4KSMA

Crystal structure of escherichia coli glutraredoxin 2 c9s/c12s mutant without glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
216
Chain Sequence
AMKLYIYDHSPYSLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-2
publication title Crystal structures of E.Coli glutaredoxin 2 with glutathione and of a mutant C9S/C12S without glutathione
rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 77
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ksmA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ksmA01
2M80A 3DKSA 3IRAA 1KBNA 4HU7A 4RI6A 2CZ2A 2OADA 2EC4A 2F3MA 3KH7A 3LEFA 2H74A 2F8AA 4EDYA 4QL7A 3BCKA 1QFNA 3HZ4A 1V40A 1EOGA 4TW5A 4PQ1A 3OR5A 1SD8A 3EVIA 1OC3A 1V58A 4N10A 1X5CA 5HFGA 5AIXA 1DUGA 4PUFC 1HYUA 3IK7A 4AF2A 2VLVA 5HR2A 3GL3A 4TR1B 1A8YA 4ECJA 2LRCA 4X0XA 4G0LA 2I9HA 2WB9A 5LCZA 2EIOA 2C3NA 1TK0B 4OD7A 2WRTA 3K8NA 3WGEA 1SENA 1GSUA 3HCZA 2GZYA 4Q5NA 1AQVA 3EINA 5KN0A 1U3AA 3QAGA 1A0RP 2CAIA 1XWKA 2DIZA 4WETA 1XOBA 3IC8A 2M72A 2B1KA 3D4MA 2YZHA 1V2AA 1J08A 3QAWA 2VCTA 2H75A 1A23A 2KP1A 3QDNA 4XCSA 2DJJA 2ON7A 1TRSA 2P31A 5HR3A 4GXZA 5ENUA 1AAZA 2XBQA 1G7EA 3FR9A 3F0IA 5IPGA 1XW6A 2JSYA 4WF5A 2MMNA 2IFQB 5HQPA 1X5DA 3IHQA 4OO4A 2H1AA 3BD2A 4G19A 1O85A 2LKUA 1M2DA 3ZYWA 2KHPA 4OWYA 3LXTA 4L0UA 3SBCA 1AW9A 2HZEA 5ID2A 1MDIA 3DYRA 3GUSA 1KEBA 5IMZA 1TU7A 5J9CA 3TGZA 2GS3A 1F3BA 2H19A 1SK2A 2YCDA 2CAQA 4V1Ap 3QMXA 1SL1B 1KTEA 2GVPA 5CYYA 4KUNA 1PL2A 1GSYA 1GTAA 4KSMA 1JLWA 1MD3A 1U87A 1TI3A 4BA7A 5JCWA 4ISDA 5ECLB 3M9KA 3CBUA 4IJ3A 2DBCA 2JSZA 4X1UA 2VUPA 2C80A 2FUG2 2YWOA 4GSSA 3H79A 4MH2A 4AGSA 2MMOA 1F37A 1WOUA 2G2QA 1F2EA 2UZ8A 3EYTA 2J9HA 1I5GA 2V2GA 1YZXA 1SKWB 1Z5YE 3D0ZA 2WCIA 2E0QA 1DE2A 5GSSA 3FY7A 5B8AA 1X0RA 2DSAA 3ZMKA 4WR4A 3H4KA 2AAWA 2KP2A 1GULA 4HI7A 5IOXA 3ZZXA 4RQXA 5IMFA 2CA8A 5G1KA 5ECOB 4P3YB 1TTZA 5GAPD 4BVXB 1XWAA 2H0GA 1OE7A 2YP6A 5LD0A 4OO5A 2GSSA 9GSSA 3QOUA 4KW6A 3HYPA 4MABA 1M7TA 5KEJA 5DJMA 4TR0A 3KH9A 3V1WA 1R26A 1ZGNA 1B9XC 1TRWA 4BVYB 5JWRB 4PQHA 2H01A 4YQUA 5DALB 1JZWA 2CX4A 2FGXA 1ERVA 1GH2A 4XTSA 3IPZA 3LXZA 1T4ZA 2B1LA 2XPEA 3RPPA 3RDWA 1TDIA 4OCFA 5IOWA 3WT2A 4POBA 1QGVA 4LMVA 4ZIJA 2K6VA 4NWYA 1GTBA 3KZQA 4AJ7A 4EVMA 4FO5A 1YJ6A 4ID0A 2MBTA 4DSSB 3I69A 5DJLA 3TOTA 3TKQA 2NBSA 2VCQA 2C8UA 3IXRA 5E59A 1OKDA 2DJ1A 3I9V2 3KEBA 1SYRA 1GSEA 1U3IA 3PPUA 1O8WA 3M9JA 3MAKA 4F9ZA 1AIUA 1O81A 1VRSD 3L9SA 2YANA 4K8MA 12GSA 4YH2A 1XFLA 5D9VA 3GH9A 3TRPA 2J23A 4J57E 4KDYA 5IPHA 2LRNA 4EDZA 4BWQA 2MBSA 3GSTA 1K0NA 5DBQA 3KGKA 4AJ8A 5AGYA 1E6BA 5D9TA 5J41A 2VL2C 6GSWA 5ECHB 3I6AA 3FKFA 4FIWA 3GYKA 3HXSA 3SWLA 3WGXA 2B6MA 4QQ7A 3KCMA 2HSMA 3EE2A 3UIWA 2JACA 2VCXA 4ZB6A 2AHEA 3FW2A 5IMCA 1SJIA 4PNFA 3WT1A 2PERA 3TOUA 2DLXA 4WEYA 4IELA 3ZITA 4G0KA 10GSA 1FOVA 4AJ6A 3DIEA 3P2AA 1ZZYA 2CT6A 2IJYA 1T1VA 4EUYA 2EIRA 1SKRB 2HRNA 2ZCTA 2IPAA 3JCML 2YNXA 3U6VA 2L5LA 1V9WA 3GA4A 1B8XA 4V2NA 4G0IA 1PSQA 2YJHA 3O3TA 1ZYQB 1GL8A 5F06A 3EWLA 3N9JA 1Z6NA 3M0FA 2GSRA 4X43A 4ULXA 3GH6A 1ILOA 1ZOFA 4GSNA 1F3AA 2O89A 4HU9A 1WWJA 2P5QA 3O6TA 3TRQA 2OKAA 4WR5A 3IE3A 5DDLA 4XS4A 4IKHA 4KDXA 1JHBA 3J7Yk 2PVQA 1UA5A 1YF1A 4RI7A 4MJBA 3P8WA 1TRUA 4ML6A 2ES7A 1Y6EA 4NAXA 3TKSC 3FZ4A 3I43A 2CVBA 2JZTA 3HD5A 1SU9A 3VLNA 2PPTA 4POKA 3EMXA 2VL9A 1GTIA 1ZYEA 2N5BA 2MMZA 4NMUA 2AYTA 2DJ3A 4DSQA 3E9JB 5A4VA 2C1YA 2IN3A 3CXGA 1NW2A 1GSFA 1A2JA 2I1UA 5J9BA 1XCCA 3GX0A 4ZL9A 13GSA 2MZCA 5AN1A 2REMA 1GP1A 1R4WA 2C3QA 1EGOA 4N11A 1MDJA 3MWHA 3GMFA 5J4UA 2LQOA 1B9YC 4CW9A 4ZBDA 2LJKA 2CVDA 2K9FA 4FQUA 1PRXA 2E7PA 5CO3A 1TK8B 5B8BA 1PQNA 1UN2A 4I8BA 4IVFA 1GRXA 3IOSA 4K7IA 1YEXA 1XWCA 4IGJA 3Q19A 5CREA 1YF0A 1GNEA 3DEXA 4MP4A 3N5OA 3DMLA 1XVWA 4KA0A 3WGDA 2CX3A 4K1FA 1DSBA 1TXXA 3C7MA 3GKKA 2GZZA 2RM6A 4K7OA 4TOPA 1NHOA 2ALBA 3VI7A 4JR6A 3DRNA 1EWXA 2HYXA 4YAVA 7GSSA 3IDVA 3UVTA 3Q18A 4GRFA 4ZL7A 4HS1A 4HJMA 3HJPA 5JCUA 5ECIB 3UVHA 2VL2A 2HFDA 1FVJA 3L9VA 3ZRDA 3GURA 1EZKA 4GSTA 4XRAA 4MPFA 1YKAA 4KGIA 2WZ9A 2O87A 3HA9A 4GF0A 4NHZA 1THXA 1R5PA 2DJKA 1YKCA 3C1SA 4WKWA 2LJAA 4KNDA 19GSA 2D2ZA 1QXHA 5FT3A 4XRDA 4G9HA 2M46A 4MF7A 1YEPA 2R37A 5D9WA 3ZMLA 1BJXA 3F4RA 4F82A 3QPMA 3IBHA 1VF3A 1K0AA 4IQ1A 3DGQA 4HOJA 2F51A 1Z6MA 6GSUA 1N8JA 3M8NA 3G9BA 5IIZA 2NDOA 1OYJA 1M2BA 5IMVA 5ELGA 2LNSA 1LBKA 2N5FA 3KTBA 1YDKA 2HRKA 3EU4A 1XWGA 3TRXA 4ML1A 4PX1A 4KSOA 1KNGA 1DBYA 2IMDA 1OE8A 4IP6A 2GT6A 3FR6A 4D73B 2I4AA 3H1NA 4Q5FA 5CP1A 1TJDA 3D6IA 1WP0A 5KN3A 4GTUA 2TRXA 3VFIA 3MNGA 3WD6A 4OFTA 4TXVA 2XHFA 1YY7A 5D8IA 4NV2A 3TKSA 2PMTA 2FWHA 1H4OA 5INYA 3ZIJA 4MK3A 4HQSA 2A2RA 1U6TA 1QQ2A 4EE0A 1A2LA 3ZL5A 3Q6OA 1MTCA 2O7KA 4FH8A 2OA7A 3Q74A 4IS0A 3TB2A 4IN0A 1OVNA 1HNBA 3VI5A 5DAKB 1EGRA 2VCZA 1ML6A 5GSTA 2FNOA 2C0FA 1S3CA 3GX8A 1X9WB 4WF4A 2B7JA 5FWGA 2GQLA 3E3EA 1AQXA 2HQTA 2HT9A 2H1DA 4EXJA 5A4UA 3ZLPA 3F3RA 3IR4A 1AQWA 4V2LA 2HLSA 3ZREA 5KN2A 3RHCA 1ERTA 3R3EA 1F9MA 1FVKA 2F8FA 1SJ6A 1W89A 5JWOB 2VIMA 4Z7XA 1BAYA 2ON5A 1TK5B 4FYCA 4K7NA 2MYGA 1MDKA 4K0NA 3LSZA 2XBIA 4LL4B 2VM2A 1XPVA 3TCOA 1TKDB 1EP7A 2E2GA 3BJ5A 3HJOA 2FHEA 1PD21 3CSJA 4OMVA 2H73A 1UVZA 4HQZA 3ERWA 5L71A 3D4TA 1JZOA 1T8EB 3EURA 3ZIVA 1TI1A 3ERFA 4IJIA 4OFNA 3TJJA 3GNJA 1B4QA 3GTUA 2R6KA 6GSYA 2X8HA 5KN1A 4J56E 1XIYA 2A4VA 3FEUA 2FWGA 2EIQA 3ED3A 2P5RA 4LA1A 2PGTA 2PN8A 20GSA 1QK8A 4HDEA 4I5QA 2IMIA 3QFBC 4GQCA 2YN1A 2FLSA 1J0FA 5C04A 5ABRA 3VWVA 4KCAA 4TKYA 1OC8A 3TJFA 2FA4A 3D5JA 1GUKA 1OC9B 4Q5QA 4BL7B 1O8XA 2N5AA 4MLYA 4BWSA 3KMOA 3UJ1A 2PU9C 4POLA 3UARA 2X64A 2O8VB 4PTSA 3NIVA 4YAPA 4ZILA 3US3A 2NTOA 4LL1B 3A5WA 1BEDA 4I97A 4EKZA 1A0FA 2HSNB 2WDUA 5EPFA 2H8LA 4MJCA 2L5OA 4MZBA 4N0VA 2C3TA 2H6ZA 4GLTA 3TKPA 3W8JA 2H1BA 4E8EA 3L9UA 4ECBA 3KMNA 4QL9A 1RK4A 3D22A 4TR3A 5CRWA 3H8QA 4TR1A 4ECIA 4EF0A 1A2MA 1FG4A 2IL3A 5G5EA 3UL3A 4L8EA 3CSHA 5F07A 4JU5A 2VO4A 1B4PA 2HI7A 2H72A 2X8GA 2DC5A 1ACVA 4PURA 3VURA 4G10A 5EY6A 3VPQA 4IHUA 3IA1A 2YV9A 3KM6A 1G0TA 3FYGA 3QCPA 3LORA 6GSSA 2WJUA 1ZL9A 3E0UA 1IYIA 3IK9A 3F8UA 4O7HA 1WPIA 4WBRD 5G31A 2WFCA 1JLVA 1XBSA 4F03A 3L4NA 2YWNA 4NXIA 2V6OA 4ZXGA 5G1LA 4MJAA 1FO5A 3LFLA 2VL3A 5CRGA 1LU4A 2OACA 2DIYA 1J9BA 4KE3A 3L0HA 2IFQA 2R5GA 1EEMA 3GKXA 3C1RA 4XHMA 1ZMAA 4ECCA 5HFIA 2RIIA 3U5RE 2IWTA 3UAPA 4USSA 4MMMA 1FAAA 2FA8A 1UC7A 4EC0A 4GQFA 5IO0A 3TJKA 1AXDA 4PNGA 1VF1A 2CZ3A 1O6JA 4TN8A 1B48A 3S9FA 5H5SA 1Z9HA 5ELAA 4KB3A 5JWQB 1K0DA 1T7PB 2HZEB 5ID2B 1NSWA 3CYNA 4MA9A 3VPTA 3UBKA 2B5YA 5J5NA 3GV1A 1RW1A 2JADA 2WS2A 2K8SA 1H75A 3BOAA 3KJYA 1XWBA 1FB0A 1XXUA 2AJQB 3TKRA 3G7JA 1G6WA 3GRXA 1JZDA 1GTUA 1M9BA 1XW9A 3UOMA 2R2JA 1AUCA 3CTGA 1Z3EA 3KP9A 2F9SA 3TJBA 5CNWA 5COHA 1A8LA 3IAS2 4MZCA 1G6YA 2DMLA 1OKTA 3HJMA 1JFUA 3BBYA 3NZNA 2GQMA 3DVXA 2OJLA 1EOHA 4ZBBA 1GSSA 5B6MA 4TRXA 4L5OA 4ACSA 1HNCA 3CMIA 1NM3A 2E2MA 4MH3A 4BVXA 3ZTLA 4OFMA 4JRRA 3A2XA 2WULA 1PL1A 2QKEA 3H93A 2RLIA 4PQIA 5C00A 2PWJA 2LQQA 5F05A 4I2TA 3IV4A 1N2AA 1GWCA 1Z7RA 2YJ7A 1ZCPA 4BVYA 1PKWA 5DALA 2CQ9A 2I3YA 2QGVA 4EL1A 5DVBA 5IO2A 1PA3A 1YQ1A 3ZFBA 5GZZB 3LQ7A 5ECKB 2XPDA 6GSTA 2VOCA 2HE3A 2X8CA 2H76A 4J2FA 4O32A 3R2QA 3TUEA 3C71A 3EMPA 3LJRA 1BX9A 1VF4A 2GLRA 4IQAA 3FR3A 1GSQA 5ECQB 3HY2A 3UEMA 4POMA 5A4WA 4DSSA 3F6DA 3CTFA 2NVLA 4F2IA 3IC4A 2QC7A 3PR8A 5F8BA 4MZWA 4JEDA 1PMTA 4NHWA 1BYEA 5AIVA 1K0MA 8GSSA 4KAEA 1TW9A 5A5KA 4WXTA 1SK0A 1M2AA 3FZ9A 2VD1A 4F0BA 2TRCP 1SYXA 2CV4A 2H70A 4JZQA 2ZUPA 3ZFLA 5AISA 5CAXA 4XS6A 2VM1A 5GAND 2C4JA 4FYUA 2K8VA 3W8SA 4IBPA 2R4VA 14GSA 4BPYA 1R5AA 3W6GA 4E8HA 2GSTA 2L57A 2YPMA 5IQYA 2JU5A 3FZ5A 2HXKA 2YWMA 3APQA 4KX4A 1QUWA 1X9MB 2L59A 4HEA2 5IMAA 2GGTA 4I2UA 1ERWA 1WMJA 2LV3A 5D73A 2B5XA 3ME7A 1K0BA 2HSMB 4TXOA 1EV4A 3FK8A 3GHAA 18GSA 5ECRB 2XC2A 3DXBA 3CRUA 1T00A 2C0GA 3F4SA 4K9ZA 1MD4A 1BQ7A 4TR4A 1WRYA 5LNKe 3FZAA 2B7KA 2HSYA 3KTLA 3GSSA 1V98A 1XVQA 3APOA 3L78A 2L4QA 1K3YA 2YZUA 2TIRA 2G0FA 4HUAA 3LG6A 5CRHA 4MPGA 3EU3A 4L0WA 3VWWA 1GUMA 2LEGA 5IM9A 4XIHA 2Z9SA 2P0GA 3F3QA 2OE3A 4OCEA 5G5FA 5DQYA 5CRDA 3CRTA 3DVWA 2IMFA 2O85A 3LYKA 3CSIA 4XS4B 2GZPA 1PX7A 2IMKA 2DJ0A 2L6CA 1K0CA 1GUHA 3RPNA 2AV4A 2OE0A 1T3BA 4CHSA 5DCHA 2H0IA 2OBKA 3BCIA 3ZVJA 5ECNB 2V6KA 1OAZA 1E2YA 5G30A 2OBIA 2CVKA 16GSA 1PKZA 4MCUA 1THOA 3A3TA 2H6YA 4RQRA 1USBA 1O7UA 3GN3A 1VGLA 3VK9A 5J3RA 5JCGA 2H0HA 2BTOT 3QR6A 3FHKA 1SKSB 2JL4A 1SJZA 4JE1A 3IAM2 5HFKA 2NPBA 1M0UA 3M3MA 1PGTA 3RAZA 3KIJA 2FY6A 2ZNMA 3KD0A 3C8EA 1ERUA 3D21A 1R7HA 1HNAA 1M9AA 5H5QA 3C73A 4JR4A 5IMDA 1XW5A 3UMAA 2HRFA 4LMWA 2JZSA 3GKMA 2K18A 3P7XA 4PGTA 1S3DA 2L6DA 2LSTA 3GL5A 2V41A 1EV9A 2FD3A 4KCEA 5FHIA 4HJ2A 5DQSA 2AB6A 3GKNA 2WGRA 1QMVA 4XS1A 4WBJA 1M99A 2PBJA 4ZB8A 4H86A 2QSIA 1SK1A 2RUEA 1GSDA 2VAFA 1X9SB 1TU8A 5BMUA 5B7CA 2PVOC 2VLUA 1HQOA 5F0GA 4CDOA 1EEJA 1LJRA 3ME8A 1O73A 1SL2B 3A2WA 1CQHA 3AY8A 3MDKA 3LWAA 4HZ4A 2YV7A 3HVSA 3HHVA 1A24A 3TKSE 1JZRA 1GNWA 2H1GA 2KUCA 4TVEA 2C0EA 3WYWA 6GSVA 2AUVA 3F6FA 4RUVA 1WE0A 3PGTA 1GLQA 3HZ8A 1G7OA 2HRAA 3HKRA 6GSXA 4I6XA 2DJ2A 1TRVA 2C0DA 2GT5A 4GWRA 2LTKA 1Q4JA 2H71A 1ABAA 3QFAC 1XOAA 2RM5A 4V1Ag 3HDCA 1PN9A 4IW9A 3VWUA 2H6XA 4O92A 1MEKA 5HR0A 1HD2A 1IYHA 4LLRA 4EO3A 4KH7A 1K3LA 2LJRA 2FCHA 4DVCA 3VWXA 1NHYA 1W4VA 1I9DA 1CQGA 3QAVA 2A2SA 4MF5A 2LS5A 2V1MA 3F4TA 2HRKB 2HNLA 3HVXA 5ECPB 1T4YA 4K6XA 1GLPA 4DEJA 2X99A 4N0ZA 2R3XA 4D73A 3NOFA 3RHBA 2LNTA 4NV5A 4TXOB 2YWIA 1FB6A 4O5RA 5HR1A 3RBTA 5B6NA 2KLXA 5DCGA 2V32A 3KXOA 2RUFA 2YOIA 1ON4A 1Y25A 3P90A 2GQKA 1XZOA 5ECSA 3EC3A 2BMXA 2L4CA 1FHEA 3J7Yb 4GCIA 3DWVA 3DD3A 3GIXA 4Q5RA 1Q98A 3TDGA 2GDRA 4F0CA 2OE1A 2B5EA 1K3OA 1K0OA 5DAKA 2DMMA 3PH9A 1VF2A 1URMA 2VD0A 4MF6A 4FYBA 3F63A 2BJXA 1C72A 1SD9A 2I81A 4V2MA 4ZL8A 3F9UA 1S3AA 1WJKA 5E4WA 4KF9A 1SL0B 3UBLA 1TOFA 5EL8A 4DSRA 2IIYA 3QD9A 2JZRA 3PINA 1EP8A 4L5LA 1DE1A 3TJGA 4KDUA 4ZBAA 2PUKC 5H5RA 3KP8A 1WIKA 4K0GA 2B3SA 3HVVA 5G2ZA 4MDCA 11GSA 2LUSA 1BG5A 2GSQA 22GSA 1TP9A 4N30A 2VLTA 3LYPA 1RQMA 2H30A 1X5EA 4NPBA 3O76A 2HSHA 1U88A 3ISOA 2VCVA 1Z7PA 4HZ2A 4YQMA 5EVOA 1FW1A 3GFKA 2IMEA 17GSA 1V57A 3LGCA 4IP1A 5D93A 3M1GA 3FRCA 3GTUB 2FWFA 2VCWA 1AC1A 5D96A 3G7IA 4ZB9A 2H66A 4PXOA 3ERGA 3MSZA 2FWEA 3A2VA 4PUAA 4K2DA 4YQVA 4MJEA 2KOKA 3G7YA 5D9XA 3ZVJD 1PX6A 2HZFA 1OC9A 4BL7A 4G2EA 4ILFA 1ST9A 4JBBA 5ECMB 3APSA 2LRTA 1F6MC 2GTUA 2MMAA
