4ACSA

Crystal structure of mutant gst a2-2 with enhanced catalytic efficiency with azathioprine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
219
structure length
219
Chain Sequence
KPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMIGDLSFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE A2
publication title Structure-Based Redesign of Gst A2-2 for Enhanced Catalytic Efficiency with Azathioprine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4acsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4acsA01
2C8UA 3H79A 4KNDA 3APQA 5B8AA 4ECIA 4V2LA 1U6TA 3V1WA 2FWFA 1MDJA 1GUMA 5L71A 1CQGA 2LS5A 1VRSD 1VF4A 2GDRA 3ZIJA 18GSA 1EEMA 3KTBA 1XZOA 1Q98A 3FZ4A 2KP1A 3R3EA 2NPBA 2VAFA 2PPTA 2M80A 2CX4A 1OC3A 3GSSA 1G6YA 3ZFLA 4N11A 1TJDA 1T7PB 2L4CA 3FW2A 2E2MA 4IQAA 2DJ0A 4NWYA 1O73A 3IA1A 1B4QA 2IIYA 1ZYEA 3DXBA 1AQVA 3F6DA 2YWOA 2J9HA 5HFKA 3GH9A 2FD3A 4HU7A 5ID2B 4KAEA 3QCPA 4Q5NA 3VI5A 2B5XA 2FHEA 4IELA 9GSSA 3DYRA 2GT6A 2HZEB 2RIIA 2IN3A 1VF2A 14GSA 1SL2B 5AIXA 2EIRA 3U5RE 4J2FA 1IYIA 2YANA 2LTKA 5GAPD 4CHSA 2C4JA 2L5OA 4K0GA 1MD4A 1XWKA 2IMKA 1QUWA 2OE1A 4OFMA 1BQ7A 2YWNA 2H30A 2NDOA 3NOFA 2L5LA 3WD6A 3HZ4A 3ZMLA 3TJJA 4FQUA 1OC9B 5D93A 2AHEA 3ZITA 5KN3A 3VFIA 3CYNA 1GTUA 3GTUB 2XPEA 4L0WA 1RQMA 3L4NA 3WT2A 3Q18A 1TW9A 3HY2A 4CDOA 2MYGA 2YJHA 4F9ZA 3GIXA 1XXUA 1PKZA 4POMA 4D73B 3C7MA 2J23A 1ZGNA 4K6XA 4F0CA 4KCEA 1GSFA 4KUNA 2H1AA 2E0QA 3I43A 1EZKA 2VCVA 2FA8A 3EYTA 3KP9A 1G7EA 4BVXB 1BYEA 3MAKA 1A8LA 10GSA 2VL3A 1OC9A 2IL3A 4QQ7A 1SENA 1PGTA 2HLSA 1SYRA 3FKFA 4GRFA 5CNWA 5ECQB 3M3MA 2HSNB 5C00A 3VPTA 5IQYA 3IBHA 1Z5YE 3P90A 3ZZXA 2MBTA 1SL1B 3FHKA 4TXVA 2H0HA 3TRQA 1X5EA 2X8HA 4KX4A 2DIZA 3TKRA 1BAYA 3RPPA 3GV1A 5GZZB 3FRCA 3QMXA 3EU4A 2ZNMA 5GSTA 2X8CA 5CRGA 2BMXA 4FYBA 3ZYWA 4YQVA 2DIYA 5D8IA 3EE2A 1HD2A 1YZXA 3FR6A 1TI3A 3TKSE 3JCML 2A4VA 2MMAA 3N9JA 2PMTA 2B7KA 1WMJA 3DRNA 3KEBA 1O8XA 1MDIA 3L9SA 2VOCA 4IBPA 2B5EA 2HE3A 1T1VA 1OC8A 5DALB 2A2RA 4N0ZA 2LNTA 4G10A 3I6AA 4JZQA 1ILOA 4TR1A 1ZL9A 4GQFA 1YQ1A 2YWIA 3IPZA 1BEDA 7GSSA 2VIMA 2YV9A 3GX0A 5DCGA 4MH3A 4TR0A 2WZ9A 5CP1A 2V6OA 2MMOA 2C1YA 1A0RP 2WRTA 2MZCA 5IO2A 1V57A 1K0AA 4G0LA 3F4RA 1HNBA 2FWHA 5IIZA 4IKHA 1FG4A 4XS6A 4EL1A 3F3RA 3CRTA 2CQ9A 3L78A 3TJKA 1NHOA 2DJJA 5FWGA 5CRDA 4AF2A 2QC7A 5DJLA 2WS2A 1DSBA 1I9DA 1S3DA 1GSYA 2RM5A 2IJYA 2HFDA 5GSSA 1M2BA 3F0IA 3MDKA 4O7HA 1T4YA 6GSXA 5JCUA 2R2JA 3ZRDA 1WJKA 3ERGA 2MMNA 1XPVA 3A2VA 1HQOA 3HJMA 1W89A 1O7UA 2H73A 2I9HA 4OMVA 3C1RA 1EWXA 4PNFA 1OVNA 3AY8A 1YJ6A 3VWXA 4PUAA 2VLTA 5IPGA 2FWEA 4GWRA 3UVHA 1VF3A 2OA7A 2HXKA 1QQ2A 1JZOA 2QSIA 3KIJA 4K9ZA 2YJ7A 4PURA 2LRCA 2F8AA 1TTZA 2H1DA 1ZYQB 3MNGA 2I1UA 4X43A 3GKKA 3CSIA 1SL0B 1AC1A 3HKRA 1ACVA 1GWCA 2ON5A 3VWWA 3ZIVA 5J4UA 5JWOB 1U3AA 1E6BA 1YDKA 2LQOA 1RK4A 4ECBA 1PD21 1EP7A 5CREA 2VO4A 4MF6A 3ZVJD 5ECNB 3TKSA 1T00A 3BOAA 4HZ2A 2VL2C 3GYKA 5EPFA 1IYHA 3GL5A 3EURA 4NXIA 4TR3A 1GLPA 4MJAA 5BMUA 4GSSA 2IMIA 5A4WA 1PMTA 3CRUA 4KE3A 3EMXA 2DJKA 2PUKC 3ERWA 3P2AA 2GZYA 3WYWA 1U3IA 2YNXA 4JEDA 3ED3A 2AAWA 1LJRA 2O87A 2JSZA 2P0GA 3TGZA 3CTFA 4F0BA 4IS0A 5DAKA 5IMDA 19GSA 1A2MA 3H4KA 4WXTA 3DVXA 5IMAA 5GAND 5IMCA 3HVVA 3EMPA 4AJ8A 4EKZA 4KF9A 3IE3A 4YAVA 1V40A 3IV4A 4K7OA 3ME8A 3GA4A 3PPUA 2VCZA 4IJIA 4CW9A 4NV2A 4EDYA 4HEA2 4OO5A 4I97A 4I5QA 2FWGA 3N5OA 4ML6A 1YF1A 2CT6A 3ZMKA 2CAQA 2K9FA 3TB2A 2VLUA 5CRWA 1EEJA 3VWVA 2G0FA 4WKWA 3KM6A 4TXOA 5ECSA 1ZZYA 2P5RA 4XS4A 2HI7A 4G0KA 4PX1A 5A4VA 2ZCTA 4MJBA 5EL8A 1GSDA 3DIEA 4LMVA 3KGKA 1YY7A 1B9YC 1ZCPA 1OAZA 2AB6A 4YQMA 2KUCA 1KBNA 3FZAA 3G7JA 2H6ZA 3NIVA 2C0FA 2GGTA 3DWVA 2H0GA 4MPFA 3IK7A 2PVOC 1M2AA 5IMFA 4IN0A 2PBJA 4EDZA 4KCAA 3KTLA 16GSA 3F8UA 2VCQA 5JWQB 2GT5A 1ON4A 1SJIA 1G6WA 4PGTA 3BD2A 2GQLA 4KA0A 3KMOA 4EVMA 4JR4A 3VPQA 4BL7B 2B3SA 2BTOT 5G5FA 1EV4A 4WF4A 2LV3A 4MMMA 2N5FA 2R4VA 3LQ7A 4LL1B 2X8GA 3KCMA 1THXA 4PTSA 5G5EA 4MCUA 5E59A 1XWCA 5CO3A 2H76A 1FVKA 4HQZA 5A4UA 3TJGA 1ERWA 1XFLA 3A5WA 3TUEA 3TJBA 3G7IA 1PRXA 2YPMA 2AYTA 4POLA 4MABA 2L59A 4MF5A 2HSMB 1XVQA 5ELGA 2E7PA 4O32A 1GH2A 2V1MA 4MH2A 1A2LA 4ID0A 3KH9A 2LUSA 4NAXA 2RM6A 3M8NA 1X9MB 4ISDA 2K6VA 1R26A 3MSZA 5G31A 5H5SA 1A23A 4NV5A 4MPGA 2AUVA 3VWUA 5INYA 3E3EA 3NZNA 3CMIA 1U87A 2RUFA 1WP0A 1M0UA 1TKDB 4I6XA 4HOJA 4V1Ag 2OACA 1FB6A 2AV4A 2R5GA 4DSSB 5LCZA 4YAPA 3O76A 5LNKe 5J9CA 3R2QA 2YWMA 2NBSA 3QFBC 1UA5A 2HSYA 3QD9A 5IM9A 3DD3A 1GLQA 2R37A 2HSMA 4GTUA 5ID2A 1B9XC 3LYPA 3PGTA 4KW6A 4I2UA 1OE8A 1FB0A 4IJ3A 1DBYA 2HZEA 2V2GA 5HR1A 1GTAA 2DBCA 5AGYA 4RQRA 2GVPA 5HFGA 2VCWA 2N5AA 1WRYA 4NMUA 3EWLA 1R5PA 5DDLA 3HCZA 4XRAA 1GSQA 5IOWA 4YQUA 1B8XA 3O6TA 3ME7A 3LGCA 4IW9A 2H6XA 4Z7XA 3W6GA 2DMMA 1SKSB 5DBQA 5ECIB 4BVYB 2VL9A 1EOGA 1GNEA 5B6NA 1C72A 2PU9C 3GTUA 4LA1A 2PVQA 3D22A 5A5KA 3FZ9A 2CV4A 3F3QA 4IP1A 2HQTA 3GSTA 4GF0A 1R7HA 4EO3A 2VD0A 1F9MA 5D9VA 2CZ2A 5C04A 1CQHA 2WDUA 4XS1A 1H75A 3WT1A 1M9AA 4E8HA 4D73A 1BG5A 2OJLA 2C0DA 1TI1A 2VD1A 2FY6A 1NM3A 2C3QA 5CAXA 3HJPA 1TP9A 4BVXA 2X64A 1SU9A 1TK8B 4K7IA 4EC0A 1XOBA 5ECKB 1XOAA 2K8SA 3H8QA 3F4TA 5F07A 3KMNA 4BVYA 3UBKA 2LJKA 2CA8A 4ZIJA 4MA9A 1SKRB 4ZL9A 4FYUA 3E9JB 3Q6OA 1XCCA 1EOHA 3GKMA 2WB9A 1K3YA 5EVOA 3M0FA 3ZLPA 3FR9A 2G2QA 1AUCA 3L9UA 1GULA 3PINA 4OD7A 2XBIA 3A2WA 1GTIA 1Z7PA 3IOSA 6GSVA 3QPMA 5HQPA 4HJ2A 4DSRA 2GLRA 2XBQA 11GSA 1X0RA 3EVIA 3EC3A 5D9XA 2YP6A 3FK8A 2DJ1A 3M9KA 4ZXGA 4OO4A 3GN3A 4X1UA 4XHMA 5DALA 1A8YA 2LJRA 2B5YA 1EGRA 2XHFA 2FUG2 3M1GA 4TN8A 2TIRA 2ZUPA 5J9BA 1JLVA 4POBA 4MF7A 2GSTA 3ISOA 1N8JA 3KP8A 4Q5FA 3VLNA 1XIYA 3RBTA 1T4ZA 2L6CA 4IP6A 1XBSA 4F82A 1PL2A 1Z9HA 1Z3EA 3CXGA 2IMEA 1WOUA 4AJ7A 3UAPA 1QMVA 1PL1A 5DCHA 1GRXA 4TR4A 1Q4JA 2I3YA 2YOIA 5DQYA 1JHBA 6GSWA 4K7NA 2R6KA 1QXHA 4HU9A 5F06A 4ZB9A 3LFLA 1V58A 1URMA 5H5QA 2P5QA 3F9UA 1AAZA 3QAWA 2H71A 3FZ5A 5AISA 2L4QA 2MBSA 3GH6A 5EY6A 1SK0A 2FGXA 2CVDA 3IRAA 4DEJA 1JZRA 5IO0A 4KDYA 2WCIA 2KOKA 3ZVJA 5FHIA 3ZTLA 3DGQA 4X0XA 5DVBA 1GUKA 4G0IA 1M9BA 3TRXA 1LBKA 4I2TA 5B6MA 3CBUA 2B7JA 3DMLA 5ECHB 2C3TA 4MZCA 2WGRA 3BJ5A 3UARA 1K0OA 4ECCA 2XC2A 3A3TA 4K0NA 2FLSA 4TKYA 4MLYA 6GSTA 3RHBA 1B48A 2YN1A 22GSA 2IFQB 3RDWA 1S3AA 3KXOA 3E0UA 4ZILA 3APSA 3ZL5A 3HA9A 4JBBA 2JZSA 2GSSA 5D9TA 2F51A 5HR0A 3APOA 1T3BA 4KSMA 1R5AA 5D9WA 4ML1A 4OCFA 4OCEA 4P3YB 2MMZA 3FR3A 2DJ3A 2XPDA 2H1BA 4V2MA 1ERTA 3D4MA 2TRXA 1NHYA 1K0MA 3SWLA 3GURA 4MJCA 2H75A 4J57E 1O85A 2VCXA 3GNJA 3F63A 3C1SA 4GCIA 1K3LA 2VM2A 4JU5A 4OFTA 4NHWA 2YZHA 3BCIA 2OADA 1TRWA 4GSNA 3UJ1A 2PN8A 4Q5QA 4AJ6A 1O6JA 5ECOB 1TRSA 1PSQA 4O5RA 1DE1A 2DJ2A 3RAZA 2LNSA 4LLRA 3QOUA 3IXRA 4KGIA 3GL3A 1TDIA 2RUEA 3I9V2 4FO5A 2O85A 2H8LA 1EP8A 2EC4A 4WR5A 3IDVA 1ERVA 2DC5A 3UEMA 2JZTA 4JE1A 2DMLA 1F2EA 3SBCA 5B7CA 2H66A 1AW9A 2REMA 2DLXA 4DSQA 13GSA 2ON7A 3GFKA 3W8JA 3TKSC 4EXJA 3C71A 3ZFBA 4OFNA 1ABAA 3HVSA 3BBYA 4PQHA 2F9SA 4G2EA 1PN9A 4AGSA 4WEYA 3VI7A 2OE3A 5ENUA 3TOUA 4FH8A 1K0BA 1VF1A 2P31A 3UVTA 4H86A 1Y6EA 1YF0A 1SKWB 2JACA 20GSA 4BWQA 2LSTA 4EE0A 2B6MA 4GXZA 2CVBA 1K0DA 1U88A 4NHZA 4F2IA 1E2YA 2UZ8A 2GZZA 4KSOA 2E2GA 2KHPA 1VGLA 1GSUA 5D96A 2JU5A 1PA3A 5CYYA 5CRHA 4ZBDA 4POKA 2YCDA 3VURA 3O3TA 2HRFA 1V2AA 1PX7A 1AIUA 3HXSA 2VCTA 2O7KA 1USBA 1JZWA 4ZB6A 1HNCA 3QAGA 2V41A 4WBRD 1F37A 2I81A 3LYKA 1EV9A 3IC4A 1AQXA 3P7XA 2NTOA 3F6FA 3F4SA 5IPHA 1SK2A 5J41A 1K0CA 2CVKA 1X5DA 2PWJA 4MZBA 4BL7A 5IMVA 4IQ1A 2KP2A 4L0UA 4MP4A 2CX3A 4OWYA 3UMAA 4IHUA 3D4TA 3OR5A 1M7TA 3D21A 5KN0A 4BWSA 1OKTA 6GSYA 3GKXA 2KLXA 3EU3A 4ECJA 3QAVA 1SJZA 5ECMB 3D5JA 1G7OA 1YEXA 4XIHA 4K1FA 3GMFA 3DKSA 5LD0A 2GQKA 3KZQA 3IC8A 2IPAA 2GSQA 1XVWA 1K0NA 2EIQA 4YH2A 4KDXA 5KN2A 4E8EA 5KEJA 1X5CA 1KEBA 5HR3A 3DEXA 1M99A 1MTCA 2LKUA 3GUSA 5COHA 5F0GA 4TW5A 4XTSA 3P8WA 1W4VA 2LJAA 1TK0B 1TU8A 3CTGA 1QK8A 2VUPA 4J56E 2HYXA 1BX9A 1FO5A 2DSAA 5AN1A 2GQMA 2FCHA 3H1NA 3QDNA 4HI7A 4DSSA 3G9BA 1WWJA 1FOVA 1TRVA 3UOMA 5ECRB 1JFUA 4G19A 4GSTA 2C80A 2TRCP 2OBKA 2WJUA 3TOTA 5J5NA 2IWTA 2V32A 8GSSA 1R4WA 2VLVA 3LORA 1SJ6A 3UIWA 4EUYA 1TOFA 2HRNA 3TCOA 2M46A 3GX8A 1A2JA 1WPIA 4TR1B 2A2SA 3J7Yb 2LRTA 3CSHA 1PKWA 2V6KA 1J9BA 1ERUA 5DQSA 1FAAA 4BA7A 3UL3A 3KJYA 2H72A 2C0GA 4HUAA 2OKAA 1DUGA 1GTBA 2CZ3A 2QGVA 4NPBA 2GTUA 3WGXA 2H1GA 2PGTA 3HDCA 3L0HA 2H74A 2HSHA 1T8EB 4ILFA 2H19A 1GNWA 4V2NA 4K2DA 3IHQA 4LMWA 4O92A 4ZBAA 3TKQA 4RI6A 3C8EA 4WF5A 5ABRA 5ECPB 2K8VA 2L6DA 4RI7A 1AXDA 4TOPA 3HYPA 4IGJA 3LWAA 4Q5RA 2FNOA 1DE2A 3LSZA 2IMFA 17GSA 1Z7RA 3WGEA 1JLWA 2ES7A 1SD8A 2EIOA 2OBIA 4WBJA 1NSWA 5IOXA 2K18A 1ST9A 2VL2A 4N30A 1OE7A 1B4PA 1F3AA 4BPYA 3M9JA 3H93A 2JL4A 4FIWA 4HZ4A 5G1KA 3I69A 2LRNA 1TRUA 2HRKB 3FYGA 1UN2A 4K8MA 1SK1A 4QL9A 4HQSA 3TRPA 4ZBBA 2O89A 2HNLA 2C3NA 3WGDA 4GLTA 1OKDA 6GSUA 3S9FA 1A24A 5FT3A 2FA4A 4KDUA 2D2ZA 12GSA 5H5RA 2GS3A 3TDGA 3U6VA 1GSSA 5F05A 1JZDA 2BJXA 2AJQB 2YV7A 1GUHA 3RHCA 4TRXA 4HJMA 1THOA 2M72A 1QFNA 4IVFA 2VM1A 4V1Ap 1FVJA 4JRRA 2B1LA 1FW1A 4ZL8A 4XCSA 3UBLA 3TKPA 2I4AA 5KN1A 3ERFA 1XWBA 1YKAA 4PNGA 3VK9A 3PR8A 3ZREA 3TJFA 1S3CA 5D73A 2O8VB 2H70A 2HRKA 5JCGA 4EF0A 1I5GA 4HS1A 1LU4A 1MDKA 3RPNA 2OE0A 4ZB8A 1PQNA 2QKEA 4USSA 4G9HA 2RLIA 1ZOFA 1Y25A 4PXOA 4QL7A 1KNGA 4HDEA 1A0FA 5G2ZA 2H6YA 1AQWA 4KH7A 3IR4A 2C0EA 1N2AA 3GRXA 1XW6A 2GZPA 3C73A 4RQXA 5DJMA 3D6IA 1SYXA 3IK9A 4WETA 1X9WB 1HYUA 1V98A 4KB3A 4FYCA 1PX6A 2PERA 5DAKB 5HFIA 3IAS2 1UC7A 1O81A 2Z9SA 3BCKA 1GSEA 5F8BA 6GSSA 3LEFA 4PQ1A 2WFCA 3D0ZA 2JADA 3IAM2 2X99A 4L8EA 1KTEA 1RW1A 3G7YA 3PH9A 3KD0A 1BJXA 3KH7A 4GQCA 4ACSA 2N5BA 2L57A 4RUVA 1WE0A 4N0VA 3LXZA 5G1LA 2NVLA 1XWAA 2WULA 3HVXA 4DVCA 3GKNA 4MK3A 3Q19A 2F8FA 2ALBA 4WR4A 1UVZA 2IMDA 1V9WA 3DVWA 3A2XA 4MZWA 3HD5A 1HNAA 1QGVA 1Z6NA 3LXTA 2HRAA 5E4WA 4ZL7A 5ELAA 3FY7A 1F3BA 2HZFA 1K3OA 4TXOB 2H01A 2GSRA 3Q74A 2IFQA 1OYJA 3HHVA 1EGOA 4PQIA 5HR2A 1YKCA 4XS4B 3MWHA 3CSJA 4PUFC 1XW9A 1GP1A 2LQQA 2B1KA 1M2DA 5IMZA 3J7Yk 3HJOA 2JZRA 2LEGA 3FEUA 2CAIA 5JCWA 2JSYA 1ZMAA 4LL4B 1H4OA 2YZUA 3K8NA 1TK5B 3QFAC 5JWRB 3GHAA 1YEPA 1MD3A 4JR6A 5AIVA 4L5OA 1O8WA 4L5LA 5G30A 1J08A 1SD9A 3HZ8A 1G0TA 1XW5A 4N10A 1Z6MA 3US3A 4TVEA 3LJRA 1TXXA 1ML6A 1J0FA 1X9SB 5J3RA 3QR6A 3L9VA 2F3MA 4F03A 3W8SA 3EINA 1GL8A 5B8BA 1FHEA 1XWGA 4ULXA 5ECLB 4MJEA 1TU7A 4XRDA 1F6MC 2H0IA 1NW2A 1WIKA 2R3XA 1MEKA 2HT9A 3LG6A 4I8BA 4MDCA
