA2A 1DE2A 1WOUA 4Q5QA 3AY8A 5HFGA 1C72A 5KN0A 14GSA 2BMXA 3RBTA 2ON5A 3KP9A 2FCHA 2OADA 4N0VA 3GTUA 2LNTA 2RM5A 3KMOA 1QUWA 3M8NA 4F82A 3FR3A 1H75A 2VD0A 4G9HA 4EVMA 4BVXB 4O32A 1SKRB 1YKCA 3F8UA 2GZPA 4XS6A 4FYCA 1EOGA 3ZREA 5J4UA 4O5QA 5AGYA 1QGVA 3LWAA 1J9BA 4MDCA 1X5CA 4IN0A 4DSSA 4WEYA 1DE1A 2H70A 4F2IA 5EVOA 5GZZB 3KTBA 2O5VA 2QA1A 2I9HA 4L0UA 4PXOA 2DLXA 2WCIA 2YWMA 5AIXA 2AYTA 3KP8A 1GRXA 1BX9A 1I9DA 1NHOA 3UVTA 3UOMA 3VI5A 2JSYA 4YKFA 3LYPA 3VI7A 2RUFA 3TJBA 2YWIA 4LMWA 5D93A 3APOA 4HUAA 1SK1A 3R2QA 1SYRA 2R5GA 1T7PB 4MF5A 4X0XA 2EIOA 4GTUA 2H0HA 2EC4A 2DJ2A 1O7UA 1YJ6A 4POBA 1OVNA 5A34B 4Z2TA 4HU9A 1TOFA 2LQOA 3F4SA 4O92A 4HEA2 1A2JA 1A8YA 4KCAA 3W8SA 1XVQA 4KF9A 2YPMA 4RQXA 4J2FA 1AUCA 1J0FA 2I4AA 3V1WA 2FNOA 3QAWA 4DSRA 3LQ7A 5FHIA 3DKSA 1JZOA 4USSA 2V2GA 1PD21 2H01A 1Y6EA 3A2VA 3KH9A 1M0UA 4DEJA 1OC9A 1S3AA 1K0DA 4IGJA 2J9HA 4MA9A 2HT9A 2NPBA 2TIRA 5BMUB 4MZCA 1ZYEA 3GHAA 3UARA 4OFNA 1U3IA 2LJKA 4OMVA 3D0ZA 2AB6A 3ZYWA 1AW9A 4EIQA 1AQXA 2H0IA 2B6MA 2L4QA 4MLYA 3ZIJA 4Z2RA 3TKRA 2OE1A 2DSAA 1FAAA 3SBCA 3IE3A 2GT6A 1E6BA 4F03A 3FK8A 3JCML 3HHVA 2CVKA 2K9FA 5B8BA 1WWJA 3HKRA 1ERUA 1XWCA 5J4YA 4I6XA 2LEGA 3QD9A 2H0GA 3G7JA 2HRAA 3I9V2 3FW2A 2E0QA 3NZNA 1PKWA 4ECJA 1O85A 4IS0A 1Y1UA 4MNNA 1GL8A 1ZCPA 2KP1A 5D73A 5A4WA 4EDZA 3SWLA 3D22A 4G19A 2J23A 2LSTA 2O7KA 2QKEA 4I2UA 4V1Ag 2P0GA 3HXSA 2VL2C 2YZHA 5ELAA 3ZMLA 1M9AA 2UZ8A 2HLSA 4XS4B 1YEPA 2MBTA 1SENA 3TCOA 4N30A 5AISA 2MMNA 1THOA 5J3RA 3E9JB 1FOVA 4XTSA 3ZL5A 1MEKA 2KUCA 1XFLA 4PGTA 4L5LA 2WGRA 3QFAC 2PBJA 5ECNB 1AIUA 2G2QA 3G7YA 5ELGA 2P5QA 4MCUA 4KH7A 2QSIA 3LXTA 4GQCA 4EC0A 2H6ZA 5DAKA 3HVXA 2P5RA 2C0EA 5HR3A 2LRTA 1OAZA 4GLTA 3IR4A 4EE0A 2X8CA 1GTUA 2H1BA 2HFDA 5KN1A 3ED3A 2M72A 1OE8A 3U6VA 2D2ZA 1EP8A 1WE0A 6GSVA 4IQAA 1GSSA 1NHYA 1JLWA 1O81A 2H1AA 3RDWA 5AN1A 2IFQA 1PN0A 3VURA 2L57A 3U5RE 1CQHA 1SJZA 4TXOB 2TRCP 4TR3A 3PGTA 1U3AA 3GKXA 1V58A 4D73B 2L4CA 1HYUA 1X0RA 3KEBA 2JZTA 2HSMB 2HRKA 3HVSA 1S3CA 2CV4A 4LA1A 1JZWA 5IMAA 3GUSA 2JACA 2M80A 3VK9A 1WP0A 2ALBA 5A5HA 2R0GA 1FOHA 1N8JA 2B5EA 5ECIB 4ML1A 4OWYA 2L6DA 3ERWA 3BD2A 4K8MA 4GSNA 4K0GA 1BEDA 1ST9A 2MZCA 4X4JA 3FR9A 3PPUA 4JU5A 1GTIA 2XC2A 2R4VA 6GSXA 12GSA 2LNSA 3GV1A 1CQGA 4Q5NA 3GIXA 3LFLA 4WF5A 1F3BA 3GKMA 3VPTA 4I5QA 1GSEA 4WR5A 2LKUA 3GTUB 4NV5A 3S9FA 1U6TA 1PKZA 1I5GA 2F51A 1DUGA 2OBIA 4GXZA 2WULA 1O73A 5H5RA 3LYKA 2R2JA 1G0TA 1ZOFA 5ECKB 1EV4A 5CRDA 4RI6A 2JL4A 2VL9A 1TXXA 4OO4A 5ECHB 5ID2A 1TXUA 2GS3A 5B6MA 5J4VA 4DSSB 5CNWA 3TOUA 4N11A 3CRUA 1XW9A 2VCZA 1URMA 3MSZA 2XBIA 1A0RP 2WJUA 3UMAA 2C3NA 1UA5A 2CA8A 5A5KA 4XCSA 1X9WB 3C7MA 5CAXA 2FWEA 1GUMA 3A5WA 3F0IA 2NBSA 1XCCA 5CYYA 1ILOA 3H4KA 1O8XA 3US3A 1XW5A 3DXBA 4ZIJA 4F9ZA 5L71A 2WDUA 2DJ3A 3FZ5A 3P2AA 2BJXA 2F3MA 2AHEA 1OKDA 2PGTA 4IVFA 1OYJA 1ERTA 5H5SA 4TR1A 3ME8A 1TTZA 1B4QA 3CBUA 1AAZA 4NHZA 4ZBAA 1HNAA 1K3LA 2CAQA 4BWSA 2KHPA 2XBQA 4V1Ap 3I69A 2G0FA 1EWXA 3MIXA 3GH6A 3BBYA 4IELA 4AKHA 3WYWA 1SL0B 2VL2A 3DD3A 2C4JA 4JEDA 1HNCA 4MPGA 1FVKA 1M2DA 3GL3A 2H1GA 3DIEA 4TKYA 3IC8A 1OC9B 2C1YA 1SD9A 1MTCA 1F6MC 3FHKA 3EU4A 4KB3A 3L9VA 3GKKA 2GT5A 2FGXA 3VFIA 3QMXA 1UN2A 5EPFA 2N5FA 2H75A 3A3TA 4MJBA 5IIZA 3IOSA 1K0AA 1Z7PA 3QR6A 2GQKA 2PMTA 4TR0A 3EE2A 4A5PA 5D9TA 2H72A 3TOTA 4EDYA 2VCVA 4TOPA 3TGZA 2R3XA 1EZKA 1TRWA 1N25A 1KTEA 4ZL8A 5J9BA 3IK9A 2LTKA 1VF4A 3ZRDA 4WR4A 1RW1A 13GSA 3I6AA 1T8EB 1XWBA 1B9XC 1ZMAA 1YEXA 1T1VA 3EMPA 4MK3A 4V2LA 1UC7A 1ZYPA 2N5AA 1HQOA 2VCXA 4N10A 3TRQA 2BTOT 1EOHA 1TRSA 5IOWA 2LQQA 1PX7A 4GSTA 3O76A 4ICYA 4MJAA 4G0IA 2VLVA 5IPHA 3DGQA 1MD4A 3LXZA 1WRYA 6GSWA 5HR0A 2NDOA 3ISOA 1TRUA 1OC8A 1IYIA 2B1KA 1X9SB 3RPPA 3HD5A 2H1DA 2R6KA 3MAKA 1IYHA 5DCGA 1M2AA 2A4HA 2C3TA 3GH9A 5D8IA 2PERA 3O3TA 3Q19A 2YOIA 1NW2A 1YDKA 3ZFBA 1XXUA 2HZEA 2DBCA 3IXRA 3LG6A 2H74A 3M1GA 4K2XA 3EPTA 5KN2A 4HS1A 4TN8A 5ECOB 2NTOA 3FYGA 1GTBA 1PN9A 3IK7A 1HNBA 4L0WA 5DAKB 4E8EA 4PUAA 4OD7A 3EVIA 3MDKA 3PR8A 3E3EA 1JZRA 5D9XA 1PMTA 3NOFA 1O8WA 1GUHA 4ZL9A 2H76A 5BRTA 3PH9A 3ZITA 4ECIA 2IFQB 2QGVA 4FQUA 5KN3A 1VRSD 3EMXA 1T4YA 4Q5RA 2K18A 4LLRA 5D96A 5GAPD 2MMZA 2IN3A 4CY8A 2GSTA 3J7Yb 4Q5FA 1QXHA 3R3EA 2L5OA 2WFCA 4V2NA 2VKZG 4KNDA 4JR6A 1JHBA 1SKWB 1EV9A 2M46A 4NPBA 2HRKB 1FB0A 4K7IA 3GYKA 5A5HB 3TUEA 5F07A 3ZIVA 4TRXA 5G2ZA 3KZQA 4HDEA 2X64A 3C1SA 5C00A 4RQRA 3RAZA 11GSA 4CHSA 4FIWA 3EWLA 5J5NA 3UIWA 4I97A 2VIMA 4YQUA 3DMLA 1B48A 2XHFA 1U87A 4OFMA 1BG1A 3FZAA 1PA3A 1X5DA 1XZOA 2LS5A 3ZFLA 4AKGA 1NM3A 3CSJA 2YWNA 2O85A 2FWHA 4EIPA 4CDOA 3WGEA 1TK5B 2FY6A 3IV4A 2DJ1A 4KDUA 2HE3A 20GSA 5A4UA 5KEJA 3HZ8A 3WGXA 3EURA 2AJQB 3FR6A 4KA0A 1EGRA 1M99A 4KDYA 16GSA 4MH3A 1R26A 1TDIA 1YF1A 1GWCA 3M9KA 1V2AA 3P7XA 5G1KA 4KW6A 3BCIA 2MMOA 1W4VA 5LNKe 4LMVA 2B5YA 2VCWA 5ID2B 3EC3A 1KEBA 1T4ZA 1OE7A 3CWGA 2LV3A 4ULXA 3GSTA 2B3SA 2V6KA 2JSZA 4GCIA 1RK4A 3IAS2 4ZB7A 5F8BA 1W89A 2HXKA 3D4TA 2YP6A 2HI7A 5J40A 3APQA 5CRWA 3QAVA 3C71A 4AKIA 4WBJA 1SL1B 2HSNA 2AAWA 3WD6A 1QK8A 4F0BA 4MPFA 5ECLB 2UV8G 3ZVJD 5ABRA 4YKGA 4AGSA 4YAPA 5HQPA 3P90A 1K0NA 3Q18A 5IMFA 2HRFA 1F2EA 3A2WA 3QCPA 2X8GA 2CZ2A 3LORA 5KOXA 3MNGA 1QMVA 1ZGNA 4V2MA 3M0FA 1XWAA 2CVDA 2REMA 1K0OA 4HZ2A 4JZQA 4TR1B 3GKNA 1GLQA 1AC1A 4IJIA 2K8SA 5IMDA 1TKDB 2HQTA 2R37A 4KSMA 2FA4A 2DKHA 4GWRA 2PWJA 1XOAA 1F9MA 5A1NB 5C04A 2CT6A 4EL1A 17GSA 5ENUA 2O8VB 3CYNA 1Z7RA 5D9WA 4N0ZA 2X4AA 1MDJA 4ZL7A 2YCDA 1SJ6A 4TW5A 2ES7A 5DDLA 3M3MA 5DCHA 4FO5A 3LSZA 5DJLA 3D5JA 2FUG2 3IDVA 2GSRA 2CZ3A 6GSUA 2VCQA 2FWFA 1YQ1A 1XPVA 5B8AA 3ZZXA 4IW9A 2IWTA 4TXVA 5EL8A 2KOKA 2QC7A 5JWQB 2PN8A 2EFCA 2VLTA 1K3YA 2H1LA 1G6WA 4NHWA 2XPDA 2IJYA 3CXGA 3GRXA 4NV2A 1M9BA 4ZB6A 4BL7A 2JU5A 1R4WA 4ML6A 1QFNA 2C8UA 2VL3A 5COHA 5GSSA 4WF4A 1BAYA 4IKHA 1SK0A 4X43A 4Z7XA 3HDCA 4JRRA 4PURA 4K1FA 3M9JA 2DIZA 1UVZA 2O87A 2NVLA 1GULA 4J57E 2JZRA 5A4VA 2DJKA 2PUKC 3G9BA 2VCTA 4PQ1A 5G31A 1GSDA 1Z3EA 1A8LA 1EEMA 5D9VA 5ECQB 2VAFA 5INYA 4DSQA 2HZFA 5F05A 3KM6A 4EXJA 4IP1A 3HY2A 3UVHA 5DALA 1A23A 2ON7A 2EIRA 6GSSA 3KH7A 2GDRA 3LGCA 5CP1A 1FW1A 3NIVA 1VGLA 2H71A 1FHEA 1XVWA 4CY6A 3KD0A 2KP2A 1SK2A 4EUYA 2HZEB 2F8FA 4CW9A 5H5QA 1WMJA 2OBKA 3MWHA 4PUFC 1XWGA 4MABA 2VM2A 1FO5A 3J7Yk 4AKXB 2CX3A 3DVWA 3MYDA 1PX6A 1YKAA 4ECBA 1THXA 1PQNA 4XRAA 1GSYA 3IA1A 3UEMA 1YZXA 1SKSB 2DKIA 1Q98A 2IMKA 2VO4A 2JADA 2VOCA 4W66A 3CSHA 1DBYA 3QPMA 4G2EA 5J47A 2KLXA 3A5IA 1Z9HA 1OC3A 3Q74A 4HZ4A 2B7KA 3DYRA 3VWVA 2YV7A 4MZWA 2DJ0A 1AQWA 5JWOB 18GSA 3FY7A 4OCEA 3HYPA 5HR2A 2EFEA 4QL7A 1B9YC 8GSSA 5JCUA 1O6JA 1R7HA 3KJYA 3W8JA 1GP1A 4QMKA 3QAGA 1SD8A 3DVXA 2EFDA 4XIHA 4KCEA 1TW9A 4O7HA 2LJAA 4GQFA 2MYGA 4TXOA 4ILFA 2HSHA 3N9JA 4FYBA 2PU9C 3KMNA 2B5XA 5KOWA 4ISDA 1SL2B 4HOJA 1MDIA 3QDNA 2OJLA 1ABAA 1U88A 4J56E 1ZZYA 4IJ3A 5ECSA 3KIJA 1LBKA 1X5EA 3WT2A 4PTSA 2L6CA 2IPAA 3GSSA 2A2PA 