4KSMA

Crystal structure of escherichia coli glutraredoxin 2 c9s/c12s mutant without glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
216
Chain Sequence
AMKLYIYDHSPYSLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Glutaredoxin-2
publication title Crystal structures of E.Coli glutaredoxin 2 with glutathione and of a mutant C9S/C12S without glutathione
rcsb
source organism Escherichia coli
total genus 77
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ksmA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ksmA01
4OO4A 5D73A 3RHBA 3A2WA 2V41A 1JFUA 2L59A 3GKNA 3IAS2 3C73A 3F4SA 1XCCA 3QFBC 3H1NA 5J5NA 2JZRA 4ZB6A 2ES7A 2AHEA 2LNSA 7GSSA 1AC1A 1FO5A 3TJFA 2JZTA 3FR9A 2FWEA 3IDVA 2PBJA 3WGXA 1T4ZA 4HZ4A 5A4VA 1QUWA 1YQ1A 1SL0B 1PQNA 3HJOA 5GAND 5HR2A 1A0RP 4NWYA 1IYIA 3F4TA 1KEBA 2C1YA 3IK9A 1SK1A 1GP1A 1OE8A 6GSSA 1O85A 2WB9A 1XPVA 2X8GA 3KJYA 1ERTA 4KCAA 1GUKA 5IMVA 4TXVA 1UVZA 4G2EA 2IJYA 4JEDA 4WR5A 4OWYA 2WGRA 1G6WA 2WDUA 1A8YA 4Q5NA 1C72A 3TRQA 4G0IA 18GSA 3TJGA 4DSSB 1MDIA 3WYWA 4ECIA 2K6VA 3ZFLA 3CYNA 4ZL8A 3W6GA 1G0TA 5L71A 4N0ZA 1TRVA 5IM9A 5HR1A 1EV4A 2GGTA 3C7MA 3Q18A 2X99A 3DIEA 2H01A 2L6DA 3KH7A 2CAIA 1OYJA 1SYRA 1XOAA 1SKSB 4G19A 4AGSA 2CT6A 1T8EB 4GSTA 4GTUA 1OE7A 1ZZYA 3KGKA 1GTUA 2HZEA 1PN9A 1DUGA 4KNDA 4ML6A 2R5GA 2K8VA 4CHSA 4K0NA 4IQ1A 2PWJA 1GL8A 2A2SA 2VL2C 3I6AA 2YZHA 5A5KA 2LTKA 4DVCA 1Y25A 3DYRA 5A4UA 1K0BA 2NVLA 1NM3A 3BD2A 1GH2A 2CZ2A 5IO2A 3HJPA 4HDEA 3MNGA 4ECCA 3PINA 5JWQB 3QD9A 4ECJA 2PGTA 5D9TA 2KP2A 1ZCPA 4PNGA 5B6MA 1Z7RA 2OE1A 3FEUA 2WRTA 1S3AA 3FHKA 1O6JA 1O73A 1OKDA 5AISA 2CV4A 1F9MA 3GIXA 5INYA 5AGYA 2GT5A 4MZBA 2H1GA 4K1FA 1FHEA 2MMOA 4HI7A 4KAEA 3KP8A 3H93A 1J08A 2LJKA 4GWRA 2O87A 1BJXA 2F3MA 2AB6A 8GSSA 4E8EA 1OC9B 3QDNA 3ZZXA 2LJAA 2K8SA 3KMNA 4TR4A 3TKSC 4KX4A 5E59A 5F8BA 2RM6A 2C3QA 5DQYA 5IPGA 3ERWA 4HOJA 3IHQA 5ECOB 4LMWA 4EO3A 5IQYA 3L4NA 2JACA 3VWXA 1BQ7A 2M72A 4JR4A 5F07A 1A2MA 2TRXA 4I2TA 5IPHA 2UZ8A 2IFQB 4NHWA 2CQ9A 4WF5A 1G7OA 1YDKA 1GNEA 1M7TA 2NBSA 5EPFA 1GLPA 3GKXA 1TK5B 4FH8A 3C71A 4TXOA 1X0RA 4LLRA 4K9ZA 1PA3A 1SL2B 4KDUA 3LG6A 4NV5A 4IJIA 2VD1A 3FY7A 1EP7A 2LSTA 1ZMAA 2TRCP 1WIKA 2I3YA 1ZYQB 4D73B 5J41A 5AN1A 5B8AA 1GSQA 2FA4A 2RUFA 1GWCA 4NPBA 3U6VA 4ULXA 5G1LA 2O89A 5LNKe 4OMVA 1U3AA 3US3A 1XW5A 5C00A 4MJAA 1G7EA 2E2MA 4PURA 2K18A 4RI6A 2H0IA 4V1Ag 3LSZA 3QPMA 4P3YB 1EOGA 3E9JB 4I8BA 4YH2A 3EU3A 3TGZA 3PR8A 1XBSA 4N11A 1EGRA 2DJ2A 5D9VA 2VCQA 1DSBA 2H1AA 2JL4A 3WD6A 2ZNMA 3Q19A 3VURA 3D6IA 4DSRA 2P31A 1GSUA 1V58A 1T1VA 4HJ2A 2HZFA 2GVPA 2YNXA 2VL2A 1XZOA 3U5RE 1F3AA 1TI3A 1WP0A 3FYGA 3HHVA 1GTIA 3A5WA 4O32A 5KN2A 4WF4A 2VD0A 4F82A 3VI7A 4MF7A 4HJMA 4WETA 4IGJA 1B48A 2E0QA 3FZ9A 3DRNA 1QGVA 4IBPA 2JSYA 4FQUA 2IN3A 3P2AA 2HRNA 1BG5A 5DALA 3IXRA 2WJUA 3EC3A 1ERVA 4JRRA 3HVXA 1DBYA 1XXUA 2KOKA 1AQVA 3DWVA 1I5GA 4IHUA 2LQOA 2MMNA 5ABRA 5B7CA 1V98A 2VL3A 3UOMA 3HVVA 2FHEA 3E3EA 1Y6EA 1X9WB 3FZAA 2CVKA 4MP4A 4LL1B 1X5DA 3RDWA 2N5BA 4TR0A 2G2QA 5IMAA 4RUVA 1XW6A 4EE0A 3QAGA 3OR5A 3GFKA 5GSSA 4PUFC 1V2AA 4CW9A 1LBKA 3IBHA 1JZWA 1YF1A 5ELGA 3ZRDA 3KTBA 5JWRB 4DSQA 2X64A 1Z3EA 4ID0A 3VWVA 4MJBA 1MDJA 3KZQA 2IMFA 5CAXA 1XVWA 20GSA 2L6CA 3R2QA 2HZEB 3GMFA 4MLYA 1A8LA 1H4OA 2HE3A 3TCOA 3D21A 1JZOA 2AYTA 5ECLB 1SKRB 4POMA 3QAWA 3N9JA 5AIVA 1B8XA 2XBIA 5CYYA 3H4KA 2Z9SA 4F0BA 4MK3A 2VAFA 2EC4A 5ENUA 2FLSA 1RW1A 5H5RA 4J56E 4JZQA 4V1Ap 1FB6A 6GSWA 1MD4A 4XRDA 3KD0A 2HQTA 5JCGA 3IK7A 2GSTA 2VCXA 3L78A 2B3SA 3AY8A 4WEYA 2HSMA 4MH2A 3KIJA 5HR0A 2F8FA 3MWHA 1TRWA 1ACVA 3FRCA 1LJRA 2ALBA 2LKUA 2F51A 1WRYA 2FNOA 2YPMA 4FO5A 1HYUA 1CQGA 3ZVJA 4F03A 3ZREA 2FCHA 3LORA 2GT6A 1K0DA 1VRSD 3EMPA 2IMKA 2LQQA 5FWGA 3F6FA 4MF5A 2VLUA 3LXZA 2QC7A 1YJ6A 2PVQA 4EDYA 1EP8A 4TW5A 2H74A 3GL5A 5G30A 3Q6OA 3M1GA 4BPYA 4O7HA 3O6TA 3FZ5A 1M2AA 4PTSA 2C0FA 5GAPD 5ECNB 1T7PB 2JADA 3TRXA 2C80A 3GSSA 5F06A 1PX7A 1WOUA 5DBQA 5J9BA 2H73A 1AW9A 4MDCA 5D8IA 1F2EA 5B6NA 4V2MA 5HFKA 2MBSA 2HSHA 3LWAA 4Q5QA 1K3OA 1BX9A 4MMMA 1GULA 3V1WA 2YP6A 2O85A 1XWGA 4TXOB 2YOIA 2H75A 1A24A 1HNAA 2CX4A 2OJLA 3UL3A 1TRUA 2HYXA 1THXA 4ECBA 3FZ4A 1M9BA 4PX1A 1SJZA 1TTZA 4XS4A 4BVYB 2GQLA 1V40A 2YN1A 3VWWA 2FWHA 3P90A 4I5QA 1TJDA 4HQSA 2OBKA 2C0DA 5ECIB 1DE2A 4WXTA 4PNFA 2KHPA 3EURA 2F8AA 2RUEA 1WMJA 2LEGA 3VFIA 1USBA 1O7UA 4KGIA 2ZCTA 4ILFA 3PPUA 2O8VB 4K6XA 1S3CA 5LCZA 3EYTA 4OD7A 5COHA 2E2GA 2DJ1A 3IOSA 14GSA 3BCIA 3W8SA 1N8JA 2WS2A 1XW9A 1U6TA 1NW2A 1NHOA 2LNTA 1FVJA 3IR4A 2GZYA 1K0MA 2GSRA 3RAZA 1ILOA 3F6DA 2HSYA 2AAWA 3NOFA 5J3RA 2LJRA 2VUPA 4BL7A 3EE2A 3CTGA 5CRHA 1MEKA 2HSNB 5LD0A 4NAXA 4K0GA 2H6ZA 4GSSA 5D93A 4GQFA 2OKAA 1W89A 4DEJA 1JLWA 4GCIA 2DBCA 4X0XA 4EDZA 4K7IA 4Q5FA 4FYCA 1MTCA 5IO0A 2V32A 6GSYA 3TB2A 4XTSA 2CA8A 2K9FA 5HFIA 2PERA 3FKFA 1OKTA 2XC2A 3DXBA 2HRKA 5DCGA 2VCTA 2H19A 4EUYA 3BBYA 4MABA 2J23A 3UVTA 2I9HA 5ECHB 2YWIA 1BYEA 3QMXA 5DALB 4F0CA 4USSA 2J9HA 4WBJA 5D9WA 1SJ6A 4PQ1A 2PVOC 2EIQA 2WFCA 1FAAA 2B7KA 3KEBA 2KP1A 4KF9A 3HCZA 1SD9A 1SK2A 2B6MA 4OFTA 3N5OA 3C8EA 3ERGA 2FGXA 2GQKA 3IE3A 2XPDA 3Q74A 2H30A 1Q98A 3LJRA 2YZUA 2FD3A 5CO3A 4AJ8A 4GXZA 3CMIA 4AF2A 3ISOA 4JE1A 1JLVA 4CDOA 2P5QA 2PPTA 1W4VA 3DMLA 1PKWA 3CSIA 1PGTA 5DDLA 1ML6A 1B4QA 1GTBA 1GUMA 1O8XA 2R6KA 4OFNA 5ECKB 3APQA 3RHCA 3LQ7A 2NPBA 4MZCA 1GSYA 1KBNA 2R3XA 4HU9A 2H6XA 3QR6A 3GX0A 3ZFBA 2LRTA 1X5CA 4PQHA 2HNLA 3GKMA 1ZGNA 3TDGA 1HNBA 3GYKA 5CP1A 1SU9A 1PSQA 2L57A 2DSAA 1WWJA 4ZILA 3LYPA 4PUAA 1HD2A 9GSSA 2H70A 5DAKB 2BMXA 2HSMB 1YF0A 3ZYWA 1UA5A 2X8CA 2AV4A 3QOUA 5KEJA 2KLXA 2YWNA 2ZUPA 1SJIA 3LEFA 1YKAA 4XIHA 4TOPA 1GSFA 1TU8A 3KP9A 1Q4JA 2N5FA 5KN1A 2YWOA 4HUAA 1TRSA 5ECQB 3VLNA 2H72A 3CBUA 2VLVA 4I97A 5IMCA 4GLTA 5BMUA 1QK8A 3IAM2 3M9KA 4EKZA 13GSA 3KTLA 2VOCA 3HZ4A 3A2VA 1O8WA 3EU4A 2GLRA 3QAVA 3GL3A 1R5AA 3WT2A 3KM6A 2MMAA 1XOBA 1O81A 2VCWA 2BJXA 1FW1A 2IPAA 1OAZA 3BOAA 1EZKA 2IMDA 3EINA 1ON4A 1AUCA 1PMTA 3LXTA 3M8NA 3FW2A 4XHMA 3ZMKA 4WR4A 1M2BA 4XRAA 3TUEA 1U3IA 2H1BA 3BCKA 5JCUA 3PH9A 4POLA 3ERFA 3EVIA 4FYBA 4O5RA 2DMLA 4MF6A 1M2DA 1B9XC 4MH3A 1F6MC 2P0GA 5ECSA 5CRGA 3GN3A 2M46A 2PMTA 3UARA 4MCUA 1R26A 2VM2A 4JR6A 2GQMA 1WE0A 1M0UA 4FIWA 2HRAA 3GRXA 2OACA 3L9SA 4RQRA 4HU7A 1GNWA 2P5RA 2CVDA 3NIVA 4KE3A 2E7PA 2V6OA 3GHAA 5G2ZA 1K0AA 3D4MA 2HRFA 4WKWA 1VGLA 4RQXA 1F37A 2VO4A 1AIUA 1TP9A 1NHYA 2VLTA 1QMVA 2CX3A 4L0UA 5DJMA 3UVHA 4TVEA 4K8MA 3UJ1A 3QFAC 4YAPA 3TKSA 3JCML 4ZXGA 4MPGA 5ECRB 5J4UA 2DIYA 1H75A 4PGTA 2RIIA 1BEDA 3F3QA 1KTEA 1JHBA 3CRUA 4KH7A 3FK8A 3GTUA 3D22A 4L8EA 1OC9A 4I6XA 3SBCA 3ZLPA 4IS0A 4ZL9A 3IC8A 1XWBA 4BL7B 5G5EA 4IKHA 5KN0A 1AQWA 2HI7A 3G9BA 4KW6A 2FWFA 4ZIJA 1HQOA 2C4JA 4G0KA 1EWXA 3NZNA 1BAYA 1TI1A 3H8QA 3MSZA 4ZB8A 3F9UA 1M99A 4IELA 1U88A 3HDCA 2MBTA 4TN8A 3VWUA 4EXJA 2L4CA 2O7KA 2I1UA 1YZXA 2X8HA 4ZBAA 4NXIA 2OE3A 4NV2A 4G10A 1QFNA 2H8LA 1FG4A 11GSA 1R4WA 2OADA 4K7OA 3WGDA 3O76A 1THOA 4K7NA 3ZVJD 1PX6A 2JZSA 4E8HA 3EWLA 1Z6MA 4D73A 5ECMB 2XBQA 3TJBA 2H1DA 2JU5A 4IQAA 1K0CA 1K3LA 1XWKA 3SWLA 4J57E 1RQMA 3RPNA 3TOTA 2WULA 1TK8B 3P7XA 2ON7A 2OE0A 2FUG2 1FVKA 1TKDB 1EOHA 3R3EA 2B1LA 2B1KA 1VF4A 6GSTA 5DCHA 3DGQA 3TKQA 1S3DA 4BWSA 12GSA 2B7JA 4I2UA 1OC3A 4KSOA 5KN3A 2XPEA 3IA1A 3PGTA 3UEMA 4AJ7A 4ZBDA 1N2AA 4N30A 2DIZA 2DJ0A 3J7Yk 1OVNA 1SL1B 3D4TA 5CNWA 10GSA 5IMFA 2L4QA 4TRXA 5J9CA 2LUSA 2YCDA 4QL9A 2GSSA 1JZDA 2GS3A 1Z7PA 3GV1A 4V2NA 4LMVA 2GDRA 1HNCA 1SKWB 2YWMA 3VPQA 2IMIA 3K8NA 2FWGA 3LYKA 2B5XA 4LL4B 1V9WA 1SYXA 5ID2A 5A4WA 3TRPA 2QGVA 2G0FA 3TKRA 3GX8A 2V2GA 4Q5RA 1VF3A 3ME8A 3DVWA 2PUKC 1A0FA 4KCEA 3G7JA 1EV9A 1YY7A 1EEJA 4H86A 2H0HA 4MJCA 3KMOA 4OCFA 3TKSE 4BA7A 3DVXA 1K3YA 3E0UA 1PKZA 2HFDA 4EL1A 2IMEA 2IL3A 4BVXA 3RPPA 3M0FA 4JU5A 3GKKA 2R2JA 5FT3A 1T3BA 3I43A 2YV9A 4V2LA 3GH9A 19GSA 1ABAA 2CVBA 3CRTA 1GUHA 3ZITA 2BTOT 3GSTA 4MPFA 1FOVA 1ERUA 5DJLA 1XIYA 1GSDA 2I81A 5DVBA 4ML1A 4MJEA 4GRFA 1J0FA 3L9VA 2HXKA 4F9ZA 3ZL5A 5FHIA 3WT1A 4RI7A 2DMMA 3WGEA 3LFLA 3ME7A 1T4YA 3HXSA 4HQZA 1AXDA 4IN0A 2LS5A 1FB0A 1WPIA 2VL9A 1MD3A 2R4VA 5IIZA 3J7Yb 2B5EA 3F0IA 2CAQA 3IPZA 4TR1A 1K0OA 3IRAA 4BWQA 2C3TA 3IV4A 2YJ7A 4IP1A 2JSZA 3RBTA 4K2DA 2MYGA 2VCVA 3A3TA 2C0GA 5GZZB 2M80A 3DEXA 2LRCA 1JZRA 1Z6NA 4POBA 5D96A 3MAKA 3GH6A 4GSNA 6GSVA 2B5YA 3P8WA 1ZOFA 3GTUB 1E6BA 2OA7A 2L5LA 3ED3A 4Z7XA 2MMZA 2MZCA 1R7HA 5IOXA 5IOWA 3HA9A 1YEPA 2L5OA 3F3RA 4IVFA 2VIMA 5EVOA 5HFGA 1YEXA 5HR3A 2V6KA 3W8JA 1OC8A 2GTUA 3L0HA 1XWCA 6GSUA 1ZYEA 3FR6A 5ECPB 3I9V2 3F8UA 3ZMLA 3C1SA 2IWTA 5JCWA 4X1UA 4KSMA 4L5OA 2EIOA 3G7IA 4PXOA 2R37A 5C04A 1TU7A 5IMDA 3KXOA 1X9SB 2XHFA 4YQMA 3HYPA 2YANA 5G1KA 1TK0B 4FYUA 4XCSA 2GZPA 1F3BA 3GA4A 5D9XA 1TDIA 2LRNA 2PN8A 4BVYA 4TR3A 3KH9A 3APOA 5IMZA 1U87A 4PQIA 1NSWA 1ZL9A 3F63A 3HD5A 1CQHA 4KUNA 5E4WA 4ZB9A 5G31A 1X5EA 4QL7A 1UC7A 3IC4A 4DSSA 1YKCA 2DJKA 4IJ3A 3HVSA 4OO5A 1A2JA 3APSA 3UAPA 1MDKA 2VM1A 2C0EA 4EVMA 1Z5YE 2REMA 3C1RA 2LV3A 1A2LA 1B9YC 4TKYA 3ZTLA 4YQVA 1TXXA 2C3NA 4EF0A 5B8BA 4L5LA 1AQXA 3M9JA 1VF1A 1DE1A 1X9MB 4JBBA 4YAVA 2H6YA 4QQ7A 4KDXA 3L9UA 3FR3A 1PL2A 5EL8A 4MA9A 3DKSA 4HZ2A 5HQPA 3UBLA 2ON5A 1LU4A 4O92A 1XFLA 2H66A 2IIYA 3F4RA 3GNJA 1UN2A 4XS4B 3TKPA 4POKA 3ZIVA 5AIXA 4AJ6A 5GSTA 3UMAA 2VCZA 4GF0A 3TJJA 1SENA 2N5AA 1T00A 2TIRA 5ID2B 4IP6A 3LGCA 1ERWA 3VPTA 2NDOA 16GSA 3ZIJA 3HJMA 3QCPA 4G0LA 5CREA 2WZ9A 4GQCA 2FY6A 2DLXA 17GSA 2YV7A 3HZ8A 1TW9A 1SK0A 3TOUA 4KA0A 5F05A 1GSEA 4ZL7A 1I9DA 3CTFA 1WJKA 1QQ2A 3GURA 4XS1A 2D2ZA 3EMXA 3O3TA 2QSIA 2GZZA 4ACSA 4HEA2 1SD8A 4BVXB 3UBKA 2AJQB 2I4AA 1URMA 3M3MA 2A4VA 1J9BA 2DJ3A 1G6YA 5JWOB 1VF2A 3HKRA 3VI5A 2KUCA 2DC5A 1E2YA 4LA1A 5DQSA 5G5FA 1EGOA 2IFQA 4NMUA 2HLSA 1ST9A 2AUVA 1K0NA 3H79A 2OBIA 5ELAA 4G9HA 1GSSA 1PRXA 3VK9A 2H71A 1Z9HA 1AAZA 1B4PA 2HT9A 5H5QA 5EY6A 1GTAA 1EEMA 1TOFA 3D5JA 3DD3A 2HRKB 4N0VA 3D0ZA 5CRWA 4IW9A 1PL1A 4J2FA 2CZ3A 1QXHA 3G7YA 4N10A 1XWAA 2F9SA 1RK4A 1M9AA 3BJ5A 4OFMA 4WBRD 2EIRA 2YJHA 4X43A 2C8UA 5DAKA 3A2XA 2DJJA 4OCEA 4HS1A 1IYHA 1GLQA 3I69A 4KB3A 4TR1B 2QKEA 3CSJA 5F0GA 22GSA 4XS6A 3CSHA 3TJKA 1KNGA 2RLIA 3HY2A 2H76A 3S9FA 4EC0A 5H5SA 3UIWA 4ZBBA 2H0GA 3MDKA 1V57A 4YQUA 1XVQA 4MZWA 1R5PA 2NTOA 1PD21 2A2RA 4KDYA 2FA8A 4F2IA 2PU9C 2V1MA 5CRDA 1A23A 1GRXA 6GSXA 2RM5A 4L0WA 4ISDA 3GUSA 3CXGA 4NHZA 2WCIA 3KCMA 2GSQA