chains in the Genus database with same CATH superfamily
2C8UA 3H79A 4KNDA 3APQA 5B8AA 4ECIA 4V2LA 1U6TA 3V1WA 2FWFA 1MDJA 1GUMA 5L71A 1CQGA 2LS5A 1VRSD 1VF4A 2GDRA 3ZIJA 18GSA 1EEMA 3KTBA 1XZOA 1Q98A 3FZ4A 2KP1A 3R3EA 2NPBA 2VAFA 2PPTA 2M80A 2CX4A 1OC3A 3GSSA 1G6YA 3ZFLA 4N11A 1TJDA 1T7PB 2L4CA 3FW2A 2E2MA 4IQAA 2DJ0A 4NWYA 1O73A 1PFOA 3IA1A 1B4QA 2IIYA 1ZYEA 3DXBA 3F6DA 1AQVA 2YWOA 2J9HA 5HFKA 3GH9A 2FD3A 4HU7A 5ID2B 4KAEA 3QCPA 4Q5NA 3VI5A 2B5XA 2FHEA 4IELA 9GSSA 3DYRA 2GT6A 2HZEB 2RIIA 3CWGA 2IN3A 1VF2A 14GSA 1SL2B 5AIXA 2EIRA 3U5RE 3LW9A 4J2FA 1IYIA 2YANA 2LTKA 5GAPD 4CHSA 2C4JA 2L5OA 4K0GA 1MD4A 1XWKA 2IMKA 1QUWA 2OE1A 4OFMA 1BQ7A 2YWNA 2H30A 2NDOA 3NOFA 1S4BP 2L5LA 3WD6A 3HZ4A 3ZMLA 3TJJA 2QA2A 4FQUA 1OC9B 5D93A 2AHEA 3ZITA 5KN3A 3VFIA 3CYNA 1GTUA 3GTUB 2XPEA 4L0WA 1RQMA 1I1IP 3L4NA 3WT2A 3Q18A 1TW9A 3HY2A 4CDOA 2O3EA 2MYGA 2YJHA 4F9ZA 3GIXA 1XXUA 1PKZA 4POMA 4D73B 3C7MA 2J23A 1ZGNA 4K6XA 4F0CA 4KCEA 1GSFA 4KUNA 2H1AA 2E0QA 3I43A 1EZKA 2VCVA 2FA8A 3EYTA 3KP9A 4MNNA 1G7EA 4BVXB 4AKXB 1BYEA 3MAKA 1A8LA 10GSA 2VL3A 1OC9A 2IL3A 4QQ7A 2X4AA 1SENA 1PGTA 2HLSA 1SYRA 3FKFA 4GRFA 5CNWA 5ECQB 2DKIA 3M3MA 4YKGA 2HSNB 5C00A 3VPTA 5IQYA 3IBHA 1Z5YE 5J40A 3P90A 3ZZXA 2MBTA 1SL1B 3FHKA 5BRTA 4TXVA 2H0HA 3TRQA 1X5EA 2X8HA 4KX4A 2DIZA 3TKRA 1BAYA 3RPPA 2UV8G 3GV1A 5GZZB 4PI2C 4EIPA 3FRCA 3QMXA 3EU4A 2ZNMA 5GSTA 2X8CA 5CRGA 2BMXA 4FYBA 3ZYWA 4YQVA 2DIYA 5D8IA 3EE2A 1HD2A 1YZXA 3FR6A 1TI3A 3TKSE 3JCML 2A4VA 2MMAA 3N9JA 4X4JA 2PMTA 2B7KA 1WMJA 3DRNA 3KEBA 1O8XA 1MDIA 3L9SA 2VOCA 4IBPA 2B5EA 2HE3A 1T1VA 1OC8A 5DALB 2A2RA 4N0ZA 2LNTA 1M3JA 4G10A 3I6AA 4JZQA 1ILOA 3FMWA 4TR1A 1ZL9A 4GQFA 1YQ1A 2YWIA 3IPZA 1BEDA 7GSSA 2VIMA 2YV9A 3GX0A 5DCGA 4MH3A 4TR0A 1XG8A 2WZ9A 5CP1A 2V6OA 2MMOA 2C1YA 1A0RP 2WRTA 3CQFA 2MZCA 1BF5A 5IO2A 1V57A 1K0AA 4G0LA 3MIXA 4AKHA 3F4RA 2O36A 1HNBA 2FWHA 5IIZA 4IKHA 1FG4A 4XS6A 4EL1A 3F3RA 3CRTA 2CQ9A 3L78A 3TJKA 1NHOA 2DJJA 5FWGA 5CRDA 5A5HB 4AF2A 2QC7A 5DJLA 2WS2A 1DSBA 1I9DA 1S3DA 1GSYA 2RM5A 2IJYA 4AKGA 2HFDA 5GSSA 1M2BA 3F0IA 2O5VA 3MDKA 4O7HA 3A5IA 1T4YA 6GSXA 4G01A 5JCUA 2R2JA 3ZRDA 1WJKA 3ERGA 2MMNA 1XPVA 3A2VA 1HQOA 3HJMA 1W89A 1O7UA 2H73A 2I9HA 4OMVA 3C1RA 1EWXA 4PNFA 1OVNA 2EFEA 3AY8A 1YJ6A 3VWXA 4PUAA 2VLTA 5IPGA 2FWEA 4GWRA 3UVHA 1VF3A 2OA7A 2HXKA 1QQ2A 1JZOA 2QSIA 3KIJA 4K9ZA 2A2PA 2YJ7A 5A5HA 4PURA 2LRCA 2F8AA 1TTZA 2H1DA 1ZYQB 3MNGA 2I1UA 4X43A 4K5RA 2WVYA 3GKKA 3CSIA 2VKZG 1SL0B 1AC1A 3HKRA 1ACVA 1GWCA 2ON5A 3VWWA 3ZIVA 5J4UA 5JWOB 1U3AA 1E6BA 1YDKA 2LQOA 1RK4A 1FOHA 4ECBA 1PD21 3IHGA 1EP7A 5CREA 2VO4A 4MF6A 3ZVJD 5ECNB 3TKSA 1T00A 3BOAA 4HZ2A 2VL2C 3GYKA 5EPFA 1IYHA 3GL5A 3EURA 4NXIA 4TR3A 1GLPA 4MJAA 5BMUA 4GSSA 2IMIA 5A4WA 1PMTA 3CRUA 4KE3A 3EMXA 2DJKA 2PUKC 3ERWA 2H1LA 3P2AA 2GZYA 3WYWA 1U3IA 2YNXA 4JEDA 3ED3A 2AAWA 1LJRA 2O87A 2JSZA 2P0GA 3TGZA 3CTFA 4F0BA 4IS0A 5DAKA 5IMDA 19GSA 1A2MA 3H4KA 4WXTA 3DVXA 5IMAA 5GAND 5IMCA 3HVVA 1PN0A 3EMPA 4AJ8A 4EKZA 4KF9A 3IE3A 4YAVA 1V40A 3IV4A 4K7OA 3ME8A 1ZYPA 3GA4A 3PPUA 2VCZA 4IJIA 4CW9A 4NV2A 4EDYA 4HEA2 4OO5A 4I97A 4I5QA 2FWGA 4EIQA 3N5OA 4ML6A 1YF1A 2CT6A 3ZMKA 2CAQA 5KOWA 2K9FA 3TB2A 2VLUA 5CRWA 1EEJA 3VWVA 2G0FA 4WKWA 3KM6A 4TXOA 5ECSA 1ZZYA 2P5RA 4XS4A 2HI7A 4G0KA 4PX1A 5A4VA 2ZCTA 4MJBA 5EL8A 1GSDA 3DIEA 4LMVA 3KGKA 1YY7A 1B9YC 1ZCPA 1OAZA 2AB6A 4YQMA 2KUCA 1KBNA 3FZAA 3G7JA 2H6ZA 3NIVA 2C0FA 2GGTA 3DWVA 2H0GA 4MPFA 3IK7A 2PVOC 1M2AA 5IMFA 4IN0A 2PBJA 4EDZA 4KCAA 3KTLA 16GSA 3F8UA 2VCQA 5JWQB 2GT5A 1ON4A 1SJIA 1G6WA 2WVXB 4PGTA 3BD2A 2GQLA 4KA0A 3KMOA 4EVMA 4JR4A 3VPQA 4BL7B 2B3SA 2BTOT 5G5FA 1EV4A 4ICYA 4WF4A 2LV3A 4MMMA 2N5FA 2R4VA 3LQ7A 4LL1B 2X8GA 3KCMA 1THXA 4PTSA 5G5EA 4MCUA 5KOXA 5E59A 1XWCA 5CO3A 2H76A 1FVKA 4HQZA 5A4UA 3TJGA 1ERWA 1XFLA 3A5WA 3TUEA 4CY8A 3TJBA 3G7IA 1PRXA 2YPMA 2AYTA 4POLA 4MABA 2L59A 4MF5A 2HSMB 1XVQA 5ELGA 2E7PA 4O32A 4I8BA 1GH2A 2V1MA 4QMKA 4MH2A 1A2LA 4ID0A 3KH9A 2LUSA 4NAXA 2RM6A 3M8NA 1X9MB 4ISDA 2K6VA 1R26A 3MSZA 5G31A 5H5SA 1A23A 4NV5A 4MPGA 2AUVA 3VWUA 5INYA 3E3EA 2A4HA 3NZNA 3CMIA 1U87A 2RUFA 1WP0A 1M0UA 1TKDB 4I6XA 4HOJA 4V1Ag 2OACA 1FB6A 2AV4A 2R5GA 4DSSB 5LCZA 4YAPA 4K5SA 3O76A 5LNKe 5J9CA 3R2QA 2YWMA 5J4YA 2NBSA 3QFBC 1UA5A 2HSYA 3QD9A 5IM9A 3DD3A 1GLQA 2R37A 2HSMA 4GTUA 5ID2A 1B9XC 3LYPA 3PGTA 4KW6A 4I2UA 1OE8A 1FB0A 4IJ3A 1DBYA 2HZEA 2V2GA 5HR1A 1GTAA 2DBCA 5AGYA 4RQRA 2GVPA 5HFGA 2VCWA 2N5AA 1WRYA 4NMUA 3EWLA 1R5PA 5DDLA 3HCZA 4XRAA 1GSQA 5IOWA 4YQUA 1B8XA 1BG1A 3O6TA 3ME7A 3LGCA 4IW9A 2H6XA 4Z7XA 3W6GA 2DMMA 1SKSB 5DBQA 5ECIB 4BVYB 2VL9A 1EOGA 1GNEA 5B6NA 1C72A 2PU9C 3GTUA 4O5QA 4LA1A 2PVQA 3D22A 5A5KA 3FZ9A 2WW0A 2CV4A 3F3QA 4IP1A 2HQTA 3GSTA 4GF0A 1R7HA 4EO3A 2VD0A 1F9MA 5D9VA 2CZ2A 5C04A 1CQHA 2WDUA 4XS1A 1H75A 3WT1A 1M9AA 4E8HA 4D73A 1BG5A 2OJLA 2C0DA 5A34B 1TI1A 3HVNA 2VD1A 2FY6A 1NM3A 2C3QA 5CAXA 1N25A 3HJPA 1TP9A 4BVXA 2X64A 1SU9A 1TK8B 4K7IA 2WW1A 4EC0A 1XOBA 5ECKB 1XOAA 2K8SA 3H8QA 3F4TA 5F07A 3KMNA 4BVYA 2HSNA 3UBKA 2LJKA 2CA8A 4ZIJA 4MA9A 1SKRB 4ZL9A 4FYUA 3E9JB 3Q6OA 1XCCA 1EOHA 3GKMA 2WB9A 1K3YA 5EVOA 3M0FA 3ZLPA 3FR9A 4GDFA 2G2QA 1AUCA 3L9UA 1GULA 3PINA 4OD7A 2XBIA 5A34A 3A2WA 1GTIA 1Z7PA 3IOSA 6GSVA 3QPMA 5HQPA 4HJ2A 4DSRA 2GLRA 2XBQA 11GSA 1X0RA 3EVIA 3EC3A 5D9XA 2YP6A 3FK8A 2DJ1A 3M9KA 4ZXGA 4OO4A 3GN3A 4X1UA 4XHMA 5DALA 1A8YA 3EPTA 2LJRA 2B5YA 1EGRA 2XHFA 2FUG2 3M1GA 4TN8A 2TIRA 2ZUPA 5J9BA 1JLVA 4POBA 4MF7A 2GSTA 3ISOA 1N8JA 3KP8A 4Q5FA 3VLNA 1XIYA 1S3RA 3RBTA 1T4ZA 2L6CA 4IP6A 1XBSA 4F82A 1PL2A 2R0PA 1Z9HA 1Z3EA 3CXGA 2IMEA 1WOUA 4AJ7A 3UAPA 1QMVA 1PL1A 5DCHA 1GRXA 4TR4A 1Q4JA 2I3YA 2YOIA 5DQYA 1JHBA 6GSWA 4K7NA 2R6KA 1QXHA 4HU9A 1M3IA 5F06A 4ZB9A 3LFLA 1V58A 1URMA 5H5QA 2P5QA 5A1NB 3F9UA 1AAZA 3QAWA 2H71A 3FZ5A 5AISA 2L4QA 2MBSA 3GH6A 5EY6A 1SK0A 2FGXA 2CVDA 3IRAA 4DEJA 1JZRA 5IO0A 4KDYA 4CY6A 2WCIA 2KOKA 3ZVJA 5FHIA 3ZTLA 3DGQA 4X0XA 5DVBA 1GUKA 4G0IA 1M9BA 3TRXA 1LBKA 4I2TA 5B6MA 3CBUA 2B7JA 3DMLA 4FXYP 5ECHB 2C3TA 4MZCA 2WGRA 3BJ5A 3UARA 1K0OA 4ECCA 2XC2A 3A3TA 4K0NA 2FLSA 4TKYA 1YVLA 4MLYA 6GSTA 3RHBA 1B48A 2YN1A 2WW3A 22GSA 2IFQB 3RDWA 1S3AA 3KXOA 3E0UA 4ZILA 3APSA 3ZL5A 3HA9A 4JBBA 2JZSA 2GSSA 5D9TA 2F51A 5HR0A 3APOA 1T3BA 4KSMA 1R5AA 5D9WA 4ML1A 4OCFA 4OCEA 4P3YB 3RFRC 2MMZA 3FR3A 2DJ3A 2XPDA 3TU3B 4W66A 2R0GA 2H1BA 4V2MA 1ERTA 3D4MA 2TRXA 1NHYA 1K0MA 3SWLA 3GURA 4MJCA 2H75A 4J57E 1O85A 2VCXA 3RGBC 3GNJA 3F63A 3C1SA 4GCIA 1K3LA 2VM2A 4JU5A 4OFTA 4NHWA 2YZHA 3BCIA 2OADA 1TRWA 5J47A 4GSNA 3UJ1A 2PN8A 4Q5QA 4AJ6A 1O6JA 5ECOB 1TRSA 3MYDA 1PSQA 4O5RA 1DE1A 2DJ2A 3RAZA 2LNSA 4LLRA 3QOUA 3IXRA 4KGIA 3GL3A 1TDIA 2RUEA 3I9V2 4FO5A 2O85A 2H8LA 1EP8A 2EC4A 4WR5A 3IDVA 1ERVA 2DC5A 3UEMA 2JZTA 4JE1A 2DMLA 1F2EA 3SBCA 5B7CA 2H66A 1AW9A 2REMA 1ZYNA 2DLXA 4DSQA 13GSA 4E68A 2ON7A 3GFKA 3W8JA 3TKSC 4EXJA 3C71A 4OFNA 2R0CA 1ABAA 3HVSA 3BBYA 4PQHA 2F9SA 4G2EA 1PN9A 4AGSA 4WEYA 3VI7A 2OE3A 2QA1A 5ENUA 3TOUA 4FH8A 1K0BA 1VF1A 2P31A 3UVTA 4H86A 1Y6EA 1YF0A 1SKWB 2JACA 20GSA 4BWQA 2LSTA 4ZB7A 4EE0A 2B6MA 4GXZA 2CVBA 1K0DA 1U88A 4NHZA 4F2IA 1E2YA 2UZ8A 2GZZA 2OT3A 4KSOA 2E2GA 2KHPA 1VGLA 1GSUA 5D96A 2JU5A 1PA3A 5CYYA 5CRHA 4ZBDA 4POKA 2YCDA 3VURA 3O3TA 2HRFA 1V2AA 1PX7A 1AIUA 3HXSA 2VCTA 2O7KA 1USBA 1JZWA 4ZB6A 1HNCA 3QAGA 2V41A 4WBRD 1F37A 2I81A 3LYKA 1EV9A 3IC4A 1AQXA 3P7XA 2NTOA 3F6FA 3F4SA 2WVXA 5IPHA 1SK2A 5J41A 1K0CA 2CVKA 1X5DA 2PWJA 2DKHA 4BL7A 4MZBA 5IMVA 4IQ1A 2KP2A 4L0UA 4MP4A 2CX3A 4OWYA 3UMAA 4IHUA 3D4TA 3OR5A 1M7TA 3D21A 5KN0A 4BWSA 1OKTA 6GSYA 3GKXA 2KLXA 3EU3A 4ECJA 3QAVA 1SJZA 5ECMB 3D5JA 1G7OA 1YEXA 4XIHA 4K1FA 3GMFA 3DKSA 4K2XA 5LD0A 2GQKA 3KZQA 3IC8A 2IPAA 2GSQA 1XVWA 1K0NA 2EIQA 4YH2A 4KDXA 5KN2A 4E8EA 5KEJA 1X5CA 1KEBA 5HR3A 4HSCX 3DEXA 1M99A 1MTCA 2LKUA 3GUSA 5COHA 5F0GA 4TW5A 4XTSA 3P8WA 1TXUA 1W4VA 2LJAA 1TK0B 1TU8A 3CTGA 1QK8A 2VUPA 4J56E 2HYXA 1BX9A 1FO5A 2DSAA 5AN1A 2GQMA 2FCHA 3H1NA 3QDNA 4HI7A 4DSSA 3G9BA 1SVOA 1WWJA 1FOVA 1TRVA 3UOMA 5ECRB 1JFUA 4G19A 4GSTA 2C80A 2TRCP 2OBKA 2WJUA 3TOTA 5J5NA 2IWTA 2V32A 8GSSA 1R4WA 4N3ZA 2VLVA 3LORA 1SJ6A 3UIWA 4EUYA 3CHXC 1TOFA 2HRNA 3TCOA 2M46A 3GX8A 1A2JA 1WPIA 4TR1B 2A2SA 3J7Yb 2LRTA 4BIKA 3CSHA 1PKWA 2V6KA 1J9BA 1ERUA 5DQSA 1FAAA 4BA7A 3UL3A 3KJYA 2H72A 2C0GA 4HUAA 2OKAA 4YKFA 1DUGA 1GTBA 2CZ3A 2QGVA 4NPBA 2GTUA 3WGXA 2H1GA 2PGTA 3HDCA 3L0HA 2H74A 2HSHA 1T8EB 4ILFA 2H19A 1GNWA 4V2NA 4K2DA 3IHQA 4LMWA 4O92A 4ZBAA 3TKQA 4RI6A 3C8EA 3HMJG 4WF5A 4PI0C 5ABRA 5ECPB 2K8VA 2L6DA 4RI7A 1SVMA 1AXDA 4TOPA 3HYPA 4IGJA 3LWAA 4Q5RA 2FNOA 1DE2A 3LSZA 2IMFA 17GSA 1Z7RA 3WGEA 1JLWA 2ES7A 1SD8A 2EIOA 2OBIA 4WBJA 1NSWA 5IOXA 2K18A 1ST9A 2VL2A 4N30A 1OE7A 1B4PA 1F3AA 4BPYA 3M9JA 3H93A 2JL4A 4FIWA 4HZ4A 5G1KA 3I69A 2LRNA 1TRUA 2HRKB 3FYGA 1UN2A 4K8MA 1SK1A 4QL9A 4HQSA 3TRPA 4ZBBA 2O89A 2HNLA 2C3NA 3WGDA 4GLTA 1OKDA 6GSUA 3S9FA 1A24A 5FT3A 2FA4A 4KDUA 2D2ZA 12GSA 5H5RA 2GS3A 3TDGA 3U6VA 1GSSA 5F05A 4O5UA 1JZDA 2BJXA 2AJQB 2YV7A 1GUHA 3RHCA 4TRXA 4Z2TA 4HJMA 