1PSQA 4ZILA 3IHQA 1OKTA 1VF2A 4NMUA 1VF1A 4LL1B 1ZYQB 1JLVA 2HRNA 1A24A 2GZYA 2GGTA 3CTFA 1ML6A 3DRNA 3RHBA 5GAND 3ZVJA 2CX4A 1T3BA 4ZB8A 2I81A 1NSWA 3ME7A 1TRVA 5JCWA 3Q6OA 1BF5A 1T00A 2H73A 3H79A 5DQSA 2YANA 4RUVA 5CREA 3RPNA 2YNXA 3GURA 1MDKA 3L4NA 5DVBA 1TI1A 5J9CA 3WT1A 2YN1A 2LRNA 5ECRB 2YJHA 1J08A 4ID0A 3W6GA 3TKSE 4HJ2A 3WGDA 5FWGA 2FA8A 4F0CA 5IOXA 5G30A 3F63A 1K3OA 4K6XA 3C1RA 4AJ7A 2HSNB 4NAXA 1TJDA 3KCMA 3LW9A 4ZXGA 2IMDA 3TU3B 3FZ4A 1K0MA 4K9ZA 1N2AA 4O5UA 4QL9A 3TKSC 4K7NA 5ECMB 1GSQA 1G7OA 3PINA 1SJIA 4KAEA 5IQYA 3APSA 4E68A 2B7JA 4XRDA 4FYUA 5G1LA 4AF2A 2DJJA 4TR4A 1SVLA 22GSA 3LJRA 5CRGA 1SU9A 1GH2A 1TU7A 1Z5YE 3UJ1A 3C8EA 7GSSA 4K7OA 2OE0A 3FMWA 2GSQA 3GMFA 1HD2A 4WETA 1AXDA 2L5LA 1EEJA 2YZUA 1SYXA 4ZBBA 4WXTA 3VLNA 3L9UA 3F6DA 2H6XA 3IHGA 2TRXA 3VPQA 2C0FA 1XWKA 1TU8A 5B7CA 4IP6A 3TJKA 1V98A 5CO3A 2VM1A 3L78A 1F3AA 3HZ4A 4MF6A 5JCGA 4OFTA 2A2RA 2I3YA 3TB2A 3O6TA 3VWUA 1BYEA 5JWRB 4EO3A 4DVCA 2OACA 5HFKA 4GF0A 2WB9A 2MMAA 2YWOA 4KE3A 5IPGA 4PNFA 5DJMA 4BVYA 2CVBA 1Y25A 4YH2A 4HQZA 1KNGA 2X49A 5J41A 4BL7B 1M2BA 4H86A 2C0DA 3TRPA 4L8EA 4G01A 2X99A 2L59A 3UBKA 2X8HA 5CRHA 1ERVA 4YAVA 4MH2A 3ZTLA 4RI7A 4KUNA 5IO2A 2DC5A 3TDGA 1ON4A 1BJXA 4K2DA 4LL4B 9GSSA 1LU4A 1JZDA 4AJ8A 1WIKA 1MD3A 2WZ9A 1B8XA 4TVEA 4K0NA 3F9UA 1USBA 2CQ9A 4FH8A 1S3DA 4YQMA 1EP7A 5G5FA 3A2XA 3EYTA 2H30A 3QFBC 5B6NA 4BWQA 5DALB 1X9MB 3KXOA 3I43A 2EFHA 5F0GA 1E2YA 4P3YB 2PVQA 5HFIA 1VF3A 1WJKA 3ERFA 1Q4JA 4MJEA 4MMMA 3FEUA 1H4OA 4BVXA 4N3ZA 1AQVA 3TJFA 1SVOA 2R0CA 4K5RA 2PVOC 3EU3A 3D6IA 1BQ7A 3HJMA 1PRXA 4JBBA 3P8WA 1XW6A 1B4PA 3IPZA 4Z2UA 4ECCA 2GZZA 4HJMA 1LJRA 2GSSA 4ZB9A 4EKZA 5EY6A 4XS1A 2C80A 4OO5A 2MBSA 5IO0A 3E0UA 1PGTA 4PNGA 3GNJA 3DWVA 3UBLA 2IMFA 1A0FA 1XOBA 2K6VA 2LJRA 2Z9SA 4WBRD 2GVPA 2IMIA 2AUVA 5DQYA 1ZYNA 1GSUA 5A34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCZ A;  5DBQ A;  3RHC A;  1TK0 B;  2RM6 A;  4QQ7 A;  4EF0 A;  1BG5 A;  3K8N A;  1ACV A;  2P31 A;  3F4T A;  2WRT A;  2EIQ A;  2O89 A;  3H93 A;  2GTU A;  5IMV A;  3CMI A;  4MJC A;  1EGO A;  4GSS A;  1XIY A;  1FB6 A;  5GST A;  3HA9 A;  1DSB A;  5LD0 A;  19GS A;  4G10 A;  3GN3 A;  1Z6M A;  4POK A;  2RII A;  5F06 A;  2OA7 A;  4X1U A;  3GA4 A;  1PL2 A;  3BJ5 A;  4KX4 A;  2FLS A;  6GSY A;  3TKS A;  2E2G A;  3GFK A;  1GNE A;  3D4M A;  3GX8 A;  6GST A;  2FD3 A;  5BMU A;  3TJJ A;  3EIN A;  2H66 A;  4O5R A;  2WS2 A;  4HU7 A;  4IQ1 A;  2H8L A;  2VD1 A;  2FWG A;  4G0L A;  3N5O A;  2HSY A;  2E7P A;  2F8A A;  2N5B A;  2ZUP A;  2LUS A;  4IBP A;  2B1L A;  5LCZ A;  2XPE A;  3FKF A;  4I8B A;  4PQI A;  4ACS A;  3CSI A;  3LEF A;  3VWW A;  5E59 A;  5G5E A;  1ZL9 A;  5ECP B;  4JE1 A;  1TK8 B;  3ZMK A;  4KDX A;  2IME A;  1GUK A;  3HVV A;  4NXI A;  2DML A;  3KTL A;  1K0B A;  3L0H A;  4I2T A;  10GS A;  2ZCT A;  4WKW A;  1FG4 A;  2F9S A;  1R5P A;  4NWY A;  2HNL A;  1A2M A;  2A4V A;  3ERG A;  2H6Y A;  3TRX A;  4HI7 A;  2HYX A;  1KBN A;  4BPY A;  4MF7 A;  1G7E A;  2OE3 A;  2AV4 A;  3IAM 2;  1V40 A;  3VWX A;  1V57 A;  2DIY A;  2RUE A;  1K0C A;  3H8Q A;  2CAI A;  3QOU A;  1GLP A;  4XS4 A;  4YQV A;  2GLR A;  4XHM A;  4ZBD A;  1GNW A;  1G6Y A;  1F37 A;  2IL3 A;  2OKA A;  1XBS A;  4HQS A;  5HR1 A;  3H1N A;  3F3R A;  1TP9 A;  3F4R A;  1A2L A;  1QQ2 A;  4MP4 A;  2A2S A;  4POM A;  2V6O A;  1R5A A;  2H19 A;  2C0G A;  1V9W A;  3GX0 A;  1Z6N A;  2V41 A;  4GRF A;  4KGI A;  4G0K A;  2GQL A;  3FRC A;  1ERW A;  1JFU A;  3UAP A;  2I1U A;  3F3Q A;  1M7T A;  3FZ9 A;  3IC4 A;  3L9S A;  1GSF A;  3HJP A;  4MZB A;  4IHU A;  2LRC A;  2PPT A;  3OR5 A;  2GQM A;  2YJ7 A;  4PX1 A;  3CRT A;  5IM9 A;  1RQM A;  3TJG A;  1YF0 A;  2IIY A;  5AIV A;  4BA7 A;  1FVJ A;  4PQH A;  2DMM A;  4E8H A;  1TI3 A;  2V32 A;  2ZNM A;  3IBH A;  3C73 A;  3IRA A;  4D73 A;  1GTA A;  5IMC A;  2VUP A;  3HJO A;  1PL1 A;  2C3Q A;  3TKQ A;  2JZS A;  1YY7 A;  2VLU A;  5IMZ A;  2HSM A;  3D21 A;  5E4W A;  4AJ6 A;  4BVY B;  3BOA A;  2V1M A;  5FT3 A;  4OCF A;  4KSO A;  2K8V A;  4JR4 A;  1WPI A;  3TKP A;  3CTG A;  3KGK A;  4POL A;  3ZLP A;  3DEX A;  4L5O A;  2FHE A;  3G7I A;  2E2M A;  3UL3 A;  3GL5 A;  2YV9 A;  3BCK A;  3F6F A;  2RLI A;  1DE2 A;  1WOU A;  4Q5Q A;  3AY8 A;  5HFG A;  1C72 A;  5KN0 A;  14GS A;  2BMX A;  3RBT A;  2ON5 A;  3KP9 A;  2FCH A;  2OAD A;  4N0V A;  3GTU A;  2LNT A;  2RM5 A;  3KMO A;  1QUW A;  3M8N A;  4F82 A;  3FR3 A;  1H75 A;  2VD0 A;  4G9H A;  4EVM A;  4BVX B;  4O32 A;  1SKR B;  1YKC A;  3F8U A;  2GZP A;  4XS6 A;  4FYC A;  1EOG A;  3ZRE A;  5J4U A;  5AGY A;  1QGV A;  3LWA A;  1J9B A;  4MDC A;  1X5C A;  4IN0 A;  4DSS A;  4WEY A;  1DE1 A;  2H70 A;  4F2I A;  5EVO A;  5GZZ B;  3KTB A;  2I9H A;  4L0U A;  4PXO A;  2DLX A;  2WCI A;  2YWM A;  5AIX A;  2AYT A;  3KP8 A;  1GRX A;  1BX9 A;  1I9D A;  1NHO A;  3UVT A;  3UOM A;  3VI5 A;  2JSY A;  3LYP A;  3VI7 A;  2RUF A;  3TJB A;  2YWI A;  4LMW A;  5D93 A;  3APO A;  4HUA A;  1SK1 A;  3R2Q A;  1SYR A;  2R5G A;  1T7P B;  4MF5 A;  4X0X A;  2EIO A;  4GTU A;  2H0H A;  2EC4 A;  2DJ2 A;  1O7U A;  1YJ6 A;  4POB A;  1OVN A;  4HU9 A;  1TOF A;  2LQO A;  3F4S A;  4O92 A;  4HEA 2;  1A2J A;  1A8Y A;  4KCA A;  3W8S A;  1XVQ A;  4KF9 A;  2YPM A;  4RQX A;  4J2F A;  1AUC A;  1J0F A;  2I4A A;  3V1W A;  2FNO A;  3QAW A;  4DSR A;  3LQ7 A;  5FHI A;  3DKS A;  1JZO A;  4USS A;  2V2G A;  1PD2 1;  2H01 A;  1Y6E A;  3A2V A;  3KH9 A;  1M0U A;  4DEJ A;  1OC9 A;  1S3A A;  1K0D A;  4IGJ A;  2J9H A;  4MA9 A;  2HT9 A;  2NPB A;  2TIR A;  4MZC A;  1ZYE A;  3GHA A;  3UAR A;  4OFN A;  1U3I A;  2LJK A;  4OMV A;  3D0Z A;  2AB6 A;  3ZYW A;  1AW9 A;  1AQX A;  2H0I A;  2B6M A;  2L4Q A;  4MLY A;  3ZIJ A;  3TKR A;  2OE1 A;  2DSA A;  1FAA A;  3SBC A;  3IE3 A;  2GT6 A;  1E6B A;  4F03 A;  3FK8 A;  3JCM L;  3HHV A;  2CVK A;  2K9F A;  5B8B A;  1WWJ A;  3HKR A;  1ERU A;  1XWC A;  4I6X A;  2LEG A;  3QD9 A;  2H0G A;  3G7J A;  2HRA A;  3I9V 2;  3FW2 A;  2E0Q A;  3NZN A;  1PKW A;  4ECJ A;  1O85 A;  4IS0 A;  1GL8 A;  1ZCP A;  2KP1 A;  5D73 A;  5A4W A;  4EDZ A;  3SWL A;  3D22 A;  4G19 A;  4I2U A;  2J23 A;  2LST A;  2O7K A;  2QKE A;  4V1A g;  2P0G A;  3HXS A;  2VL2 C;  2YZH A;  5ELA A;  3ZML A;  1M9A A;  2UZ8 A;  2HLS A;  4XS4 B;  1YEP A;  2MBT A;  1SEN A;  3TCO A;  4N30 A;  5AIS A;  2MMN A;  1THO A;  5J3R A;  3E9J B;  1FOV A;  4XTS A;  3ZL5 A;  1MEK A;  2KUC A;  1XFL A;  4PGT A;  4L5L A;  2WGR A;  3QFA C;  2PBJ A;  5ECN B;  1AIU A;  2G2Q A;  3G7Y A;  5ELG A;  2P5Q A;  4MCU A;  4KH7 A;  2QSI A;  3LXT A;  4GQC A;  4EC0 A;  2H6Z A;  5DAK A;  3HVX A;  2P5R A;  2C0E A;  5HR3 A;  2LRT A;  1OAZ A;  4GLT A;  3IR4 A;  4EE0 A;  2X8C A;  1GTU A;  2H1B A;  2HFD A;  5KN1 A;  3ED3 A;  2M72 A;  1OE8 A;  3U6V A;  2D2Z A;  1EP8 A;  1WE0 A;  6GSV A;  4IQA A;  1GSS