chains in the Genus database with same CATH superfamily
4OO4A 5D73A 3RHBA 3A2WA 2V41A 1JFUA 2L59A 3GKNA 3IAS2 3C73A 3F4SA 1XCCA 3QFBC 4YKGA 3H1NA 5J5NA 4Z2TA 5J4VA 2JZRA 4ZB6A 2ES7A 2AHEA 2LNSA 4BIKA 7GSSA 1AC1A 1FO5A 3TJFA 2JZTA 3FR9A 2FWEA 3IDVA 2PBJA 3EPTA 1T4ZA 4HZ4A 3WGXA 5A4VA 1QUWA 1YQ1A 1SL0B 1PQNA 3HJOA 5GAND 5HR2A 1A0RP 4NWYA 1IYIA 3F4TA 1KEBA 2C1YA 3IK9A 1SK1A 1GP1A 2WW1A 1OE8A 6GSSA 1O85A 2WB9A 1XPVA 2X8GA 3KJYA 1ERTA 4KCAA 1GUKA 5IMVA 4TXVA 1UVZA 4G2EA 2IJYA 4JEDA 4WR5A 4OWYA 2WGRA 5A5HA 1G6WA 2WDUA 1A8YA 1I1IP 4Q5NA 1C72A 3TRQA 4G0IA 18GSA 3TJGA 4DSSB 1MDIA 3WYWA 4ECIA 2K6VA 3ZFLA 3CYNA 2R0CA 4ZL8A 3W6GA 1G0TA 5L71A 4N0ZA 1TRVA 5IM9A 5HR1A 1EV4A 2GGTA 3C7MA 3Q18A 2X99A 3DIEA 2H01A 2L6DA 3KH7A 2CAIA 2H1LA 1OYJA 1SYRA 1XOAA 1SKSB 4G19A 4AGSA 2CT6A 1T8EB 4GDFA 4GSTA 4GTUA 1OE7A 1ZZYA 3KGKA 1GTUA 2HZEA 1PN9A 1DUGA 4KNDA 4ML6A 2R5GA 2K8VA 4CHSA 4K0NA 4IQ1A 2PWJA 1GL8A 2A2SA 2OT3A 2VL2C 3I6AA 2YZHA 5A5KA 2LTKA 4DVCA 1Y25A 1TXUA 3DYRA 5A4UA 1K0BA 2NVLA 1NM3A 3BD2A 1GH2A 2CZ2A 1YVLA 4AKGA 5IO2A 3HJPA 4HDEA 3MNGA 4ECCA 3PINA 5JWQB 3QD9A 4ECJA 2PGTA 5D9TA 2KP2A 1ZCPA 4PNGA 5B6MA 1Z7RA 2UV8G 2OE1A 3FEUA 2WRTA 1S3AA 3FHKA 1O6JA 1O73A 1OKDA 5AISA 2CV4A 1F9MA 3GIXA 5INYA 5AGYA 2GT5A 4MZBA 2H1GA 1FHEA 2MMOA 4HI7A 4K1FA 2X49A 4KAEA 3KP8A 3H93A 1J08A 2LJKA 4GWRA 2O87A 1BJXA 2F3MA 2AB6A 8GSSA 4E8EA 1OC9B 3QDNA 3ZZXA 2LJAA 2K8SA 3KMNA 4TR4A 3TKSC 4KX4A 5E59A 5F8BA 2RM6A 2C3QA 5DQYA 5IPGA 1S4BP 3ERWA 4HOJA 3IHQA 5ECOB 4LMWA 4EO3A 5IQYA 3L4NA 2JACA 3VWXA 1BQ7A 2M72A 4JR4A 5F07A 1A2MA 2TRXA 4I2TA 5IPHA 2UZ8A 2IFQB 4NHWA 2CQ9A 4WF5A 1G7OA 1YDKA 1GNEA 4FXYP 1M7TA 2NBSA 5EPFA 1GLPA 3GKXA 1TK5B 4FH8A 3C71A 4TXOA 1X0RA 4LLRA 4K9ZA 1PA3A 1SL2B 4KDUA 3LG6A 4NV5A 4IJIA 2VD1A 3FY7A 1EP7A 2LSTA 1ZMAA 2TRCP 1WIKA 2I3YA 1ZYQB 4D73B 5J41A 5AN1A 2R0PA 5B8AA 1GSQA 2FA4A 2WVXB 5A1NA 2RUFA 1GWCA 4NPBA 3U6VA 4ULXA 5G1LA 2O89A 5LNKe 4OMVA 1U3AA 3US3A 1XW5A 5C00A 4MJAA 1G7EA 2E2MA 4PURA 2K18A 4RI6A 2H0IA 4V1Ag 3LSZA 3QPMA 4P3YB 1EOGA 3E9JB 4I8BA 4YH2A 3EU3A 3TGZA 3PR8A 1XBSA 4N11A 1EGRA 2DJ2A 5D9VA 2VCQA 1DSBA 2H1AA 2JL4A 3WD6A 2ZNMA 3Q19A 3VURA 3D6IA 4DSRA 2P31A 1GSUA 2HSNA 3CWGA 1V58A 1T1VA 4HJ2A 3A5IA 2HZFA 2GVPA 2YNXA 2VL2A 1XZOA 3U5RE 1WP0A 1F3AA 1TI3A 3FYGA 3HHVA 1GTIA 3A5WA 2A4HA 4O32A 5KN2A 4WF4A 2VD0A 4F82A 3VI7A 5KOXA 4MF7A 4HJMA 4WETA 4IGJA 1B48A 2E0QA 3FZ9A 3DRNA 1QGVA 4IBPA 2JSYA 4FQUA 2IN3A 3P2AA 2HRNA 1BG5A 5DALA 3IXRA 2WJUA 3EC3A 1ERVA 4JRRA 3HVXA 1DBYA 1XXUA 2KOKA 1AQVA 3DWVA 1I5GA 4IHUA 2LQOA 2MMNA 5ABRA 5B7CA 1V98A 2VL3A 3UOMA 3HVVA 2FHEA 3E3EA 1Y6EA 1X9WB 3FZAA 2CVKA 1M3IA 4MP4A 4LL1B 1X5DA 3RDWA 2N5BA 4TR0A 2G2QA 5IMAA 4RUVA 1XW6A 4EE0A 3QAGA 3OR5A 3GFKA 5GSSA 4PUFC 1V2AA 4CW9A 1LBKA 1ZYNA 3IBHA 1JZWA 1YF1A 5ELGA 3ZRDA 3KTBA 5JWRB 1S3RA 4DSQA 2X64A 1Z3EA 4ID0A 3VWVA 4MJBA 1MDJA 3KZQA 2IMFA 5CAXA 1XVWA 20GSA 2L6CA 3R2QA 2HZEB 3GMFA 4MLYA 1A8LA 1H4OA 2HE3A 3TCOA 3D21A 1JZOA 2AYTA 5ECLB 1SKRB 4POMA 3QAWA 3N9JA 5AIVA 1B8XA 2XBIA 5CYYA 3H4KA 2Z9SA 4F0BA 4MK3A 2VAFA 2EC4A 5ENUA 2FLSA 1RW1A 5H5RA 4J56E 4JZQA 4V1Ap 1FB6A 6GSWA 1MD4A 4XRDA 3KD0A 2HQTA 5JCGA 3IK7A 2GSTA 2VCXA 3L78A 2B3SA 3AY8A 4WEYA 2HSMA 4MH2A 4AKXB 3KIJA 5HR0A 2F8FA 3MWHA 2QA1A 1TRWA 1ACVA 3FRCA 1LJRA 2ALBA 2LKUA 2F51A 1WRYA 2FNOA 2YPMA 4FO5A 1HYUA 2R0GA 1CQGA 3ZVJA 4F03A 3ZREA 2FCHA 3LORA 2GT6A 1K0DA 1VRSD 3EMPA 2VKZG 2IMKA 2LQQA 5FWGA 3F6FA 2A2PA 4MF5A 2EFCA 2VLUA 3LXZA 2QC7A 1YJ6A 2PVQA 4EDYA 1EP8A 4TW5A 2H74A 3GL5A 5G30A 3Q6OA 3M1GA 4BPYA 4O7HA 3O6TA 3FZ5A 1M2AA 4PTSA 2C0FA 5GAPD 5ECNB 1T7PB 2WW3A 2JADA 3TRXA 2C80A 3GSSA 5F06A 5J40A 1PX7A 1WOUA 5DBQA 5J9BA 2H73A 1AW9A 4MDCA 5D8IA 1F2EA 5B6NA 4V2MA 5HFKA 2MBSA 2HSHA 3LWAA 4Q5QA 1K3OA 1BX9A 4MMMA 1GULA 3V1WA 2YP6A 2O85A 1XWGA 4TXOB 2YOIA 2H75A 1A24A 1HNAA 1N25A 2DKHA 2CX4A 2OJLA 3UL3A 1TRUA 2HYXA 1THXA 4ECBA 3FZ4A 1M9BA 4PX1A 1SJZA 1TTZA 4XS4A 2X4AA 4BVYB 2EFDA 1V40A 2GQLA 5A1NB 2YN1A 3VWWA 2FWHA 4K2XA 3P90A 4I5QA 1TJDA 4HQSA 2OBKA 2C0DA 5ECIB 1DE2A 4WXTA 4PNFA 2KHPA 3EURA 2F8AA 2RUEA 1WMJA 2LEGA 3VFIA 1USBA 1O7UA 4KGIA 2ZCTA 4ILFA 3PPUA 2O8VB 4K6XA 1S3CA 5LCZA 3EYTA 4OD7A 5COHA 2E2GA 2DJ1A 3IOSA 14GSA 3BCIA 3W8SA 1N8JA 2WS2A 1XW9A 1U6TA 1NW2A 1NHOA 2LNTA 1FVJA 3IR4A 2GZYA 1K0MA 2GSRA 3RAZA 1ILOA 3F6DA 2HSYA 2AAWA 3NOFA 5J3RA 1SVOA 2LJRA 2VUPA 4BL7A 3EE2A 3CTGA 5CRHA 1MEKA 2HSNB 5LD0A 4NAXA 4K0GA 2H6ZA 4GSSA 5D93A 5A34A 4GQFA 2OKAA 1W89A 4DEJA 1JLWA 4GCIA 2DBCA 4X0XA 4EDZA 4K7IA 4Q5FA 4FYCA 1MTCA 3TU3B 5IO0A 2V32A 6GSYA 3TB2A 4XTSA 2CA8A 2K9FA 5HFIA 2PERA 3FKFA 1OKTA 2XC2A 3DXBA 2HRKA 4QMKA 5DCGA 2VCTA 2H19A 4EUYA 3BBYA 4MABA 2J23A 3UVTA 2EFEA 2I9HA 5ECHB 2YWIA 1BYEA 3QMXA 5DALB 4F0CA 4USSA 2J9HA 4WBJA 5D9WA 1SJ6A 4PQ1A 2PVOC 2EIQA 2WFCA 1FAAA 2B7KA 3KEBA 2KP1A 4KF9A 3HCZA 1SD9A 1SK2A 2B6MA 4OFTA 3N5OA 3C8EA 3ERGA 2FGXA 2GQKA 3IE3A 2XPDA 3Q74A 2H30A 1Q98A 3LJRA 2YZUA 2FD3A 5CO3A 4ZB7A 4AJ8A 4GXZA 3CMIA 4AF2A 3ISOA 4JE1A 1JLVA 5J47A 4CDOA 2P5QA 2PPTA 1W4VA 3DMLA 1PKWA 3CSIA 1PGTA 5DDLA 1ML6A 1B4QA 1GTBA 1GUMA 1O8XA 2R6KA 4OFNA 5ECKB 3APQA 3RHCA 3LQ7A 2NPBA 4MZCA 1GSYA 1KBNA 2R3XA 4HU9A 2H6XA 3QR6A 3GX0A 3ZFBA 2LRTA 1X5CA 4PQHA 2HNLA 3GKMA 1ZGNA 3TDGA 1HNBA 3GYKA 5CP1A 1SU9A 1PSQA 4N3ZA 1XG8A 2L57A 2DSAA 1WWJA 4ZILA 3LYPA 4PUAA 1HD2A 9GSSA 2H70A 5DAKB 2BMXA 2HSMB 1YF0A 3ZYWA 1UA5A 2X8CA 2AV4A 3QOUA 5KEJA 2KLXA 2YWNA 2ZUPA 1SJIA 3LEFA 1YKAA 4XIHA 4TOPA 1GSFA 1TU8A 3KP9A 1Q4JA 2N5FA 5KN1A 2YWOA 4HUAA 1TRSA 5ECQB 3VLNA 2H72A 3CBUA 2VLVA 4I97A 5IMCA 3IHGA 4GLTA 5BMUA 1QK8A 3IAM2 3M9KA 1SVLA 4EKZA 13GSA 3KTLA 2VOCA 3HZ4A 3A2VA 1O8WA 3EU4A 2GLRA 3QAVA 3GL3A 1R5AA 3WT2A 3KM6A 2MMAA 1XOBA 1O81A 2VCWA 2BJXA 1FW1A 2IPAA 1OAZA 3BOAA 3MIXA 4CY8A 1EZKA 2IMDA 3EINA 1ON4A 1AUCA 1PMTA 3LXTA 3M8NA 3FW2A 4XHMA 3ZMKA 4WR4A 1M2BA 4XRAA 3TUEA 1U3IA 2H1BA 3BCKA 5JCUA 3PH9A 4POLA 4AKHA 3ERFA 3EVIA 4FYBA 4O5RA 2DMLA 4MF6A 1M2DA 1B9XC 4MH3A 1F6MC 2P0GA 5ECSA 5CRGA 3GN3A 2M46A 2PMTA 3UARA 4MCUA 1R26A 2VM2A 4JR6A 2GQMA 1WE0A 5J4YA 1M0UA 4FIWA 3RFRC 2HRAA 3GRXA 1BG1A 2OACA 3L9SA 5A5HB 4RQRA 4A5PA 4HU7A 1GNWA 2P5RA 2CVDA 3NIVA 4KE3A 2E7PA 2V6OA 3GHAA 5G2ZA 1K0AA 3D4MA 2HRFA 4WKWA 1VGLA 4RQXA 1F37A 2VO4A 1AIUA 2O3EA 1TP9A 1NHYA 2VLTA 1QMVA 2CX3A 4L0UA 5DJMA 3UVHA 4TVEA 4K8MA 3UJ1A 3QFAC 4YAPA 3TKSA 3JCML 4ZXGA 4MPGA 5ECRB 5J4UA 2DIYA 1H75A 4PGTA 2RIIA 1BEDA 3F3QA 1KTEA 1JHBA 3CRUA 4KH7A 3FK8A 3GTUA 3D22A 4L8EA 1OC9A 4I6XA 3SBCA 3ZLPA 4IS0A 4ZL9A 3IC8A 1XWBA 4BL7B 5G5EA 4IKHA 5KN0A 1AQWA 2HI7A 3G9BA 4KW6A 2FWFA 4ZIJA 1HQOA 2C4JA 4G0KA 1EWXA 3NZNA 1BAYA 1TI1A 3H8QA 3MSZA 4ZB8A 3F9UA 1M99A 4IELA 4YKFA 1U88A 3HDCA 2MBTA 4TN8A 3VWUA 4EXJA 2EFHA 2L4CA 2O7KA 2I1UA 1YZXA 2X8HA 4ZBAA 4O5QA 4NXIA 2OE3A 4NV2A 4G10A 1QFNA 2H8LA 1FG4A 11GSA 1R4WA 2OADA 4K7OA 3WGDA 3O76A 1THOA 4K7NA 3ZVJD 1PX6A 2JZSA 4E8HA 3EWLA 4PI0C 1Z6MA 4D73A 5ECMB 1YEWC 2XBQA 2WVYA 3TJBA 2H1DA 2JU5A 4IQAA 1K0CA 1K3LA 1XWKA 3SWLA 3RGBC 4J57E 1RQMA 3RPNA 3TOTA 2WULA 4W66A 3P7XA 2ON7A 2OE0A 1TK8B 2FUG2 1FVKA 1TKDB 1EOHA 3R3EA 2B1LA 2B1KA 1VF4A 4K5SA 6GSTA 5DCHA 3DGQA 3TKQA 1S3DA 4BWSA 1FOHA 12GSA 2B7JA 4I2UA 1OC3A 4KSOA 5KN3A 2XPEA 4X4JA 3IA1A 3PGTA 3UEMA 4AJ7A 4ZBDA 1N2AA 4N30A 2DIZA 2DJ0A 3J7Yk 1OVNA 1SL1B 3D4TA 5CNWA 10GSA 5IMFA 2L4QA 4TRXA 5J9CA 2LUSA 2YCDA 4ICYA 4QL9A 2O5VA 2GSSA 2WVZA 1JZDA 2GS3A 1Z7PA 3GV1A 4V2NA 4LMVA 2GDRA 1HNCA 4AKIA 1SKWB 2YWMA 3VPQA 2IMIA 3K8NA 2FWGA 3LYKA 2B5XA 4LL4B 1V9WA 1SYXA 5ID2A 5A4WA 3TRPA 2QGVA 2G0FA 3TKRA 3GX8A 2V2GA 4Q5RA 1VF3A 4CY6A 3ME8A 3DVWA 2PUKC 1A0FA 4KCEA 3CQFA 5BRTA 3G7JA 5BMUB 1EV9A 1YY7A 1EEJA 4H86A 2H0HA 4MJCA 3KMOA 4OCFA 3TKSE 4BA7A 4Z2RA 3DVXA 1K3YA 3E0UA 1PKZA 2HFDA 4EL1A 2IMEA 1SVMA 2IL3A 3LW9A 4BVXA 3RPPA 3M0FA 4JU5A 3GKKA 2R2JA 5FT3A 1T3BA 3I43A 2YV9A 4V2LA 3GH9A 19GSA 1ABAA 2CVBA 3CRTA 1GUHA 3ZITA 2BTOT 3GSTA 4MPFA 3HVNA 1FOVA 1ERUA 5DJLA 1XIYA 1GSDA 2I81A 5DVBA 4ML1A 4MJEA 4AI6A 4GRFA 1J0FA 3L9VA 2HXKA 4F9ZA 3ZL5A 5FHIA 3WT1A 4Z2UA 4RI7A 2DMMA 3WGEA 3LFLA 3ME7A 1T4YA 3HXSA 4HQZA 1AXDA 4IN0A 2LS5A 1FB0A 1WPIA 2VL9A 1MD3A 2R4VA 5IIZA 3J7Yb 2B5EA 3F0IA 2CAQA 3IPZA 4TR1A 1K0OA 3IRAA 3MYDA 4BWQA 2WW0A 2C3TA 3IV4A 2YJ7A 3FMWA 4IP1A 2JSZA 5KOWA 3RBTA 4K2DA 2MYGA 2VCVA 3A3TA 2C0GA 5GZZB 2M80A 3DEXA 2LRCA 1JZRA 1Z6NA 2DKIA 4POBA 5D96A 3MAKA 3GH6A 4GSNA 4E68A 6GSVA 2B5YA 3P8WA 1ZOFA 3GTUB 1E6BA 2OA7A 4O5UA 2L5LA 3ED3A 4Z7XA 2MMZA 3CHXC 2MZCA 1R7HA 5IOXA 5IOWA 3HA9A 1YEPA 2L5OA 3F3RA 4IVFA 1M3JA 2VIMA 5EVOA 5HFGA 1YEXA 5HR3A 2V6KA 3W8JA 1OC8A 2GTUA 3L0HA 1XWCA 6GSUA 1ZYEA 3FR6A 5ECPB 3I9V2 3F8UA 3ZMLA 3C1SA 1ZYPA 2IWTA 5JCWA 4X1UA 4KSMA 4L5OA 2EIOA 3G7IA 4PXOA 2R37A 5C04A 1TU7A 5IMDA 3KXOA 1X9SB 2XHFA 4YQMA 4G01A 3HYPA 2YANA 5G1KA 2WW2A 1TK0B 4PI2C 4FYUA 4XCSA 2GZPA 1F3BA 3GA4A 5D9XA 1TDIA 1PN0A 2LRNA 2PN8A 4BVYA 4TR3A 3KH9A 3APOA 5IMZA 1U87A 4PQIA 1NSWA 1ZL9A 3F63A 3HD5A 1CQHA 4KUNA 5E4WA 4ZB9A 5G31A 1X5EA 4QL7A 1UC7A 3IC4A 4DSSA 1YKCA 2DJKA 