1THOA 2M72A 1QFNA 4IVFA 2VM1A 4V1Ap 1FVJA 4A5PA 4JRRA 2B1LA 4AI6A 1FW1A 4ZL8A 4XCSA 3UBLA 3TKPA 2I4AA 5J4VA 3ERFA 5KN1A 1XWBA 1YKAA 4PNGA 3VK9A 3PR8A 3ZREA 3TJFA 1S3CA 5D73A 2O8VB 2H70A 2HRKA 5JCGA 4EF0A 1I5GA 4HS1A 1LU4A 1MDKA 3RPNA 2OE0A 4ZB8A 1PQNA 2QKEA 4USSA 4G9HA 2RLIA 1ZOFA 1Y25A 4PXOA 4QL7A 1KNGA 5BMUB 4HDEA 1A0FA 5G2ZA 2H6YA 1AQWA 4KH7A 3IR4A 2C0EA 1N2AA 3GRXA 1XW6A 2GZPA 3C73A 4RQXA 4Z2UA 5DJMA 4PHZC 3D6IA 1SYXA 3IK9A 4WETA 1X9WB 1HYUA 1V98A 4KB3A 4FYCA 1PX6A 2PERA 5DAKB 5HFIA 3IAS2 1UC7A 1O81A 2Z9SA 3BCKA 5A1NA 1GSEA 5F8BA 6GSSA 3LEFA 4PQ1A 2WFCA 3D0ZA 2JADA 3IAM2 2X99A 4L8EA 1KTEA 1RW1A 3G7YA 3PH9A 3KD0A 1BJXA 3KH7A 4GQCA 2WZSA 4ACSA 2N5BA 2L57A 4RUVA 1WE0A 4N0VA 3LXZA 1YEWC 5G1LA 2NVLA 1XWAA 2WULA 3HVXA 4DVCA 3GKNA 4MK3A 3Q19A 2F8FA 2WVZA 2ALBA 4WR4A 1UVZA 2IMDA 1V9WA 3DVWA 3A2XA 4MZWA 3HD5A 1HNAA 2X49A 1QGVA 1Z6NA 3LXTA 2HRAA 5E4WA 4ZL7A 5ELAA 3FY7A 1F3BA 1SVLA 2HZFA 1K3OA 4TXOB 2H01A 2GSRA 3Q74A 2WW2A 2IFQA 1OYJA 3HHVA 1EGOA 4PQIA 5HR2A 1YKCA 4XS4B 3MWHA 3CSJA 4PUFC 1XW9A 1GP1A 2LQQA 2B1KA 1M2DA 5IMZA 3J7Yk 3HJOA 2JZRA 1Y1UA 2LEGA 3FEUA 2CAIA 5JCWA 2JSYA 4AKIA 1ZMAA 2EFCA 4LL4B 1H4OA 2YZUA 3K8NA 1TK5B 2EFDA 3QFAC 5JWRB 3GHAA 1YEPA 1MD3A 4JR6A 5AIVA 4Z2RA 4L5OA 1O8WA 4L5LA 5G30A 1J08A 1SD9A 3HZ8A 1G0TA 1XW5A 4N10A 1Z6MA 3US3A 4TVEA 3LJRA 1TXXA 1ML6A 1J0FA 1X9SB 5J3RA 2EFHA 3QR6A 3L9VA 2F3MA 4F03A 3W8SA 3EINA 1GL8A 5B8BA 1FHEA 1XWGA 4ULXA 5ECLB 4MJEA 1TU7A 4XRDA 1F6MC 2H0IA 1NW2A 1WIKA 2R3XA 1MEKA 2HT9A 3LG6A 3ZFBA 4MDCA
chains in the Genus database with same CATH topology
2C8UA 3H79A 4KNDA 3APQA 5B8AA 4ECIA 4V2LA 1U6TA 3V1WA 2FWFA 1MDJA 1GUMA 5L71A 1CQGA 2LS5A 1VRSD 1VF4A 2GDRA 3ZIJA 18GSA 1EEMA 3KTBA 1XZOA 1Q98A 3FZ4A 2KP1A 3R3EA 2NPBA 2VAFA 2PPTA 2M80A 2CX4A 1OC3A 3GSSA 1G6YA 3ZFLA 4N11A 1TJDA 1T7PB 2L4CA 3FW2A 2E2MA 4IQAA 2DJ0A 4NWYA 1O73A 3IA1A 1B4QA 2IIYA 1ZYEA 3DXBA 3F6DA 1AQVA 2YWOA 2J9HA 5HFKA 3GH9A 2FD3A 4HU7A 5ID2B 4KAEA 3QCPA 4Q5NA 3VI5A 2B5XA 2FHEA 4IELA 9GSSA 3DYRA 2GT6A 2HZEB 2RIIA 3CWGA 2IN3A 1VF2A 14GSA 1SL2B 5AIXA 2EIRA 3U5RE 3LW9A 4J2FA 1IYIA 2YANA 2LTKA 5GAPD 4CHSA 2C4JA 2L5OA 4K0GA 1MD4A 1XWKA 2IMKA 1QUWA 2OE1A 4OFMA 1BQ7A 2YWNA 2H30A 2NDOA 3NOFA 2L5LA 3WD6A 3HZ4A 3ZMLA 3TJJA 2QA2A 4FQUA 1OC9B 5D93A 2AHEA 3ZITA 5KN3A 3VFIA 3CYNA 1GTUA 3GTUB 2XPEA 4L0WA 1RQMA 3L4NA 3WT2A 3Q18A 1TW9A 3HY2A 4CDOA 2MYGA 2YJHA 4F9ZA 3GIXA 1XXUA 1PKZA 4POMA 4D73B 3C7MA 2J23A 1ZGNA 4K6XA 4F0CA 4KCEA 1GSFA 4KUNA 2H1AA 2E0QA 3I43A 1EZKA 2VCVA 2FA8A 3EYTA 3KP9A 4MNNA 1G7EA 4BVXB 4AKXB 1BYEA 3MAKA 1A8LA 10GSA 2VL3A 1OC9A 2IL3A 4QQ7A 2X4AA 1SENA 1PGTA 2HLSA 1SYRA 3FKFA 4GRFA 5CNWA 5ECQB 2DKIA 3M3MA 4YKGA 2HSNB 5C00A 3VPTA 5IQYA 3IBHA 1Z5YE 5J40A 3P90A 3ZZXA 2MBTA 1SL1B 3FHKA 5BRTA 4TXVA 2H0HA 3TRQA 1X5EA 2X8HA 4KX4A 2DIZA 3TKRA 1BAYA 3RPPA 2UV8G 3GV1A 5GZZB 4EIPA 3FRCA 3QMXA 3EU4A 2ZNMA 5GSTA 2X8CA 5CRGA 2BMXA 4FYBA 3ZYWA 4YQVA 2DIYA 5D8IA 3EE2A 1HD2A 1YZXA 3FR6A 1TI3A 3TKSE 3JCML 2A4VA 2MMAA 3N9JA 4X4JA 2PMTA 2B7KA 1WMJA 3DRNA 3KEBA 1O8XA 1MDIA 3L9SA 2VOCA 4IBPA 2B5EA 2HE3A 1T1VA 1OC8A 5DALB 2A2RA 4N0ZA 2LNTA 4G10A 3I6AA 4JZQA 1ILOA 3FMWA 4TR1A 1ZL9A 4GQFA 1YQ1A 2YWIA 3IPZA 1BEDA 7GSSA 2VIMA 2YV9A 3GX0A 5DCGA 4MH3A 4TR0A 2WZ9A 5CP1A 2V6OA 2MMOA 2C1YA 1A0RP 2WRTA 2MZCA 1BF5A 5IO2A 1V57A 1K0AA 4G0LA 3MIXA 4AKHA 3F4RA 1HNBA 2FWHA 5IIZA 4IKHA 1FG4A 4XS6A 4EL1A 3F3RA 3CRTA 2CQ9A 3L78A 3TJKA 1NHOA 2DJJA 5FWGA 5CRDA 5A5HB 4AF2A 2QC7A 5DJLA 2WS2A 1DSBA 1I9DA 1S3DA 1GSYA 2RM5A 2IJYA 4AKGA 2HFDA 5GSSA 1M2BA 3F0IA 2O5VA 3MDKA 4O7HA 3A5IA 1T4YA 6GSXA 4G01A 5JCUA 2R2JA 3ZRDA 1WJKA 3ERGA 2MMNA 1XPVA 3A2VA 1HQOA 3HJMA 1W89A 1O7UA 2H73A 2I9HA 4OMVA 3C1RA 1EWXA 4PNFA 1OVNA 2EFEA 3AY8A 1YJ6A 3VWXA 4PUAA 2VLTA 5IPGA 2FWEA 4GWRA 3UVHA 1VF3A 2OA7A 2HXKA 1QQ2A 1JZOA 2QSIA 3KIJA 4K9ZA 2A2PA 2YJ7A 5A5HA 4PURA 2LRCA 2F8AA 1TTZA 2H1DA 1ZYQB 3MNGA 2I1UA 4X43A 4K5RA 3GKKA 3CSIA 2VKZG 1SL0B 1AC1A 3HKRA 1ACVA 1GWCA 2ON5A 3VWWA 3ZIVA 5J4UA 5JWOB 1U3AA 1E6BA 1YDKA 2LQOA 1RK4A 1FOHA 4ECBA 1PD21 3IHGA 1EP7A 5CREA 2VO4A 4MF6A 3ZVJD 5ECNB 3TKSA 1T00A 3BOAA 4HZ2A 2VL2C 3GYKA 5EPFA 1IYHA 3GL5A 3EURA 4NXIA 4TR3A 1GLPA 4MJAA 5BMUA 4GSSA 2IMIA 5A4WA 1PMTA 3CRUA 4KE3A 3EMXA 2DJKA 2PUKC 3ERWA 2H1LA 3P2AA 2GZYA 3WYWA 1U3IA 2YNXA 4JEDA 3ED3A 2AAWA 1LJRA 2O87A 2JSZA 2P0GA 3TGZA 3CTFA 4F0BA 4IS0A 5DAKA 5IMDA 19GSA 1A2MA 3H4KA 4WXTA 3DVXA 5IMAA 5GAND 5IMCA 3HVVA 1PN0A 3EMPA 4AJ8A 4EKZA 4KF9A 3IE3A 4YAVA 1V40A 3IV4A 4K7OA 3ME8A 1ZYPA 3GA4A 3PPUA 2VCZA 4IJIA 4CW9A 4NV2A 4EDYA 4HEA2 4OO5A 4I97A 4I5QA 2FWGA 4EIQA 3N5OA 4ML6A 1YF1A 2CT6A 3ZMKA 2CAQA 5KOWA 2K9FA 3TB2A 2VLUA 5CRWA 1EEJA 3VWVA 2G0FA 4WKWA 3KM6A 4TXOA 5ECSA 1ZZYA 2P5RA 4XS4A 2HI7A 4G0KA 4PX1A 5A4VA 2ZCTA 4MJBA 5EL8A 1GSDA 3DIEA 4LMVA 3KGKA 1YY7A 1B9YC 1ZCPA 1OAZA 2AB6A 4YQMA 2KUCA 1KBNA 3FZAA 3G7JA 2H6ZA 3NIVA 2C0FA 2GGTA 3DWVA 2H0GA 4MPFA 3IK7A 2PVOC 1M2AA 5IMFA 4IN0A 2PBJA 4EDZA 4KCAA 3KTLA 16GSA 3F8UA 2VCQA 5JWQB 2GT5A 1ON4A 1SJIA 1G6WA 4PGTA 3BD2A 2GQLA 4KA0A 3KMOA 4EVMA 4JR4A 3VPQA 4BL7B 2B3SA 2BTOT 5G5FA 1EV4A 4ICYA 4WF4A 2LV3A 4MMMA 2N5FA 2R4VA 3LQ7A 4LL1B 2X8GA 3KCMA 1THXA 4PTSA 5G5EA 4MCUA 5KOXA 5E59A 1XWCA 5CO3A 2H76A 1FVKA 4HQZA 5A4UA 3TJGA 1ERWA 1XFLA 3A5WA 3TUEA 4CY8A 3TJBA 3G7IA 1PRXA 2YPMA 2AYTA 4POLA 4MABA 2L59A 4MF5A 2HSMB 1XVQA 5ELGA 2E7PA 4O32A 4I8BA 1GH2A 2V1MA 4QMKA 4MH2A 1A2LA 4ID0A 3KH9A 2LUSA 4NAXA 2RM6A 3M8NA 1X9MB 4ISDA 2K6VA 1R26A 3MSZA 5G31A 5H5SA 1A23A 4NV5A 4MPGA 2AUVA 3VWUA 5INYA 3E3EA 2A4HA 3NZNA 3CMIA 1U87A 2RUFA 1WP0A 1M0UA 1TKDB 4I6XA 4HOJA 4V1Ag 2OACA 1FB6A 2AV4A 2R5GA 4DSSB 5LCZA 4YAPA 4K5SA 3O76A 5LNKe 5J9CA 3R2QA 2YWMA 5J4YA 2NBSA 3QFBC 1UA5A 2HSYA 3QD9A 5IM9A 3DD3A 1GLQA 2R37A 2HSMA 4GTUA 5ID2A 1B9XC 3LYPA 3PGTA 4KW6A 4I2UA 1OE8A 1FB0A 4IJ3A 1DBYA 2HZEA 2V2GA 5HR1A 1GTAA 2DBCA 5AGYA 4RQRA 2GVPA 5HFGA 2VCWA 2N5AA 1WRYA 4NMUA 3EWLA 1R5PA 5DDLA 3HCZA 4XRAA 1GSQA 5IOWA 4YQUA 1B8XA 1BG1A 3O6TA 3ME7A 3LGCA 4IW9A 2H6XA 4Z7XA 3W6GA 2DMMA 1SKSB 5DBQA 5ECIB 4BVYB 2VL9A 1EOGA 1GNEA 5B6NA 1C72A 2PU9C 3GTUA 4O5QA 4LA1A 2PVQA 3D22A 5A5KA 3FZ9A 2CV4A 3F3QA 4IP1A 2HQTA 3GSTA 4GF0A 1R7HA 4EO3A 2VD0A 1F9MA 5D9VA 2CZ2A 5C04A 1CQHA 2WDUA 4XS1A 1H75A 3WT1A 1M9AA 4E8HA 4D73A 1BG5A 2OJLA 2C0DA 5A34B 1TI1A 2VD1A 2FY6A 1NM3A 2C3QA 5CAXA 1N25A 3HJPA 1TP9A 4BVXA 2X64A 1SU9A 1TK8B 4K7IA 4EC0A 1XOBA 5ECKB 1XOAA 2K8SA 3H8QA 3F4TA 5F07A 3KMNA 4BVYA 2HSNA 3UBKA 2LJKA 2CA8A 4ZIJA 4MA9A 1SKRB 4ZL9A 4FYUA 3E9JB 3Q6OA 1XCCA 1EOHA 3GKMA 2WB9A 1K3YA 5EVOA 3M0FA 3ZLPA 3FR9A 4GDFA 2G2QA 1AUCA 3L9UA 1GULA 3PINA 4OD7A 2XBIA 5A34A 3A2WA 1GTIA 1Z7PA 3IOSA 6GSVA 3QPMA 5HQPA 4HJ2A 4DSRA 2GLRA 2XBQA 11GSA 1X0RA 3EVIA 3EC3A 5D9XA 2YP6A 3FK8A 2DJ1A 3M9KA 4ZXGA 4OO4A 3GN3A 4X1UA 4XHMA 5DALA 1A8YA 3EPTA 2LJRA 2B5YA 1EGRA 2XHFA 2FUG2 3M1GA 4TN8A 2TIRA 2ZUPA 5J9BA 1JLVA 4POBA 4MF7A 2GSTA 3ISOA 1N8JA 3KP8A 4Q5FA 3VLNA 1XIYA 3RBTA 1T4ZA 2L6CA 4IP6A 1XBSA 4F82A 1PL2A 2R0PA 1Z9HA 1Z3EA 3CXGA 2IMEA 1WOUA 4AJ7A 3UAPA 1QMVA 1PL1A 5DCHA 1GRXA 4TR4A 1Q4JA 2I3YA 2YOIA 5DQYA 1JHBA 6GSWA 4K7NA 2R6KA 1QXHA 4HU9A 5F06A 4ZB9A 3LFLA 1V58A 1URMA 5H5QA 2P5QA 5A1NB 3F9UA 1AAZA 3QAWA 2H71A 3FZ5A 5AISA 2L4QA 2MBSA 3GH6A 5EY6A 1SK0A 2FGXA 2CVDA 3IRAA 4DEJA 1JZRA 5IO0A 4KDYA 4CY6A 2WCIA 2KOKA 3ZVJA 5FHIA 3ZTLA 3DGQA 4X0XA 5DVBA 1GUKA 4G0IA 1M9BA 3TRXA 1LBKA 4I2TA 5B6MA 3CBUA 2B7JA 3DMLA 5ECHB 2C3TA 4MZCA 2WGRA 3BJ5A 3UARA 1K0OA 4ECCA 2XC2A 3A3TA 4K0NA 2FLSA 4TKYA 1YVLA 4MLYA 6GSTA 3RHBA 1B48A 2YN1A 22GSA 2IFQB 3RDWA 1S3AA 3KXOA 3E0UA 4ZILA 3APSA 3ZL5A 3HA9A 4JBBA 2JZSA 2GSSA 5D9TA 2F51A 5HR0A 3APOA 1T3BA 4KSMA 1R5AA 5D9WA 4ML1A 4OCFA 4OCEA 4P3YB 2MMZA 3FR3A 2DJ3A 2XPDA 3TU3B 4W66A 2R0GA 2H1BA 4V2MA 1ERTA 3D4MA 2TRXA 1NHYA 1K0MA 3SWLA 3GURA 4MJCA 2H75A 4J57E 1O85A 2VCXA 3GNJA 3F63A 3C1SA 4GCIA 1K3LA 2VM2A 4JU5A 4OFTA 4NHWA 2YZHA 3BCIA 2OADA 1TRWA 5J47A 4GSNA 3UJ1A 2PN8A 4Q5QA 4AJ6A 1O6JA 5ECOB 1TRSA 3MYDA 1PSQA 4O5RA 1DE1A 2DJ2A 3RAZA 2LNSA 4LLRA 3QOUA 3IXRA 4KGIA 3GL3A 1TDIA 2RUEA 3I9V2 4FO5A 2O85A 2H8LA 1EP8A 2EC4A 4WR5A 3IDVA 1ERVA 2DC5A 3UEMA 2JZTA 4JE1A 2DMLA 1F2EA 3SBCA 5B7CA 2H66A 1AW9A 2REMA 1ZYNA 2DLXA 4DSQA 13GSA 4E68A 2ON7A 3GFKA 3W8JA 3TKSC 4EXJA 3C71A 4OFNA 2R0CA 1ABAA 3HVSA 3BBYA 4PQHA 2F9SA 4G2EA 1PN9A 4AGSA 4WEYA 3VI7A 2OE3A 2QA1A 5ENUA 3TOUA 4FH8A 1K0BA 1VF1A 2P31A 3UVTA 4H86A 1Y6EA 1YF0A 1SKWB 2JACA 20GSA 4BWQA 2LSTA 4ZB7A 4EE0A 2B6MA 4GXZA 2CVBA 1K0DA 1U88A 4NHZA 4F2IA 1E2YA 2UZ8A 2GZZA 2OT3A 4KSOA 2E2GA 2KHPA 1VGLA 1GSUA 5D96A 2JU5A 1PA3A 5CYYA 5CRHA 4ZBDA 4POKA 2YCDA 3VURA 3O3TA 2HRFA 1V2AA 1PX7A 1AIUA 3HXSA 2VCTA 2O7KA 1USBA 1JZWA 4ZB6A 1HNCA 3QAGA 2V41A 4WBRD 1F37A 2I81A 3LYKA 1EV9A 3IC4A 1AQXA 3P7XA 2NTOA 3F6FA 3F4SA 5IPHA 1SK2A 5J41A 1K0CA 2CVKA 1X5DA 2PWJA 2DKHA 4BL7A 4MZBA 5IMVA 4IQ1A 2KP2A 4L0UA 4MP4A 2CX3A 4OWYA 3UMAA 4IHUA 3D4TA 3OR5A 1M7TA 3D21A 5KN0A 4BWSA 1OKTA 6GSYA 3GKXA 2KLXA 3EU3A 4ECJA 3QAVA 1SJZA 5ECMB 3D5JA 1G7OA 1YEXA 4XIHA 4K1FA 3GMFA 3DKSA 4K2XA 5LD0A 2GQKA 3KZQA 3IC8A 2IPAA 2GSQA 1XVWA 1K0NA 2EIQA 4YH2A 4KDXA 5KN2A 4E8EA 5KEJA 1X5CA 1KEBA 5HR3A 3DEXA 1M99A 1MTCA 2LKUA 3GUSA 5COHA 5F0GA 4TW5A 4XTSA 3P8WA 1TXUA 1W4VA 2LJAA 1TK0B 1TU8A 3CTGA 1QK8A 2VUPA 4J56E 2HYXA 1BX9A 1FO5A 2DSAA 5AN1A 2GQMA 2FCHA 3H1NA 3QDNA 4HI7A 4DSSA 3G9BA 1SVOA 1WWJA 1FOVA 1TRVA 3UOMA 5ECRB 1JFUA 4G19A 4GSTA 2C80A 2TRCP 2OBKA 2WJUA 3TOTA 5J5NA 2IWTA 2V32A 8GSSA 1R4WA 4N3ZA 2VLVA 3LORA 1SJ6A 3UIWA 4EUYA 1TOFA 2HRNA 3TCOA 2M46A 3GX8A 1A2JA 1WPIA 4TR1B 2A2SA 3J7Yb 2LRTA 3CSHA 1PKWA 2V6KA 1J9BA 1ERUA 5DQSA 1FAAA 4BA7A 3UL3A 3KJYA 