A;  1NHY A;  1JLW A;  1O81 A;  2H1A A;  3RDW A;  5AN1 A;  2IFQ A;  3U5R E;  3VUR A;  2L57 A;  1CQH A;  1SJZ A;  4TXO B;  2TRC P;  4TR3 A;  3PGT A;  1U3A A;  3GKX A;  1V58 A;  4D73 B;  2L4C A;  1HYU A;  1X0R A;  3KEB A;  2JZT A;  2HSM B;  2HRK A;  3HVS A;  1S3C A;  2CV4 A;  4LA1 A;  1JZW A;  5IMA A;  3GUS A;  2JAC A;  2M80 A;  3VK9 A;  1WP0 A;  2ALB A;  1N8J A;  2B5E A;  5ECI B;  4ML1 A;  4OWY A;  2L6D A;  3ERW A;  3BD2 A;  4K8M A;  4GSN A;  4K0G A;  1BED A;  1ST9 A;  2MZC A;  3FR9 A;  3PPU A;  4JU5 A;  1GTI A;  2XC2 A;  2R4V A;  6GSX A;  12GS A;  2LNS A;  3GV1 A;  1CQG A;  4Q5N A;  3GIX A;  3LFL A;  4WF5 A;  1F3B A;  3GKM A;  3VPT A;  4I5Q A;  1GSE A;  4WR5 A;  2LKU A;  3GTU B;  4NV5 A;  3S9F A;  1U6T A;  1PKZ A;  1I5G A;  2F51 A;  1DUG A;  2OBI A;  4GXZ A;  2WUL A;  1O73 A;  5H5R A;  3LYK A;  2R2J A;  1G0T A;  1ZOF A;  5ECK B;  1EV4 A;  5CRD A;  4RI6 A;  2JL4 A;  2VL9 A;  1TXX A;  4OO4 A;  5ECH B;  5ID2 A;  2GS3 A;  5B6M A;  4DSS B;  5CNW A;  3TOU A;  4N11 A;  3CRU A;  1XW9 A;  2VCZ A;  1URM A;  3MSZ A;  2XBI A;  1A0R P;  2WJU A;  3UMA A;  2C3N A;  1UA5 A;  2CA8 A;  5A5K A;  4XCS A;  1X9W B;  3C7M A;  5CAX A;  2FWE A;  1GUM A;  3A5W A;  3F0I A;  2NBS A;  1XCC A;  5CYY A;  1ILO A;  3H4K A;  1O8X A;  3US3 A;  1XW5 A;  3DXB A;  4ZIJ A;  4F9Z A;  5L71 A;  2WDU A;  2DJ3 A;  3FZ5 A;  3P2A A;  2BJX A;  2F3M A;  2AHE A;  1OKD A;  2PGT A;  4IVF A;  1OYJ A;  1ERT A;  5H5S A;  4TR1 A;  3ME8 A;  1TTZ A;  1B4Q A;  3CBU A;  1AAZ A;  4NHZ A;  4ZBA A;  1HNA A;  1K3L A;  2CAQ A;  4BWS A;  2KHP A;  2XBQ A;  4V1A p;  3I69 A;  2G0F A;  1EWX A;  3GH6 A;  3BBY A;  4IEL A;  3WYW A;  1SL0 B;  2VL2 A;  3DD3 A;  2C4J A;  4JED A;  1HNC A;  4MPG A;  1FVK A;  1M2D A;  3GL3 A;  2H1G A;  3DIE A;  4TKY A;  3IC8 A;  1OC9 B;  2C1Y A;  1SD9 A;  1MTC A;  1F6M C;  3FHK A;  3EU4 A;  4KB3 A;  3L9V A;  3GKK A;  2GT5 A;  2FGX A;  3VFI A;  3QMX A;  1UN2 A;  5EPF A;  2N5F A;  2H75 A;  3A3T A;  4MJB A;  5IIZ A;  3IOS A;  1K0A A;  1Z7P A;  3QR6 A;  2GQK A;  2PMT A;  4TR0 A;  3EE2 A;  5D9T A;  2H72 A;  3TOT A;  4EDY A;  2VCV A;  4TOP A;  3TGZ A;  2R3X A;  1EZK A;  1TRW A;  1KTE A;  4ZL8 A;  5J9B A;  3IK9 A;  2LTK A;  1VF4 A;  3ZRD A;  4WR4 A;  1RW1 A;  13GS A;  3I6A A;  1T8E B;  1XWB A;  1B9X C;  1ZMA A;  1YEX A;  1T1V A;  3EMP A;  4MK3 A;  4V2L A;  1UC7 A;  2N5A A;  1HQO A;  2VCX A;  4N10 A;  3TRQ A;  2BTO T;  1EOH A;  1TRS A;  5IOW A;  2LQQ A;  1PX7 A;  4GST A;  3O76 A;  4MJA A;  4G0I A;  2VLV A;  5IPH A;  3DGQ A;  1MD4 A;  3LXZ A;  1WRY A;  6GSW A;  5HR0 A;  2NDO A;  3ISO A;  1TRU A;  1OC8 A;  1IYI A;  2B1K A;  1X9S B;  3RPP A;  3HD5 A;  2H1D A;  2R6K A;  3MAK A;  1IYH A;  5DCG A;  1M2A A;  2C3T A;  3GH9 A;  5D8I A;  2PER A;  3O3T A;  3Q19 A;  2YOI A;  1NW2 A;  1YDK A;  3ZFB A;  1XXU A;  2HZE A;  2DBC A;  3IXR A;  3LG6 A;  2H74 A;  3M1G A;  5KN2 A;  4HS1 A;  4TN8 A;  5ECO B;  2NTO A;  3FYG A;  1GTB A;  1PN9 A;  3IK7 A;  1HNB A;  4L0W A;  5DAK B;  4E8E A;  4PUA A;  4OD7 A;  3EVI A;  3MDK A;  3PR8 A;  3E3E A;  1JZR A;  5D9X A;  1PMT A;  3NOF A;  1O8W A;  1GUH A;  4ZL9 A;  2H76 A;  3PH9 A;  3ZIT A;  4ECI A;  2IFQ B;  2QGV A;  4FQU A;  5KN3 A;  1VRS D;  3EMX A;  1T4Y A;  4Q5R A;  2K18 A;  4LLR A;  5D96 A;  5GAP D;  2MMZ A;  2IN3 A;  2GST A;  3J7Y b;  4Q5F A;  1QXH A;  3R3E A;  2L5O A;  2WFC A;  4V2N A;  4KND A;  4JR6 A;  1JHB A;  1SKW B;  1EV9 A;  2M46 A;  4NPB A;  2HRK B;  1FB0 A;  4K7I A;  3GYK A;  3TUE A;  5F07 A;  3ZIV A;  4TRX A;  5G2Z A;  3KZQ A;  4HDE A;  2X64 A;  3C1S A;  5C00 A;  4RQR A;  3RAZ A;  11GS A;  4CHS A;  4FIW A;  3EWL A;  5J5N A;  3UIW A;  4I97 A;  2VIM A;  4YQU A;  3DML A;  1B48 A;  2XHF A;  1U87 A;  4OFM A;  3FZA A;  1PA3 A;  1X5D A;  1XZO A;  2LS5 A;  3ZFL A;  1NM3 A;  3CSJ A;  2YWN A;  2O85 A;  2FWH A;  4CDO A;  3WGE A;  1TK5 B;  2FY6 A;  3IV4 A;  2DJ1 A;  4KDU A;  2HE3 A;  20GS A;  5A4U A;  5KEJ A;  3HZ8 A;  3WGX A;  3EUR A;  2AJQ B;  3FR6 A;  4KA0 A;  1EGR A;  1M99 A;  4KDY A;  16GS A;  4MH3 A;  1R26 A;  1TDI A;  1YF1 A;  1GWC A;  3M9K A;  1V2A A;  3P7X A;  5G1K A;  4KW6 A;  3BCI A;  2MMO A;  1W4V A;  5LNK e;  4LMV A;  2B5Y A;  2VCW A;  5ID2 B;  3EC3 A;  1KEB A;  1T4Z A;  1OE7 A;  2LV3 A;  4ULX A;  3GST A;  2B3S A;  2V6K A;  2JSZ A;  4GCI A;  1RK4 A;  3IAS 2;  5F8B A;  1W89 A;  2HXK A;  3D4T A;  2YP6 A;  2HI7 A;  3APQ A;  5CRW A;  3QAV A;  3C71 A;  4WBJ A;  1SL1 B;  2AAW A;  3WD6 A;  1QK8 A;  4F0B A;  4MPF A;  5ECL B;  3ZVJ D;  5ABR A;  4AGS A;  4YAP A;  5HQP A;  3P90 A;  1K0N A;  3Q18 A;  5IMF A;  2HRF A;  1F2E A;  3A2W A;  3QCP A;  2X8G A;  2CZ2 A;  3LOR A;  3MNG A;  1QMV A;  1ZGN A;  4V2M A;  3M0F A;  1XWA A;  2CVD A;  2REM A;  1K0O A;  4HZ2 A;  4JZQ A;  4TR1 B;  3GKN A;  1GLQ A;  1AC1 A;  4IJI A;  2K8S A;  5IMD A;  1TKD B;  2HQT A;  2R37 A;  4KSM A;  2FA4 A;  4GWR A;  2PWJ A;  1XOA A;  1F9M A;  5C04 A;  2CT6 A;  4EL1 A;  17GS A;  5ENU A;  2O8V B;  3CYN A;  1Z7R A;  5D9W A;  4N0Z A;  1MDJ A;  4ZL7 A;  2YCD A;  1SJ6 A;  4TW5 A;  2ES7 A;  5DDL A;  3M3M A;  5DCH A;  4FO5 A;  3LSZ A;  5DJL A;  3D5J A;  2FUG 2;  3IDV A;  2GSR A;  2CZ3 A;  6GSU A;  2VCQ A;  2FWF A;  1YQ1 A;  1XPV A;  5B8A A;  3ZZX A;  4IW9 A;  2IWT A;  4TXV A;  5EL8 A;  2KOK A;  2QC7 A;  5JWQ B;  2PN8 A;  2VLT A;  1K3Y A;  1G6W A;  4NHW A;  2XPD A;  2IJY A;  3CXG A;  3GRX A;  4NV2 A;  1M9B A;  4ZB6 A;  4BL7 A;  2JU5 A;  1R4W A;  4ML6 A;  1QFN A;  2C8U A;  2VL3 A;  5COH A;  5GSS A;  4WF4 A;  1BAY A;  4IKH A;  1SK0 A;  4X43 A;  4Z7X A;  3HDC A;  4JRR A;  4PUR A;  4K1F A;  3M9J A;  2DIZ A;  1UVZ A;  2O87 A;  2NVL A;  1GUL A;  4J57 E;  2JZR A;  5A4V A;  2DJK A;  2PUK C;  3G9B A;  2VCT A;  4PQ1 A;  5G31 A;  1GSD A;  1Z3E A;  1A8L A;  1EEM A;  5D9V A;  5ECQ B;  2VAF A;  5INY A;  4DSQ A;  2HZF A;  5F05 A;  3KM6 A;  4EXJ A;  4IP1 A;  3HY2 A;  3UVH A;  5DAL A;  1A23 A;  2ON7 A;  2EIR A;  6GSS A;  3KH7 A;  2GDR A;  3LGC A;  5CP1 A;  1FW1 A;  3NIV A;  1VGL A;  2H71 A;  1FHE A;  1XVW A;  3KD0 A;  2KP2 A;  1SK2 A;  4EUY A;  2HZE B;  2F8F A;  4CW9 A;  5H5Q A;  1WMJ A;  2OBK A;  3MWH A;  4PUF C;  1XWG A;  4MAB A;  2VM2 A;  1FO5 A;  3J7Y k;  2CX3 A;  3DVW A;  1PX6 A;  1YKA A;  4ECB A;  1THX A;  1PQN A;  4XRA A;  1GSY A;  3IA1 A;  3UEM A;  1YZX A;  1SKS B;  1Q98 A;  2IMK A;  2VO4 A;  2JAD A;  2VOC A;  3CSH A;  1DBY A;  3QPM A;  4G2E A;  2KLX A;  1Z9H A;  1OC3 A;  3Q74 A;  4HZ4 A;  2B7K A;  3DYR A;  3VWV A;  2YV7 A;  4MZW A;  2DJ0 A;  1AQW A;  5JWO B;  18GS A;  3FY7 A;  4OCE A;  3HYP A;  5HR2 A;  4QL7 A;  1B9Y C;  8GSS A;  5JCU A;  1O6J A;  1R7H A;  3KJY A;  3W8J A;  1GP1 A;  3DVX A;  3QAG A;  1SD8 A;  4XIH A;  4KCE A;  1TW9 A;  4O7H A;  2LJA A;  4GQF A;  2MYG A;  4TXO A;  4ILF A;  2HSH A;  3N9J