4KSMA

Crystal structure of escherichia coli glutraredoxin 2 c9s/c12s mutant without glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
216
Chain Sequence
b'AMKLYIYDHSPYSLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-2
publication title Crystal structures of E.Coli glutaredoxin 2 with glutathione and of a mutant C9S/C12S without glutathione
rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 77
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04399 Glutaredoxin2_C Glutaredoxin 2, C terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ksmA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ksmA01
3BD2A 2LNSA 1FVJA 5EY6A 4F03A 3EC3A 2DC5A 4QL7A 3CXGA 2K9FA 2CX4A 4X1UA 4WBRD 2LEGA 5ECQB 2VCXA 1V58A 4HQSA 3F63A 2HXKA 4I5QA 3Q19A 4L0WA 7GSSA 2V6OA 3QFAC 3M3MA 3WGDA 3FZAA 5ENUA 5B8BA 1HQOA 4OWYA 1NM3A 1TOFA 3WT2A 2E0QA 5D93A 4GTUA 5BMUA 2C0FA 3Q18A 2GSSA 4IP1A 1Z6MA 2N5FA 1GLQA 4J57E 4HI7A 5J3RA 3ERGA 1URMA 2OA7A 3ZLPA 4D73A 5J4UA 4PUAA 3HYPA 5JCUA 1CQHA 5EVOA 1R4WA 1X5EA 4E8HA 2XBQA 3LGCA 2R4VA 1IYHA 2PMTA 3WGEA 4FQUA 3E0UA 3TOUA 3J7Yk 5J9CA 1GTIA 5ECHB 3C8EA 2H75A 2RLIA 1SD9A 17GSA 3N5OA 1G0TA 5DCGA 1OVNA 2NPBA 4MJCA 16GSA 2H1AA 4ZB8A 1GUHA 3TRXA 2H70A 3APOA 5D9VA 2GQLA 5IO0A 1XPVA 1ERVA 1EV4A 2VOCA 2H6ZA 5DQYA 3L9UA 4HU7A 1TKDB 1EGOA 4XRDA 1QMVA 4YAVA 4N11A 2J9HA 2VD0A 3FYGA 3VI5A 3IA1A 2JSZA 4KE3A 6GSUA 2V1MA 3HJMA 2YPMA 1TTZA 5G1LA 2H0GA 2VL2C 3BBYA 2YWOA 5CREA 1BQ7A 1Z7PA 2L4QA 3HZ8A 1MDIA 6GSWA 1ZYQB 1ZMAA 2OKAA 3VWVA 4PUFC 2ZCTA 3GKKA 3VWWA 1N8JA 3GMFA 3H4KA 3CRUA 4L5OA 5HFIA 1R5PA 1PGTA 2QSIA 2IPAA 2L6CA 4KUNA 5DVBA 5EL8A 1Y6EA 2IJYA 1UN2A 1GSEA 5IM9A 1A0FA 2LNTA 3L78A 1CQGA 1SU9A 4Q5FA 2YOIA 2BMXA 3VI7A 2ES7A 2HRNA 4MCUA 4IKHA 1XWAA 3G9BA 3PINA 3KGKA 2CV4A 1Z9HA 3VPTA 5DJMA 1K0DA 2I3YA 2ZUPA 2H1BA 3UMAA 2CAIA 2K18A 3GFKA 5ECKB 1SJIA 2YJ7A 1Z5YE 4G0IA 2O8VB 2A2RA 2PUKC 3OR5A 5G5FA 1KNGA 2KHPA 1WRYA 3ZMLA 1SL2B 2B1KA 4PQ1A 3GHAA 2A2SA 4ECBA 1BEDA 3C73A 1Z3EA 12GSA 1T1VA 2J23A 4TR1A 2GT6A 3I69A 3EURA 4JR4A 1EEMA 4HJ2A 2O87A 3F4RA 2C4JA 2LRCA 1GSQA 4IBPA 1V40A 1V98A 3VPQA 1B9XC 5H5QA 1VRSD 2DMLA 3GURA 2VLUA 4GWRA 4HZ4A 2P0GA 3HA9A 4NV2A 4OMVA 4AGSA 1OAZA 2L5LA 3A2VA 4WF4A 4WBJA 3KH9A 2HZEB 4ECJA 3ZL5A 1FW1A 4HOJA 3QD9A 2YWNA 5B6NA 2FA4A 4N0VA 1EV9A 2PPTA 2I1UA 3CSJA 2YV7A 2IL3A 4I6XA 4OCFA 1YF1A 4ML6A 3TKRA 4MA9A 2FY6A 4BL7B 4EO3A 2I4AA 3NIVA 2G2QA 3QR6A 2CAQA 1PX7A 1SKWB 4IQAA 2CT6A 4ZL7A 4LMVA 3EE2A 2F51A 1V9WA 5CP1A 2H74A 1M7TA 1A0RP 2PWJA 2DJKA 4P3YB 1HNAA 2VL2A 4V2MA 1KBNA 3EU3A 4PURA 1TI3A 3GH9A 1EOGA 4IQ1A 2PVOC 4L8EA 3NOFA 2JZTA 2IIYA 1JHBA 1Z7RA 4AF2A 3IAS2 1TDIA 1O8WA 5GSTA 1NSWA 2H73A 4ZXGA 3HJPA 3TOTA 1A2MA 2FHEA 5HQPA 1G6YA 4I2TA 1NHOA 3ERFA 1FAAA 2BTOT 1X9SB 2RUEA 3H93A 3TKQA 2H71A 1T7PB 2CX3A 1F3AA 2MBTA 2V2GA 3F0IA 1ZL9A 4EXJA 2F9SA 2H1GA 5ID2A 2LSTA 4BWSA 4MF6A 3KP9A 2IMIA 2OBIA 1SJ6A 1VF4A 1QUWA 4JR6A 2FD3A 3KMNA 5ECSA 1E6BA 4YQMA 3MSZA 3UIWA 3DKSA 3FHKA 2HSMB 1VF3A 1KEBA 3QFBC 2WJUA 3MAKA 4G2EA 5E4WA 3TJBA 3C1RA 2KP1A 4AJ7A 3EMXA 4ULXA 1GSYA 3LXTA 4WXTA 1TRUA 4EKZA 4XS4A 1RQMA 1OC9B 2H6XA 2TRXA 2AAWA 4IW9A 3F4SA 4MZCA 3TJFA 1XIYA 1MDJA 6GSXA 4V1Ag 1PKWA 1X5CA 4DSSB 2RM6A 3QAVA 3TRQA 1U3IA 2L59A 2VCZA 4V1Ap 3F8UA 3FZ4A 1C72A 2WCIA 3G7YA 1SL0B 1GSDA 4G0KA 4PXOA 3HKRA 1WP0A 1B8XA 2MMZA 3WYWA 1ZGNA 2REMA 3TKPA 1UVZA 5F0GA 2VIMA 2DJ1A 1S3CA 3GKMA 3P8WA 4POKA 4PX1A 3M9KA 2K6VA 2WZ9A 1DBYA 4IELA 2GSRA 5HR2A 4MF7A 1K3LA 2GT5A 2B7KA 4YQUA 3BCKA 3APSA 3NZNA 5G31A 3C7MA 4MH3A 1VF2A 2IFQB 2FLSA 2H8LA 5IMFA 3HVXA 4PQIA 3ZTLA 2H72A 2GZZA 5D9XA 4E8EA 1Y25A 1GTAA 1XXUA 1DSBA 4FH8A 4MJEA 2O85A 5KN1A 1U88A 2AYTA 1GL8A 2B5XA 5AIVA 4XIHA 1WWJA 1OE7A 4ZBDA 2WDUA 3LJRA 4XS1A 4F0BA 4HQZA 4KW6A 2JU5A 5JWQB 5FWGA 1TK8B 1ML6A 5CO3A 3IHQA 5IMAA 3FKFA 4G10A 2YNXA 3GSSA 2H66A 4O92A 2LTKA 3ZYWA 3IE3A 1S3AA 2V32A 5A4WA 3UEMA 2IWTA 1JZDA 1YQ1A 5GSSA 1QXHA 3KCMA 4AJ8A 2IMKA 1O73A 3GL3A 3MNGA 5D9TA 3QMXA 2JSYA 3D6IA 4PQHA 1THOA 4ILFA 4MZWA 3ZZXA 1XBSA 3PGTA 3GN3A 3KTBA 5B8AA 1ERUA 1AW9A 1W4VA 2IN3A 2GSQA 1JLVA 3FR9A 4WR4A 4I8BA 4X0XA 5ECRB 2JL4A 3IC8A 4ZB9A 3L9VA 2C0GA 1GTBA 3N9JA 4LA1A 4FYUA 4MK3A 3RDWA 5HR0A 5LNKe 1XWCA 3BCIA 2MMOA 3C1SA 2H76A 4J56E 2OBKA 4MF5A 1ERTA 5COHA 1TXXA 2DMMA 3P7XA 5IOWA 1B4QA 1SL1B 2MZCA 2R2JA 4GCIA 3M1GA 3P2AA 5DDLA 3GX8A 3A3TA 2GGTA 3RHBA 2VUPA 3CTFA 1BG5A 5F07A 4N0ZA 4YH2A 4IJIA 3KIJA 4IGJA 3MDKA 3UOMA 3E9JB 3F3QA 2YWIA 4TOPA 4RI7A 2ON5A 2IMFA 4BVXB 4Q5NA 22GSA 5AIXA 3HCZA 1GSFA 2KUCA 1LU4A 4JBBA 5F8BA 2YP6A 2PERA 4USSA 6GSSA 2MYGA 4EDZA 2EIOA 2K8VA 1FVKA 3IXRA 4NAXA 3TB2A 2GQKA 1F9MA 3D21A 1EWXA 3Q74A 1J9BA 4HUAA 1YJ6A 8GSSA 2N5BA 3KJYA 3DYRA 1K0NA 1A23A 4TXOB 5G1KA 5ECLB 4GXZA 5GAND 5ECOB 1FB0A 5CRHA 2P5RA 2YZHA 3J7Yb 1QK8A 3VWUA 3DWVA 3H8QA 1PMTA 4YAPA 4MMMA 3D22A 2YV9A 2XPDA 4KDXA 2GQMA 4TKYA 4JZQA 2WGRA 2FWGA 3TKSC 1B9YC 5GZZB 2C0DA 1WOUA 4DEJA 4G0LA 3KEBA 3FR3A 1AIUA 1VGLA 3TJJA 4FO5A 4XS6A 2C8UA 5LD0A 2FWHA 3IAM2 3LEFA 1XWGA 2WS2A 1XVWA 1PQNA 3CRTA 1A24A 1V57A 3GA4A 3SWLA 3GX0A 2HNLA 3CMIA 2VCTA 1XZOA 3S9FA 1X9WB 3IC4A 5ELGA 4EL1A 1FO5A 5KN2A 2GZYA 3FY7A 4DVCA 4ZL9A 1YEPA 3PR8A 9GSSA 1NHYA 4XHMA 2K8SA 1B4PA 1TP9A 2TRCP 5HFKA 2H1DA 1T4YA 1RK4A 2L6DA 2NTOA 4QQ7A 3TJGA 5IQYA 4MP4A 2NDOA 2Z9SA 2PN8A 3HVVA 5DCHA 1V2AA 2CZ2A 2XBIA 4WEYA 4EF0A 1OC3A 1GWCA 3ZFBA 3EYTA 3FRCA 5CRWA 2HZEA 3GTUB 3ME7A 4HU9A 3DRNA 3GKXA 3KP8A 5ABRA 2BJXA 2PU9C 1NW2A 2HFDA 4ECIA 3UL3A 1XW9A 2JZRA 3F6DA 2H30A 4JRRA 1K0BA 3CSIA 3HDCA 1XVQA 3L4NA 4BL7A 1TK0B 3LORA 3F4TA 4GSSA 1GNEA 1K0OA 2C3TA 2E7PA 2FA8A 1XWBA 3RPNA 4OCEA 1BJXA 4KGIA 2V6KA 3DMLA 4XCSA 3LYKA 4JE1A 4IN0A 2HSHA 1ZOFA 1PA3A 3CBUA 5CRDA 1AUCA 1H4OA 4JU5A 4TRXA 1TI1A 4MDCA 3ZVJD 3O3TA 4CDOA 4KCEA 4RQXA 4N30A 5F05A 2OE3A 1M0UA 3JCML 4MPGA 1OC8A 3U5RE 3M8NA 5J41A 1YDKA 1R7HA 4O7HA 4WR5A 1Z6NA 1GSUA 1TJDA 2MMAA 3EWLA 2A4VA 2RM5A 3TKSA 5KEJA 5F06A 1FG4A 5JCGA 2LRNA 1THXA 3FK8A 1LJRA 1F3BA 2L4CA 2HZFA 2VCQA 2I9HA 3ERWA 2RUFA 2O7KA 1TRVA 5CRGA 4KSMA 1JZRA 1HD2A 3TJKA 1TK5B 3WT1A 4ZIJA 4EC0A 3F9UA 1DUGA 2C3NA 4EE0A 1MD4A 3TGZA 1U87A 2LJAA 2GSTA 2DBCA 3QAGA 4PNGA 1WMJA 1FB6A 1RW1A 19GSA 4BVYB 1M2AA 5DALB 4KX4A 1OKTA 5IPGA 2GS3A 4J2FA 4NWYA 3RHCA 2HSMA 2V41A 2HRKB 1VF1A 3WGXA 2FUG2 2C0EA 4HDEA 2X8CA 3GV1A 3IDVA 2HI7A 4OD7A 5INYA 1K0MA 3I9V2 5ELAA 5HFGA 1YEXA 1OC9A 2FWFA 2R3XA 3FEUA 2C3QA 2H19A 2NBSA 3DEXA 3ZREA 4DSSA 1OYJA 5IO2A 3EU4A 2IMDA 4PTSA 3HY2A 3IOSA 3LYPA 1WE0A 1GH2A 1SK0A 4NPBA 3A5WA 2M46A 2EIRA 4PNFA 1ACVA 1AC1A 1DE1A 4Q5RA 1SENA 3LSZA 3VWXA 4V2NA 4PGTA 1PN9A 4MLYA 3GH6A 1M9BA 2B3SA 2LV3A 4GF0A 1GRXA 4I97A 1EZKA 1OE8A 4FYCA 3DVXA 4KH7A 4TR4A 4MPFA 1SK2A 2GTUA 3H1NA 4YQVA 5GAPD 2CA8A 2ALBA 1LBKA 4MH2A 3DD3A 2EC4A 1K0AA 4NXIA 3GIXA 4K0NA 2HSYA 4BPYA 5L71A 3QDNA 1TRSA 5A4VA 1PSQA 2IFQA 1MEKA 1UC7A 1PKZA 4OFNA 1YY7A 3G7JA 5DAKB 6GSVA 1J08A 2AUVA 4RI6A 4LL1B 3QPMA 4RQRA 2ZNMA 1X9MB 4G19A 10GSA 1R5AA 2LQQA 1FHEA 2NVLA 4NHWA 4IP6A 3KMOA 3R2QA 2L5OA 3DGQA 2X8GA 4MZBA 1XFLA 5C04A 1USBA 1A8YA 11GSA 1GUMA 5C00A 4X43A 4WKWA 3A2XA 4CW9A 4TXVA 1K3YA 1AQWA 4NHZA 4Q5QA 1M99A 4TW5A 1BAYA 1ST9A 3KZQA 2P31A 1KTEA 3GSTA 2CZ3A 4TVEA 3ZRDA 3O76A 1T4ZA 1XWKA 2VO4A 6GSYA 2VD1A 4V2LA 5IOXA 4D73B 3RBTA 4Z7XA 1AAZA 3RAZA 2XPEA 4KA0A 2MBSA 1ZZYA 1F37A 5D9WA 3W6GA 4ZBBA 4EDYA 4KB3A 4L5LA 3EVIA 3FR6A 3Q6OA 1OKDA 2AV4A 1YKAA 4FYBA 5DQSA 4TR3A 2VM1A 3KXOA 2G0FA 3QAWA 1ILOA 3I6AA 4HS1A 2XHFA 1MD3A 4OFMA 1HNCA 1TRWA 3MWHA 1J0FA 3IV4A 2VCVA 1X5DA 2CVBA 2HE3A 5ECNB 4LLRA 4KDYA 4EVMA 2R37A 3VK9A 2YWMA 2H0IA 4O32A 1M9AA 3D5JA 4NV5A 3PPUA 4BA7A 3BOAA 1T3BA 3DVWA 5B6MA 5JCWA 5CAXA 5HR3A 4GQCA 2ON7A 2HSNB 2VM2A 4GSTA 1WIKA 4K7OA 18GSA 5KN0A 4K9ZA 3ZIVA 2I81A 2C80A 4KDUA 2JADA 5G5EA 1F2EA 3K8NA 3VURA 2QKEA 3TDGA 1EP8A 4BVXA 4TN8A 3IPZA 5H5SA 3KH7A 4OO4A 3US3A 2PGTA 4K7IA 2X64A 3IRAA 3ME8A 2AJQB 2FNOA 4GQFA 3QOUA 1X0RA 1QQ2A 3EMPA 1ON4A 2X99A 5A4UA 1O8XA 2MMNA 4ZB6A 1U6TA 1HYUA 3GL5A 4POLA 5J9BA 3IK9A 3RPPA 2PBJA 1QFNA 3IK7A 4FIWA 1SJZA 3VLNA 4TXOA 5B7CA 2HT9A 2DIYA 3GYKA 1Q4JA 2E2MA 4ML1A 1PL2A 1PX6A 4ID0A 4I2UA 1PD21 1O85A 1AQXA 1QGVA 3KD0A 1IYIA 5CYYA 1UA5A 2M80A 2M72A 1Q98A 3FZ5A 1K0CA 2LJRA 2H0HA 1SKRB 2DJJA 2P5QA 2HRAA 2X8HA 1ZYEA 4CHSA 3UAPA 4O5RA 4K2DA 2LKUA 2E2GA 1DE2A 4K8MA 3FW2A 4TR1B 2F3MA 1XW5A 1EP7A 2VL9A 3HJOA 4ACSA 3H79A 3SBCA 2OADA 3O6TA 2OE0A 4WETA 1JFUA 3KM6A 5DJLA 5CNWA 5D73A 1A2JA 2GLRA 5H5RA 3IR4A 2H6YA 3HZ4A 3HVSA 3V1WA 3HD5A 3BJ5A 3M9JA 1GSSA 1K3OA 3D4TA 3ZFLA 1MTCA 2AHEA 2B5YA 1SKSB 4DSRA 2B7JA 4LL4B 4HZ2A 3VFIA 1MDKA 4POBA 1TU8A 2KOKA 4ECCA 1GUKA 3TUEA 3ISOA 4DSQA 3E3EA 2FGXA 5ECIB 2QC7A 1YZXA 3ED3A 3G7IA 4NMUA 1U3AA 2B1LA 4GLTA 2LJKA 4AJ6A 3PH9A 5IIZA 5AN1A 1F6MC 3GTUA 3WD6A 3DXBA 4KSOA 2YZUA 3U6VA 2H01A 2JZSA 2FCHA 3M0FA 2OE1A 2LUSA 1E2YA 4MJBA 4KNDA 5AISA 1A2LA 2WULA 4K7NA 2DSAA 5A5KA 2RIIA 3TRPA 2YANA 2HYXA 4QL9A 3W8SA 3QCPA 2QGVA 4MABA 3R3EA 5E59A 3FZ9A 1G6WA 1T8EB 3TKSE 5DBQA 4F82A 5G2ZA 2LS5A 1M2BA 3ZIJA 1AXDA 4HEA2 3GKNA 1H75A 4ZL8A 1XCCA 3UARA 1WJKA 3I43A 2DJ3A 3LFLA 4GRFA 1S3DA 1SD8A 1EGRA 5JWRB 2YN1A 5AGYA 14GSA 2L57A 2OJLA 1ZCPA 5ECMB 5IMCA 2B6MA 3UVTA 6GSTA 4KCAA 1GNWA 3F6FA 1G7OA 1M2DA 2AB6A 4K0GA 1XW6A 4XTSA 2VLTA 5ID2B 2VL3A 4JEDA 4K6XA 3DIEA 20GSA 1TU7A 2LQOA 1EEJA 4L0UA 1FOVA 3L0HA 1JZOA 2KP2A 3LQ7A 1WPIA 3ZMKA 1SYXA 3CYNA 1AQVA 2XC2A 4IS0A 4HJMA 5HR1A 4N10A 1YF0A 2DIZA 1N2AA 1ABAA 5IMZA 3CSHA 4G9HA 3EINA 4IJ3A 3GRXA 4F9ZA 1A8LA 4OFTA 3AY8A 2VCWA 4F0CA 4XS4B 3HHVA 2IMEA 2HLSA 2VAFA 4ISDA 1I5GA 2WRTA 4TR0A 2D2ZA 3ZVJA 1XOAA 3L9SA 2YCDA 3LXZA 1SK1A 3LG6A 3APQA 3A2WA 1W89A 4F2IA 2CQ9A 3W8JA 3GNJA 3IBHA 1EOHA 1B48A 2HQTA 5EPFA 5IMDA 5KN3A 1GP1A 4BVYA 4LMWA 1GLPA 5DALA 5JWOB 3F3RA 2B5EA 3C71A 2HRKA 4GSNA 5IMVA 2JACA 3D0ZA 2VLVA 2FWEA 3UBKA 5G30A 4ZILA 1PRXA 5D96A 1BYEA 3KTLA 2YJHA 3LWAA 2CVDA 4XRAA 3ZITA 2GVPA 4OO5A 4BWQA 1JLWA 2KLXA 4H86A 2GZPA 4KF9A 5FHIA 1T00A 2DJ2A 1I9DA 5ECPB 2DJ0A 1BX9A 4POMA 2WB9A 2GDRA 4EUYA 1XOBA 3UVHA 4KAEA 2N5AA 2R6KA 2WFCA 5LCZA 2EIQA 2TIRA 1O7UA 1O6JA 3TCOA 13GSA 2C1YA 3P90A 3UJ1A 2F8AA 5J5NA 2OACA 5FT3A 2F8FA 2HRFA 3HXSA 2CVKA 1SYRA 1YKCA 4IVFA 1G7EA 2DLXA 4MJAA 5D8IA 3UBLA 2O89A 1JZWA 4WF5A 1TW9A 1O81A 1GTUA 2LRTA 2R5GA 5IPHA 4IHUA 3GUSA 1GULA 1HNBA 4RUVA 2PVQA 1ERWA 5DAKA 3CTGA 2UZ8A 4ZBAA 4K1FA 1R26A 1PL1A 3D4MA