2H72A 2C0GA 4HUAA 2OKAA 4YKFA 1DUGA 1GTBA 2CZ3A 2QGVA 4NPBA 2GTUA 3WGXA 2H1GA 2PGTA 3HDCA 3L0HA 2H74A 2HSHA 1T8EB 4ILFA 2H19A 1GNWA 4V2NA 4K2DA 3IHQA 4LMWA 4O92A 4ZBAA 3TKQA 4RI6A 3C8EA 3HMJG 4WF5A 5ABRA 5ECPB 2K8VA 2L6DA 4RI7A 1SVMA 1AXDA 4TOPA 3HYPA 4IGJA 3LWAA 4Q5RA 2FNOA 1DE2A 3LSZA 2IMFA 17GSA 1Z7RA 3WGEA 1JLWA 2ES7A 1SD8A 2EIOA 2OBIA 4WBJA 1NSWA 5IOXA 2K18A 1ST9A 2VL2A 4N30A 1OE7A 1B4PA 1F3AA 4BPYA 3M9JA 3H93A 2JL4A 4FIWA 4HZ4A 5G1KA 3I69A 2LRNA 1TRUA 2HRKB 3FYGA 1UN2A 4K8MA 1SK1A 4QL9A 4HQSA 3TRPA 4ZBBA 2O89A 2HNLA 2C3NA 3WGDA 4GLTA 1OKDA 6GSUA 3S9FA 1A24A 5FT3A 2FA4A 4KDUA 2D2ZA 12GSA 5H5RA 2GS3A 3TDGA 3U6VA 1GSSA 5F05A 4O5UA 1JZDA 2BJXA 2AJQB 2YV7A 1GUHA 3RHCA 4TRXA 4Z2TA 4HJMA 1THOA 2M72A 1QFNA 4IVFA 2VM1A 4V1Ap 1FVJA 4A5PA 4JRRA 2B1LA 4AI6A 1FW1A 4ZL8A 4XCSA 3UBLA 3TKPA 2I4AA 5J4VA 3ERFA 5KN1A 1XWBA 1YKAA 4PNGA 3VK9A 3PR8A 3ZREA 3TJFA 1S3CA 5D73A 2O8VB 2H70A 2HRKA 5JCGA 4EF0A 1I5GA 4HS1A 1LU4A 1MDKA 3RPNA 2OE0A 4ZB8A 1PQNA 2QKEA 4USSA 4G9HA 2RLIA 1ZOFA 1Y25A 4PXOA 4QL7A 1KNGA 5BMUB 4HDEA 1A0FA 5G2ZA 2H6YA 1AQWA 4KH7A 3IR4A 2C0EA 1N2AA 3GRXA 1XW6A 2GZPA 3C73A 4RQXA 4Z2UA 5DJMA 3D6IA 1SYXA 3IK9A 4WETA 1X9WB 1HYUA 1V98A 4KB3A 4FYCA 1PX6A 2PERA 5DAKB 5HFIA 3IAS2 1UC7A 1O81A 2Z9SA 3BCKA 5A1NA 1GSEA 5F8BA 6GSSA 3LEFA 4PQ1A 2WFCA 3D0ZA 2JADA 3IAM2 2X99A 4L8EA 1KTEA 1RW1A 3G7YA 3PH9A 3KD0A 1BJXA 3KH7A 4GQCA 4ACSA 2N5BA 2L57A 4RUVA 1WE0A 4N0VA 3LXZA 5G1LA 2NVLA 1XWAA 2WULA 3HVXA 4DVCA 3GKNA 4MK3A 3Q19A 2F8FA 2ALBA 4WR4A 1UVZA 2IMDA 1V9WA 3DVWA 3A2XA 4MZWA 3HD5A 1HNAA 2X49A 1QGVA 1Z6NA 3LXTA 2HRAA 5E4WA 4ZL7A 5ELAA 3FY7A 1F3BA 1SVLA 2HZFA 1K3OA 4TXOB 2H01A 2GSRA 3Q74A 2IFQA 1OYJA 3HHVA 1EGOA 4PQIA 5HR2A 1YKCA 4XS4B 3MWHA 3CSJA 4PUFC 1XW9A 1GP1A 2LQQA 2B1KA 1M2DA 5IMZA 3J7Yk 3HJOA 2JZRA 1Y1UA 2LEGA 3FEUA 2CAIA 5JCWA 2JSYA 4AKIA 1ZMAA 2EFCA 4LL4B 1H4OA 2YZUA 3K8NA 1TK5B 2EFDA 3QFAC 5JWRB 3GHAA 1YEPA 1MD3A 4JR6A 5AIVA 4Z2RA 4L5OA 1O8WA 4L5LA 5G30A 1J08A 1SD9A 3HZ8A 1G0TA 1XW5A 4N10A 1Z6MA 3US3A 4TVEA 3LJRA 1TXXA 1ML6A 1J0FA 1X9SB 5J3RA 2EFHA 3QR6A 3L9VA 2F3MA 4F03A 3W8SA 3EINA 1GL8A 5B8BA 1FHEA 1XWGA 4ULXA 5ECLB 4MJEA 1TU7A 4XRDA 1F6MC 2H0IA 1NW2A 1WIKA 2R3XA 1MEKA 2HT9A 3LG6A 3ZFBA 4MDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C8U A;  3H79 A;  4KND A;  3APQ A;  5B8A A;  4ECI A;  4V2L A;  1U6T A;  3V1W A;  2FWF A;  1MDJ A;  1GUM A;  5L71 A;  1CQG A;  2LS5 A;  1VRS D;  1VF4 A;  2GDR A;  3ZIJ A;  18GS A;  1EEM A;  3KTB A;  1XZO A;  1Q98 A;  3FZ4 A;  2KP1 A;  3R3E A;  2NPB A;  2VAF A;  2PPT A;  2M80 A;  2CX4 A;  1OC3 A;  3GSS A;  1G6Y A;  3ZFL A;  4N11 A;  1TJD A;  1T7P B;  2L4C A;  3FW2 A;  2E2M A;  4IQA A;  2DJ0 A;  4NWY A;  1O73 A;  3IA1 A;  1B4Q A;  2IIY A;  1ZYE A;  3DXB A;  1AQV A;  3F6D A;  2YWO A;  2J9H A;  5HFK A;  3GH9 A;  2FD3 A;  4HU7 A;  5ID2 B;  4KAE A;  3QCP A;  4Q5N A;  3VI5 A;  2B5X A;  2FHE A;  4IEL A;  9GSS A;  3DYR A;  2GT6 A;  2HZE B;  2RII A;  2IN3 A;  1VF2 A;  14GS A;  1SL2 B;  5AIX A;  2EIR A;  3U5R E;  4J2F A;  1IYI A;  2YAN A;  2LTK A;  5GAP D;  4CHS A;  2C4J A;  2L5O A;  4K0G A;  1MD4 A;  1XWK A;  2IMK A;  1QUW A;  2OE1 A;  4OFM A;  1BQ7 A;  2YWN A;  2H30 A;  2NDO A;  3NOF A;  2L5L A;  3WD6 A;  3HZ4 A;  3ZML A;  3TJJ A;  4FQU A;  1OC9 B;  5D93 A;  2AHE A;  3ZIT A;  5KN3 A;  3VFI A;  3CYN A;  1GTU A;  3GTU B;  2XPE A;  4L0W A;  1RQM A;  3L4N A;  3WT2 A;  3Q18 A;  1TW9 A;  3HY2 A;  4CDO A;  2MYG A;  2YJH A;  4F9Z A;  3GIX A;  1XXU A;  1PKZ A;  4POM A;  4D73 B;  3C7M A;  2J23 A;  1ZGN A;  4K6X A;  4F0C A;  4KCE A;  1GSF A;  4KUN A;  2H1A A;  2E0Q A;  3I43 A;  1EZK A;  2VCV A;  2FA8 A;  3EYT A;  3KP9 A;  1G7E A;  4BVX B;  1BYE A;  3MAK A;  1A8L A;  10GS A;  2VL3 A;  1OC9 A;  2IL3 A;  4QQ7 A;  1SEN A;  1PGT A;  2HLS A;  1SYR A;  3FKF A;  4GRF A;  5CNW A;  5ECQ B;  3M3M A;  2HSN B;  5C00 A;  3VPT A;  5IQY A;  3IBH A;  1Z5Y E;  3P90 A;  3ZZX A;  2MBT A;  1SL1 B;  3FHK A;  4TXV A;  2H0H A;  3TRQ A;  1X5E A;  2X8H A;  4KX4 A;  2DIZ A;  3TKR A;  1BAY A;  3RPP A;  3GV1 A;  5GZZ B;  3FRC A;  3QMX A;  3EU4 A;  2ZNM A;  5GST A;  2X8C A;  5CRG A;  2BMX A;  4FYB A;  3ZYW A;  4YQV A;  2DIY A;  5D8I A;  3EE2 A;  1HD2 A;  1YZX A;  3FR6 A;  1TI3 A;  3TKS E;  3JCM L;  2A4V A;  2MMA A;  3N9J A;  2PMT A;  2B7K A;  1WMJ A;  3DRN A;  3KEB A;  1O8X A;  1MDI A;  3L9S A;  2VOC A;  4IBP A;  2B5E A;  2HE3 A;  1T1V A;  1OC8 A;  5DAL B;  2A2R A;  4N0Z A;  2LNT A;  4G10 A;  3I6A A;  4JZQ A;  1ILO A;  4TR1 A;  1ZL9 A;  4GQF A;  1YQ1 A;  2YWI A;  3IPZ A;  1BED A;  7GSS A;  2VIM A;  2YV9 A;  3GX0 A;  5DCG A;  4MH3 A;  4TR0 A;  2WZ9 A;  5CP1 A;  2V6O A;  2MMO A;  2C1Y A;  1A0R P;  2WRT A;  2MZC A;  5IO2 A;  1V57 A;  1K0A A;  4G0L A;  3F4R A;  1HNB A;  2FWH A;  5IIZ A;  4IKH A;  1FG4 A;  4XS6 A;  4EL1 A;  3F3R A;  3CRT A;  2CQ9 A;  3L78 A;  3TJK A;  1NHO A;  2DJJ A;  5FWG A;  5CRD A;  4AF2 A;  2QC7 A;  5DJL A;  2WS2 A;  1DSB A;  1I9D A;  1S3D A;  1GSY A;  2RM5 A;  2IJY A;  2HFD A;  5GSS A;  1M2B A;  3F0I A;  3MDK A;  4O7H A;  1T4Y A;  6GSX A;  5JCU A;  2R2J A;  3ZRD A;  1WJK A;  3ERG A;  2MMN A;  1XPV A;  3A2V A;  1HQO A;  3HJM A;  1W89 A;  1O7U A;  2H73 A;  2I9H A;  4OMV A;  3C1R A;  1EWX A;  4PNF A;  1OVN A;  3AY8 A;  1YJ6 A;  3VWX A;  4PUA A;  2VLT A;  5IPG A;  2FWE A;  4GWR A;  3UVH A;  1VF3 A;  2OA7 A;  2HXK A;  1QQ2 A;  1JZO A;  2QSI A;  3KIJ A;  4K9Z A;  2YJ7 A;  4PUR A;  2LRC A;  2F8A A;  1TTZ A;  2H1D A;  1ZYQ B;  3MNG A;  2I1U A;  4X43 A;  3GKK A;  3CSI A;  1SL0 B;  1AC1 A;  3HKR A;  1ACV A;  1GWC A;  2ON5 A;  3VWW A;  3ZIV A;  5J4U A;  5JWO B;  1U3A A;  1E6B A;  1YDK A;  2LQO A;  1RK4 A;  4ECB A;  1PD2 1;  1EP7 A;  5CRE A;  2VO4 A;  4MF6 A;  3ZVJ D;  5ECN B;  3TKS A;  1T00 A;  3BOA A;  4HZ2 A;  2VL2 C;  3GYK A;  5EPF A;  1IYH A;  3GL5 A;  3EUR A;  4NXI A;  4TR3 A;  1GLP A;  4MJA A;  5BMU A;  4GSS A;  2IMI A;  5A4W A;  1PMT A;  3CRU A;  4KE3 A;  3EMX A;  2DJK A;  2PUK C;  3ERW A;  3P2A A;  2GZY A;  3WYW A;  1U3I A;  2YNX A;  4JED A;  3ED3 A;  2AAW A;  1LJR A;  2O87 A;  2JSZ A;  2P0G A;  3TGZ A;  3CTF A;  4F0B A;  4IS0 A;  5DAK A;  5IMD A;  19GS A;  1A2M A;  3H4K A;  4WXT A;  3DVX A;  5IMA A;  5GAN D;  5IMC A;  3HVV A;  3EMP A;  4AJ8 A;  4EKZ A;  4KF9 A;  3IE3 A;  4YAV A;  1V40 A;  3IV4 A;  4K7O A;  3ME8 A;  3GA4 A;  3PPU A;  2VCZ A;  4IJI A;  4CW9 A;  4NV2 A;  4EDY A;  4HEA 2;  4OO5 A;  4I97 A;  4I5Q A;  2FWG A;  3N5O A;  4ML6 A;  1YF1 A;  2CT6 A;  3ZMK A;  2CAQ A;  2K9F A;  3TB2 A;  2VLU A;  5CRW A;  1EEJ A;  3VWV A;  2G0F A;  4WKW A;  3KM6 A;  4TXO A;  5ECS A;  1ZZY A;  2P5R A;  4XS4 A;  2HI7 A;  4G0K A;  4PX1 A;  5A4V A;  2ZCT A;  4MJB A;  5EL8 A;  1GSD A;  3DIE A;  4LMV A;  3KGK A;  1YY7 A;  1B9Y C;  1ZCP A;  1OAZ A;  2AB6 A;  4YQM A;  2KUC A;  1KBN A;  3FZA A;  3G7J A;  2H6Z A;  3NIV A;  2C0F A;  2GGT A;  3DWV A;  2H0G A;  4MPF A;  3IK7 A;  2PVO C;  1M2A A;  5IMF A;  4IN0 A;  2PBJ A;  4EDZ A;  4KCA A;  3KTL A;  16GS A;  3F8U A;  2VCQ A;  5JWQ B;  2GT5 A;  1ON4 A;  1SJI A;  1G6W A;  4PGT A;  3BD2 A;  2GQL A;  4KA0 A;  3KMO A;  4EVM A;  4JR4 A;  3VPQ A;  4BL7 B;  2B3S A;  2BTO T;  5G5F A;  1EV4 A;  4WF4 A;  2LV3 A;  4MMM A;  2N5F A;  2R4V A;  3LQ7 A;  4LL1 B;  2X8G A;  3KCM A;  1THX A;  4PTS A;  5G5E A;  4MCU A;  5E59 A;  1XWC A;  5CO3 A;  2H76 A;  1FVK A;  4HQZ A;  5A4U A;  3TJG A;  1ERW A;  1XFL A;  3A5W A;  3TUE A;  3TJB A;  3G7I A;  1PRX A;  2YPM A;  2AYT A;  4POL A;  4MAB A;  2L59 A;  4MF5 A;  2HSM B;  1XVQ A;  5ELG A;  2E7P A;  4O32 A;  1GH2 A;  2V1M A;  4MH2 A;  1A2L A;  4ID0 A;  3KH9 A;  2LUS A;  4NAX A;  2RM6 A;  3M8N A;  1X9M B;  4ISD A;  2K6V A;  1R26 A;  3MSZ A;  5G31 A;  5H5S A;  1A23 A;  4NV5 A;  4MPG A;  2AUV A;  3VWU A;  5INY A;  3E3E A;  3NZN A;  3CMI A;  1U87 A;  2RUF A;  1WP0 A;  1M0U A;  1TKD B;  4I6X A;  4HOJ A;  4V1A g;  2OAC A;  1FB6 A;  2AV4 A;  2R5G A;  4DSS B;  5LCZ A;  4YAP A;  3O76 A;  5LNK e;  5J9C A;  3R2Q A;  2YWM A;  2NBS A;  3QFB C;  1UA5 A;  2HSY A;  3QD9 A;  5IM9 A;  3DD3 A;  1GLQ A;  2R37 A;  2HSM A;  4GTU A;  5ID2 A;  1B9X C;  3LYP A;  3PGT A;  4KW6 A;  4I2U A;  1OE8 A;  1FB0 A;  4IJ3 A;  1DBY A;  2HZE A;  2V2G A;  5HR1 A;  1GTA A;  2DBC A;  5AGY A;  4RQR A;  2GVP A;  5HFG A;  2VCW A;  2N5A A;  1WRY A;  4NMU A;  3EWL A;  1R5P A;  5DDL A;  3HCZ A;  4XRA A;  1GSQ A;  5IOW A;  4YQU A;  1B8X A;  3O6T A;  3ME7 A;  3LGC A;  4IW9 A;  2H6X A;  4Z7X A;  3W6G A;  2DMM A;  1SKS B;  5DBQ A;  5ECI B;  4BVY B;  2VL9 A;  1EOG A;  1GNE A;  5B6N A;  1C72 A;  2PU9 C;  3GTU A;  4LA1 A;  2PVQ A;  3D22 A;  5A5K A;  3FZ9 A;  2CV4 A;  3F3Q A;  4IP1 A;  2HQT A;  3GST A;  4GF0 A;  1R7H A;  4EO3 A;  2VD0 A;  1F9M A;  5D9V A;  2CZ2 A;  5C04 A;  1CQH A;  2WDU A;  4XS1 A;  1H75 A;  3WT1 A;  1M9A A;  4E8H A;  4D73 A;  1BG5 A;  2OJL A;  2C0D A;  1TI1 A;  2VD1 A;  2FY6 A;  1NM3 A;  2C3Q A;  5CAX A;  3HJP A;  1TP9 A;  4BVX A;  2X64 A;  1SU9 A;  1TK8 B;  4K7I A;  4EC0 A;  1XOB A;  5ECK B;  1XOA A;  2K8S A;  3H8Q A;  3F4T A;  5F07 A;  3KMN A;  4BVY A;  3UBK A;  2LJK A;  2CA8 A;  4ZIJ A;  4MA9 A;  1SKR B;  4ZL9 A;  4FYU A;  3E9J B;  3Q6O A;  1XCC A;  1EOH A;  3GKM A;  2WB9 A;  1K3Y A;  5EVO A;  3M0F A;  3ZLP A;  3FR9 A;  2G2Q A;  1AUC A;  3L9U A;  1GUL A;  3PIN A;  4OD7 A;  2XBI A;  3A2W A;  1GTI A;  1Z7P A;  3IOS A;  6GSV A;  3QPM A;  5HQP A;  4HJ2 A;  4DSR A;  2GLR A;  2XBQ A;  11GS A;  1X0R A;  3EVI A;  3EC3 A;  5D9X A;  2YP6 A;  3FK8 A;  2DJ1 A;  3M9K A;  4ZXG A;  4OO4 A;  3GN3 A;  4X1U A;  4XHM A;  5DAL A;  1A8Y