A;  4FYB A;  2PU9 C;  3KMN A;  2B5X A;  4ISD A;  1SL2 B;  4HOJ A;  1MDI A;  3QDN A;  2OJL A;  1ABA A;  1U88 A;  4J56 E;  1ZZY A;  4IJ3 A;  5ECS A;  3KIJ A;  1LBK A;  1X5E A;  3WT2 A;  4PTS A;  2L6C A;  2IPA A;  3GSS A;  1PSQ A;  4ZIL A;  3IHQ A;  1OKT A;  1VF2 A;  4NMU A;  1VF1 A;  4LL1 B;  1ZYQ B;  1JLV A;  2HRN A;  1A24 A;  2GZY A;  2GGT A;  3CTF A;  1ML6 A;  3DRN A;  3RHB A;  5GAN D;  3ZVJ A;  2CX4 A;  1T3B A;  4ZB8 A;  2I81 A;  1NSW A;  3ME7 A;  1TRV A;  5JCW A;  3Q6O A;  1T00 A;  2H73 A;  3H79 A;  5DQS A;  2YAN A;  4RUV A;  5CRE A;  3RPN A;  2YNX A;  3GUR A;  1MDK A;  3L4N A;  5DVB A;  1TI1 A;  5J9C A;  3WT1 A;  2YN1 A;  2LRN A;  5ECR B;  2YJH A;  1J08 A;  4ID0 A;  3W6G A;  3TKS E;  4HJ2 A;  3WGD A;  5FWG A;  2FA8 A;  4F0C A;  5IOX A;  5G30 A;  3F63 A;  1K3O A;  4K6X A;  3C1R A;  4AJ7 A;  2HSN B;  4NAX A;  1TJD A;  3KCM A;  4ZXG A;  2IMD A;  3FZ4 A;  1K0M A;  4K9Z A;  1N2A A;  4QL9 A;  3TKS C;  4K7N A;  5ECM B;  1GSQ A;  1G7O A;  3PIN A;  1SJI A;  4KAE A;  5IQY A;  3APS A;  2B7J A;  4XRD A;  4FYU A;  5G1L A;  4AF2 A;  2DJJ A;  4TR4 A;  22GS A;  3LJR A;  5CRG A;  1SU9 A;  1GH2 A;  1TU7 A;  1Z5Y E;  3UJ1 A;  3C8E A;  7GSS A;  4K7O A;  2OE0 A;  2GSQ A;  3GMF A;  1HD2 A;  4WET A;  1AXD A;  2L5L A;  1EEJ A;  2YZU A;  1SYX A;  4ZBB A;  4WXT A;  3VLN A;  3L9U A;  3F6D A;  2H6X A;  2TRX A;  3VPQ A;  2C0F A;  1XWK A;  1TU8 A;  5B7C A;  4IP6 A;  3TJK A;  1V98 A;  5CO3 A;  2VM1 A;  3L78 A;  1F3A A;  3HZ4 A;  4MF6 A;  5JCG A;  4OFT A;  2A2R A;  2I3Y A;  3TB2 A;  3O6T A;  3VWU A;  1BYE A;  5JWR B;  4EO3 A;  4DVC A;  2OAC A;  5HFK A;  4GF0 A;  2WB9 A;  2MMA A;  2YWO A;  4KE3 A;  5IPG A;  4PNF A;  5DJM A;  4BVY A;  2CVB A;  1Y25 A;  4YH2 A;  4HQZ A;  1KNG A;  5J41 A;  4BL7 B;  1M2B A;  4H86 A;  2C0D A;  3TRP A;  4L8E A;  2X99 A;  2L59 A;  3UBK A;  2X8H A;  5CRH A;  1ERV A;  4YAV A;  4MH2 A;  3ZTL A;  4RI7 A;  4KUN A;  5IO2 A;  2DC5 A;  3TDG A;  1ON4 A;  1BJX A;  4K2D A;  4LL4 B;  9GSS A;  1LU4 A;  1JZD A;  4AJ8 A;  1WIK A;  1MD3 A;  2WZ9 A;  1B8X A;  4TVE A;  4K0N A;  3F9U A;  1USB A;  2CQ9 A;  4FH8 A;  1S3D A;  4YQM A;  1EP7 A;  5G5F A;  3A2X A;  3EYT A;  2H30 A;  3QFB C;  5B6N A;  4BWQ A;  5DAL B;  1X9M B;  3KXO A;  3I43 A;  5F0G A;  1E2Y A;  4P3Y B;  2PVQ A;  5HFI A;  1VF3 A;  1WJK A;  3ERF A;  1Q4J A;  4MJE A;  4MMM A;  3FEU A;  1H4O A;  4BVX A;  1AQV A;  3TJF A;  2PVO C;  3EU3 A;  3D6I A;  1BQ7 A;  3HJM A;  1PRX A;  4JBB A;  3P8W A;  1XW6 A;  1B4P A;  3IPZ A;  4ECC A;  2GZZ A;  4HJM A;  1LJR A;  2GSS A;  4ZB9 A;  4EKZ A;  5EY6 A;  4XS1 A;  2C80 A;  4OO5 A;  2MBS A;  5IO0 A;  3E0U A;  1PGT A;  4PNG A;  3GNJ A;  3DWV A;  3UBL A;  2IMF A;  1A0F A;  1XOB A;  2K6V A;  2LJR A;  2Z9S A;  4WBR D;  2GVP A;  2IMI A;  2AUV A;  5DQY A;  1GSU A; 
#chains in the Genus database with same CATH topology
 3HCZ A;  5DBQ A;  3RHC A;  1TK0 B;  2RM6 A;  4QQ7 A;  4EF0 A;  1BG5 A;  3K8N A;  1ACV A;  2P31 A;  3F4T A;  2WRT A;  2EIQ A;  2O89 A;  3H93 A;  2GTU A;  5IMV A;  3CMI A;  4MJC A;  1EGO A;  4GSS A;  1XIY A;  1FB6 A;  5GST A;  3HA9 A;  1DSB A;  5LD0 A;  19GS A;  4G10 A;  3GN3 A;  1Z6M A;  4POK A;  2RII A;  5F06 A;  2OA7 A;  4X1U A;  3GA4 A;  1PL2 A;  3BJ5 A;  4KX4 A;  2FLS A;  6GSY A;  3TKS A;  2E2G A;  3GFK A;  1GNE A;  3D4M A;  2O36 A;  3GX8 A;  6GST A;  2FD3 A;  5BMU A;  3TJJ A;  3EIN A;  2H66 A;  4O5R A;  2WS2 A;  4HU7 A;  4IQ1 A;  2H8L A;  2VD1 A;  2FWG A;  4G0L A;  3N5O A;  2HSY A;  2E7P A;  2F8A A;  2N5B A;  2ZUP A;  4K5S A;  2R0P A;  2LUS A;  4IBP A;  2B1L A;  5LCZ A;  2XPE A;  3FKF A;  4I8B A;  4PQI A;  4ACS A;  3CSI A;  3LEF A;  4PI0 C;  3VWW A;  5E59 A;  5G5E A;  1ZL9 A;  5ECP B;  4JE1 A;  1TK8 B;  3ZMK A;  4KDX A;  2IME A;  1GUK A;  3HVV A;  4NXI A;  2DML A;  3KTL A;  1K0B A;  3L0H A;  4I2T A;  10GS A;  2ZCT A;  4WKW A;  1FG4 A;  4AI6 A;  2F9S A;  1R5P A;  4NWY A;  1YVL A;  2HNL A;  1A2M A;  2A4V A;  3ERG A;  2H6Y A;  3TRX A;  4HI7 A;  2HYX A;  1KBN A;  4BPY A;  4MF7 A;  1G7E A;  2OE3 A;  2AV4 A;  3IAM 2;  1V40 A;  3VWX A;  1V57 A;  2DIY A;  2RUE A;  1K0C A;  3H8Q A;  2CAI A;  3QOU A;  1GLP A;  4XS4 A;  4YQV A;  2GLR A;  4XHM A;  4ZBD A;  1GNW A;  4GDF A;  1G6Y A;  1F37 A;  2IL3 A;  2OKA A;  1XBS A;  4HQS A;  5HR1 A;  3H1N A;  3F3R A;  1TP9 A;  3F4R A;  1A2L A;  1QQ2 A;  4BIK A;  4MP4 A;  2A2S A;  4POM A;  2V6O A;  1R5A A;  2H19 A;  2C0G A;  1V9W A;  3GX0 A;  1Z6N A;  2V41 A;  4GRF A;  4KGI A;  4G0K A;  2GQL A;  2OT3 A;  3FRC A;  1ERW A;  1JFU A;  3UAP A;  2I1U A;  3F3Q A;  1M7T A;  3FZ9 A;  3IC4 A;  3L9S A;  1GSF A;  3HJP A;  4MZB A;  4IHU A;  3CQF A;  2LRC A;  2PPT A;  3OR5 A;  2GQM A;  2YJ7 A;  4PX1 A;  3CRT A;  5IM9 A;  1RQM A;  3TJG A;  1S3R A;  1YF0 A;  5A1N A;  2IIY A;  5AIV A;  4BA7 A;  1FVJ A;  4PQH A;  2DMM A;  4E8H A;  1TI3 A;  2V32 A;  2ZNM A;  3IBH A;  3HMJ G;  3C73 A;  3IRA A;  4D73 A;  1GTA A;  5IMC A;  2VUP A;  3HJO A;  1PL1 A;  2C3Q A;  3TKQ A;  2JZS A;  1YY7 A;  2VLU A;  5IMZ A;  2HSM A;  3D21 A;  5E4W A;  4AJ6 A;  4BVY B;  3BOA A;  2V1M A;  5FT3 A;  4OCF A;  4KSO A;  2K8V A;  4JR4 A;  1WPI A;  3TKP A;  3CTG A;  3KGK A;  4POL A;  3ZLP A;  3DEX A;  4L5O A;  2FHE A;  3G7I A;  2E2M A;  3UL3 A;  1SVM A;  3GL5 A;  2YV9 A;  3BCK A;  3F6F A;  2RLI A;  2QA2 A;  1DE2 A;  1WOU A;  4Q5Q A;  3AY8 A;  5HFG A;  1C72 A;  5KN0 A;  14GS A;  2BMX A;  3RBT A;  2ON5 A;  3KP9 A;  2FCH A;  2OAD A;  4N0V A;  3GTU A;  2LNT A;  2RM5 A;  3KMO A;  1QUW A;  3M8N A;  4F82 A;  3FR3 A;  1H75 A;  2VD0 A;  4G9H A;  4EVM A;  4BVX B;  4O32 A;  1SKR B;  1YKC A;  3F8U A;  2GZP A;  4XS6 A;  4FYC A;  1EOG A;  3ZRE A;  5J4U A;  4O5Q A;  5AGY A;  1QGV A;  1J9B A;  3LWA A;  4MDC A;  1X5C A;  4IN0 A;  4DSS A;  4PHZ C;  4WEY A;  1DE1 A;  2H70 A;  4F2I A;  5EVO A;  5GZZ B;  3KTB A;  2O5V A;  2QA1 A;  2I9H A;  4L0U A;  4PXO A;  2DLX A;  2WCI A;  2YWM A;  5AIX A;  2AYT A;  3KP8 A;  1GRX A;  1BX9 A;  1I9D A;  1NHO A;  3UVT A;  3UOM A;  3VI5 A;  2JSY A;  4YKF A;  3LYP A;  3VI7 A;  2RUF A;  3TJB A;  2YWI A;  4LMW A;  5D93 A;  3APO A;  4HUA A;  1SK1 A;  3R2Q A;  1SYR A;  2R5G A;  1T7P B;  4MF5 A;  4X0X A;  2EIO A;  4GTU A;  2H0H A;  2EC4 A;  2DJ2 A;  1O7U A;  1YJ6 A;  4POB A;  1OVN A;  5A34 B;  4Z2T A;  4HU9 A;  1TOF A;  2LQO A;  3F4S A;  4O92 A;  4HEA 2;  1A2J A;  1A8Y A;  4KCA A;  3W8S A;  1XVQ A;  4KF9 A;  2YPM A;  4RQX A;  4J2F A;  1AUC A;  1J0F A;  2I4A A;  3V1W A;  2FNO A;  3QAW A;  4DSR A;  3LQ7 A;  5FHI A;  3DKS A;  1JZO A;  4USS A;  2V2G A;  1PD2 1;  2H01 A;  1Y6E A;  3A2V A;  3KH9 A;  1M0U A;  4DEJ A;  1OC9 A;  1S3A A;  1K0D A;  4IGJ A;  2J9H A;  4MA9 A;  2HT9 A;  2NPB A;  2TIR A;  5BMU B;  4MZC A;  1ZYE A;  3GHA A;  3UAR A;  4OFN A;  1U3I A;  2LJK A;  4OMV A;  