chains in the Genus database with same CATH superfamily
2M80A 3DKSA 3IRAA 1KBNA 4CY6A 4HU7A 4RI6A 2EFDA 2CZ2A 2OADA 2EC4A 2F3MA 3KH7A 2HSNA 2H74A 3LEFA 2F8AA 4EDYA 4QL7A 3BCKA 1QFNA 3HZ4A 1V40A 1EOGA 4TW5A 4PQ1A 3OR5A 1SD8A 3EVIA 1OC3A 1V58A 4N10A 1X5CA 5HFGA 5AIXA 1DUGA 4PUFC 1HYUA 3IK7A 4AF2A 2VLVA 5HR2A 3GL3A 4TR1B 1A8YA 2UV8G 4ECJA 2LRCA 4X0XA 4G0LA 2I9HA 4K5SA 2WB9A 5LCZA 2EIOA 2C3NA 1TK0B 4OD7A 2WRTA 3K8NA 3WGEA 1SENA 1GSUA 2WW1A 3HCZA 2GZYA 4Q5NA 4Z2TA 1AQVA 3EINA 5KN0A 1U3AA 4K5RA 3QAGA 1A0RP 2CAIA 1XWKA 2DIZA 4WETA 1XOBA 3IC8A 2M72A 2B1KA 3D4MA 2YZHA 1V2AA 1J08A 3QAWA 2VCTA 2H75A 1A23A 2KP1A 3QDNA 4XCSA 2DJJA 2ON7A 1TRSA 2P31A 5HR3A 4GXZA 5ENUA 1AAZA 2XBQA 1G7EA 3FR9A 3F0IA 5IPGA 1XW6A 1SVOA 2JSYA 4WF5A 2MMNA 2IFQB 3FMWA 5HQPA 1X5DA 3IHQA 4OO4A 2H1AA 3BD2A 4G19A 1O85A 2LKUA 1M2DA 3ZYWA 3MYDA 2KHPA 4OWYA 3RFRC 3LXTA 4L0UA 3SBCA 1AW9A 2HZEA 5ID2A 1MDIA 3DYRA 3GUSA 1KEBA 1PFOA 5IMZA 1TU7A 5J9CA 3TGZA 4AKGA 2GS3A 1F3BA 2H19A 1SK2A 2YCDA 2CAQA 4V1Ap 3QMXA 1SL1B 1KTEA 2GVPA 5CYYA 4KUNA 1PL2A 1GSYA 1GTAA 4KSMA 1JLWA 1MD3A 1U87A 3CQFA 1TI3A 4BA7A 5JCWA 2X4AA 4ISDA 5ECLB 3M9KA 5J40A 3CBUA 4IJ3A 2DBCA 2JSZA 4X1UA 2VUPA 2C80A 2FUG2 2YWOA 4GSSA 3H79A 4MH2A 4AGSA 2MMOA 1F37A 1WOUA 2G2QA 1F2EA 2UZ8A 3EYTA 2J9HA 1I5GA 2V2GA 1YZXA 1SKWB 4QMKA 1Z5YE 3D0ZA 2WCIA 2E0QA 1DE2A 5GSSA 3FY7A 5B8AA 1X0RA 2DSAA 3ZMKA 4WR4A 3H4KA 1M3IA 2AAWA 2KP2A 1GULA 4HI7A 5IOXA 3ZZXA 4RQXA 5IMFA 2CA8A 5G1KA 5ECOB 4P3YB 1TTZA 5GAPD 4BVXB 1XWAA 2H0GA 1OE7A 2YP6A 5LD0A 4OO5A 2GSSA 9GSSA 3QOUA 4KW6A 3HYPA 4MABA 1M7TA 5KEJA 5DJMA 1YVLA 4TR0A 3KH9A 3V1WA 1R26A 1ZGNA 1B9XC 1TRWA 4BVYB 5JWRB 4PQHA 4PHZC 2H01A 4YQUA 5DALB 1JZWA 2CX4A 2FGXA 1ERVA 1GH2A 4XTSA 3IPZA 3LXZA 1T4ZA 2B1LA 2XPEA 3RPPA 3RDWA 1TDIA 4OCFA 5IOWA 3WT2A 4POBA 1QGVA 4LMVA 4ZIJA 2K6VA 4NWYA 1GTBA 3A5IA 3KZQA 4AJ7A 4EVMA 4FO5A 1YJ6A 4ID0A 4N3ZA 4O5QA 2MBTA 4DSSB 3I69A 5DJLA 3TOTA 3TKQA 2NBSA 2VCQA 2C8UA 3IXRA 5E59A 1OKDA 2DJ1A 2WW0A 3I9V2 3KEBA 1SYRA 1GSEA 1U3IA 3PPUA 1O8WA 3M9JA 3MAKA 4F9ZA 1AIUA 1O81A 1VRSD 3L9SA 2YANA 4K8MA 12GSA 4YH2A 1XFLA 5D9VA 3GH9A 3TRPA 2J23A 4J57E 4KDYA 5IPHA 4GDFA 4EIQA 2LRNA 4EDZA 4BWQA 2MBSA 3GSTA 1K0NA 5DBQA 1I1IP 3KGKA 4AJ8A 5AGYA 5A34A 1E6BA 5D9TA 5J41A 2VL2C 6GSWA 2VKZG 5ECHB 3I6AA 3CHXC 3FKFA 3GYKA 4FIWA 3HXSA 3SWLA 3WGXA 2B6MA 4QQ7A 3KCMA 2HSMA 3EE2A 3UIWA 4Z2UA 2JACA 1ZYPA 2VCXA 4AKIA 4ZB6A 2AHEA 3FW2A 5IMCA 1SJIA 4PNFA 3WT1A 2PERA 3TOUA 2DLXA 4WEYA 4IELA 3ZITA 4G0KA 10GSA 1FOVA 4AJ6A 3DIEA 3P2AA 1ZZYA 2CT6A 2H1LA 2IJYA 1T1VA 4EUYA 2EIRA 1SKRB 2HRNA 2ZCTA 2A4HA 2IPAA 3JCML 2YNXA 3U6VA 2L5LA 1V9WA 3GA4A 1B8XA 4V2NA 4G0IA 1PSQA 2EFCA 2YJHA 3O3TA 1ZYQB 1GL8A 5F06A 3EWLA 3N9JA 1Z6NA 3M0FA 2GSRA 4X43A 4ULXA 3GH6A 4CY8A 1ILOA 1ZOFA 4GSNA 1F3AA 2O89A 4HU9A 1WWJA 1SVLA 4PI0C 2P5QA 3O6TA 3TRQA 2OKAA 4WR5A 3IE3A 5DDLA 4XS4A 4IKHA 4KDXA 1JHBA 3J7Yk 2O36A 2PVQA 1UA5A 1YF1A 2WW2A 4RI7A 4MJBA 3P8WA 1TRUA 4ML6A 2ES7A 1Y6EA 4A5PA 4NAXA 3TKSC 3FZ4A 1FOHA 3I43A 2CVBA 2JZTA 3HD5A 1SU9A 2EFEA 3VLNA 2PPTA 4POKA 3EMXA 2VL9A 1GTIA 1ZYEA 2N5BA 2MMZA 4NMUA 2AYTA 2DJ3A 4DSQA 3E9JB 5A4VA 2C1YA 2IN3A 3CXGA 1NW2A 1GSFA 1A2JA 2I1UA 5J9BA 1XCCA 5J4VA 3GX0A 4ZL9A 13GSA 2MZCA 5AN1A 2REMA 5A1NB 2WVZA 1GP1A 1R4WA 1N25A 2C3QA 1EGOA 4N11A 1MDJA 1SVMA 3MWHA 3GMFA 5J4UA 2LQOA 1B9YC 4CW9A 4ZBDA 2LJKA 4AKXB 2CVDA 2K9FA 4FQUA 1PRXA 2E7PA 5CO3A 1TK8B 5B8BA 1PQNA 1UN2A 4I8BA 4IVFA 1GRXA 3IOSA 4K7IA 1YEXA 1XWCA 4IGJA 3Q19A 5CREA 1YF0A 1GNEA 3DEXA 4MP4A 3N5OA 3DMLA 1XVWA 4KA0A 3WGDA 2CX3A 4K1FA 1DSBA 1TXXA 3C7MA 3GKKA 2GZZA 2RM6A 4K7OA 4TOPA 1NHOA 2ALBA 3VI7A 4JR6A 3DRNA 1EWXA 2HYXA 2O3EA 4YAVA 7GSSA 3IDVA 3UVTA 2WZSA 3Q18A 5BMUB 4GRFA 4ZL7A 4HS1A 4HJMA 3HJPA 5JCUA 5ECIB 3UVHA 2VL2A 2HFDA 1FVJA 3L9VA 3ZRDA 3GURA 1EZKA 4GSTA 5A5HA 4XRAA 4MPFA 1YKAA 4KGIA 2WZ9A 2O87A 3HA9A 4GF0A 4NHZA 1THXA 1R5PA 2DJKA 1YKCA 2O5VA 3C1SA 4WKWA 2LJAA 2R0GA 4KNDA 19GSA 2D2ZA 1QXHA 5FT3A 4XRDA 4G9HA 2M46A 4MF7A 1YEPA 2R37A 5D9WA 3ZMLA 1BJXA 3F4RA 4F82A 3QPMA 3IBHA 1VF3A 1K0AA 4IQ1A 3DGQA 4HOJA 2F51A 2DKIA 1Z6MA 6GSUA 1N8JA 3M8NA 3G9BA 5IIZA 2EFHA 2NDOA 1OYJA 1M2BA 5IMVA 5ELGA 2LNSA 1LBKA 2N5FA 3KTBA 1YDKA 2QA2A 2HRKA 3EU4A 1XWGA 3TRXA 4ML1A 4PX1A 4KSOA 1KNGA 1DBYA 2R0PA 4K2XA 2IMDA 1OE8A 4IP6A 2GT6A 3FR6A 4D73B 5J47A 2I4AA 3H1NA 4Q5FA 5CP1A 1TJDA 3D6IA 1WP0A 5KN3A 4GTUA 2TRXA 3VFIA 3MNGA 3WD6A 4OFTA 4TXVA 2XHFA 1YY7A 5D8IA 4NV2A 3TKSA 2PMTA 2FWHA 1H4OA 5INYA 3ZIJA 4MK3A 4HQSA 2A2RA 1U6TA 1QQ2A 4EE0A 1A2LA 3ZL5A 4O5UA 3Q6OA 1MTCA 2WVXA 2O7KA 4FH8A 2OA7A 3Q74A 4IS0A 3TB2A 4IN0A 1OVNA 1HNBA 3VI5A 5DAKB 1EGRA 2VCZA 1ML6A 5GSTA 2FNOA 2C0FA 1S3CA 3GX8A 1X9WB 4WF4A 2B7JA 5FWGA 2GQLA 3E3EA 1AQXA 2HQTA 2HT9A 2H1DA 4EXJA 5A4UA 3EPTA 3ZLPA 3F3RA 3IR4A 1AQWA 4V2LA 2HLSA 3ZREA 5KN2A 4ICYA 3RHCA 1ERTA 3R3EA 1F9MA 1FVKA 2F8FA 1SJ6A 1W89A 5JWOB 2VIMA 4Z7XA 1BAYA 2ON5A 1TK5B 4FYCA 4K7NA 2MYGA 1MDKA 4K0NA 3LSZA 2XBIA 3LW9A 4LL4B 2VM2A 1XPVA 3TCOA 1TKDB 1EP7A 2E2GA 3BJ5A 4G01A 3HJOA 2FHEA 1PD21 3CSJA 4OMVA 2H73A 1UVZA 4HQZA 3ERWA 5L71A 3D4TA 1JZOA 1T8EB 3EURA 3ZIVA 1TI1A 3ERFA 4IJIA 4OFNA 3TJJA 3GNJA 1B4QA 3GTUA 2R6KA 6GSYA 2X8HA 5KN1A 4J56E 1XIYA 2A4VA 3FEUA 2FWGA 2EIQA 4MNNA 2OT3A 3ED3A 5KOWA 2P5RA 4LA1A 2PGTA 2PN8A 20GSA 1QK8A 4HDEA 4I5QA 2A2PA 2IMIA 3QFBC 4GQCA 2YN1A 2FLSA 1J0FA 5C04A 5ABRA 1Y1UA 3VWVA 4KCAA 4TKYA 1OC8A 3CWGA 3TJFA 2FA4A 3D5JA 1GUKA 1OC9B 4Q5QA 4BL7B 1O8XA 2N5AA 4MLYA 4BWSA 3KMOA 3UJ1A 2PU9C 4POLA 3UARA 2X64A 2O8VB 4PTSA 3NIVA 4YAPA 4ZILA 3US3A 4YKGA 2NTOA 4LL1B 3A5WA 1BEDA 4I97A 4EKZA 1A0FA 2HSNB 2WDUA 5EPFA 2H8LA 4MJCA 1M3JA 2L5OA 4MZBA 4N0VA 2C3TA 2H6ZA 4GLTA 3TKPA 3W8JA 2H1BA 4E8EA 3L9UA 4ECBA 3KMNA 4QL9A 2QA1A 1RK4A 3MIXA 3D22A 4TR3A 5CRWA 3H8QA 4TR1A 4ECIA 4EF0A 1A2MA 1FG4A 1S4BP 2IL3A 5G5EA 3UL3A 4L8EA 3CSHA 5F07A 4JU5A 2VO4A 1B4PA 2HI7A 2H72A 2X8GA 2DC5A 1ACVA 4PURA 3VURA 4G10A 5EY6A 3VPQA 4IHUA 3IA1A 2YV9A 3KM6A 1G0TA 3FYGA 3QCPA 3LORA 6GSSA 2WJUA 1ZL9A 3E0UA 1IYIA 3IK9A 3F8UA 4O7HA 1WPIA 4WBRD 5G31A 2WFCA 1JLVA 1XBSA 4F03A 3L4NA 2YWNA 4NXIA 2V6OA 4ZXGA 5G1LA 4MJAA 1FO5A 3LFLA 2VL3A 5CRGA 1LU4A 2OACA 2DIYA 1J9BA 4KE3A 3L0HA 2IFQA 2R5GA 1EEMA 3GKXA 3C1RA 4XHMA 1ZMAA 4ECCA 5HFIA 2RIIA 3U5RE 2IWTA 3UAPA 4USSA 4MMMA 1FAAA 2FA8A 1UC7A 4EC0A 4GQFA 2WW3A 5IO0A 3TJKA 1AXDA 5BRTA 4PNGA 1VF1A 2CZ3A 1O6JA 4TN8A 1B48A 3S9FA 5H5SA 1Z9HA 5ELAA 4KB3A 5JWQB 1K0DA 1T7PB 1XG8A 2HZEB 5ID2B 1NSWA 3CYNA 2DKHA 4MA9A 3VPTA 3UBKA 2B5YA 5J5NA 2WVYA 1RW1A 3GV1A 2JADA 2WS2A 2K8SA 1H75A 3BOAA 3KJYA 1XWBA 5KOXA 1FB0A 1XXUA 2AJQB 3TKRA 3G7JA 1G6WA 3GRXA 1JZDA 1GTUA 2R0CA 1M9BA 1XW9A 3UOMA 2R2JA 1AUCA 3CTGA 1Z3EA 4ZB7A 3KP9A 2F9SA 3TJBA 5CNWA 4BIKA 5COHA 1A8LA 3IAS2 4MZCA 1G6YA 2DMLA 1OKTA 3HJMA 1JFUA 3BBYA 3NZNA 2GQMA 3DVXA 2OJLA 1EOHA 4ZBBA 1GSSA 5B6MA 4TRXA 4L5OA 4ACSA 1HNCA 3CMIA 1NM3A 3IHGA 2E2MA 4MH3A 4BVXA 3ZTLA 4OFMA 4JRRA 3A2XA 2WULA 1PL1A 2QKEA 3H93A 2RLIA 4PQIA 5C00A 2PWJA 2LQQA 5F05A 4I2TA 3IV4A 1N2AA 1GWCA 1Z7RA 5J4YA 2YJ7A 1ZCPA 4BVYA 3RGBC 1PKWA 5DALA 2CQ9A 2I3YA 2QGVA 4EL1A 5DVBA 5IO2A 1PA3A 1YQ1A 3ZFBA 5GZZB 3LQ7A 5ECKB 2XPDA 6GSTA 2VOCA 2HE3A 2X8CA 2H76A 4Z2RA 4J2FA 4O32A 3R2QA 3TUEA 3C71A 3EMPA 3LJRA 1BX9A 1VF4A 2GLRA 4IQAA 3FR3A 1GSQA 5ECQB 3HY2A 3UEMA 4POMA 5A4WA 4DSSA 3F6DA 3CTFA 2NVLA 4F2IA 3IC4A 2QC7A 3PR8A 5F8BA 4MZWA 4JEDA 1PMTA 4NHWA 1BYEA 5AIVA 1K0MA 8GSSA 4KAEA 1TW9A 5A5KA 4WXTA 1SK0A 1M2AA 3FZ9A 2VD1A 4F0BA 2TRCP 1SYXA 2CV4A 2H70A 4JZQA 2ZUPA 3ZFLA 5AISA 5CAXA 4XS6A 2VM1A 5GAND 2C4JA 4FYUA 2K8VA 3W8SA 4IBPA 2R4VA 1YEWC 14GSA 4BPYA 1R5AA 3W6GA 4E8HA 2GSTA 2L57A 2YPMA 5IQYA 2JU5A 3FZ5A 2HXKA 5A34B 2YWMA 3APQA 4KX4A 1QUWA 1X9MB 2L59A 4HEA2 5IMAA 2GGTA 1ERWA 1WMJA 2LV3A 4I2UA 5D73A 2B5XA 3ME7A 1K0BA 2HSMB 4TXOA 1EV4A 3FK8A 3GHAA 18GSA 5ECRB 2XC2A 3DXBA 3CRUA 1T00A 2C0GA 3F4SA 4K9ZA 1MD4A 1BQ7A 4TR4A 1WRYA 5LNKe 3FZAA 2B7KA 2HSYA 3KTLA 3GSSA 1V98A 1XVQA 3APOA 3L78A 2L4QA 1K3YA 4PI2C 2YZUA 2TIRA 2G0FA 4HUAA 3LG6A 5CRHA 4MPGA 3EU3A 4L0WA 3VWWA 1GUMA 2LEGA 5IM9A 4XIHA 2Z9SA 2P0GA 3F3QA 2OE3A 4OCEA 5G5FA 5DQYA 5CRDA 3CRTA 3DVWA 2IMFA 2O85A 3LYKA 3CSIA 4XS4B 4YKFA 2GZPA 1PX7A 2IMKA 2DJ0A 2L6CA 1K0CA 1GUHA 3RPNA 2AV4A 2OE0A 1T3BA 4CHSA 5DCHA 1TXUA 2H0IA 2OBKA 3BCIA 3HVNA 3ZVJA 5ECNB 2V6KA 1OAZA 1E2YA 5G30A 2OBIA 2CVKA 16GSA 1PKZA 4MCUA 1THOA 3A3TA 4EIPA 2H6YA 4RQRA 1USBA 1O7UA 3GN3A 1VGLA 3VK9A 5J3RA 5JCGA 2H0HA 2BTOT 3FHKA 3QR6A 5A1NA 1SKSB 2JL4A 1SJZA 4JE1A 3IAM2 5HFKA 4FXYP 2NPBA 1M0UA 3M3MA 1PGTA 3RAZA 3KIJA 2FY6A 2X49A 2ZNMA 3KD0A 3C8EA 1ERUA 3TU3B 3D21A 1R7HA 1HNAA 1M9AA 5H5QA 3C73A 4JR4A 5IMDA 1XW5A 3UMAA 2HRFA 4LMWA 2JZSA 3GKMA 2K18A 3P7XA 4PGTA 1S3DA 2L6DA 2LSTA 3GL5A 2V41A 1EV9A 2FD3A 4KCEA 5FHIA 4HJ2A 5DQSA 1BG1A 2AB6A 3GKNA 1PN0A 2WGRA 1QMVA 4XS1A 4WBJA 1M99A 2PBJA 4ZB8A 4H86A 2QSIA 1SK1A 2RUEA 1GSDA 2VAFA 1X9SB 1TU8A 5BMUA 5B7CA 2PVOC 2VLUA 1HQOA 5F0GA 4CDOA 1EEJA 1LJRA 3ME8A 1O73A 1SL2B 3A2WA 1CQHA 4HSCX 3AY8A 3MDKA 