A;  2LJR A;  2B5Y A;  1EGR A;  2XHF A;  2FUG 2;  3M1G A;  4TN8 A;  2TIR A;  2ZUP A;  5J9B A;  1JLV A;  4POB A;  4MF7 A;  2GST A;  3ISO A;  1N8J A;  3KP8 A;  4Q5F A;  3VLN A;  1XIY A;  3RBT A;  1T4Z A;  2L6C A;  4IP6 A;  1XBS A;  4F82 A;  1PL2 A;  1Z9H A;  1Z3E A;  3CXG A;  2IME A;  1WOU A;  4AJ7 A;  3UAP A;  1QMV A;  1PL1 A;  5DCH A;  1GRX A;  4TR4 A;  1Q4J A;  2I3Y A;  2YOI A;  5DQY A;  1JHB A;  6GSW A;  4K7N A;  2R6K A;  1QXH A;  4HU9 A;  5F06 A;  4ZB9 A;  3LFL A;  1V58 A;  1URM A;  5H5Q A;  2P5Q A;  3F9U A;  1AAZ A;  3QAW A;  2H71 A;  3FZ5 A;  5AIS A;  2L4Q A;  2MBS A;  3GH6 A;  5EY6 A;  1SK0 A;  2FGX A;  2CVD A;  3IRA A;  4DEJ A;  1JZR A;  5IO0 A;  4KDY A;  2WCI A;  2KOK A;  3ZVJ A;  5FHI A;  3ZTL A;  3DGQ A;  4X0X A;  5DVB A;  1GUK A;  4G0I A;  1M9B A;  3TRX A;  1LBK A;  4I2T A;  5B6M A;  3CBU A;  2B7J A;  3DML A;  5ECH B;  2C3T A;  4MZC A;  2WGR A;  3BJ5 A;  3UAR A;  1K0O A;  4ECC A;  2XC2 A;  3A3T A;  4K0N A;  2FLS A;  4TKY A;  4MLY A;  6GST A;  3RHB A;  1B48 A;  2YN1 A;  22GS A;  2IFQ B;  3RDW A;  1S3A A;  3KXO A;  3E0U A;  4ZIL A;  3APS A;  3ZL5 A;  3HA9 A;  4JBB A;  2JZS A;  2GSS A;  5D9T A;  2F51 A;  5HR0 A;  3APO A;  1T3B A;  4KSM A;  1R5A A;  5D9W A;  4ML1 A;  4OCF A;  4OCE A;  4P3Y B;  2MMZ A;  3FR3 A;  2DJ3 A;  2XPD A;  2H1B A;  4V2M A;  1ERT A;  3D4M A;  2TRX A;  1NHY A;  1K0M A;  3SWL A;  3GUR A;  4MJC A;  2H75 A;  4J57 E;  1O85 A;  2VCX A;  3GNJ A;  3F63 A;  3C1S A;  4GCI A;  1K3L A;  2VM2 A;  4JU5 A;  4OFT A;  4NHW A;  2YZH A;  3BCI A;  2OAD A;  1TRW A;  4GSN A;  3UJ1 A;  2PN8 A;  4Q5Q A;  4AJ6 A;  1O6J A;  5ECO B;  1TRS A;  1PSQ A;  4O5R A;  1DE1 A;  2DJ2 A;  3RAZ A;  2LNS A;  4LLR A;  3QOU A;  3IXR A;  4KGI A;  3GL3 A;  1TDI A;  2RUE A;  3I9V 2;  4FO5 A;  2O85 A;  2H8L A;  1EP8 A;  2EC4 A;  4WR5 A;  3IDV A;  1ERV A;  2DC5 A;  3UEM A;  2JZT A;  4JE1 A;  2DML A;  1F2E A;  3SBC A;  5B7C A;  2H66 A;  1AW9 A;  2REM A;  2DLX A;  4DSQ A;  13GS A;  2ON7 A;  3GFK A;  3W8J A;  3TKS C;  4EXJ A;  3C71 A;  3ZFB A;  4OFN A;  1ABA A;  3HVS A;  3BBY A;  4PQH A;  2F9S A;  4G2E A;  1PN9 A;  4AGS A;  4WEY A;  3VI7 A;  2OE3 A;  5ENU A;  3TOU A;  4FH8 A;  1K0B A;  1VF1 A;  2P31 A;  3UVT A;  4H86 A;  1Y6E A;  1YF0 A;  1SKW B;  2JAC A;  20GS A;  4BWQ A;  2LST A;  4EE0 A;  2B6M A;  4GXZ A;  2CVB A;  1K0D A;  1U88 A;  4NHZ A;  4F2I A;  1E2Y A;  2UZ8 A;  2GZZ A;  4KSO A;  2E2G A;  2KHP A;  1VGL A;  1GSU A;  5D96 A;  2JU5 A;  1PA3 A;  5CYY A;  5CRH A;  4ZBD A;  4POK A;  2YCD A;  3VUR A;  3O3T A;  2HRF A;  1V2A A;  1PX7 A;  1AIU A;  3HXS A;  2VCT A;  2O7K A;  1USB A;  1JZW A;  4ZB6 A;  1HNC A;  3QAG A;  2V41 A;  4WBR D;  1F37 A;  2I81 A;  3LYK A;  1EV9 A;  3IC4 A;  1AQX A;  3P7X A;  2NTO A;  3F6F A;  3F4S A;  5IPH A;  1SK2 A;  5J41 A;  1K0C A;  2CVK A;  1X5D A;  2PWJ A;  4MZB A;  4BL7 A;  5IMV A;  4IQ1 A;  2KP2 A;  4L0U A;  4MP4 A;  2CX3 A;  4OWY A;  3UMA A;  4IHU A;  3D4T A;  3OR5 A;  1M7T A;  3D21 A;  5KN0 A;  4BWS A;  1OKT A;  6GSY A;  3GKX A;  2KLX A;  3EU3 A;  4ECJ A;  3QAV A;  1SJZ A;  5ECM B;  3D5J A;  1G7O A;  1YEX A;  4XIH A;  4K1F A;  3GMF A;  3DKS A;  5LD0 A;  2GQK A;  3KZQ A;  3IC8 A;  2IPA A;  2GSQ A;  1XVW A;  1K0N A;  2EIQ A;  4YH2 A;  4KDX A;  5KN2 A;  4E8E A;  5KEJ A;  1X5C A;  1KEB A;  5HR3 A;  3DEX A;  1M99 A;  1MTC A;  2LKU A;  3GUS A;  5COH A;  5F0G A;  4TW5 A;  4XTS A;  3P8W A;  1W4V A;  2LJA A;  1TK0 B;  1TU8 A;  3CTG A;  1QK8 A;  2VUP A;  4J56 E;  2HYX A;  1BX9 A;  1FO5 A;  2DSA A;  5AN1 A;  2GQM A;  2FCH A;  3H1N A;  3QDN A;  4HI7 A;  4DSS A;  3G9B A;  1WWJ A;  1FOV A;  1TRV A;  3UOM A;  5ECR B;  1JFU A;  4G19 A;  4GST A;  2C80 A;  2TRC P;  2OBK A;  2WJU A;  3TOT A;  5J5N A;  2IWT A;  2V32 A;  8GSS A;  1R4W A;  2VLV A;  3LOR A;  1SJ6 A;  3UIW A;  4EUY A;  1TOF A;  2HRN A;  3TCO A;  2M46 A;  3GX8 A;  1A2J A;  1WPI A;  4TR1 B;  2A2S A;  3J7Y b;  2LRT A;  3CSH A;  1PKW A;  2V6K A;  1J9B A;  1ERU A;  5DQS A;  1FAA A;  4BA7 A;  3UL3 A;  3KJY A;  2H72 A;  2C0G A;  4HUA A;  2OKA A;  1DUG A;  1GTB A;  2CZ3 A;  2QGV A;  4NPB A;  2GTU A;  3WGX A;  2H1G A;  2PGT A;  3HDC A;  3L0H A;  2H74 A;  2HSH A;  1T8E B;  4ILF A;  2H19 A;  1GNW A;  4V2N A;  4K2D A;  3IHQ A;  4LMW A;  4O92 A;  4ZBA A;  3TKQ A;  4RI6 A;  3C8E A;  4WF5 A;  5ABR A;  5ECP B;  2K8V A;  2L6D A;  4RI7 A;  1AXD A;  4TOP A;  3HYP A;  4IGJ A;  3LWA A;  4Q5R A;  2FNO A;  1DE2 A;  3LSZ A;  2IMF A;  17GS A;  1Z7R A;  3WGE A;  1JLW A;  2ES7 A;  1SD8 A;  2EIO A;  2OBI A;  4WBJ A;  1NSW A;  5IOX A;  2K18 A;  1ST9 A;  2VL2 A;  4N30 A;  1OE7 A;  1B4P A;  1F3A A;  4BPY A;  3M9J A;  3H93 A;  2JL4 A;  4FIW A;  4HZ4 A;  5G1K A;  3I69 A;  2LRN A;  1TRU A;  2HRK B;  3FYG A;  1UN2 A;  4K8M A;  1SK1 A;  4QL9 A;  4HQS A;  3TRP A;  4ZBB A;  2O89 A;  2HNL A;  2C3N A;  3WGD A;  4GLT A;  1OKD A;  6GSU A;  3S9F A;  1A24 A;  5FT3 A;  2FA4 A;  4KDU A;  2D2Z A;  12GS A;  5H5R A;  2GS3 A;  3TDG A;  3U6V A;  1GSS A;  5F05 A;  1JZD A;  2BJX A;  2AJQ B;  2YV7 A;  1GUH A;  3RHC A;  4TRX A;  4HJM A;  1THO A;  2M72 A;  1QFN A;  4IVF A;  2VM1 A;  4V1A p;  1FVJ A;  4JRR A;  2B1L A;  1FW1 A;  4ZL8 A;  4XCS A;  3UBL A;  3TKP A;  2I4A A;  5KN1 A;  3ERF A;  1XWB A;  1YKA A;  4PNG A;  3VK9 A;  3PR8 A;  3ZRE A;  3TJF A;  1S3C A;  5D73 A;  2O8V B;  2H70 A;  2HRK A;  5JCG A;  4EF0 A;  1I5G A;  4HS1 A;  1LU4 A;  1MDK A;  3RPN A;  2OE0 A;  4ZB8 A;  1PQN A;  2QKE A;  4USS A;  4G9H A;  2RLI A;  1ZOF A;  1Y25 A;  4PXO A;  4QL7 A;  1KNG A;  4HDE A;  1A0F A;  5G2Z A;  2H6Y A;  1AQW A;  4KH7 A;  3IR4 A;  2C0E A;  1N2A A;  3GRX A;  1XW6 A;  2GZP A;  3C73 A;  4RQX A;  5DJM A;  3D6I A;  1SYX A;  3IK9 A;  4WET A;  1X9W B;  1HYU A;  1V98 A;  4KB3 A;  4FYC A;  1PX6 A;  2PER A;  5DAK B;  5HFI A;  3IAS 2;  1UC7 A;  1O81 A;  2Z9S A;  3BCK A;  1GSE A;  5F8B A;  6GSS A;  3LEF A;  4PQ1 A;  2WFC A;  3D0Z A;  2JAD A;  3IAM 2;  2X99 A;  4L8E A;  1KTE A;  1RW1 A;  3G7Y A;  3PH9 A;  3KD0 A;  1BJX A;  3KH7 A;  4GQC A;  4ACS A;  2N5B A;  2L57 A;  4RUV A;  1WE0 A;  4N0V A;  3LXZ A;  5G1L A;  2NVL A;  1XWA A;  2WUL A;  3HVX A;  4DVC A;  3GKN A;  4MK3 A;  3Q19 A;  2F8F A;  2ALB A;  4WR4 A;  1UVZ A;  2IMD A;  1V9W A;  3DVW A;  3A2X A;  4MZW A;  3HD5 A;  1HNA A;  1QGV A;  1Z6N A;  3LXT A;  2HRA A;  5E4W A;  4ZL7 A;  5ELA A;  3FY7 A;  1F3B A;  2HZF A;  1K3O A;  4TXO B;  2H01 A;  2GSR A;  3Q74 A;  2IFQ A;  1OYJ A;  3HHV A;  1EGO A;  4PQI A;  5HR2 A;  1YKC A;  4XS4 B;  3MWH A;  3CSJ A;  4PUF C;  1XW9 A;  1GP1 A;  2LQQ A;  2B1K A;  1M2D A;  5IMZ A;  3J7Y k;  3HJO A;  2JZR A;  2LEG A;  3FEU A;  2CAI A;  5JCW A;  2JSY A;  1ZMA A;  4LL4 B;  1H4O A;  2YZU A;  3K8N A;  1TK5 B;  3QFA C;  5JWR B;  3GHA A;  1YEP A;  1MD3 A;  4JR6 A;  5AIV A;  4L5O A;  1O8W A;  4L5L A;  5G30 A;  1J08 A;  1SD9 A;  3HZ8 A;  1G0T A;  1XW5 A;  4N10 A;  1Z6M A;  3US3 A;  4TVE A;  3LJR A;  1TXX A;  1ML6 A;  1J0F A;  1X9S B;  5J3R A;  3QR6 A;  3L9V A;  2F3M A;  4F03 A;  3W8S A;  3EIN A;  1GL8 A;  5B8B A;  1FHE A;  1XWG A;  4ULX A;  5ECL B;  4MJE A;  1TU7 A;  4XRD A;  1F6M C;  2H0I A;  1NW2 A;  1WIK A;  2R3X A;  1MEK A;  2HT9 A;  3LG6 A;  4I8B A;  4MDC A; 
#chains in the Genus database with same CATH topology
 2C8U A;  3H79 A;  4KND A;  3APQ A;  5B8A A;  4ECI A;  4V2L A;  1U6T A;  3V1W A;  2FWF A;  1MDJ A;  1GUM A;  5L71 A;  1CQG A;  2LS5 A;  1VRS D;  1VF4 A;  2GDR A;  3ZIJ A;  18GS A;  1EEM A;  3KTB A;  1XZO A;  1Q98 A;  3FZ4 A;  2KP1 A;  3R3E A;  2NPB A;  2VAF A;  2PPT A;  2M80 A;  2CX4 A;  1OC3 A;  3GSS A;  1G6Y A;  3ZFL A;  4N11 A;  1TJD A;  1T7P B;  2L4C A;  3FW2 A;  2E2M A;  4IQA A;  2DJ0 A;  4NWY A;  1O73 A;  1PFO A;  3IA1 A;  1B4Q A;  2IIY A;  1ZYE A;  3DXB A;  3F6D A;  1AQV A;  2YWO A;  2J9H A;  5HFK A;  3GH9 A;  2FD3 A;  4HU7 A;  5ID2 B;  4KAE A;  3QCP A;  4Q5N A;  3VI5 A;  2B5X A;  2FHE A;  4IEL A;  9GSS A;  3DYR A;  2GT6 A;  2HZE B;  2RII A;  3CWG A;  2IN3 A;  1VF2 A;  14GS A;  1SL2 B;  5AIX A;  2EIR A;  3U5R E;  3LW9 A;  4J2F A;  1IYI A;  2YAN A;  2LTK A;  5GAP D;  4CHS A;  2C4J A;  2L5O A;  4K0G A;  1MD4 A;  1XWK A;  2IMK A;  1QUW A;  2OE1 A;  4OFM A;  1BQ7 A;  2YWN A;  2H30 A;  2NDO A;  3NOF A;  1S4B P;  2L5L A;  3WD6 A;  3HZ4 A;  3ZML A;  3TJJ A;  2QA2 A;  4FQU A;  1OC9 B;  5D93 A;  2AHE A;  3ZIT A;  5KN3 A;  3VFI A;  3CYN A;  1GTU A;  3GTU B;  2XPE A;  4L0W A;  1RQM A;  1I1I P;  3L4N A;  3WT2 A;  3Q18 A;  1TW9 A;  3HY2 A;  4CDO A;  2O3E A;  2MYG A;  2YJH A;  4F9Z A;  3GIX A;  1XXU A;  1PKZ A;  4POM A;  4D73 B;  3C7M A;  2J23 A;  1ZGN A;  4K6X A;  4F0C A;  4KCE A;  1GSF A;  4KUN A;  2H1A A;  2E0Q A;  3I43 A;  1EZK A;  2VCV A;  2FA8 A;  3EYT A;  3KP9 A;  4MNN A;  1G7E A;  4BVX B;  4AKX B;  1BYE A;  3MAK A;  1A8L A;  10GS A;  2VL3 A;  1OC9 A;  2IL3 A;  4QQ7 A;  2X4A A;  1SEN A;  1PGT A;  2HLS A;  1SYR A;  3FKF A;  4GRF A;  5CNW A;  5ECQ B;  2DKI A;  3M3M A;  4YKG A;  2HSN B;  5C00 A;  3VPT A;  5IQY A;  3IBH A;  1Z5Y E;  5J40 A;  3P90 A;  3ZZX A;  2MBT A;  1SL1 B;  3FHK A;  5BRT A;  4TXV A;  2H0H A;  3TRQ A;  1X5E A;  2X8H A;  4KX4 A;  2DIZ A;  3TKR A;  1BAY A;  3RPP A;  2UV8 G;  3GV1 A;  5GZZ B;  4PI2 C;  4EIP A;  3FRC A;  3QMX A;  3EU4 A;  2ZNM A;  5GST A;  2X8C A;  5CRG A;  2BMX A;  4FYB A;  3ZYW A;  4YQV A;  2DIY A;  5D8I A;  3EE2 A;  1HD2 A;  1YZX A;  3FR6 A;  1TI3 A;  3TKS E;  3JCM L;  2A4V A;  2MMA A;  3N9J A;  4X4J A;  2PMT A;  2B7K A;  1WMJ A;  3DRN A;  3KEB A;  1O8X A;  1MDI A;  3L9S A;  2VOC A;  4IBP A;  2B5E A;  2HE3 A;  1T1V A;  1OC8 A;  5DAL