4IJ3A 3HVSA 4OO5A 1A2JA 3APSA 3UAPA 1MDKA 2VM1A 2C0EA 4EVMA 1Z5YE 2REMA 3C1RA 2LV3A 1A2LA 1B9YC 4TKYA 3ZTLA 4YQVA 1TXXA 2C3NA 4EF0A 5B8BA 4L5LA 1AQXA 3M9JA 4EIPA 1VF1A 1DE1A 1X9MB 4JBBA 4YAVA 2H6YA 4QQ7A 4KDXA 3L9UA 3FR3A 1PL2A 5EL8A 4MA9A 3DKSA 4HZ2A 1BF5A 5HQPA 3UBLA 2ON5A 1LU4A 4O92A 1XFLA 2H66A 2IIYA 1Y1UA 3F4RA 3GNJA 1UN2A 4XS4B 3TKPA 4POKA 3ZIVA 5AIXA 4AJ6A 5GSTA 3UMAA 2VCZA 4GF0A 3TJJA 1SENA 2N5AA 1T00A 2TIRA 5ID2B 4IP6A 3LGCA 1ERWA 3VPTA 2NDOA 16GSA 3ZIJA 3HJMA 3QCPA 4G0LA 5CREA 2WZ9A 4GQCA 2FY6A 2DLXA 17GSA 2YV7A 3HZ8A 1TW9A 1SK0A 3TOUA 4KA0A 5F05A 1GSEA 4ZL7A 1I9DA 3CTFA 1WJKA 1QQ2A 3GURA 4XS1A 2D2ZA 3EMXA 3HMJG 3O3TA 4PHZC 2QSIA 2GZZA 4ACSA 4HEA2 1SD8A 4BVXB 3UBKA 2AJQB 2I4AA 1URMA 3M3MA 2A4VA 1J9BA 2DJ3A 1G6YA 5JWOB 1VF2A 3HKRA 3VI5A 2KUCA 2DC5A 5A34B 1E2YA 4HSCX 4LA1A 5DQSA 5G5FA 1EGOA 1PFOA 2QA2A 2IFQA 4NMUA 2HLSA 1ST9A 2AUVA 1K0NA 3H79A 2OBIA 5ELAA 4G9HA 1GSSA 1PRXA 3VK9A 2H71A 1Z9HA 1AAZA 1B4PA 2HT9A 4MNNA 5EY6A 5H5QA 1GTAA 1EEMA 1TOFA 3D5JA 3DD3A 2HRKB 4N0VA 3D0ZA 5CRWA 4IW9A 1PL1A 4J2FA 2CZ3A 1QXHA 3G7YA 4N10A 1XWAA 2F9SA 1RK4A 4K5RA 1M9AA 3BJ5A 4OFMA 4WBRD 2EIRA 2YJHA 4X43A 2C8UA 2WVXA 5DAKA 3A2XA 2O36A 2DJJA 4OCEA 4HS1A 1IYHA 1GLQA 3I69A 4KB3A 4TR1B 2WZSA 2QKEA 3CSJA 5F0GA 22GSA 4XS6A 3CSHA 3TJKA 1KNGA 2RLIA 3HY2A 2H76A 3S9FA 4EC0A 5H5SA 3UIWA 4ZBBA 2H0GA 3MDKA 1V57A 4YQUA 1XVQA 4MZWA 1R5PA 2NTOA 1PD21 2A2RA 4KDYA 2FA8A 4F2IA 2PU9C 2V1MA 5CRDA 1A23A 1GRXA 6GSXA 2RM5A 4L0WA 4EIQA 4ISDA 3GUSA 3CXGA 4NHZA 2WCIA 3KCMA 2GSQA
chains in the Genus database with same CATH topology
4OO4A 5D73A 3RHBA 3A2WA 2V41A 1JFUA 2L59A 3GKNA 3IAS2 3C73A 3F4SA 1XCCA 3QFBC 4YKGA 3H1NA 5J5NA 4Z2TA 5J4VA 2JZRA 4ZB6A 2ES7A 2AHEA 2LNSA 7GSSA 1AC1A 1FO5A 3TJFA 2JZTA 3FR9A 2FWEA 3IDVA 2PBJA 3EPTA 1T4ZA 4HZ4A 3WGXA 5A4VA 1QUWA 1YQ1A 1SL0B 1PQNA 3HJOA 5GAND 5HR2A 1A0RP 4NWYA 1IYIA 3F4TA 1KEBA 2C1YA 3IK9A 1SK1A 1GP1A 1OE8A 6GSSA 1O85A 2WB9A 1XPVA 2X8GA 3KJYA 1ERTA 4KCAA 1GUKA 5IMVA 4TXVA 1UVZA 4G2EA 2IJYA 4JEDA 4WR5A 4OWYA 2WGRA 5A5HA 1G6WA 2WDUA 1A8YA 4Q5NA 1C72A 3TRQA 4G0IA 18GSA 3TJGA 4DSSB 1MDIA 3WYWA 4ECIA 2K6VA 3ZFLA 3CYNA 2R0CA 4ZL8A 3W6GA 1G0TA 5L71A 4N0ZA 1TRVA 5IM9A 5HR1A 1EV4A 2GGTA 3C7MA 3Q18A 2X99A 3DIEA 2H01A 2L6DA 3KH7A 2CAIA 2H1LA 1OYJA 1SYRA 1XOAA 1SKSB 4G19A 4AGSA 2CT6A 1T8EB 4GDFA 4GSTA 4GTUA 1OE7A 1ZZYA 3KGKA 1GTUA 2HZEA 1PN9A 1DUGA 4KNDA 4ML6A 2R5GA 2K8VA 4CHSA 4K0NA 4IQ1A 2PWJA 1GL8A 2A2SA 2OT3A 2VL2C 3I6AA 2YZHA 5A5KA 2LTKA 4DVCA 1Y25A 1TXUA 3DYRA 5A4UA 1K0BA 2NVLA 1NM3A 3BD2A 1GH2A 2CZ2A 1YVLA 4AKGA 5IO2A 3HJPA 4HDEA 3MNGA 4ECCA 3PINA 5JWQB 3QD9A 4ECJA 2PGTA 5D9TA 2KP2A 1ZCPA 4PNGA 5B6MA 1Z7RA 2UV8G 2OE1A 3FEUA 2WRTA 1S3AA 3FHKA 1O6JA 1O73A 1OKDA 5AISA 2CV4A 1F9MA 3GIXA 5INYA 5AGYA 2GT5A 4MZBA 2H1GA 1FHEA 2MMOA 4HI7A 4K1FA 2X49A 4KAEA 3KP8A 3H93A 1J08A 2LJKA 4GWRA 2O87A 1BJXA 2F3MA 2AB6A 8GSSA 4E8EA 1OC9B 3QDNA 3ZZXA 2LJAA 2K8SA 3KMNA 4TR4A 3TKSC 4KX4A 5E59A 5F8BA 2RM6A 2C3QA 5DQYA 5IPGA 3ERWA 4HOJA 3IHQA 5ECOB 4LMWA 4EO3A 5IQYA 3L4NA 2JACA 3VWXA 1BQ7A 2M72A 4JR4A 5F07A 1A2MA 2TRXA 4I2TA 5IPHA 2UZ8A 2IFQB 4NHWA 2CQ9A 4WF5A 1G7OA 1YDKA 1GNEA 1M7TA 2NBSA 5EPFA 1GLPA 3GKXA 1TK5B 4FH8A 3C71A 4TXOA 1X0RA 4LLRA 4K9ZA 1PA3A 1SL2B 4KDUA 3LG6A 4NV5A 4IJIA 2VD1A 3FY7A 1EP7A 2LSTA 1ZMAA 2TRCP 1WIKA 2I3YA 1ZYQB 4D73B 5J41A 5AN1A 2R0PA 5B8AA 1GSQA 2FA4A 5A1NA 2RUFA 1GWCA 4NPBA 3U6VA 4ULXA 5G1LA 2O89A 5LNKe 4OMVA 1U3AA 3US3A 1XW5A 5C00A 4MJAA 1G7EA 2E2MA 4PURA 2K18A 4RI6A 2H0IA 4V1Ag 3LSZA 3QPMA 4P3YB 1EOGA 3E9JB 4I8BA 4YH2A 3EU3A 3TGZA 3PR8A 1XBSA 4N11A 1EGRA 2DJ2A 5D9VA 2VCQA 1DSBA 2H1AA 2JL4A 3WD6A 2ZNMA 3Q19A 3VURA 3D6IA 4DSRA 2P31A 1GSUA 2HSNA 3CWGA 1V58A 1T1VA 4HJ2A 3A5IA 2HZFA 2GVPA 2YNXA 2VL2A 1XZOA 3U5RE 1F3AA 1TI3A 1WP0A 3FYGA 3HHVA 1GTIA 3A5WA 2A4HA 4O32A 5KN2A 4WF4A 2VD0A 4F82A 3VI7A 5KOXA 4MF7A 4HJMA 4WETA 4IGJA 1B48A 2E0QA 3FZ9A 3DRNA 1QGVA 4IBPA 2JSYA 4FQUA 2IN3A 3P2AA 2HRNA 1BG5A 5DALA 3IXRA 2WJUA 3EC3A 1ERVA 4JRRA 3HVXA 1DBYA 1XXUA 2KOKA 1AQVA 3DWVA 1I5GA 4IHUA 2LQOA 2MMNA 5ABRA 5B7CA 1V98A 2VL3A 3UOMA 3HVVA 2FHEA 3E3EA 1Y6EA 1X9WB 3FZAA 2CVKA 4MP4A 4LL1B 1X5DA 3RDWA 2N5BA 4TR0A 2G2QA 5IMAA 4RUVA 1XW6A 4EE0A 3QAGA 3OR5A 3GFKA 5GSSA 4PUFC 1V2AA 4CW9A 1LBKA 1ZYNA 3IBHA 1JZWA 1YF1A 5ELGA 3ZRDA 3KTBA 5JWRB 4DSQA 2X64A 1Z3EA 4ID0A 3VWVA 4MJBA 1MDJA 3KZQA 2IMFA 5CAXA 1XVWA 20GSA 2L6CA 3R2QA 2HZEB 3GMFA 4MLYA 1A8LA 1H4OA 2HE3A 3TCOA 3D21A 1JZOA 2AYTA 5ECLB 1SKRB 4POMA 3QAWA 3N9JA 5AIVA 1B8XA 2XBIA 5CYYA 3H4KA 2Z9SA 4F0BA 4MK3A 2VAFA 2EC4A 5ENUA 2FLSA 1RW1A 5H5RA 4J56E 4JZQA 4V1Ap 1FB6A 6GSWA 1MD4A 4XRDA 3KD0A 2HQTA 5JCGA 3IK7A 2GSTA 2VCXA 3L78A 2B3SA 3AY8A 4WEYA 2HSMA 4MH2A 4AKXB 3KIJA 5HR0A 2F8FA 3MWHA 2QA1A 1TRWA 1ACVA 3FRCA 1LJRA 2ALBA 2LKUA 2F51A 1WRYA 2FNOA 2YPMA 4FO5A 1HYUA 2R0GA 1CQGA 3ZVJA 4F03A 3ZREA 2FCHA 3LORA 2GT6A 1K0DA 1VRSD 3EMPA 2VKZG 2IMKA 2LQQA 5FWGA 3F6FA 2A2PA 4MF5A 2EFCA 2VLUA 3LXZA 2QC7A 1YJ6A 2PVQA 4EDYA 1EP8A 4TW5A 2H74A 3GL5A 5G30A 3Q6OA 3M1GA 4BPYA 4O7HA 3O6TA 3FZ5A 1M2AA 4PTSA 2C0FA 5GAPD 5ECNB 1T7PB 2JADA 3TRXA 2C80A 3GSSA 5F06A 5J40A 1PX7A 1WOUA 5DBQA 5J9BA 2H73A 1AW9A 4MDCA 5D8IA 1F2EA 5B6NA 4V2MA 5HFKA 2MBSA 2HSHA 3LWAA 4Q5QA 1K3OA 1BX9A 4MMMA 1GULA 3V1WA 2YP6A 2O85A 1XWGA 4TXOB 2YOIA 2H75A 1A24A 1HNAA 1N25A 2DKHA 2CX4A 2OJLA 3UL3A 1TRUA 2HYXA 1THXA 4ECBA 3FZ4A 1M9BA 4PX1A 1SJZA 1TTZA 4XS4A 2X4AA 4BVYB 2EFDA 1V40A 2GQLA 5A1NB 2YN1A 3VWWA 2FWHA 4K2XA 3P90A 4I5QA 1TJDA 4HQSA 2OBKA 2C0DA 5ECIB 1DE2A 4WXTA 4PNFA 2KHPA 3EURA 2F8AA 2RUEA 1WMJA 2LEGA 3VFIA 1USBA 1O7UA 4KGIA 2ZCTA 4ILFA 3PPUA 2O8VB 4K6XA 1S3CA 5LCZA 3EYTA 4OD7A 5COHA 2E2GA 2DJ1A 3IOSA 14GSA 3BCIA 3W8SA 1N8JA 2WS2A 1XW9A 1U6TA 1NW2A 1NHOA 2LNTA 1FVJA 3IR4A 2GZYA 1K0MA 2GSRA 3RAZA 1ILOA 3F6DA 2HSYA 2AAWA 3NOFA 5J3RA 1SVOA 2LJRA 2VUPA 4BL7A 3EE2A 3CTGA 5CRHA 1MEKA 2HSNB 5LD0A 4NAXA 4K0GA 2H6ZA 4GSSA 5D93A 5A34A 4GQFA 2OKAA 1W89A 4DEJA 1JLWA 4GCIA 2DBCA 4X0XA 4EDZA 4K7IA 4Q5FA 4FYCA 1MTCA 3TU3B 5IO0A 2V32A 6GSYA 3TB2A 4XTSA 2CA8A 2K9FA 5HFIA 2PERA 3FKFA 1OKTA 2XC2A 3DXBA 2HRKA 4QMKA 5DCGA 2VCTA 2H19A 4EUYA 3BBYA 4MABA 2J23A 3UVTA 2EFEA 2I9HA 5ECHB 2YWIA 1BYEA 3QMXA 5DALB 4F0CA 4USSA 2J9HA 4WBJA 5D9WA 1SJ6A 4PQ1A 2PVOC 2EIQA 2WFCA 1FAAA 2B7KA 3KEBA 2KP1A 4KF9A 3HCZA 1SD9A 1SK2A 2B6MA 4OFTA 3N5OA 3C8EA 3ERGA 2FGXA 2GQKA 3IE3A 2XPDA 3Q74A 2H30A 1Q98A 3LJRA 2YZUA 2FD3A 5CO3A 4ZB7A 4AJ8A 4GXZA 3CMIA 4AF2A 3ISOA 4JE1A 1JLVA 5J47A 4CDOA 2P5QA 2PPTA 1W4VA 3DMLA 1PKWA 3CSIA 1PGTA 5DDLA 1ML6A 1B4QA 1GTBA 1GUMA 1O8XA 2R6KA 4OFNA 5ECKB 3APQA 3RHCA 3LQ7A 2NPBA 4MZCA 1GSYA 1KBNA 2R3XA 4HU9A 2H6XA 3QR6A 3GX0A 3ZFBA 2LRTA 1X5CA 4PQHA 2HNLA 3GKMA 1ZGNA 3TDGA 1HNBA 3GYKA 5CP1A 1SU9A 1PSQA 4N3ZA 2L57A 2DSAA 1WWJA 4ZILA 3LYPA 4PUAA 1HD2A 9GSSA 2H70A 5DAKB 2BMXA 2HSMB 1YF0A 3ZYWA 1UA5A 2X8CA 2AV4A 3QOUA 5KEJA 2KLXA 2YWNA 2ZUPA 1SJIA 3LEFA 1YKAA 4XIHA 4TOPA 1GSFA 1TU8A 3KP9A 1Q4JA 2N5FA 5KN1A 2YWOA 4HUAA 1TRSA 5ECQB 3VLNA 2H72A 3CBUA 2VLVA 4I97A 5IMCA 3IHGA 4GLTA 5BMUA 1QK8A 3IAM2 3M9KA 1SVLA 4EKZA 13GSA 3KTLA 2VOCA 3HZ4A 3A2VA 1O8WA 3EU4A 2GLRA 3QAVA 3GL3A 1R5AA 3WT2A 3KM6A 2MMAA 1XOBA 1O81A 2VCWA 2BJXA 1FW1A 2IPAA 1OAZA 3BOAA 3MIXA 4CY8A 1EZKA 2IMDA 3EINA 1ON4A 1AUCA 1PMTA 3LXTA 3M8NA 3FW2A 4XHMA 3ZMKA 4WR4A 1M2BA 4XRAA 3TUEA 1U3IA 2H1BA 3BCKA 5JCUA 3PH9A 4POLA 4AKHA 3ERFA 3EVIA 4FYBA 4O5RA 2DMLA 4MF6A 1M2DA 1B9XC 4MH3A 1F6MC 2P0GA 5ECSA 5CRGA 3GN3A 2M46A 2PMTA 3UARA 4MCUA 1R26A 2VM2A 4JR6A 2GQMA 1WE0A 5J4YA 1M0UA 4FIWA 2HRAA 3GRXA 1BG1A 2OACA 3L9SA 5A5HB 4RQRA 4A5PA 4HU7A 1GNWA 2P5RA 2CVDA 3NIVA 4KE3A 2E7PA 2V6OA 3GHAA 5G2ZA 1K0AA 3D4MA 2HRFA 4WKWA 1VGLA 4RQXA 1F37A 2VO4A 1AIUA 1TP9A 1NHYA 2VLTA 1QMVA 2CX3A 4L0UA 5DJMA 3UVHA 4TVEA 4K8MA 3UJ1A 3QFAC 4YAPA 3TKSA 3JCML 4ZXGA 4MPGA 5ECRB 5J4UA 2DIYA 1H75A 4PGTA 2RIIA 1BEDA 3F3QA 1KTEA 1JHBA 3CRUA 4KH7A 3FK8A 3GTUA 3D22A 4L8EA 1OC9A 4I6XA 3SBCA 3ZLPA 4IS0A 4ZL9A 3IC8A 1XWBA 4BL7B 5G5EA 4IKHA 5KN0A 1AQWA 2HI7A 3G9BA 4KW6A 2FWFA 4ZIJA 1HQOA 2C4JA 4G0KA 1EWXA 3NZNA 1BAYA 1TI1A 3H8QA 3MSZA 4ZB8A 3F9UA 1M99A 4IELA 4YKFA 1U88A 3HDCA 2MBTA 4TN8A 3VWUA 4EXJA 2EFHA 2L4CA 2O7KA 2I1UA 1YZXA 2X8HA 4ZBAA 4O5QA 4NXIA 2OE3A 4NV2A 4G10A 1QFNA 2H8LA 1FG4A 11GSA 1R4WA 2OADA 4K7OA 3WGDA 3O76A 1THOA 4K7NA 3ZVJD 1PX6A 2JZSA 4E8HA 3EWLA 1Z6MA 4D73A 5ECMB 2XBQA 3TJBA 2H1DA 2JU5A 4IQAA 1K0CA 1K3LA 1XWKA 3SWLA 4J57E 1RQMA 3RPNA 3TOTA 2WULA 4W66A 3P7XA 2ON7A 2OE0A 1TK8B 2FUG2 1FVKA 1TKDB 1EOHA 3R3EA 2B1LA 2B1KA 1VF4A 4K5SA 6GSTA 5DCHA 3DGQA 3TKQA 1S3DA 4BWSA 1FOHA 12GSA 2B7JA 4I2UA 1OC3A 4KSOA 5KN3A 2XPEA 4X4JA 3IA1A 3PGTA 3UEMA 4AJ7A 4ZBDA 1N2AA 4N30A 2DIZA 2DJ0A 3J7Yk 1OVNA 1SL1B 3D4TA 5CNWA 10GSA 5IMFA 2L4QA 4TRXA 5J9CA 2LUSA 2YCDA 4ICYA 4QL9A 2O5VA 2GSSA 1JZDA 2GS3A 1Z7PA 3GV1A 4V2NA 4LMVA 2GDRA 1HNCA 4AKIA 1SKWB 2YWMA 3VPQA 2IMIA 3K8NA 2FWGA 3LYKA 2B5XA 4LL4B 1V9WA 1SYXA 5ID2A 5A4WA 3TRPA 2QGVA 2G0FA 3TKRA 3GX8A 2V2GA 4Q5RA 1VF3A 4CY6A 3ME8A 3DVWA 2PUKC 1A0FA 4KCEA 5BRTA 3G7JA 5BMUB 1EV9A 1YY7A 1EEJA 4H86A 2H0HA 4MJCA 3KMOA 4OCFA 3TKSE 4BA7A 4Z2RA 3DVXA 1K3YA 3E0UA 1PKZA 2HFDA 4EL1A 2IMEA 1SVMA 2IL3A 3LW9A 4BVXA 3RPPA 3M0FA 4JU5A 3GKKA 2R2JA 5FT3A 1T3BA 3I43A 2YV9A 4V2LA 3GH9A 19GSA 1ABAA 2CVBA 3CRTA 1GUHA 3ZITA 2BTOT 3GSTA 4MPFA 1FOVA 1ERUA 5DJLA 1XIYA 1GSDA 2I81A 5DVBA 4ML1A 4MJEA 4AI6A 4GRFA 1J0FA 3L9VA 2HXKA 4F9ZA 3ZL5A 5FHIA 3WT1A 4Z2UA 4RI7A 2DMMA 3WGEA 3LFLA 3ME7A 1T4YA 3HXSA 4HQZA 1AXDA 4IN0A 2LS5A 1FB0A 1WPIA 2VL9A 1MD3A 2R4VA 5IIZA 3J7Yb 2B5EA 3F0IA 2CAQA 3IPZA 4TR1A 1K0OA 3IRAA 3MYDA 4BWQA 2C3TA 3IV4A 2YJ7A 3FMWA 4IP1A 