3LWAA 4HZ4A 2YV7A 3HVSA 3HHVA 1A24A 3TKSE 1JZRA 1GNWA 2H1GA 2KUCA 4TVEA 2C0EA 3WYWA 5A5HB 6GSVA 2AUVA 3F6FA 4RUVA 1WE0A 3PGTA 1GLQA 3HZ8A 1G7OA 2HRAA 3HKRA 6GSXA 4I6XA 2DJ2A 1TRVA 2C0DA 2GT5A 4GWRA 2LTKA 1Q4JA 2H71A 1ABAA 3QFAC 1XOAA 2RM5A 4V1Ag 3HDCA 1PN9A 4IW9A 3HMJG 3VWUA 2H6XA 4O92A 1MEKA 5HR0A 1HD2A 1IYHA 4LLRA 1BF5A 4EO3A 4KH7A 1K3LA 2LJRA 4X4JA 2FCHA 4DVCA 3VWXA 1NHYA 1W4VA 1I9DA 1CQGA 3QAVA 2A2SA 4MF5A 4W66A 2LS5A 2V1MA 3F4TA 2HRKB 2HNLA 3HVXA 5ECPB 1T4YA 4K6XA 1GLPA 4DEJA 2X99A 4N0ZA 2R3XA 4D73A 3NOFA 3RHBA 2LNTA 4NV5A 4TXOB 2YWIA 1FB6A 4O5RA 5HR1A 3RBTA 5B6NA 2KLXA 5DCGA 2V32A 3KXOA 2RUFA 2YOIA 1ON4A 1Y25A 3P90A 2GQKA 1XZOA 4E68A 4AI6A 5ECSA 3EC3A 2BMXA 2L4CA 1FHEA 3J7Yb 4GCIA 3DWVA 3DD3A 3GIXA 4Q5RA 1Q98A 3TDGA 2GDRA 4F0CA 2OE1A 2B5EA 1K3OA 1K0OA 2WVXB 5DAKA 2DMMA 3PH9A 1VF2A 1URMA 2VD0A 4MF6A 4FYBA 3F63A 2BJXA 1C72A 1S3RA 1SD9A 2I81A 4V2MA 4ZL8A 3F9UA 1S3AA 1WJKA 5E4WA 4KF9A 1SL0B 3UBLA 1TOFA 5EL8A 4DSRA 2IIYA 3QD9A 2JZRA 3PINA 4AKHA 1EP8A 4L5LA 1DE1A 3TJGA 4KDUA 4ZBAA 2PUKC 5H5RA 3KP8A 1WIKA 4K0GA 2B3SA 3HVVA 5G2ZA 4MDCA 11GSA 2LUSA 1BG5A 2GSQA 22GSA 1TP9A 4N30A 2VLTA 3LYPA 1RQMA 2H30A 1X5EA 4NPBA 3O76A 1ZYNA 2HSHA 1U88A 3ISOA 2VCVA 1Z7PA 4HZ2A 4YQMA 5EVOA 1FW1A 3GFKA 2IMEA 17GSA 1V57A 3LGCA 4IP1A 5D93A 3M1GA 3FRCA 3GTUB 2FWFA 2VCWA 1AC1A 5D96A 3G7IA 4ZB9A 2H66A 4PXOA 3ERGA 3MSZA 2FWEA 3A2VA 4PUAA 4K2DA 4YQVA 4MJEA 2KOKA 3G7YA 5D9XA 3ZVJD 1PX6A 2HZFA 1OC9A 4BL7A 4G2EA 4ILFA 1ST9A 4JBBA 5ECMB 3APSA 2LRTA 1F6MC 2GTUA 2MMAA
chains in the Genus database with same CATH topology
2M80A 3DKSA 3IRAA 1KBNA 4CY6A 4HU7A 4RI6A 2EFDA 2CZ2A 2OADA 2EC4A 2F3MA 3KH7A 2HSNA 2H74A 3LEFA 2F8AA 4EDYA 4QL7A 3BCKA 1QFNA 3HZ4A 1V40A 1EOGA 4TW5A 4PQ1A 3OR5A 1SD8A 3EVIA 1OC3A 1V58A 4N10A 1X5CA 5HFGA 5AIXA 1DUGA 4PUFC 1HYUA 3IK7A 4AF2A 2VLVA 5HR2A 3GL3A 4TR1B 1A8YA 2UV8G 4ECJA 2LRCA 4X0XA 4G0LA 2I9HA 4K5SA 2WB9A 5LCZA 2EIOA 2C3NA 1TK0B 4OD7A 2WRTA 3K8NA 3WGEA 1SENA 1GSUA 3HCZA 2GZYA 4Q5NA 4Z2TA 1AQVA 3EINA 5KN0A 1U3AA 4K5RA 3QAGA 1A0RP 2CAIA 1XWKA 2DIZA 4WETA 1XOBA 3IC8A 2M72A 2B1KA 3D4MA 2YZHA 1V2AA 1J08A 3QAWA 2VCTA 2H75A 1A23A 2KP1A 3QDNA 4XCSA 2DJJA 2ON7A 1TRSA 2P31A 5HR3A 4GXZA 5ENUA 1AAZA 2XBQA 1G7EA 3FR9A 3F0IA 5IPGA 1XW6A 1SVOA 2JSYA 4WF5A 2MMNA 2IFQB 3FMWA 5HQPA 1X5DA 3IHQA 4OO4A 2H1AA 3BD2A 4G19A 1O85A 2LKUA 1M2DA 3ZYWA 3MYDA 2KHPA 4OWYA 3LXTA 4L0UA 3SBCA 1AW9A 2HZEA 5ID2A 1MDIA 3DYRA 3GUSA 1KEBA 5IMZA 1TU7A 5J9CA 3TGZA 4AKGA 2GS3A 1F3BA 2H19A 1SK2A 2YCDA 2CAQA 4V1Ap 3QMXA 1SL1B 1KTEA 2GVPA 5CYYA 4KUNA 1PL2A 1GSYA 1GTAA 4KSMA 1JLWA 1MD3A 1U87A 1TI3A 4BA7A 5JCWA 2X4AA 4ISDA 5ECLB 3M9KA 5J40A 3CBUA 4IJ3A 2DBCA 2JSZA 4X1UA 2VUPA 2C80A 2FUG2 2YWOA 4GSSA 3H79A 4MH2A 4AGSA 2MMOA 1F37A 1WOUA 2G2QA 1F2EA 2UZ8A 3EYTA 2J9HA 1I5GA 2V2GA 1YZXA 1SKWB 4QMKA 1Z5YE 3D0ZA 2WCIA 2E0QA 1DE2A 5GSSA 3FY7A 5B8AA 1X0RA 2DSAA 3ZMKA 4WR4A 3H4KA 2AAWA 2KP2A 1GULA 4HI7A 5IOXA 3ZZXA 4RQXA 5IMFA 2CA8A 5G1KA 5ECOB 4P3YB 1TTZA 5GAPD 4BVXB 1XWAA 2H0GA 1OE7A 2YP6A 5LD0A 4OO5A 2GSSA 9GSSA 3QOUA 4KW6A 3HYPA 4MABA 1M7TA 5KEJA 5DJMA 1YVLA 4TR0A 3KH9A 3V1WA 1R26A 1ZGNA 1B9XC 1TRWA 4BVYB 5JWRB 4PQHA 2H01A 4YQUA 5DALB 1JZWA 2CX4A 2FGXA 1ERVA 1GH2A 4XTSA 3IPZA 3LXZA 1T4ZA 2B1LA 2XPEA 3RPPA 3RDWA 1TDIA 4OCFA 5IOWA 3WT2A 4POBA 1QGVA 4LMVA 4ZIJA 2K6VA 4NWYA 1GTBA 3A5IA 3KZQA 4AJ7A 4EVMA 4FO5A 1YJ6A 4ID0A 4N3ZA 4O5QA 2MBTA 4DSSB 3I69A 5DJLA 3TOTA 3TKQA 2NBSA 2VCQA 2C8UA 3IXRA 5E59A 1OKDA 2DJ1A 3I9V2 3KEBA 1SYRA 1GSEA 1U3IA 3PPUA 1O8WA 3M9JA 3MAKA 4F9ZA 1AIUA 1O81A 1VRSD 3L9SA 2YANA 4K8MA 12GSA 4YH2A 1XFLA 5D9VA 3GH9A 3TRPA 2J23A 4J57E 4KDYA 5IPHA 4GDFA 4EIQA 2LRNA 4EDZA 4BWQA 2MBSA 3GSTA 1K0NA 5DBQA 3KGKA 4AJ8A 5AGYA 5A34A 1E6BA 5D9TA 5J41A 2VL2C 6GSWA 2VKZG 5ECHB 3I6AA 3FKFA 3GYKA 4FIWA 3HXSA 3SWLA 3WGXA 2B6MA 4QQ7A 3KCMA 2HSMA 3EE2A 3UIWA 4Z2UA 2JACA 1ZYPA 2VCXA 4AKIA 4ZB6A 2AHEA 3FW2A 5IMCA 1SJIA 4PNFA 3WT1A 2PERA 3TOUA 2DLXA 4WEYA 4IELA 3ZITA 4G0KA 10GSA 1FOVA 4AJ6A 3DIEA 3P2AA 1ZZYA 2CT6A 2H1LA 2IJYA 1T1VA 4EUYA 2EIRA 1SKRB 2HRNA 2ZCTA 2A4HA 2IPAA 3JCML 2YNXA 3U6VA 2L5LA 1V9WA 3GA4A 1B8XA 4V2NA 4G0IA 1PSQA 2EFCA 2YJHA 3O3TA 1ZYQB 1GL8A 5F06A 3EWLA 3N9JA 1Z6NA 3M0FA 2GSRA 4X43A 4ULXA 3GH6A 4CY8A 1ILOA 1ZOFA 4GSNA 1F3AA 2O89A 4HU9A 1WWJA 1SVLA 2P5QA 3O6TA 3TRQA 2OKAA 4WR5A 3IE3A 5DDLA 4XS4A 4IKHA 4KDXA 1JHBA 3J7Yk 2PVQA 1UA5A 1YF1A 4RI7A 4MJBA 3P8WA 1TRUA 4ML6A 2ES7A 1Y6EA 4A5PA 4NAXA 3TKSC 3FZ4A 1FOHA 3I43A 2CVBA 2JZTA 3HD5A 1SU9A 2EFEA 3VLNA 2PPTA 4POKA 3EMXA 2VL9A 1GTIA 1ZYEA 2N5BA 2MMZA 4NMUA 2AYTA 2DJ3A 4DSQA 3E9JB 5A4VA 2C1YA 2IN3A 3CXGA 1NW2A 1GSFA 1A2JA 2I1UA 5J9BA 1XCCA 5J4VA 3GX0A 4ZL9A 13GSA 2MZCA 5AN1A 2REMA 5A1NB 1GP1A 1R4WA 1N25A 2C3QA 1EGOA 4N11A 1MDJA 1SVMA 3MWHA 3GMFA 5J4UA 2LQOA 1B9YC 4CW9A 4ZBDA 2LJKA 4AKXB 2CVDA 2K9FA 4FQUA 1PRXA 2E7PA 5CO3A 1TK8B 5B8BA 1PQNA 1UN2A 4I8BA 4IVFA 1GRXA 3IOSA 4K7IA 1YEXA 1XWCA 4IGJA 3Q19A 5CREA 1YF0A 1GNEA 3DEXA 4MP4A 3N5OA 3DMLA 1XVWA 4KA0A 3WGDA 2CX3A 4K1FA 1DSBA 1TXXA 3C7MA 3GKKA 2GZZA 2RM6A 4K7OA 4TOPA 1NHOA 2ALBA 3VI7A 4JR6A 3DRNA 1EWXA 2HYXA 4YAVA 7GSSA 3IDVA 3UVTA 3Q18A 5BMUB 4GRFA 4ZL7A 4HS1A 4HJMA 3HJPA 5JCUA 5ECIB 3UVHA 2VL2A 2HFDA 1FVJA 3L9VA 3ZRDA 3GURA 1EZKA 4GSTA 5A5HA 4XRAA 4MPFA 1YKAA 4KGIA 2WZ9A 2O87A 3HA9A 4GF0A 4NHZA 1THXA 1R5PA 2DJKA 1YKCA 2O5VA 3C1SA 4WKWA 2LJAA 2R0GA 4KNDA 19GSA 2D2ZA 1QXHA 5FT3A 4XRDA 4G9HA 2M46A 4MF7A 1YEPA 2R37A 5D9WA 3ZMLA 1BJXA 3F4RA 4F82A 3QPMA 3IBHA 1VF3A 1K0AA 4IQ1A 3DGQA 4HOJA 2F51A 2DKIA 1Z6MA 6GSUA 1N8JA 3M8NA 3G9BA 5IIZA 2EFHA 2NDOA 1OYJA 1M2BA 5IMVA 5ELGA 2LNSA 1LBKA 2N5FA 3KTBA 1YDKA 2QA2A 2HRKA 3EU4A 1XWGA 3TRXA 4ML1A 4PX1A 4KSOA 1KNGA 1DBYA 2R0PA 4K2XA 2IMDA 1OE8A 4IP6A 2GT6A 3FR6A 4D73B 5J47A 2I4AA 3H1NA 4Q5FA 5CP1A 1TJDA 3D6IA 1WP0A 5KN3A 4GTUA 2TRXA 3VFIA 3MNGA 3WD6A 4OFTA 4TXVA 2XHFA 1YY7A 5D8IA 4NV2A 3TKSA 2PMTA 2FWHA 1H4OA 5INYA 3ZIJA 4MK3A 4HQSA 2A2RA 1U6TA 1QQ2A 4EE0A 1A2LA 3ZL5A 4O5UA 3Q6OA 1MTCA 2O7KA 4FH8A 2OA7A 3Q74A 4IS0A 3TB2A 4IN0A 1OVNA 1HNBA 3VI5A 5DAKB 1EGRA 2VCZA 1ML6A 5GSTA 2FNOA 2C0FA 1S3CA 3GX8A 1X9WB 4WF4A 2B7JA 5FWGA 2GQLA 3E3EA 1AQXA 2HQTA 2HT9A 2H1DA 4EXJA 5A4UA 3EPTA 3ZLPA 3F3RA 3IR4A 1AQWA 4V2LA 2HLSA 3ZREA 5KN2A 4ICYA 3RHCA 1ERTA 3R3EA 1F9MA 1FVKA 2F8FA 1SJ6A 1W89A 5JWOB 2VIMA 4Z7XA 1BAYA 2ON5A 1TK5B 4FYCA 4K7NA 2MYGA 1MDKA 4K0NA 3LSZA 2XBIA 3LW9A 4LL4B 2VM2A 1XPVA 3TCOA 1TKDB 1EP7A 2E2GA 3BJ5A 4G01A 3HJOA 2FHEA 1PD21 3CSJA 4OMVA 2H73A 1UVZA 4HQZA 3ERWA 5L71A 3D4TA 1JZOA 1T8EB 3EURA 3ZIVA 1TI1A 3ERFA 4IJIA 4OFNA 3TJJA 3GNJA 1B4QA 3GTUA 2R6KA 6GSYA 2X8HA 5KN1A 4J56E 1XIYA 2A4VA 3FEUA 2FWGA 2EIQA 4MNNA 2OT3A 3ED3A 5KOWA 2P5RA 4LA1A 2PGTA 2PN8A 20GSA 1QK8A 4HDEA 4I5QA 2A2PA 2IMIA 3QFBC 4GQCA 2YN1A 2FLSA 1J0FA 5C04A 5ABRA 1Y1UA 3VWVA 4KCAA 4TKYA 1OC8A 3CWGA 3TJFA 2FA4A 3D5JA 1GUKA 1OC9B 4Q5QA 4BL7B 1O8XA 2N5AA 4MLYA 4BWSA 3KMOA 3UJ1A 2PU9C 4POLA 3UARA 2X64A 2O8VB 4PTSA 3NIVA 4YAPA 4ZILA 3US3A 4YKGA 2NTOA 4LL1B 3A5WA 1BEDA 4I97A 4EKZA 1A0FA 2HSNB 2WDUA 5EPFA 2H8LA 4MJCA 2L5OA 4MZBA 4N0VA 2C3TA 2H6ZA 4GLTA 3TKPA 3W8JA 2H1BA 4E8EA 3L9UA 4ECBA 3KMNA 4QL9A 2QA1A 1RK4A 3MIXA 3D22A 4TR3A 5CRWA 3H8QA 4TR1A 4ECIA 4EF0A 1A2MA 1FG4A 2IL3A 5G5EA 3UL3A 4L8EA 3CSHA 5F07A 4JU5A 2VO4A 1B4PA 2HI7A 2H72A 2X8GA 2DC5A 1ACVA 4PURA 3VURA 4G10A 5EY6A 3VPQA 4IHUA 3IA1A 2YV9A 3KM6A 1G0TA 3FYGA 3QCPA 3LORA 6GSSA 2WJUA 1ZL9A 3E0UA 1IYIA 3IK9A 3F8UA 4O7HA 1WPIA 4WBRD 5G31A 2WFCA 1JLVA 1XBSA 4F03A 3L4NA 2YWNA 4NXIA 2V6OA 4ZXGA 5G1LA 4MJAA 1FO5A 3LFLA 2VL3A 5CRGA 1LU4A 2OACA 2DIYA 1J9BA 4KE3A 3L0HA 2IFQA 2R5GA 1EEMA 3GKXA 3C1RA 4XHMA 1ZMAA 4ECCA 5HFIA 2RIIA 3U5RE 2IWTA 3UAPA 4USSA 4MMMA 1FAAA 2FA8A 1UC7A 4EC0A 4GQFA 5IO0A 3TJKA 1AXDA 5BRTA 4PNGA 1VF1A 2CZ3A 1O6JA 4TN8A 1B48A 3S9FA 5H5SA 1Z9HA 5ELAA 4KB3A 5JWQB 1K0DA 1T7PB 2HZEB 5ID2B 1NSWA 3CYNA 2DKHA 4MA9A 3VPTA 3UBKA 2B5YA 5J5NA 3GV1A 1RW1A 2JADA 2WS2A 2K8SA 1H75A 3BOAA 3KJYA 1XWBA 5KOXA 1FB0A 1XXUA 2AJQB 3TKRA 3G7JA 1G6WA 3GRXA 1JZDA 1GTUA 2R0CA 1M9BA 1XW9A 3UOMA 2R2JA 1AUCA 3CTGA 1Z3EA 4ZB7A 3KP9A 2F9SA 3TJBA 5CNWA 5COHA 1A8LA 3IAS2 4MZCA 1G6YA 2DMLA 1OKTA 3HJMA 1JFUA 3BBYA 3NZNA 2GQMA 3DVXA 2OJLA 1EOHA 4ZBBA 1GSSA 5B6MA 4TRXA 4L5OA 4ACSA 1HNCA 3CMIA 1NM3A 3IHGA 2E2MA 4MH3A 4BVXA 3ZTLA 4OFMA 4JRRA 3A2XA 2WULA 1PL1A 2QKEA 3H93A 2RLIA 4PQIA 5C00A 2PWJA 2LQQA 5F05A 4I2TA 3IV4A 1N2AA 1GWCA 1Z7RA 5J4YA 2YJ7A 1ZCPA 4BVYA 1PKWA 5DALA 2CQ9A 2I3YA 2QGVA 4EL1A 5DVBA 5IO2A 1PA3A 1YQ1A 3ZFBA 5GZZB 3LQ7A 5ECKB 2XPDA 6GSTA 2VOCA 2HE3A 2X8CA 2H76A 4Z2RA 4J2FA 4O32A 3R2QA 3TUEA 3C71A 3EMPA 3LJRA 1BX9A 1VF4A 2GLRA 4IQAA 3FR3A 1GSQA 5ECQB 3HY2A 3UEMA 4POMA 5A4WA 4DSSA 3F6DA 3CTFA 2NVLA 4F2IA 3IC4A 2QC7A 3PR8A 5F8BA 4MZWA 4JEDA 1PMTA 4NHWA 1BYEA 5AIVA 1K0MA 8GSSA 4KAEA 1TW9A 5A5KA 4WXTA 1SK0A 1M2AA 3FZ9A 2VD1A 4F0BA 2TRCP 1SYXA 2CV4A 2H70A 4JZQA 2ZUPA 3ZFLA 5AISA 5CAXA 4XS6A 2VM1A 5GAND 2C4JA 4FYUA 2K8VA 3W8SA 4IBPA 2R4VA 14GSA 4BPYA 1R5AA 3W6GA 4E8HA 2GSTA 2L57A 2YPMA 5IQYA 2JU5A 3FZ5A 2HXKA 5A34B 2YWMA 3APQA 4KX4A 1QUWA 1X9MB 2L59A 4HEA2 5IMAA 2GGTA 1ERWA 1WMJA 2LV3A 4I2UA 5D73A 2B5XA 3ME7A 1K0BA 2HSMB 4TXOA 1EV4A 3FK8A 3GHAA 18GSA 5ECRB 2XC2A 3DXBA 3CRUA 1T00A 2C0GA 3F4SA 4K9ZA 1MD4A 1BQ7A 4TR4A 1WRYA 5LNKe 3FZAA 2B7KA 2HSYA 3KTLA 3GSSA 1V98A 1XVQA 3APOA 3L78A 2L4QA 1K3YA 2YZUA 2TIRA 2G0FA 4HUAA 3LG6A 5CRHA 4MPGA 3EU3A 4L0WA 3VWWA 1GUMA 2LEGA 5IM9A 4XIHA 2Z9SA 2P0GA 3F3QA 2OE3A 4OCEA 5G5FA 5DQYA 5CRDA 3CRTA 3DVWA 2IMFA 2O85A 3LYKA 3CSIA 4XS4B 4YKFA 2GZPA 1PX7A 2IMKA 2DJ0A 2L6CA 1K0CA 1GUHA 3RPNA 2AV4A 2OE0A 1T3BA 4CHSA 5DCHA 1TXUA 2H0IA 