B;  2A2R A;  4N0Z A;  2LNT A;  1M3J A;  4G10 A;  3I6A A;  4JZQ A;  1ILO A;  3FMW A;  4TR1 A;  1ZL9 A;  4GQF A;  1YQ1 A;  2YWI A;  3IPZ A;  1BED A;  7GSS A;  2VIM A;  2YV9 A;  3GX0 A;  5DCG A;  4MH3 A;  4TR0 A;  1XG8 A;  2WZ9 A;  5CP1 A;  2V6O A;  2MMO A;  2C1Y A;  1A0R P;  2WRT A;  3CQF A;  2MZC A;  1BF5 A;  5IO2 A;  1V57 A;  1K0A A;  4G0L A;  3MIX A;  4AKH A;  3F4R A;  2O36 A;  1HNB A;  2FWH A;  5IIZ A;  4IKH A;  1FG4 A;  4XS6 A;  4EL1 A;  3F3R A;  3CRT A;  2CQ9 A;  3L78 A;  3TJK A;  1NHO A;  2DJJ A;  5FWG A;  5CRD A;  5A5H B;  4AF2 A;  2QC7 A;  5DJL A;  2WS2 A;  1DSB A;  1I9D A;  1S3D A;  1GSY A;  2RM5 A;  2IJY A;  4AKG A;  2HFD A;  5GSS A;  1M2B A;  3F0I A;  2O5V A;  3MDK A;  4O7H A;  3A5I A;  1T4Y A;  6GSX A;  4G01 A;  5JCU A;  2R2J A;  3ZRD A;  1WJK A;  3ERG A;  2MMN A;  1XPV A;  3A2V A;  1HQO A;  3HJM A;  1W89 A;  1O7U A;  2H73 A;  2I9H A;  4OMV A;  3C1R A;  1EWX A;  4PNF A;  1OVN A;  2EFE A;  3AY8 A;  1YJ6 A;  3VWX A;  4PUA A;  2VLT A;  5IPG A;  2FWE A;  4GWR A;  3UVH A;  1VF3 A;  2OA7 A;  2HXK A;  1QQ2 A;  1JZO A;  2QSI A;  3KIJ A;  4K9Z A;  2A2P A;  2YJ7 A;  5A5H A;  4PUR A;  2LRC A;  2F8A A;  1TTZ A;  2H1D A;  1ZYQ B;  3MNG A;  2I1U A;  4X43 A;  4K5R A;  2WVY A;  3GKK A;  3CSI A;  2VKZ G;  1SL0 B;  1AC1 A;  3HKR A;  1ACV A;  1GWC A;  2ON5 A;  3VWW A;  3ZIV A;  5J4U A;  5JWO B;  1U3A A;  1E6B A;  1YDK A;  2LQO A;  1RK4 A;  1FOH A;  4ECB A;  1PD2 1;  3IHG A;  1EP7 A;  5CRE A;  2VO4 A;  4MF6 A;  3ZVJ D;  5ECN B;  3TKS A;  1T00 A;  3BOA A;  4HZ2 A;  2VL2 C;  3GYK A;  5EPF A;  1IYH A;  3GL5 A;  3EUR A;  4NXI A;  4TR3 A;  1GLP A;  4MJA A;  5BMU A;  4GSS A;  2IMI A;  5A4W A;  1PMT A;  3CRU A;  4KE3 A;  3EMX A;  2DJK A;  2PUK C;  3ERW A;  2H1L A;  3P2A A;  2GZY A;  3WYW A;  1U3I A;  2YNX A;  4JED A;  3ED3 A;  2AAW A;  1LJR A;  2O87 A;  2JSZ A;  2P0G A;  3TGZ A;  3CTF A;  4F0B A;  4IS0 A;  5DAK A;  5IMD A;  19GS A;  1A2M A;  3H4K A;  4WXT A;  3DVX A;  5IMA A;  5GAN D;  5IMC A;  3HVV A;  1PN0 A;  3EMP A;  4AJ8 A;  4EKZ A;  4KF9 A;  3IE3 A;  4YAV A;  1V40 A;  3IV4 A;  4K7O A;  3ME8 A;  1ZYP A;  3GA4 A;  3PPU A;  2VCZ A;  4IJI A;  4CW9 A;  4NV2 A;  4EDY A;  4HEA 2;  4OO5 A;  4I97 A;  4I5Q A;  2FWG A;  4EIQ A;  3N5O A;  4ML6 A;  1YF1 A;  2CT6 A;  3ZMK A;  2CAQ A;  5KOW A;  2K9F A;  3TB2 A;  2VLU A;  5CRW A;  1EEJ A;  3VWV A;  2G0F A;  4WKW A;  3KM6 A;  4TXO A;  5ECS A;  1ZZY A;  2P5R A;  4XS4 A;  2HI7 A;  4G0K A;  4PX1 A;  5A4V A;  2ZCT A;  4MJB A;  5EL8 A;  1GSD A;  3DIE A;  4LMV A;  3KGK A;  1YY7 A;  1B9Y C;  1ZCP A;  1OAZ A;  2AB6 A;  4YQM A;  2KUC A;  1KBN A;  3FZA A;  3G7J A;  2H6Z A;  3NIV A;  2C0F A;  2GGT A;  3DWV A;  2H0G A;  4MPF A;  3IK7 A;  2PVO C;  1M2A A;  5IMF A;  4IN0 A;  2PBJ A;  4EDZ A;  4KCA A;  3KTL A;  16GS A;  3F8U A;  2VCQ A;  5JWQ B;  2GT5 A;  1ON4 A;  1SJI A;  1G6W A;  2WVX B;  4PGT A;  3BD2 A;  2GQL A;  4KA0 A;  3KMO A;  4EVM A;  4JR4 A;  3VPQ A;  4BL7 B;  2B3S A;  2BTO T;  5G5F A;  1EV4 A;  4ICY A;  4WF4 A;  2LV3 A;  4MMM A;  2N5F A;  2R4V A;  3LQ7 A;  4LL1 B;  2X8G A;  3KCM A;  1THX A;  4PTS A;  5G5E A;  4MCU A;  5KOX A;  5E59 A;  1XWC A;  5CO3 A;  2H76 A;  1FVK A;  4HQZ A;  5A4U A;  3TJG A;  1ERW A;  1XFL A;  3A5W A;  3TUE A;  4CY8 A;  3TJB A;  3G7I A;  1PRX A;  2YPM A;  2AYT A;  4POL A;  4MAB A;  2L59 A;  4MF5 A;  2HSM B;  1XVQ A;  5ELG A;  2E7P A;  4O32 A;  4I8B A;  1GH2 A;  2V1M A;  4QMK A;  4MH2 A;  1A2L A;  4ID0 A;  3KH9 A;  2LUS A;  4NAX A;  2RM6 A;  3M8N A;  1X9M B;  4ISD A;  2K6V A;  1R26 A;  3MSZ A;  5G31 A;  5H5S A;  1A23 A;  4NV5 A;  4MPG A;  2AUV A;  3VWU A;  5INY A;  3E3E A;  2A4H A;  3NZN A;  3CMI A;  1U87 A;  2RUF A;  1WP0 A;  1M0U A;  1TKD B;  4I6X A;  4HOJ A;  4V1A g;  2OAC A;  1FB6 A;  2AV4 A;  2R5G A;  4DSS B;  5LCZ A;  4YAP A;  4K5S A;  3O76 A;  5LNK e;  5J9C A;  3R2Q A;  2YWM A;  5J4Y A;  2NBS A;  3QFB C;  1UA5 A;  2HSY A;  3QD9 A;  5IM9 A;  3DD3 A;  1GLQ A;  2R37 A;  2HSM A;  4GTU A;  5ID2 A;  1B9X C;  3LYP A;  3PGT A;  4KW6 A;  4I2U A;  1OE8 A;  1FB0 A;  4IJ3 A;  1DBY A;  2HZE A;  2V2G A;  5HR1 A;  1GTA A;  2DBC A;  5AGY A;  4RQR A;  2GVP A;  5HFG A;  2VCW A;  2N5A A;  1WRY A;  4NMU A;  3EWL A;  1R5P A;  5DDL A;  3HCZ A;  4XRA A;  1GSQ A;  5IOW A;  4YQU A;  1B8X A;  1BG1 A;  3O6T A;  3ME7 A;  3LGC A;  4IW9 A;  2H6X A;  4Z7X A;  3W6G A;  2DMM A;  1SKS B;  5DBQ A;  5ECI B;  4BVY B;  2VL9 A;  1EOG A;  1GNE A;  5B6N A;  1C72 A;  2PU9 C;  3GTU A;  4O5Q A;  4LA1 A;  2PVQ A;  3D22 A;  5A5K A;  3FZ9 A;  2WW0 A;  2CV4 A;  3F3Q A;  4IP1 A;  2HQT A;  3GST A;  4GF0 A;  1R7H A;  4EO3 A;  2VD0 A;  1F9M A;  5D9V A;  2CZ2 A;  5C04 A;  1CQH A;  2WDU A;  4XS1 A;  1H75 A;  3WT1 A;  1M9A A;  4E8H A;  4D73 A;  1BG5 A;  2OJL A;  2C0D A;  5A34 B;  1TI1 A;  3HVN A;  2VD1 A;  2FY6 A;  1NM3 A;  2C3Q A;  5CAX A;  1N25 A;  3HJP A;  1TP9 A;  4BVX A;  2X64 A;  1SU9 A;  1TK8 B;  4K7I A;  2WW1 A;  4EC0 A;  1XOB A;  5ECK B;  1XOA A;  2K8S A;  3H8Q A;  3F4T A;  5F07 A;  3KMN A;  4BVY A;  2HSN A;  3UBK A;  2LJK A;  2CA8 A;  4ZIJ A;  4MA9 A;  1SKR B;  4ZL9 A;  4FYU A;  3E9J B;  3Q6O A;  1XCC A;  1EOH A;  3GKM A;  2WB9 A;  1K3Y A;  5EVO A;  3M0F A;  3ZLP A;  3FR9 A;  4GDF A;  2G2Q A;  1AUC A;  3L9U A;  1GUL A;  3PIN A;  4OD7 A;  2XBI A;  5A34 A;  3A2W A;  1GTI A;  1Z7P A;  3IOS A;  6GSV A;  3QPM A;  5HQP A;  4HJ2 A;  4DSR A;  2GLR A;  2XBQ A;  11GS A;  1X0R A;  3EVI A;  3EC3 A;  5D9X A;  2YP6 A;  3FK8 A;  2DJ1 A;  3M9K A;  4ZXG A;  4OO4 A;  3GN3 A;  4X1U A;  4XHM A;  5DAL A;  1A8Y A;  3EPT A;  2LJR A;  2B5Y A;  1EGR A;  2XHF A;  2FUG 2;  3M1G A;  4TN8 A;  2TIR A;  2ZUP A;  5J9B A;  1JLV A;  4POB A;  4MF7 A;  2GST A;  3ISO A;  1N8J A;  3KP8 A;  4Q5F A;  3VLN A;  1XIY A;  1S3R A;  3RBT A;  1T4Z A;  2L6C A;  4IP6 A;  1XBS A;  4F82 A;  1PL2 A;  2R0P A;  1Z9H A;  1Z3E A;  3CXG A;  2IME A;  1WOU A;  4AJ7 A;  3UAP A;  1QMV A;  1PL1 A;  5DCH A;  1GRX A;  4TR4 A;  1Q4J A;  2I3Y A;  2YOI A;  5DQY A;  1JHB A;  6GSW A;  4K7N A;  2R6K A;  1QXH A;  4HU9 A;  1M3I A;  5F06 A;  4ZB9 A;  3LFL A;  1V58 A;  1URM A;  5H5Q A;  2P5Q A;  5A1N B;  3F9U A;  1AAZ A;  3QAW A;  2H71 A;  3FZ5 A;  5AIS A;  2L4Q A;  2MBS A;  3GH6 A;  5EY6 A;  1SK0 A;  2FGX A;  2CVD A;  3IRA A;  4DEJ A;  1JZR A;  5IO0 A;  4KDY A;  4CY6 A;  2WCI A;  2KOK A;  3ZVJ A;  5FHI A;  3ZTL A;  3DGQ A;  4X0X A;  5DVB A;  1GUK A;  4G0I A;  1M9B A;  3TRX A;  1LBK A;  4I2T A;  5B6M A;  3CBU A;  2B7J A;  3DML A;  4FXY P;  5ECH B;  2C3T A;  4MZC A;  2WGR A;  3BJ5 A;  3UAR A;  1K0O A;  4ECC A;  2XC2 A;  3A3T A;  4K0N A;  2FLS A;  4TKY A;  1YVL A;  4MLY A;  6GST A;  3RHB A;  1B48 A;  2YN1 A;  2WW3 A;  22GS A;  2IFQ B;  3RDW A;  1S3A A;  3KXO A;  3E0U A;  4ZIL A;  3APS A;  3ZL5 A;  3HA9 A;  4JBB A;  2JZS A;  2GSS A;  5D9T A;  2F51 A;  5HR0 A;  3APO A;  1T3B A;  4KSM A;  1R5A A;  5D9W A;  4ML1 A;  4OCF A;  4OCE A;  4P3Y B;  3RFR C;  2MMZ A;  3FR3 A;  2DJ3 A;  2XPD A;  3TU3 B;  4W66 A;  2R0G A;  2H1B A;  4V2M A;  1ERT A;  3D4M A;  2TRX A;  1NHY A;  1K0M A;  3SWL A;  3GUR A;  4MJC A;  2H75 A;  4J57 E;  1O85 A;  2VCX A;  3RGB C;  3GNJ A;  3F63 A;  3C1S A;  4GCI A;  1K3L A;  2VM2 A;  4JU5 A;  4OFT A;  4NHW A;  2YZH A;  3BCI A;  2OAD A;  1TRW A;  5J47 A;  4GSN A;  3UJ1 A;  2PN8 A;  4Q5Q A;  4AJ6 A;  1O6J A;  5ECO B;  1TRS A;  3MYD A;  1PSQ A;  4O5R A;  1DE1 A;  2DJ2 A;  3RAZ A;  2LNS A;  4LLR A;  3QOU A;  3IXR A;  4KGI A;  3GL3 A;  1TDI A;  2RUE A;  3I9V 2;  4FO5 A;  2O85 A;  2H8L A;  1EP8 A;  2EC4 A;  4WR5 A;  3IDV A;  1ERV A;  2DC5 A;  3UEM A;  2JZT A;  4JE1 A;  2DML A;  1F2E A;  3SBC A;  5B7C A;  2H66 A;  1AW9 A;  2REM A;  1ZYN A;  2DLX A;  4DSQ A;  13GS A;  4E68 A;  2ON7 A;  3GFK A;  3W8J A;  3TKS C;  4EXJ A;  3C71 A;  4OFN A;  2R0C A;  1ABA A;  3HVS A;  3BBY A;  4PQH A;  2F9S A;  4G2E A;  1PN9 A;  4AGS A;  4WEY A;  3VI7 A;  2OE3 A;  2QA1 A;  5ENU A;  3TOU A;  4FH8 A;  1K0B A;  1VF1 A;  2P31 A;  3UVT A;  4H86 A;  1Y6E A;  1YF0 A;  1SKW B;  2JAC A;  20GS A;  4BWQ A;  2LST A;  4ZB7 A;  4EE0 A;  2B6M A;  4GXZ A;  2CVB A;  1K0D A;  1U88 A;  4NHZ A;  4F2I A;  1E2Y A;  2UZ8 A;  2GZZ A;  2OT3 A;  4KSO A;  2E2G A;  2KHP A;  1VGL A;  1GSU A;  5D96 A;  2JU5 A;  1PA3 A;  5CYY A;  5CRH A;  4ZBD A;  4POK A;  2YCD A;  3VUR A;  3O3T A;  2HRF A;  1V2A A;  1PX7 A;  1AIU A;  3HXS A;  2VCT A;  2O7K A;  1USB A;  1JZW A;  4ZB6 A;  1HNC A;  3QAG A;  2V41 A;  4WBR D;  1F37 A;  2I81 A;  3LYK A;  1EV9 A;  3IC4 A;  1AQX A;  3P7X A;  2NTO A;  3F6F A;  3F4S A;  2WVX A;  5IPH A;  1SK2 A;  5J41 A;  1K0C A;  2CVK A;  1X5D A;  2PWJ A;  2DKH A;  4BL7 A;  4MZB A;  5IMV A;  4IQ1 A;  2KP2 A;  4L0U A;  4MP4 A;  2CX3 A;  4OWY A;  3UMA A;  4IHU A;  3D4T A;  3OR5 A;  1M7T A;  3D21 A;  5KN0 A;  4BWS A;  1OKT A;  6GSY A;  3GKX A;  2KLX A;  3EU3 A;  4ECJ A;  3QAV A;  1SJZ A;  5ECM B;  3D5J A;  1G7O A;  1YEX A;  4XIH A;  4K1F A;  3GMF A;  3DKS A;  4K2X A;  5LD0 A;  2GQK A;  3KZQ A;  3IC8 A;  2IPA A;  2GSQ A;  1XVW A;  1K0N A;  2EIQ A;  4YH2 A;  4KDX A;  5KN2 A;  4E8E A;  5KEJ A;  1X5C A;  1KEB A;  5HR3 A;  4HSC X;  3DEX A;  1M99 A;  1MTC A;  2LKU A;  3GUS A;  5COH A;  5F0G A;  4TW5 A;  4XTS A;  3P8W A;  1TXU A;  1W4V A;  2LJA A;  1TK0 B;  1TU8 A;  3CTG A;  1QK8 A;  2VUP A;  4J56 E;  2HYX A;  1BX9 A;  1FO5 A;  2DSA A;  5AN1 A;  2GQM A;  2FCH A;  3H1N A;  3QDN A;  4HI7 A;  4DSS A;  3G9B A;  1SVO A;  1WWJ A;  1FOV A;  1TRV A;  3UOM A;  5ECR B;  1JFU A;  4G19 A;  4GST A;  2C80 A;  2TRC P;  2OBK A;  2WJU A;  3TOT A;  5J5N A;  2IWT