2JSZA 5KOWA 3RBTA 4K2DA 2MYGA 2VCVA 3A3TA 2C0GA 5GZZB 2M80A 3DEXA 2LRCA 1JZRA 1Z6NA 2DKIA 4POBA 5D96A 3MAKA 3GH6A 4GSNA 4E68A 6GSVA 2B5YA 3P8WA 1ZOFA 3GTUB 1E6BA 2OA7A 4O5UA 2L5LA 3ED3A 4Z7XA 2MMZA 2MZCA 1R7HA 5IOXA 5IOWA 3HA9A 1YEPA 2L5OA 3F3RA 4IVFA 2VIMA 5EVOA 5HFGA 1YEXA 5HR3A 2V6KA 3W8JA 1OC8A 2GTUA 3L0HA 1XWCA 6GSUA 1ZYEA 3FR6A 5ECPB 3I9V2 3F8UA 3ZMLA 3C1SA 1ZYPA 2IWTA 5JCWA 4X1UA 4KSMA 4L5OA 2EIOA 3G7IA 4PXOA 2R37A 5C04A 1TU7A 5IMDA 3KXOA 1X9SB 2XHFA 4YQMA 4G01A 3HYPA 2YANA 5G1KA 1TK0B 4FYUA 4XCSA 2GZPA 1F3BA 3GA4A 5D9XA 1TDIA 1PN0A 2LRNA 2PN8A 4BVYA 4TR3A 3KH9A 3APOA 5IMZA 1U87A 4PQIA 1NSWA 1ZL9A 3F63A 3HD5A 1CQHA 4KUNA 5E4WA 4ZB9A 5G31A 1X5EA 4QL7A 1UC7A 3IC4A 4DSSA 1YKCA 2DJKA 4IJ3A 3HVSA 4OO5A 1A2JA 3APSA 3UAPA 1MDKA 2VM1A 2C0EA 4EVMA 1Z5YE 2REMA 3C1RA 2LV3A 1A2LA 1B9YC 4TKYA 3ZTLA 4YQVA 1TXXA 2C3NA 4EF0A 5B8BA 4L5LA 1AQXA 3M9JA 4EIPA 1VF1A 1DE1A 1X9MB 4JBBA 4YAVA 2H6YA 4QQ7A 4KDXA 3L9UA 3FR3A 1PL2A 5EL8A 4MA9A 3DKSA 4HZ2A 1BF5A 5HQPA 3UBLA 2ON5A 1LU4A 4O92A 1XFLA 2H66A 2IIYA 1Y1UA 3F4RA 3GNJA 1UN2A 4XS4B 3TKPA 4POKA 3ZIVA 5AIXA 4AJ6A 5GSTA 3UMAA 2VCZA 4GF0A 3TJJA 1SENA 2N5AA 1T00A 2TIRA 5ID2B 4IP6A 3LGCA 1ERWA 3VPTA 2NDOA 16GSA 3ZIJA 3HJMA 3QCPA 4G0LA 5CREA 2WZ9A 4GQCA 2FY6A 2DLXA 17GSA 2YV7A 3HZ8A 1TW9A 1SK0A 3TOUA 4KA0A 5F05A 1GSEA 4ZL7A 1I9DA 3CTFA 1WJKA 1QQ2A 3GURA 4XS1A 2D2ZA 3EMXA 3HMJG 3O3TA 2QSIA 2GZZA 4ACSA 4HEA2 1SD8A 4BVXB 3UBKA 2AJQB 2I4AA 1URMA 3M3MA 2A4VA 1J9BA 2DJ3A 1G6YA 5JWOB 1VF2A 3HKRA 3VI5A 2KUCA 2DC5A 5A34B 1E2YA 4LA1A 5DQSA 5G5FA 1EGOA 2QA2A 2IFQA 4NMUA 2HLSA 1ST9A 2AUVA 1K0NA 3H79A 2OBIA 5ELAA 4G9HA 1GSSA 1PRXA 3VK9A 2H71A 1Z9HA 1AAZA 1B4PA 2HT9A 4MNNA 5EY6A 5H5QA 1GTAA 1EEMA 1TOFA 3D5JA 3DD3A 2HRKB 4N0VA 3D0ZA 5CRWA 4IW9A 1PL1A 4J2FA 2CZ3A 1QXHA 3G7YA 4N10A 1XWAA 2F9SA 1RK4A 4K5RA 1M9AA 3BJ5A 4OFMA 4WBRD 2EIRA 2YJHA 4X43A 2C8UA 5DAKA 3A2XA 2DJJA 4OCEA 4HS1A 1IYHA 1GLQA 3I69A 4KB3A 4TR1B 2QKEA 3CSJA 5F0GA 22GSA 4XS6A 3CSHA 3TJKA 1KNGA 2RLIA 3HY2A 2H76A 3S9FA 4EC0A 5H5SA 3UIWA 4ZBBA 2H0GA 3MDKA 1V57A 4YQUA 1XVQA 4MZWA 1R5PA 2NTOA 1PD21 2A2RA 4KDYA 2FA8A 4F2IA 2PU9C 2V1MA 5CRDA 1A23A 1GRXA 6GSXA 2RM5A 4L0WA 4EIQA 4ISDA 3GUSA 3CXGA 4NHZA 2WCIA 3KCMA 2GSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO4 A;  5D73 A;  3RHB A;  3A2W A;  2V41 A;  1JFU A;  2L59 A;  3GKN A;  3IAS 2;  3C73 A;  3F4S A;  1XCC A;  3QFB C;  3H1N A;  5J5N A;  2JZR A;  4ZB6 A;  2ES7 A;  2AHE A;  2LNS A;  7GSS A;  1AC1 A;  1FO5 A;  3TJF A;  2JZT A;  3FR9 A;  2FWE A;  3IDV A;  2PBJ A;  3WGX A;  1T4Z A;  4HZ4 A;  5A4V A;  1QUW A;  1YQ1 A;  1SL0 B;  1PQN A;  3HJO A;  5GAN D;  5HR2 A;  1A0R P;  4NWY A;  1IYI A;  3F4T A;  1KEB A;  2C1Y A;  3IK9 A;  1SK1 A;  1GP1 A;  1OE8 A;  6GSS A;  1O85 A;  2WB9 A;  1XPV A;  2X8G A;  3KJY A;  1ERT A;  4KCA A;  1GUK A;  5IMV A;  4TXV A;  1UVZ A;  4G2E A;  2IJY A;  4JED A;  4WR5 A;  4OWY A;  2WGR A;  1G6W A;  2WDU A;  1A8Y A;  4Q5N A;  1C72 A;  3TRQ A;  4G0I A;  18GS A;  3TJG A;  4DSS B;  1MDI A;  3WYW A;  4ECI A;  2K6V A;  3ZFL A;  3CYN A;  4ZL8 A;  3W6G A;  1G0T A;  5L71 A;  4N0Z A;  1TRV A;  5IM9 A;  5HR1 A;  1EV4 A;  2GGT A;  3C7M A;  3Q18 A;  2X99 A;  3DIE A;  2H01 A;  2L6D A;  3KH7 A;  2CAI A;  1OYJ A;  1SYR A;  1XOA A;  1SKS B;  4G19 A;  4AGS A;  2CT6 A;  1T8E B;  4GST A;  4GTU A;  1OE7 A;  1ZZY A;  3KGK A;  1GTU A;  2HZE A;  1PN9 A;  1DUG A;  4KND A;  4ML6 A;  2R5G A;  2K8V A;  4CHS A;  4K0N A;  4IQ1 A;  2PWJ A;  1GL8 A;  2A2S A;  2VL2 C;  3I6A A;  2YZH A;  5A5K A;  2LTK A;  4DVC A;  1Y25 A;  3DYR A;  5A4U A;  1K0B A;  2NVL A;  1NM3 A;  3BD2 A;  1GH2 A;  2CZ2 A;  5IO2 A;  3HJP A;  4HDE A;  3MNG A;  4ECC A;  3PIN A;  5JWQ B;  3QD9 A;  4ECJ A;  2PGT A;  5D9T A;  2KP2 A;  1ZCP A;  4PNG A;  5B6M A;  1Z7R A;  2OE1 A;  3FEU A;  2WRT A;  1S3A A;  3FHK A;  1O6J A;  1O73 A;  1OKD A;  5AIS A;  2CV4 A;  1F9M A;  3GIX A;  5INY A;  5AGY A;  2GT5 A;  4MZB A;  2H1G A;  4K1F A;  1FHE A;  2MMO A;  4HI7 A;  4KAE A;  3KP8 A;  3H93 A;  1J08 A;  2LJK A;  4GWR A;  2O87 A;  1BJX A;  2F3M A;  2AB6 A;  8GSS A;  4E8E A;  1OC9 B;  3QDN A;  3ZZX A;  2LJA A;  2K8S A;  3KMN A;  4TR4 A;  3TKS C;  4KX4 A;  5E59 A;  5F8B A;  2RM6 A;  2C3Q A;  5DQY A;  5IPG A;  3ERW A;  4HOJ A;  3IHQ A;  5ECO B;  4LMW A;  4EO3 A;  5IQY A;  3L4N A;  2JAC A;  3VWX A;  1BQ7 A;  2M72 A;  4JR4 A;  5F07 A;  1A2M A;  2TRX A;  4I2T A;  5IPH A;  2UZ8 A;  2IFQ B;  4NHW A;  2CQ9 A;  4WF5 A;  1G7O A;  1YDK A;  1GNE A;  1M7T A;  2NBS A;  5EPF A;  1GLP A;  3GKX A;  1TK5 B;  4FH8 A;  3C71 A;  4TXO A;  1X0R A;  4LLR A;  4K9Z A;  1PA3 A;  1SL2 B;  4KDU A;  3LG6 A;  4NV5 A;  4IJI A;  2VD1 A;  3FY7 A;  1EP7 A;  2LST A;  1ZMA A;  2TRC P;  1WIK A;  2I3Y A;  1ZYQ B;  4D73 B;  5J41 A;  5AN1 A;  5B8A A;  1GSQ A;  2FA4 A;  2RUF A;  1GWC A;  4NPB A;  3U6V A;  4ULX A;  5G1L A;  2O89 A;  5LNK e;  4OMV A;  1U3A A;  3US3 A;  1XW5 A;  5C00 A;  4MJA A;  1G7E A;  2E2M A;  4PUR A;  2K18 A;  4RI6 A;  2H0I A;  4V1A g;  3LSZ A;  3QPM A;  4P3Y B;  1EOG A;  3E9J B;  4I8B A;  4YH2 A;  3EU3 A;  3TGZ A;  3PR8 A;  1XBS A;  4N11 A;  1EGR A;  2DJ2 A;  5D9V A;  2VCQ A;  1DSB A;  2H1A A;  2JL4 A;  3WD6 A;  2ZNM A;  3Q19 A;  3VUR A;  3D6I A;  4DSR A;  2P31 A;  1GSU A;  1V58 A;  1T1V A;  4HJ2 A;  2HZF A;  2GVP A;  2YNX A;  2VL2 A;  1XZO A;  3U5R E;  1F3A A;  1TI3 A;  1WP0 A;  3FYG A;  3HHV A;  1GTI A;  3A5W A;  4O32 A;  5KN2 A;  4WF4 A;  2VD0 A;  4F82 A;  3VI7 A;  4MF7 A;  4HJM A;  4WET A;  4IGJ A;  1B48 A;  2E0Q A;  3FZ9 A;  3DRN A;  1QGV A;  4IBP A;  2JSY A;  4FQU A;  2IN3 A;  3P2A A;  2HRN A;  1BG5 A;  5DAL A;  3IXR A;  2WJU A;  3EC3 A;  1ERV A;  4JRR A;  3HVX A;  1DBY A;  1XXU A;  2KOK A;  1AQV A;  3DWV A;  1I5G A;  4IHU A;  2LQO A;  2MMN A;  5ABR A;  5B7C A;  1V98 A;  2VL3 A;  3UOM A;  3HVV A;  2FHE A;  3E3E A;  1Y6E A;  1X9W B;  3FZA A;  2CVK A;  4MP4 A;  4LL1 B;  1X5D A;  3RDW A;  2N5B A;  4TR0 A;  2G2Q A;  5IMA A;  4RUV A;  1XW6 A;  4EE0 A;  3QAG A;  3OR5 A;  3GFK A;  5GSS A;  4PUF C;  1V2A A;  4CW9 A;  1LBK A;  3IBH A;  1JZW A;  1YF1 A;  5ELG A;  3ZRD A;  3KTB A;  5JWR B;  4DSQ A;  2X64 A;  1Z3E A;  4ID0 A;  3VWV A;  4MJB A;  1MDJ A;  3KZQ A;  2IMF A;  5CAX A;  1XVW A;  20GS A;  2L6C A;  3R2Q A;  2HZE B;  3GMF A;  4MLY A;  1A8L A;  1H4O A;  2HE3 A;  3TCO A;  3D21 A;  1JZO A;  2AYT A;  5ECL B;  1SKR B;  4POM A;  3QAW A;  3N9J A;  5AIV A;  1B8X A;  2XBI A;  5CYY A;  3H4K A;  2Z9S A;  4F0B A;  4MK3 A;  2VAF A;  2EC4 A;  5ENU A;  2FLS A;  1RW1 A;  5H5R A;  4J56 E;  4JZQ A;  4V1A p;  1FB6 A;  6GSW A;  1MD4 A;  4XRD A;  3KD0 A;  2HQT A;  5JCG A;  3IK7 A;  2GST A;  2VCX A;  3L78 A;  2B3S A;  3AY8 A;  4WEY A;  2HSM A;  4MH2 A;  3KIJ A;  5HR0 A;  2F8F A;  3MWH A;  1TRW A;  1ACV A;  3FRC A;  1LJR A;  2ALB A;  2LKU A;  2F51 A;  1WRY A;  2FNO A;  2YPM A;  4FO5 A;  1HYU A;  1CQG A;  3ZVJ A;  4F03 A;  3ZRE A;  2FCH A;  3LOR A;  2GT6 A;  1K0D A;  1VRS D;  3EMP A;  2IMK A;  2LQQ A;  5FWG A;  3F6F A;  4MF5 A;  2VLU A;  3LXZ A;  2QC7 A;  1YJ6 A;  2PVQ A;  4EDY A;  1EP8 A;  4TW5 A;  2H74 A;  3GL5 A;  5G30 A;  3Q6O A;  3M1G A;  4BPY A;  4O7H A;  3O6T A;  3FZ5 A;  1M2A A;  4PTS A;  2C0F A;  5GAP D;  5ECN B;  1T7P B;  2JAD A;  3TRX A;  2C80 A;  3GSS A;  5F06 A;  1PX7 A;  1WOU A;  5DBQ A;  5J9B A;  2H73 A;  1AW9 A;  4MDC A;  5D8I A;  1F2E A;  5B6N A;  4V2M A;  5HFK A;  2MBS A;  2HSH A;  3LWA A;  4Q5Q A;  1K3O A;  1BX9 A;  4MMM A;  1GUL A;  3V1W A;  2YP6 A;  2O85 A;  1XWG A;  4TXO B;  2YOI A;  2H75 A;  1A24 A;  1HNA A;  2CX4 A;  2OJL A;  3UL3 A;  1TRU A;  2HYX A;  1THX A;  4ECB A;  3FZ4 A;  1M9B A;  4PX1 A;  1SJZ A;  1TTZ A;  4XS4 A;  4BVY B;  2GQL A;  1V40 A;  2YN1 A;  3VWW A;  2FWH A;  3P90 A;  4I5Q A;  1TJD A;  4HQS A;  2OBK A;  2C0D A;  5ECI B;  1DE2 A;  4WXT A;  4PNF A;  2KHP A;  3EUR A;  2F8A A;  2RUE A;  1WMJ A;  2LEG A;  3VFI A;  1USB A;  1O7U A;  4KGI A;  2ZCT A;  4ILF A;  3PPU A;  2O8V B;  4K6X A;  1S3C A;  5LCZ A;  3EYT A;  4OD7 A;  5COH A;  2E2G A;  2DJ1 A;  3IOS A;  14GS A;  3BCI A;  3W8S A;  1N8J A;  2WS2 A;  1XW9 A;  1U6T A;  1NW2 A;  1NHO A;  2LNT A;  1FVJ A;  3IR4 A;  2GZY A;  1K0M A;  2GSR A;  3RAZ A;  1ILO A;  3F6D A;  2HSY A;  2AAW A;  3NOF A;  5J3R A;  2LJR A;  2VUP A;  4BL7 A;  3EE2 A;  3CTG A;  5CRH A;  1MEK A;  2HSN B;  5LD0 A;  4NAX A;  4K0G A;  2H6Z A;  4GSS A;  5D93 A;  4GQF A;  2OKA A;  1W89 A;  4DEJ A;  1JLW A;  4GCI A;  2DBC A;  4X0X A;  4EDZ A;  4K7I A;  4Q5F A;  4FYC A;  1MTC A;  5IO0 A;  2V32 A;  6GSY A;  3TB2 A;  4XTS A;  2CA8 A;  2K9F A;  5HFI A;  2PER A;  3FKF A;  1OKT A;  2XC2 A;  3DXB A;  2HRK A;  5DCG A;  2VCT A;  2H19 A;  4EUY A;  3BBY A;  4MAB A;  2J23 A;  3UVT A;  2I9H A;  5ECH B;  2YWI A;  1BYE A;  3QMX A;  5DAL B;  4F0C A;  4USS A;  2J9H A;  4WBJ A;  5D9W A;  1SJ6 A;  4PQ1 A;  2PVO C;  2EIQ A;  2WFC A;  1FAA A;  2B7K A;  3KEB A;  2KP1 A;  4KF9 A;  3HCZ A;  1SD9 A;  1SK2 A;  2B6M A;  4OFT A;  3N5O A;  3C8E A;  3ERG A;  2FGX A;  2GQK A;  3IE3 A;  2XPD A;  3Q74 A;  2H30 A;  1Q98 A;  3LJR A;  2YZU A;  2FD3 A;  5CO3 A;  4AJ8 A;  4GXZ A;  3CMI A;  4AF2 A;  3ISO A;  4JE1 A;  1JLV A;  4CDO A;  2P5Q A;  2PPT A;  1W4V A;  3DML A;  1PKW A;  3CSI A;  1PGT A;  5DDL A;  1ML6 A;  1B4Q A;  1GTB A;  1GUM A;  1O8X A;  2R6K A;  4OFN A;  5ECK B;  3APQ A;  3RHC A;  3LQ7 A;  2NPB A;  4MZC A;  1GSY A;  1KBN A;  2R3X A;  4HU9 A;  2H6X A;  3QR6 A;  3GX0 A;  3ZFB A;  2LRT A;  1X5C A;  4PQH A;  2HNL A;  3GKM A;  1ZGN A;  3TDG A;  1HNB A;  3GYK A;  5CP1 A;  1SU9 A;  1PSQ A;  2L57 