chains in the Genus database with same CATH superfamily
3BD2A 4E68A 2LNSA 1FVJA 5EY6A 4F03A 3EC3A 2DC5A 4QL7A 3CXGA 2K9FA 2CX4A 4X1UA 4WBRD 2LEGA 5ECQB 2VCXA 1V58A 4HQSA 3F63A 2HXKA 4I5QA 3Q19A 4L0WA 7GSSA 2V6OA 3QFAC 3M3MA 3WGDA 3FZAA 5ENUA 5B8BA 1HQOA 4OWYA 1NM3A 1TOFA 3WT2A 2E0QA 5D93A 4GTUA 5BMUA 2C0FA 3Q18A 2GSSA 4IP1A 1Z6MA 2N5FA 1GLQA 4J57E 4Z2UA 4HI7A 5J3RA 3ERGA 1URMA 2OA7A 3ZLPA 4D73A 5J4UA 4PUAA 3HYPA 5JCUA 1CQHA 5EVOA 1R4WA 1X5EA 4E8HA 2XBQA 3LGCA 2R4VA 4K5SA 1IYHA 2PMTA 3WGEA 4FQUA 3E0UA 3TOUA 3J7Yk 5J9CA 1GTIA 5ECHB 3C8EA 2H75A 2RLIA 1SD9A 17GSA 3N5OA 1G0TA 5DCGA 1OVNA 2NPBA 4MJCA 16GSA 2H1AA 4ZB8A 1GUHA 3TRXA 2H70A 3APOA 5D9VA 2GQLA 5IO0A 1XPVA 2DKIA 4EIPA 1ERVA 1EV4A 2VOCA 2H6ZA 5DQYA 3L9UA 4HU7A 1TKDB 1EGOA 4XRDA 1QMVA 4YAVA 4N11A 2J9HA 2VD0A 3FYGA 3VI5A 3IA1A 2HSNA 2JSZA 4KE3A 6GSUA 2V1MA 3HJMA 2YPMA 4O5UA 1TTZA 5G1LA 2H0GA 2VL2C 3BBYA 2YWOA 5CREA 1BQ7A 1Z7PA 2L4QA 3HZ8A 1MDIA 6GSWA 1ZYQB 1ZMAA 2OKAA 3VWVA 4PUFC 2ZCTA 3GKKA 3VWWA 1N8JA 3GMFA 3H4KA 3CRUA 4L5OA 5HFIA 1R5PA 1PGTA 2QSIA 2IPAA 2L6CA 4KUNA 5DVBA 5EL8A 1Y6EA 2IJYA 1UN2A 1GSEA 5IM9A 1A0FA 2LNTA 3L78A 1CQGA 1SU9A 4HSCX 4Q5FA 2YOIA 2BMXA 3VI7A 2ES7A 2HRNA 4MCUA 4IKHA 1XWAA 3G9BA 3PINA 3KGKA 2CV4A 1Z9HA 3VPTA 5DJMA 1K0DA 2I3YA 2ZUPA 2H1BA 1BF5A 3UMAA 2CAIA 2K18A 3GFKA 5ECKB 1SJIA 2YJ7A 1Z5YE 4G0IA 2O8VB 2A2RA 3MIXA 2PUKC 3OR5A 5G5FA 1KNGA 2KHPA 1WRYA 3ZMLA 1SL2B 2B1KA 4PQ1A 3GHAA 2A2SA 4ECBA 2EFDA 1I1IP 1BEDA 3C73A 2A4HA 1Z3EA 12GSA 1T1VA 2J23A 4TR1A 1M3JA 2GT6A 3I69A 3EURA 4JR4A 1EEMA 4HJ2A 2O87A 3F4RA 2C4JA 2LRCA 1GSQA 4IBPA 1V40A 1V98A 5A34A 5J4VA 3VPQA 1B9XC 5H5QA 1VRSD 2DMLA 3GURA 2VLUA 4GWRA 4HZ4A 2P0GA 3HA9A 4NV2A 4OMVA 4AGSA 1OAZA 2L5LA 3A2VA 4WF4A 4WBJA 3KH9A 2HZEB 4ECJA 3ZL5A 1FW1A 4HOJA 5A1NB 3QD9A 2YWNA 5B6NA 2FA4A 4N0VA 1EV9A 2PPTA 2WW1A 2I1UA 3CSJA 2X4AA 2YV7A 2IL3A 4I6XA 4OCFA 1YF1A 4ML6A 3TKRA 4MA9A 2FY6A 4BL7B 4EO3A 2I4AA 1ZYNA 3NIVA 2G2QA 3QR6A 2CAQA 1PX7A 1SKWB 4IQAA 2CT6A 4ZL7A 4LMVA 3EE2A 2F51A 1V9WA 5CP1A 2H74A 1M7TA 1A0RP 2PWJA 2DJKA 4P3YB 1HNAA 2VL2A 4V2MA 1KBNA 3EU3A 4PURA 1TI3A 3GH9A 1EOGA 4IQ1A 2PVOC 2O3EA 4MNNA 5BRTA 4L8EA 3NOFA 2JZTA 2IIYA 1JHBA 1Z7RA 4AF2A 3IAS2 3RFRC 1TDIA 1O8WA 5GSTA 1NSWA 2H73A 4ZXGA 3HJPA 3TOTA 1A2MA 2FHEA 5HQPA 1G6YA 4I2TA 1NHOA 3ERFA 1FAAA 2BTOT 1X9SB 2RUEA 3H93A 3LW9A 3TKQA 2H71A 1T7PB 2CX3A 1F3AA 2MBTA 2V2GA 3F0IA 1ZL9A 3RGBC 3HVNA 4EXJA 2F9SA 2H1GA 5ID2A 2LSTA 4BWSA 4MF6A 3KP9A 2IMIA 2OBIA 1SJ6A 1VF4A 1QUWA 4JR6A 2FD3A 3KMNA 5ECSA 1E6BA 4YQMA 3MSZA 3UIWA 3DKSA 3FHKA 2HSMB 1VF3A 1KEBA 1XG8A 3QFBC 2WJUA 3MAKA 4G2EA 5E4WA 3A5IA 3TJBA 1SVLA 2R0PA 3C1RA 2KP1A 4AJ7A 3EMXA 4ULXA 1GSYA 3LXTA 4WXTA 1TRUA 4EKZA 4XS4A 1RQMA 1OC9B 2H6XA 2TRXA 2AAWA 4IW9A 3F4SA 4MZCA 3TJFA 1XIYA 1MDJA 6GSXA 4V1Ag 1PKWA 1X5CA 4DSSB 2RM6A 3QAVA 3TRQA 1U3IA 2L59A 2VCZA 4V1Ap 3F8UA 3FZ4A 1C72A 2WCIA 3G7YA 1SL0B 1GSDA 4G0KA 4PXOA 3HKRA 5A5HA 1WP0A 1B8XA 2MMZA 3WYWA 1ZGNA 2REMA 3TKPA 1UVZA 5F0GA 2WW3A 2VIMA 2DJ1A 1S3CA 3GKMA 3P8WA 4POKA 4PX1A 3M9KA 2K6VA 2WZ9A 4W66A 1DBYA 4IELA 2GSRA 5HR2A 4MF7A 1K3LA 2GT5A 2B7KA 4YQUA 3BCKA 3APSA 3NZNA 5G31A 3C7MA 4MH3A 1VF2A 2IFQB 2FLSA 2H8LA 5IMFA 3HVXA 4PQIA 3ZTLA 2H72A 2GZZA 5D9XA 4E8EA 1Y25A 1GTAA 1XXUA 1DSBA 4FH8A 4MJEA 2O85A 5KN1A 1U88A 2AYTA 1GL8A 2B5XA 5AIVA 4XIHA 1WWJA 1OE7A 4G01A 4ZBDA 2WDUA 3LJRA 4XS1A 4F0BA 4HQZA 4KW6A 4PI2C 2JU5A 5JWQB 5FWGA 1TK8B 1ML6A 5CO3A 3IHQA 5IMAA 3FKFA 4G10A 2YNXA 3GSSA 2H66A 4O92A 2LTKA 3ZYWA 3IE3A 1S3AA 2WVXA 2V32A 5A4WA 3UEMA 1S4BP 2IWTA 1JZDA 1YQ1A 5GSSA 1QXHA 3KCMA 4AKHA 4AJ8A 2IMKA 1O73A 3GL3A 3MNGA 5D9TA 3QMXA 2JSYA 3D6IA 4PQHA 1THOA 4ILFA 4MZWA 3ZZXA 1XBSA 3PGTA 3GN3A 3KTBA 5B8AA 1ERUA 1AW9A 1W4VA 2IN3A 2GSQA 1JLVA 3FR9A 4WR4A 4I8BA 4X0XA 5ECRB 2JL4A 2WVYA 3IC8A 2EFCA 4ZB9A 2R0CA 3L9VA 2C0GA 1GTBA 3N9JA 4LA1A 4FYUA 4MK3A 3RDWA 5HR0A 5LNKe 1XWCA 3BCIA 2MMOA 3C1SA 2H76A 4J56E 2OBKA 4MF5A 1ERTA 5COHA 1TXXA 2DMMA 3P7XA 5IOWA 1B4QA 1SL1B 2MZCA 2R2JA 4GCIA 3M1GA 3P2AA 5DDLA 3GX8A 3A3TA 2GGTA 3RHBA 2VUPA 3CTFA 3HMJG 1BG5A 5F07A 4N0ZA 4YH2A 4IJIA 4N3ZA 3KIJA 4IGJA 3MDKA 4CY8A 3UOMA 3E9JB 3F3QA 2YWIA 4TOPA 4RI7A 2ON5A 2IMFA 4BVXB 4Q5NA 22GSA 5AIXA 3HCZA 1GSFA 4AKGA 2KUCA 1LU4A 4JBBA 5F8BA 2YP6A 2PERA 1S3RA 4USSA 6GSSA 2MYGA 2WVZA 4EDZA 2EIOA 2K8VA 1FVKA 3IXRA 4NAXA 3TB2A 2GQKA 1F9MA 3D21A 3EPTA 1EWXA 3Q74A 1J9BA 4HUAA 4YKGA 1YJ6A 8GSSA 2N5BA 3KJYA 3DYRA 1K0NA 1A23A 4TXOB 5G1KA 5ECLB 4GXZA 5GAND 5ECOB 1FB0A 5CRHA 2P5RA 2YZHA 3J7Yb 1QK8A 3VWUA 3DWVA 3H8QA 1PMTA 4YAPA 4MMMA 3D22A 2YV9A 2XPDA 4KDXA 2GQMA 4TKYA 4JZQA 2WGRA 2A2PA 2FWGA 3TKSC 1B9YC 5GZZB 2C0DA 1WOUA 2R0GA 4DEJA 4G0LA 3KEBA 3FR3A 2O36A 1AIUA 1VGLA 3TJJA 4FO5A 4XS6A 2C8UA 5LD0A 2FWHA 3IAM2 3LEFA 1XWGA 2WS2A 1XVWA 1PQNA 3CRTA 1A24A 1V57A 3GA4A 3CWGA 3SWLA 3GX0A 2HNLA 3CMIA 2VCTA 1ZYPA 1XZOA 3S9FA 1X9WB 4K5RA 3IC4A 5ELGA 4EL1A 1FO5A 5KN2A 2GZYA 3FY7A 4DVCA 4ZL9A 2VKZG 1YEPA 3PR8A 5J47A 9GSSA 1NHYA 1PN0A 4XHMA 2K8SA 1B4PA 1TP9A 2TRCP 5HFKA 2H1DA 1T4YA 1RK4A 4FXYP 2L6DA 2NTOA 4QQ7A 3TJGA 5IQYA 4MP4A 2NDOA 2Z9SA 2PN8A 3HVVA 5DCHA 1V2AA 2CZ2A 2XBIA 4WEYA 4EF0A 4Z2TA 1FOHA 1OC3A 1GWCA 3ZFBA 3EYTA 3FRCA 5CRWA 2HZEA 3GTUB 3ME7A 4HU9A 3DRNA 5A1NA 3GKXA 3KP8A 5ABRA 2BJXA 2PU9C 1NW2A 2HFDA 4ECIA 3UL3A 1XW9A 2JZRA 3F6DA 2H30A 4JRRA 1K0BA 3CSIA 3HDCA 3CQFA 1XVQA 3L4NA 4BL7A 1TK0B 3LORA 3F4TA 4GSSA 3CHXC 1GNEA 1K0OA 2C3TA 2E7PA 2FA8A 1XWBA 3RPNA 4OCEA 1BJXA 4KGIA 3DMLA 2V6KA 4XCSA 3MYDA 1TXUA 3LYKA 4JE1A 4IN0A 2HSHA 1ZOFA 2QA2A 1PA3A 3CBUA 5CRDA 1AUCA 1H4OA 4JU5A 4TRXA 1TI1A 4MDCA 3ZVJD 3O3TA 4CDOA 4KCEA 4RQXA 4N30A 5F05A 2OE3A 1M0UA 3JCML 4MPGA 1OC8A 3U5RE 3M8NA 5J41A 1YDKA 1R7HA 4O7HA 4WR5A 1Z6NA 4X4JA 1GSUA 1TJDA 2DKHA 2MMAA 3EWLA 2A4VA 2RM5A 3TKSA 5KEJA 5F06A 1FG4A 5JCGA 2LRNA 1THXA 3FK8A 1LJRA 1F3BA 2L4CA 2HZFA 2VCQA 2I9HA 3ERWA 2RUFA 2O7KA 1TRVA 5CRGA 4KSMA 1JZRA 1HD2A 3TJKA 1TK5B 3WT1A 4ZIJA 4EC0A 3F9UA 1DUGA 2C3NA 4EE0A 1MD4A 3TGZA 1U87A 2LJAA 2GSTA 2DBCA 3QAGA 4PNGA 1WMJA 1FB6A 1RW1A 19GSA 2WZSA 4BVYB 2EFHA 1M2AA 5DALB 4KX4A 1OKTA 5IPGA 2GS3A 4J2FA 4NWYA 3RHCA 2HSMA 2V41A 2HRKB 1VF1A 3WGXA 2FUG2 2C0EA 2X8CA 4HDEA 3GV1A 3IDVA 2HI7A 4OD7A 5INYA 1K0MA 2WW0A 3I9V2 5ELAA 5HFGA 1YEXA 1OC9A 2FWFA 2R3XA 3FEUA 2C3QA 2H19A 2NBSA 3DEXA 3ZREA 4DSSA 1OYJA 5IO2A 3EU4A 2IMDA 4PTSA 3HY2A 3IOSA 4AKXB 3LYPA 1WE0A 1GH2A 1SK0A 4NPBA 3A5WA 2M46A 2EIRA 4PNFA 1ACVA 1AC1A 1DE1A 4Q5RA 1SENA 3LSZA 3VWXA 4V2NA 4PGTA 1PN9A 4MLYA 3GH6A 1M9BA 2B3SA 2LV3A 4GF0A 1GRXA 4I97A 1EZKA 1OE8A 4FYCA 3DVXA 4KH7A 4TR4A 4MPFA 1SK2A 2GTUA 3H1NA 4YQVA 5GAPD 2CA8A 2ALBA 1LBKA 4MH2A 3DD3A 2EC4A 1K0AA 4NXIA 3GIXA 4K0NA 2HSYA 4BPYA 5L71A 3QDNA 1TRSA 5A4VA 1PSQA 2IFQA 2EFEA 1MEKA 1UC7A 1PKZA 4OFNA 1YY7A 3G7JA 5DAKB 6GSVA 1J08A 2AUVA 4RI6A 4LL1B 3QPMA 4RQRA 2ZNMA 1X9MB 4G19A 5KOXA 10GSA 1R5AA 2LQQA 1FHEA 2NVLA 4NHWA 4IP6A 3KMOA 3R2QA 2L5OA 3DGQA 2X8GA 4MZBA 1XFLA 5C04A 1USBA 1A8YA 4K2XA 11GSA 1GUMA 5C00A 4X43A 4WKWA 3A2XA 4CW9A 4TXVA 1K3YA 1AQWA 4NHZA 4Q5QA 1M99A 4TW5A 5BMUB 1BAYA 1ST9A 4PHZC 3KZQA 4CY6A 2P31A 1KTEA 3GSTA 2CZ3A 4TVEA 3ZRDA 3O76A 1T4ZA 1XWKA 2VO4A 4ICYA 6GSYA 2VD1A 4V2LA 2H1LA 5IOXA 4D73B 3RBTA 4Z7XA 1AAZA 3RAZA 2XPEA 4KA0A 2MBSA 1ZZYA 1F37A 5D9WA 3W6GA 4ZBBA 4EDYA 4KB3A 4L5LA 3EVIA 3FR6A 3Q6OA 1OKDA 2AV4A 1YKAA 4FYBA 5DQSA 4TR3A 2VM1A 3KXOA 2G0FA 3QAWA 1ILOA 3I6AA 4HS1A 2XHFA 1MD3A 4OFMA 1HNCA 1TRWA 3MWHA 1J0FA 3IV4A 2VCVA 1X5DA 2CVBA 2HE3A 5ECNB 4LLRA 4KDYA 4EVMA 2R37A 3VK9A 1YVLA 2YWMA 1SVMA 2H0IA 4O32A 1M9AA 3D5JA 4NV5A 3PPUA 4BA7A 2UV8G 3BOAA 1T3BA 3DVWA 5B6MA 5JCWA 5CAXA 5HR3A 4GQCA 2ON7A 2HSNB 2VM2A 4GSTA 1WIKA 4K7OA 18GSA 4AKIA 5KN0A 4K9ZA 3ZIVA 2I81A 2C80A 4KDUA 2JADA 5G5EA 1F2EA 3K8NA 1M3IA 3VURA 2QKEA 3TDGA 1EP8A 4BVXA 4TN8A 3IPZA 5H5SA 3KH7A 4OO4A 3US3A 2PGTA 4K7IA 2X64A 1PFOA 3IRAA 3ME8A 2AJQB 2FNOA 4GQFA 4QMKA 3QOUA 1X0RA 1QQ2A 3EMPA 1ON4A 2X99A 5A4UA 1O8XA 2MMNA 4ZB6A 1U6TA 1HYUA 3GL5A 4POLA 5J9BA 3IK9A 3RPPA 2PBJA 1QFNA 3IK7A 4FIWA 1SJZA 3VLNA 4TXOA 5B7CA 2HT9A 2DIYA 3GYKA 1Q4JA 2E2MA 4ML1A 1PL2A 2OT3A 1PX6A 4ID0A 4I2UA 1PD21 5J40A 1O85A 1AQXA 1QGVA 3FMWA 3KD0A 1IYIA 5CYYA 1UA5A 2O5VA 2M80A 1Y1UA 2M72A 1Q98A 3FZ5A 1K0CA 2LJRA 2H0HA 1SKRB 2DJJA 2P5QA 2HRAA 2X8HA 1ZYEA 4CHSA 4O5QA 3UAPA 4O5RA 4K2DA 2LKUA 2E2GA 1DE2A 4K8MA 3FW2A 2QA1A 4TR1B 2F3MA 1XW5A 1EP7A 2VL9A 3HJOA 4ACSA 3H79A 3SBCA 2OADA 3O6TA 5A34B 2OE0A 4WETA 1JFUA 3KM6A 5DJLA 5CNWA 5D73A 1A2JA 2GLRA 5H5RA 3IR4A 