2OBKA 3BCIA 3ZVJA 5ECNB 2V6KA 1OAZA 1E2YA 5G30A 2OBIA 2CVKA 16GSA 1PKZA 4MCUA 1THOA 3A3TA 4EIPA 2H6YA 4RQRA 1USBA 1O7UA 3GN3A 1VGLA 3VK9A 5J3RA 5JCGA 2H0HA 2BTOT 3FHKA 3QR6A 5A1NA 1SKSB 2JL4A 1SJZA 4JE1A 3IAM2 5HFKA 2NPBA 1M0UA 3M3MA 1PGTA 3RAZA 3KIJA 2FY6A 2X49A 2ZNMA 3KD0A 3C8EA 1ERUA 3TU3B 3D21A 1R7HA 1HNAA 1M9AA 5H5QA 3C73A 4JR4A 5IMDA 1XW5A 3UMAA 2HRFA 4LMWA 2JZSA 3GKMA 2K18A 3P7XA 4PGTA 1S3DA 2L6DA 2LSTA 3GL5A 2V41A 1EV9A 2FD3A 4KCEA 5FHIA 4HJ2A 5DQSA 1BG1A 2AB6A 3GKNA 1PN0A 2WGRA 1QMVA 4XS1A 4WBJA 1M99A 2PBJA 4ZB8A 4H86A 2QSIA 1SK1A 2RUEA 1GSDA 2VAFA 1X9SB 1TU8A 5BMUA 5B7CA 2PVOC 2VLUA 1HQOA 5F0GA 4CDOA 1EEJA 1LJRA 3ME8A 1O73A 1SL2B 3A2WA 1CQHA 3AY8A 3MDKA 3LWAA 4HZ4A 2YV7A 3HVSA 3HHVA 1A24A 3TKSE 1JZRA 1GNWA 2H1GA 2KUCA 4TVEA 2C0EA 3WYWA 5A5HB 6GSVA 2AUVA 3F6FA 4RUVA 1WE0A 3PGTA 1GLQA 3HZ8A 1G7OA 2HRAA 3HKRA 6GSXA 4I6XA 2DJ2A 1TRVA 2C0DA 2GT5A 4GWRA 2LTKA 1Q4JA 2H71A 1ABAA 3QFAC 1XOAA 2RM5A 4V1Ag 3HDCA 1PN9A 4IW9A 3HMJG 3VWUA 2H6XA 4O92A 1MEKA 5HR0A 1HD2A 1IYHA 4LLRA 1BF5A 4EO3A 4KH7A 1K3LA 2LJRA 4X4JA 2FCHA 4DVCA 3VWXA 1NHYA 1W4VA 1I9DA 1CQGA 3QAVA 2A2SA 4MF5A 4W66A 2LS5A 2V1MA 3F4TA 2HRKB 2HNLA 3HVXA 5ECPB 1T4YA 4K6XA 1GLPA 4DEJA 2X99A 4N0ZA 2R3XA 4D73A 3NOFA 3RHBA 2LNTA 4NV5A 4TXOB 2YWIA 1FB6A 4O5RA 5HR1A 3RBTA 5B6NA 2KLXA 5DCGA 2V32A 3KXOA 2RUFA 2YOIA 1ON4A 1Y25A 3P90A 2GQKA 1XZOA 4E68A 4AI6A 5ECSA 3EC3A 2BMXA 2L4CA 1FHEA 3J7Yb 4GCIA 3DWVA 3DD3A 3GIXA 4Q5RA 1Q98A 3TDGA 2GDRA 4F0CA 2OE1A 2B5EA 1K3OA 1K0OA 5DAKA 2DMMA 3PH9A 1VF2A 1URMA 2VD0A 4MF6A 4FYBA 3F63A 2BJXA 1C72A 1SD9A 2I81A 4V2MA 4ZL8A 3F9UA 1S3AA 1WJKA 5E4WA 4KF9A 1SL0B 3UBLA 1TOFA 5EL8A 4DSRA 2IIYA 3QD9A 2JZRA 3PINA 4AKHA 1EP8A 4L5LA 1DE1A 3TJGA 4KDUA 4ZBAA 2PUKC 5H5RA 3KP8A 1WIKA 4K0GA 2B3SA 3HVVA 5G2ZA 4MDCA 11GSA 2LUSA 1BG5A 2GSQA 22GSA 1TP9A 4N30A 2VLTA 3LYPA 1RQMA 2H30A 1X5EA 4NPBA 3O76A 1ZYNA 2HSHA 1U88A 3ISOA 2VCVA 1Z7PA 4HZ2A 4YQMA 5EVOA 1FW1A 3GFKA 2IMEA 17GSA 1V57A 3LGCA 4IP1A 5D93A 3M1GA 3FRCA 3GTUB 2FWFA 2VCWA 1AC1A 5D96A 3G7IA 4ZB9A 2H66A 4PXOA 3ERGA 3MSZA 2FWEA 3A2VA 4PUAA 4K2DA 4YQVA 4MJEA 2KOKA 3G7YA 5D9XA 3ZVJD 1PX6A 2HZFA 1OC9A 4BL7A 4G2EA 4ILFA 1ST9A 4JBBA 5ECMB 3APSA 2LRTA 1F6MC 2GTUA 2MMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M80 A;  3DKS A;  3IRA A;  1KBN A;  4HU7 A;  4RI6 A;  2CZ2 A;  2OAD A;  2EC4 A;  2F3M A;  3KH7 A;  3LEF A;  2H74 A;  2F8A A;  4EDY A;  4QL7 A;  3BCK A;  1QFN A;  3HZ4 A;  1V40 A;  1EOG A;  4TW5 A;  4PQ1 A;  3OR5 A;  1SD8 A;  3EVI A;  1OC3 A;  1V58 A;  4N10 A;  1X5C A;  5HFG A;  5AIX A;  1DUG A;  4PUF C;  1HYU A;  3IK7 A;  4AF2 A;  2VLV A;  5HR2 A;  3GL3 A;  4TR1 B;  1A8Y A;  4ECJ A;  2LRC A;  4X0X A;  4G0L A;  2I9H A;  2WB9 A;  5LCZ A;  2EIO A;  2C3N A;  1TK0 B;  4OD7 A;  2WRT A;  3K8N A;  3WGE A;  1SEN A;  1GSU A;  3HCZ A;  2GZY A;  4Q5N A;  1AQV A;  3EIN A;  5KN0 A;  1U3A A;  3QAG A;  1A0R P;  2CAI A;  1XWK A;  2DIZ A;  4WET A;  1XOB A;  3IC8 A;  2M72 A;  2B1K A;  3D4M A;  2YZH A;  1V2A A;  1J08 A;  3QAW A;  2VCT A;  2H75 A;  1A23 A;  2KP1 A;  3QDN A;  4XCS A;  2DJJ A;  2ON7 A;  1TRS A;  2P31 A;  5HR3 A;  4GXZ A;  5ENU A;  1AAZ A;  2XBQ A;  1G7E A;  3FR9 A;  3F0I A;  5IPG A;  1XW6 A;  2JSY A;  4WF5 A;  2MMN A;  2IFQ B;  5HQP A;  1X5D A;  3IHQ A;  4OO4 A;  2H1A A;  3BD2 A;  4G19 A;  1O85 A;  2LKU A;  1M2D A;  3ZYW A;  2KHP A;  4OWY A;  3LXT A;  4L0U A;  3SBC A;  1AW9 A;  2HZE A;  5ID2 A;  1MDI A;  3DYR A;  3GUS A;  1KEB A;  5IMZ A;  1TU7 A;  5J9C A;  3TGZ A;  2GS3 A;  1F3B A;  2H19 A;  1SK2 A;  2YCD A;  2CAQ A;  4V1A p;  3QMX A;  1SL1 B;  1KTE A;  2GVP A;  5CYY A;  4KUN A;  1PL2 A;  1GSY A;  1GTA A;  4KSM A;  1JLW A;  1MD3 A;  1U87 A;  1TI3 A;  4BA7 A;  5JCW A;  4ISD A;  5ECL B;  3M9K A;  3CBU A;  4IJ3 A;  2DBC A;  2JSZ A;  4X1U A;  2VUP A;  2C80 A;  2FUG 2;  2YWO A;  4GSS A;  3H79 A;  4MH2 A;  4AGS A;  2MMO A;  1F37 A;  1WOU A;  2G2Q A;  1F2E A;  2UZ8 A;  3EYT A;  2J9H A;  1I5G A;  2V2G A;  1YZX A;  1SKW B;  1Z5Y E;  3D0Z A;  2WCI A;  2E0Q A;  1DE2 A;  5GSS A;  3FY7 A;  5B8A A;  1X0R A;  2DSA A;  3ZMK A;  4WR4 A;  3H4K A;  2AAW A;  2KP2 A;  1GUL A;  4HI7 A;  5IOX A;  3ZZX A;  4RQX A;  5IMF A;  2CA8 A;  5G1K A;  5ECO B;  4P3Y B;  1TTZ A;  5GAP D;  4BVX B;  1XWA A;  2H0G A;  1OE7 A;  2YP6 A;  5LD0 A;  4OO5 A;  2GSS A;  9GSS A;  3QOU A;  4KW6 A;  3HYP A;  4MAB A;  1M7T A;  5KEJ A;  5DJM A;  4TR0 A;  3KH9 A;  3V1W A;  1R26 A;  1ZGN A;  1B9X C;  1TRW A;  4BVY B;  5JWR B;  4PQH A;  2H01 A;  4YQU A;  5DAL B;  1JZW A;  2CX4 A;  2FGX A;  1ERV A;  1GH2 A;  4XTS A;  3IPZ A;  3LXZ A;  1T4Z A;  2B1L A;  2XPE A;  3RPP A;  3RDW A;  1TDI A;  4OCF A;  5IOW A;  3WT2 A;  4POB A;  1QGV A;  4LMV A;  4ZIJ A;  2K6V A;  4NWY A;  1GTB A;  3KZQ A;  4AJ7 A;  4EVM A;  4FO5 A;  1YJ6 A;  4ID0 A;  2MBT A;  4DSS B;  3I69 A;  5DJL A;  3TOT A;  3TKQ A;  2NBS A;  2VCQ A;  2C8U A;  3IXR A;  5E59 A;  1OKD A;  2DJ1 A;  3I9V 2;  3KEB A;  1SYR A;  1GSE A;  1U3I A;  3PPU A;  1O8W A;  3M9J A;  3MAK A;  4F9Z A;  1AIU A;  1O81 A;  1VRS D;  3L9S A;  2YAN A;  4K8M A;  12GS A;  4YH2 A;  1XFL A;  5D9V A;  3GH9 A;  3TRP A;  2J23 A;  4J57 E;  4KDY A;  5IPH A;  2LRN A;  4EDZ A;  4BWQ A;  2MBS A;  3GST A;  1K0N A;  5DBQ A;  3KGK A;  4AJ8 A;  5AGY A;  1E6B A;  5D9T A;  5J41 A;  2VL2 C;  6GSW A;  5ECH B;  3I6A A;  3FKF A;  4FIW A;  3GYK A;  3HXS A;  3SWL A;  3WGX A;  2B6M A;  4QQ7 A;  3KCM A;  2HSM A;  3EE2 A;  3UIW A;  2JAC A;  2VCX A;  4ZB6 A;  2AHE A;  3FW2 A;  5IMC A;  1SJI A;  4PNF A;  3WT1 A;  2PER A;  3TOU A;  2DLX A;  4WEY A;  4IEL A;  3ZIT A;  4G0K A;  10GS A;  1FOV A;  4AJ6 A;  3DIE A;  3P2A A;  1ZZY A;  2CT6 A;  2IJY A;  1T1V A;  4EUY A;  2EIR A;  1SKR B;  2HRN A;  2ZCT A;  2IPA A;  3JCM L;  2YNX A;  3U6V A;  2L5L A;  1V9W A;  3GA4 A;  1B8X A;  4V2N A;  4G0I A;  1PSQ A;  2YJH A;  3O3T A;  1ZYQ B;  1GL8 A;  5F06 A;  3EWL A;  3N9J A;  1Z6N A;  3M0F A;  2GSR A;  4X43 A;  4ULX A;  3GH6 A;  1ILO A;  1ZOF A;  4GSN A;  1F3A A;  2O89 A;  4HU9 A;  1WWJ A;  2P5Q A;  3O6T A;  3TRQ A;  2OKA A;  4WR5 A;  3IE3 A;  5DDL A;  4XS4 A;  4IKH A;  4KDX A;  1JHB A;  3J7Y k;  2PVQ A;  1UA5 A;  1YF1 A;  4RI7 A;  4MJB A;  3P8W A;  1TRU A;  4ML6 A;  2ES7 A;  1Y6E A;  4NAX A;  3TKS C;  3FZ4 A;  3I43 A;  2CVB A;  2JZT A;  3HD5 A;  1SU9 A;  3VLN A;  2PPT A;  4POK A;  3EMX A;  2VL9 A;  1GTI A;  1ZYE A;  2N5B A;  2MMZ A;  4NMU A;  2AYT A;  2DJ3 A;  4DSQ A;  3E9J B;  5A4V A;  2C1Y A;  2IN3 A;  3CXG A;  1NW2 A;  1GSF A;  1A2J A;  2I1U A;  5J9B A;  1XCC A;  3GX0 A;  4ZL9 A;  13GS A;  2MZC A;  5AN1 A;  2REM A;  1GP1 A;  1R4W A;  2C3Q A;  1EGO A;  4N11 A;  1MDJ A;  3MWH A;  3GMF A;  5J4U A;  2LQO A;  1B9Y C;  4CW9 A;  4ZBD A;  2LJK A;  2CVD A;  2K9F A;  4FQU A;  1PRX A;  2E7P A;  5CO3 A;  1TK8 B;  5B8B A;  1PQN A;  1UN2 A;  4I8B A;  4IVF A;  1GRX A;  3IOS A;  4K7I A;  1YEX A;  1XWC A;  4IGJ A;  3Q19 A;  5CRE A;  1YF0 A;  1GNE A;  3DEX A;  4MP4 A;  3N5O A;  3DML A;  1XVW A;  4KA0 A;  3WGD A;  2CX3 A;  4K1F A;  1DSB A;  1TXX A;  3C7M A;  3GKK A;  2GZZ A;  2RM6 A;  4K7O A;  4TOP A;  1NHO A;  2ALB A;  3VI7 A;  4JR6 A;  3DRN A;  1EWX A;  2HYX A;  4YAV A;  7GSS A;  3IDV A;  3UVT A;  3Q18 A;  4GRF A;  4ZL7 A;  4HS1 A;  4HJM A;  3HJP A;  5JCU A;  5ECI B;  3UVH A;  2VL2 A;  2HFD A;  1FVJ A;  3L9V A;  3ZRD A;  3GUR A;  1EZK A;  4GST A;  4XRA A;  4MPF A;  1YKA A;  4KGI A;  2WZ9 A;  2O87 A;  3HA9 A;  4GF0 A;  4NHZ A;  1THX A;  1R5P A;  2DJK A;  1YKC A;  3C1S A;  4WKW A;  2LJA A;  4KND A;  19GS A;  2D2Z A;  1QXH A;  5FT3 A;  4XRD A;  4G9H A;  2M46 A;  4MF7 A;  1YEP A;  2R37 A;  5D9W A;  3ZML A;  1BJX A;  3F4R A;  4F82 A;  3QPM A;  3IBH A;  1VF3 A;  1K0A A;  4IQ1 A;  3DGQ A;  4HOJ A;  2F51 A;  1Z6M A;  6GSU A;  1N8J A;  3M8N A;  3G9B A;  5IIZ A;  2NDO A;  1OYJ A;  1M2B A;  5IMV A;  5ELG A;  2LNS A;  1LBK A;  2N5F A;  3KTB A;  1YDK A;  2HRK A;  3EU4 A;  1XWG A;  3TRX A;  4ML1 A;  4PX1 A;  4KSO A;  1KNG A;  1DBY A;  2IMD A;  1OE8 A;  4IP6 A;  2GT6 A;  3FR6 A;  4D73 B;  2I4A A;  3H1N A;  4Q5F A;  5CP1 A;  1TJD A;  3D6I A;  1WP0 A;  5KN3 A;  4GTU A;  2TRX A;  3VFI A;  3MNG A;  3WD6 A;  4OFT A;  4TXV A;  2XHF A;  1YY7 A;  5D8I A;  4NV2 A;  3TKS A;  2PMT A;  2FWH A;  1H4O A;  5INY A;  3ZIJ A;  4MK3 A;  4HQS A;  2A2R A;  1U6T A;  1QQ2 A;  4EE0 A;  1A2L A;  3ZL5 A;  3Q6O A;  1MTC A;  2O7K A;  4FH8 A;  2OA7 A;  3Q74 A;  4IS0 A;  3TB2 A;  4IN0 A;  1OVN A;  1HNB A;  3VI5 A;  5DAK B;  1EGR A;  2VCZ A;  1ML6 A;  5GST A;  2FNO A;  2C0F A;  1S3C A;  3GX8 A;  1X9W B;  4WF4 A;  2B7J A;  5FWG A;  2GQL A;  3E3E A;  1AQX A;  2HQT A;  2HT9 A;  2H1D A;  4EXJ A;  5A4U A;  3ZLP A;  3F3R A;  3IR4 A;  1AQW A;  4V2L A;  2HLS A;  3ZRE A;  5KN2 A;  3RHC A;  1ERT A;  3R3E A;  1F9M A;  1FVK A;  2F8F A;  1SJ6 A;  1W89 A;  5JWO B;  2VIM A;  4Z7X A;  1BAY A;  2ON5 A;  1TK5 B;  4FYC A;  4K7N A;  2MYG A;  1MDK A;  4K0N A;  3LSZ A;  2XBI A;  4LL4 B;  2VM2 A;  1XPV A;  3TCO A;  1TKD B;  1EP7 A;  2E2G A;  3BJ5 A;  3HJO A;  2FHE A;  1PD2 1;  3CSJ A;  4OMV A;  2H73 A;  1UVZ A;  4HQZ A;  3ERW A;  5L71 A;  3D4T A;  1JZO A;  1T8E B;  3EUR A;  3ZIV A;  1TI1 A;  3ERF A;  4IJI A;  4OFN A;  3TJJ A;  3GNJ A;  1B4Q A;  3GTU A;  2R6K A;  6GSY A;  2X8H A;  5KN1 A;  4J56 E;  1XIY A;  2A4V A;  3FEU A;  2FWG A;  2EIQ A;  3ED3 A;  2P5R A;  4LA1 A;  2PGT A;  2PN8 A;  20GS A;  1QK8 A;  4HDE A;  4I5Q A;  2IMI A;  3QFB C;  4GQC A;  2YN1 A;  2FLS A;  1J0F A;  5C04 A;  5ABR A;  3VWV A;  4KCA A;  4TKY A;  1OC8 A;  3TJF A;  2FA4 A;  3D5J A;  1GUK A;  