3D0Z A;  2AB6 A;  3ZYW A;  1AW9 A;  4EIQ A;  1AQX A;  2H0I A;  2B6M A;  2L4Q A;  4MLY A;  3ZIJ A;  4Z2R A;  3TKR A;  2OE1 A;  2DSA A;  1FAA A;  3SBC A;  3IE3 A;  2GT6 A;  1E6B A;  4F03 A;  3FK8 A;  3JCM L;  3HHV A;  2CVK A;  2K9F A;  5B8B A;  1WWJ A;  3HKR A;  1ERU A;  1XWC A;  5J4Y A;  4I6X A;  2LEG A;  3QD9 A;  2H0G A;  3G7J A;  2HRA A;  3I9V 2;  3FW2 A;  2E0Q A;  3NZN A;  1PKW A;  4ECJ A;  1O85 A;  4IS0 A;  1Y1U A;  2WVZ A;  4MNN A;  1GL8 A;  1ZCP A;  2KP1 A;  5D73 A;  5A4W A;  4EDZ A;  3SWL A;  3D22 A;  4G19 A;  2J23 A;  2LST A;  2O7K A;  2QKE A;  4I2U A;  4V1A g;  2P0G A;  3HXS A;  2VL2 C;  2YZH A;  5ELA A;  3ZML A;  1M9A A;  2UZ8 A;  2HLS A;  4XS4 B;  1YEP A;  2MBT A;  1SEN A;  3TCO A;  4N30 A;  5AIS A;  2MMN A;  1THO A;  5J3R A;  1M3I A;  3E9J B;  1FOV A;  4XTS A;  3ZL5 A;  1MEK A;  2KUC A;  1XFL A;  4PGT A;  4L5L A;  2WGR A;  3QFA C;  2PBJ A;  5ECN B;  1AIU A;  2G2Q A;  3G7Y A;  5ELG A;  2P5Q A;  4MCU A;  4KH7 A;  2QSI A;  2WW0 A;  3LXT A;  4GQC A;  4EC0 A;  2H6Z A;  5DAK A;  3HVX A;  2P5R A;  2C0E A;  5HR3 A;  2LRT A;  1OAZ A;  4GLT A;  3IR4 A;  4EE0 A;  2X8C A;  1GTU A;  2H1B A;  2HFD A;  5KN1 A;  3ED3 A;  2M72 A;  1OE8 A;  3U6V A;  2D2Z A;  1EP8 A;  1WE0 A;  6GSV A;  4IQA A;  1GSS A;  1NHY A;  1JLW A;  1O81 A;  2H1A A;  3RDW A;  5AN1 A;  2IFQ A;  1PN0 A;  3VUR A;  2L57 A;  3U5R E;  1CQH A;  1SJZ A;  4TXO B;  2TRC P;  4TR3 A;  3PGT A;  1U3A A;  3GKX A;  1V58 A;  4D73 B;  2L4C A;  1HYU A;  1X0R A;  3KEB A;  2JZT A;  2HSM B;  2HRK A;  3HVS A;  1S3C A;  2CV4 A;  4LA1 A;  1JZW A;  5IMA A;  3GUS A;  2JAC A;  2M80 A;  3VK9 A;  1WP0 A;  2ALB A;  5A5H A;  2R0G A;  1FOH A;  1N8J A;  2B5E A;  5ECI B;  4ML1 A;  4OWY A;  2L6D A;  3ERW A;  3BD2 A;  4K8M A;  4GSN A;  4K0G A;  1BED A;  1ST9 A;  2MZC A;  4X4J A;  2WZS A;  3FR9 A;  3PPU A;  4JU5 A;  1GTI A;  2XC2 A;  2R4V A;  6GSX A;  12GS A;  2LNS A;  3GV1 A;  1CQG A;  4Q5N A;  3GIX A;  3LFL A;  4WF5 A;  1PFO A;  1F3B A;  3GKM A;  3VPT A;  4I5Q A;  1GSE A;  4WR5 A;  2LKU A;  3GTU B;  4NV5 A;  3S9F A;  1U6T A;  1PKZ A;  1I5G A;  2F51 A;  1DUG A;  2OBI A;  4GXZ A;  2WUL A;  1O73 A;  5H5R A;  3LYK A;  2R2J A;  1G0T A;  1ZOF A;  5ECK B;  1EV4 A;  5CRD A;  4RI6 A;  2JL4 A;  2VL9 A;  1TXX A;  4OO4 A;  5ECH B;  5ID2 A;  1TXU A;  2GS3 A;  5B6M A;  5J4V A;  4DSS B;  5CNW A;  3TOU A;  4N11 A;  3CRU A;  1XW9 A;  2VCZ A;  1URM A;  3MSZ A;  2XBI A;  1A0R P;  2WJU A;  3UMA A;  2C3N A;  1UA5 A;  2CA8 A;  5A5K A;  4XCS A;  1X9W B;  3C7M A;  5CAX A;  2FWE A;  1GUM A;  3A5W A;  3F0I A;  2NBS A;  1XCC A;  5CYY A;  1ILO A;  3H4K A;  1O8X A;  3US3 A;  1XW5 A;  3DXB A;  4ZIJ A;  4F9Z A;  5L71 A;  2WDU A;  2DJ3 A;  3FZ5 A;  3P2A A;  2BJX A;  2F3M A;  2AHE A;  1OKD A;  2PGT A;  4IVF A;  1OYJ A;  1ERT A;  5H5S A;  4TR1 A;  3ME8 A;  1S4B P;  1TTZ A;  1B4Q A;  3CBU A;  1AAZ A;  4NHZ A;  4ZBA A;  1HNA A;  1K3L A;  2CAQ A;  4BWS A;  2KHP A;  2XBQ A;  4V1A p;  3I69 A;  2G0F A;  1EWX A;  3MIX A;  3GH6 A;  3BBY A;  4IEL A;  4AKH A;  3WYW A;  1SL0 B;  2VL2 A;  3DD3 A;  2C4J A;  4JED A;  1HNC A;  4MPG A;  1FVK A;  1M2D A;  3GL3 A;  2H1G A;  3DIE A;  4TKY A;  3IC8 A;  1OC9 B;  2C1Y A;  1SD9 A;  1MTC A;  1F6M C;  3FHK A;  3EU4 A;  4KB3 A;  3L9V A;  3CHX C;  3GKK A;  2GT5 A;  2FGX A;  3VFI A;  3QMX A;  1UN2 A;  5EPF A;  2N5F A;  2H75 A;  3A3T A;  4MJB A;  5IIZ A;  3IOS A;  1K0A A;  1Z7P A;  3QR6 A;  2GQK A;  2PMT A;  4TR0 A;  3EE2 A;  4A5P A;  5D9T A;  2H72 A;  3TOT A;  4EDY A;  2VCV A;  4TOP A;  3TGZ A;  2R3X A;  1EZK A;  1TRW A;  1N25 A;  1KTE A;  3RFR C;  4ZL8 A;  5J9B A;  3IK9 A;  2LTK A;  1VF4 A;  3ZRD A;  4WR4 A;  1RW1 A;  13GS A;  3I6A A;  1T8E B;  1XWB A;  1B9X C;  1ZMA A;  1YEX A;  1T1V A;  3EMP A;  4MK3 A;  4V2L A;  1UC7 A;  1ZYP A;  2N5A A;  1HQO A;  2VCX A;  4N10 A;  3TRQ A;  2BTO T;  1EOH A;  1TRS A;  5IOW A;  2LQQ A;  1PX7 A;  4GST A;  3O76 A;  4ICY A;  4MJA A;  4G0I A;  2VLV A;  5IPH A;  3DGQ A;  1MD4 A;  3LXZ A;  1WRY A;  6GSW A;  5HR0 A;  2NDO A;  3ISO A;  1TRU A;  1OC8 A;  1IYI A;  2B1K A;  1X9S B;  3RPP A;  3HD5 A;  2H1D A;  2R6K A;  3MAK A;  1IYH A;  5DCG A;  1M2A A;  2A4H A;  2C3T A;  3GH9 A;  5D8I A;  2PER A;  3O3T A;  3Q19 A;  2YOI A;  1NW2 A;  1YDK A;  3ZFB A;  1XXU A;  2HZE A;  2DBC A;  3IXR A;  3LG6 A;  2H74 A;  3M1G A;  4K2X A;  4PI2 C;  3EPT A;  5KN2 A;  4HS1 A;  4TN8 A;  5ECO B;  2NTO A;  3FYG A;  1GTB A;  1PN9 A;  3IK7 A;  1HNB A;  4L0W A;  5DAK B;  4E8E A;  4PUA A;  4OD7 A;  3EVI A;  3MDK A;  3PR8 A;  3E3E A;  1JZR A;  5D9X A;  1PMT A;  3NOF A;  1O8W A;  1GUH A;  4ZL9 A;  2H76 A;  5BRT A;  2WVX A;  3PH9 A;  3ZIT A;  4ECI A;  2IFQ B;  2QGV A;  4FQU A;  5KN3 A;  1VRS D;  3EMX A;  1T4Y A;  4Q5R A;  2K18 A;  4LLR A;  5D96 A;  5GAP D;  2MMZ A;  2IN3 A;  4CY8 A;  2GST A;  3J7Y b;  4Q5F A;  1QXH A;  3R3E A;  2L5O A;  2WFC A;  4V2N A;  2VKZ G;  4KND A;  4JR6 A;  1JHB A;  1SKW B;  1EV9 A;  2M46 A;  4NPB A;  2HRK B;  1FB0 A;  4K7I A;  3GYK A;  5A5H B;  3TUE A;  5F07 A;  3ZIV A;  4TRX A;  5G2Z A;  3KZQ A;  4HDE A;  2X64 A;  3C1S A;  5C00 A;  4RQR A;  3RAZ A;  11GS A;  4CHS A;  4FIW A;  3EWL A;  5J5N A;  3UIW A;  4I97 A;  2VIM A;  4YQU A;  3DML A;  1B48 A;  2XHF A;  1U87 A;  4OFM A;  1BG1 A;  3FZA A;  1PA3 A;  1X5D A;  1XZO A;  2LS5 A;  3ZFL A;  4AKG A;  1NM3 A;  3CSJ A;  2YWN A;  2O85 A;  3HVN A;  2FWH A;  4EIP A;  4CDO A;  3WGE A;  1TK5 B;  2FY6 A;  3IV4 A;  2DJ1 A;  4KDU A;  2HE3 A;  20GS A;  5A4U A;  5KEJ A;  3HZ8 A;  3WGX A;  3EUR A;  2AJQ B;  3FR6 A;  4KA0 A;  1EGR A;  1M99 A;  4KDY A;  16GS A;  4MH3 A;  1R26 A;  1TDI A;  1YF1 A;  1GWC A;  3M9K A;  1V2A A;  3P7X A;  5G1K A;  4KW6 A;  3BCI A;  2MMO A;  1W4V A;  5LNK e;  4LMV A;  2B5Y A;  2VCW A;  5ID2 B;  3EC3 A;  1KEB A;  1T4Z A;  1OE7 A;  3CWG A;  2LV3 A;  4ULX A;  3GST A;  2B3S A;  2V6K A;  2JSZ A;  4GCI A;  1RK4 A;  3IAS 2;  4ZB7 A;  5F8B A;  1W89 A;  2HXK A;  3D4T A;  2YP6 A;  2HI7 A;  5J40 A;  3APQ A;  1I1I P;  5CRW A;  3QAV A;  3C71 A;  4AKI A;  4WBJ A;  1SL1 B;  2HSN A;  2AAW A;  4FXY P;  3WD6 A;  1QK8 A;  4F0B A;  4MPF A;  5ECL B;  2UV8 G;  3ZVJ D;  5ABR A;  4YKG A;  4AGS A;  4YAP A;  5HQP A;  3P90 A;  1K0N A;  3Q18 A;  5IMF A;  2HRF A;  1F2E A;  3A2W A;  3QCP A;  2X8G A;  2CZ2 A;  1XG8 A;  3LOR A;  5KOX A;  3MNG A;  1QMV A;  1ZGN A;  4V2M A;  3M0F A;  1XWA A;  2CVD A;  2REM A;  1K0O A;  4HZ2 A;  4JZQ A;  4TR1 B;  3GKN A;  1GLQ A;  1AC1 A;  4IJI A;  2K8S A;  5IMD A;  1TKD B;  2HQT A;  2R37 A;  4KSM A;  2FA4 A;  2DKH A;  4GWR A;  2PWJ A;  1XOA A;  1F9M A;  5A1N B;  5C04 A;  2CT6 A;  4EL1 A;  17GS A;  5ENU A;  2O8V B;  3CYN A;  1Z7R A;  5D9W A;  4N0Z A;  2X4A A;  1MDJ A;  4ZL7 A;  2YCD A;  1SJ6 A;  4TW5 A;  2ES7 A;  5DDL A;  3M3M A;  