4GDFA 2H6YA 3HZ4A 3HVSA 3V1WA 3HD5A 3BJ5A 3M9JA 1GSSA 1K3OA 3D4TA 3ZFLA 1MTCA 2AHEA 2B5YA 1SKSB 4DSRA 2B7JA 4LL4B 4HZ2A 3VFIA 4YKFA 1MDKA 4POBA 1TU8A 2KOKA 4ECCA 1GUKA 3TUEA 3ISOA 4DSQA 3E3EA 2FGXA 5ECIB 2QC7A 2WW2A 1YZXA 3ED3A 3G7IA 4NMUA 1U3AA 2B1LA 4GLTA 2LJKA 4AJ6A 3PH9A 5IIZA 4EIQA 5AN1A 1F6MC 3GTUA 3WD6A 3DXBA 4KSOA 2YZUA 3U6VA 2H01A 2JZSA 2FCHA 3M0FA 2OE1A 2LUSA 1E2YA 4ZB7A 4MJBA 4KNDA 5AISA 1A2LA 2WULA 4K7NA 2DSAA 5A5KA 2RIIA 3TRPA 2YANA 2HYXA 4QL9A 3W8SA 3QCPA 2QGVA 4MABA 3IHGA 3R3EA 5E59A 3FZ9A 1G6WA 1T8EB 3TKSE 5DBQA 4F82A 5G2ZA 2LS5A 1M2BA 3ZIJA 5KOWA 1AXDA 4HEA2 3GKNA 1H75A 4ZL8A 1XCCA 1N25A 3UARA 1WJKA 3I43A 4A5PA 2DJ3A 3LFLA 4GRFA 4BIKA 1S3DA 1SD8A 1EGRA 5JWRB 2YN1A 5AGYA 2X49A 14GSA 2L57A 2OJLA 1SVOA 1ZCPA 5ECMB 5IMCA 2B6MA 3UVTA 6GSTA 4KCAA 1GNWA 3F6FA 1G7OA 1M2DA 2AB6A 4K0GA 1XW6A 4XTSA 2VLTA 5ID2B 1BG1A 2VL3A 4JEDA 4K6XA 3DIEA 20GSA 1YEWC 1TU7A 2LQOA 1EEJA 4L0UA 1FOVA 3L0HA 1JZOA 2KP2A 4AI6A 3LQ7A 1WPIA 3ZMKA 1SYXA 3CYNA 1AQVA 2XC2A 4IS0A 4HJMA 5HR1A 4N10A 5J4YA 1YF0A 2DIZA 1N2AA 1ABAA 5IMZA 3CSHA 4G9HA 3EINA 4IJ3A 3GRXA 4F9ZA 1A8LA 4OFTA 3AY8A 2VCWA 4F0CA 4XS4B 3HHVA 2IMEA 2HLSA 2VAFA 4ISDA 1I5GA 2WRTA 4TR0A 2D2ZA 3ZVJA 1XOAA 3L9SA 2YCDA 3LXZA 1SK1A 3LG6A 3APQA 3A2WA 1W89A 4F2IA 2CQ9A 3W8JA 3GNJA 3IBHA 4PI0C 1EOHA 1B48A 2HQTA 5EPFA 5IMDA 5KN3A 1GP1A 4BVYA 4LMWA 1GLPA 5DALA 5JWOB 3F3RA 5A5HB 2B5EA 3C71A 2HRKA 4GSNA 5IMVA 2JACA 3D0ZA 2VLVA 2FWEA 3UBKA 5G30A 4ZILA 1PRXA 5D96A 1BYEA 3KTLA 2YJHA 3LWAA 2CVDA 4XRAA 3ZITA 2GVPA 4OO5A 4BWQA 1JLWA 2KLXA 4H86A 2GZPA 4KF9A 5FHIA 1T00A 2DJ2A 1I9DA 5ECPB 2DJ0A 1BX9A 4POMA 2WB9A 2GDRA 4EUYA 1XOBA 3UVHA 4KAEA 2N5AA 2R6KA 2WFCA 5LCZA 2EIQA 2TIRA 1O7UA 1O6JA 3TCOA 4Z2RA 13GSA 2C1YA 3P90A 3UJ1A 2F8AA 5J5NA 2OACA 5FT3A 2F8FA 2HRFA 3HXSA 2CVKA 1SYRA 1YKCA 4IVFA 1G7EA 2DLXA 4MJAA 5D8IA 3UBLA 2O89A 1JZWA 4WF5A 1TW9A 2WVXB 1O81A 1GTUA 2LRTA 3TU3B 2R5GA 5IPHA 4IHUA 3GUSA 1GULA 1HNBA 4RUVA 2PVQA 1ERWA 5DAKA 3CTGA 2UZ8A 4ZBAA 4K1FA 1R26A 1PL1A 3D4MA
chains in the Genus database with same CATH topology
3BD2A 4E68A 2LNSA 1FVJA 5EY6A 4F03A 3EC3A 2DC5A 4QL7A 3CXGA 2K9FA 2CX4A 4X1UA 4WBRD 2LEGA 5ECQB 2VCXA 1V58A 4HQSA 3F63A 2HXKA 4I5QA 3Q19A 4L0WA 7GSSA 2V6OA 3QFAC 3M3MA 3WGDA 3FZAA 5ENUA 5B8BA 1HQOA 4OWYA 1NM3A 1TOFA 3WT2A 2E0QA 5D93A 4GTUA 5BMUA 2C0FA 3Q18A 2GSSA 4IP1A 1Z6MA 2N5FA 1GLQA 4J57E 4Z2UA 4HI7A 5J3RA 3ERGA 1URMA 2OA7A 3ZLPA 4D73A 5J4UA 4PUAA 3HYPA 5JCUA 1CQHA 5EVOA 1R4WA 1X5EA 4E8HA 2XBQA 3LGCA 2R4VA 4K5SA 1IYHA 2PMTA 3WGEA 4FQUA 3E0UA 3TOUA 3J7Yk 5J9CA 1GTIA 5ECHB 3C8EA 2H75A 2RLIA 1SD9A 17GSA 3N5OA 1G0TA 5DCGA 1OVNA 2NPBA 4MJCA 16GSA 2H1AA 4ZB8A 1GUHA 3TRXA 2H70A 3APOA 5D9VA 2GQLA 5IO0A 1XPVA 2DKIA 4EIPA 1ERVA 1EV4A 2VOCA 2H6ZA 5DQYA 3L9UA 4HU7A 1TKDB 1EGOA 4XRDA 1QMVA 4YAVA 4N11A 2J9HA 2VD0A 3FYGA 3VI5A 3IA1A 2HSNA 2JSZA 4KE3A 6GSUA 2V1MA 3HJMA 2YPMA 4O5UA 1TTZA 5G1LA 2H0GA 2VL2C 3BBYA 2YWOA 5CREA 1BQ7A 1Z7PA 2L4QA 3HZ8A 1MDIA 6GSWA 1ZYQB 1ZMAA 2OKAA 3VWVA 4PUFC 2ZCTA 3GKKA 3VWWA 1N8JA 3GMFA 3H4KA 3CRUA 4L5OA 5HFIA 1R5PA 1PGTA 2QSIA 2IPAA 2L6CA 4KUNA 5DVBA 5EL8A 1Y6EA 2IJYA 1UN2A 1GSEA 5IM9A 1A0FA 2LNTA 3L78A 1CQGA 1SU9A 4Q5FA 2YOIA 2BMXA 3VI7A 2ES7A 2HRNA 4MCUA 4IKHA 1XWAA 3G9BA 3PINA 3KGKA 2CV4A 1Z9HA 3VPTA 5DJMA 1K0DA 2I3YA 2ZUPA 2H1BA 1BF5A 3UMAA 2CAIA 2K18A 3GFKA 5ECKB 1SJIA 2YJ7A 1Z5YE 4G0IA 2O8VB 2A2RA 3MIXA 2PUKC 3OR5A 5G5FA 1KNGA 2KHPA 1WRYA 3ZMLA 1SL2B 2B1KA 4PQ1A 3GHAA 2A2SA 4ECBA 2EFDA 1BEDA 3C73A 2A4HA 1Z3EA 12GSA 1T1VA 2J23A 4TR1A 2GT6A 3I69A 3EURA 4JR4A 1EEMA 4HJ2A 2O87A 3F4RA 2C4JA 2LRCA 1GSQA 4IBPA 1V40A 1V98A 5A34A 5J4VA 3VPQA 1B9XC 5H5QA 1VRSD 2DMLA 3GURA 2VLUA 4GWRA 4HZ4A 2P0GA 3HA9A 4NV2A 4OMVA 4AGSA 1OAZA 2L5LA 3A2VA 4WF4A 4WBJA 3KH9A 2HZEB 4ECJA 3ZL5A 1FW1A 4HOJA 5A1NB 3QD9A 2YWNA 5B6NA 2FA4A 4N0VA 1EV9A 2PPTA 2I1UA 3CSJA 2X4AA 2YV7A 2IL3A 4I6XA 4OCFA 1YF1A 4ML6A 3TKRA 4MA9A 2FY6A 4BL7B 4EO3A 2I4AA 1ZYNA 3NIVA 2G2QA 3QR6A 2CAQA 1PX7A 1SKWB 4IQAA 2CT6A 4ZL7A 4LMVA 3EE2A 2F51A 1V9WA 5CP1A 2H74A 1M7TA 1A0RP 2PWJA 2DJKA 4P3YB 1HNAA 2VL2A 4V2MA 1KBNA 3EU3A 4PURA 1TI3A 3GH9A 1EOGA 4IQ1A 2PVOC 4MNNA 5BRTA 4L8EA 3NOFA 2JZTA 2IIYA 1JHBA 1Z7RA 4AF2A 3IAS2 1TDIA 1O8WA 5GSTA 1NSWA 2H73A 4ZXGA 3HJPA 3TOTA 1A2MA 2FHEA 5HQPA 1G6YA 4I2TA 1NHOA 3ERFA 1FAAA 2BTOT 1X9SB 2RUEA 3H93A 3LW9A 3TKQA 2H71A 1T7PB 2CX3A 1F3AA 2MBTA 2V2GA 3F0IA 1ZL9A 4EXJA 2F9SA 2H1GA 5ID2A 2LSTA 4BWSA 4MF6A 3KP9A 2IMIA 2OBIA 1SJ6A 1VF4A 1QUWA 4JR6A 2FD3A 3KMNA 5ECSA 1E6BA 4YQMA 3MSZA 3UIWA 3DKSA 3FHKA 2HSMB 1VF3A 1KEBA 3QFBC 2WJUA 3MAKA 4G2EA 5E4WA 3A5IA 3TJBA 1SVLA 2R0PA 3C1RA 2KP1A 4AJ7A 3EMXA 4ULXA 1GSYA 3LXTA 4WXTA 1TRUA 4EKZA 4XS4A 1RQMA 1OC9B 2H6XA 2TRXA 2AAWA 4IW9A 3F4SA 4MZCA 3TJFA 1XIYA 1MDJA 6GSXA 4V1Ag 1PKWA 1X5CA 4DSSB 2RM6A 3QAVA 3TRQA 1U3IA 2L59A 2VCZA 4V1Ap 3F8UA 3FZ4A 1C72A 2WCIA 3G7YA 1SL0B 1GSDA 4G0KA 4PXOA 3HKRA 5A5HA 1WP0A 1B8XA 2MMZA 3WYWA 1ZGNA 2REMA 3TKPA 1UVZA 5F0GA 2VIMA 2DJ1A 1S3CA 3GKMA 3P8WA 4POKA 4PX1A 3M9KA 2K6VA 2WZ9A 4W66A 1DBYA 4IELA 2GSRA 5HR2A 4MF7A 1K3LA 2GT5A 2B7KA 4YQUA 3BCKA 3APSA 3NZNA 5G31A 3C7MA 4MH3A 1VF2A 2IFQB 2FLSA 2H8LA 5IMFA 3HVXA 4PQIA 3ZTLA 2H72A 2GZZA 5D9XA 4E8EA 1Y25A 1GTAA 1XXUA 1DSBA 4FH8A 4MJEA 2O85A 5KN1A 1U88A 2AYTA 1GL8A 2B5XA 5AIVA 4XIHA 1WWJA 1OE7A 4G01A 4ZBDA 2WDUA 3LJRA 4XS1A 4F0BA 4HQZA 4KW6A 2JU5A 5JWQB 5FWGA 1TK8B 1ML6A 5CO3A 3IHQA 5IMAA 3FKFA 4G10A 2YNXA 3GSSA 2H66A 4O92A 2LTKA 3ZYWA 3IE3A 1S3AA 2V32A 5A4WA 3UEMA 2IWTA 1JZDA 1YQ1A 5GSSA 1QXHA 3KCMA 4AKHA 4AJ8A 2IMKA 1O73A 3GL3A 3MNGA 5D9TA 3QMXA 2JSYA 3D6IA 4PQHA 1THOA 4ILFA 4MZWA 3ZZXA 1XBSA 3PGTA 3GN3A 3KTBA 5B8AA 1ERUA 1AW9A 1W4VA 2IN3A 2GSQA 1JLVA 3FR9A 4WR4A 4I8BA 4X0XA 5ECRB 2JL4A 3IC8A 2EFCA 4ZB9A 2R0CA 3L9VA 2C0GA 1GTBA 3N9JA 4LA1A 4FYUA 4MK3A 3RDWA 5HR0A 5LNKe 1XWCA 3BCIA 2MMOA 3C1SA 2H76A 4J56E 2OBKA 4MF5A 1ERTA 5COHA 1TXXA 2DMMA 3P7XA 5IOWA 1B4QA 1SL1B 2MZCA 2R2JA 4GCIA 3M1GA 3P2AA 5DDLA 3GX8A 3A3TA 2GGTA 3RHBA 2VUPA 3CTFA 3HMJG 1BG5A 5F07A 4N0ZA 4YH2A 4IJIA 4N3ZA 3KIJA 4IGJA 3MDKA 4CY8A 3UOMA 3E9JB 3F3QA 2YWIA 4TOPA 4RI7A 2ON5A 2IMFA 4BVXB 4Q5NA 22GSA 5AIXA 3HCZA 1GSFA 4AKGA 2KUCA 1LU4A 4JBBA 5F8BA 2YP6A 2PERA 4USSA 6GSSA 2MYGA 4EDZA 2EIOA 2K8VA 1FVKA 3IXRA 4NAXA 3TB2A 2GQKA 1F9MA 3D21A 3EPTA 1EWXA 3Q74A 1J9BA 4HUAA 4YKGA 1YJ6A 8GSSA 2N5BA 3KJYA 3DYRA 1K0NA 1A23A 4TXOB 5G1KA 5ECLB 4GXZA 5GAND 5ECOB 1FB0A 5CRHA 2P5RA 2YZHA 3J7Yb 1QK8A 3VWUA 3DWVA 3H8QA 1PMTA 4YAPA 4MMMA 3D22A 2YV9A 2XPDA 4KDXA 2GQMA 4TKYA 4JZQA 2WGRA 2A2PA 2FWGA 3TKSC 1B9YC 5GZZB 2C0DA 1WOUA 2R0GA 4DEJA 4G0LA 3KEBA 3FR3A 1AIUA 1VGLA 3TJJA 4FO5A 4XS6A 2C8UA 5LD0A 2FWHA 3IAM2 3LEFA 1XWGA 2WS2A 1XVWA 1PQNA 3CRTA 1A24A 1V57A 3GA4A 3CWGA 3SWLA 3GX0A 2HNLA 3CMIA 2VCTA 1ZYPA 1XZOA 3S9FA 1X9WB 4K5RA 3IC4A 5ELGA 4EL1A 1FO5A 5KN2A 2GZYA 3FY7A 4DVCA 4ZL9A 2VKZG 1YEPA 3PR8A 5J47A 9GSSA 1NHYA 1PN0A 4XHMA 2K8SA 1B4PA 1TP9A 2TRCP 5HFKA 2H1DA 1T4YA 1RK4A 2L6DA 2NTOA 4QQ7A 3TJGA 5IQYA 4MP4A 2NDOA 2Z9SA 2PN8A 3HVVA 5DCHA 1V2AA 2CZ2A 2XBIA 4WEYA 4EF0A 4Z2TA 1FOHA 1OC3A 1GWCA 3ZFBA 3EYTA 3FRCA 5CRWA 2HZEA 3GTUB 3ME7A 4HU9A 3DRNA 5A1NA 3GKXA 3KP8A 5ABRA 2BJXA 2PU9C 1NW2A 2HFDA 4ECIA 3UL3A 1XW9A 2JZRA 3F6DA 2H30A 4JRRA 1K0BA 3CSIA 3HDCA 1XVQA 3L4NA 4BL7A 1TK0B 3LORA 3F4TA 4GSSA 1GNEA 1K0OA 2C3TA 2E7PA 2FA8A 1XWBA 3RPNA 4OCEA 1BJXA 4KGIA 3DMLA 2V6KA 4XCSA 3MYDA 1TXUA 3LYKA 4JE1A 4IN0A 2HSHA 1ZOFA 2QA2A 1PA3A 3CBUA 5CRDA 1AUCA 1H4OA 4JU5A 4TRXA 1TI1A 4MDCA 3ZVJD 3O3TA 4CDOA 4KCEA 4RQXA 4N30A 5F05A 2OE3A 1M0UA 3JCML 4MPGA 1OC8A 3U5RE 3M8NA 5J41A 1YDKA 1R7HA 4O7HA 4WR5A 1Z6NA 4X4JA 1GSUA 1TJDA 2DKHA 2MMAA 3EWLA 2A4VA 2RM5A 3TKSA 5KEJA 5F06A 1FG4A 5JCGA 2LRNA 1THXA 3FK8A 1LJRA 1F3BA 2L4CA 2HZFA 2VCQA 2I9HA 3ERWA 2RUFA 2O7KA 1TRVA 5CRGA 4KSMA 1JZRA 1HD2A 3TJKA 1TK5B 3WT1A 4ZIJA 4EC0A 3F9UA 1DUGA 2C3NA 4EE0A 1MD4A 3TGZA 1U87A 2LJAA 2GSTA 2DBCA 3QAGA 4PNGA 1WMJA 1FB6A 1RW1A 19GSA 4BVYB 2EFHA 1M2AA 5DALB 4KX4A 1OKTA 5IPGA 2GS3A 4J2FA 4NWYA 3RHCA 2HSMA 2V41A 2HRKB 1VF1A 3WGXA 2FUG2 2C0EA 2X8CA 4HDEA 3GV1A 3IDVA 2HI7A 4OD7A 5INYA 1K0MA 3I9V2 5ELAA 5HFGA 1YEXA 1OC9A 2FWFA 2R3XA 3FEUA 2C3QA 2H19A 2NBSA 3DEXA 3ZREA 4DSSA 1OYJA 5IO2A 3EU4A 2IMDA 4PTSA 3HY2A 3IOSA 4AKXB 3LYPA 1WE0A 1GH2A 1SK0A 4NPBA 3A5WA 2M46A 2EIRA 4PNFA 1ACVA 1AC1A 1DE1A 4Q5RA 1SENA 3LSZA 3VWXA 4V2NA 4PGTA 1PN9A 4MLYA 3GH6A 1M9BA 2B3SA 2LV3A 4GF0A 1GRXA 4I97A 1EZKA 1OE8A 4FYCA 3DVXA 4KH7A 4TR4A 4MPFA 1SK2A 2GTUA 3H1NA 4YQVA 5GAPD 2CA8A 2ALBA 1LBKA 4MH2A 3DD3A 2EC4A 1K0AA 4NXIA 3GIXA 4K0NA 2HSYA 4BPYA 5L71A 3QDNA 1TRSA 5A4VA 1PSQA 2IFQA 2EFEA 1MEKA 1UC7A 1PKZA 4OFNA 1YY7A 3G7JA 5DAKB 6GSVA 1J08A 2AUVA 4RI6A 4LL1B 3QPMA 4RQRA 2ZNMA 1X9MB 4G19A 5KOXA 10GSA 1R5AA 2LQQA 1FHEA 2NVLA 4NHWA 4IP6A 3KMOA 3R2QA 2L5OA 3DGQA 2X8GA 4MZBA 1XFLA 5C04A 1USBA 1A8YA 4K2XA 11GSA 1GUMA 5C00A 4X43A 4WKWA 3A2XA 4CW9A 4TXVA 1K3YA 1AQWA 4NHZA 4Q5QA 1M99A 4TW5A 5BMUB 1BAYA 1ST9A 3KZQA 4CY6A 2P31A 1KTEA 3GSTA 2CZ3A 4TVEA 3ZRDA 3O76A 1T4ZA 1XWKA 2VO4A 4ICYA 6GSYA 2VD1A 4V2LA 2H1LA 5IOXA 4D73B 3RBTA 4Z7XA 1AAZA 3RAZA 2XPEA 4KA0A 2MBSA 1ZZYA 1F37A 5D9WA 3W6GA 4ZBBA 4EDYA 4KB3A 4L5LA 3EVIA 3FR6A 3Q6OA 1OKDA 2AV4A 1YKAA 4FYBA 5DQSA 4TR3A 2VM1A 3KXOA 2G0FA 3QAWA 1ILOA 3I6AA 4HS1A 2XHFA 1MD3A 4OFMA 1HNCA 1TRWA 3MWHA 1J0FA 3IV4A 2VCVA 1X5DA 2CVBA 2HE3A 5ECNB 4LLRA 4KDYA 4EVMA 2R37A 3VK9A 1YVLA 2YWMA 1SVMA 2H0IA 4O32A 1M9AA 