A;  2DSA A;  1WWJ A;  4ZIL A;  3LYP A;  4PUA A;  1HD2 A;  9GSS A;  2H70 A;  5DAK B;  2BMX A;  2HSM B;  1YF0 A;  3ZYW A;  1UA5 A;  2X8C A;  2AV4 A;  3QOU A;  5KEJ A;  2KLX A;  2YWN A;  2ZUP A;  1SJI A;  3LEF A;  1YKA A;  4XIH A;  4TOP A;  1GSF A;  1TU8 A;  3KP9 A;  1Q4J A;  2N5F A;  5KN1 A;  2YWO A;  4HUA A;  1TRS A;  5ECQ B;  3VLN A;  2H72 A;  3CBU A;  2VLV A;  4I97 A;  5IMC A;  4GLT A;  5BMU A;  1QK8 A;  3IAM 2;  3M9K A;  4EKZ A;  13GS A;  3KTL A;  2VOC A;  3HZ4 A;  3A2V A;  1O8W A;  3EU4 A;  2GLR A;  3QAV A;  3GL3 A;  1R5A A;  3WT2 A;  3KM6 A;  2MMA A;  1XOB A;  1O81 A;  2VCW A;  2BJX A;  1FW1 A;  2IPA A;  1OAZ A;  3BOA A;  1EZK A;  2IMD A;  3EIN A;  1ON4 A;  1AUC A;  1PMT A;  3LXT A;  3M8N A;  3FW2 A;  4XHM A;  3ZMK A;  4WR4 A;  1M2B A;  4XRA A;  3TUE A;  1U3I A;  2H1B A;  3BCK A;  5JCU A;  3PH9 A;  4POL A;  3ERF A;  3EVI A;  4FYB A;  4O5R A;  2DML A;  4MF6 A;  1M2D A;  1B9X C;  4MH3 A;  1F6M C;  2P0G A;  5ECS A;  5CRG A;  3GN3 A;  2M46 A;  2PMT A;  3UAR A;  4MCU A;  1R26 A;  2VM2 A;  4JR6 A;  2GQM A;  1WE0 A;  1M0U A;  4FIW A;  2HRA A;  3GRX A;  2OAC A;  3L9S A;  4RQR A;  4HU7 A;  1GNW A;  2P5R A;  2CVD A;  3NIV A;  4KE3 A;  2E7P A;  2V6O A;  3GHA A;  5G2Z A;  1K0A A;  3D4M A;  2HRF A;  4WKW A;  1VGL A;  4RQX A;  1F37 A;  2VO4 A;  1AIU A;  1TP9 A;  1NHY A;  2VLT A;  1QMV A;  2CX3 A;  4L0U A;  5DJM A;  3UVH A;  4TVE A;  4K8M A;  3UJ1 A;  3QFA C;  4YAP A;  3TKS A;  3JCM L;  4ZXG A;  4MPG A;  5ECR B;  5J4U A;  2DIY A;  1H75 A;  4PGT A;  2RII A;  1BED A;  3F3Q A;  1KTE A;  1JHB A;  3CRU A;  4KH7 A;  3FK8 A;  3GTU A;  3D22 A;  4L8E A;  1OC9 A;  4I6X A;  3SBC A;  3ZLP A;  4IS0 A;  4ZL9 A;  3IC8 A;  1XWB A;  4BL7 B;  5G5E A;  4IKH A;  5KN0 A;  1AQW A;  2HI7 A;  3G9B A;  4KW6 A;  2FWF A;  4ZIJ A;  1HQO A;  2C4J A;  4G0K A;  1EWX A;  3NZN A;  1BAY A;  1TI1 A;  3H8Q A;  3MSZ A;  4ZB8 A;  3F9U A;  1M99 A;  4IEL A;  1U88 A;  3HDC A;  2MBT A;  4TN8 A;  3VWU A;  4EXJ A;  2L4C A;  2O7K A;  2I1U A;  1YZX A;  2X8H A;  4ZBA A;  4NXI A;  2OE3 A;  4NV2 A;  4G10 A;  1QFN A;  2H8L A;  1FG4 A;  11GS A;  1R4W A;  2OAD A;  4K7O A;  3WGD A;  3O76 A;  1THO A;  4K7N A;  3ZVJ D;  1PX6 A;  2JZS A;  4E8H A;  3EWL A;  1Z6M A;  4D73 A;  5ECM B;  2XBQ A;  3TJB A;  2H1D A;  2JU5 A;  4IQA A;  1K0C A;  1K3L A;  1XWK A;  3SWL A;  4J57 E;  1RQM A;  3RPN A;  3TOT A;  2WUL A;  1TK8 B;  3P7X A;  2ON7 A;  2OE0 A;  2FUG 2;  1FVK A;  1TKD B;  1EOH A;  3R3E A;  2B1L A;  2B1K A;  1VF4 A;  6GST A;  5DCH A;  3DGQ A;  3TKQ A;  1S3D A;  4BWS A;  12GS A;  2B7J A;  4I2U A;  1OC3 A;  4KSO A;  5KN3 A;  2XPE A;  3IA1 A;  3PGT A;  3UEM A;  4AJ7 A;  4ZBD A;  1N2A A;  4N30 A;  2DIZ A;  2DJ0 A;  3J7Y k;  1OVN A;  1SL1 B;  3D4T A;  5CNW A;  10GS A;  5IMF A;  2L4Q A;  4TRX A;  5J9C A;  2LUS A;  2YCD A;  4QL9 A;  2GSS A;  1JZD A;  2GS3 A;  1Z7P A;  3GV1 A;  4V2N A;  4LMV A;  2GDR A;  1HNC A;  1SKW B;  2YWM A;  3VPQ A;  2IMI A;  3K8N A;  2FWG A;  3LYK A;  2B5X A;  4LL4 B;  1V9W A;  1SYX A;  5ID2 A;  5A4W A;  3TRP A;  2QGV A;  2G0F A;  3TKR A;  3GX8 A;  2V2G A;  4Q5R A;  1VF3 A;  3ME8 A;  3DVW A;  2PUK C;  1A0F A;  4KCE A;  3G7J A;  1EV9 A;  1YY7 A;  1EEJ A;  4H86 A;  2H0H A;  4MJC A;  3KMO A;  4OCF A;  3TKS E;  4BA7 A;  3DVX A;  1K3Y A;  3E0U A;  1PKZ A;  2HFD A;  4EL1 A;  2IME A;  2IL3 A;  4BVX A;  3RPP A;  3M0F A;  4JU5 A;  3GKK A;  2R2J A;  5FT3 A;  1T3B A;  3I43 A;  2YV9 A;  4V2L A;  3GH9 A;  19GS A;  1ABA A;  2CVB A;  3CRT A;  1GUH A;  3ZIT A;  2BTO T;  3GST A;  4MPF A;  1FOV A;  1ERU A;  5DJL A;  1XIY A;  1GSD A;  2I81 A;  5DVB A;  4ML1 A;  4MJE A;  4GRF A;  1J0F A;  3L9V A;  2HXK A;  4F9Z A;  3ZL5 A;  5FHI A;  3WT1 A;  4RI7 A;  2DMM A;  3WGE A;  3LFL A;  3ME7 A;  1T4Y A;  3HXS A;  4HQZ A;  1AXD A;  4IN0 A;  2LS5 A;  1FB0 A;  1WPI A;  2VL9 A;  1MD3 A;  2R4V A;  5IIZ A;  3J7Y b;  2B5E A;  3F0I A;  2CAQ A;  3IPZ A;  4TR1 A;  1K0O A;  3IRA A;  4BWQ A;  2C3T A;  3IV4 A;  2YJ7 A;  4IP1 A;  2JSZ A;  3RBT A;  4K2D A;  2MYG A;  2VCV A;  3A3T A;  2C0G A;  5GZZ B;  2M80 A;  3DEX A;  2LRC A;  1JZR A;  1Z6N A;  4POB A;  5D96 A;  3MAK A;  3GH6 A;  4GSN A;  6GSV A;  2B5Y A;  3P8W A;  1ZOF A;  3GTU B;  1E6B A;  2OA7 A;  2L5L A;  3ED3 A;  4Z7X A;  2MMZ A;  2MZC A;  1R7H A;  5IOX A;  5IOW A;  3HA9 A;  1YEP A;  2L5O A;  3F3R A;  4IVF A;  2VIM A;  5EVO A;  5HFG A;  1YEX A;  5HR3 A;  2V6K A;  3W8J A;  1OC8 A;  2GTU A;  3L0H A;  1XWC A;  6GSU A;  1ZYE A;  3FR6 A;  5ECP B;  3I9V 2;  3F8U A;  3ZML A;  3C1S A;  2IWT A;  5JCW A;  4X1U A;  4KSM A;  4L5O A;  2EIO A;  3G7I A;  4PXO A;  2R37 A;  5C04 A;  1TU7 A;  5IMD A;  3KXO A;  1X9S B;  2XHF A;  4YQM A;  3HYP A;  2YAN A;  5G1K A;  1TK0 B;  4FYU A;  4XCS A;  2GZP A;  1F3B A;  3GA4 A;  5D9X A;  1TDI A;  2LRN A;  2PN8 A;  4BVY A;  4TR3 A;  3KH9 A;  3APO A;  5IMZ A;  1U87 A;  4PQI A;  1NSW A;  1ZL9 A;  3F63 A;  3HD5 A;  1CQH A;  4KUN A;  5E4W A;  4ZB9 A;  5G31 A;  1X5E A;  4QL7 A;  1UC7 A;  3IC4 A;  4DSS A;  1YKC A;  2DJK A;  4IJ3 A;  3HVS A;  4OO5 A;  1A2J A;  3APS A;  3UAP A;  1MDK A;  2VM1 A;  2C0E A;  4EVM A;  1Z5Y E;  2REM A;  3C1R A;  2LV3 A;  1A2L A;  1B9Y C;  4TKY A;  3ZTL A;  4YQV A;  1TXX A;  2C3N A;  4EF0 A;  5B8B A;  4L5L A;  1AQX A;  3M9J A;  1VF1 A;  1DE1 A;  1X9M B;  4JBB A;  4YAV A;  2H6Y A;  4QQ7 A;  4KDX A;  3L9U A;  3FR3 A;  1PL2 A;  5EL8 A;  4MA9 A;  3DKS A;  4HZ2 A;  5HQP A;  3UBL A;  2ON5 A;  1LU4 A;  4O92 A;  1XFL A;  2H66 A;  2IIY A;  3F4R A;  3GNJ A;  1UN2 A;  4XS4 B;  3TKP A;  4POK A;  3ZIV A;  5AIX A;  4AJ6 A;  5GST A;  3UMA A;  2VCZ A;  4GF0 A;  3TJJ A;  1SEN A;  2N5A A;  1T00 A;  2TIR A;  5ID2 B;  4IP6 A;  3LGC A;  1ERW A;  3VPT A;  2NDO A;  16GS A;  3ZIJ A;  3HJM A;  3QCP A;  4G0L A;  5CRE A;  2WZ9 A;  4GQC A;  2FY6 A;  2DLX A;  17GS A;  2YV7 A;  3HZ8 A;  1TW9 A;  1SK0 A;  3TOU A;  4KA0 A;  5F05 A;  1GSE A;  4ZL7 A;  1I9D A;  3CTF A;  1WJK A;  1QQ2 A;  3GUR A;  4XS1 A;  2D2Z A;  3EMX A;  3O3T A;  2QSI A;  2GZZ A;  4ACS A;  4HEA 2;  1SD8 A;  4BVX B;  3UBK A;  2AJQ B;  2I4A A;  1URM A;  3M3M A;  2A4V A;  1J9B A;  2DJ3 A;  1G6Y A;  5JWO B;  1VF2 A;  3HKR A;  3VI5 A;  2KUC A;  2DC5 A;  1E2Y A;  4LA1 A;  5DQS A;  5G5F A;  1EGO A;  2IFQ A;  4NMU A;  2HLS A;  1ST9 A;  2AUV A;  1K0N A;  3H79 A;  2OBI A;  5ELA A;  4G9H A;  1GSS A;  1PRX A;  3VK9 A;  2H71 A;  1Z9H A;  1AAZ A;  1B4P A;  2HT9 A;  5H5Q A;  5EY6 A;  1GTA A;  1EEM A;  1TOF A;  3D5J A;  3DD3 A;  2HRK B;  4N0V A;  3D0Z A;  5CRW A;  4IW9 A;  1PL1 A;  4J2F A;  2CZ3 A;  1QXH A;  3G7Y A;  4N10 A;  1XWA A;  2F9S A;  1RK4 A;  1M9A A;  3BJ5 A;  4OFM A;  4WBR D;  2EIR A;  2YJH A;  4X43 A;  2C8U A;  5DAK A;  3A2X A;  2DJJ A;  4OCE A;  4HS1 A;  1IYH A;  1GLQ A;  3I69 A;  4KB3 A;  4TR1 B;  2QKE A;  3CSJ A;  5F0G A;  22GS A;  4XS6 A;  3CSH A;  3TJK A;  1KNG A;  2RLI A;  3HY2 A;  2H76 A;  3S9F A;  4EC0 A;  5H5S A;  3UIW A;  4ZBB A;  2H0G A;  3MDK A;  1V57 A;  4YQU A;  1XVQ A;  4MZW A;  1R5P A;  2NTO A;  1PD2 1;  2A2R A;  4KDY A;  2FA8 A;  4F2I A;  2PU9 C;  2V1M A;  5CRD A;  1A23 A;  1GRX A;  6GSX A;  2RM5 A;  4L0W A;  4ISD A;  3GUS A;  3CXG A;  4NHZ A;  2WCI A;  3KCM A;  2GSQ A; 
#chains in the Genus database with same CATH topology
 4OO4 A;  5D73 A;  3RHB A;  3A2W A;  2V41 A;  1JFU A;  2L59 A;  3GKN A;  3IAS 2;  3C73 A;  3F4S A;  1XCC A;  3QFB C;  4YKG A;  3H1N A;  5J5N A;  4Z2T A;  5J4V A;  2JZR A;  4ZB6 A;  2ES7 A;  2AHE A;  2LNS A;  4BIK A;  7GSS A;  1AC1 A;  1FO5 A;  3TJF A;  2JZT A;  3FR9 A;  2FWE A;  3IDV A;  2PBJ A;  3EPT A;  1T4Z A;  4HZ4 A;  3WGX A;  5A4V A;  1QUW A;  1YQ1 A;  1SL0 B;  1PQN A;  3HJO A;  5GAN D;  5HR2 A;  1A0R P;  4NWY A;  1IYI A;  3F4T A;  1KEB A;  2C1Y A;  3IK9 A;  1SK1 A;  1GP1 A;  2WW1 A;  1OE8 A;  6GSS A;  1O85 A;  2WB9 A;  1XPV A;  2X8G A;  3KJY A;  1ERT A;  4KCA A;  1GUK A;  5IMV A;  4TXV A;  1UVZ A;  4G2E A;  2IJY A;  4JED A;  4WR5 A;  4OWY A;  2WGR A;  5A5H A;  1G6W A;  2WDU A;  1A8Y A;  1I1I P;  4Q5N A;  1C72 A;  3TRQ A;  4G0I A;  18GS A;  3TJG A;  4DSS B;  1MDI A;  3WYW A;  4ECI A;  2K6V A;  3ZFL A;  3CYN A;  2R0C A;  4ZL8 A;  3W6G A;  1G0T A;  5L71 A;  4N0Z A;  1TRV A;  5IM9 A;  5HR1 A;  1EV4 A;  2GGT A;  3C7M A;  3Q18 A;  2X99 A;  3DIE A;  2H01 A;  2L6D A;  3KH7 A;  2CAI A;  2H1L A;  1OYJ A;  1SYR A;  1XOA A;  1SKS B;  4G19 A;  4AGS A;  2CT6 A;  1T8E B;  4GDF A;  4GST A;  4GTU A;  1OE7 A;  1ZZY A;  3KGK A;  1GTU A;  2HZE A;  1PN9 A;  1DUG A;  4KND A;  4ML6 A;  2R5G A;  2K8V A;  4CHS A;  4K0N A;  4IQ1 A;  2PWJ A;  1GL8 A;  2A2S A;  2OT3 A;  2VL2 C;  3I6A A;  2YZH A;  5A5K A;  2LTK A;  4DVC A;  1Y25 A;  1TXU A;  3DYR A;  5A4U A;  1K0B A;  2NVL A;  1NM3 A;  3BD2 A;  1GH2 A;  2CZ2 A;  1YVL A;  4AKG A;  5IO2 A;  3HJP A;  4HDE A;  3MNG A;  4ECC A;  3PIN A;  5JWQ B;  3QD9 A;  4ECJ A;  2PGT A;  5D9T A;  2KP2 A;  1ZCP A;  4PNG A;  5B6M A;  1Z7R A;  2UV8 G;  2OE1 A;  3FEU A;  2WRT A;  1S3A A;  3FHK A;  1O6J A;  1O73 A;  1OKD A;  5AIS A;  2CV4 A;  1F9M A;  3GIX A;  5INY A;  5AGY A;  2GT5 A;  4MZB A;  2H1G A;  1FHE A;  2MMO A;  4HI7 A;  4K1F A;  2X49 A;  4KAE A;  3KP8 A;  3H93 A;  1J08 A;  2LJK A;  4GWR A;  2O87 A;  1BJX A;  2F3M A;  2AB6 A;  8GSS A;  4E8E A;  1OC9 B;  3QDN A;  3ZZX A;  2LJA A;  2K8S A;  3KMN A;  4TR4 A;  3TKS C;  4KX4 A;  5E59 A;  5F8B A;  2RM6 A;  2C3Q A;  5DQY A;  5IPG A;  1S4B P;  3ERW A;  4HOJ A;  3IHQ A;  5ECO B;  4LMW A;  4EO3 A;  5IQY A;  3L4N A;  2JAC A;  3VWX A;  1BQ7 A;  2M72 A;  4JR4 A;  5F07 A;  1A2M A;  2TRX A;  4I2T A;  5IPH A;  2UZ8 