5DCH A;  4FO5 A;  3LSZ A;  5DJL A;  3D5J A;  1YEW C;  2FUG 2;  3IDV A;  2GSR A;  2CZ3 A;  6GSU A;  2VCQ A;  2FWF A;  1YQ1 A;  1XPV A;  5B8A A;  3ZZX A;  4IW9 A;  2IWT A;  1M3J A;  4TXV A;  2WW1 A;  5EL8 A;  2KOK A;  2QC7 A;  5JWQ B;  2PN8 A;  2EFC A;  2VLT A;  1K3Y A;  2H1L A;  1G6W A;  4NHW A;  2XPD A;  2IJY A;  3CXG A;  3GRX A;  4NV2 A;  1M9B A;  4ZB6 A;  4BL7 A;  2JU5 A;  1R4W A;  4ML6 A;  1QFN A;  2C8U A;  2VL3 A;  5COH A;  5GSS A;  4WF4 A;  1BAY A;  4IKH A;  1SK0 A;  4X43 A;  4Z7X A;  3HDC A;  4JRR A;  4PUR A;  4K1F A;  3M9J A;  2DIZ A;  1UVZ A;  2O87 A;  2NVL A;  1GUL A;  4J57 E;  2JZR A;  5A4V A;  2DJK A;  2PUK C;  3G9B A;  2VCT A;  4PQ1 A;  5G31 A;  1GSD A;  1Z3E A;  1A8L A;  1EEM A;  5D9V A;  5ECQ B;  2VAF A;  5INY A;  4DSQ A;  2HZF A;  5F05 A;  2O3E A;  3KM6 A;  4EXJ A;  4IP1 A;  3HY2 A;  3UVH A;  5DAL A;  1A23 A;  2ON7 A;  2EIR A;  6GSS A;  3KH7 A;  2GDR A;  3LGC A;  5CP1 A;  1FW1 A;  3NIV A;  1VGL A;  2H71 A;  1FHE A;  1XVW A;  4CY6 A;  3KD0 A;  2KP2 A;  1SK2 A;  4EUY A;  2HZE B;  2F8F A;  4CW9 A;  5H5Q A;  1WMJ A;  2OBK A;  3MWH A;  4PUF C;  1XWG A;  4MAB A;  2VM2 A;  1FO5 A;  3J7Y k;  4AKX B;  2CX3 A;  3DVW A;  3MYD A;  1PX6 A;  1YKA A;  4ECB A;  1THX A;  1PQN A;  4XRA A;  1GSY A;  3IA1 A;  3UEM A;  1YZX A;  1SKS B;  2DKI A;  1Q98 A;  2IMK A;  2VO4 A;  2JAD A;  2VOC A;  4W66 A;  3CSH A;  1DBY A;  3QPM A;  4G2E A;  5J47 A;  2KLX A;  3A5I A;  1Z9H A;  1OC3 A;  3Q74 A;  4HZ4 A;  2WVX B;  2B7K A;  3DYR A;  3VWV A;  2YV7 A;  4MZW A;  2DJ0 A;  1AQW A;  5JWO B;  18GS A;  3FY7 A;  4OCE A;  3HYP A;  5HR2 A;  2EFE A;  4QL7 A;  1B9Y C;  8GSS A;  5JCU A;  1O6J A;  1R7H A;  3KJY A;  3W8J A;  1GP1 A;  4QMK A;  3QAG A;  1SD8 A;  3DVX A;  2EFD A;  4XIH A;  4KCE A;  1TW9 A;  4O7H A;  2LJA A;  4GQF A;  2MYG A;  4TXO A;  4ILF A;  3RGB C;  2HSH A;  3N9J A;  4FYB A;  2PU9 C;  3KMN A;  2B5X A;  5KOW A;  4ISD A;  1SL2 B;  4HOJ A;  1MDI A;  3QDN A;  2OJL A;  1ABA A;  1U88 A;  4J56 E;  1ZZY A;  4IJ3 A;  5ECS A;  3KIJ A;  1LBK A;  1X5E A;  3WT2 A;  4PTS A;  2L6C A;  2IPA A;  3GSS A;  2A2P A;  1PSQ A;  4ZIL A;  3IHQ A;  1OKT A;  1VF2 A;  4NMU A;  1VF1 A;  4LL1 B;  1ZYQ B;  1JLV A;  2HRN A;  1A24 A;  2GZY A;  2GGT A;  3CTF A;  1ML6 A;  3DRN A;  3RHB A;  5GAN D;  3ZVJ A;  2CX4 A;  1T3B A;  4ZB8 A;  2I81 A;  1NSW A;  3ME7 A;  1TRV A;  5JCW A;  3Q6O A;  1BF5 A;  1T00 A;  2H73 A;  3H79 A;  5DQS A;  2YAN A;  4RUV A;  5CRE A;  3RPN A;  2YNX A;  3GUR A;  1MDK A;  3L4N A;  5DVB A;  1TI1 A;  5J9C A;  3WT1 A;  2YN1 A;  2LRN A;  5ECR B;  2YJH A;  1J08 A;  4ID0 A;  3W6G A;  3TKS E;  4HJ2 A;  3WGD A;  5FWG A;  2FA8 A;  4F0C A;  5IOX A;  5G30 A;  3F63 A;  1K3O A;  4K6X A;  3C1R A;  4AJ7 A;  2HSN B;  4NAX A;  1TJD A;  3KCM A;  3LW9 A;  4ZXG A;  2IMD A;  3TU3 B;  3FZ4 A;  1K0M A;  2WW2 A;  4K9Z A;  1N2A A;  4O5U A;  4QL9 A;  3TKS C;  4K7N A;  5ECM B;  1GSQ A;  1G7O A;  3PIN A;  1SJI A;  4KAE A;  5IQY A;  3APS A;  4E68 A;  2B7J A;  4XRD A;  4FYU A;  5G1L A;  4AF2 A;  2DJJ A;  4TR4 A;  1SVL A;  22GS A;  3LJR A;  5CRG A;  1SU9 A;  1GH2 A;  1TU7 A;  1Z5Y E;  3UJ1 A;  3C8E A;  7GSS A;  4K7O A;  2OE0 A;  3FMW A;  2GSQ A;  3GMF A;  1HD2 A;  4WET A;  1AXD A;  2L5L A;  1EEJ A;  2YZU A;  1SYX A;  4ZBB A;  4WXT A;  3VLN A;  3L9U A;  3F6D A;  2H6X A;  3IHG A;  2TRX A;  3VPQ A;  2C0F A;  1XWK A;  1TU8 A;  5B7C A;  4IP6 A;  3TJK A;  1V98 A;  5CO3 A;  2VM1 A;  3L78 A;  1F3A A;  3HZ4 A;  4MF6 A;  5JCG A;  4OFT A;  2A2R A;  2I3Y A;  3TB2 A;  3O6T A;  3VWU A;  1BYE A;  5JWR B;  4EO3 A;  4DVC A;  2OAC A;  5HFK A;  4GF0 A;  2WB9 A;  2MMA A;  2YWO A;  4KE3 A;  5IPG A;  4PNF A;  5DJM A;  4BVY A;  2CVB A;  1Y25 A;  4YH2 A;  4HQZ A;  1KNG A;  2X49 A;  5J41 A;  4BL7 B;  1M2B A;  4H86 A;  2C0D A;  3TRP A;  4L8E A;  4G01 A;  2X99 A;  2L59 A;  3UBK A;  2X8H A;  5CRH A;  1ERV A;  4YAV A;  4MH2 A;  3ZTL A;  4RI7 A;  4KUN A;  5IO2 A;  2DC5 A;  3TDG A;  1ON4 A;  1BJX A;  4K2D A;  4LL4 B;  9GSS A;  1LU4 A;  1JZD A;  4AJ8 A;  1WIK A;  1MD3 A;  2WVY A;  2WZ9 A;  1B8X A;  4TVE A;  4K0N A;  3F9U A;  1USB A;  2CQ9 A;  4FH8 A;  1S3D A;  4YQM A;  1EP7 A;  5G5F A;  3A2X A;  3EYT A;  2H30 A;  3QFB C;  5B6N A;  4BWQ A;  5DAL B;  1X9M B;  3KXO A;  3I43 A;  2EFH A;  5F0G A;  1E2Y A;  4HSC X;  4P3Y B;  2PVQ A;  5HFI A;  1VF3 A;  1WJK A;  3ERF A;  1Q4J A;  4MJE A;  4MMM A;  3FEU A;  1H4O A;  4BVX A;  4N3Z A;  1AQV A;  3TJF A;  1SVO A;  2R0C A;  4K5R A;  2PVO C;  3EU3 A;  3D6I A;  1BQ7 A;  3HJM A;  1PRX A;  4JBB A;  3P8W A;  1XW6 A;  1B4P A;  3IPZ A;  4Z2U A;  4ECC A;  2GZZ A;  4HJM A;  1LJR A;  2GSS A;  4ZB9 A;  4EKZ A;  5EY6 A;  4XS1 A;  2C80 A;  4OO5 A;  2MBS A;  5IO0 A;  3E0U A;  1PGT A;  4PNG A;  3GNJ A;  3DWV A;  3UBL A;  2IMF A;  1A0F A;  1XOB A;  2K6V A;  2LJR A;  2Z9S A;  4WBR D;  2GVP A;  2IMI A;  2AUV A;  2WW3 A;  5DQY A;  1ZYN A;  1GSU A;  5A34 A; 
#chains in the Genus database with same CATH homology
 3HCZ A;  5DBQ A;  3RHC A;  1TK0 B;  2RM6 A;  4QQ7 A;  4EF0 A;  1BG5 A;  3K8N A;  1ACV A;  2P31 A;  3F4T A;  2WRT A;  2EIQ A;  2O89 A;  3H93 A;  2GTU A;  5IMV A;  3CMI A;  4MJC A;  1EGO A;  4GSS A;  1XIY A;  1FB6 A;  5GST A;  3HA9 A;  1DSB A;  5LD0 A;  19GS A;  4G10 A;  3GN3 A;  1Z6M A;  4POK A;  2RII A;  5F06 A;  2OA7 A;  4X1U A;  3GA4 A;  1PL2 A;  3BJ5 A;  4KX4 A;  2FLS A;  6GSY A;  3TKS A;  2E2G A;  3GFK A;  1GNE A;  3D4M A;  3GX8 A;  6GST A;  2FD3 A;  5BMU A;  3TJJ A;  3EIN A;  2H66 A;  4O5R A;  2WS2 A;  4HU7 A;  4IQ1 A;  2H8L A;  2VD1 A;  2FWG A;  4G0L A;  3N5O A;  2HSY A;  2E7P A;  2F8A A;  2N5B A;  2ZUP A;  4K5S A;  2R0P A;  2LUS A;  4IBP A;  2B1L A;  5LCZ A;  2XPE A;  3FKF A;  4I8B A;  4PQI A;  4ACS A;  3CSI A;  3LEF A;  3VWW A;  5E59 A;  5G5E A;  1ZL9 A;  5ECP B;  4JE1 A;  1TK8 B;  3ZMK A;  4KDX A;  2IME A;  1GUK A;  3HVV A;  4NXI A;  2DML A;  3KTL A;  1K0B A;  3L0H A;  4I2T A;  10GS A;  2ZCT A;  4WKW A;  1FG4 A;  4AI6 A;  2F9S A;  1R5P A;  4NWY A;  1YVL A;  2HNL A;  1A2M A;  2A4V A;  3ERG A;  2H6Y A;  3TRX A;  4HI7 A;  2HYX A;  1KBN A;  4BPY A;  4MF7 A;  1G7E A;  2OE3 A;  2AV4 A;  3IAM 2;  1V40 A;  3VWX A;  1V57 A;  2DIY A;  2RUE A;  1K0C A;  3H8Q A;  2CAI A;  3QOU A;  1GLP A;  4XS4 A;  4YQV A;  2GLR A;  4XHM A;  4ZBD A;  1GNW A;  4GDF A;  1G6Y A;  1F37 A;  2IL3 A;  2OKA A;  1XBS A;  4HQS A;  5HR1 A;  3H1N A;  3F3R A;  1TP9 A;  3F4R A;  1A2L A;  1QQ2 A;  4MP4 A;  2A2S A;  4POM A;  2V6O A;  1R5A A;  2H19 A;  2C0G A;  1V9W A;  3GX0 A;  1Z6N A;  2V41 A;  4GRF A;  4KGI A;  4G0K A;  2GQL A;  2OT3 A;  3FRC A;  1ERW A;  1JFU A;  3UAP A;  2I1U A;  3F3Q A;  1M7T A;  3FZ9 A;  3IC4 A;  3L9S A;  1GSF A;  3HJP A;  4MZB A;  4IHU A;  2LRC A;  2PPT A;  3OR5 A;  2GQM A;  2YJ7 A;  4PX1 A;  3CRT A;  