3D5JA 4NV5A 3PPUA 4BA7A 2UV8G 3BOAA 1T3BA 3DVWA 5B6MA 5JCWA 5CAXA 5HR3A 4GQCA 2ON7A 2HSNB 2VM2A 4GSTA 1WIKA 4K7OA 18GSA 4AKIA 5KN0A 4K9ZA 3ZIVA 2I81A 2C80A 4KDUA 2JADA 5G5EA 1F2EA 3K8NA 3VURA 2QKEA 3TDGA 1EP8A 4BVXA 4TN8A 3IPZA 5H5SA 3KH7A 4OO4A 3US3A 2PGTA 4K7IA 2X64A 3IRAA 3ME8A 2AJQB 2FNOA 4GQFA 4QMKA 3QOUA 1X0RA 1QQ2A 3EMPA 1ON4A 2X99A 5A4UA 1O8XA 2MMNA 4ZB6A 1U6TA 1HYUA 3GL5A 4POLA 5J9BA 3IK9A 3RPPA 2PBJA 1QFNA 3IK7A 4FIWA 1SJZA 3VLNA 4TXOA 5B7CA 2HT9A 2DIYA 3GYKA 1Q4JA 2E2MA 4ML1A 1PL2A 2OT3A 1PX6A 4ID0A 4I2UA 1PD21 5J40A 1O85A 1AQXA 1QGVA 3FMWA 3KD0A 1IYIA 5CYYA 1UA5A 2O5VA 2M80A 1Y1UA 2M72A 1Q98A 3FZ5A 1K0CA 2LJRA 2H0HA 1SKRB 2DJJA 2P5QA 2HRAA 2X8HA 1ZYEA 4CHSA 4O5QA 3UAPA 4O5RA 4K2DA 2LKUA 2E2GA 1DE2A 4K8MA 3FW2A 2QA1A 4TR1B 2F3MA 1XW5A 1EP7A 2VL9A 3HJOA 4ACSA 3H79A 3SBCA 2OADA 3O6TA 5A34B 2OE0A 4WETA 1JFUA 3KM6A 5DJLA 5CNWA 5D73A 1A2JA 2GLRA 5H5RA 3IR4A 4GDFA 2H6YA 3HZ4A 3HVSA 3V1WA 3HD5A 3BJ5A 3M9JA 1GSSA 1K3OA 3D4TA 3ZFLA 1MTCA 2AHEA 2B5YA 1SKSB 4DSRA 2B7JA 4LL4B 4HZ2A 3VFIA 4YKFA 1MDKA 4POBA 1TU8A 2KOKA 4ECCA 1GUKA 3TUEA 3ISOA 4DSQA 3E3EA 2FGXA 5ECIB 2QC7A 1YZXA 3ED3A 3G7IA 4NMUA 1U3AA 2B1LA 4GLTA 2LJKA 4AJ6A 3PH9A 5IIZA 4EIQA 5AN1A 1F6MC 3GTUA 3WD6A 3DXBA 4KSOA 2YZUA 3U6VA 2H01A 2JZSA 2FCHA 3M0FA 2OE1A 2LUSA 1E2YA 4ZB7A 4MJBA 4KNDA 5AISA 1A2LA 2WULA 4K7NA 2DSAA 5A5KA 2RIIA 3TRPA 2YANA 2HYXA 4QL9A 3W8SA 3QCPA 2QGVA 4MABA 3IHGA 3R3EA 5E59A 3FZ9A 1G6WA 1T8EB 3TKSE 5DBQA 4F82A 5G2ZA 2LS5A 1M2BA 3ZIJA 5KOWA 1AXDA 4HEA2 3GKNA 1H75A 4ZL8A 1XCCA 1N25A 3UARA 1WJKA 3I43A 4A5PA 2DJ3A 3LFLA 4GRFA 1S3DA 1SD8A 1EGRA 5JWRB 2YN1A 5AGYA 2X49A 14GSA 2L57A 2OJLA 1SVOA 1ZCPA 5ECMB 5IMCA 2B6MA 3UVTA 6GSTA 4KCAA 1GNWA 3F6FA 1G7OA 1M2DA 2AB6A 4K0GA 1XW6A 4XTSA 2VLTA 5ID2B 1BG1A 2VL3A 4JEDA 4K6XA 3DIEA 20GSA 1TU7A 2LQOA 1EEJA 4L0UA 1FOVA 3L0HA 1JZOA 2KP2A 4AI6A 3LQ7A 1WPIA 3ZMKA 1SYXA 3CYNA 1AQVA 2XC2A 4IS0A 4HJMA 5HR1A 4N10A 5J4YA 1YF0A 2DIZA 1N2AA 1ABAA 5IMZA 3CSHA 4G9HA 3EINA 4IJ3A 3GRXA 4F9ZA 1A8LA 4OFTA 3AY8A 2VCWA 4F0CA 4XS4B 3HHVA 2IMEA 2HLSA 2VAFA 4ISDA 1I5GA 2WRTA 4TR0A 2D2ZA 3ZVJA 1XOAA 3L9SA 2YCDA 3LXZA 1SK1A 3LG6A 3APQA 3A2WA 1W89A 4F2IA 2CQ9A 3W8JA 3GNJA 3IBHA 1EOHA 1B48A 2HQTA 5EPFA 5IMDA 5KN3A 1GP1A 4BVYA 4LMWA 1GLPA 5DALA 5JWOB 3F3RA 5A5HB 2B5EA 3C71A 2HRKA 4GSNA 5IMVA 2JACA 3D0ZA 2VLVA 2FWEA 3UBKA 5G30A 4ZILA 1PRXA 5D96A 1BYEA 3KTLA 2YJHA 3LWAA 2CVDA 4XRAA 3ZITA 2GVPA 4OO5A 4BWQA 1JLWA 2KLXA 4H86A 2GZPA 4KF9A 5FHIA 1T00A 2DJ2A 1I9DA 5ECPB 2DJ0A 1BX9A 4POMA 2WB9A 2GDRA 4EUYA 1XOBA 3UVHA 4KAEA 2N5AA 2R6KA 2WFCA 5LCZA 2EIQA 2TIRA 1O7UA 1O6JA 3TCOA 4Z2RA 13GSA 2C1YA 3P90A 3UJ1A 2F8AA 5J5NA 2OACA 5FT3A 2F8FA 2HRFA 3HXSA 2CVKA 1SYRA 1YKCA 4IVFA 1G7EA 2DLXA 4MJAA 5D8IA 3UBLA 2O89A 1JZWA 4WF5A 1TW9A 1O81A 1GTUA 2LRTA 3TU3B 2R5GA 5IPHA 4IHUA 3GUSA 1GULA 1HNBA 4RUVA 2PVQA 1ERWA 5DAKA 3CTGA 2UZ8A 4ZBAA 4K1FA 1R26A 1PL1A 3D4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BD2 A;  2LNS A;  1FVJ A;  5EY6 A;  4F03 A;  3EC3 A;  2DC5 A;  4QL7 A;  3CXG A;  2K9F A;  2CX4 A;  4X1U A;  4WBR D;  2LEG A;  5ECQ B;  2VCX A;  1V58 A;  4HQS A;  3F63 A;  2HXK A;  4I5Q A;  3Q19 A;  4L0W A;  7GSS A;  2V6O A;  3QFA C;  3M3M A;  3WGD A;  3FZA A;  5ENU A;  5B8B A;  1HQO A;  4OWY A;  1NM3 A;  1TOF A;  3WT2 A;  2E0Q A;  5D93 A;  4GTU A;  5BMU A;  2C0F A;  3Q18 A;  2GSS A;  4IP1 A;  1Z6M A;  2N5F A;  1GLQ A;  4J57 E;  4HI7 A;  5J3R A;  3ERG A;  1URM A;  2OA7 A;  3ZLP A;  4D73 A;  5J4U A;  4PUA A;  3HYP A;  5JCU A;  1CQH A;  5EVO A;  1R4W A;  1X5E A;  4E8H A;  2XBQ A;  3LGC A;  2R4V A;  1IYH A;  2PMT A;  3WGE A;  4FQU A;  3E0U A;  3TOU A;  3J7Y k;  5J9C A;  1GTI A;  5ECH B;  3C8E A;  2H75 A;  2RLI A;  1SD9 A;  17GS A;  3N5O A;  1G0T A;  5DCG A;  1OVN A;  2NPB A;  4MJC A;  16GS A;  2H1A A;  4ZB8 A;  1GUH A;  3TRX A;  2H70 A;  3APO A;  5D9V A;  2GQL A;  5IO0 A;  1XPV A;  1ERV A;  1EV4 A;  2VOC A;  2H6Z A;  5DQY A;  3L9U A;  4HU7 A;  1TKD B;  1EGO A;  4XRD A;  1QMV A;  4YAV A;  4N11 A;  2J9H A;  2VD0 A;  3FYG A;  3VI5 A;  3IA1 A;  2JSZ A;  4KE3 A;  6GSU A;  2V1M A;  3HJM A;  2YPM A;  1TTZ A;  5G1L A;  2H0G A;  2VL2 C;  3BBY A;  2YWO A;  5CRE A;  1BQ7 A;  1Z7P A;  2L4Q A;  3HZ8 A;  1MDI A;  6GSW A;  1ZYQ B;  1ZMA A;  2OKA A;  3VWV A;  4PUF C;  2ZCT A;  3GKK A;  3VWW A;  1N8J A;  3GMF A;  3H4K A;  3CRU A;  4L5O A;  5HFI A;  1R5P A;  1PGT A;  2QSI A;  2IPA A;  2L6C A;  4KUN A;  5DVB A;  5EL8 A;  1Y6E A;  2IJY A;  1UN2 A;  1GSE A;  5IM9 A;  1A0F A;  2LNT A;  3L78 A;  1CQG A;  1SU9 A;  4Q5F A;  2YOI A;  2BMX A;  3VI7 A;  2ES7 A;  2HRN A;  4MCU A;  4IKH A;  1XWA A;  3G9B A;  3PIN A;  3KGK A;  2CV4 A;  1Z9H A;  3VPT A;  5DJM A;  1K0D A;  2I3Y A;  2ZUP A;  2H1B A;  3UMA A;  2CAI A;  2K18 A;  3GFK A;  5ECK B;  1SJI A;  2YJ7 A;  1Z5Y E;  4G0I A;  2O8V B;  2A2R A;  2PUK C;  3OR5 A;  5G5F A;  1KNG A;  2KHP A;  1WRY A;  3ZML A;  1SL2 B;  2B1K A;  4PQ1 A;  3GHA A;  2A2S A;  4ECB A;  1BED A;  3C73 A;  1Z3E A;  12GS A;  1T1V A;  2J23 A;  4TR1 A;  2GT6 A;  3I69 A;  3EUR A;  4JR4 A;  1EEM A;  4HJ2 A;  2O87 A;  3F4R A;  2C4J A;  2LRC A;  1GSQ A;  4IBP A;  1V40 A;  1V98 A;  3VPQ A;  1B9X C;  5H5Q A;  1VRS D;  2DML A;  3GUR A;  2VLU A;  4GWR A;  4HZ4 A;  2P0G A;  3HA9 A;  4NV2 A;  4OMV A;  4AGS A;  1OAZ A;  2L5L A;  3A2V A;  4WF4 A;  4WBJ A;  3KH9 A;  2HZE B;  4ECJ A;  3ZL5 A;  1FW1 A;  4HOJ A;  3QD9 A;  2YWN A;  5B6N A;  2FA4 A;  4N0V A;  1EV9 A;  2PPT A;  2I1U A;  3CSJ A;  2YV7 A;  2IL3 A;  4I6X A;  4OCF A;  1YF1 A;  4ML6 A;  3TKR A;  4MA9 A;  2FY6 A;  4BL7 B;  4EO3 A;  2I4A A;  3NIV A;  2G2Q A;  3QR6 A;  2CAQ A;  1PX7 A;  1SKW B;  4IQA A;  2CT6 A;  4ZL7 A;  4LMV A;  3EE2 A;  2F51 A;  1V9W A;  5CP1 A;  2H74 A;  1M7T A;  1A0R P;  2PWJ A;  2DJK A;  4P3Y B;  1HNA A;  2VL2 A;  4V2M A;  1KBN A;  3EU3 A;  4PUR A;  1TI3 A;  3GH9 A;  1EOG A;  4IQ1 A;  2PVO C;  4L8E A;  3NOF A;  2JZT A;  2IIY A;  1JHB A;  1Z7R A;  4AF2 A;  3IAS 2;  1TDI A;  1O8W A;  5GST A;  1NSW A;  2H73 A;  4ZXG A;  3HJP A;  3TOT A;  1A2M A;  2FHE A;  5HQP A;  1G6Y A;  4I2T A;  1NHO A;  3ERF A;  1FAA A;  2BTO T;  1X9S B;  2RUE A;  3H93 A;  3TKQ A;  2H71 A;  1T7P B;  2CX3 A;  1F3A A;  2MBT A;  2V2G A;  3F0I A;  1ZL9 A;  4EXJ A;  2F9S A;  2H1G A;  5ID2 A;  2LST A;  4BWS A;  4MF6 A;  3KP9 A;  2IMI A;  2OBI A;  1SJ6 A;  1VF4 A;  1QUW A;  4JR6 A;  2FD3 A;  3KMN A;  5ECS A;  1E6B A;  4YQM A;  3MSZ A;  3UIW A;  3DKS A;  3FHK A;  2HSM B;  1VF3 A;  1KEB A;  3QFB C;  2WJU A;  3MAK A;  4G2E A;  5E4W A;  3TJB A;  3C1R A;  2KP1 A;  4AJ7 A;  3EMX A;  4ULX A;  1GSY A;  3LXT A;  4WXT A;  1TRU A;  4EKZ A;  4XS4 A;  1RQM A;  1OC9 B;  2H6X A;  2TRX A;  2AAW A;  4IW9 A;  3F4S A;  4MZC A;  3TJF A;  1XIY A;  1MDJ A;  6GSX A;  4V1A g;  1PKW A;  1X5C A;  4DSS B;  2RM6 A;  3QAV A;  3TRQ A;  1U3I A;  2L59 A;  2VCZ A;  4V1A p;  3F8U A;  3FZ4 A;  1C72 A;  2WCI A;  3G7Y A;  1SL0 B;  1GSD A;  4G0K A;  4PXO A;  3HKR A;  1WP0 A;  1B8X A;  2MMZ A;  3WYW A;  1ZGN A;  2REM A;  3TKP A;  1UVZ A;  5F0G A;  2VIM A;  2DJ1 A;  1S3C A;  3GKM A;  3P8W A;  4POK A;  4PX1 A;  3M9K A;  2K6V A;  2WZ9 A;  1DBY A;  4IEL A;  2GSR A;  5HR2 A;  4MF7 A;  1K3L A;  2GT5 A;  2B7K A;  4YQU A;  3BCK A;  3APS A;  3NZN A;  5G31 A;  3C7M A;  4MH3 A;  1VF2 A;  2IFQ B;  2FLS A;  2H8L A;  5IMF A;  3HVX A;  4PQI A;  3ZTL A;  2H72 A;  2GZZ A;  5D9X A;  4E8E A;  1Y25 A;  1GTA A;  1XXU A;  1DSB A;  4FH8 A;  4MJE A;  2O85 A;  5KN1 A;  1U88 A;  2AYT A;  1GL8 A;  2B5X A;  5AIV A;  4XIH A;  1WWJ A;  1OE7 A;  4ZBD A;  2WDU A;  3LJR A;  4XS1 A;  4F0B A;  4HQZ A;  4KW6 A;  2JU5 A;  5JWQ B;  5FWG A;  1TK8 B;  1ML6 A;  5CO3 A;  3IHQ A;  5IMA A;  3FKF A;  4G10 A;  2YNX A;  3GSS A;  2H66 A;  4O92 A;  2LTK A;  3ZYW A;  3IE3 A;  1S3A A;  2V32 A;  5A4W A;  3UEM A;  2IWT A;  1JZD A;  1YQ1 A;  5GSS A;  1QXH A;  3KCM A;  4AJ8 A;  2IMK A;  1O73 A;  3GL3 A;  3MNG A;  5D9T A;  3QMX A;  2JSY A;  3D6I A;  4PQH A;  1THO A;  4ILF A;  4MZW A;  3ZZX A;  1XBS A;  3PGT A;  3GN3 A;  3KTB A;  5B8A A;  1ERU A;  1AW9 A;  1W4V A;  2IN3 A;  2GSQ A;  1JLV A;  3FR9 A;  4WR4 A;  4I8B A;  4X0X A;  5ECR B;  2JL4 A;  3IC8 A;  4ZB9 A;  3L9V A;  2C0G A;  1GTB A;  3N9J A;  4LA1 A;  4FYU A;  4MK3 A;  3RDW A;  5HR0 A;  5LNK e;  1XWC A;  3BCI A;  2MMO A;  3C1S A;  2H76 A;  4J56 E;  2OBK A;  4MF5 A;  1ERT A;  5COH A;  1TXX A;  2DMM A;  3P7X A;  5IOW A;  1B4Q A;  1SL1 B;  2MZC A;  2R2J A;  4GCI A;  3M1G A;  3P2A A;  5DDL A;  3GX8 A;  3A3T A;  2GGT A;  3RHB A;  2VUP A;  3CTF A;  1BG5 A;  5F07 A;  4N0Z A;  4YH2 A;  4IJI A;  3KIJ A;  4IGJ A;  3MDK A;  3UOM A;  3E9J B;  3F3Q A;  2YWI A;  4TOP A;  4RI7 A;  2ON5 A;  2IMF A;  4BVX B;  4Q5N A;  22GS A;  5AIX A;  3HCZ A;  1GSF A;  2KUC A;  1LU4 A;  4JBB A;  5F8B A;  2YP6 A;  2PER A;  4USS A;  6GSS A;  2MYG A;  4EDZ A;  2EIO A;  2K8V A;  1FVK A;  3IXR A;  4NAX A;  3TB2 A;  2GQK A;  1F9M A;  3D21 A;  1EWX A;  3Q74 A;  1J9B A;  4HUA A;  1YJ6 A;  8GSS A;  2N5B A;  3KJY A;  3DYR A;  1K0N A;  1A23 A;  4TXO B;  5G1K A;  5ECL B;  4GXZ A;  5GAN D;  5ECO B;  1FB0 A;  5CRH A;  2P5R A;  2YZH A;  3J7Y b;  1QK8 A;  3VWU A;  3DWV A;  3H8Q A;  1PMT A;  4YAP A;  4MMM A;  3D22 A;  2YV9 A;  2XPD A;  4KDX A;  2GQM A;  4TKY A;  4JZQ A;  2WGR A;  2FWG A;  3TKS C;  1B9Y C;  5GZZ B;  2C0D A;  1WOU A;  4DEJ A;  4G0L A;  3KEB A;  