A;  2IFQ B;  4NHW A;  2CQ9 A;  4WF5 A;  1G7O A;  1YDK A;  1GNE A;  4FXY P;  1M7T A;  2NBS A;  5EPF A;  1GLP A;  3GKX A;  1TK5 B;  4FH8 A;  3C71 A;  4TXO A;  1X0R A;  4LLR A;  4K9Z A;  1PA3 A;  1SL2 B;  4KDU A;  3LG6 A;  4NV5 A;  4IJI A;  2VD1 A;  3FY7 A;  1EP7 A;  2LST A;  1ZMA A;  2TRC P;  1WIK A;  2I3Y A;  1ZYQ B;  4D73 B;  5J41 A;  5AN1 A;  2R0P A;  5B8A A;  1GSQ A;  2FA4 A;  2WVX B;  5A1N A;  2RUF A;  1GWC A;  4NPB A;  3U6V A;  4ULX A;  5G1L A;  2O89 A;  5LNK e;  4OMV A;  1U3A A;  3US3 A;  1XW5 A;  5C00 A;  4MJA A;  1G7E A;  2E2M A;  4PUR A;  2K18 A;  4RI6 A;  2H0I A;  4V1A g;  3LSZ A;  3QPM A;  4P3Y B;  1EOG A;  3E9J B;  4I8B A;  4YH2 A;  3EU3 A;  3TGZ A;  3PR8 A;  1XBS A;  4N11 A;  1EGR A;  2DJ2 A;  5D9V A;  2VCQ A;  1DSB A;  2H1A A;  2JL4 A;  3WD6 A;  2ZNM A;  3Q19 A;  3VUR A;  3D6I A;  4DSR A;  2P31 A;  1GSU A;  2HSN A;  3CWG A;  1V58 A;  1T1V A;  4HJ2 A;  3A5I A;  2HZF A;  2GVP A;  2YNX A;  2VL2 A;  1XZO A;  3U5R E;  1WP0 A;  1F3A A;  1TI3 A;  3FYG A;  3HHV A;  1GTI A;  3A5W A;  2A4H A;  4O32 A;  5KN2 A;  4WF4 A;  2VD0 A;  4F82 A;  3VI7 A;  5KOX A;  4MF7 A;  4HJM A;  4WET A;  4IGJ A;  1B48 A;  2E0Q A;  3FZ9 A;  3DRN A;  1QGV A;  4IBP A;  2JSY A;  4FQU A;  2IN3 A;  3P2A A;  2HRN A;  1BG5 A;  5DAL A;  3IXR A;  2WJU A;  3EC3 A;  1ERV A;  4JRR A;  3HVX A;  1DBY A;  1XXU A;  2KOK A;  1AQV A;  3DWV A;  1I5G A;  4IHU A;  2LQO A;  2MMN A;  5ABR A;  5B7C A;  1V98 A;  2VL3 A;  3UOM A;  3HVV A;  2FHE A;  3E3E A;  1Y6E A;  1X9W B;  3FZA A;  2CVK A;  1M3I A;  4MP4 A;  4LL1 B;  1X5D A;  3RDW A;  2N5B A;  4TR0 A;  2G2Q A;  5IMA A;  4RUV A;  1XW6 A;  4EE0 A;  3QAG A;  3OR5 A;  3GFK A;  5GSS A;  4PUF C;  1V2A A;  4CW9 A;  1LBK A;  1ZYN A;  3IBH A;  1JZW A;  1YF1 A;  5ELG A;  3ZRD A;  3KTB A;  5JWR B;  1S3R A;  4DSQ A;  2X64 A;  1Z3E A;  4ID0 A;  3VWV A;  4MJB A;  1MDJ A;  3KZQ A;  2IMF A;  5CAX A;  1XVW A;  20GS A;  2L6C A;  3R2Q A;  2HZE B;  3GMF A;  4MLY A;  1A8L A;  1H4O A;  2HE3 A;  3TCO A;  3D21 A;  1JZO A;  2AYT A;  5ECL B;  1SKR B;  4POM A;  3QAW A;  3N9J A;  5AIV A;  1B8X A;  2XBI A;  5CYY A;  3H4K A;  2Z9S A;  4F0B A;  4MK3 A;  2VAF A;  2EC4 A;  5ENU A;  2FLS A;  1RW1 A;  5H5R A;  4J56 E;  4JZQ A;  4V1A p;  1FB6 A;  6GSW A;  1MD4 A;  4XRD A;  3KD0 A;  2HQT A;  5JCG A;  3IK7 A;  2GST A;  2VCX A;  3L78 A;  2B3S A;  3AY8 A;  4WEY A;  2HSM A;  4MH2 A;  4AKX B;  3KIJ A;  5HR0 A;  2F8F A;  3MWH A;  2QA1 A;  1TRW A;  1ACV A;  3FRC A;  1LJR A;  2ALB A;  2LKU A;  2F51 A;  1WRY A;  2FNO A;  2YPM A;  4FO5 A;  1HYU A;  2R0G A;  1CQG A;  3ZVJ A;  4F03 A;  3ZRE A;  2FCH A;  3LOR A;  2GT6 A;  1K0D A;  1VRS D;  3EMP A;  2VKZ G;  2IMK A;  2LQQ A;  5FWG A;  3F6F A;  2A2P A;  4MF5 A;  2EFC A;  2VLU A;  3LXZ A;  2QC7 A;  1YJ6 A;  2PVQ A;  4EDY A;  1EP8 A;  4TW5 A;  2H74 A;  3GL5 A;  5G30 A;  3Q6O A;  3M1G A;  4BPY A;  4O7H A;  3O6T A;  3FZ5 A;  1M2A A;  4PTS A;  2C0F A;  5GAP D;  5ECN B;  1T7P B;  2WW3 A;  2JAD A;  3TRX A;  2C80 A;  3GSS A;  5F06 A;  5J40 A;  1PX7 A;  1WOU A;  5DBQ A;  5J9B A;  2H73 A;  1AW9 A;  4MDC A;  5D8I A;  1F2E A;  5B6N A;  4V2M A;  5HFK A;  2MBS A;  2HSH A;  3LWA A;  4Q5Q A;  1K3O A;  1BX9 A;  4MMM A;  1GUL A;  3V1W A;  2YP6 A;  2O85 A;  1XWG A;  4TXO B;  2YOI A;  2H75 A;  1A24 A;  1HNA A;  1N25 A;  2DKH A;  2CX4 A;  2OJL A;  3UL3 A;  1TRU A;  2HYX A;  1THX A;  4ECB A;  3FZ4 A;  1M9B A;  4PX1 A;  1SJZ A;  1TTZ A;  4XS4 A;  2X4A A;  4BVY B;  2EFD A;  1V40 A;  2GQL A;  5A1N B;  2YN1 A;  3VWW A;  2FWH A;  4K2X A;  3P90 A;  4I5Q A;  1TJD A;  4HQS A;  2OBK A;  2C0D A;  5ECI B;  1DE2 A;  4WXT A;  4PNF A;  2KHP A;  3EUR A;  2F8A A;  2RUE A;  1WMJ A;  2LEG A;  3VFI A;  1USB A;  1O7U A;  4KGI A;  2ZCT A;  4ILF A;  3PPU A;  2O8V B;  4K6X A;  1S3C A;  5LCZ A;  3EYT A;  4OD7 A;  5COH A;  2E2G A;  2DJ1 A;  3IOS A;  14GS A;  3BCI A;  3W8S A;  1N8J A;  2WS2 A;  1XW9 A;  1U6T A;  1NW2 A;  1NHO A;  2LNT A;  1FVJ A;  3IR4 A;  2GZY A;  1K0M A;  2GSR A;  3RAZ A;  1ILO A;  3F6D A;  2HSY A;  2AAW A;  3NOF A;  5J3R A;  1SVO A;  2LJR A;  2VUP A;  4BL7 A;  3EE2 A;  3CTG A;  5CRH A;  1MEK A;  2HSN B;  5LD0 A;  4NAX A;  4K0G A;  2H6Z A;  4GSS A;  5D93 A;  5A34 A;  4GQF A;  2OKA A;  1W89 A;  4DEJ A;  1JLW A;  4GCI A;  2DBC A;  4X0X A;  4EDZ A;  4K7I A;  4Q5F A;  4FYC A;  1MTC A;  3TU3 B;  5IO0 A;  2V32 A;  6GSY A;  3TB2 A;  4XTS A;  2CA8 A;  2K9F A;  5HFI A;  2PER A;  3FKF A;  1OKT A;  2XC2 A;  3DXB A;  2HRK A;  4QMK A;  5DCG A;  2VCT A;  2H19 A;  4EUY A;  3BBY A;  4MAB A;  2J23 A;  3UVT A;  2EFE A;  2I9H A;  5ECH B;  2YWI A;  1BYE A;  3QMX A;  5DAL B;  4F0C A;  4USS A;  2J9H A;  4WBJ A;  5D9W A;  1SJ6 A;  4PQ1 A;  2PVO C;  2EIQ A;  2WFC A;  1FAA A;  2B7K A;  3KEB A;  2KP1 A;  4KF9 A;  3HCZ A;  1SD9 A;  1SK2 A;  2B6M A;  4OFT A;  3N5O A;  3C8E A;  3ERG A;  2FGX A;  2GQK A;  3IE3 A;  2XPD A;  3Q74 A;  2H30 A;  1Q98 A;  3LJR A;  2YZU A;  2FD3 A;  5CO3 A;  4ZB7 A;  4AJ8 A;  4GXZ A;  3CMI A;  4AF2 A;  3ISO A;  4JE1 A;  1JLV A;  5J47 A;  4CDO A;  2P5Q A;  2PPT A;  1W4V A;  3DML A;  1PKW A;  3CSI A;  1PGT A;  5DDL A;  1ML6 A;  1B4Q A;  1GTB A;  1GUM A;  1O8X A;  2R6K A;  4OFN A;  5ECK B;  3APQ A;  3RHC A;  3LQ7 A;  2NPB A;  4MZC A;  1GSY A;  1KBN A;  2R3X A;  4HU9 A;  2H6X A;  3QR6 A;  3GX0 A;  3ZFB A;  2LRT A;  1X5C A;  4PQH A;  2HNL A;  3GKM A;  1ZGN A;  3TDG A;  1HNB A;  3GYK A;  5CP1 A;  1SU9 A;  1PSQ A;  4N3Z A;  1XG8 A;  2L57 A;  2DSA A;  1WWJ A;  4ZIL A;  3LYP A;  4PUA A;  1HD2 A;  9GSS A;  2H70 A;  5DAK B;  2BMX A;  2HSM B;  1YF0 A;  3ZYW A;  1UA5 A;  2X8C A;  2AV4 A;  3QOU A;  5KEJ A;  2KLX A;  2YWN A;  2ZUP A;  1SJI A;  3LEF A;  1YKA A;  4XIH A;  4TOP A;  1GSF A;  1TU8 A;  3KP9 A;  1Q4J A;  2N5F A;  5KN1 A;  2YWO A;  4HUA A;  1TRS A;  5ECQ B;  3VLN A;  2H72 A;  3CBU A;  2VLV A;  4I97 A;  5IMC A;  3IHG A;  4GLT A;  5BMU A;  1QK8 A;  3IAM 2;  3M9K A;  1SVL A;  4EKZ A;  13GS A;  3KTL A;  2VOC A;  3HZ4 A;  3A2V A;  1O8W A;  3EU4 A;  2GLR A;  3QAV A;  3GL3 A;  1R5A A;  3WT2 A;  3KM6 A;  2MMA A;  1XOB A;  1O81 A;  2VCW A;  2BJX A;  1FW1 A;  2IPA A;  1OAZ A;  3BOA A;  3MIX A;  4CY8 A;  1EZK A;  2IMD A;  3EIN A;  1ON4 A;  1AUC A;  1PMT A;  3LXT A;  3M8N A;  3FW2 A;  4XHM A;  3ZMK A;  4WR4 A;  1M2B A;  4XRA A;  3TUE A;  1U3I A;  2H1B A;  3BCK A;  5JCU A;  3PH9 A;  4POL A;  4AKH A;  3ERF A;  3EVI A;  4FYB A;  4O5R A;  2DML A;  4MF6 A;  1M2D A;  1B9X C;  4MH3 A;  1F6M C;  2P0G A;  5ECS A;  5CRG A;  3GN3 A;  2M46 A;  2PMT A;  3UAR A;  4MCU A;  1R26 A;  2VM2 A;  4JR6 A;  2GQM A;  1WE0 A;  5J4Y A;  1M0U A;  4FIW A;  3RFR C;  2HRA A;  3GRX A;  1BG1 A;  2OAC A;  3L9S A;  5A5H B;  4RQR A;  4A5P A;  4HU7 A;  1GNW A;  2P5R A;  2CVD A;  3NIV A;  4KE3 A;  2E7P A;  2V6O A;  3GHA A;  5G2Z A;  1K0A A;  3D4M A;  2HRF A;  4WKW A;  1VGL A;  4RQX A;  1F37 A;  2VO4 A;  1AIU A;  2O3E A;  1TP9 A;  1NHY A;  2VLT A;  1QMV A;  2CX3 A;  4L0U A;  5DJM A;  3UVH A;  4TVE A;  4K8M A;  3UJ1 A;  3QFA C;  4YAP A;  3TKS A;  3JCM L;  4ZXG A;  4MPG A;  5ECR B;  5J4U A;  2DIY A;  1H75 A;  4PGT A;  2RII A;  1BED A;  3F3Q A;  1KTE A;  1JHB A;  3CRU A;  4KH7 A;  3FK8 A;  3GTU A;  3D22 A;  4L8E A;  1OC9 A;  4I6X A;  3SBC A;  3ZLP A;  4IS0 A;  4ZL9 A;  3IC8 A;  1XWB A;  4BL7 B;  5G5E A;  4IKH A;  5KN0 A;  1AQW A;  2HI7 A;  3G9B A;  4KW6 A;  2FWF A;  4ZIJ A;  1HQO A;  2C4J A;  4G0K A;  1EWX A;  3NZN A;  1BAY A;  1TI1 A;  3H8Q A;  3MSZ A;  4ZB8 A;  3F9U A;  1M99 A;  4IEL A;  4YKF A;  1U88 A;  3HDC A;  2MBT A;  4TN8 A;  3VWU A;  4EXJ A;  2EFH A;  2L4C A;  2O7K A;  2I1U A;  1YZX A;  2X8H A;  4ZBA A;  4O5Q A;  4NXI A;  2OE3 A;  4NV2 A;  4G10 A;  1QFN A;  2H8L A;  1FG4 A;  11GS A;  1R4W A;  2OAD A;  4K7O A;  3WGD A;  3O76 A;  1THO A;  4K7N A;  3ZVJ D;  1PX6 A;  2JZS A;  4E8H A;  3EWL A;  4PI0 C;  1Z6M A;  4D73 A;  5ECM B;  1YEW C;  2XBQ A;  2WVY A;  3TJB A;  2H1D A;  2JU5 A;  4IQA A;  1K0C A;  1K3L A;  1XWK A;  3SWL A;  3RGB C;  4J57 E;  1RQM A;  3RPN A;  3TOT A;  2WUL A;  4W66 A;  3P7X A;  2ON7 A;  2OE0 A;  1TK8 B;  2FUG 2;  1FVK A;  1TKD B;  1EOH A;  3R3E A;  2B1L A;  2B1K A;  1VF4 A;  4K5S A;  6GST A;  5DCH A;  3DGQ A;  3TKQ A;  1S3D A;  4BWS A;  1FOH A;  12GS A;  2B7J A;  4I2U A;  1OC3 A;  4KSO A;  5KN3 A;  2XPE A;  4X4J A;  3IA1 A;  3PGT A;  3UEM A;  4AJ7 A;  4ZBD A;  1N2A A;  4N30 A;  2DIZ A;  2DJ0 A;  3J7Y k;  1OVN A;  1SL1 B;  3D4T A;  5CNW A;  10GS A;  5IMF A;  2L4Q A;  4TRX A;  5J9C A;  2LUS A;  2YCD A;  4ICY A;  4QL9 A;  2O5V A;  2GSS A;  2WVZ A;  1JZD A;  2GS3 A;  1Z7P A;  3GV1 A;  4V2N A;  4LMV A;  2GDR A;  1HNC A;  4AKI A;  1SKW B;  2YWM A;  3VPQ A;  2IMI A;  3K8N A;  2FWG A;  3LYK A;  2B5X A;  4LL4 B;  1V9W A;  1SYX A;  5ID2 A;  5A4W A;  3TRP A;  2QGV A;  2G0F A;  3TKR A;  3GX8 A;  2V2G A;  4Q5R A;  1VF3 A;  4CY6 A;  3ME8 A;  3DVW A;  2PUK C;  1A0F A;  4KCE A;  3CQF A;  5BRT A;  3G7J A;  5BMU B;  1EV9 A;  1YY7 A;  1EEJ A;  4H86 A;  2H0H A;  4MJC A;  3KMO A;  4OCF A;  3TKS E;  4BA7 A;  4Z2R A;  3DVX A;  1K3Y A;  3E0U A;  1PKZ A;  2HFD A;  4EL1 A;  2IME A;  1SVM A;  2IL3 A;  3LW9 A;  4BVX A;  3RPP A;  3M0F A;  4JU5 A;  3GKK A;  2R2J A;  5FT3 A;  1T3B A;  3I43 A;  2YV9 A;  4V2L A;  3GH9 A;  19GS A;  1ABA A;  2CVB A;  3CRT A;  1GUH A;  3ZIT A;  2BTO T;  3GST A;  4MPF A;  3HVN A;  1FOV A;  1ERU A;  5DJL A;  1XIY A;  1GSD A;  2I81 A;  5DVB A;  4ML1 A;  4MJE A;  4AI6 A;  4GRF A;  1J0F A;  3L9V A;  2HXK A;  4F9Z A;  3ZL5 A;  5FHI A;  3WT1 A;  4Z2U A;  4RI7 A;  2DMM A;  3WGE A;  3LFL A;  3ME7 