5IM9 A;  1RQM A;  3TJG A;  1YF0 A;  5A1N A;  2IIY A;  5AIV A;  4BA7 A;  1FVJ A;  4PQH A;  2DMM A;  4E8H A;  1TI3 A;  2V32 A;  2ZNM A;  3IBH A;  3HMJ G;  3C73 A;  3IRA A;  4D73 A;  1GTA A;  5IMC A;  2VUP A;  3HJO A;  1PL1 A;  2C3Q A;  3TKQ A;  2JZS A;  1YY7 A;  2VLU A;  5IMZ A;  2HSM A;  3D21 A;  5E4W A;  4AJ6 A;  4BVY B;  3BOA A;  2V1M A;  5FT3 A;  4OCF A;  4KSO A;  2K8V A;  4JR4 A;  1WPI A;  3TKP A;  3CTG A;  3KGK A;  4POL A;  3ZLP A;  3DEX A;  4L5O A;  2FHE A;  3G7I A;  2E2M A;  3UL3 A;  1SVM A;  3GL5 A;  2YV9 A;  3BCK A;  3F6F A;  2RLI A;  2QA2 A;  1DE2 A;  1WOU A;  4Q5Q A;  3AY8 A;  5HFG A;  1C72 A;  5KN0 A;  14GS A;  2BMX A;  3RBT A;  2ON5 A;  3KP9 A;  2FCH A;  2OAD A;  4N0V A;  3GTU A;  2LNT A;  2RM5 A;  3KMO A;  1QUW A;  3M8N A;  4F82 A;  3FR3 A;  1H75 A;  2VD0 A;  4G9H A;  4EVM A;  4BVX B;  4O32 A;  1SKR B;  1YKC A;  3F8U A;  2GZP A;  4XS6 A;  4FYC A;  1EOG A;  3ZRE A;  5J4U A;  4O5Q A;  5AGY A;  1QGV A;  3LWA A;  1J9B A;  4MDC A;  1X5C A;  4IN0 A;  4DSS A;  4WEY A;  1DE1 A;  2H70 A;  4F2I A;  5EVO A;  5GZZ B;  3KTB A;  2O5V A;  2QA1 A;  2I9H A;  4L0U A;  4PXO A;  2DLX A;  2WCI A;  2YWM A;  5AIX A;  2AYT A;  3KP8 A;  1GRX A;  1BX9 A;  1I9D A;  1NHO A;  3UVT A;  3UOM A;  3VI5 A;  2JSY A;  4YKF A;  3LYP A;  3VI7 A;  2RUF A;  3TJB A;  2YWI A;  4LMW A;  5D93 A;  3APO A;  4HUA A;  1SK1 A;  3R2Q A;  1SYR A;  2R5G A;  1T7P B;  4MF5 A;  4X0X A;  2EIO A;  4GTU A;  2H0H A;  2EC4 A;  2DJ2 A;  1O7U A;  1YJ6 A;  4POB A;  1OVN A;  5A34 B;  4Z2T A;  4HU9 A;  1TOF A;  2LQO A;  3F4S A;  4O92 A;  4HEA 2;  1A2J A;  1A8Y A;  4KCA A;  3W8S A;  1XVQ A;  4KF9 A;  2YPM A;  4RQX A;  4J2F A;  1AUC A;  1J0F A;  2I4A A;  3V1W A;  2FNO A;  3QAW A;  4DSR A;  3LQ7 A;  5FHI A;  3DKS A;  1JZO A;  4USS A;  2V2G A;  1PD2 1;  2H01 A;  1Y6E A;  3A2V A;  3KH9 A;  1M0U A;  4DEJ A;  1OC9 A;  1S3A A;  1K0D A;  4IGJ A;  2J9H A;  4MA9 A;  2HT9 A;  2NPB A;  2TIR A;  5BMU B;  4MZC A;  1ZYE A;  3GHA A;  3UAR A;  4OFN A;  1U3I A;  2LJK A;  4OMV A;  3D0Z A;  2AB6 A;  3ZYW A;  1AW9 A;  4EIQ A;  1AQX A;  2H0I A;  2B6M A;  2L4Q A;  4MLY A;  3ZIJ A;  4Z2R A;  3TKR A;  2OE1 A;  2DSA A;  1FAA A;  3SBC A;  3IE3 A;  2GT6 A;  1E6B A;  4F03 A;  3FK8 A;  3JCM L;  3HHV A;  2CVK A;  2K9F A;  5B8B A;  1WWJ A;  3HKR A;  1ERU A;  1XWC A;  5J4Y A;  4I6X A;  2LEG A;  3QD9 A;  2H0G A;  3G7J A;  2HRA A;  3I9V 2;  3FW2 A;  2E0Q A;  3NZN A;  1PKW A;  4ECJ A;  1O85 A;  4IS0 A;  1Y1U A;  4MNN A;  1GL8 A;  1ZCP A;  2KP1 A;  5D73 A;  5A4W A;  4EDZ A;  3SWL A;  3D22 A;  4G19 A;  2J23 A;  2LST A;  2O7K A;  2QKE A;  4I2U A;  4V1A g;  2P0G A;  3HXS A;  2VL2 C;  2YZH A;  5ELA A;  3ZML A;  1M9A A;  2UZ8 A;  2HLS A;  4XS4 B;  1YEP A;  2MBT A;  1SEN A;  3TCO A;  4N30 A;  5AIS A;  2MMN A;  1THO A;  5J3R A;  3E9J B;  1FOV A;  4XTS A;  3ZL5 A;  1MEK A;  2KUC A;  1XFL A;  4PGT A;  4L5L A;  2WGR A;  3QFA C;  2PBJ A;  5ECN B;  1AIU A;  2G2Q A;  3G7Y A;  5ELG A;  2P5Q A;  4MCU A;  4KH7 A;  2QSI A;  3LXT A;  4GQC A;  4EC0 A;  2H6Z A;  5DAK A;  3HVX A;  2P5R A;  2C0E A;  5HR3 A;  2LRT A;  1OAZ A;  4GLT A;  3IR4 A;  4EE0 A;  2X8C A;  1GTU A;  2H1B A;  2HFD A;  5KN1 A;  3ED3 A;  2M72 A;  1OE8 A;  3U6V A;  2D2Z A;  1EP8 A;  1WE0 A;  6GSV A;  4IQA A;  1GSS A;  1NHY A;  1JLW A;  1O81 A;  2H1A A;  3RDW A;  5AN1 A;  2IFQ A;  1PN0 A;  3VUR A;  2L57 A;  3U5R E;  1CQH A;  1SJZ A;  4TXO B;  2TRC P;  4TR3 A;  3PGT A;  1U3A A;  3GKX A;  1V58 A;  4D73 B;  2L4C A;  1HYU A;  1X0R A;  3KEB A;  2JZT A;  2HSM B;  2HRK A;  3HVS A;  1S3C A;  2CV4 A;  4LA1 A;  1JZW A;  5IMA A;  3GUS A;  2JAC A;  2M80 A;  3VK9 A;  1WP0 A;  2ALB A;  5A5H A;  2R0G A;  1FOH A;  1N8J A;  2B5E A;  5ECI B;  4ML1 A;  4OWY A;  2L6D A;  3ERW A;  3BD2 A;  4K8M A;  4GSN A;  4K0G A;  1BED A;  1ST9 A;  2MZC A;  4X4J A;  3FR9 A;  3PPU A;  4JU5 A;  1GTI A;  2XC2 A;  2R4V A;  6GSX A;  12GS A;  2LNS A;  3GV1 A;  1CQG A;  4Q5N A;  3GIX A;  3LFL A;  4WF5 A;  1F3B A;  3GKM A;  3VPT A;  4I5Q A;  1GSE A;  4WR5 A;  2LKU A;  3GTU B;  4NV5 A;  3S9F A;  1U6T A;  1PKZ A;  1I5G A;  2F51 A;  1DUG A;  2OBI A;  4GXZ A;  2WUL A;  1O73 A;  5H5R A;  3LYK A;  2R2J A;  1G0T A;  1ZOF A;  5ECK B;  1EV4 A;  5CRD A;  4RI6 A;  2JL4 A;  2VL9 A;  1TXX A;  4OO4 A;  5ECH B;  5ID2 A;  1TXU A;  2GS3 A;  5B6M A;  5J4V A;  4DSS B;  5CNW A;  3TOU A;  4N11 A;  3CRU A;  1XW9 A;  2VCZ A;  1URM A;  3MSZ A;  2XBI A;  1A0R P;  2WJU A;  3UMA A;  2C3N A;  1UA5 A;  2CA8 A;  5A5K A;  4XCS A;  1X9W B;  3C7M A;  5CAX A;  2FWE A;  1GUM A;  3A5W A;  3F0I A;  2NBS A;  1XCC A;  5CYY A;  1ILO A;  3H4K A;  1O8X A;  3US3 A;  1XW5 A;  3DXB A;  4ZIJ A;  4F9Z A;  5L71 A;  2WDU A;  2DJ3 A;  3FZ5 A;  3P2A A;  2BJX A;  2F3M A;  2AHE A;  1OKD A;  2PGT A;  4IVF A;  1OYJ A;  1ERT A;  5H5S A;  4TR1 A;  3ME8 A;  1TTZ A;  1B4Q A;  3CBU A;  1AAZ A;  4NHZ A;  4ZBA A;  1HNA A;  1K3L A;  2CAQ A;  4BWS A;  2KHP A;  2XBQ A;  4V1A p;  3I69 A;  2G0F A;  1EWX A;  3MIX A;  3GH6 A;  3BBY A;  4IEL A;  4AKH A;  3WYW A;  1SL0 B;  2VL2 A;  3DD3 A;  2C4J A;  4JED A;  1HNC A;  4MPG A;  1FVK A;  1M2D A;  3GL3 A;  2H1G A;  3DIE A;  4TKY A;  3IC8 A;  1OC9 B;  2C1Y A;  1SD9 A;  1MTC A;  1F6M C;  3FHK A;  3EU4 A;  4KB3 A;  3L9V A;  3GKK A;  2GT5 A;  2FGX A;  3VFI A;  3QMX A;  1UN2 A;  5EPF A;  2N5F A;  2H75 A;  3A3T A;  4MJB A;  5IIZ A;  3IOS A;  1K0A A;  1Z7P A;  3QR6 A;  2GQK A;  2PMT A;  4TR0 A;  3EE2 A;  4A5P A;  5D9T A;  2H72 A;  3TOT A;  4EDY A;  2VCV A;  4TOP A;  3TGZ A;  2R3X A;  1EZK A;  1TRW A;  1N25 A;  1KTE A;  4ZL8 A;  5J9B A;  3IK9 A;  2LTK A;  1VF4 A;  3ZRD A;  4WR4 A;  1RW1 A;  13GS A;  3I6A A;  1T8E B;  1XWB A;  1B9X C;  1ZMA A;  1YEX A;  1T1V A;  3EMP A;  4MK3 A;  4V2L A;  1UC7 A;  1ZYP A;  2N5A A;  1HQO A;  2VCX A;  4N10 A;  3TRQ A;  2BTO T;  1EOH A;  1TRS A;  5IOW A;  2LQQ A;  1PX7 A;  4GST A;  3O76 A;  4ICY A;  4MJA A;  4G0I A;  2VLV A;  5IPH A;  3DGQ A;  1MD4 A;  3LXZ A;  1WRY A;  6GSW A;  5HR0 A;  2NDO A;  3ISO A;  1TRU A;  1OC8 A;  1IYI A;  2B1K A;  1X9S B;  3RPP A;  3HD5 A;  2H1D A;  2R6K A;  3MAK A;  1IYH A;  5DCG A;  1M2A A;  2A4H A;  2C3T A;  3GH9 A;  5D8I A;  2PER A;  3O3T A;  3Q19 A;  2YOI A;  1NW2 A;  1YDK A;  3ZFB A;  1XXU A;  2HZE A;  2DBC A;  3IXR A;  3LG6 A;  2H74 A;  3M1G A;  4K2X A;  3EPT A;  5KN2 A;  4HS1 A;  4TN8 A;  5ECO B;  2NTO A;  3FYG A;  1GTB A;  1PN9 A;  3IK7 A;  1HNB A;  4L0W A;  5DAK B;  4E8E A;  4PUA A;  4OD7 A;  3EVI A;  3MDK A;  3PR8 A;  3E3E A;  1JZR A;  5D9X A;  1PMT A;  3NOF A;  1O8W A;  1GUH A;  4ZL9 A;  2H76 A;  5BRT A;  3PH9 A;  3ZIT A;  4ECI A;  2IFQ B;  2QGV A;  4FQU A;  5KN3 A;  1VRS D;  3EMX A;  1T4Y A;  4Q5R A;  2K18 A;  4LLR A;  5D96 A;  5GAP D;  2MMZ A;  2IN3 A;  4CY8 A;  2GST A;  3J7Y