3FR3 A;  1AIU A;  1VGL A;  3TJJ A;  4FO5 A;  4XS6 A;  2C8U A;  5LD0 A;  2FWH A;  3IAM 2;  3LEF A;  1XWG A;  2WS2 A;  1XVW A;  1PQN A;  3CRT A;  1A24 A;  1V57 A;  3GA4 A;  3SWL A;  3GX0 A;  2HNL A;  3CMI A;  2VCT A;  1XZO A;  3S9F A;  1X9W B;  3IC4 A;  5ELG A;  4EL1 A;  1FO5 A;  5KN2 A;  2GZY A;  3FY7 A;  4DVC A;  4ZL9 A;  1YEP A;  3PR8 A;  9GSS A;  1NHY A;  4XHM A;  2K8S A;  1B4P A;  1TP9 A;  2TRC P;  5HFK A;  2H1D A;  1T4Y A;  1RK4 A;  2L6D A;  2NTO A;  4QQ7 A;  3TJG A;  5IQY A;  4MP4 A;  2NDO A;  2Z9S A;  2PN8 A;  3HVV A;  5DCH A;  1V2A A;  2CZ2 A;  2XBI A;  4WEY A;  4EF0 A;  1OC3 A;  1GWC A;  3ZFB A;  3EYT A;  3FRC A;  5CRW A;  2HZE A;  3GTU B;  3ME7 A;  4HU9 A;  3DRN A;  3GKX A;  3KP8 A;  5ABR A;  2BJX A;  2PU9 C;  1NW2 A;  2HFD A;  4ECI A;  3UL3 A;  1XW9 A;  2JZR A;  3F6D A;  2H30 A;  4JRR A;  1K0B A;  3CSI A;  3HDC A;  1XVQ A;  3L4N A;  4BL7 A;  1TK0 B;  3LOR A;  3F4T A;  4GSS A;  1GNE A;  1K0O A;  2C3T A;  2E7P A;  2FA8 A;  1XWB A;  3RPN A;  4OCE A;  1BJX A;  4KGI A;  2V6K A;  3DML A;  4XCS A;  3LYK A;  4JE1 A;  4IN0 A;  2HSH A;  1ZOF A;  1PA3 A;  3CBU A;  5CRD A;  1AUC A;  1H4O A;  4JU5 A;  4TRX A;  1TI1 A;  4MDC A;  3ZVJ D;  3O3T A;  4CDO A;  4KCE A;  4RQX A;  4N30 A;  5F05 A;  2OE3 A;  1M0U A;  3JCM L;  4MPG A;  1OC8 A;  3U5R E;  3M8N A;  5J41 A;  1YDK A;  1R7H A;  4O7H A;  4WR5 A;  1Z6N A;  1GSU A;  1TJD A;  2MMA A;  3EWL A;  2A4V A;  2RM5 A;  3TKS A;  5KEJ A;  5F06 A;  1FG4 A;  5JCG A;  2LRN A;  1THX A;  3FK8 A;  1LJR A;  1F3B A;  2L4C A;  2HZF A;  2VCQ A;  2I9H A;  3ERW A;  2RUF A;  2O7K A;  1TRV A;  5CRG A;  4KSM A;  1JZR A;  1HD2 A;  3TJK A;  1TK5 B;  3WT1 A;  4ZIJ A;  4EC0 A;  3F9U A;  1DUG A;  2C3N A;  4EE0 A;  1MD4 A;  3TGZ A;  1U87 A;  2LJA A;  2GST A;  2DBC A;  3QAG A;  4PNG A;  1WMJ A;  1FB6 A;  1RW1 A;  19GS A;  4BVY B;  1M2A A;  5DAL B;  4KX4 A;  1OKT A;  5IPG A;  2GS3 A;  4J2F A;  4NWY A;  3RHC A;  2HSM A;  2V41 A;  2HRK B;  1VF1 A;  3WGX A;  2FUG 2;  2C0E A;  4HDE A;  2X8C A;  3GV1 A;  3IDV A;  2HI7 A;  4OD7 A;  5INY A;  1K0M A;  3I9V 2;  5ELA A;  5HFG A;  1YEX A;  1OC9 A;  2FWF A;  2R3X A;  3FEU A;  2C3Q A;  2H19 A;  2NBS A;  3DEX A;  3ZRE A;  4DSS A;  1OYJ A;  5IO2 A;  3EU4 A;  2IMD A;  4PTS A;  3HY2 A;  3IOS A;  3LYP A;  1WE0 A;  1GH2 A;  1SK0 A;  4NPB A;  3A5W A;  2M46 A;  2EIR A;  4PNF A;  1ACV A;  1AC1 A;  1DE1 A;  4Q5R A;  1SEN A;  3LSZ A;  3VWX A;  4V2N A;  4PGT A;  1PN9 A;  4MLY A;  3GH6 A;  1M9B A;  2B3S A;  2LV3 A;  4GF0 A;  1GRX A;  4I97 A;  1EZK A;  1OE8 A;  4FYC A;  3DVX A;  4KH7 A;  4TR4 A;  4MPF A;  1SK2 A;  2GTU A;  3H1N A;  4YQV A;  5GAP D;  2CA8 A;  2ALB A;  1LBK A;  4MH2 A;  3DD3 A;  2EC4 A;  1K0A A;  4NXI A;  3GIX A;  4K0N A;  2HSY A;  4BPY A;  5L71 A;  3QDN A;  1TRS A;  5A4V A;  1PSQ A;  2IFQ A;  1MEK A;  1UC7 A;  1PKZ A;  4OFN A;  1YY7 A;  3G7J A;  5DAK B;  6GSV A;  1J08 A;  2AUV A;  4RI6 A;  4LL1 B;  3QPM A;  4RQR A;  2ZNM A;  1X9M B;  4G19 A;  10GS A;  1R5A A;  2LQQ A;  1FHE A;  2NVL A;  4NHW A;  4IP6 A;  3KMO A;  3R2Q A;  2L5O A;  3DGQ A;  2X8G A;  4MZB A;  1XFL A;  5C04 A;  1USB A;  1A8Y A;  11GS A;  1GUM A;  5C00 A;  4X43 A;  4WKW A;  3A2X A;  4CW9 A;  4TXV A;  1K3Y A;  1AQW A;  4NHZ A;  4Q5Q A;  1M99 A;  4TW5 A;  1BAY A;  1ST9 A;  3KZQ A;  2P31 A;  1KTE A;  3GST A;  2CZ3 A;  4TVE A;  3ZRD A;  3O76 A;  1T4Z A;  1XWK A;  2VO4 A;  6GSY A;  2VD1 A;  4V2L A;  5IOX A;  4D73 B;  3RBT A;  4Z7X A;  1AAZ A;  3RAZ A;  2XPE A;  4KA0 A;  2MBS A;  1ZZY A;  1F37 A;  5D9W A;  3W6G A;  4ZBB A;  4EDY A;  4KB3 A;  4L5L A;  3EVI A;  3FR6 A;  3Q6O A;  1OKD A;  2AV4 A;  1YKA A;  4FYB A;  5DQS A;  4TR3 A;  2VM1 A;  3KXO A;  2G0F A;  3QAW A;  1ILO A;  3I6A A;  4HS1 A;  2XHF A;  1MD3 A;  4OFM A;  1HNC A;  1TRW A;  3MWH A;  1J0F A;  3IV4 A;  2VCV A;  1X5D A;  2CVB A;  2HE3 A;  5ECN B;  4LLR A;  4KDY A;  4EVM A;  2R37 A;  3VK9 A;  2YWM A;  2H0I A;  4O32 A;  1M9A A;  3D5J A;  4NV5 A;  3PPU A;  4BA7 A;  3BOA A;  1T3B A;  3DVW A;  5B6M A;  5JCW A;  5CAX A;  5HR3 A;  4GQC A;  2ON7 A;  2HSN B;  2VM2 A;  4GST A;  1WIK A;  4K7O A;  18GS A;  5KN0 A;  4K9Z A;  3ZIV A;  2I81 A;  2C80 A;  4KDU A;  2JAD A;  5G5E A;  1F2E A;  3K8N A;  3VUR A;  2QKE A;  3TDG A;  1EP8 A;  4BVX A;  4TN8 A;  3IPZ A;  5H5S A;  3KH7 A;  4OO4 A;  3US3 A;  2PGT A;  4K7I A;  2X64 A;  3IRA A;  3ME8 A;  2AJQ B;  2FNO A;  4GQF A;  3QOU A;  1X0R A;  1QQ2 A;  3EMP A;  1ON4 A;  2X99 A;  5A4U A;  1O8X A;  2MMN A;  4ZB6 A;  1U6T A;  1HYU A;  3GL5 A;  4POL A;  5J9B A;  3IK9 A;  3RPP A;  2PBJ A;  1QFN A;  3IK7 A;  4FIW A;  1SJZ A;  3VLN A;  4TXO A;  5B7C A;  2HT9 A;  2DIY A;  3GYK A;  1Q4J A;  2E2M A;  4ML1 A;  1PL2 A;  1PX6 A;  4ID0 A;  4I2U A;  1PD2 1;  1O85 A;  1AQX A;  1QGV A;  3KD0 A;  1IYI A;  5CYY A;  1UA5 A;  2M80 A;  2M72 A;  1Q98 A;  3FZ5 A;  1K0C A;  2LJR A;  2H0H A;  1SKR B;  2DJJ A;  2P5Q A;  2HRA A;  2X8H A;  1ZYE A;  4CHS A;  3UAP A;  4O5R A;  4K2D A;  2LKU A;  2E2G A;  1DE2 A;  4K8M A;  3FW2 A;  4TR1 B;  2F3M A;  1XW5 A;  1EP7 A;  2VL9 A;  3HJO A;  4ACS A;  3H79 A;  3SBC A;  2OAD A;  3O6T A;  2OE0 A;  4WET A;  1JFU A;  3KM6 A;  5DJL A;  5CNW A;  5D73 A;  1A2J A;  2GLR A;  5H5R A;  3IR4 A;  2H6Y A;  3HZ4 A;  3HVS A;  3V1W A;  3HD5 A;  3BJ5 A;  3M9J A;  1GSS A;  1K3O A;  3D4T A;  3ZFL A;  1MTC A;  2AHE A;  2B5Y A;  1SKS B;  4DSR A;  2B7J A;  4LL4 B;  4HZ2 A;  3VFI A;  1MDK A;  4POB A;  1TU8 A;  2KOK A;  4ECC A;  1GUK A;  3TUE A;  3ISO A;  4DSQ A;  3E3E A;  2FGX A;  5ECI B;  2QC7 A;  1YZX A;  3ED3 A;  3G7I A;  4NMU A;  1U3A A;  2B1L A;  4GLT A;  2LJK A;  4AJ6 A;  3PH9 A;  5IIZ A;  5AN1 A;  1F6M C;  3GTU A;  3WD6 A;  3DXB A;  4KSO A;  2YZU A;  3U6V A;  2H01 A;  2JZS A;  2FCH A;  3M0F A;  2OE1 A;  2LUS A;  1E2Y A;  4MJB A;  4KND A;  5AIS A;  1A2L A;  2WUL A;  4K7N A;  2DSA A;  5A5K A;  2RII A;  3TRP A;  2YAN A;  2HYX A;  4QL9 A;  3W8S A;  3QCP A;  2QGV A;  4MAB A;  3R3E A;  5E59 A;  3FZ9 A;  1G6W A;  1T8E B;  3TKS E;  5DBQ A;  4F82 A;  5G2Z A;  2LS5 A;  1M2B A;  3ZIJ A;  1AXD A;  4HEA 2;  3GKN A;  1H75 A;  4ZL8 A;  1XCC A;  3UAR A;  1WJK A;  3I43 A;  2DJ3 A;  3LFL A;  4GRF A;  1S3D A;  1SD8 A;  1EGR A;  5JWR B;  2YN1 A;  5AGY A;  14GS A;  2L57 A;  2OJL A;  1ZCP A;  5ECM B;  5IMC A;  2B6M A;  3UVT A;  6GST A;  4KCA A;  1GNW A;  3F6F A;  1G7O A;  1M2D A;  2AB6 A;  4K0G A;  1XW6 A;  4XTS A;  2VLT A;  5ID2 B;  2VL3 A;  4JED A;  4K6X A;  3DIE A;  20GS A;  1TU7 A;  2LQO A;  1EEJ A;  4L0U A;  1FOV A;  3L0H A;  1JZO A;  2KP2 A;  3LQ7 A;  1WPI A;  3ZMK A;  1SYX A;  3CYN A;  1AQV A;  2XC2 A;  4IS0 A;  4HJM A;  5HR1 A;  4N10 A;  1YF0 A;  2DIZ A;  1N2A A;  1ABA A;  5IMZ A;  3CSH A;  4G9H A;  3EIN A;  4IJ3 A;  3GRX A;  4F9Z A;  1A8L A;  4OFT A;  3AY8 A;  2VCW A;  4F0C A;  4XS4 B;  3HHV A;  2IME A;  2HLS A;  2VAF A;  4ISD A;  1I5G A;  2WRT A;  4TR0 A;  2D2Z A;  3ZVJ A;  1XOA A;  3L9S A;  2YCD A;  3LXZ A;  1SK1 A;  3LG6 A;  3APQ A;  3A2W A;  1W89 A;  4F2I A;  2CQ9 A;  3W8J A;  3GNJ A;  3IBH A;  1EOH A;  1B48 A;  2HQT A;  5EPF A;  5IMD A;  5KN3 A;  1GP1 A;  4BVY A;  4LMW A;  1GLP A;  5DAL A;  5JWO B;  3F3R A;  2B5E A;  3C71 A;  2HRK A;  4GSN A;  5IMV A;  2JAC A;  3D0Z A;  2VLV A;  2FWE A;  3UBK A;  5G30 A;  4ZIL A;  1PRX A;  5D96 A;  1BYE A;  3KTL A;  2YJH A;  3LWA A;  2CVD A;  4XRA A;  3ZIT A;  2GVP A;  4OO5 A;  4BWQ A;  1JLW A;  2KLX A;  4H86 A;  2GZP A;  4KF9 A;  5FHI A;  1T00 A;  2DJ2 A;  1I9D A;  5ECP B;  2DJ0 A;  1BX9 A;  4POM A;  2WB9 A;  2GDR A;  4EUY A;  1XOB A;  3UVH A;  4KAE A;  2N5A A;  2R6K A;  2WFC A;  5LCZ A;  2EIQ A;  2TIR A;  1O7U A;  1O6J A;  3TCO A;  13GS A;  2C1Y A;  3P90 A;  3UJ1 A;  2F8A A;  5J5N A;  2OAC A;  5FT3 A;  2F8F A;  2HRF A;  3HXS A;  2CVK A;  1SYR A;  1YKC A;  4IVF A;  1G7E A;  2DLX A;  4MJA A;  5D8I A;  3UBL A;  2O89 A;  1JZW A;  4WF5 A;  1TW9 A;  1O81 A;  1GTU A;  2LRT A;  2R5G A;  5IPH A;  4IHU A;  3GUS A;  1GUL A;  1HNB A;  4RUV A;  2PVQ A;  1ERW A;  5DAK A;  3CTG A;  2UZ8 A;  4ZBA A;  4K1F A;  1R26 A;  1PL1 A;  3D4M A; 
#chains in the Genus database with same CATH topology