A;  2V32 A;  8GSS A;  1R4W A;  4N3Z A;  2VLV A;  3LOR A;  1SJ6 A;  3UIW A;  4EUY A;  3CHX C;  1TOF A;  2HRN A;  3TCO A;  2M46 A;  3GX8 A;  1A2J A;  1WPI A;  4TR1 B;  2A2S A;  3J7Y b;  2LRT A;  4BIK A;  3CSH A;  1PKW A;  2V6K A;  1J9B A;  1ERU A;  5DQS A;  1FAA A;  4BA7 A;  3UL3 A;  3KJY A;  2H72 A;  2C0G A;  4HUA A;  2OKA A;  4YKF A;  1DUG A;  1GTB A;  2CZ3 A;  2QGV A;  4NPB A;  2GTU A;  3WGX A;  2H1G A;  2PGT A;  3HDC A;  3L0H A;  2H74 A;  2HSH A;  1T8E B;  4ILF A;  2H19 A;  1GNW A;  4V2N A;  4K2D A;  3IHQ A;  4LMW A;  4O92 A;  4ZBA A;  3TKQ A;  4RI6 A;  3C8E A;  3HMJ G;  4WF5 A;  4PI0 C;  5ABR A;  5ECP B;  2K8V A;  2L6D A;  4RI7 A;  1SVM A;  1AXD A;  4TOP A;  3HYP A;  4IGJ A;  3LWA A;  4Q5R A;  2FNO A;  1DE2 A;  3LSZ A;  2IMF A;  17GS A;  1Z7R A;  3WGE A;  1JLW A;  2ES7 A;  1SD8 A;  2EIO A;  2OBI A;  4WBJ A;  1NSW A;  5IOX A;  2K18 A;  1ST9 A;  2VL2 A;  4N30 A;  1OE7 A;  1B4P A;  1F3A A;  4BPY A;  3M9J A;  3H93 A;  2JL4 A;  4FIW A;  4HZ4 A;  5G1K A;  3I69 A;  2LRN A;  1TRU A;  2HRK B;  3FYG A;  1UN2 A;  4K8M A;  1SK1 A;  4QL9 A;  4HQS A;  3TRP A;  4ZBB A;  2O89 A;  2HNL A;  2C3N A;  3WGD A;  4GLT A;  1OKD A;  6GSU A;  3S9F A;  1A24 A;  5FT3 A;  2FA4 A;  4KDU A;  2D2Z A;  12GS A;  5H5R A;  2GS3 A;  3TDG A;  3U6V A;  1GSS A;  5F05 A;  4O5U A;  1JZD A;  2BJX A;  2AJQ B;  2YV7 A;  1GUH A;  3RHC A;  4TRX A;  4Z2T A;  4HJM A;  1THO A;  2M72 A;  1QFN A;  4IVF A;  2VM1 A;  4V1A p;  1FVJ A;  4A5P A;  4JRR A;  2B1L A;  4AI6 A;  1FW1 A;  4ZL8 A;  4XCS A;  3UBL A;  3TKP A;  2I4A A;  5J4V A;  3ERF A;  5KN1 A;  1XWB A;  1YKA A;  4PNG A;  3VK9 A;  3PR8 A;  3ZRE A;  3TJF A;  1S3C A;  5D73 A;  2O8V B;  2H70 A;  2HRK A;  5JCG A;  4EF0 A;  1I5G A;  4HS1 A;  1LU4 A;  1MDK A;  3RPN A;  2OE0 A;  4ZB8 A;  1PQN A;  2QKE A;  4USS A;  4G9H A;  2RLI A;  1ZOF A;  1Y25 A;  4PXO A;  4QL7 A;  1KNG A;  5BMU B;  4HDE A;  1A0F A;  5G2Z A;  2H6Y A;  1AQW A;  4KH7 A;  3IR4 A;  2C0E A;  1N2A A;  3GRX A;  1XW6 A;  2GZP A;  3C73 A;  4RQX A;  4Z2U A;  5DJM A;  4PHZ C;  3D6I A;  1SYX A;  3IK9 A;  4WET A;  1X9W B;  1HYU A;  1V98 A;  4KB3 A;  4FYC A;  1PX6 A;  2PER A;  5DAK B;  5HFI A;  3IAS 2;  1UC7 A;  1O81 A;  2Z9S A;  3BCK A;  5A1N A;  1GSE A;  5F8B A;  6GSS A;  3LEF A;  4PQ1 A;  2WFC A;  3D0Z A;  2JAD A;  3IAM 2;  2X99 A;  4L8E A;  1KTE A;  1RW1 A;  3G7Y A;  3PH9 A;  3KD0 A;  1BJX A;  3KH7 A;  4GQC A;  2WZS A;  4ACS A;  2N5B A;  2L57 A;  4RUV A;  1WE0 A;  4N0V A;  3LXZ A;  1YEW C;  5G1L A;  2NVL A;  1XWA A;  2WUL A;  3HVX A;  4DVC A;  3GKN A;  4MK3 A;  3Q19 A;  2F8F A;  2WVZ A;  2ALB A;  4WR4 A;  1UVZ A;  2IMD A;  1V9W A;  3DVW A;  3A2X A;  4MZW A;  3HD5 A;  1HNA A;  2X49 A;  1QGV A;  1Z6N A;  3LXT A;  2HRA A;  5E4W A;  4ZL7 A;  5ELA A;  3FY7 A;  1F3B A;  1SVL A;  2HZF A;  1K3O A;  4TXO B;  2H01 A;  2GSR A;  3Q74 A;  2WW2 A;  2IFQ A;  1OYJ A;  3HHV A;  1EGO A;  4PQI A;  5HR2 A;  1YKC A;  4XS4 B;  3MWH A;  3CSJ A;  4PUF C;  1XW9 A;  1GP1 A;  2LQQ A;  2B1K A;  1M2D A;  5IMZ A;  3J7Y k;  3HJO A;  2JZR A;  1Y1U A;  2LEG A;  3FEU A;  2CAI A;  5JCW A;  2JSY A;  4AKI A;  1ZMA A;  2EFC A;  4LL4 B;  1H4O A;  2YZU A;  3K8N A;  1TK5 B;  2EFD A;  3QFA C;  5JWR B;  3GHA A;  1YEP A;  1MD3 A;  4JR6 A;  5AIV A;  4Z2R A;  4L5O A;  1O8W A;  4L5L A;  5G30 A;  1J08 A;  1SD9 A;  3HZ8 A;  1G0T A;  1XW5 A;  4N10 A;  1Z6M A;  3US3 A;  4TVE A;  3LJR A;  1TXX A;  1ML6 A;  1J0F A;  1X9S B;  5J3R A;  2EFH A;  3QR6 A;  3L9V A;  2F3M A;  4F03 A;  3W8S A;  3EIN A;  1GL8 A;  5B8B A;  1FHE A;  1XWG A;  4ULX A;  5ECL B;  4MJE A;  1TU7 A;  4XRD A;  1F6M C;  2H0I A;  1NW2 A;  1WIK A;  2R3X A;  1MEK A;  2HT9 A;  3LG6 A;  3ZFB A;  4MDC A; 
#chains in the Genus database with same CATH homology
 2C8U A;  3H79 A;  4KND A;  3APQ A;  5B8A A;  4ECI A;  4V2L A;  1U6T A;  3V1W A;  2FWF A;  1MDJ A;  1GUM A;  5L71 A;  1CQG A;  2LS5 A;  1VRS D;  1VF4 A;  2GDR A;  3ZIJ A;  18GS A;  1EEM A;  3KTB A;  1XZO A;  1Q98 A;  3FZ4 A;  2KP1 A;  3R3E A;  2NPB A;  2VAF A;  2PPT A;  2M80 A;  2CX4 A;  1OC3 A;  3GSS A;  1G6Y A;  3ZFL A;  4N11 A;  1TJD A;  1T7P B;  2L4C A;  3FW2 A;  2E2M A;  4IQA A;  2DJ0 A;  4NWY A;  1O73 A;  3IA1 A;  1B4Q A;  2IIY A;  1ZYE A;  3DXB A;  3F6D A;  1AQV A;  2YWO A;  2J9H A;  5HFK A;  3GH9 A;  2FD3 A;  4HU7 A;  5ID2 B;  4KAE A;  3QCP A;  4Q5N A;  3VI5 A;  2B5X A;  2FHE A;  4IEL A;  9GSS A;  3DYR A;  2GT6 A;  2HZE B;  2RII A;  3CWG A;  2IN3 A;  1VF2 A;  14GS A;  1SL2 B;  5AIX A;  2EIR A;  3U5R E;  3LW9 A;  4J2F A;  1IYI A;  2YAN A;  2LTK A;  5GAP D;  4CHS A;  2C4J A;  2L5O A;  4K0G A;  1MD4 A;  1XWK A;  2IMK A;  1QUW A;  2OE1 A;  4OFM A;  1BQ7 A;  2YWN A;  2H30 A;  2NDO A;  3NOF A;  2L5L A;  3WD6 A;  3HZ4 A;  3ZML A;  3TJJ A;  2QA2 A;  4FQU A;  1OC9 B;  5D93 A;  2AHE A;  3ZIT A;  5KN3 A;  3VFI A;  3CYN A;  1GTU A;  3GTU B;  2XPE A;  4L0W A;  1RQM A;  3L4N A;  3WT2 A;  3Q18 A;  1TW9 A;  3HY2 A;  4CDO A;  2MYG A;  2YJH A;  4F9Z A;  3GIX A;  1XXU A;  1PKZ A;  4POM A;  4D73 B;  3C7M A;  2J23 A;  1ZGN A;  4K6X A;  4F0C A;  4KCE A;  1GSF A;  4KUN A;  2H1A A;  2E0Q A;  3I43 A;  1EZK A;  2VCV A;  2FA8 A;  3EYT A;  3KP9 A;  4MNN A;  1G7E A;  4BVX B;  4AKX B;  1BYE A;  3MAK A;  1A8L A;  10GS A;  2VL3 A;  1OC9 A;  2IL3 A;  4QQ7 A;  2X4A A;  1SEN A;  1PGT A;  2HLS A;  1SYR A;  3FKF A;  4GRF A;  5CNW A;  5ECQ B;  2DKI A;  3M3M A;  4YKG A;  2HSN B;  5C00 A;  3VPT A;  5IQY A;  3IBH A;  1Z5Y E;  5J40 A;  3P90 A;  3ZZX A;  2MBT A;  1SL1 B;  3FHK A;  5BRT A;  4TXV A;  2H0H A;  3TRQ A;  1X5E A;  2X8H A;  4KX4 A;  2DIZ A;  3TKR A;  1BAY A;  3RPP A;  2UV8 G;  3GV1 A;  5GZZ B;  4EIP A;  3FRC A;  3QMX A;  3EU4 A;  2ZNM A;  5GST A;  2X8C A;  5CRG A;  2BMX A;  4FYB A;  3ZYW A;  4YQV A;  2DIY A;  5D8I A;  3EE2 A;  1HD2 A;  1YZX A;  3FR6 A;  1TI3 A;  3TKS E;  3JCM L;  2A4V A;  2MMA A;  3N9J A;  4X4J A;  2PMT A;  2B7K A;  1WMJ A;  3DRN A;  3KEB A;  1O8X A;  1MDI A;  3L9S A;  2VOC A;  4IBP A;  2B5E A;  2HE3 A;  1T1V A;  1OC8 A;  5DAL B;  2A2R A;  4N0Z A;  2LNT A;  4G10 A;  3I6A A;  4JZQ A;  1ILO A;  3FMW A;  4TR1 A;  1ZL9 A;  4GQF A;  1YQ1 A;  2YWI A;  3IPZ A;  1BED A;  7GSS A;  2VIM A;  2YV9 A;  3GX0 A;  5DCG A;  4MH3 A;  4TR0 A;  2WZ9 A;  5CP1 A;  2V6O A;  2MMO A;  2C1Y A;  1A0R P;  2WRT A;  2MZC A;  1BF5 A;  5IO2 A;  1V57 A;  1K0A A;  4G0L A;  3MIX A;  4AKH A;  3F4R A;  1HNB A;  2FWH A;  5IIZ A;  4IKH A;  1FG4 A;  4XS6 A;  4EL1 A;  3F3R A;  3CRT A;  2CQ9 A;  3L78 A;  3TJK A;  1NHO A;  2DJJ A;  5FWG A;  5CRD A;  5A5H B;  4AF2 A;  2QC7 A;  5DJL A;  2WS2 A;  1DSB A;  1I9D A;  1S3D A;  1GSY A;  2RM5 A;  2IJY A;  4AKG A;  2HFD A;  5GSS A;  1M2B A;  3F0I A;  2O5V A;  3MDK A;  4O7H A;  3A5I A;  1T4Y A;  6GSX A;  4G01 A;  5JCU A;  2R2J A;  3ZRD A;  1WJK A;  3ERG A;  2MMN A;  1XPV A;  3A2V A;  1HQO A;  3HJM A;  1W89 A;  1O7U A;  2H73 A;  2I9H A;  4OMV A;  3C1R A;  1EWX A;  4PNF A;  1OVN A;  2EFE A;  3AY8 A;  1YJ6 A;  3VWX A;  4PUA A;  2VLT A;  5IPG A;  2FWE A;  4GWR A;  3UVH A;  1VF3 A;  2OA7 A;  2HXK A;  1QQ2 A;  1JZO A;  2QSI A;  3KIJ A;  4K9Z A;  2A2P A;  2YJ7 A;  5A5H A;  4PUR A;  2LRC A;  2F8A A;  1TTZ A;  2H1D A;  1ZYQ B;  3MNG A;  2I1U A;  4X43 A;  4K5R A;  3GKK A;  3CSI A;  2VKZ G;  1SL0 B;  1AC1 A;  3HKR A;  1ACV A;  1GWC A;  2ON5 A;  3VWW A;  3ZIV A;  5J4U A;  5JWO B;  1U3A A;  1E6B A;  1YDK A;  2LQO A;  1RK4 A;  1FOH A;  4ECB A;  1PD2 1;  3IHG A;  1EP7 A;  5CRE A;  2VO4 A;  4MF6 A;  3ZVJ D;  5ECN B;  3TKS A;  1T00 A;  3BOA A;  4HZ2 A;  2VL2 C;  3GYK A;  5EPF A;  1IYH A;  3GL5 A;  3EUR A;  4NXI A;  4TR3 A;  1GLP A;  4MJA A;  5BMU A;  4GSS A;  2IMI A;  5A4W A;  1PMT A;  3CRU A;  4KE3 A;  3EMX A;  2DJK A;  2PUK C;  3ERW A;  2H1L A;  3P2A A;  2GZY A;  3WYW A;  1U3I A;  2YNX A;  4JED A;  3ED3 A;  2AAW A;  1LJR A;  2O87 A;  2JSZ A;  2P0G A;  3TGZ A;  3CTF A;  4F0B A;  4IS0 A;  5DAK A;  5IMD A;  19GS A;  1A2M A;  3H4K A;  4WXT A;  3DVX A;  5IMA A;  5GAN D;  5IMC A;  3HVV A;  1PN0 A;  3EMP A;  4AJ8 A;  4EKZ A;  4KF9 A;  3IE3 A;  4YAV A;  1V40 A;  3IV4 A;  4K7O A;  3ME8 A;  1ZYP A;  3GA4 A;  3PPU A;  2VCZ A;  4IJI A;  4CW9 A;  4NV2 A;  4EDY A;  4HEA 2;  4OO5 A;  4I97 A;  4I5Q A;  2FWG A;  4EIQ A;  3N5O A;  4ML6 A;  1YF1 A;  2CT6 A;  3ZMK A;  2CAQ A;  5KOW A;  2K9F A;  3TB2 A;  2VLU A;  5CRW A;  1EEJ A;  3VWV A;  2G0F A;  4WKW A;  3KM6 A;  4TXO A;  5ECS A;  1ZZY A;  2P5R A;  4XS4 A;  2HI7 A;  4G0K A;  4PX1 A;  5A4V A;  2ZCT A;  4MJB A;  5EL8 A;  1GSD A;  3DIE A;  4LMV A;  3KGK A;  1YY7 A;  1B9Y C;  1ZCP A;  1OAZ A;  2AB6 A;  4YQM A;  2KUC A;  1KBN A;  3FZA A;  3G7J A;  2H6Z A;  3NIV A;  2C0F A;  2GGT A;  3DWV A;  2H0G A;  4MPF A;  3IK7 A;  2PVO C;  1M2A A;  5IMF A;  4IN0 A;  2PBJ A;  4EDZ A;  4KCA A;  3KTL A;  16GS A;  3F8U A;  2VCQ A;  5JWQ B;  2GT5 A;  1ON4 A;  1SJI A;  1G6W A;  4PGT A;  3BD2 A;  2GQL A;  4KA0 A;  3KMO A;  4EVM A;  4JR4 A;  3VPQ A;  4BL7 B;  2B3S A;  2BTO T;  5G5F A;  1EV4 A;  4ICY A;  4WF4 A;  2LV3 A;  4MMM A;  2N5F A;  2R4V A;  3LQ7 A;  4LL1 B;  2X8G A;  3KCM A;  1THX A;  4PTS A;  5G5E A;  4MCU A;  5KOX A;  5E59 A;  1XWC A;  5CO3 A;  2H76 A;  1FVK A;  4HQZ A;  5A4U A;  3TJG A;  1ERW A;  1XFL A;  3A5W A;  3TUE A;  4CY8 A;  3TJB A;  3G7I A;  1PRX A;  2YPM A;  2AYT A;  4POL A;  4MAB A;  2L59 A;  4MF5 A;  2HSM B;  1XVQ A;  5ELG A;  2E7P A;  4O32 A;  4I8B A;  1GH2 A;  2V1M A;  4QMK A;  4MH2 A;  1A2L A;  4ID0 A;  3KH9 A;  2LUS A;  4NAX A;  2RM6 A;  3M8N A;  1X9M B;  4ISD A;  2K6V A;  1R26 A;  3MSZ A;  5G31 A;  5H5S