1OC9 B;  4Q5Q A;  4BL7 B;  1O8X A;  2N5A A;  4MLY A;  4BWS A;  3KMO A;  3UJ1 A;  2PU9 C;  4POL A;  3UAR A;  2X64 A;  2O8V B;  4PTS A;  3NIV A;  4YAP A;  4ZIL A;  3US3 A;  2NTO A;  4LL1 B;  3A5W A;  1BED A;  4I97 A;  4EKZ A;  1A0F A;  2HSN B;  2WDU A;  5EPF A;  2H8L A;  4MJC A;  2L5O A;  4MZB A;  4N0V A;  2C3T A;  2H6Z A;  4GLT A;  3TKP A;  3W8J A;  2H1B A;  4E8E A;  3L9U A;  4ECB A;  3KMN A;  4QL9 A;  1RK4 A;  3D22 A;  4TR3 A;  5CRW A;  3H8Q A;  4TR1 A;  4ECI A;  4EF0 A;  1A2M A;  1FG4 A;  2IL3 A;  5G5E A;  3UL3 A;  4L8E A;  3CSH A;  5F07 A;  4JU5 A;  2VO4 A;  1B4P A;  2HI7 A;  2H72 A;  2X8G A;  2DC5 A;  1ACV A;  4PUR A;  3VUR A;  4G10 A;  5EY6 A;  3VPQ A;  4IHU A;  3IA1 A;  2YV9 A;  3KM6 A;  1G0T A;  3FYG A;  3QCP A;  3LOR A;  6GSS A;  2WJU A;  1ZL9 A;  3E0U A;  1IYI A;  3IK9 A;  3F8U A;  4O7H A;  1WPI A;  4WBR D;  5G31 A;  2WFC A;  1JLV A;  1XBS A;  4F03 A;  3L4N A;  2YWN A;  4NXI A;  2V6O A;  4ZXG A;  5G1L A;  4MJA A;  1FO5 A;  3LFL A;  2VL3 A;  5CRG A;  1LU4 A;  2OAC A;  2DIY A;  1J9B A;  4KE3 A;  3L0H A;  2IFQ A;  2R5G A;  1EEM A;  3GKX A;  3C1R A;  4XHM A;  1ZMA A;  4ECC A;  5HFI A;  2RII A;  3U5R E;  2IWT A;  3UAP A;  4USS A;  4MMM A;  1FAA A;  2FA8 A;  1UC7 A;  4EC0 A;  4GQF A;  5IO0 A;  3TJK A;  1AXD A;  4PNG A;  1VF1 A;  2CZ3 A;  1O6J A;  4TN8 A;  1B48 A;  3S9F A;  5H5S A;  1Z9H A;  5ELA A;  4KB3 A;  5JWQ B;  1K0D A;  1T7P B;  2HZE B;  5ID2 B;  1NSW A;  3CYN A;  4MA9 A;  3VPT A;  3UBK A;  2B5Y A;  5J5N A;  3GV1 A;  1RW1 A;  2JAD A;  2WS2 A;  2K8S A;  1H75 A;  3BOA A;  3KJY A;  1XWB A;  1FB0 A;  1XXU A;  2AJQ B;  3TKR A;  3G7J A;  1G6W A;  3GRX A;  1JZD A;  1GTU A;  1M9B A;  1XW9 A;  3UOM A;  2R2J A;  1AUC A;  3CTG A;  1Z3E A;  3KP9 A;  2F9S A;  3TJB A;  5CNW A;  5COH A;  1A8L A;  3IAS 2;  4MZC A;  1G6Y A;  2DML A;  1OKT A;  3HJM A;  1JFU A;  3BBY A;  3NZN A;  2GQM A;  3DVX A;  2OJL A;  1EOH A;  4ZBB A;  1GSS A;  5B6M A;  4TRX A;  4L5O A;  4ACS A;  1HNC A;  3CMI A;  1NM3 A;  2E2M A;  4MH3 A;  4BVX A;  3ZTL A;  4OFM A;  4JRR A;  3A2X A;  2WUL A;  1PL1 A;  2QKE A;  3H93 A;  2RLI A;  4PQI A;  5C00 A;  2PWJ A;  2LQQ A;  5F05 A;  4I2T A;  3IV4 A;  1N2A A;  1GWC A;  1Z7R A;  2YJ7 A;  1ZCP A;  4BVY A;  1PKW A;  5DAL A;  2CQ9 A;  2I3Y A;  2QGV A;  4EL1 A;  5DVB A;  5IO2 A;  1PA3 A;  1YQ1 A;  3ZFB A;  5GZZ B;  3LQ7 A;  5ECK B;  2XPD A;  6GST A;  2VOC A;  2HE3 A;  2X8C A;  2H76 A;  4J2F A;  4O32 A;  3R2Q A;  3TUE A;  3C71 A;  3EMP A;  3LJR A;  1BX9 A;  1VF4 A;  2GLR A;  4IQA A;  3FR3 A;  1GSQ A;  5ECQ B;  3HY2 A;  3UEM A;  4POM A;  5A4W A;  4DSS A;  3F6D A;  3CTF A;  2NVL A;  4F2I A;  3IC4 A;  2QC7 A;  3PR8 A;  5F8B A;  4MZW A;  4JED A;  1PMT A;  4NHW A;  1BYE A;  5AIV A;  1K0M A;  8GSS A;  4KAE A;  1TW9 A;  5A5K A;  4WXT A;  1SK0 A;  1M2A A;  3FZ9 A;  2VD1 A;  4F0B A;  2TRC P;  1SYX A;  2CV4 A;  2H70 A;  4JZQ A;  2ZUP A;  3ZFL A;  5AIS A;  5CAX A;  4XS6 A;  2VM1 A;  5GAN D;  2C4J A;  4FYU A;  2K8V A;  3W8S A;  4IBP A;  2R4V A;  14GS A;  4BPY A;  1R5A A;  3W6G A;  4E8H A;  2GST A;  2L57 A;  2YPM A;  5IQY A;  2JU5 A;  3FZ5 A;  2HXK A;  2YWM A;  3APQ A;  4KX4 A;  1QUW A;  1X9M B;  2L59 A;  4HEA 2;  5IMA A;  2GGT A;  4I2U A;  1ERW A;  1WMJ A;  2LV3 A;  5D73 A;  2B5X A;  3ME7 A;  1K0B A;  2HSM B;  4TXO A;  1EV4 A;  3FK8 A;  3GHA A;  18GS A;  5ECR B;  2XC2 A;  3DXB A;  3CRU A;  1T00 A;  2C0G A;  3F4S A;  4K9Z A;  1MD4 A;  1BQ7 A;  4TR4 A;  1WRY A;  5LNK e;  3FZA A;  2B7K A;  2HSY A;  3KTL A;  3GSS A;  1V98 A;  1XVQ A;  3APO A;  3L78 A;  2L4Q A;  1K3Y A;  2YZU A;  2TIR A;  2G0F A;  4HUA A;  3LG6 A;  5CRH A;  4MPG A;  3EU3 A;  4L0W A;  3VWW A;  1GUM A;  2LEG A;  5IM9 A;  4XIH A;  2Z9S A;  2P0G A;  3F3Q A;  2OE3 A;  4OCE A;  5G5F A;  5DQY A;  5CRD A;  3CRT A;  3DVW A;  2IMF A;  2O85 A;  3LYK A;  3CSI A;  4XS4 B;  2GZP A;  1PX7 A;  2IMK A;  2DJ0 A;  2L6C A;  1K0C A;  1GUH A;  3RPN A;  2AV4 A;  2OE0 A;  1T3B A;  4CHS A;  5DCH A;  2H0I A;  2OBK A;  3BCI A;  3ZVJ A;  5ECN B;  2V6K A;  1OAZ A;  1E2Y A;  5G30 A;  2OBI A;  2CVK A;  16GS A;  1PKZ A;  4MCU A;  1THO A;  3A3T A;  2H6Y A;  4RQR A;  1USB A;  1O7U A;  3GN3 A;  1VGL A;  3VK9 A;  5J3R A;  5JCG A;  2H0H A;  2BTO T;  3QR6 A;  3FHK A;  1SKS B;  2JL4 A;  1SJZ A;  4JE1 A;  3IAM 2;  5HFK A;  2NPB A;  1M0U A;  3M3M A;  1PGT A;  3RAZ A;  3KIJ A;  2FY6 A;  2ZNM A;  3KD0 A;  3C8E A;  1ERU A;  3D21 A;  1R7H A;  1HNA A;  1M9A A;  5H5Q A;  3C73 A;  4JR4 A;  5IMD A;  1XW5 A;  3UMA A;  2HRF A;  4LMW A;  2JZS A;  3GKM A;  2K18 A;  3P7X A;  4PGT A;  1S3D A;  2L6D A;  2LST A;  3GL5 A;  2V41 A;  1EV9 A;  2FD3 A;  4KCE A;  5FHI A;  4HJ2 A;  5DQS A;  2AB6 A;  3GKN A;  2WGR A;  1QMV A;  4XS1 A;  4WBJ A;  1M99 A;  2PBJ A;  4ZB8 A;  4H86 A;  2QSI A;  1SK1 A;  2RUE A;  1GSD A;  2VAF A;  1X9S B;  1TU8 A;  5BMU A;  5B7C A;  2PVO C;  2VLU A;  1HQO A;  5F0G A;  4CDO A;  1EEJ A;  1LJR A;  3ME8 A;  1O73 A;  1SL2 B;  3A2W A;  1CQH A;  3AY8 A;  3MDK A;  3LWA A;  4HZ4 A;  2YV7 A;  3HVS A;  3HHV A;  1A24 A;  3TKS E;  1JZR A;  1GNW A;  2H1G A;  2KUC A;  4TVE A;  2C0E A;  3WYW A;  6GSV A;  2AUV A;  3F6F A;  4RUV A;  1WE0 A;  3PGT A;  1GLQ A;  3HZ8 A;  1G7O A;  2HRA A;  3HKR A;  6GSX A;  4I6X A;  2DJ2 A;  1TRV A;  2C0D A;  2GT5 A;  4GWR A;  2LTK A;  1Q4J A;  2H71 A;  1ABA A;  3QFA C;  1XOA A;  2RM5 A;  4V1A g;  3HDC A;  1PN9 A;  4IW9 A;  3VWU A;  2H6X A;  4O92 A;  1MEK A;  5HR0 A;  1HD2 A;  1IYH A;  4LLR A;  4EO3 A;  4KH7 A;  1K3L A;  2LJR A;  2FCH A;  4DVC A;  3VWX A;  1NHY A;  1W4V A;  1I9D A;  1CQG A;  3QAV A;  2A2S A;  4MF5 A;  2LS5 A;  2V1M A;  3F4T A;  2HRK B;  2HNL A;  3HVX A;  5ECP B;  1T4Y A;  4K6X A;  1GLP A;  4DEJ A;  2X99 A;  4N0Z A;  2R3X A;  4D73 A;  3NOF A;  3RHB A;  2LNT A;  4NV5 A;  4TXO B;  2YWI A;  1FB6 A;  4O5R A;  5HR1 A;  3RBT A;  5B6N A;  2KLX A;  5DCG A;  2V32 A;  3KXO A;  2RUF A;  2YOI A;  1ON4 A;  1Y25 A;  3P90 A;  2GQK A;  1XZO A;  5ECS A;  3EC3 A;  2BMX A;  2L4C A;  1FHE A;  3J7Y b;  4GCI A;  3DWV A;  3DD3 A;  3GIX A;  4Q5R A;  1Q98 A;  3TDG A;  2GDR A;  4F0C A;  2OE1 A;  2B5E A;  1K3O A;  1K0O A;  5DAK A;  2DMM A;  3PH9 A;  1VF2 A;  1URM A;  2VD0 A;  4MF6 A;  4FYB A;  3F63 A;  2BJX A;  1C72 A;  1SD9 A;  2I81 A;  4V2M A;  4ZL8 A;  3F9U A;  1S3A A;  1WJK A;  5E4W A;  4KF9 A;  1SL0 B;  3UBL A;  1TOF A;  5EL8 A;  4DSR A;  2IIY A;  3QD9 A;  2JZR A;  3PIN A;  1EP8 A;  4L5L A;  1DE1 A;  3TJG A;  4KDU A;  4ZBA A;  2PUK C;  5H5R A;  3KP8 A;  1WIK A;  4K0G A;  2B3S A;  3HVV A;  5G2Z A;  4MDC A;  11GS A;  2LUS A;  1BG5 A;  2GSQ A;  22GS A;  1TP9 A;  4N30 A;  2VLT A;  3LYP A;  1RQM A;  2H30 A;  1X5E A;  4NPB A;  3O76 A;  2HSH A;  1U88 A;  3ISO A;  2VCV A;  1Z7P A;  4HZ2 A;  4YQM A;  5EVO A;  1FW1 A;  3GFK A;  2IME A;  17GS A;  1V57 A;  3LGC A;  4IP1 A;  5D93 A;  3M1G A;  3FRC A;  3GTU B;  2FWF A;  2VCW A;  1AC1 A;  5D96 A;  3G7I A;  4ZB9 A;  2H66 A;  4PXO A;  3ERG A;  3MSZ A;  2FWE A;  3A2V A;  4PUA A;  4K2D A;  4YQV A;  4MJE A;  2KOK A;  3G7Y A;  5D9X A;  3ZVJ D;  1PX6 A;  2HZF A;  1OC9 A;  4BL7 A;  4G2E A;  4ILF A;  1ST9 A;  4JBB A;  5ECM B;  3APS A;  2LRT A;  1F6M C;  2GTU A;  2MMA A; 
#chains in the Genus database with same CATH topology
 2M80 A;  3DKS A;  3IRA A;  1KBN A;  4CY6 A;  4HU7 A;  4RI6 A;  2EFD A;  2CZ2 A;  2OAD A;  2EC4 A;  2F3M A;  3KH7 A;  2HSN A;  2H74 A;  3LEF A;  2F8A A;  4EDY A;  4QL7 A;  3BCK A;  1QFN A;  3HZ4 A;  1V40 A;  1EOG A;  4TW5 A;  4PQ1 A;  3OR5 A;  1SD8 A;  3EVI A;  1OC3 A;  1V58 A;  4N10 A;  1X5C A;  5HFG A;  5AIX A;  1DUG A;  4PUF C;  1HYU A;  3IK7 A;  4AF2 A;  2VLV A;  5HR2 A;  3GL3 A;  4TR1 B;  1A8Y A;  2UV8 G;  4ECJ A;  2LRC A;  4X0X A;  4G0L A;  2I9H A;  4K5S A;  2WB9 A;  5LCZ A;  2EIO A;  2C3N A;  1TK0 B;  4OD7 A;  2WRT A;  3K8N A;  3WGE A;  1SEN A;  1GSU A;  2WW1 A;  3HCZ A;  2GZY A;  4Q5N A;  4Z2T A;  1AQV A;  3EIN A;  5KN0 A;  1U3A A;  4K5R A;  3QAG A;  1A0R P;  2CAI A;  1XWK A;  2DIZ A;  4WET A;  1XOB A;  3IC8 A;  2M72 A;  2B1K A;  3D4M A;  2YZH A;  1V2A A;  1J08 A;  3QAW A;  2VCT A;  2H75 A;  1A23 A;  2KP1 A;  3QDN A;  4XCS A;  2DJJ A;  2ON7 A;  1TRS A;  2P31 A;  5HR3 A;  4GXZ A;  5ENU A;  1AAZ A;  2XBQ A;  1G7E A;  3FR9 A;  3F0I A;  5IPG A;  1XW6 A;  1SVO A;  2JSY A;  4WF5 A;  2MMN A;  2IFQ B;  3FMW A;  5HQP A;  1X5D A;  3IHQ A;  4OO4 A;  2H1A A;  3BD2 A;  4G19 A;  1O85 A;  2LKU A;  1M2D A;  3ZYW A;  3MYD A;  2KHP A;  4OWY A;  3RFR C;  3LXT A;  4L0U A;  3SBC A;  1AW9 A;  2HZE A;  5ID2 A;  1MDI A;  3DYR A;  3GUS A;  1KEB A;  1PFO A;  5IMZ A;  1TU7 A;  5J9C A;  3TGZ A;  4AKG A;  2GS3 A;  1F3B A;  2H19 A;  1SK2 A;  2YCD A;  2CAQ A;  4V1A p;  3QMX A;  1SL1 B;  1KTE A;  2GVP A;  5CYY A;  4KUN A;  1PL2 A;  1GSY A;  1GTA A;  4KSM A;  1JLW A;  1MD3 A;  1U87 A;  3CQF A;  1TI3 A;  4BA7 A;  5JCW A;  2X4A A;  4ISD A;  5ECL B;  3M9K A;  5J40 A;  3CBU A;  4IJ3 A;  2DBC A;  2JSZ A;  4X1U A;  2VUP A;  2C80 A;  2FUG 2;  2YWO A;  4GSS A;  3H79 A;  4MH2 A;  4AGS A;  2MMO A;  1F37 A;  1WOU A;  2G2Q A;  1F2E A;  2UZ8 A;  3EYT A;  2J9H A;  1I5G A;  2V2G A;  1YZX A;  1SKW B;  4QMK A;  1Z5Y E;  3D0Z A;  2WCI A;  2E0Q A;  1DE2 A;  5GSS A;  3FY7 A;  5B8A A;  1X0R A;  2DSA A;  3ZMK A;  4WR4 A;  3H4K A;  1M3I A;  2AAW A;  2KP2 A;  1GUL A;  4HI7 A;  5IOX A;  3ZZX A;  4RQX A;  5IMF A;  2CA8 A;  5G1K A;  5ECO B;  4P3Y B;  1TTZ A;  5GAP D;  4BVX B;  1XWA A;  2H0G A;  1OE7 A;  2YP6 A;  5LD0 A;  4OO5 A;  2GSS A;  9GSS A;  3QOU A;  4KW6 A;  3HYP A;  4MAB A;  1M7T A;  5KEJ A;  5DJM A;  1YVL A;  