 3BD2 A;  4E68 A;  2LNS A;  1FVJ A;  5EY6 A;  4F03 A;  3EC3 A;  2DC5 A;  4QL7 A;  3CXG A;  2K9F A;  2CX4 A;  4X1U A;  4WBR D;  2LEG A;  5ECQ B;  2VCX A;  1V58 A;  4HQS A;  3F63 A;  2HXK A;  4I5Q A;  3Q19 A;  4L0W A;  7GSS A;  2V6O A;  3QFA C;  3M3M A;  3WGD A;  3FZA A;  5ENU A;  5B8B A;  1HQO A;  4OWY A;  1NM3 A;  1TOF A;  3WT2 A;  2E0Q A;  5D93 A;  4GTU A;  5BMU A;  2C0F A;  3Q18 A;  2GSS A;  4IP1 A;  1Z6M A;  2N5F A;  1GLQ A;  4J57 E;  4Z2U A;  4HI7 A;  5J3R A;  3ERG A;  1URM A;  2OA7 A;  3ZLP A;  4D73 A;  5J4U A;  4PUA A;  3HYP A;  5JCU A;  1CQH A;  5EVO A;  1R4W A;  1X5E A;  4E8H A;  2XBQ A;  3LGC A;  2R4V A;  4K5S A;  1IYH A;  2PMT A;  3WGE A;  4FQU A;  3E0U A;  3TOU A;  3J7Y k;  5J9C A;  1GTI A;  5ECH B;  3C8E A;  2H75 A;  2RLI A;  1SD9 A;  17GS A;  3N5O A;  1G0T A;  5DCG A;  1OVN A;  2NPB A;  4MJC A;  16GS A;  2H1A A;  4ZB8 A;  1GUH A;  3TRX A;  2H70 A;  3APO A;  5D9V A;  2GQL A;  5IO0 A;  1XPV A;  2DKI A;  4EIP A;  1ERV A;  1EV4 A;  2VOC A;  2H6Z A;  5DQY A;  3L9U A;  4HU7 A;  1TKD B;  1EGO A;  4XRD A;  1QMV A;  4YAV A;  4N11 A;  2J9H A;  2VD0 A;  3FYG A;  3VI5 A;  3IA1 A;  2HSN A;  2JSZ A;  4KE3 A;  6GSU A;  2V1M A;  3HJM A;  2YPM A;  4O5U A;  1TTZ A;  5G1L A;  2H0G A;  2VL2 C;  3BBY A;  2YWO A;  5CRE A;  1BQ7 A;  1Z7P A;  2L4Q A;  3HZ8 A;  1MDI A;  6GSW A;  1ZYQ B;  1ZMA A;  2OKA A;  3VWV A;  4PUF C;  2ZCT A;  3GKK A;  3VWW A;  1N8J A;  3GMF A;  3H4K A;  3CRU A;  4L5O A;  5HFI A;  1R5P A;  1PGT A;  2QSI A;  2IPA A;  2L6C A;  4KUN A;  5DVB A;  5EL8 A;  1Y6E A;  2IJY A;  1UN2 A;  1GSE A;  5IM9 A;  1A0F A;  2LNT A;  3L78 A;  1CQG A;  1SU9 A;  4HSC X;  4Q5F A;  2YOI A;  2BMX A;  3VI7 A;  2ES7 A;  2HRN A;  4MCU A;  4IKH A;  1XWA A;  3G9B A;  3PIN A;  3KGK A;  2CV4 A;  1Z9H A;  3VPT A;  5DJM A;  1K0D A;  2I3Y A;  2ZUP A;  2H1B A;  1BF5 A;  3UMA A;  2CAI A;  2K18 A;  3GFK A;  5ECK B;  1SJI A;  2YJ7 A;  1Z5Y E;  4G0I A;  2O8V B;  2A2R A;  3MIX A;  2PUK C;  3OR5 A;  5G5F A;  1KNG A;  2KHP A;  1WRY A;  3ZML A;  1SL2 B;  2B1K A;  4PQ1 A;  3GHA A;  2A2S A;  4ECB A;  2EFD A;  1I1I P;  1BED A;  3C73 A;  2A4H A;  1Z3E A;  12GS A;  1T1V A;  2J23 A;  4TR1 A;  1M3J A;  2GT6 A;  3I69 A;  3EUR A;  4JR4 A;  1EEM A;  4HJ2 A;  2O87 A;  3F4R A;  2C4J A;  2LRC A;  1GSQ A;  4IBP A;  1V40 A;  1V98 A;  5A34 A;  5J4V A;  3VPQ A;  1B9X C;  5H5Q A;  1VRS D;  2DML A;  3GUR A;  2VLU A;  4GWR A;  4HZ4 A;  2P0G A;  3HA9 A;  4NV2 A;  4OMV A;  4AGS A;  1OAZ A;  2L5L A;  3A2V A;  4WF4 A;  4WBJ A;  3KH9 A;  2HZE B;  4ECJ A;  3ZL5 A;  1FW1 A;  4HOJ A;  5A1N B;  3QD9 A;  2YWN A;  5B6N A;  2FA4 A;  4N0V A;  1EV9 A;  2PPT A;  2WW1 A;  2I1U A;  3CSJ A;  2X4A A;  2YV7 A;  2IL3 A;  4I6X A;  4OCF A;  1YF1 A;  4ML6 A;  3TKR A;  4MA9 A;  2FY6 A;  4BL7 B;  4EO3 A;  2I4A A;  1ZYN A;  3NIV A;  2G2Q A;  3QR6 A;  2CAQ A;  1PX7 A;  1SKW B;  4IQA A;  2CT6 A;  4ZL7 A;  4LMV A;  3EE2 A;  2F51 A;  1V9W A;  5CP1 A;  2H74 A;  1M7T A;  1A0R P;  2PWJ A;  2DJK A;  4P3Y B;  1HNA A;  2VL2 A;  4V2M A;  1KBN A;  3EU3 A;  4PUR A;  1TI3 A;  3GH9 A;  1EOG A;  4IQ1 A;  2PVO C;  2O3E A;  4MNN A;  5BRT A;  4L8E A;  3NOF A;  2JZT A;  2IIY A;  1JHB A;  1Z7R A;  4AF2 A;  3IAS 2;  3RFR C;  1TDI A;  1O8W A;  5GST A;  1NSW A;  2H73 A;  4ZXG A;  3HJP A;  3TOT A;  1A2M A;  2FHE A;  5HQP A;  1G6Y A;  4I2T A;  1NHO A;  3ERF A;  1FAA A;  2BTO T;  1X9S B;  2RUE A;  3H93 A;  3LW9 A;  3TKQ A;  2H71 A;  1T7P B;  2CX3 A;  1F3A A;  2MBT A;  2V2G A;  3F0I A;  1ZL9 A;  3RGB C;  3HVN A;  4EXJ A;  2F9S A;  2H1G A;  5ID2 A;  2LST A;  4BWS A;  4MF6 A;  3KP9 A;  2IMI A;  2OBI A;  1SJ6 A;  1VF4 A;  1QUW A;  4JR6 A;  2FD3 A;  3KMN A;  5ECS A;  1E6B A;  4YQM A;  3MSZ A;  3UIW A;  3DKS A;  3FHK A;  2HSM B;  1VF3 A;  1KEB A;  1XG8 A;  3QFB C;  2WJU A;  3MAK A;  4G2E A;  5E4W A;  3A5I A;  3TJB A;  1SVL A;  2R0P A;  3C1R A;  2KP1 A;  4AJ7 A;  3EMX A;  4ULX A;  1GSY A;  3LXT A;  4WXT A;  1TRU A;  4EKZ A;  4XS4 A;  1RQM A;  1OC9 B;  2H6X A;  2TRX A;  2AAW A;  4IW9 A;  3F4S A;  4MZC A;  3TJF A;  1XIY A;  1MDJ A;  6GSX A;  4V1A g;  1PKW A;  1X5C A;  4DSS B;  2RM6 A;  3QAV A;  3TRQ A;  1U3I A;  2L59 A;  2VCZ A;  4V1A p;  3F8U A;  3FZ4 A;  1C72 A;  2WCI A;  3G7Y A;  1SL0 B;  1GSD A;  4G0K A;  4PXO A;  3HKR A;  5A5H A;  1WP0 A;  1B8X A;  2MMZ A;  3WYW A;  1ZGN A;  2REM A;  3TKP A;  1UVZ A;  5F0G A;  2WW3 A;  2VIM A;  2DJ1 A;  1S3C A;  3GKM A;  3P8W A;  4POK A;  4PX1 A;  3M9K A;  2K6V A;  2WZ9 A;  4W66 A;  1DBY A;  4IEL A;  2GSR A;  5HR2 A;  4MF7 A;  1K3L A;  2GT5 A;  2B7K A;  4YQU A;  3BCK A;  3APS A;  3NZN A;  5G31 A;  3C7M A;  4MH3 A;  1VF2 A;  2IFQ B;  2FLS A;  2H8L A;  5IMF A;  3HVX A;  4PQI A;  3ZTL A;  2H72 A;  2GZZ A;  5D9X A;  4E8E A;  1Y25 A;  1GTA A;  1XXU A;  1DSB A;  4FH8 A;  4MJE A;  2O85 A;  5KN1 A;  1U88 A;  2AYT A;  1GL8 A;  2B5X A;  5AIV A;  4XIH A;  1WWJ A;  1OE7 A;  4G01 A;  4ZBD A;  2WDU A;  3LJR A;  4XS1 A;  4F0B A;  4HQZ A;  4KW6 A;  4PI2 C;  2JU5 A;  5JWQ B;  5FWG A;  1TK8 B;  1ML6 A;  5CO3 A;  3IHQ A;  5IMA A;  3FKF A;  4G10 A;  2YNX A;  3GSS A;  2H66 A;  4O92 A;  2LTK A;  3ZYW A;  3IE3 A;  1S3A A;  2WVX A;  2V32 A;  5A4W A;  3UEM A;  1S4B P;  2IWT A;  1JZD A;  1YQ1 A;  5GSS A;  1QXH A;  3KCM A;  4AKH A;  4AJ8 A;  2IMK A;  1O73 A;  3GL3 A;  3MNG A;  5D9T A;  3QMX A;  2JSY A;  3D6I A;  4PQH A;  1THO A;  4ILF A;  4MZW A;  3ZZX A;  1XBS A;  3PGT A;  3GN3 A;  3KTB A;  5B8A A;  1ERU A;  1AW9 A;  1W4V A;  2IN3 A;  2GSQ A;  1JLV A;  3FR9 A;  4WR4 A;  4I8B A;  4X0X A;  5ECR B;  2JL4 A;  2WVY A;  3IC8 A;  2EFC A;  4ZB9 A;  2R0C A;  3L9V A;  2C0G A;  1GTB A;  3N9J A;  4LA1 A;  4FYU A;  4MK3 A;  3RDW A;  5HR0 A;  5LNK e;  1XWC A;  3BCI A;  2MMO A;  3C1S A;  2H76 A;  4J56 E;  2OBK A;  4MF5 A;  1ERT A;  5COH A;  1TXX A;  2DMM A;  3P7X A;  5IOW A;  1B4Q A;  1SL1 B;  2MZC A;  2R2J A;  4GCI A;  3M1G A;  3P2A A;  5DDL A;  3GX8 A;  3A3T A;  2GGT A;  3RHB A;  2VUP A;  3CTF A;  3HMJ G;  1BG5 A;  5F07 A;  4N0Z A;  4YH2 A;  4IJI A;  4N3Z A;  3KIJ A;  4IGJ A;  3MDK A;  4CY8 A;  3UOM A;  3E9J B;  3F3Q A;  2YWI A;  4TOP A;  4RI7 A;  2ON5 A;  2IMF A;  4BVX B;  4Q5N A;  22GS A;  5AIX A;  3HCZ A;  1GSF A;  4AKG A;  2KUC A;  1LU4 A;  4JBB A;  5F8B A;  2YP6 A;  2PER A;  1S3R A;  4USS A;  6GSS A;  2MYG A;  2WVZ A;  4EDZ A;  2EIO A;  2K8V A;  1FVK A;  3IXR A;  4NAX A;  3TB2 A;  2GQK A;  1F9M A;  3D21 A;  3EPT A;  1EWX A;  3Q74 A;  1J9B A;  4HUA A;  4YKG A;  1YJ6 A;  8GSS A;  2N5B A;  3KJY A;  3DYR A;  1K0N A;  1A23 A;  4TXO B;  5G1K A;  5ECL B;  4GXZ A;  5GAN D;  5ECO B;  1FB0 A;  5CRH A;  2P5R A;  2YZH A;  3J7Y b;  1QK8 A;  3VWU A;  3DWV A;  3H8Q A;  1PMT A;  4YAP A;  4MMM A;  3D22 A;  2YV9 A;  2XPD A;  4KDX A;  2GQM A;  4TKY A;  4JZQ A;  2WGR A;  2A2P A;  2FWG A;  3TKS C;  1B9Y C;  5GZZ B;  2C0D A;  1WOU A;  2R0G A;  4DEJ A;  4G0L A;  3KEB A;  3FR3 A;  2O36 A;  1AIU A;  1VGL A;  3TJJ A;  4FO5 A;  4XS6 A;  2C8U A;  5LD0 A;  2FWH A;  3IAM 2;  3LEF A;  1XWG A;  2WS2 A;  1XVW A;  1PQN A;  3CRT A;  1A24 A;  1V57 A;  3GA4 A;  3CWG A;  3SWL A;  3GX0 A;  2HNL A;  3CMI A;  2VCT A;  1ZYP A;  1XZO A;  3S9F A;  1X9W B;  4K5R A;  3IC4 A;  5ELG A;  4EL1 A;  1FO5 A;  5KN2 A;  2GZY A;  3FY7 A;  4DVC A;  4ZL9 A;  2VKZ G;  1YEP A;  3PR8 A;  5J47 A;  9GSS A;  1NHY A;  1PN0 A;  4XHM A;  2K8S A;  1B4P A;  1TP9 A;  2TRC P;  5HFK A;  2H1D A;  1T4Y A;  1RK4 A;  4FXY P;  2L6D A;  2NTO A;  4QQ7 A;  3TJG A;  5IQY A;  4MP4 A;  2NDO A;  2Z9S A;  2PN8 A;  3HVV A;  5DCH A;  1V2A A;  2CZ2 A;  2XBI A;  4WEY A;  4EF0 A;  4Z2T A;  1FOH A;  1OC3 A;  1GWC A;  3ZFB A;  3EYT A;  3FRC A;  5CRW A;  2HZE A;  3GTU B;  3ME7 A;  4HU9 A;  3DRN A;  5A1N A;  3GKX A;  3KP8 A;  5ABR A;  2BJX A;  2PU9 C;  1NW2 A;  2HFD A;  4ECI A;  3UL3 A;  1XW9 A;  2JZR A;  3F6D A;  2H30 A;  4JRR A;  1K0B A;  3CSI A;  3HDC A;  3CQF A;  1XVQ A;  3L4N A;  4BL7 A;  1TK0 B;  3LOR A;  3F4T A;  4GSS A;  3CHX C;  1GNE A;  1K0O A;  2C3T A;  2E7P A;  2FA8 A;  1XWB A;  3RPN A;  4OCE A;  1BJX A;  4KGI A;  3DML A;  2V6K A;  4XCS A;  3MYD A;  1TXU A;  3LYK A;  4JE1 A;  4IN0 A;  2HSH A;  1ZOF A;  2QA2 A;  1PA3 A;  3CBU A;  5CRD A;  1AUC A;  1H4O A;  4JU5 A;  4TRX A;  1TI1 A;  4MDC A;  3ZVJ D;  3O3T A;  4CDO A;  4KCE A;  4RQX A;  4N30 A;  5F05 A;  2OE3 A;  1M0U A;  3JCM L;  4MPG A;  1OC8 A;  3U5R E;  3M8N A;  5J41 A;  1YDK A;  1R7H A;  4O7H A;  4WR5 A;  1Z6N A;  4X4J A;  1GSU A;  1TJD A;  2DKH A;  2MMA A;  3EWL A;  2A4V A;  2RM5 A;  3TKS A;  5KEJ A;  5F06 A;  1FG4 A;  5JCG A;  2LRN A;  1THX A;  3FK8 A;  1LJR A;  1F3B A;  2L4C A;  2HZF A;  2VCQ A;  2I9H A;  3ERW A;  2RUF A;  2O7K A;  1TRV A;  5CRG A;  4KSM A;  1JZR A;  1HD2 A;  3TJK A;  1TK5 B;  3WT1 A;  4ZIJ A;  4EC0 A;  3F9U A;  1DUG A;  2C3N A;  4EE0 A;  1MD4 A;  3TGZ A;  1U87 A;  2LJA A;  2GST A;  2DBC A;  3QAG A;  4PNG A;  1WMJ A;  1FB6 A;  1RW1 A;  19GS A;  2WZS A;  4BVY B;  2EFH A;  1M2A A;  5DAL B;  4KX4 A;  1OKT A;  5IPG A;  2GS3 A;  4J2F A;  4NWY A;  3RHC A;  2HSM A;  2V41 A;  2HRK B;  1VF1 A;  3WGX A;  2FUG 2;  2C0E A;  2X8C A;  4HDE A;  3GV1 A;  3IDV A;  2HI7 A;  4OD7 A;  5INY A;  1K0M A;  2WW0 A;  3I9V 2;  5ELA A;  5HFG A;  1YEX A;  1OC9 A;  2FWF A;  2R3X A;  3FEU A;  2C3Q A;  2H19 A;  2NBS A;  3DEX A;  3ZRE A;  4DSS A;  1OYJ A;  5IO2 A;  3EU4 A;  2IMD A;  4PTS A;  3HY2 A;  3IOS A;  4AKX B;  3LYP A;  1WE0 A;  1GH2 A;  1SK0 A;  4NPB A;  3A5W A;  2M46 A;  2EIR A;  4PNF A;  1ACV A;  1AC1 A;  1DE1 A;  4Q5R A;  1SEN A;  3LSZ A;  3VWX A;  4V2N A;  4PGT A;  1PN9 A;  4MLY A;  3GH6 A;  1M9B A;  2B3S A;  2LV3 A;  4GF0 A;  1GRX A;  4I97 A;  1EZK A;  1OE8 A;  4FYC A;  3DVX A;  4KH7 A;  4TR4 A;  4MPF A;  1SK2 A;  2GTU A;  3H1N A;  4YQV A;  5GAP D;  2CA8 A;  2ALB A;  1LBK A;  4MH2 A;  3DD3 A;  2EC4 A;  1K0A A;  4NXI A;  3GIX A;  4K0N A;  2HSY A;  4BPY A;  5L71 A;  3QDN A;  1TRS A;  5A4V A;  1PSQ A;  2IFQ A;  2EFE A;  1MEK A;  1UC7 A;  1PKZ A;  4OFN A;  1YY7 A;  3G7J A;  5DAK B;  6GSV A;  1J08 A;  2AUV A;  4RI6 A;  4LL1 B;  3QPM A;  4RQR A;  2ZNM A;  1X9M B;  4G19 A;  5KOX A;  10GS A;  1R5A A;  2LQQ A;  1FHE A;  2NVL A;  4NHW A;  4IP6 A;  3KMO A;  3R2Q A;  2L5O A;  3DGQ A;  2X8G A;  4MZB A;  1XFL A;  5C04 A;  1USB A;  1A8Y A;  4K2X A;  11GS A;  1GUM A;  5C00 A;  4X43 A;  4WKW A;  3A2X A;  4CW9 A;  4TXV A;  1K3Y A;  1AQW A;  4NHZ A;  4Q5Q A;  1M99 A;  4TW5 A;  5BMU B;  1BAY A;  1ST9 A;  4PHZ C;  3KZQ A;  4CY6 A;  2P31 A;  1KTE A;  3GST A;  2CZ3 A;  4TVE A;  3ZRD A;  3O76 A;  1T4Z A;  1XWK A;  2VO4 A;  4ICY A;  6GSY A;  2VD1 A;  4V2L A;  2H1L