A;  1T4Y A;  3HXS A;  4HQZ A;  1AXD A;  4IN0 A;  2LS5 A;  1FB0 A;  1WPI A;  2VL9 A;  1MD3 A;  2R4V A;  5IIZ A;  3J7Y b;  2B5E A;  3F0I A;  2CAQ A;  3IPZ A;  4TR1 A;  1K0O A;  3IRA A;  3MYD A;  4BWQ A;  2WW0 A;  2C3T A;  3IV4 A;  2YJ7 A;  3FMW A;  4IP1 A;  2JSZ A;  5KOW A;  3RBT A;  4K2D A;  2MYG A;  2VCV A;  3A3T A;  2C0G A;  5GZZ B;  2M80 A;  3DEX A;  2LRC A;  1JZR A;  1Z6N A;  2DKI A;  4POB A;  5D96 A;  3MAK A;  3GH6 A;  4GSN A;  4E68 A;  6GSV A;  2B5Y A;  3P8W A;  1ZOF A;  3GTU B;  1E6B A;  2OA7 A;  4O5U A;  2L5L A;  3ED3 A;  4Z7X A;  2MMZ A;  3CHX C;  2MZC A;  1R7H A;  5IOX A;  5IOW A;  3HA9 A;  1YEP A;  2L5O A;  3F3R A;  4IVF A;  1M3J A;  2VIM A;  5EVO A;  5HFG A;  1YEX A;  5HR3 A;  2V6K A;  3W8J A;  1OC8 A;  2GTU A;  3L0H A;  1XWC A;  6GSU A;  1ZYE A;  3FR6 A;  5ECP B;  3I9V 2;  3F8U A;  3ZML A;  3C1S A;  1ZYP A;  2IWT A;  5JCW A;  4X1U A;  4KSM A;  4L5O A;  2EIO A;  3G7I A;  4PXO A;  2R37 A;  5C04 A;  1TU7 A;  5IMD A;  3KXO A;  1X9S B;  2XHF A;  4YQM A;  4G01 A;  3HYP A;  2YAN A;  5G1K A;  2WW2 A;  1TK0 B;  4PI2 C;  4FYU A;  4XCS A;  2GZP A;  1F3B A;  3GA4 A;  5D9X A;  1TDI A;  1PN0 A;  2LRN A;  2PN8 A;  4BVY A;  4TR3 A;  3KH9 A;  3APO A;  5IMZ A;  1U87 A;  4PQI A;  1NSW A;  1ZL9 A;  3F63 A;  3HD5 A;  1CQH A;  4KUN A;  5E4W A;  4ZB9 A;  5G31 A;  1X5E A;  4QL7 A;  1UC7 A;  3IC4 A;  4DSS A;  1YKC A;  2DJK A;  4IJ3 A;  3HVS A;  4OO5 A;  1A2J A;  3APS A;  3UAP A;  1MDK A;  2VM1 A;  2C0E A;  4EVM A;  1Z5Y E;  2REM A;  3C1R A;  2LV3 A;  1A2L A;  1B9Y C;  4TKY A;  3ZTL A;  4YQV A;  1TXX A;  2C3N A;  4EF0 A;  5B8B A;  4L5L A;  1AQX A;  3M9J A;  4EIP A;  1VF1 A;  1DE1 A;  1X9M B;  4JBB A;  4YAV A;  2H6Y A;  4QQ7 A;  4KDX A;  3L9U A;  3FR3 A;  1PL2 A;  5EL8 A;  4MA9 A;  3DKS A;  4HZ2 A;  1BF5 A;  5HQP A;  3UBL A;  2ON5 A;  1LU4 A;  4O92 A;  1XFL A;  2H66 A;  2IIY A;  1Y1U A;  3F4R A;  3GNJ A;  1UN2 A;  4XS4 B;  3TKP A;  4POK A;  3ZIV A;  5AIX A;  4AJ6 A;  5GST A;  3UMA A;  2VCZ A;  4GF0 A;  3TJJ A;  1SEN A;  2N5A A;  1T00 A;  2TIR A;  5ID2 B;  4IP6 A;  3LGC A;  1ERW A;  3VPT A;  2NDO A;  16GS A;  3ZIJ A;  3HJM A;  3QCP A;  4G0L A;  5CRE A;  2WZ9 A;  4GQC A;  2FY6 A;  2DLX A;  17GS A;  2YV7 A;  3HZ8 A;  1TW9 A;  1SK0 A;  3TOU A;  4KA0 A;  5F05 A;  1GSE A;  4ZL7 A;  1I9D A;  3CTF A;  1WJK A;  1QQ2 A;  3GUR A;  4XS1 A;  2D2Z A;  3EMX A;  3HMJ G;  3O3T A;  4PHZ C;  2QSI A;  2GZZ A;  4ACS A;  4HEA 2;  1SD8 A;  4BVX B;  3UBK A;  2AJQ B;  2I4A A;  1URM A;  3M3M A;  2A4V A;  1J9B A;  2DJ3 A;  1G6Y A;  5JWO B;  1VF2 A;  3HKR A;  3VI5 A;  2KUC A;  2DC5 A;  5A34 B;  1E2Y A;  4HSC X;  4LA1 A;  5DQS A;  5G5F A;  1EGO A;  1PFO A;  2QA2 A;  2IFQ A;  4NMU A;  2HLS A;  1ST9 A;  2AUV A;  1K0N A;  3H79 A;  2OBI A;  5ELA A;  4G9H A;  1GSS A;  1PRX A;  3VK9 A;  2H71 A;  1Z9H A;  1AAZ A;  1B4P A;  2HT9 A;  4MNN A;  5EY6 A;  5H5Q A;  1GTA A;  1EEM A;  1TOF A;  3D5J A;  3DD3 A;  2HRK B;  4N0V A;  3D0Z A;  5CRW A;  4IW9 A;  1PL1 A;  4J2F A;  2CZ3 A;  1QXH A;  3G7Y A;  4N10 A;  1XWA A;  2F9S A;  1RK4 A;  4K5R A;  1M9A A;  3BJ5 A;  4OFM A;  4WBR D;  2EIR A;  2YJH A;  4X43 A;  2C8U A;  2WVX A;  5DAK A;  3A2X A;  2O36 A;  2DJJ A;  4OCE A;  4HS1 A;  1IYH A;  1GLQ A;  3I69 A;  4KB3 A;  4TR1 B;  2WZS A;  2QKE A;  3CSJ A;  5F0G A;  22GS A;  4XS6 A;  3CSH A;  3TJK A;  1KNG A;  2RLI A;  3HY2 A;  2H76 A;  3S9F A;  4EC0 A;  5H5S A;  3UIW A;  4ZBB A;  2H0G A;  3MDK A;  1V57 A;  4YQU A;  1XVQ A;  4MZW A;  1R5P A;  2NTO A;  1PD2 1;  2A2R A;  4KDY A;  2FA8 A;  4F2I A;  2PU9 C;  2V1M A;  5CRD A;  1A23 A;  1GRX A;  6GSX A;  2RM5 A;  4L0W A;  4EIQ A;  4ISD A;  3GUS A;  3CXG A;  4NHZ A;  2WCI A;  3KCM A;  2GSQ A; 
#chains in the Genus database with same CATH homology
 4OO4 A;  5D73 A;  3RHB A;  3A2W A;  2V41 A;  1JFU A;  2L59 A;  3GKN A;  3IAS 2;  3C73 A;  3F4S A;  1XCC A;  3QFB C;  4YKG A;  3H1N A;  5J5N A;  4Z2T A;  5J4V A;  2JZR A;  4ZB6 A;  2ES7 A;  2AHE A;  2LNS A;  7GSS A;  1AC1 A;  1FO5 A;  3TJF A;  2JZT A;  3FR9 A;  2FWE A;  3IDV A;  2PBJ A;  3EPT A;  1T4Z A;  4HZ4 A;  3WGX A;  5A4V A;  1QUW A;  1YQ1 A;  1SL0 B;  1PQN A;  3HJO A;  5GAN D;  5HR2 A;  1A0R P;  4NWY A;  1IYI A;  3F4T A;  1KEB A;  2C1Y A;  3IK9 A;  1SK1 A;  1GP1 A;  1OE8 A;  6GSS A;  1O85 A;  2WB9 A;  1XPV A;  2X8G A;  3KJY A;  1ERT A;  4KCA A;  1GUK A;  5IMV A;  4TXV A;  1UVZ A;  4G2E A;  2IJY A;  4JED A;  4WR5 A;  4OWY A;  2WGR A;  5A5H A;  1G6W A;  2WDU A;  1A8Y A;  4Q5N A;  1C72 A;  3TRQ A;  4G0I A;  18GS A;  3TJG A;  4DSS B;  1MDI A;  3WYW A;  4ECI A;  2K6V A;  3ZFL A;  3CYN A;  2R0C A;  4ZL8 A;  3W6G A;  1G0T A;  5L71 A;  4N0Z A;  1TRV A;  5IM9 A;  5HR1 A;  1EV4 A;  2GGT A;  3C7M A;  3Q18 A;  2X99 A;  3DIE A;  2H01 A;  2L6D A;  3KH7 A;  2CAI A;  2H1L A;  1OYJ A;  1SYR A;  1XOA A;  1SKS B;  4G19 A;  4AGS A;  2CT6 A;  1T8E B;  4GDF A;  4GST A;  4GTU A;  1OE7 A;  1ZZY A;  3KGK A;  1GTU A;  2HZE A;  1PN9 A;  1DUG A;  4KND A;  4ML6 A;  2R5G A;  2K8V A;  4CHS A;  4K0N A;  4IQ1 A;  2PWJ A;  1GL8 A;  2A2S A;  2OT3 A;  2VL2 C;  3I6A A;  2YZH A;  5A5K A;  2LTK A;  4DVC A;  1Y25 A;  1TXU A;  3DYR A;  5A4U A;  1K0B A;  2NVL A;  1NM3 A;  3BD2 A;  1GH2 A;  2CZ2 A;  1YVL A;  4AKG A;  5IO2 A;  3HJP A;  4HDE A;  3MNG A;  4ECC A;  3PIN A;  5JWQ B;  3QD9 A;  4ECJ A;  2PGT A;  5D9T A;  2KP2 A;  1ZCP A;  4PNG A;  5B6M A;  1Z7R A;  2UV8 G;  2OE1 A;  3FEU A;  2WRT A;  1S3A A;  3FHK A;  1O6J A;  1O73 A;  1OKD A;  5AIS A;  2CV4 A;  1F9M A;  3GIX A;  5INY A;  5AGY A;  2GT5 A;  4MZB A;  2H1G A;  1FHE A;  2MMO A;  4HI7 A;  4K1F A;  2X49 A;  4KAE A;  3KP8 A;  3H93 A;  1J08 A;  2LJK A;  4GWR A;  2O87 A;  1BJX A;  2F3M A;  2AB6 A;  8GSS A;  4E8E A;  1OC9 B;  3QDN A;  3ZZX A;  2LJA A;  2K8S A;  3KMN A;  4TR4 A;  3TKS C;  4KX4 A;  5E59 A;  5F8B A;  2RM6 A;  2C3Q A;  5DQY A;  5IPG A;  3ERW A;  4HOJ A;  3IHQ A;  5ECO B;  4LMW A;  4EO3 A;  5IQY A;  3L4N A;  2JAC A;  3VWX A;  1BQ7 A;  2M72 A;  4JR4 A;  5F07 A;  1A2M A;  2TRX A;  4I2T A;  5IPH A;  2UZ8 A;  2IFQ B;  4NHW A;  2CQ9 A;  4WF5 A;  1G7O A;  1YDK A;  1GNE A;  1M7T A;  2NBS A;  5EPF A;  1GLP A;  3GKX A;  1TK5 B;  4FH8 A;  3C71 A;  4TXO A;  1X0R A;  4LLR A;  4K9Z A;  1PA3 A;  1SL2 B;  4KDU A;  3LG6 A;  4NV5 A;  4IJI A;  2VD1 A;  3FY7 A;  1EP7 A;  2LST A;  1ZMA A;  2TRC P;  1WIK A;  2I3Y A;  1ZYQ B;  4D73 B;  5J41 A;  5AN1 A;  2R0P A;  5B8A A;  1GSQ A;  2FA4 A;  5A1N A;  2RUF A;  1GWC A;  4NPB A;  3U6V A;  4ULX A;  5G1L A;  2O89 A;  5LNK e;  4OMV A;  1U3A A;  3US3 A;  1XW5 A;  5C00 A;  4MJA A;  1G7E A;  2E2M A;  4PUR A;  2K18 A;  4RI6 A;  2H0I A;  4V1A g;  3LSZ A;  3QPM A;  4P3Y B;  1EOG A;  3E9J B;  4I8B A;  4YH2 A;  3EU3 A;  3TGZ A;  3PR8 A;  1XBS A;  4N11 A;  1EGR A;  2DJ2 A;  5D9V A;  2VCQ A;  1DSB A;  2H1A A;  2JL4 A;  3WD6 A;  2ZNM A;  3Q19 A;  3VUR A;  3D6I A;  4DSR A;  2P31 A;  1GSU A;  2HSN A;  3CWG A;  1V58 A;  1T1V A;  4HJ2 A;  3A5I A;  2HZF A;  2GVP A;  2YNX A;  2VL2 A;  1XZO A;  3U5R E;  1F3A A;  1TI3 A;  1WP0 A;  3FYG A;  3HHV A;  1GTI A;  3A5W A;  2A4H A;  4O32 A;  5KN2 A;  4WF4 A;  2VD0 A;  4F82 A;  3VI7 A;  5KOX A;  4MF7 A;  4HJM A;  4WET A;  4IGJ A;  1B48 A;  2E0Q A;  3FZ9 A;  3DRN A;  1QGV A;  4IBP A;  2JSY A;  4FQU A;  2IN3 A;  3P2A A;  2HRN A;  1BG5 A;  5DAL A;  3IXR A;  2WJU A;  3EC3 A;  1ERV A;  4JRR A;  3HVX A;  1DBY A;  1XXU A;  2KOK A;  1AQV A;  3DWV A;  1I5G A;  4IHU A;  2LQO A;  2MMN A;  5ABR A;  5B7C A;  1V98 A;  2VL3 A;  3UOM A;  3HVV A;  2FHE A;  3E3E A;  1Y6E A;  1X9W B;  3FZA A;  2CVK A;  4MP4 A;  4LL1 B;  1X5D A;  3RDW A;  2N5B A;  4TR0 A;  2G2Q A;  5IMA A;  4RUV A;  1XW6 A;  4EE0 A;  3QAG A;  3OR5 A;  3GFK A;  5GSS A;  4PUF C;  1V2A A;  4CW9 A;  1LBK A;  1ZYN A;  3IBH A;  1JZW A;  1YF1 A;  5ELG A;  3ZRD A;  3KTB A;  5JWR B;  4DSQ A;  2X64 A;  1Z3E A;  4ID0 A;  3VWV A;  4MJB A;  1MDJ A;  3KZQ A;  2IMF A;  5CAX A;  1XVW A;  20GS A;  2L6C A;  3R2Q A;  2HZE B;  3GMF A;  4MLY A;  1A8L A;  1H4O A;  2HE3 A;  3TCO A;  3D21 A;  1JZO A;  2AYT A;  5ECL B;  1SKR B;  4POM A;  3QAW A;  3N9J A;  5AIV A;  1B8X A;  2XBI A;  5CYY A;  3H4K A;  2Z9S A;  4F0B A;  4MK3 A;  2VAF A;  2EC4 A;  5ENU A;  2FLS A;  1RW1 A;  5H5R A;  4J56 E;  4JZQ A;  4V1A p;  1FB6 A;  6GSW A;  1MD4 A;  4XRD A;  3KD0 A;  2HQT A;  5JCG A;  3IK7 A;  2GST A;  2VCX A;  3L78 A;  2B3S A;  3AY8 A;  4WEY A;  2HSM A;  4MH2 A;  4AKX B;  3KIJ A;  5HR0 A;  2F8F A;  3MWH A;  2QA1 A;  1TRW A;  1ACV A;  3FRC A;  1LJR A;  2ALB A;  2LKU A;  2F51 A;  1WRY A;  2FNO A;  2YPM A;  4FO5 A;  1HYU A;  2R0G A;  1CQG A;  3ZVJ A;  4F03 A;  3ZRE A;  2FCH A;  3LOR A;  2GT6 A;  1K0D A;  1VRS D;  3EMP A;  2VKZ G;  2IMK A;  2LQQ A;  5FWG A;  3F6F A;  2A2P A;  4MF5 A;  2EFC A;  2VLU A;  3LXZ A;  2QC7 A;  1YJ6 A;  2PVQ A;  4EDY A;  1EP8 A;  4TW5 A;  2H74 A;  3GL5 A;  5G30 A;  3Q6O A;  3M1G A;  4BPY A;  4O7H A;  3O6T A;  3FZ5 A;  1M2A A;  4PTS A;  2C0F A;  5GAP D;  5ECN B;  1T7P B;  2JAD A;  3TRX A;  2C80 A;  3GSS A;  5F06 A;  5J40 A;  1PX7 A;  1WOU A;  5DBQ A;  5J9B A;  2H73 A;  1AW9 A;  4MDC A;  5D8I A;  1F2E A;  5B6N A;  4V2M A;  5HFK A;  2MBS A;  2HSH A;  3LWA A;  4Q5Q A;  1K3O A;  1BX9 A;  4MMM A;  1GUL A;  3V1W A;  2YP6 A;  2O85 A;  1XWG A;  4TXO B;  2YOI A;  2H75 A;  1A24 A;  1HNA A;  1N25 A;  2DKH A;  2CX4 A;  2OJL A;  3UL3 A;  1TRU A;  2HYX A;  1THX A;  4ECB A;  3FZ4 A;  1M9B A;  4PX1 A;  1SJZ A;  1TTZ A;  4XS4 A;  2X4A A;  4BVY B;  2EFD A;  1V40 A;  2GQL A;  5A1N B;  2YN1 A;  3VWW A;  2FWH A;  4K2X A;  3P90 A;  4I5Q