4TR0 A;  3KH9 A;  3V1W A;  1R26 A;  1ZGN A;  1B9X C;  1TRW A;  4BVY B;  5JWR B;  4PQH A;  4PHZ C;  2H01 A;  4YQU A;  5DAL B;  1JZW A;  2CX4 A;  2FGX A;  1ERV A;  1GH2 A;  4XTS A;  3IPZ A;  3LXZ A;  1T4Z A;  2B1L A;  2XPE A;  3RPP A;  3RDW A;  1TDI A;  4OCF A;  5IOW A;  3WT2 A;  4POB A;  1QGV A;  4LMV A;  4ZIJ A;  2K6V A;  4NWY A;  1GTB A;  3A5I A;  3KZQ A;  4AJ7 A;  4EVM A;  4FO5 A;  1YJ6 A;  4ID0 A;  4N3Z A;  4O5Q A;  2MBT A;  4DSS B;  3I69 A;  5DJL A;  3TOT A;  3TKQ A;  2NBS A;  2VCQ A;  2C8U A;  3IXR A;  5E59 A;  1OKD A;  2DJ1 A;  2WW0 A;  3I9V 2;  3KEB A;  1SYR A;  1GSE A;  1U3I A;  3PPU A;  1O8W A;  3M9J A;  3MAK A;  4F9Z A;  1AIU A;  1O81 A;  1VRS D;  3L9S A;  2YAN A;  4K8M A;  12GS A;  4YH2 A;  1XFL A;  5D9V A;  3GH9 A;  3TRP A;  2J23 A;  4J57 E;  4KDY A;  5IPH A;  4GDF A;  4EIQ A;  2LRN A;  4EDZ A;  4BWQ A;  2MBS A;  3GST A;  1K0N A;  5DBQ A;  1I1I P;  3KGK A;  4AJ8 A;  5AGY A;  5A34 A;  1E6B A;  5D9T A;  5J41 A;  2VL2 C;  6GSW A;  2VKZ G;  5ECH B;  3I6A A;  3CHX C;  3FKF A;  3GYK A;  4FIW A;  3HXS A;  3SWL A;  3WGX A;  2B6M A;  4QQ7 A;  3KCM A;  2HSM A;  3EE2 A;  3UIW A;  4Z2U A;  2JAC A;  1ZYP A;  2VCX A;  4AKI A;  4ZB6 A;  2AHE A;  3FW2 A;  5IMC A;  1SJI A;  4PNF A;  3WT1 A;  2PER A;  3TOU A;  2DLX A;  4WEY A;  4IEL A;  3ZIT A;  4G0K A;  10GS A;  1FOV A;  4AJ6 A;  3DIE A;  3P2A A;  1ZZY A;  2CT6 A;  2H1L A;  2IJY A;  1T1V A;  4EUY A;  2EIR A;  1SKR B;  2HRN A;  2ZCT A;  2A4H A;  2IPA A;  3JCM L;  2YNX A;  3U6V A;  2L5L A;  1V9W A;  3GA4 A;  1B8X A;  4V2N A;  4G0I A;  1PSQ A;  2EFC A;  2YJH A;  3O3T A;  1ZYQ B;  1GL8 A;  5F06 A;  3EWL A;  3N9J A;  1Z6N A;  3M0F A;  2GSR A;  4X43 A;  4ULX A;  3GH6 A;  4CY8 A;  1ILO A;  1ZOF A;  4GSN A;  1F3A A;  2O89 A;  4HU9 A;  1WWJ A;  1SVL A;  4PI0 C;  2P5Q A;  3O6T A;  3TRQ A;  2OKA A;  4WR5 A;  3IE3 A;  5DDL A;  4XS4 A;  4IKH A;  4KDX A;  1JHB A;  3J7Y k;  2O36 A;  2PVQ A;  1UA5 A;  1YF1 A;  2WW2 A;  4RI7 A;  4MJB A;  3P8W A;  1TRU A;  4ML6 A;  2ES7 A;  1Y6E A;  4A5P A;  4NAX A;  3TKS C;  3FZ4 A;  1FOH A;  3I43 A;  2CVB A;  2JZT A;  3HD5 A;  1SU9 A;  2EFE A;  3VLN A;  2PPT A;  4POK A;  3EMX A;  2VL9 A;  1GTI A;  1ZYE A;  2N5B A;  2MMZ A;  4NMU A;  2AYT A;  2DJ3 A;  4DSQ A;  3E9J B;  5A4V A;  2C1Y A;  2IN3 A;  3CXG A;  1NW2 A;  1GSF A;  1A2J A;  2I1U A;  5J9B A;  1XCC A;  5J4V A;  3GX0 A;  4ZL9 A;  13GS A;  2MZC A;  5AN1 A;  2REM A;  5A1N B;  2WVZ A;  1GP1 A;  1R4W A;  1N25 A;  2C3Q A;  1EGO A;  4N11 A;  1MDJ A;  1SVM A;  3MWH A;  3GMF A;  5J4U A;  2LQO A;  1B9Y C;  4CW9 A;  4ZBD A;  2LJK A;  4AKX B;  2CVD A;  2K9F A;  4FQU A;  1PRX A;  2E7P A;  5CO3 A;  1TK8 B;  5B8B A;  1PQN A;  1UN2 A;  4I8B A;  4IVF A;  1GRX A;  3IOS A;  4K7I A;  1YEX A;  1XWC A;  4IGJ A;  3Q19 A;  5CRE A;  1YF0 A;  1GNE A;  3DEX A;  4MP4 A;  3N5O A;  3DML A;  1XVW A;  4KA0 A;  3WGD A;  2CX3 A;  4K1F A;  1DSB A;  1TXX A;  3C7M A;  3GKK A;  2GZZ A;  2RM6 A;  4K7O A;  4TOP A;  1NHO A;  2ALB A;  3VI7 A;  4JR6 A;  3DRN A;  1EWX A;  2HYX A;  2O3E A;  4YAV A;  7GSS A;  3IDV A;  3UVT A;  2WZS A;  3Q18 A;  5BMU B;  4GRF A;  4ZL7 A;  4HS1 A;  4HJM A;  3HJP A;  5JCU A;  5ECI B;  3UVH A;  2VL2 A;  2HFD A;  1FVJ A;  3L9V A;  3ZRD A;  3GUR A;  1EZK A;  4GST A;  5A5H A;  4XRA A;  4MPF A;  1YKA A;  4KGI A;  2WZ9 A;  2O87 A;  3HA9 A;  4GF0 A;  4NHZ A;  1THX A;  1R5P A;  2DJK A;  1YKC A;  2O5V A;  3C1S A;  4WKW A;  2LJA A;  2R0G A;  4KND A;  19GS A;  2D2Z A;  1QXH A;  5FT3 A;  4XRD A;  4G9H A;  2M46 A;  4MF7 A;  1YEP A;  2R37 A;  5D9W A;  3ZML A;  1BJX A;  3F4R A;  4F82 A;  3QPM A;  3IBH A;  1VF3 A;  1K0A A;  4IQ1 A;  3DGQ A;  4HOJ A;  2F51 A;  2DKI A;  1Z6M A;  6GSU A;  1N8J A;  3M8N A;  3G9B A;  5IIZ A;  2EFH A;  2NDO A;  1OYJ A;  1M2B A;  5IMV A;  5ELG A;  2LNS A;  1LBK A;  2N5F A;  3KTB A;  1YDK A;  2QA2 A;  2HRK A;  3EU4 A;  1XWG A;  3TRX A;  4ML1 A;  4PX1 A;  4KSO A;  1KNG A;  1DBY A;  2R0P A;  4K2X A;  2IMD A;  1OE8 A;  4IP6 A;  2GT6 A;  3FR6 A;  4D73 B;  5J47 A;  2I4A A;  3H1N A;  4Q5F A;  5CP1 A;  1TJD A;  3D6I A;  1WP0 A;  5KN3 A;  4GTU A;  2TRX A;  3VFI A;  3MNG A;  3WD6 A;  4OFT A;  4TXV A;  2XHF A;  1YY7 A;  5D8I A;  4NV2 A;  3TKS A;  2PMT A;  2FWH A;  1H4O A;  5INY A;  3ZIJ A;  4MK3 A;  4HQS A;  2A2R A;  1U6T A;  1QQ2 A;  4EE0 A;  1A2L A;  3ZL5 A;  4O5U A;  3Q6O A;  1MTC A;  2WVX A;  2O7K A;  4FH8 A;  2OA7 A;  3Q74 A;  4IS0 A;  3TB2 A;  4IN0 A;  1OVN A;  1HNB A;  3VI5 A;  5DAK B;  1EGR A;  2VCZ A;  1ML6 A;  5GST A;  2FNO A;  2C0F A;  1S3C A;  3GX8 A;  1X9W B;  4WF4 A;  2B7J A;  5FWG A;  2GQL A;  3E3E A;  1AQX A;  2HQT A;  2HT9 A;  2H1D A;  4EXJ A;  5A4U A;  3EPT A;  3ZLP A;  3F3R A;  3IR4 A;  1AQW A;  4V2L A;  2HLS A;  3ZRE A;  5KN2 A;  4ICY A;  3RHC A;  1ERT A;  3R3E A;  1F9M A;  1FVK A;  2F8F A;  1SJ6 A;  1W89 A;  5JWO B;  2VIM A;  4Z7X A;  1BAY A;  2ON5 A;  1TK5 B;  4FYC A;  4K7N A;  2MYG A;  1MDK A;  4K0N A;  3LSZ A;  2XBI A;  3LW9 A;  4LL4 B;  2VM2 A;  1XPV A;  3TCO A;  1TKD B;  1EP7 A;  2E2G A;  3BJ5 A;  4G01 A;  3HJO A;  2FHE A;  1PD2 1;  3CSJ A;  4OMV A;  2H73 A;  1UVZ A;  4HQZ A;  3ERW A;  5L71 A;  3D4T A;  1JZO A;  1T8E B;  3EUR A;  3ZIV A;  1TI1 A;  3ERF A;  4IJI A;  4OFN A;  3TJJ A;  3GNJ A;  1B4Q A;  3GTU A;  2R6K A;  6GSY A;  2X8H A;  5KN1 A;  4J56 E;  1XIY A;  2A4V A;  3FEU A;  2FWG A;  2EIQ A;  4MNN A;  2OT3 A;  3ED3 A;  5KOW A;  2P5R A;  4LA1 A;  2PGT A;  2PN8 A;  20GS A;  1QK8 A;  4HDE A;  4I5Q A;  2A2P A;  2IMI A;  3QFB C;  4GQC A;  2YN1 A;  2FLS A;  1J0F A;  5C04 A;  5ABR A;  1Y1U A;  3VWV A;  4KCA A;  4TKY A;  1OC8 A;  3CWG A;  3TJF A;  2FA4 A;  3D5J A;  1GUK A;  1OC9 B;  4Q5Q A;  4BL7 B;  1O8X A;  2N5A A;  4MLY A;  4BWS A;  3KMO A;  3UJ1 A;  2PU9 C;  4POL A;  3UAR A;  2X64 A;  2O8V B;  4PTS A;  3NIV A;  4YAP A;  4ZIL A;  3US3 A;  4YKG A;  2NTO A;  4LL1 B;  3A5W A;  1BED A;  4I97 A;  4EKZ A;  1A0F A;  2HSN B;  2WDU A;  5EPF A;  2H8L A;  4MJC A;  1M3J A;  2L5O A;  4MZB A;  4N0V A;  2C3T A;  2H6Z A;  4GLT A;  3TKP A;  3W8J A;  2H1B A;  4E8E A;  3L9U A;  4ECB A;  3KMN A;  4QL9 A;  2QA1 A;  1RK4 A;  3MIX A;  3D22 A;  4TR3 A;  5CRW A;  3H8Q A;  4TR1 A;  4ECI A;  4EF0 A;  1A2M A;  1FG4 A;  1S4B P;  2IL3 A;  5G5E A;  3UL3 A;  4L8E A;  3CSH A;  5F07 A;  4JU5 A;  2VO4 A;  1B4P A;  2HI7 A;  2H72 A;  2X8G A;  2DC5 A;  1ACV A;  4PUR A;  3VUR A;  4G10 A;  5EY6 A;  3VPQ A;  4IHU A;  3IA1 A;  2YV9 A;  3KM6 A;  1G0T A;  3FYG A;  3QCP A;  3LOR A;  6GSS A;  2WJU A;  1ZL9 A;  3E0U A;  1IYI A;  3IK9 A;  3F8U A;  4O7H A;  1WPI A;  4WBR D;  5G31 A;  2WFC A;  1JLV A;  1XBS A;  4F03 A;  3L4N A;  2YWN A;  4NXI A;  2V6O A;  4ZXG A;  5G1L A;  4MJA A;  1FO5 A;  3LFL A;  2VL3 A;  5CRG A;  1LU4 A;  2OAC A;  2DIY A;  1J9B A;  4KE3 A;  3L0H A;  2IFQ A;  2R5G A;  1EEM A;  3GKX A;  3C1R A;  4XHM A;  1ZMA A;  4ECC A;  5HFI A;  2RII A;  3U5R E;  2IWT A;  3UAP A;  4USS A;  4MMM A;  1FAA A;  2FA8 A;  1UC7 A;  4EC0 A;  4GQF A;  2WW3 A;  5IO0 A;  3TJK A;  1AXD A;  5BRT A;  4PNG A;  1VF1 A;  2CZ3 A;  1O6J A;  4TN8 A;  1B48 A;  3S9F A;  5H5S A;  1Z9H A;  5ELA A;  4KB3 A;  5JWQ B;  1K0D A;  1T7P B;  1XG8 A;  2HZE B;  5ID2 B;  1NSW A;  3CYN A;  2DKH A;  4MA9 A;  3VPT A;  3UBK A;  2B5Y A;  5J5N A;  2WVY A;  1RW1 A;  3GV1 A;  2JAD A;  2WS2 A;  2K8S A;  1H75 A;  3BOA A;  3KJY A;  1XWB A;  5KOX A;  1FB0 A;  1XXU A;  2AJQ B;  3TKR A;  3G7J A;  1G6W A;  3GRX A;  1JZD A;  1GTU A;  2R0C A;  1M9B A;  1XW9 A;  3UOM A;  2R2J A;  1AUC A;  3CTG A;  1Z3E A;  4ZB7 A;  3KP9 A;  2F9S A;  3TJB A;  5CNW A;  4BIK A;  5COH A;  1A8L A;  3IAS 2;  4MZC A;  1G6Y A;  2DML A;  1OKT A;  3HJM A;  1JFU A;  3BBY A;  3NZN A;  2GQM A;  3DVX A;  2OJL A;  1EOH A;  4ZBB A;  1GSS A;  5B6M A;  4TRX A;  4L5O A;  4ACS A;  1HNC A;  3CMI A;  1NM3 A;  3IHG A;  2E2M A;  4MH3 A;  4BVX A;  3ZTL A;  4OFM A;  4JRR A;  3A2X A;  2WUL A;  1PL1 A;  2QKE A;  3H93 A;  2RLI A;  4PQI A;  5C00 A;  2PWJ A;  2LQQ A;  5F05 A;  4I2T A;  3IV4 A;  1N2A A;  1GWC A;  1Z7R A;  5J4Y A;  2YJ7 A;  1ZCP A;  4BVY A;  3RGB C;  1PKW A;  5DAL A;  2CQ9 A;  2I3Y A;  2QGV A;  4EL1 A;  5DVB A;  5IO2 A;  1PA3 A;  1YQ1 A;  3ZFB A;  5GZZ B;  3LQ7 A;  5ECK B;  2XPD A;  6GST A;  2VOC A;  2HE3 A;  2X8C A;  2H76 A;  4Z2R A;  4J2F A;  4O32 A;  3R2Q A;  3TUE A;  3C71 A;  3EMP A;  3LJR A;  1BX9 A;  1VF4 A;  2GLR A;  4IQA A;  3FR3 A;  1GSQ A;  5ECQ B;  3HY2 A;  3UEM A;  4POM A;  5A4W A;  4DSS A;  3F6D A;  3CTF A;  2NVL A;  4F2I A;  3IC4 A;  2QC7 A;  3PR8 A;  5F8B A;  4MZW A;  4JED A;  1PMT A;  4NHW A;  1BYE A;  5AIV A;  1K0M A;  8GSS A;  4KAE A;  1TW9 A;  5A5K A;  4WXT A;  1SK0 A;  1M2A A;  3FZ9 A;  2VD1 A;  4F0B A;  2TRC P;  1SYX A;  2CV4 A;  2H70 A;  4JZQ A;  2ZUP A;  3ZFL A;  5AIS A;  5CAX A;  4XS6 A;  2VM1 A;  5GAN D;  2C4J A;  4FYU A;  2K8V A;  3W8S A;  4IBP A;  2R4V A;  1YEW C;  14GS A;  4BPY A;  1R5A A;  3W6G A;  4E8H A;  2GST A;  2L57 A;  2YPM A;  5IQY A;  2JU5 A;  3FZ5 A;  2HXK A;  5A34 B;  2YWM A;  3APQ A;  4KX4 A;  1QUW A;  1X9M B;  2L59 A;  4HEA 2;  5IMA A;  2GGT A;  1ERW A;  1WMJ A;  2LV3 A;  4I2U A;  5D73 A;  2B5X A;  3ME7 A;  1K0B A;  2HSM B;  4TXO A;  1EV4 A;  3FK8 A;  3GHA A;  18GS A;  5ECR B;  2XC2 A;  3DXB A;  3CRU A;  1T00 A;  2C0G A;  3F4S A;  4K9Z A;  1MD4 A;  1BQ7 A;  4TR4 A;  1WRY A;  5LNK e;  3FZA A;  2B7K A;  2HSY A;  3KTL A;  3GSS A;  1V98 A;  1XVQ A;  3APO A;  3L78 A;  2L4Q A;  1K3Y A;  4PI2 C;  2YZU A;  2TIR A;  2G0F A;  4HUA A;  3LG6 A;  5CRH A;  4MPG A;  3EU3 A;  4L0W A;  3VWW A;  1GUM A;  