A;  5IOX A;  4D73 B;  3RBT A;  4Z7X A;  1AAZ A;  3RAZ A;  2XPE A;  4KA0 A;  2MBS A;  1ZZY A;  1F37 A;  5D9W A;  3W6G A;  4ZBB A;  4EDY A;  4KB3 A;  4L5L A;  3EVI A;  3FR6 A;  3Q6O A;  1OKD A;  2AV4 A;  1YKA A;  4FYB A;  5DQS A;  4TR3 A;  2VM1 A;  3KXO A;  2G0F A;  3QAW A;  1ILO A;  3I6A A;  4HS1 A;  2XHF A;  1MD3 A;  4OFM A;  1HNC A;  1TRW A;  3MWH A;  1J0F A;  3IV4 A;  2VCV A;  1X5D A;  2CVB A;  2HE3 A;  5ECN B;  4LLR A;  4KDY A;  4EVM A;  2R37 A;  3VK9 A;  1YVL A;  2YWM A;  1SVM A;  2H0I A;  4O32 A;  1M9A A;  3D5J A;  4NV5 A;  3PPU A;  4BA7 A;  2UV8 G;  3BOA A;  1T3B A;  3DVW A;  5B6M A;  5JCW A;  5CAX A;  5HR3 A;  4GQC A;  2ON7 A;  2HSN B;  2VM2 A;  4GST A;  1WIK A;  4K7O A;  18GS A;  4AKI A;  5KN0 A;  4K9Z A;  3ZIV A;  2I81 A;  2C80 A;  4KDU A;  2JAD A;  5G5E A;  1F2E A;  3K8N A;  1M3I A;  3VUR A;  2QKE A;  3TDG A;  1EP8 A;  4BVX A;  4TN8 A;  3IPZ A;  5H5S A;  3KH7 A;  4OO4 A;  3US3 A;  2PGT A;  4K7I A;  2X64 A;  1PFO A;  3IRA A;  3ME8 A;  2AJQ B;  2FNO A;  4GQF A;  4QMK A;  3QOU A;  1X0R A;  1QQ2 A;  3EMP A;  1ON4 A;  2X99 A;  5A4U A;  1O8X A;  2MMN A;  4ZB6 A;  1U6T A;  1HYU A;  3GL5 A;  4POL A;  5J9B A;  3IK9 A;  3RPP A;  2PBJ A;  1QFN A;  3IK7 A;  4FIW A;  1SJZ A;  3VLN A;  4TXO A;  5B7C A;  2HT9 A;  2DIY A;  3GYK A;  1Q4J A;  2E2M A;  4ML1 A;  1PL2 A;  2OT3 A;  1PX6 A;  4ID0 A;  4I2U A;  1PD2 1;  5J40 A;  1O85 A;  1AQX A;  1QGV A;  3FMW A;  3KD0 A;  1IYI A;  5CYY A;  1UA5 A;  2O5V A;  2M80 A;  1Y1U A;  2M72 A;  1Q98 A;  3FZ5 A;  1K0C A;  2LJR A;  2H0H A;  1SKR B;  2DJJ A;  2P5Q A;  2HRA A;  2X8H A;  1ZYE A;  4CHS A;  4O5Q A;  3UAP A;  4O5R A;  4K2D A;  2LKU A;  2E2G A;  1DE2 A;  4K8M A;  3FW2 A;  2QA1 A;  4TR1 B;  2F3M A;  1XW5 A;  1EP7 A;  2VL9 A;  3HJO A;  4ACS A;  3H79 A;  3SBC A;  2OAD A;  3O6T A;  5A34 B;  2OE0 A;  4WET A;  1JFU A;  3KM6 A;  5DJL A;  5CNW A;  5D73 A;  1A2J A;  2GLR A;  5H5R A;  3IR4 A;  4GDF A;  2H6Y A;  3HZ4 A;  3HVS A;  3V1W A;  3HD5 A;  3BJ5 A;  3M9J A;  1GSS A;  1K3O A;  3D4T A;  3ZFL A;  1MTC A;  2AHE A;  2B5Y A;  1SKS B;  4DSR A;  2B7J A;  4LL4 B;  4HZ2 A;  3VFI A;  4YKF A;  1MDK A;  4POB A;  1TU8 A;  2KOK A;  4ECC A;  1GUK A;  3TUE A;  3ISO A;  4DSQ A;  3E3E A;  2FGX A;  5ECI B;  2QC7 A;  2WW2 A;  1YZX A;  3ED3 A;  3G7I A;  4NMU A;  1U3A A;  2B1L A;  4GLT A;  2LJK A;  4AJ6 A;  3PH9 A;  5IIZ A;  4EIQ A;  5AN1 A;  1F6M C;  3GTU A;  3WD6 A;  3DXB A;  4KSO A;  2YZU A;  3U6V A;  2H01 A;  2JZS A;  2FCH A;  3M0F A;  2OE1 A;  2LUS A;  1E2Y A;  4ZB7 A;  4MJB A;  4KND A;  5AIS A;  1A2L A;  2WUL A;  4K7N A;  2DSA A;  5A5K A;  2RII A;  3TRP A;  2YAN A;  2HYX A;  4QL9 A;  3W8S A;  3QCP A;  2QGV A;  4MAB A;  3IHG A;  3R3E A;  5E59 A;  3FZ9 A;  1G6W A;  1T8E B;  3TKS E;  5DBQ A;  4F82 A;  5G2Z A;  2LS5 A;  1M2B A;  3ZIJ A;  5KOW A;  1AXD A;  4HEA 2;  3GKN A;  1H75 A;  4ZL8 A;  1XCC A;  1N25 A;  3UAR A;  1WJK A;  3I43 A;  4A5P A;  2DJ3 A;  3LFL A;  4GRF A;  4BIK A;  1S3D A;  1SD8 A;  1EGR A;  5JWR B;  2YN1 A;  5AGY A;  2X49 A;  14GS A;  2L57 A;  2OJL A;  1SVO A;  1ZCP A;  5ECM B;  5IMC A;  2B6M A;  3UVT A;  6GST A;  4KCA A;  1GNW A;  3F6F A;  1G7O A;  1M2D A;  2AB6 A;  4K0G A;  1XW6 A;  4XTS A;  2VLT A;  5ID2 B;  1BG1 A;  2VL3 A;  4JED A;  4K6X A;  3DIE A;  20GS A;  1YEW C;  1TU7 A;  2LQO A;  1EEJ A;  4L0U A;  1FOV A;  3L0H A;  1JZO A;  2KP2 A;  4AI6 A;  3LQ7 A;  1WPI A;  3ZMK A;  1SYX A;  3CYN A;  1AQV A;  2XC2 A;  4IS0 A;  4HJM A;  5HR1 A;  4N10 A;  5J4Y A;  1YF0 A;  2DIZ A;  1N2A A;  1ABA A;  5IMZ A;  3CSH A;  4G9H A;  3EIN A;  4IJ3 A;  3GRX A;  4F9Z A;  1A8L A;  4OFT A;  3AY8 A;  2VCW A;  4F0C A;  4XS4 B;  3HHV A;  2IME A;  2HLS A;  2VAF A;  4ISD A;  1I5G A;  2WRT A;  4TR0 A;  2D2Z A;  3ZVJ A;  1XOA A;  3L9S A;  2YCD A;  3LXZ A;  1SK1 A;  3LG6 A;  3APQ A;  3A2W A;  1W89 A;  4F2I A;  2CQ9 A;  3W8J A;  3GNJ A;  3IBH A;  4PI0 C;  1EOH A;  1B48 A;  2HQT A;  5EPF A;  5IMD A;  5KN3 A;  1GP1 A;  4BVY A;  4LMW A;  1GLP A;  5DAL A;  5JWO B;  3F3R A;  5A5H B;  2B5E A;  3C71 A;  2HRK A;  4GSN A;  5IMV A;  2JAC A;  3D0Z A;  2VLV A;  2FWE A;  3UBK A;  5G30 A;  4ZIL A;  1PRX A;  5D96 A;  1BYE A;  3KTL A;  2YJH A;  3LWA A;  2CVD A;  4XRA A;  3ZIT A;  2GVP A;  4OO5 A;  4BWQ A;  1JLW A;  2KLX A;  4H86 A;  2GZP A;  4KF9 A;  5FHI A;  1T00 A;  2DJ2 A;  1I9D A;  5ECP B;  2DJ0 A;  1BX9 A;  4POM A;  2WB9 A;  2GDR A;  4EUY A;  1XOB A;  3UVH A;  4KAE A;  2N5A A;  2R6K A;  2WFC A;  5LCZ A;  2EIQ A;  2TIR A;  1O7U A;  1O6J A;  3TCO A;  4Z2R A;  13GS A;  2C1Y A;  3P90 A;  3UJ1 A;  2F8A A;  5J5N A;  2OAC A;  5FT3 A;  2F8F A;  2HRF A;  3HXS A;  2CVK A;  1SYR A;  1YKC A;  4IVF A;  1G7E A;  2DLX A;  4MJA A;  5D8I A;  3UBL A;  2O89 A;  1JZW A;  4WF5 A;  1TW9 A;  2WVX B;  1O81 A;  1GTU A;  2LRT A;  3TU3 B;  2R5G A;  5IPH A;  4IHU A;  3GUS A;  1GUL A;  1HNB A;  4RUV A;  2PVQ A;  1ERW A;  5DAK A;  3CTG A;  2UZ8 A;  4ZBA A;  4K1F A;  1R26 A;  1PL1 A;  3D4M A; 
#chains in the Genus database with same CATH homology
 3BD2 A;  4E68 A;  2LNS A;  1FVJ A;  5EY6 A;  4F03 A;  3EC3 A;  2DC5 A;  4QL7 A;  3CXG A;  2K9F A;  2CX4 A;  4X1U A;  4WBR D;  2LEG A;  5ECQ B;  2VCX A;  1V58 A;  4HQS A;  3F63 A;  2HXK A;  4I5Q A;  3Q19 A;  4L0W A;  7GSS A;  2V6O A;  3QFA C;  3M3M A;  3WGD A;  3FZA A;  5ENU A;  5B8B A;  1HQO A;  4OWY A;  1NM3 A;  1TOF A;  3WT2 A;  2E0Q A;  5D93 A;  4GTU A;  5BMU A;  2C0F A;  3Q18 A;  2GSS A;  4IP1 A;  1Z6M A;  2N5F A;  1GLQ A;  4J57 E;  4Z2U A;  4HI7 A;  5J3R A;  3ERG A;  1URM A;  2OA7 A;  3ZLP A;  4D73 A;  5J4U A;  4PUA A;  3HYP A;  5JCU A;  1CQH A;  5EVO A;  1R4W A;  1X5E A;  4E8H A;  2XBQ A;  3LGC A;  2R4V A;  4K5S A;  1IYH A;  2PMT A;  3WGE A;  4FQU A;  3E0U A;  3TOU A;  3J7Y k;  5J9C A;  1GTI A;  5ECH B;  3C8E A;  2H75 A;  2RLI A;  1SD9 A;  17GS A;  3N5O A;  1G0T A;  5DCG A;  1OVN A;  2NPB A;  4MJC A;  16GS A;  2H1A A;  4ZB8 A;  1GUH A;  3TRX A;  2H70 A;  3APO A;  5D9V A;  2GQL A;  5IO0 A;  1XPV A;  2DKI A;  4EIP A;  1ERV A;  1EV4 A;  2VOC A;  2H6Z A;  5DQY A;  3L9U A;  4HU7 A;  1TKD B;  1EGO A;  4XRD A;  1QMV A;  4YAV A;  4N11 A;  2J9H A;  2VD0 A;  3FYG A;  3VI5 A;  3IA1 A;  2HSN A;  2JSZ A;  4KE3 A;  6GSU A;  2V1M A;  3HJM A;  2YPM A;  4O5U A;  1TTZ A;  5G1L A;  2H0G A;  2VL2 C;  3BBY A;  2YWO A;  5CRE A;  1BQ7 A;  1Z7P A;  2L4Q A;  3HZ8 A;  1MDI A;  6GSW A;  1ZYQ B;  1ZMA A;  2OKA A;  3VWV A;  4PUF C;  2ZCT A;  3GKK A;  3VWW A;  1N8J A;  3GMF A;  3H4K A;  3CRU A;  4L5O A;  5HFI A;  1R5P A;  1PGT A;  2QSI A;  2IPA A;  2L6C A;  4KUN A;  5DVB A;  5EL8 A;  1Y6E A;  2IJY A;  1UN2 A;  1GSE A;  5IM9 A;  1A0F A;  2LNT A;  3L78 A;  1CQG A;  1SU9 A;  4Q5F A;  2YOI A;  2BMX A;  3VI7 A;  2ES7 A;  2HRN A;  4MCU A;  4IKH A;  1XWA A;  3G9B A;  3PIN A;  3KGK A;  2CV4 A;  1Z9H A;  3VPT A;  5DJM A;  1K0D A;  2I3Y A;  2ZUP A;  2H1B A;  1BF5 A;  3UMA A;  2CAI A;  2K18 A;  3GFK A;  5ECK B;  1SJI A;  2YJ7 A;  1Z5Y E;  4G0I A;  2O8V B;  2A2R A;  3MIX A;  2PUK C;  3OR5 A;  5G5F A;  1KNG A;  2KHP A;  1WRY A;  3ZML A;  1SL2 B;  2B1K A;  4PQ1 A;  3GHA A;  2A2S A;  4ECB A;  2EFD A;  1BED A;  3C73 A;  2A4H A;  1Z3E A;  12GS A;  1T1V A;  2J23 A;  4TR1 A;  2GT6 A;  3I69 A;  3EUR A;  4JR4 A;  1EEM A;  4HJ2 A;  2O87 A;  3F4R A;  2C4J A;  2LRC A;  1GSQ A;  4IBP A;  1V40 A;  1V98 A;  5A34 A;  5J4V A;  3VPQ A;  1B9X C;  5H5Q A;  1VRS D;  2DML A;  3GUR A;  2VLU A;  4GWR A;  4HZ4 A;  2P0G A;  3HA9 A;  4NV2 A;  4OMV A;  4AGS A;  1OAZ A;  2L5L A;  3A2V A;  4WF4 A;  4WBJ A;  3KH9 A;  2HZE B;  4ECJ A;  3ZL5 A;  1FW1 A;  4HOJ A;  5A1N B;  3QD9 A;  2YWN A;  5B6N A;  2FA4 A;  4N0V A;  1EV9 A;  2PPT A;  2I1U A;  3CSJ A;  2X4A A;  2YV7 A;  2IL3 A;  4I6X A;  4OCF A;  1YF1 A;  4ML6 A;  3TKR A;  4MA9 A;  2FY6 A;  4BL7 B;  4EO3 A;  2I4A A;  1ZYN A;  3NIV A;  2G2Q A;  3QR6 A;  2CAQ A;  1PX7 A;  1SKW B;  4IQA A;  2CT6 A;  4ZL7 A;  4LMV A;  3EE2 A;  2F51 A;  1V9W A;  5CP1 A;  2H74 A;  1M7T A;  1A0R P;  2PWJ A;  2DJK A;  4P3Y B;  1HNA A;  2VL2 A;  4V2M A;  1KBN A;  3EU3 A;  4PUR A;  1TI3 A;  3GH9 A;  1EOG A;  4IQ1 A;  2PVO C;  4MNN A;  5BRT A;  4L8E A;  3NOF A;  2JZT A;  2IIY A;  1JHB A;  1Z7R A;  4AF2 A;  3IAS 2;  1TDI A;  1O8W A;  5GST A;  1NSW A;  2H73 A;  4ZXG A;  3HJP A;  3TOT A;  1A2M A;  2FHE A;  5HQP A;  1G6Y A;  4I2T A;  1NHO A;  3ERF A;  1FAA A;  2BTO T;  1X9S B;  2RUE A;  3H93 A;  3LW9 A;  3TKQ A;  2H71 A;  1T7P B;  2CX3 A;  1F3A A;  2MBT A;  2V2G A;  3F0I A;  1ZL9 A;  4EXJ A;  2F9S A;  2H1G A;  5ID2 A;  2LST A;  4BWS A;  4MF6 A;  3KP9 A;  2IMI A;  2OBI A;  1SJ6 A;  1VF4 A;  1QUW A;  4JR6 A;  2FD3 A;  3KMN A;  5ECS A;  1E6B A;  4YQM A;  3MSZ A;  3UIW A;  3DKS A;  3FHK A;  2HSM B;  1VF3 A;  1KEB A;  3QFB C;  2WJU A;  3MAK A;  4G2E A;  5E4W A;  3A5I A;  3TJB A;  1SVL A;  2R0P A;  3C1R A;  2KP1 A;  4AJ7 A;  3EMX A;  4ULX A;  1GSY A;  3LXT A;  4WXT A;  1TRU A;  4EKZ A;  4XS4 A;  1RQM A;  1OC9 B;  2H6X A;  2TRX A;  2AAW A;  4IW9 A;  3F4S A;  4MZC A;  3TJF A;  1XIY A;  1MDJ A;  6GSX A;  4V1A g;  1PKW A;  1X5C A;  4DSS B;  2RM6 A;  3QAV A;  3TRQ A;  1U3I A;  2L59 A;  2VCZ A;  4V1A p;  3F8U A;  3FZ4 A;  1C72 A;  2WCI A;  3G7Y A;  1SL0 B;  1GSD A;  4G0K A;  4PXO A;  3HKR A;  5A5H A;  1WP0 A;  1B8X A;  2MMZ A;  3WYW A;  1ZGN A;  2REM A;  3TKP A;  1UVZ A;  5F0G A;  2VIM A;  2DJ1 A;  1S3C A;  