A;  1TJD A;  4HQS A;  2OBK A;  2C0D A;  5ECI B;  1DE2 A;  4WXT A;  4PNF A;  2KHP A;  3EUR A;  2F8A A;  2RUE A;  1WMJ A;  2LEG A;  3VFI A;  1USB A;  1O7U A;  4KGI A;  2ZCT A;  4ILF A;  3PPU A;  2O8V B;  4K6X A;  1S3C A;  5LCZ A;  3EYT A;  4OD7 A;  5COH A;  2E2G A;  2DJ1 A;  3IOS A;  14GS A;  3BCI A;  3W8S A;  1N8J A;  2WS2 A;  1XW9 A;  1U6T A;  1NW2 A;  1NHO A;  2LNT A;  1FVJ A;  3IR4 A;  2GZY A;  1K0M A;  2GSR A;  3RAZ A;  1ILO A;  3F6D A;  2HSY A;  2AAW A;  3NOF A;  5J3R A;  1SVO A;  2LJR A;  2VUP A;  4BL7 A;  3EE2 A;  3CTG A;  5CRH A;  1MEK A;  2HSN B;  5LD0 A;  4NAX A;  4K0G A;  2H6Z A;  4GSS A;  5D93 A;  5A34 A;  4GQF A;  2OKA A;  1W89 A;  4DEJ A;  1JLW A;  4GCI A;  2DBC A;  4X0X A;  4EDZ A;  4K7I A;  4Q5F A;  4FYC A;  1MTC A;  3TU3 B;  5IO0 A;  2V32 A;  6GSY A;  3TB2 A;  4XTS A;  2CA8 A;  2K9F A;  5HFI A;  2PER A;  3FKF A;  1OKT A;  2XC2 A;  3DXB A;  2HRK A;  4QMK A;  5DCG A;  2VCT A;  2H19 A;  4EUY A;  3BBY A;  4MAB A;  2J23 A;  3UVT A;  2EFE A;  2I9H A;  5ECH B;  2YWI A;  1BYE A;  3QMX A;  5DAL B;  4F0C A;  4USS A;  2J9H A;  4WBJ A;  5D9W A;  1SJ6 A;  4PQ1 A;  2PVO C;  2EIQ A;  2WFC A;  1FAA A;  2B7K A;  3KEB A;  2KP1 A;  4KF9 A;  3HCZ A;  1SD9 A;  1SK2 A;  2B6M A;  4OFT A;  3N5O A;  3C8E A;  3ERG A;  2FGX A;  2GQK A;  3IE3 A;  2XPD A;  3Q74 A;  2H30 A;  1Q98 A;  3LJR A;  2YZU A;  2FD3 A;  5CO3 A;  4ZB7 A;  4AJ8 A;  4GXZ A;  3CMI A;  4AF2 A;  3ISO A;  4JE1 A;  1JLV A;  5J47 A;  4CDO A;  2P5Q A;  2PPT A;  1W4V A;  3DML A;  1PKW A;  3CSI A;  1PGT A;  5DDL A;  1ML6 A;  1B4Q A;  1GTB A;  1GUM A;  1O8X A;  2R6K A;  4OFN A;  5ECK B;  3APQ A;  3RHC A;  3LQ7 A;  2NPB A;  4MZC A;  1GSY A;  1KBN A;  2R3X A;  4HU9 A;  2H6X A;  3QR6 A;  3GX0 A;  3ZFB A;  2LRT A;  1X5C A;  4PQH A;  2HNL A;  3GKM A;  1ZGN A;  3TDG A;  1HNB A;  3GYK A;  5CP1 A;  1SU9 A;  1PSQ A;  4N3Z A;  2L57 A;  2DSA A;  1WWJ A;  4ZIL A;  3LYP A;  4PUA A;  1HD2 A;  9GSS A;  2H70 A;  5DAK B;  2BMX A;  2HSM B;  1YF0 A;  3ZYW A;  1UA5 A;  2X8C A;  2AV4 A;  3QOU A;  5KEJ A;  2KLX A;  2YWN A;  2ZUP A;  1SJI A;  3LEF A;  1YKA A;  4XIH A;  4TOP A;  1GSF A;  1TU8 A;  3KP9 A;  1Q4J A;  2N5F A;  5KN1 A;  2YWO A;  4HUA A;  1TRS A;  5ECQ B;  3VLN A;  2H72 A;  3CBU A;  2VLV A;  4I97 A;  5IMC A;  3IHG A;  4GLT A;  5BMU A;  1QK8 A;  3IAM 2;  3M9K A;  1SVL A;  4EKZ A;  13GS A;  3KTL A;  2VOC A;  3HZ4 A;  3A2V A;  1O8W A;  3EU4 A;  2GLR A;  3QAV A;  3GL3 A;  1R5A A;  3WT2 A;  3KM6 A;  2MMA A;  1XOB A;  1O81 A;  2VCW A;  2BJX A;  1FW1 A;  2IPA A;  1OAZ A;  3BOA A;  3MIX A;  4CY8 A;  1EZK A;  2IMD A;  3EIN A;  1ON4 A;  1AUC A;  1PMT A;  3LXT A;  3M8N A;  3FW2 A;  4XHM A;  3ZMK A;  4WR4 A;  1M2B A;  4XRA A;  3TUE A;  1U3I A;  2H1B A;  3BCK A;  5JCU A;  3PH9 A;  4POL A;  4AKH A;  3ERF A;  3EVI A;  4FYB A;  4O5R A;  2DML A;  4MF6 A;  1M2D A;  1B9X C;  4MH3 A;  1F6M C;  2P0G A;  5ECS A;  5CRG A;  3GN3 A;  2M46 A;  2PMT A;  3UAR A;  4MCU A;  1R26 A;  2VM2 A;  4JR6 A;  2GQM A;  1WE0 A;  5J4Y A;  1M0U A;  4FIW A;  2HRA A;  3GRX A;  1BG1 A;  2OAC A;  3L9S A;  5A5H B;  4RQR A;  4A5P A;  4HU7 A;  1GNW A;  2P5R A;  2CVD A;  3NIV A;  4KE3 A;  2E7P A;  2V6O A;  3GHA A;  5G2Z A;  1K0A A;  3D4M A;  2HRF A;  4WKW A;  1VGL A;  4RQX A;  1F37 A;  2VO4 A;  1AIU A;  1TP9 A;  1NHY A;  2VLT A;  1QMV A;  2CX3 A;  4L0U A;  5DJM A;  3UVH A;  4TVE A;  4K8M A;  3UJ1 A;  3QFA C;  4YAP A;  3TKS A;  3JCM L;  4ZXG A;  4MPG A;  5ECR B;  5J4U A;  2DIY A;  1H75 A;  4PGT A;  2RII A;  1BED A;  3F3Q A;  1KTE A;  1JHB A;  3CRU A;  4KH7 A;  3FK8 A;  3GTU A;  3D22 A;  4L8E A;  1OC9 A;  4I6X A;  3SBC A;  3ZLP A;  4IS0 A;  4ZL9 A;  3IC8 A;  1XWB A;  4BL7 B;  5G5E A;  4IKH A;  5KN0 A;  1AQW A;  2HI7 A;  3G9B A;  4KW6 A;  2FWF A;  4ZIJ A;  1HQO A;  2C4J A;  4G0K A;  1EWX A;  3NZN A;  1BAY A;  1TI1 A;  3H8Q A;  3MSZ A;  4ZB8 A;  3F9U A;  1M99 A;  4IEL A;  4YKF A;  1U88 A;  3HDC A;  2MBT A;  4TN8 A;  3VWU A;  4EXJ A;  2EFH A;  2L4C A;  2O7K A;  2I1U A;  1YZX A;  2X8H A;  4ZBA A;  4O5Q A;  4NXI A;  2OE3 A;  4NV2 A;  4G10 A;  1QFN A;  2H8L A;  1FG4 A;  11GS A;  1R4W A;  2OAD A;  4K7O A;  3WGD A;  3O76 A;  1THO A;  4K7N A;  3ZVJ D;  1PX6 A;  2JZS A;  4E8H A;  3EWL A;  1Z6M A;  4D73 A;  5ECM B;  2XBQ A;  3TJB A;  2H1D A;  2JU5 A;  4IQA A;  1K0C A;  1K3L A;  1XWK A;  3SWL A;  4J57 E;  1RQM A;  3RPN A;  3TOT A;  2WUL A;  4W66 A;  3P7X A;  2ON7 A;  2OE0 A;  1TK8 B;  2FUG 2;  1FVK A;  1TKD B;  1EOH A;  3R3E A;  2B1L A;  2B1K A;  1VF4 A;  4K5S A;  6GST A;  5DCH A;  3DGQ A;  3TKQ A;  1S3D A;  4BWS A;  1FOH A;  12GS A;  2B7J A;  4I2U A;  1OC3 A;  4KSO A;  5KN3 A;  2XPE A;  4X4J A;  3IA1 A;  3PGT A;  3UEM A;  4AJ7 A;  4ZBD A;  1N2A A;  4N30 A;  2DIZ A;  2DJ0 A;  3J7Y k;  1OVN A;  1SL1 B;  3D4T A;  5CNW A;  10GS A;  5IMF A;  2L4Q A;  4TRX A;  5J9C A;  2LUS A;  2YCD A;  4ICY A;  4QL9 A;  2O5V A;  2GSS A;  1JZD A;  2GS3 A;  1Z7P A;  3GV1 A;  4V2N A;  4LMV A;  2GDR A;  1HNC A;  4AKI A;  1SKW B;  2YWM A;  3VPQ A;  2IMI A;  3K8N A;  2FWG A;  3LYK A;  2B5X A;  4LL4 B;  1V9W A;  1SYX A;  5ID2 A;  5A4W A;  3TRP A;  2QGV A;  2G0F A;  3TKR A;  3GX8 A;  2V2G A;  4Q5R A;  1VF3 A;  4CY6 A;  3ME8 A;  3DVW A;  2PUK C;  1A0F A;  4KCE A;  5BRT A;  3G7J A;  5BMU B;  1EV9 A;  1YY7 A;  1EEJ A;  4H86 A;  2H0H A;  4MJC A;  3KMO A;  4OCF A;  3TKS E;  4BA7 A;  4Z2R A;  3DVX A;  1K3Y A;  3E0U A;  1PKZ A;  2HFD A;  4EL1 A;  2IME A;  1SVM A;  2IL3 A;  3LW9 A;  4BVX A;  3RPP A;  3M0F A;  4JU5 A;  3GKK A;  2R2J A;  5FT3 A;  1T3B A;  3I43 A;  2YV9 A;  4V2L A;  3GH9 A;  19GS A;  1ABA A;  2CVB A;  3CRT A;  1GUH A;  3ZIT A;  2BTO T;  3GST A;  4MPF A;  1FOV A;  1ERU A;  5DJL A;  1XIY A;  1GSD A;  2I81 A;  5DVB A;  4ML1 A;  4MJE A;  4AI6 A;  4GRF A;  1J0F A;  3L9V A;  2HXK A;  4F9Z A;  3ZL5 A;  5FHI A;  3WT1 A;  4Z2U A;  4RI7 A;  2DMM A;  3WGE A;  3LFL A;  3ME7 A;  1T4Y A;  3HXS A;  4HQZ A;  1AXD A;  4IN0 A;  2LS5 A;  1FB0 A;  1WPI A;  2VL9 A;  1MD3 A;  2R4V A;  5IIZ A;  3J7Y b;  2B5E A;  3F0I A;  2CAQ A;  3IPZ A;  4TR1 A;  1K0O A;  3IRA A;  3MYD A;  4BWQ A;  2C3T A;  3IV4 A;  2YJ7 A;  3FMW A;  4IP1 A;  2JSZ A;  5KOW A;  3RBT A;  4K2D A;  2MYG A;  2VCV A;  3A3T A;  2C0G A;  5GZZ B;  2M80 A;  3DEX A;  2LRC A;  1JZR A;  1Z6N A;  2DKI A;  4POB A;  5D96 A;  3MAK A;  3GH6 A;  4GSN A;  4E68 A;  6GSV A;  2B5Y A;  3P8W A;  1ZOF A;  3GTU B;  1E6B A;  2OA7 A;  4O5U A;  2L5L A;  3ED3 A;  4Z7X A;  2MMZ A;  2MZC A;  1R7H A;  5IOX A;  5IOW A;  3HA9 A;  1YEP A;  2L5O A;  3F3R A;  4IVF A;  2VIM A;  5EVO A;  5HFG A;  1YEX A;  5HR3 A;  2V6K A;  3W8J A;  1OC8 A;  2GTU A;  3L0H A;  1XWC A;  6GSU A;  1ZYE A;  3FR6 A;  5ECP B;  3I9V 2;  3F8U A;  3ZML A;  3C1S A;  1ZYP A;  2IWT A;  5JCW A;  4X1U A;  4KSM A;  4L5O A;  2EIO A;  3G7I A;  4PXO A;  2R37 A;  5C04 A;  1TU7 A;  5IMD A;  3KXO A;  1X9S B;  2XHF A;  4YQM A;  4G01 A;  3HYP A;  2YAN A;  5G1K A;  1TK0 B;  4FYU A;  4XCS A;  2GZP A;  1F3B A;  3GA4 A;  5D9X A;  1TDI A;  1PN0 A;  2LRN A;  2PN8 A;  4BVY A;  4TR3 A;  3KH9 A;  3APO A;  5IMZ A;  1U87 A;  4PQI A;  1NSW A;  1ZL9 A;  3F63 A;  3HD5 A;  1CQH A;  4KUN A;  5E4W A;  4ZB9 A;  5G31 A;  1X5E A;  4QL7 A;  1UC7 A;  3IC4 A;  4DSS A;  1YKC A;  2DJK A;  4IJ3 A;  3HVS A;  4OO5 A;  1A2J A;  3APS A;  3UAP A;  1MDK A;  2VM1 A;  2C0E A;  4EVM A;  1Z5Y E;  2REM A;  3C1R A;  2LV3 A;  1A2L A;  1B9Y C;  4TKY A;  3ZTL A;  4YQV A;  1TXX A;  2C3N A;  4EF0 A;  5B8B A;  4L5L A;  1AQX A;  3M9J A;  4EIP A;  1VF1 A;  1DE1 A;  1X9M B;  4JBB A;  4YAV A;  2H6Y A;  4QQ7 A;  4KDX A;  3L9U A;  3FR3 A;  1PL2 A;  5EL8 A;  4MA9 A;  3DKS A;  4HZ2 A;  1BF5 A;  5HQP A;  3UBL A;  2ON5 A;  1LU4 A;  4O92 A;  1XFL A;  2H66 A;  2IIY A;  1Y1U A;  3F4R A;  3GNJ A;  1UN2 A;  4XS4 B;  3TKP A;  4POK A;  3ZIV A;  5AIX A;  4AJ6 A;  5GST A;  3UMA A;  2VCZ A;  4GF0 A;  3TJJ A;  1SEN A;  2N5A A;  1T00 A;  2TIR A;  5ID2 B;  4IP6 A;  3LGC A;  1ERW A;  3VPT A;  2NDO A;  16GS A;  3ZIJ A;  3HJM A;  3QCP A;  4G0L A;  5CRE A;  2WZ9 A;  4GQC A;  2FY6 A;  2DLX A;  17GS A;  2YV7 A;  3HZ8 A;  1TW9 A;  1SK0 A;  3TOU A;  4KA0 A;  5F05 A;  1GSE A;  4ZL7 A;  1I9D A;  3CTF A;  1WJK A;  1QQ2 A;  3GUR A;  4XS1 A;  2D2Z A;  3EMX A;  3HMJ G;  3O3T A;  2QSI A;  2GZZ A;  4ACS A;  4HEA 2;  1SD8 A;  4BVX B;  3UBK A;  2AJQ B;  2I4A A;  1URM A;  3M3M A;  2A4V A;  1J9B A;  2DJ3 A;  1G6Y A;  5JWO B;  1VF2 A;  3HKR A;  3VI5 A;  2KUC A;  2DC5 A;  5A34 B;  1E2Y A;  4LA1 A;  5DQS A;  5G5F A;  1EGO A;  2QA2 A;  2IFQ A;  4NMU A;  2HLS A;  1ST9 A;  2AUV A;  1K0N A;  3H79 A;  2OBI A;  5ELA A;  4G9H A;  1GSS A;  1PRX A;  3VK9 A;  2H71 A;  1Z9H A;  1AAZ A;  1B4P A;  2HT9 A;  4MNN A;  5EY6 A;  5H5Q A;  1GTA A;  1EEM A;  1TOF A;  3D5J A;  3DD3 A;  2HRK B;  4N0V A;  3D0Z A;  5CRW A;  4IW9 A;  1PL1 A;  4J2F A;  2CZ3 A;  1QXH A;  3G7Y A;  4N10 A;  1XWA A;  2F9S A;  1RK4 A;  4K5R A;  1M9A A;  3BJ5 A;  4OFM A;  4WBR D;  2EIR A;  2YJH A;  4X43 A;  2C8U A;  5DAK A;  3A2X A;  2DJJ A;  4OCE A;  4HS1 A;  1IYH A;  1GLQ A;  3I69 A;  4KB3 A;  4TR1 B;  2QKE A;  3CSJ A;  5F0G A;  22GS A;  4XS6 A;  3CSH A;  3TJK A;  1KNG A;  2RLI A;  3HY2 A;  2H76 A;  3S9F A;  4EC0 A;  5H5S A;  3UIW A;  4ZBB A;  2H0G A;  3MDK A;  1V57 A;  4YQU A;  1XVQ A;  4MZW A;  1R5P A;  2NTO A;  1PD2 1;  2A2R A;  4KDY A;  2FA8 A;  4F2I A;  2PU9 C;  2V1M A;  5CRD A;  1A23 A;  1GRX A;  6GSX A;  2RM5 A;  4L0W A;  4EIQ A;  4ISD A;  3GUS A;  3CXG A;  4NHZ A;  2WCI A;  3KCM A;  2GSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...