2LEG A;  5IM9 A;  4XIH A;  2Z9S A;  2P0G A;  3F3Q A;  2OE3 A;  4OCE A;  5G5F A;  5DQY A;  5CRD A;  3CRT A;  3DVW A;  2IMF A;  2O85 A;  3LYK A;  3CSI A;  4XS4 B;  4YKF A;  2GZP A;  1PX7 A;  2IMK A;  2DJ0 A;  2L6C A;  1K0C A;  1GUH A;  3RPN A;  2AV4 A;  2OE0 A;  1T3B A;  4CHS A;  5DCH A;  1TXU A;  2H0I A;  2OBK A;  3BCI A;  3HVN A;  3ZVJ A;  5ECN B;  2V6K A;  1OAZ A;  1E2Y A;  5G30 A;  2OBI A;  2CVK A;  16GS A;  1PKZ A;  4MCU A;  1THO A;  3A3T A;  4EIP A;  2H6Y A;  4RQR A;  1USB A;  1O7U A;  3GN3 A;  1VGL A;  3VK9 A;  5J3R A;  5JCG A;  2H0H A;  2BTO T;  3FHK A;  3QR6 A;  5A1N A;  1SKS B;  2JL4 A;  1SJZ A;  4JE1 A;  3IAM 2;  5HFK A;  4FXY P;  2NPB A;  1M0U A;  3M3M A;  1PGT A;  3RAZ A;  3KIJ A;  2FY6 A;  2X49 A;  2ZNM A;  3KD0 A;  3C8E A;  1ERU A;  3TU3 B;  3D21 A;  1R7H A;  1HNA A;  1M9A A;  5H5Q A;  3C73 A;  4JR4 A;  5IMD A;  1XW5 A;  3UMA A;  2HRF A;  4LMW A;  2JZS A;  3GKM A;  2K18 A;  3P7X A;  4PGT A;  1S3D A;  2L6D A;  2LST A;  3GL5 A;  2V41 A;  1EV9 A;  2FD3 A;  4KCE A;  5FHI A;  4HJ2 A;  5DQS A;  1BG1 A;  2AB6 A;  3GKN A;  1PN0 A;  2WGR A;  1QMV A;  4XS1 A;  4WBJ A;  1M99 A;  2PBJ A;  4ZB8 A;  4H86 A;  2QSI A;  1SK1 A;  2RUE A;  1GSD A;  2VAF A;  1X9S B;  1TU8 A;  5BMU A;  5B7C A;  2PVO C;  2VLU A;  1HQO A;  5F0G A;  4CDO A;  1EEJ A;  1LJR A;  3ME8 A;  1O73 A;  1SL2 B;  3A2W A;  1CQH A;  4HSC X;  3AY8 A;  3MDK A;  3LWA A;  4HZ4 A;  2YV7 A;  3HVS A;  3HHV A;  1A24 A;  3TKS E;  1JZR A;  1GNW A;  2H1G A;  2KUC A;  4TVE A;  2C0E A;  3WYW A;  5A5H B;  6GSV A;  2AUV A;  3F6F A;  4RUV A;  1WE0 A;  3PGT A;  1GLQ A;  3HZ8 A;  1G7O A;  2HRA A;  3HKR A;  6GSX A;  4I6X A;  2DJ2 A;  1TRV A;  2C0D A;  2GT5 A;  4GWR A;  2LTK A;  1Q4J A;  2H71 A;  1ABA A;  3QFA C;  1XOA A;  2RM5 A;  4V1A g;  3HDC A;  1PN9 A;  4IW9 A;  3HMJ G;  3VWU A;  2H6X A;  4O92 A;  1MEK A;  5HR0 A;  1HD2 A;  1IYH A;  4LLR A;  1BF5 A;  4EO3 A;  4KH7 A;  1K3L A;  2LJR A;  4X4J A;  2FCH A;  4DVC A;  3VWX A;  1NHY A;  1W4V A;  1I9D A;  1CQG A;  3QAV A;  2A2S A;  4MF5 A;  4W66 A;  2LS5 A;  2V1M A;  3F4T A;  2HRK B;  2HNL A;  3HVX A;  5ECP B;  1T4Y A;  4K6X A;  1GLP A;  4DEJ A;  2X99 A;  4N0Z A;  2R3X A;  4D73 A;  3NOF A;  3RHB A;  2LNT A;  4NV5 A;  4TXO B;  2YWI A;  1FB6 A;  4O5R A;  5HR1 A;  3RBT A;  5B6N A;  2KLX A;  5DCG A;  2V32 A;  3KXO A;  2RUF A;  2YOI A;  1ON4 A;  1Y25 A;  3P90 A;  2GQK A;  1XZO A;  4E68 A;  4AI6 A;  5ECS A;  3EC3 A;  2BMX A;  2L4C A;  1FHE A;  3J7Y b;  4GCI A;  3DWV A;  3DD3 A;  3GIX A;  4Q5R A;  1Q98 A;  3TDG A;  2GDR A;  4F0C A;  2OE1 A;  2B5E A;  1K3O A;  1K0O A;  2WVX B;  5DAK A;  2DMM A;  3PH9 A;  1VF2 A;  1URM A;  2VD0 A;  4MF6 A;  4FYB A;  3F63 A;  2BJX A;  1C72 A;  1S3R A;  1SD9 A;  2I81 A;  4V2M A;  4ZL8 A;  3F9U A;  1S3A A;  1WJK A;  5E4W A;  4KF9 A;  1SL0 B;  3UBL A;  1TOF A;  5EL8 A;  4DSR A;  2IIY A;  3QD9 A;  2JZR A;  3PIN A;  4AKH A;  1EP8 A;  4L5L A;  1DE1 A;  3TJG A;  4KDU A;  4ZBA A;  2PUK C;  5H5R A;  3KP8 A;  1WIK A;  4K0G A;  2B3S A;  3HVV A;  5G2Z A;  4MDC A;  11GS A;  2LUS A;  1BG5 A;  2GSQ A;  22GS A;  1TP9 A;  4N30 A;  2VLT A;  3LYP A;  1RQM A;  2H30 A;  1X5E A;  4NPB A;  3O76 A;  1ZYN A;  2HSH A;  1U88 A;  3ISO A;  2VCV A;  1Z7P A;  4HZ2 A;  4YQM A;  5EVO A;  1FW1 A;  3GFK A;  2IME A;  17GS A;  1V57 A;  3LGC A;  4IP1 A;  5D93 A;  3M1G A;  3FRC A;  3GTU B;  2FWF A;  2VCW A;  1AC1 A;  5D96 A;  3G7I A;  4ZB9 A;  2H66 A;  4PXO A;  3ERG A;  3MSZ A;  2FWE A;  3A2V A;  4PUA A;  4K2D A;  4YQV A;  4MJE A;  2KOK A;  3G7Y A;  5D9X A;  3ZVJ D;  1PX6 A;  2HZF A;  1OC9 A;  4BL7 A;  4G2E A;  4ILF A;  1ST9 A;  4JBB A;  5ECM B;  3APS A;  2LRT A;  1F6M C;  2GTU A;  2MMA A; 
#chains in the Genus database with same CATH homology
 2M80 A;  3DKS A;  3IRA A;  1KBN A;  4CY6 A;  4HU7 A;  4RI6 A;  2EFD A;  2CZ2 A;  2OAD A;  2EC4 A;  2F3M A;  3KH7 A;  2HSN A;  2H74 A;  3LEF A;  2F8A A;  4EDY A;  4QL7 A;  3BCK A;  1QFN A;  3HZ4 A;  1V40 A;  1EOG A;  4TW5 A;  4PQ1 A;  3OR5 A;  1SD8 A;  3EVI A;  1OC3 A;  1V58 A;  4N10 A;  1X5C A;  5HFG A;  5AIX A;  1DUG A;  4PUF C;  1HYU A;  3IK7 A;  4AF2 A;  2VLV A;  5HR2 A;  3GL3 A;  4TR1 B;  1A8Y A;  2UV8 G;  4ECJ A;  2LRC A;  4X0X A;  4G0L A;  2I9H A;  4K5S A;  2WB9 A;  5LCZ A;  2EIO A;  2C3N A;  1TK0 B;  4OD7 A;  2WRT A;  3K8N A;  3WGE A;  1SEN A;  1GSU A;  3HCZ A;  2GZY A;  4Q5N A;  4Z2T A;  1AQV A;  3EIN A;  5KN0 A;  1U3A A;  4K5R A;  3QAG A;  1A0R P;  2CAI A;  1XWK A;  2DIZ A;  4WET A;  1XOB A;  3IC8 A;  2M72 A;  2B1K A;  3D4M A;  2YZH A;  1V2A A;  1J08 A;  3QAW A;  2VCT A;  2H75 A;  1A23 A;  2KP1 A;  3QDN A;  4XCS A;  2DJJ A;  2ON7 A;  1TRS A;  2P31 A;  5HR3 A;  4GXZ A;  5ENU A;  1AAZ A;  2XBQ A;  1G7E A;  3FR9 A;  3F0I A;  5IPG A;  1XW6 A;  1SVO A;  2JSY A;  4WF5 A;  2MMN A;  2IFQ B;  3FMW A;  5HQP A;  1X5D A;  3IHQ A;  4OO4 A;  2H1A A;  3BD2 A;  4G19 A;  1O85 A;  2LKU A;  1M2D A;  3ZYW A;  3MYD A;  2KHP A;  4OWY A;  3LXT A;  4L0U A;  3SBC A;  1AW9 A;  2HZE A;  5ID2 A;  1MDI A;  3DYR A;  3GUS A;  1KEB A;  5IMZ A;  1TU7 A;  5J9C A;  3TGZ A;  4AKG A;  2GS3 A;  1F3B A;  2H19 A;  1SK2 A;  2YCD A;  2CAQ A;  4V1A p;  3QMX A;  1SL1 B;  1KTE A;  2GVP A;  5CYY A;  4KUN A;  1PL2 A;  1GSY A;  1GTA A;  4KSM A;  1JLW A;  1MD3 A;  1U87 A;  1TI3 A;  4BA7 A;  5JCW A;  2X4A A;  4ISD A;  5ECL B;  3M9K A;  5J40 A;  3CBU A;  4IJ3 A;  2DBC A;  2JSZ A;  4X1U A;  2VUP A;  2C80 A;  2FUG 2;  2YWO A;  4GSS A;  3H79 A;  4MH2 A;  4AGS A;  2MMO A;  1F37 A;  1WOU A;  2G2Q A;  1F2E A;  2UZ8 A;  3EYT A;  2J9H A;  1I5G A;  2V2G A;  1YZX A;  1SKW B;  4QMK A;  1Z5Y E;  3D0Z A;  2WCI A;  2E0Q A;  1DE2 A;  5GSS A;  3FY7 A;  5B8A A;  1X0R A;  2DSA A;  3ZMK A;  4WR4 A;  3H4K A;  2AAW A;  2KP2 A;  1GUL A;  4HI7 A;  5IOX A;  3ZZX A;  4RQX A;  5IMF A;  2CA8 A;  5G1K A;  5ECO B;  4P3Y B;  1TTZ A;  5GAP D;  4BVX B;  1XWA A;  2H0G A;  1OE7 A;  2YP6 A;  5LD0 A;  4OO5 A;  2GSS A;  9GSS A;  3QOU A;  4KW6 A;  3HYP A;  4MAB A;  1M7T A;  5KEJ A;  5DJM A;  1YVL A;  4TR0 A;  3KH9 A;  3V1W A;  1R26 A;  1ZGN A;  1B9X C;  1TRW A;  4BVY B;  5JWR B;  4PQH A;  2H01 A;  4YQU A;  5DAL B;  1JZW A;  2CX4 A;  2FGX A;  1ERV A;  1GH2 A;  4XTS A;  3IPZ A;  3LXZ A;  1T4Z A;  2B1L A;  2XPE A;  3RPP A;  3RDW A;  1TDI A;  4OCF A;  5IOW A;  3WT2 A;  4POB A;  1QGV A;  4LMV A;  4ZIJ A;  2K6V A;  4NWY A;  1GTB A;  3A5I A;  3KZQ A;  4AJ7 A;  4EVM A;  4FO5 A;  1YJ6 A;  4ID0 A;  4N3Z A;  4O5Q A;  2MBT A;  4DSS B;  3I69 A;  5DJL A;  3TOT A;  3TKQ A;  2NBS A;  2VCQ A;  2C8U A;  3IXR A;  5E59 A;  1OKD A;  2DJ1 A;  3I9V 2;  3KEB A;  1SYR A;  1GSE A;  1U3I A;  3PPU A;  1O8W A;  3M9J A;  3MAK A;  4F9Z A;  1AIU A;  1O81 A;  1VRS D;  3L9S A;  2YAN A;  4K8M A;  12GS A;  4YH2 A;  1XFL A;  5D9V A;  3GH9 A;  3TRP A;  2J23 A;  4J57 E;  4KDY A;  5IPH A;  4GDF A;  4EIQ A;  2LRN A;  4EDZ A;  4BWQ A;  2MBS A;  3GST A;  1K0N A;  5DBQ A;  3KGK A;  4AJ8 A;  5AGY A;  5A34 A;  1E6B A;  5D9T A;  5J41 A;  2VL2 C;  6GSW A;  2VKZ G;  5ECH B;  3I6A A;  3FKF A;  3GYK A;  4FIW A;  3HXS A;  3SWL A;  3WGX A;  2B6M A;  4QQ7 A;  3KCM A;  2HSM A;  3EE2 A;  3UIW A;  4Z2U A;  2JAC A;  1ZYP A;  2VCX A;  4AKI A;  4ZB6 A;  2AHE A;  3FW2 A;  5IMC A;  1SJI A;  4PNF A;  3WT1 A;  2PER A;  3TOU A;  2DLX A;  4WEY A;  4IEL A;  3ZIT A;  4G0K A;  10GS A;  1FOV A;  4AJ6 A;  3DIE A;  3P2A A;  1ZZY A;  2CT6 A;  2H1L A;  2IJY A;  1T1V A;  4EUY A;  2EIR A;  1SKR B;  2HRN A;  2ZCT A;  2A4H A;  2IPA A;  3JCM L;  2YNX A;  3U6V A;  2L5L A;  1V9W A;  3GA4 A;  1B8X A;  4V2N A;  4G0I A;  1PSQ A;  2EFC A;  2YJH A;  3O3T A;  1ZYQ B;  1GL8 A;  5F06 A;  3EWL A;  3N9J A;  1Z6N A;  3M0F A;  2GSR A;  4X43 A;  4ULX A;  3GH6 A;  4CY8 A;  1ILO A;  1ZOF A;  4GSN A;  1F3A A;  2O89 A;  4HU9 A;  1WWJ A;  1SVL A;  2P5Q A;  3O6T A;  3TRQ A;  2OKA A;  4WR5 A;  3IE3 A;  5DDL A;  4XS4 A;  4IKH A;  4KDX A;  1JHB A;  3J7Y k;  2PVQ A;  1UA5 A;  1YF1 A;  4RI7 A;  4MJB A;  3P8W A;  1TRU A;  4ML6 A;  2ES7 A;  1Y6E A;  4A5P A;  4NAX A;  3TKS C;  3FZ4 A;  1FOH A;  3I43 A;  2CVB A;  2JZT A;  3HD5 A;  1SU9 A;  2EFE A;  3VLN A;  2PPT A;  4POK A;  3EMX A;  2VL9 A;  1GTI A;  1ZYE A;  2N5B A;  2MMZ A;  4NMU A;  2AYT A;  2DJ3 A;  4DSQ A;  3E9J B;  5A4V A;  2C1Y A;  2IN3 A;  3CXG A;  1NW2 A;  1GSF A;  1A2J A;  2I1U A;  5J9B A;  1XCC A;  5J4V A;  3GX0 A;  4ZL9 A;  13GS A;  2MZC A;  5AN1 A;  2REM A;  5A1N B;  1GP1 A;  1R4W A;  1N25 A;  2C3Q A;  1EGO A;  4N11 A;  1MDJ A;  1SVM A;  3MWH A;  3GMF A;  5J4U A;  2LQO A;  1B9Y C;  4CW9 A;  4ZBD A;  2LJK A;  4AKX B;  2CVD A;  2K9F A;  4FQU A;  1PRX A;  2E7P A;  5CO3 A;  1TK8 B;  5B8B A;  1PQN A;  1UN2 A;  4I8B A;  4IVF A;  1GRX A;  3IOS A;  4K7I A;  1YEX A;  1XWC A;  4IGJ A;  3Q19 A;  5CRE A;  1YF0 A;  1GNE A;  3DEX A;  4MP4 A;  3N5O A;  3DML A;  1XVW A;  4KA0 A;  3WGD A;  2CX3 A;  4K1F A;  1DSB A;  1TXX A;  3C7M A;  3GKK A;  2GZZ A;  2RM6 A;  4K7O A;  4TOP A;  1NHO A;  2ALB A;  3VI7 A;  4JR6 A;  3DRN A;  1EWX A;  2HYX A;  4YAV A;  7GSS A;  3IDV A;  3UVT A;  3Q18 A;  5BMU B;  4GRF A;  4ZL7 A;  4HS1 A;  4HJM A;  3HJP A;  5JCU A;  5ECI B;  3UVH A;  2VL2 A;  2HFD A;  1FVJ A;  3L9V A;  3ZRD A;  3GUR A;  1EZK A;  4GST A;  5A5H A;  4XRA A;  4MPF A;  1YKA A;  4KGI A;  2WZ9 A;  2O87 A;  3HA9 A;  4GF0 A;  4NHZ A;  1THX A;  1R5P A;  2DJK A;  1YKC A;  2O5V A;  3C1S A;  4WKW A;  2LJA A;  2R0G A;  4KND A;  19GS A;  2D2Z A;  1QXH A;  5FT3 A;  4XRD A;  4G9H A;  2M46 A;  4MF7 A;  1YEP A;  2R37 A;  5D9W A;  3ZML A;  1BJX A;  3F4R A;  4F82 A;  3QPM