b;  4Q5F A;  1QXH A;  3R3E A;  2L5O A;  2WFC A;  4V2N A;  2VKZ G;  4KND A;  4JR6 A;  1JHB A;  1SKW B;  1EV9 A;  2M46 A;  4NPB A;  2HRK B;  1FB0 A;  4K7I A;  3GYK A;  5A5H B;  3TUE A;  5F07 A;  3ZIV A;  4TRX A;  5G2Z A;  3KZQ A;  4HDE A;  2X64 A;  3C1S A;  5C00 A;  4RQR A;  3RAZ A;  11GS A;  4CHS A;  4FIW A;  3EWL A;  5J5N A;  3UIW A;  4I97 A;  2VIM A;  4YQU A;  3DML A;  1B48 A;  2XHF A;  1U87 A;  4OFM A;  1BG1 A;  3FZA A;  1PA3 A;  1X5D A;  1XZO A;  2LS5 A;  3ZFL A;  4AKG A;  1NM3 A;  3CSJ A;  2YWN A;  2O85 A;  2FWH A;  4EIP A;  4CDO A;  3WGE A;  1TK5 B;  2FY6 A;  3IV4 A;  2DJ1 A;  4KDU A;  2HE3 A;  20GS A;  5A4U A;  5KEJ A;  3HZ8 A;  3WGX A;  3EUR A;  2AJQ B;  3FR6 A;  4KA0 A;  1EGR A;  1M99 A;  4KDY A;  16GS A;  4MH3 A;  1R26 A;  1TDI A;  1YF1 A;  1GWC A;  3M9K A;  1V2A A;  3P7X A;  5G1K A;  4KW6 A;  3BCI A;  2MMO A;  1W4V A;  5LNK e;  4LMV A;  2B5Y A;  2VCW A;  5ID2 B;  3EC3 A;  1KEB A;  1T4Z A;  1OE7 A;  3CWG A;  2LV3 A;  4ULX A;  3GST A;  2B3S A;  2V6K A;  2JSZ A;  4GCI A;  1RK4 A;  3IAS 2;  4ZB7 A;  5F8B A;  1W89 A;  2HXK A;  3D4T A;  2YP6 A;  2HI7 A;  5J40 A;  3APQ A;  5CRW A;  3QAV A;  3C71 A;  4AKI A;  4WBJ A;  1SL1 B;  2HSN A;  2AAW A;  3WD6 A;  1QK8 A;  4F0B A;  4MPF A;  5ECL B;  2UV8 G;  3ZVJ D;  5ABR A;  4YKG A;  4AGS A;  4YAP A;  5HQP A;  3P90 A;  1K0N A;  3Q18 A;  5IMF A;  2HRF A;  1F2E A;  3A2W A;  3QCP A;  2X8G A;  2CZ2 A;  3LOR A;  5KOX A;  3MNG A;  1QMV A;  1ZGN A;  4V2M A;  3M0F A;  1XWA A;  2CVD A;  2REM A;  1K0O A;  4HZ2 A;  4JZQ A;  4TR1 B;  3GKN A;  1GLQ A;  1AC1 A;  4IJI A;  2K8S A;  5IMD A;  1TKD B;  2HQT A;  2R37 A;  4KSM A;  2FA4 A;  2DKH A;  4GWR A;  2PWJ A;  1XOA A;  1F9M A;  5A1N B;  5C04 A;  2CT6 A;  4EL1 A;  17GS A;  5ENU A;  2O8V B;  3CYN A;  1Z7R A;  5D9W A;  4N0Z A;  2X4A A;  1MDJ A;  4ZL7 A;  2YCD A;  1SJ6 A;  4TW5 A;  2ES7 A;  5DDL A;  3M3M A;  5DCH A;  4FO5 A;  3LSZ A;  5DJL A;  3D5J A;  2FUG 2;  3IDV A;  2GSR A;  2CZ3 A;  6GSU A;  2VCQ A;  2FWF A;  1YQ1 A;  1XPV A;  5B8A A;  3ZZX A;  4IW9 A;  2IWT A;  4TXV A;  5EL8 A;  2KOK A;  2QC7 A;  5JWQ B;  2PN8 A;  2EFC A;  2VLT A;  1K3Y A;  2H1L A;  1G6W A;  4NHW A;  2XPD A;  2IJY A;  3CXG A;  3GRX A;  4NV2 A;  1M9B A;  4ZB6 A;  4BL7 A;  2JU5 A;  1R4W A;  4ML6 A;  1QFN A;  2C8U A;  2VL3 A;  5COH A;  5GSS A;  4WF4 A;  1BAY A;  4IKH A;  1SK0 A;  4X43 A;  4Z7X A;  3HDC A;  4JRR A;  4PUR A;  4K1F A;  3M9J A;  2DIZ A;  1UVZ A;  2O87 A;  2NVL A;  1GUL A;  4J57 E;  2JZR A;  5A4V A;  2DJK A;  2PUK C;  3G9B A;  2VCT A;  4PQ1 A;  5G31 A;  1GSD A;  1Z3E A;  1A8L A;  1EEM A;  5D9V A;  5ECQ B;  2VAF A;  5INY A;  4DSQ A;  2HZF A;  5F05 A;  3KM6 A;  4EXJ A;  4IP1 A;  3HY2 A;  3UVH A;  5DAL A;  1A23 A;  2ON7 A;  2EIR A;  6GSS A;  3KH7 A;  2GDR A;  3LGC A;  5CP1 A;  1FW1 A;  3NIV A;  1VGL A;  2H71 A;  1FHE A;  1XVW A;  4CY6 A;  3KD0 A;  2KP2 A;  1SK2 A;  4EUY A;  2HZE B;  2F8F A;  4CW9 A;  5H5Q A;  1WMJ A;  2OBK A;  3MWH A;  4PUF C;  1XWG A;  4MAB A;  2VM2 A;  1FO5 A;  3J7Y k;  4AKX B;  2CX3 A;  3DVW A;  3MYD A;  1PX6 A;  1YKA A;  4ECB A;  1THX A;  1PQN A;  4XRA A;  1GSY A;  3IA1 A;  3UEM A;  1YZX A;  1SKS B;  2DKI A;  1Q98 A;  2IMK A;  2VO4 A;  2JAD A;  2VOC A;  4W66 A;  3CSH A;  1DBY A;  3QPM A;  4G2E A;  5J47 A;  2KLX A;  3A5I A;  1Z9H A;  1OC3 A;  3Q74 A;  4HZ4 A;  2B7K A;  3DYR A;  3VWV A;  2YV7 A;  4MZW A;  2DJ0 A;  1AQW A;  5JWO B;  18GS A;  3FY7 A;  4OCE A;  3HYP A;  5HR2 A;  2EFE A;  4QL7 A;  1B9Y C;  8GSS A;  5JCU A;  1O6J A;  1R7H A;  3KJY A;  3W8J A;  1GP1 A;  4QMK A;  3QAG A;  1SD8 A;  3DVX A;  2EFD A;  4XIH A;  4KCE A;  1TW9 A;  4O7H A;  2LJA A;  4GQF A;  2MYG A;  4TXO A;  4ILF A;  2HSH A;  3N9J A;  4FYB A;  2PU9 C;  3KMN A;  2B5X A;  5KOW A;  4ISD A;  1SL2 B;  4HOJ A;  1MDI A;  3QDN A;  2OJL A;  1ABA A;  1U88 A;  4J56 E;  1ZZY A;  4IJ3 A;  5ECS A;  3KIJ A;  1LBK A;  1X5E A;  3WT2 A;  4PTS A;  2L6C A;  2IPA A;  3GSS A;  2A2P A;  1PSQ A;  4ZIL A;  3IHQ A;  1OKT A;  1VF2 A;  4NMU A;  1VF1 A;  4LL1 B;  1ZYQ B;  1JLV A;  2HRN A;  1A24 A;  2GZY A;  2GGT A;  3CTF A;  1ML6 A;  3DRN A;  3RHB A;  5GAN D;  3ZVJ A;  2CX4 A;  1T3B A;  4ZB8 A;  2I81 A;  1NSW A;  3ME7 A;  1TRV A;  5JCW A;  3Q6O A;  1BF5 A;  1T00 A;  2H73 A;  3H79 A;  5DQS A;  2YAN A;  4RUV A;  5CRE A;  3RPN A;  2YNX A;  3GUR A;  1MDK A;  3L4N A;  5DVB A;  1TI1 A;  5J9C A;  3WT1 A;  2YN1 A;  2LRN A;  5ECR B;  2YJH A;  1J08 A;  4ID0 A;  3W6G A;  3TKS E;  4HJ2 A;  3WGD A;  5FWG A;  2FA8 A;  4F0C A;  5IOX A;  5G30 A;  3F63 A;  1K3O A;  4K6X A;  3C1R A;  4AJ7 A;  2HSN B;  4NAX A;  1TJD A;  3KCM A;  3LW9 A;  4ZXG A;  2IMD A;  3TU3 B;  3FZ4 A;  1K0M A;  4K9Z A;  1N2A A;  4O5U A;  4QL9 A;  3TKS C;  4K7N A;  5ECM B;  1GSQ A;  1G7O A;  3PIN A;  1SJI A;  4KAE A;  5IQY A;  3APS A;  4E68 A;  2B7J A;  4XRD A;  4FYU A;  5G1L A;  4AF2 A;  2DJJ A;  4TR4 A;  1SVL A;  22GS A;  3LJR A;  5CRG A;  1SU9 A;  1GH2 A;  1TU7 A;  1Z5Y E;  3UJ1 A;  3C8E A;  7GSS A;  4K7O A;  2OE0 A;  3FMW A;  2GSQ A;  3GMF A;  1HD2 A;  4WET A;  1AXD A;  2L5L A;  1EEJ A;  2YZU A;  1SYX A;  4ZBB A;  4WXT A;  3VLN A;  3L9U A;  3F6D A;  2H6X A;  3IHG A;  2TRX A;  3VPQ A;  2C0F A;  1XWK A;  1TU8 A;  5B7C A;  4IP6 A;  3TJK A;  1V98 A;  5CO3 A;  2VM1 A;  3L78 A;  1F3A A;  3HZ4 A;  4MF6 A;  5JCG A;  4OFT A;  2A2R A;  2I3Y A;  3TB2 A;  3O6T A;  3VWU A;  1BYE A;  5JWR B;  4EO3 A;  4DVC A;  2OAC A;  5HFK A;  4GF0 A;  2WB9 A;  2MMA A;  2YWO A;  4KE3 A;  5IPG A;  4PNF A;  5DJM A;  4BVY A;  2CVB A;  1Y25 A;  4YH2 A;  4HQZ A;  1KNG A;  2X49 A;  5J41 A;  4BL7 B;  1M2B A;  4H86 A;  2C0D A;  3TRP A;  4L8E A;  4G01 A;  2X99 A;  2L59 A;  3UBK A;  2X8H A;  5CRH A;  1ERV A;  4YAV A;  4MH2 A;  3ZTL A;  4RI7 A;  4KUN A;  5IO2 A;  2DC5 A;  3TDG A;  1ON4 A;  1BJX A;  4K2D A;  4LL4 B;  9GSS A;  1LU4 A;  1JZD A;  4AJ8 A;  1WIK A;  1MD3 A;  2WZ9 A;  1B8X A;  4TVE A;  4K0N A;  3F9U A;  1USB A;  2CQ9 A;  4FH8 A;  1S3D A;  4YQM A;  1EP7 A;  5G5F A;  3A2X A;  3EYT A;  2H30 A;  3QFB C;  5B6N A;  4BWQ A;  5DAL B;  1X9M B;  3KXO A;  3I43 A;  2EFH A;  5F0G A;  1E2Y A;  4P3Y B;  2PVQ A;  5HFI A;  1VF3 A;  1WJK A;  3ERF A;  1Q4J A;  4MJE A;  4MMM A;  3FEU A;  1H4O A;  4BVX A;  4N3Z A;  1AQV A;  3TJF A;  1SVO A;  2R0C A;  4K5R A;  2PVO C;  3EU3 A;  3D6I A;  1BQ7 A;  3HJM A;  1PRX A;  4JBB A;  3P8W A;  1XW6 A;  1B4P A;  3IPZ A;  4Z2U A;  4ECC A;  2GZZ A;  4HJM A;  1LJR A;  2GSS A;  4ZB9 A;  4EKZ A;  5EY6 A;  4XS1 A;  2C80 A;  4OO5 A;  2MBS A;  5IO0 A;  3E0U A;  1PGT A;  4PNG A;  3GNJ A;  3DWV A;  3UBL A;  2IMF A;  1A0F A;  1XOB A;  2K6V A;  2LJR A;  2Z9S A;  4WBR D;  2GVP A;  2IMI A;  2AUV A;  5DQY A;  1ZYN A;  1GSU A;  5A34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...