A;  1A23 A;  4NV5 A;  4MPG A;  2AUV A;  3VWU A;  5INY A;  3E3E A;  2A4H A;  3NZN A;  3CMI A;  1U87 A;  2RUF A;  1WP0 A;  1M0U A;  1TKD B;  4I6X A;  4HOJ A;  4V1A g;  2OAC A;  1FB6 A;  2AV4 A;  2R5G A;  4DSS B;  5LCZ A;  4YAP A;  4K5S A;  3O76 A;  5LNK e;  5J9C A;  3R2Q A;  2YWM A;  5J4Y A;  2NBS A;  3QFB C;  1UA5 A;  2HSY A;  3QD9 A;  5IM9 A;  3DD3 A;  1GLQ A;  2R37 A;  2HSM A;  4GTU A;  5ID2 A;  1B9X C;  3LYP A;  3PGT A;  4KW6 A;  4I2U A;  1OE8 A;  1FB0 A;  4IJ3 A;  1DBY A;  2HZE A;  2V2G A;  5HR1 A;  1GTA A;  2DBC A;  5AGY A;  4RQR A;  2GVP A;  5HFG A;  2VCW A;  2N5A A;  1WRY A;  4NMU A;  3EWL A;  1R5P A;  5DDL A;  3HCZ A;  4XRA A;  1GSQ A;  5IOW A;  4YQU A;  1B8X A;  1BG1 A;  3O6T A;  3ME7 A;  3LGC A;  4IW9 A;  2H6X A;  4Z7X A;  3W6G A;  2DMM A;  1SKS B;  5DBQ A;  5ECI B;  4BVY B;  2VL9 A;  1EOG A;  1GNE A;  5B6N A;  1C72 A;  2PU9 C;  3GTU A;  4O5Q A;  4LA1 A;  2PVQ A;  3D22 A;  5A5K A;  3FZ9 A;  2CV4 A;  3F3Q A;  4IP1 A;  2HQT A;  3GST A;  4GF0 A;  1R7H A;  4EO3 A;  2VD0 A;  1F9M A;  5D9V A;  2CZ2 A;  5C04 A;  1CQH A;  2WDU A;  4XS1 A;  1H75 A;  3WT1 A;  1M9A A;  4E8H A;  4D73 A;  1BG5 A;  2OJL A;  2C0D A;  5A34 B;  1TI1 A;  2VD1 A;  2FY6 A;  1NM3 A;  2C3Q A;  5CAX A;  1N25 A;  3HJP A;  1TP9 A;  4BVX A;  2X64 A;  1SU9 A;  1TK8 B;  4K7I A;  4EC0 A;  1XOB A;  5ECK B;  1XOA A;  2K8S A;  3H8Q A;  3F4T A;  5F07 A;  3KMN A;  4BVY A;  2HSN A;  3UBK A;  2LJK A;  2CA8 A;  4ZIJ A;  4MA9 A;  1SKR B;  4ZL9 A;  4FYU A;  3E9J B;  3Q6O A;  1XCC A;  1EOH A;  3GKM A;  2WB9 A;  1K3Y A;  5EVO A;  3M0F A;  3ZLP A;  3FR9 A;  4GDF A;  2G2Q A;  1AUC A;  3L9U A;  1GUL A;  3PIN A;  4OD7 A;  2XBI A;  5A34 A;  3A2W A;  1GTI A;  1Z7P A;  3IOS A;  6GSV A;  3QPM A;  5HQP A;  4HJ2 A;  4DSR A;  2GLR A;  2XBQ A;  11GS A;  1X0R A;  3EVI A;  3EC3 A;  5D9X A;  2YP6 A;  3FK8 A;  2DJ1 A;  3M9K A;  4ZXG A;  4OO4 A;  3GN3 A;  4X1U A;  4XHM A;  5DAL A;  1A8Y A;  3EPT A;  2LJR A;  2B5Y A;  1EGR A;  2XHF A;  2FUG 2;  3M1G A;  4TN8 A;  2TIR A;  2ZUP A;  5J9B A;  1JLV A;  4POB A;  4MF7 A;  2GST A;  3ISO A;  1N8J A;  3KP8 A;  4Q5F A;  3VLN A;  1XIY A;  3RBT A;  1T4Z A;  2L6C A;  4IP6 A;  1XBS A;  4F82 A;  1PL2 A;  2R0P A;  1Z9H A;  1Z3E A;  3CXG A;  2IME A;  1WOU A;  4AJ7 A;  3UAP A;  1QMV A;  1PL1 A;  5DCH A;  1GRX A;  4TR4 A;  1Q4J A;  2I3Y A;  2YOI A;  5DQY A;  1JHB A;  6GSW A;  4K7N A;  2R6K A;  1QXH A;  4HU9 A;  5F06 A;  4ZB9 A;  3LFL A;  1V58 A;  1URM A;  5H5Q A;  2P5Q A;  5A1N B;  3F9U A;  1AAZ A;  3QAW A;  2H71 A;  3FZ5 A;  5AIS A;  2L4Q A;  2MBS A;  3GH6 A;  5EY6 A;  1SK0 A;  2FGX A;  2CVD A;  3IRA A;  4DEJ A;  1JZR A;  5IO0 A;  4KDY A;  4CY6 A;  2WCI A;  2KOK A;  3ZVJ A;  5FHI A;  3ZTL A;  3DGQ A;  4X0X A;  5DVB A;  1GUK A;  4G0I A;  1M9B A;  3TRX A;  1LBK A;  4I2T A;  5B6M A;  3CBU A;  2B7J A;  3DML A;  5ECH B;  2C3T A;  4MZC A;  2WGR A;  3BJ5 A;  3UAR A;  1K0O A;  4ECC A;  2XC2 A;  3A3T A;  4K0N A;  2FLS A;  4TKY A;  1YVL A;  4MLY A;  6GST A;  3RHB A;  1B48 A;  2YN1 A;  22GS A;  2IFQ B;  3RDW A;  1S3A A;  3KXO A;  3E0U A;  4ZIL A;  3APS A;  3ZL5 A;  3HA9 A;  4JBB A;  2JZS A;  2GSS A;  5D9T A;  2F51 A;  5HR0 A;  3APO A;  1T3B A;  4KSM A;  1R5A A;  5D9W A;  4ML1 A;  4OCF A;  4OCE A;  4P3Y B;  2MMZ A;  3FR3 A;  2DJ3 A;  2XPD A;  3TU3 B;  4W66 A;  2R0G A;  2H1B A;  4V2M A;  1ERT A;  3D4M A;  2TRX A;  1NHY A;  1K0M A;  3SWL A;  3GUR A;  4MJC A;  2H75 A;  4J57 E;  1O85 A;  2VCX A;  3GNJ A;  3F63 A;  3C1S A;  4GCI A;  1K3L A;  2VM2 A;  4JU5 A;  4OFT A;  4NHW A;  2YZH A;  3BCI A;  2OAD A;  1TRW A;  5J47 A;  4GSN A;  3UJ1 A;  2PN8 A;  4Q5Q A;  4AJ6 A;  1O6J A;  5ECO B;  1TRS A;  3MYD A;  1PSQ A;  4O5R A;  1DE1 A;  2DJ2 A;  3RAZ A;  2LNS A;  4LLR A;  3QOU A;  3IXR A;  4KGI A;  3GL3 A;  1TDI A;  2RUE A;  3I9V 2;  4FO5 A;  2O85 A;  2H8L A;  1EP8 A;  2EC4 A;  4WR5 A;  3IDV A;  1ERV A;  2DC5 A;  3UEM A;  2JZT A;  4JE1 A;  2DML A;  1F2E A;  3SBC A;  5B7C A;  2H66 A;  1AW9 A;  2REM A;  1ZYN A;  2DLX A;  4DSQ A;  13GS A;  4E68 A;  2ON7 A;  3GFK A;  3W8J A;  3TKS C;  4EXJ A;  3C71 A;  4OFN A;  2R0C A;  1ABA A;  3HVS A;  3BBY A;  4PQH A;  2F9S A;  4G2E A;  1PN9 A;  4AGS A;  4WEY A;  3VI7 A;  2OE3 A;  2QA1 A;  5ENU A;  3TOU A;  4FH8 A;  1K0B A;  1VF1 A;  2P31 A;  3UVT A;  4H86 A;  1Y6E A;  1YF0 A;  1SKW B;  2JAC A;  20GS A;  4BWQ A;  2LST A;  4ZB7 A;  4EE0 A;  2B6M A;  4GXZ A;  2CVB A;  1K0D A;  1U88 A;  4NHZ A;  4F2I A;  1E2Y A;  2UZ8 A;  2GZZ A;  2OT3 A;  4KSO A;  2E2G A;  2KHP A;  1VGL A;  1GSU A;  5D96 A;  2JU5 A;  1PA3 A;  5CYY A;  5CRH A;  4ZBD A;  4POK A;  2YCD A;  3VUR A;  3O3T A;  2HRF A;  1V2A A;  1PX7 A;  1AIU A;  3HXS A;  2VCT A;  2O7K A;  1USB A;  1JZW A;  4ZB6 A;  1HNC A;  3QAG A;  2V41 A;  4WBR D;  1F37 A;  2I81 A;  3LYK A;  1EV9 A;  3IC4 A;  1AQX A;  3P7X A;  2NTO A;  3F6F A;  3F4S A;  5IPH A;  1SK2 A;  5J41 A;  1K0C A;  2CVK A;  1X5D A;  2PWJ A;  2DKH A;  4BL7 A;  4MZB A;  5IMV A;  4IQ1 A;  2KP2 A;  4L0U A;  4MP4 A;  2CX3 A;  4OWY A;  3UMA A;  4IHU A;  3D4T A;  3OR5 A;  1M7T A;  3D21 A;  5KN0 A;  4BWS A;  1OKT A;  6GSY A;  3GKX A;  2KLX A;  3EU3 A;  4ECJ A;  3QAV A;  1SJZ A;  5ECM B;  3D5J A;  1G7O A;  1YEX A;  4XIH A;  4K1F A;  3GMF A;  3DKS A;  4K2X A;  5LD0 A;  2GQK A;  3KZQ A;  3IC8 A;  2IPA A;  2GSQ A;  1XVW A;  1K0N A;  2EIQ A;  4YH2 A;  4KDX A;  5KN2 A;  4E8E A;  5KEJ A;  1X5C A;  1KEB A;  5HR3 A;  3DEX A;  1M99 A;  1MTC A;  2LKU A;  3GUS A;  5COH A;  5F0G A;  4TW5 A;  4XTS A;  3P8W A;  1TXU A;  1W4V A;  2LJA A;  1TK0 B;  1TU8 A;  3CTG A;  1QK8 A;  2VUP A;  4J56 E;  2HYX A;  1BX9 A;  1FO5 A;  2DSA A;  5AN1 A;  2GQM A;  2FCH A;  3H1N A;  3QDN A;  4HI7 A;  4DSS A;  3G9B A;  1SVO A;  1WWJ A;  1FOV A;  1TRV A;  3UOM A;  5ECR B;  1JFU A;  4G19 A;  4GST A;  2C80 A;  2TRC P;  2OBK A;  2WJU A;  3TOT A;  5J5N A;  2IWT A;  2V32 A;  8GSS A;  1R4W A;  4N3Z A;  2VLV A;  3LOR A;  1SJ6 A;  3UIW A;  4EUY A;  1TOF A;  2HRN A;  3TCO A;  2M46 A;  3GX8 A;  1A2J A;  1WPI A;  4TR1 B;  2A2S A;  3J7Y b;  2LRT A;  3CSH A;  1PKW A;  2V6K A;  1J9B A;  1ERU A;  5DQS A;  1FAA A;  4BA7 A;  3UL3 A;  3KJY A;  2H72 A;  2C0G A;  4HUA A;  2OKA A;  4YKF A;  1DUG A;  1GTB A;  2CZ3 A;  2QGV A;  4NPB A;  2GTU A;  3WGX A;  2H1G A;  2PGT A;  3HDC A;  3L0H A;  2H74 A;  2HSH A;  1T8E B;  4ILF A;  2H19 A;  1GNW A;  4V2N A;  4K2D A;  3IHQ A;  4LMW A;  4O92 A;  4ZBA A;  3TKQ A;  4RI6 A;  3C8E A;  3HMJ G;  4WF5 A;  5ABR A;  5ECP B;  2K8V A;  2L6D A;  4RI7 A;  1SVM A;  1AXD A;  4TOP A;  3HYP A;  4IGJ A;  3LWA A;  4Q5R A;  2FNO A;  1DE2 A;  3LSZ A;  2IMF A;  17GS A;  1Z7R A;  3WGE A;  1JLW A;  2ES7 A;  1SD8 A;  2EIO A;  2OBI A;  4WBJ A;  1NSW A;  5IOX A;  2K18 A;  1ST9 A;  2VL2 A;  4N30 A;  1OE7 A;  1B4P A;  1F3A A;  4BPY A;  3M9J A;  3H93 A;  2JL4 A;  4FIW A;  4HZ4 A;  5G1K A;  3I69 A;  2LRN A;  1TRU A;  2HRK B;  3FYG A;  1UN2 A;  4K8M A;  1SK1 A;  4QL9 A;  4HQS A;  3TRP A;  4ZBB A;  2O89 A;  2HNL A;  2C3N A;  3WGD A;  4GLT A;  1OKD A;  6GSU A;  3S9F A;  1A24 A;  5FT3 A;  2FA4 A;  4KDU A;  2D2Z A;  12GS A;  5H5R A;  2GS3 A;  3TDG A;  3U6V A;  1GSS A;  5F05 A;  4O5U A;  1JZD A;  2BJX A;  2AJQ B;  2YV7 A;  1GUH A;  3RHC A;  4TRX A;  4Z2T A;  4HJM A;  1THO A;  2M72 A;  1QFN A;  4IVF A;  2VM1 A;  4V1A p;  1FVJ A;  4A5P A;  4JRR A;  2B1L A;  4AI6 A;  1FW1 A;  4ZL8 A;  4XCS A;  3UBL A;  3TKP A;  2I4A A;  5J4V A;  3ERF A;  5KN1 A;  1XWB A;  1YKA A;  4PNG A;  3VK9 A;  3PR8 A;  3ZRE A;  3TJF A;  1S3C A;  5D73 A;  2O8V B;  2H70 A;  2HRK A;  5JCG A;  4EF0 A;  1I5G A;  4HS1 A;  1LU4 A;  1MDK A;  3RPN A;  2OE0 A;  4ZB8 A;  1PQN A;  2QKE A;  4USS A;  4G9H A;  2RLI A;  1ZOF A;  1Y25 A;  4PXO A;  4QL7 A;  1KNG A;  5BMU B;  4HDE A;  1A0F A;  5G2Z A;  2H6Y A;  1AQW A;  4KH7 A;  3IR4 A;  2C0E A;  1N2A A;  3GRX A;  1XW6 A;  2GZP A;  3C73 A;  4RQX A;  4Z2U A;  5DJM A;  3D6I A;  1SYX A;  3IK9 A;  4WET A;  1X9W B;  1HYU A;  1V98 A;  4KB3 A;  4FYC A;  1PX6 A;  2PER A;  5DAK B;  5HFI A;  3IAS 2;  1UC7 A;  1O81 A;  2Z9S A;  3BCK A;  5A1N A;  1GSE A;  5F8B A;  6GSS A;  3LEF A;  4PQ1 A;  2WFC A;  3D0Z A;  2JAD A;  3IAM 2;  2X99 A;  4L8E A;  1KTE A;  1RW1 A;  3G7Y A;  3PH9 A;  3KD0 A;  1BJX A;  3KH7 A;  4GQC A;  4ACS A;  2N5B A;  2L57 A;  4RUV A;  1WE0 A;  4N0V A;  3LXZ A;  5G1L A;  2NVL A;  1XWA A;  2WUL A;  3HVX A;  4DVC A;  3GKN A;  4MK3 A;  3Q19 A;  2F8F A;  2ALB A;  4WR4 A;  1UVZ A;  2IMD A;  1V9W A;  3DVW A;  3A2X A;  4MZW A;  3HD5 A;  1HNA A;  2X49 A;  1QGV A;  1Z6N A;  3LXT A;  2HRA A;  5E4W A;  4ZL7 A;  5ELA A;  3FY7 A;  1F3B A;  1SVL A;  2HZF A;  1K3O A;  4TXO B;  2H01 A;  2GSR A;  3Q74 A;  2IFQ A;  1OYJ A;  3HHV A;  1EGO A;  4PQI A;  5HR2 A;  1YKC A;  4XS4 B;  3MWH A;  3CSJ A;  4PUF C;  1XW9 A;  1GP1 A;  2LQQ A;  2B1K A;  1M2D A;  5IMZ A;  3J7Y k;  3HJO A;  2JZR A;  1Y1U A;  2LEG A;  3FEU A;  2CAI A;  5JCW A;  2JSY A;  4AKI A;  1ZMA A;  2EFC A;  4LL4 B;  1H4O A;  2YZU A;  3K8N A;  1TK5 B;  2EFD A;  3QFA C;  5JWR B;  3GHA A;  1YEP A;  1MD3 A;  4JR6 A;  5AIV A;  4Z2R A;  4L5O A;  1O8W A;  4L5L A;  5G30 A;  1J08 A;  1SD9 A;  3HZ8 A;  1G0T A;  1XW5 A;  4N10 A;  1Z6M A;  3US3 A;  4TVE A;  3LJR A;  1TXX A;  1ML6 A;  1J0F A;  1X9S B;  5J3R A;  2EFH A;  3QR6 A;  3L9V A;  2F3M A;  4F03 A;  3W8S A;  3EIN A;  1GL8 A;  5B8B A;  1FHE A;  1XWG A;  4ULX A;  5ECL B;  4MJE A;  1TU7 A;  4XRD A;  1F6M C;  2H0I A;  1NW2 A;  1WIK A;  2R3X A;  1MEK A;  2HT9 A;  3LG6 A;  3ZFB A;  4MDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...