A;  3IBH A;  1VF3 A;  1K0A A;  4IQ1 A;  3DGQ A;  4HOJ A;  2F51 A;  2DKI A;  1Z6M A;  6GSU A;  1N8J A;  3M8N A;  3G9B A;  5IIZ A;  2EFH A;  2NDO A;  1OYJ A;  1M2B A;  5IMV A;  5ELG A;  2LNS A;  1LBK A;  2N5F A;  3KTB A;  1YDK A;  2QA2 A;  2HRK A;  3EU4 A;  1XWG A;  3TRX A;  4ML1 A;  4PX1 A;  4KSO A;  1KNG A;  1DBY A;  2R0P A;  4K2X A;  2IMD A;  1OE8 A;  4IP6 A;  2GT6 A;  3FR6 A;  4D73 B;  5J47 A;  2I4A A;  3H1N A;  4Q5F A;  5CP1 A;  1TJD A;  3D6I A;  1WP0 A;  5KN3 A;  4GTU A;  2TRX A;  3VFI A;  3MNG A;  3WD6 A;  4OFT A;  4TXV A;  2XHF A;  1YY7 A;  5D8I A;  4NV2 A;  3TKS A;  2PMT A;  2FWH A;  1H4O A;  5INY A;  3ZIJ A;  4MK3 A;  4HQS A;  2A2R A;  1U6T A;  1QQ2 A;  4EE0 A;  1A2L A;  3ZL5 A;  4O5U A;  3Q6O A;  1MTC A;  2O7K A;  4FH8 A;  2OA7 A;  3Q74 A;  4IS0 A;  3TB2 A;  4IN0 A;  1OVN A;  1HNB A;  3VI5 A;  5DAK B;  1EGR A;  2VCZ A;  1ML6 A;  5GST A;  2FNO A;  2C0F A;  1S3C A;  3GX8 A;  1X9W B;  4WF4 A;  2B7J A;  5FWG A;  2GQL A;  3E3E A;  1AQX A;  2HQT A;  2HT9 A;  2H1D A;  4EXJ A;  5A4U A;  3EPT A;  3ZLP A;  3F3R A;  3IR4 A;  1AQW A;  4V2L A;  2HLS A;  3ZRE A;  5KN2 A;  4ICY A;  3RHC A;  1ERT A;  3R3E A;  1F9M A;  1FVK A;  2F8F A;  1SJ6 A;  1W89 A;  5JWO B;  2VIM A;  4Z7X A;  1BAY A;  2ON5 A;  1TK5 B;  4FYC A;  4K7N A;  2MYG A;  1MDK A;  4K0N A;  3LSZ A;  2XBI A;  3LW9 A;  4LL4 B;  2VM2 A;  1XPV A;  3TCO A;  1TKD B;  1EP7 A;  2E2G A;  3BJ5 A;  4G01 A;  3HJO A;  2FHE A;  1PD2 1;  3CSJ A;  4OMV A;  2H73 A;  1UVZ A;  4HQZ A;  3ERW A;  5L71 A;  3D4T A;  1JZO A;  1T8E B;  3EUR A;  3ZIV A;  1TI1 A;  3ERF A;  4IJI A;  4OFN A;  3TJJ A;  3GNJ A;  1B4Q A;  3GTU A;  2R6K A;  6GSY A;  2X8H A;  5KN1 A;  4J56 E;  1XIY A;  2A4V A;  3FEU A;  2FWG A;  2EIQ A;  4MNN A;  2OT3 A;  3ED3 A;  5KOW A;  2P5R A;  4LA1 A;  2PGT A;  2PN8 A;  20GS A;  1QK8 A;  4HDE A;  4I5Q A;  2A2P A;  2IMI A;  3QFB C;  4GQC A;  2YN1 A;  2FLS A;  1J0F A;  5C04 A;  5ABR A;  1Y1U A;  3VWV A;  4KCA A;  4TKY A;  1OC8 A;  3CWG A;  3TJF A;  2FA4 A;  3D5J A;  1GUK A;  1OC9 B;  4Q5Q A;  4BL7 B;  1O8X A;  2N5A A;  4MLY A;  4BWS A;  3KMO A;  3UJ1 A;  2PU9 C;  4POL A;  3UAR A;  2X64 A;  2O8V B;  4PTS A;  3NIV A;  4YAP A;  4ZIL A;  3US3 A;  4YKG A;  2NTO A;  4LL1 B;  3A5W A;  1BED A;  4I97 A;  4EKZ A;  1A0F A;  2HSN B;  2WDU A;  5EPF A;  2H8L A;  4MJC A;  2L5O A;  4MZB A;  4N0V A;  2C3T A;  2H6Z A;  4GLT A;  3TKP A;  3W8J A;  2H1B A;  4E8E A;  3L9U A;  4ECB A;  3KMN A;  4QL9 A;  2QA1 A;  1RK4 A;  3MIX A;  3D22 A;  4TR3 A;  5CRW A;  3H8Q A;  4TR1 A;  4ECI A;  4EF0 A;  1A2M A;  1FG4 A;  2IL3 A;  5G5E A;  3UL3 A;  4L8E A;  3CSH A;  5F07 A;  4JU5 A;  2VO4 A;  1B4P A;  2HI7 A;  2H72 A;  2X8G A;  2DC5 A;  1ACV A;  4PUR A;  3VUR A;  4G10 A;  5EY6 A;  3VPQ A;  4IHU A;  3IA1 A;  2YV9 A;  3KM6 A;  1G0T A;  3FYG A;  3QCP A;  3LOR A;  6GSS A;  2WJU A;  1ZL9 A;  3E0U A;  1IYI A;  3IK9 A;  3F8U A;  4O7H A;  1WPI A;  4WBR D;  5G31 A;  2WFC A;  1JLV A;  1XBS A;  4F03 A;  3L4N A;  2YWN A;  4NXI A;  2V6O A;  4ZXG A;  5G1L A;  4MJA A;  1FO5 A;  3LFL A;  2VL3 A;  5CRG A;  1LU4 A;  2OAC A;  2DIY A;  1J9B A;  4KE3 A;  3L0H A;  2IFQ A;  2R5G A;  1EEM A;  3GKX A;  3C1R A;  4XHM A;  1ZMA A;  4ECC A;  5HFI A;  2RII A;  3U5R E;  2IWT A;  3UAP A;  4USS A;  4MMM A;  1FAA A;  2FA8 A;  1UC7 A;  4EC0 A;  4GQF A;  5IO0 A;  3TJK A;  1AXD A;  5BRT A;  4PNG A;  1VF1 A;  2CZ3 A;  1O6J A;  4TN8 A;  1B48 A;  3S9F A;  5H5S A;  1Z9H A;  5ELA A;  4KB3 A;  5JWQ B;  1K0D A;  1T7P B;  2HZE B;  5ID2 B;  1NSW A;  3CYN A;  2DKH A;  4MA9 A;  3VPT A;  3UBK A;  2B5Y A;  5J5N A;  3GV1 A;  1RW1 A;  2JAD A;  2WS2 A;  2K8S A;  1H75 A;  3BOA A;  3KJY A;  1XWB A;  5KOX A;  1FB0 A;  1XXU A;  2AJQ B;  3TKR A;  3G7J A;  1G6W A;  3GRX A;  1JZD A;  1GTU A;  2R0C A;  1M9B A;  1XW9 A;  3UOM A;  2R2J A;  1AUC A;  3CTG A;  1Z3E A;  4ZB7 A;  3KP9 A;  2F9S A;  3TJB A;  5CNW A;  5COH A;  1A8L A;  3IAS 2;  4MZC A;  1G6Y A;  2DML A;  1OKT A;  3HJM A;  1JFU A;  3BBY A;  3NZN A;  2GQM A;  3DVX A;  2OJL A;  1EOH A;  4ZBB A;  1GSS A;  5B6M A;  4TRX A;  4L5O A;  4ACS A;  1HNC A;  3CMI A;  1NM3 A;  3IHG A;  2E2M A;  4MH3 A;  4BVX A;  3ZTL A;  4OFM A;  4JRR A;  3A2X A;  2WUL A;  1PL1 A;  2QKE A;  3H93 A;  2RLI A;  4PQI A;  5C00 A;  2PWJ A;  2LQQ A;  5F05 A;  4I2T A;  3IV4 A;  1N2A A;  1GWC A;  1Z7R A;  5J4Y A;  2YJ7 A;  1ZCP A;  4BVY A;  1PKW A;  5DAL A;  2CQ9 A;  2I3Y A;  2QGV A;  4EL1 A;  5DVB A;  5IO2 A;  1PA3 A;  1YQ1 A;  3ZFB A;  5GZZ B;  3LQ7 A;  5ECK B;  2XPD A;  6GST A;  2VOC A;  2HE3 A;  2X8C A;  2H76 A;  4Z2R A;  4J2F A;  4O32 A;  3R2Q A;  3TUE A;  3C71 A;  3EMP A;  3LJR A;  1BX9 A;  1VF4 A;  2GLR A;  4IQA A;  3FR3 A;  1GSQ A;  5ECQ B;  3HY2 A;  3UEM A;  4POM A;  5A4W A;  4DSS A;  3F6D A;  3CTF A;  2NVL A;  4F2I A;  3IC4 A;  2QC7 A;  3PR8 A;  5F8B A;  4MZW A;  4JED A;  1PMT A;  4NHW A;  1BYE A;  5AIV A;  1K0M A;  8GSS A;  4KAE A;  1TW9 A;  5A5K A;  4WXT A;  1SK0 A;  1M2A A;  3FZ9 A;  2VD1 A;  4F0B A;  2TRC P;  1SYX A;  2CV4 A;  2H70 A;  4JZQ A;  2ZUP A;  3ZFL A;  5AIS A;  5CAX A;  4XS6 A;  2VM1 A;  5GAN D;  2C4J A;  4FYU A;  2K8V A;  3W8S A;  4IBP A;  2R4V A;  14GS A;  4BPY A;  1R5A A;  3W6G A;  4E8H A;  2GST A;  2L57 A;  2YPM A;  5IQY A;  2JU5 A;  3FZ5 A;  2HXK A;  5A34 B;  2YWM A;  3APQ A;  4KX4 A;  1QUW A;  1X9M B;  2L59 A;  4HEA 2;  5IMA A;  2GGT A;  1ERW A;  1WMJ A;  2LV3 A;  4I2U A;  5D73 A;  2B5X A;  3ME7 A;  1K0B A;  2HSM B;  4TXO A;  1EV4 A;  3FK8 A;  3GHA A;  18GS A;  5ECR B;  2XC2 A;  3DXB A;  3CRU A;  1T00 A;  2C0G A;  3F4S A;  4K9Z A;  1MD4 A;  1BQ7 A;  4TR4 A;  1WRY A;  5LNK e;  3FZA A;  2B7K A;  2HSY A;  3KTL A;  3GSS A;  1V98 A;  1XVQ A;  3APO A;  3L78 A;  2L4Q A;  1K3Y A;  2YZU A;  2TIR A;  2G0F A;  4HUA A;  3LG6 A;  5CRH A;  4MPG A;  3EU3 A;  4L0W A;  3VWW A;  1GUM A;  2LEG A;  5IM9 A;  4XIH A;  2Z9S A;  2P0G A;  3F3Q A;  2OE3 A;  4OCE A;  5G5F A;  5DQY A;  5CRD A;  3CRT A;  3DVW A;  2IMF A;  2O85 A;  3LYK A;  3CSI A;  4XS4 B;  4YKF A;  2GZP A;  1PX7 A;  2IMK A;  2DJ0 A;  2L6C A;  1K0C A;  1GUH A;  3RPN A;  2AV4 A;  2OE0 A;  1T3B A;  4CHS A;  5DCH A;  1TXU A;  2H0I A;  2OBK A;  3BCI A;  3ZVJ A;  5ECN B;  2V6K A;  1OAZ A;  1E2Y A;  5G30 A;  2OBI A;  2CVK A;  16GS A;  1PKZ A;  4MCU A;  1THO A;  3A3T A;  4EIP A;  2H6Y A;  4RQR A;  1USB A;  1O7U A;  3GN3 A;  1VGL A;  3VK9 A;  5J3R A;  5JCG A;  2H0H A;  2BTO T;  3FHK A;  3QR6 A;  5A1N A;  1SKS B;  2JL4 A;  1SJZ A;  4JE1 A;  3IAM 2;  5HFK A;  2NPB A;  1M0U A;  3M3M A;  1PGT A;  3RAZ A;  3KIJ A;  2FY6 A;  2X49 A;  2ZNM A;  3KD0 A;  3C8E A;  1ERU A;  3TU3 B;  3D21 A;  1R7H A;  1HNA A;  1M9A A;  5H5Q A;  3C73 A;  4JR4 A;  5IMD A;  1XW5 A;  3UMA A;  2HRF A;  4LMW A;  2JZS A;  3GKM A;  2K18 A;  3P7X A;  4PGT A;  1S3D A;  2L6D A;  2LST A;  3GL5 A;  2V41 A;  1EV9 A;  2FD3 A;  4KCE A;  5FHI A;  4HJ2 A;  5DQS A;  1BG1 A;  2AB6 A;  3GKN A;  1PN0 A;  2WGR A;  1QMV A;  4XS1 A;  4WBJ A;  1M99 A;  2PBJ A;  4ZB8 A;  4H86 A;  2QSI A;  1SK1 A;  2RUE A;  1GSD A;  2VAF A;  1X9S B;  1TU8 A;  5BMU A;  5B7C A;  2PVO C;  2VLU A;  1HQO A;  5F0G A;  4CDO A;  1EEJ A;  1LJR A;  3ME8 A;  1O73 A;  1SL2 B;  3A2W A;  1CQH A;  3AY8 A;  3MDK A;  3LWA A;  4HZ4 A;  2YV7 A;  3HVS A;  3HHV A;  1A24 A;  3TKS E;  1JZR A;  1GNW A;  2H1G A;  2KUC A;  4TVE A;  2C0E A;  3WYW A;  5A5H B;  6GSV A;  2AUV A;  3F6F A;  4RUV A;  1WE0 A;  3PGT A;  1GLQ A;  3HZ8 A;  1G7O A;  2HRA A;  3HKR A;  6GSX A;  4I6X A;  2DJ2 A;  1TRV A;  2C0D A;  2GT5 A;  4GWR A;  2LTK A;  1Q4J A;  2H71 A;  1ABA A;  3QFA C;  1XOA A;  2RM5 A;  4V1A g;  3HDC A;  1PN9 A;  4IW9 A;  3HMJ G;  3VWU A;  2H6X A;  4O92 A;  1MEK A;  5HR0 A;  1HD2 A;  1IYH A;  4LLR A;  1BF5 A;  4EO3 A;  4KH7 A;  1K3L A;  2LJR A;  4X4J A;  2FCH A;  4DVC A;  3VWX A;  1NHY A;  1W4V A;  1I9D A;  1CQG A;  3QAV A;  2A2S A;  4MF5 A;  4W66 A;  2LS5 A;  2V1M A;  3F4T A;  2HRK B;  2HNL A;  3HVX A;  5ECP B;  1T4Y A;  4K6X A;  1GLP A;  4DEJ A;  2X99 A;  4N0Z A;  2R3X A;  4D73 A;  3NOF A;  3RHB A;  2LNT A;  4NV5 A;  4TXO B;  2YWI A;  1FB6 A;  4O5R A;  5HR1 A;  3RBT A;  5B6N A;  2KLX A;  5DCG A;  2V32 A;  3KXO A;  2RUF A;  2YOI A;  1ON4 A;  1Y25 A;  3P90 A;  2GQK A;  1XZO A;  4E68 A;  4AI6 A;  5ECS A;  3EC3 A;  2BMX A;  2L4C A;  1FHE A;  3J7Y b;  4GCI A;  3DWV A;  3DD3 A;  3GIX A;  4Q5R A;  1Q98 A;  3TDG A;  2GDR A;  4F0C A;  2OE1 A;  2B5E A;  1K3O A;  1K0O A;  5DAK A;  2DMM A;  3PH9 A;  1VF2 A;  1URM A;  2VD0 A;  4MF6 A;  4FYB A;  3F63 A;  2BJX A;  1C72 A;  1SD9 A;  2I81 A;  4V2M A;  4ZL8 A;  3F9U A;  1S3A A;  1WJK A;  5E4W A;  4KF9 A;  1SL0 B;  3UBL A;  1TOF A;  5EL8 A;  4DSR A;  2IIY A;  3QD9 A;  2JZR A;  3PIN A;  4AKH A;  1EP8 A;  4L5L A;  1DE1 A;  3TJG A;  4KDU A;  4ZBA A;  2PUK C;  5H5R A;  3KP8 A;  1WIK A;  4K0G A;  2B3S A;  3HVV A;  5G2Z A;  4MDC A;  11GS A;  2LUS A;  1BG5 A;  2GSQ A;  22GS A;  1TP9 A;  4N30 A;  2VLT A;  3LYP A;  1RQM A;  2H30 A;  1X5E A;  4NPB A;  3O76 A;  1ZYN A;  2HSH A;  1U88 A;  3ISO A;  2VCV A;  1Z7P A;  4HZ2 A;  4YQM A;  5EVO A;  1FW1 A;  3GFK A;  2IME A;  17GS A;  1V57 A;  3LGC A;  4IP1 A;  5D93 A;  3M1G A;  3FRC A;  3GTU B;  2FWF A;  2VCW A;  1AC1 A;  5D96 A;  3G7I A;  4ZB9 A;  2H66 A;  4PXO A;  3ERG A;  3MSZ A;  2FWE A;  3A2V A;  4PUA A;  4K2D A;  4YQV A;  4MJE A;  2KOK A;  3G7Y A;  5D9X A;  3ZVJ D;  1PX6 A;  2HZF A;  1OC9 A;  4BL7 A;  4G2E A;  4ILF A;  1ST9 A;  4JBB A;  5ECM B;  3APS A;  2LRT A;  1F6M C;  2GTU A;  2MMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...