3GKM A;  3P8W A;  4POK A;  4PX1 A;  3M9K A;  2K6V A;  2WZ9 A;  4W66 A;  1DBY A;  4IEL A;  2GSR A;  5HR2 A;  4MF7 A;  1K3L A;  2GT5 A;  2B7K A;  4YQU A;  3BCK A;  3APS A;  3NZN A;  5G31 A;  3C7M A;  4MH3 A;  1VF2 A;  2IFQ B;  2FLS A;  2H8L A;  5IMF A;  3HVX A;  4PQI A;  3ZTL A;  2H72 A;  2GZZ A;  5D9X A;  4E8E A;  1Y25 A;  1GTA A;  1XXU A;  1DSB A;  4FH8 A;  4MJE A;  2O85 A;  5KN1 A;  1U88 A;  2AYT A;  1GL8 A;  2B5X A;  5AIV A;  4XIH A;  1WWJ A;  1OE7 A;  4G01 A;  4ZBD A;  2WDU A;  3LJR A;  4XS1 A;  4F0B A;  4HQZ A;  4KW6 A;  2JU5 A;  5JWQ B;  5FWG A;  1TK8 B;  1ML6 A;  5CO3 A;  3IHQ A;  5IMA A;  3FKF A;  4G10 A;  2YNX A;  3GSS A;  2H66 A;  4O92 A;  2LTK A;  3ZYW A;  3IE3 A;  1S3A A;  2V32 A;  5A4W A;  3UEM A;  2IWT A;  1JZD A;  1YQ1 A;  5GSS A;  1QXH A;  3KCM A;  4AKH A;  4AJ8 A;  2IMK A;  1O73 A;  3GL3 A;  3MNG A;  5D9T A;  3QMX A;  2JSY A;  3D6I A;  4PQH A;  1THO A;  4ILF A;  4MZW A;  3ZZX A;  1XBS A;  3PGT A;  3GN3 A;  3KTB A;  5B8A A;  1ERU A;  1AW9 A;  1W4V A;  2IN3 A;  2GSQ A;  1JLV A;  3FR9 A;  4WR4 A;  4I8B A;  4X0X A;  5ECR B;  2JL4 A;  3IC8 A;  2EFC A;  4ZB9 A;  2R0C A;  3L9V A;  2C0G A;  1GTB A;  3N9J A;  4LA1 A;  4FYU A;  4MK3 A;  3RDW A;  5HR0 A;  5LNK e;  1XWC A;  3BCI A;  2MMO A;  3C1S A;  2H76 A;  4J56 E;  2OBK A;  4MF5 A;  1ERT A;  5COH A;  1TXX A;  2DMM A;  3P7X A;  5IOW A;  1B4Q A;  1SL1 B;  2MZC A;  2R2J A;  4GCI A;  3M1G A;  3P2A A;  5DDL A;  3GX8 A;  3A3T A;  2GGT A;  3RHB A;  2VUP A;  3CTF A;  3HMJ G;  1BG5 A;  5F07 A;  4N0Z A;  4YH2 A;  4IJI A;  4N3Z A;  3KIJ A;  4IGJ A;  3MDK A;  4CY8 A;  3UOM A;  3E9J B;  3F3Q A;  2YWI A;  4TOP A;  4RI7 A;  2ON5 A;  2IMF A;  4BVX B;  4Q5N A;  22GS A;  5AIX A;  3HCZ A;  1GSF A;  4AKG A;  2KUC A;  1LU4 A;  4JBB A;  5F8B A;  2YP6 A;  2PER A;  4USS A;  6GSS A;  2MYG A;  4EDZ A;  2EIO A;  2K8V A;  1FVK A;  3IXR A;  4NAX A;  3TB2 A;  2GQK A;  1F9M A;  3D21 A;  3EPT A;  1EWX A;  3Q74 A;  1J9B A;  4HUA A;  4YKG A;  1YJ6 A;  8GSS A;  2N5B A;  3KJY A;  3DYR A;  1K0N A;  1A23 A;  4TXO B;  5G1K A;  5ECL B;  4GXZ A;  5GAN D;  5ECO B;  1FB0 A;  5CRH A;  2P5R A;  2YZH A;  3J7Y b;  1QK8 A;  3VWU A;  3DWV A;  3H8Q A;  1PMT A;  4YAP A;  4MMM A;  3D22 A;  2YV9 A;  2XPD A;  4KDX A;  2GQM A;  4TKY A;  4JZQ A;  2WGR A;  2A2P A;  2FWG A;  3TKS C;  1B9Y C;  5GZZ B;  2C0D A;  1WOU A;  2R0G A;  4DEJ A;  4G0L A;  3KEB A;  3FR3 A;  1AIU A;  1VGL A;  3TJJ A;  4FO5 A;  4XS6 A;  2C8U A;  5LD0 A;  2FWH A;  3IAM 2;  3LEF A;  1XWG A;  2WS2 A;  1XVW A;  1PQN A;  3CRT A;  1A24 A;  1V57 A;  3GA4 A;  3CWG A;  3SWL A;  3GX0 A;  2HNL A;  3CMI A;  2VCT A;  1ZYP A;  1XZO A;  3S9F A;  1X9W B;  4K5R A;  3IC4 A;  5ELG A;  4EL1 A;  1FO5 A;  5KN2 A;  2GZY A;  3FY7 A;  4DVC A;  4ZL9 A;  2VKZ G;  1YEP A;  3PR8 A;  5J47 A;  9GSS A;  1NHY A;  1PN0 A;  4XHM A;  2K8S A;  1B4P A;  1TP9 A;  2TRC P;  5HFK A;  2H1D A;  1T4Y A;  1RK4 A;  2L6D A;  2NTO A;  4QQ7 A;  3TJG A;  5IQY A;  4MP4 A;  2NDO A;  2Z9S A;  2PN8 A;  3HVV A;  5DCH A;  1V2A A;  2CZ2 A;  2XBI A;  4WEY A;  4EF0 A;  4Z2T A;  1FOH A;  1OC3 A;  1GWC A;  3ZFB A;  3EYT A;  3FRC A;  5CRW A;  2HZE A;  3GTU B;  3ME7 A;  4HU9 A;  3DRN A;  5A1N A;  3GKX A;  3KP8 A;  5ABR A;  2BJX A;  2PU9 C;  1NW2 A;  2HFD A;  4ECI A;  3UL3 A;  1XW9 A;  2JZR A;  3F6D A;  2H30 A;  4JRR A;  1K0B A;  3CSI A;  3HDC A;  1XVQ A;  3L4N A;  4BL7 A;  1TK0 B;  3LOR A;  3F4T A;  4GSS A;  1GNE A;  1K0O A;  2C3T A;  2E7P A;  2FA8 A;  1XWB A;  3RPN A;  4OCE A;  1BJX A;  4KGI A;  3DML A;  2V6K A;  4XCS A;  3MYD A;  1TXU A;  3LYK A;  4JE1 A;  4IN0 A;  2HSH A;  1ZOF A;  2QA2 A;  1PA3 A;  3CBU A;  5CRD A;  1AUC A;  1H4O A;  4JU5 A;  4TRX A;  1TI1 A;  4MDC A;  3ZVJ D;  3O3T A;  4CDO A;  4KCE A;  4RQX A;  4N30 A;  5F05 A;  2OE3 A;  1M0U A;  3JCM L;  4MPG A;  1OC8 A;  3U5R E;  3M8N A;  5J41 A;  1YDK A;  1R7H A;  4O7H A;  4WR5 A;  1Z6N A;  4X4J A;  1GSU A;  1TJD A;  2DKH A;  2MMA A;  3EWL A;  2A4V A;  2RM5 A;  3TKS A;  5KEJ A;  5F06 A;  1FG4 A;  5JCG A;  2LRN A;  1THX A;  3FK8 A;  1LJR A;  1F3B A;  2L4C A;  2HZF A;  2VCQ A;  2I9H A;  3ERW A;  2RUF A;  2O7K A;  1TRV A;  5CRG A;  4KSM A;  1JZR A;  1HD2 A;  3TJK A;  1TK5 B;  3WT1 A;  4ZIJ A;  4EC0 A;  3F9U A;  1DUG A;  2C3N A;  4EE0 A;  1MD4 A;  3TGZ A;  1U87 A;  2LJA A;  2GST A;  2DBC A;  3QAG A;  4PNG A;  1WMJ A;  1FB6 A;  1RW1 A;  19GS A;  4BVY B;  2EFH A;  1M2A A;  5DAL B;  4KX4 A;  1OKT A;  5IPG A;  2GS3 A;  4J2F A;  4NWY A;  3RHC A;  2HSM A;  2V41 A;  2HRK B;  1VF1 A;  3WGX A;  2FUG 2;  2C0E A;  2X8C A;  4HDE A;  3GV1 A;  3IDV A;  2HI7 A;  4OD7 A;  5INY A;  1K0M A;  3I9V 2;  5ELA A;  5HFG A;  1YEX A;  1OC9 A;  2FWF A;  2R3X A;  3FEU A;  2C3Q A;  2H19 A;  2NBS A;  3DEX A;  3ZRE A;  4DSS A;  1OYJ A;  5IO2 A;  3EU4 A;  2IMD A;  4PTS A;  3HY2 A;  3IOS A;  4AKX B;  3LYP A;  1WE0 A;  1GH2 A;  1SK0 A;  4NPB A;  3A5W A;  2M46 A;  2EIR A;  4PNF A;  1ACV A;  1AC1 A;  1DE1 A;  4Q5R A;  1SEN A;  3LSZ A;  3VWX A;  4V2N A;  4PGT A;  1PN9 A;  4MLY A;  3GH6 A;  1M9B A;  2B3S A;  2LV3 A;  4GF0 A;  1GRX A;  4I97 A;  1EZK A;  1OE8 A;  4FYC A;  3DVX A;  4KH7 A;  4TR4 A;  4MPF A;  1SK2 A;  2GTU A;  3H1N A;  4YQV A;  5GAP D;  2CA8 A;  2ALB A;  1LBK A;  4MH2 A;  3DD3 A;  2EC4 A;  1K0A A;  4NXI A;  3GIX A;  4K0N A;  2HSY A;  4BPY A;  5L71 A;  3QDN A;  1TRS A;  5A4V A;  1PSQ A;  2IFQ A;  2EFE A;  1MEK A;  1UC7 A;  1PKZ A;  4OFN A;  1YY7 A;  3G7J A;  5DAK B;  6GSV A;  1J08 A;  2AUV A;  4RI6 A;  4LL1 B;  3QPM A;  4RQR A;  2ZNM A;  1X9M B;  4G19 A;  5KOX A;  10GS A;  1R5A A;  2LQQ A;  1FHE A;  2NVL A;  4NHW A;  4IP6 A;  3KMO A;  3R2Q A;  2L5O A;  3DGQ A;  2X8G A;  4MZB A;  1XFL A;  5C04 A;  1USB A;  1A8Y A;  4K2X A;  11GS A;  1GUM A;  5C00 A;  4X43 A;  4WKW A;  3A2X A;  4CW9 A;  4TXV A;  1K3Y A;  1AQW A;  4NHZ A;  4Q5Q A;  1M99 A;  4TW5 A;  5BMU B;  1BAY A;  1ST9 A;  3KZQ A;  4CY6 A;  2P31 A;  1KTE A;  3GST A;  2CZ3 A;  4TVE A;  3ZRD A;  3O76 A;  1T4Z A;  1XWK A;  2VO4 A;  4ICY A;  6GSY A;  2VD1 A;  4V2L A;  2H1L A;  5IOX A;  4D73 B;  3RBT A;  4Z7X A;  1AAZ A;  3RAZ A;  2XPE A;  4KA0 A;  2MBS A;  1ZZY A;  1F37 A;  5D9W A;  3W6G A;  4ZBB A;  4EDY A;  4KB3 A;  4L5L A;  3EVI A;  3FR6 A;  3Q6O A;  1OKD A;  2AV4 A;  1YKA A;  4FYB A;  5DQS A;  4TR3 A;  2VM1 A;  3KXO A;  2G0F A;  3QAW A;  1ILO A;  3I6A A;  4HS1 A;  2XHF A;  1MD3 A;  4OFM A;  1HNC A;  1TRW A;  3MWH A;  1J0F A;  3IV4 A;  2VCV A;  1X5D A;  2CVB A;  2HE3 A;  5ECN B;  4LLR A;  4KDY A;  4EVM A;  2R37 A;  3VK9 A;  1YVL A;  2YWM A;  1SVM A;  2H0I A;  4O32 A;  1M9A A;  3D5J A;  4NV5 A;  3PPU A;  4BA7 A;  2UV8 G;  3BOA A;  1T3B A;  3DVW A;  5B6M A;  5JCW A;  5CAX A;  5HR3 A;  4GQC A;  2ON7 A;  2HSN B;  2VM2 A;  4GST A;  1WIK A;  4K7O A;  18GS A;  4AKI A;  5KN0 A;  4K9Z A;  3ZIV A;  2I81 A;  2C80 A;  4KDU A;  2JAD A;  5G5E A;  1F2E A;  3K8N A;  3VUR A;  2QKE A;  3TDG A;  1EP8 A;  4BVX A;  4TN8 A;  3IPZ A;  5H5S A;  3KH7 A;  4OO4 A;  3US3 A;  2PGT A;  4K7I A;  2X64 A;  3IRA A;  3ME8 A;  2AJQ B;  2FNO A;  4GQF A;  4QMK A;  3QOU A;  1X0R A;  1QQ2 A;  3EMP A;  1ON4 A;  2X99 A;  5A4U A;  1O8X A;  2MMN A;  4ZB6 A;  1U6T A;  1HYU A;  3GL5 A;  4POL A;  5J9B A;  3IK9 A;  3RPP A;  2PBJ A;  1QFN A;  3IK7 A;  4FIW A;  1SJZ A;  3VLN A;  4TXO A;  5B7C A;  2HT9 A;  2DIY A;  3GYK A;  1Q4J A;  2E2M A;  4ML1 A;  1PL2 A;  2OT3 A;  1PX6 A;  4ID0 A;  4I2U A;  1PD2 1;  5J40 A;  1O85 A;  1AQX A;  1QGV A;  3FMW A;  3KD0 A;  1IYI A;  5CYY A;  1UA5 A;  2O5V A;  2M80 A;  1Y1U A;  2M72 A;  1Q98 A;  3FZ5 A;  1K0C A;  2LJR A;  2H0H A;  1SKR B;  2DJJ A;  2P5Q A;  2HRA A;  2X8H A;  1ZYE A;  4CHS A;  4O5Q A;  3UAP A;  4O5R A;  4K2D A;  2LKU A;  2E2G A;  1DE2 A;  4K8M A;  3FW2 A;  2QA1 A;  4TR1 B;  2F3M A;  1XW5 A;  1EP7 A;  2VL9 A;  3HJO A;  4ACS A;  3H79 A;  3SBC A;  2OAD A;  3O6T A;  5A34 B;  2OE0 A;  4WET A;  1JFU A;  3KM6 A;  5DJL A;  5CNW A;  5D73 A;  1A2J A;  2GLR A;  5H5R A;  3IR4 A;  4GDF A;  2H6Y A;  3HZ4 A;  3HVS A;  3V1W A;  3HD5 A;  3BJ5 A;  3M9J A;  1GSS A;  1K3O A;  3D4T A;  3ZFL A;  1MTC A;  2AHE A;  2B5Y A;  1SKS B;  4DSR A;  2B7J A;  4LL4 B;  4HZ2 A;  3VFI A;  4YKF A;  1MDK A;  4POB A;  1TU8 A;  2KOK A;  4ECC A;  1GUK A;  3TUE A;  3ISO A;  4DSQ A;  3E3E A;  2FGX A;  5ECI B;  2QC7 A;  1YZX A;  3ED3 A;  3G7I A;  4NMU A;  1U3A A;  2B1L A;  4GLT A;  2LJK A;  4AJ6 A;  3PH9 A;  5IIZ A;  4EIQ A;  5AN1 A;  1F6M C;  3GTU A;  3WD6 A;  3DXB A;  4KSO A;  2YZU A;  3U6V A;  2H01 A;  2JZS A;  2FCH A;  3M0F A;  2OE1 A;  2LUS A;  1E2Y A;  4ZB7 A;  4MJB A;  4KND A;  5AIS A;  1A2L A;  2WUL A;  4K7N A;  2DSA A;  5A5K A;  2RII A;  3TRP A;  2YAN A;  2HYX A;  4QL9 A;  3W8S A;  3QCP A;  2QGV A;  4MAB A;  3IHG A;  3R3E A;  5E59 A;  3FZ9 A;  1G6W A;  1T8E B;  3TKS E;  5DBQ A;  4F82 A;  5G2Z A;  2LS5 A;  1M2B A;  3ZIJ A;  5KOW A;  1AXD A;  4HEA 2;  3GKN A;  1H75 A;  4ZL8 A;  1XCC A;  1N25 A;  3UAR A;  1WJK A;  3I43 A;  4A5P A;  2DJ3 A;  3LFL A;  4GRF A;  1S3D A;  1SD8 A;  1EGR A;  5JWR B;  2YN1 A;  5AGY A;  2X49 A;  14GS A;  2L57 A;  2OJL A;  1SVO A;  1ZCP A;  5ECM B;  5IMC A;  2B6M A;  3UVT A;  6GST A;  4KCA A;  1GNW A;  3F6F A;  1G7O A;  1M2D A;  2AB6 A;  4K0G A;  1XW6 A;  4XTS A;  2VLT A;  5ID2 B;  1BG1 A;  2VL3 A;  4JED A;  4K6X A;  3DIE A;  20GS A;  1TU7 A;  2LQO A;  1EEJ A;  4L0U A;  1FOV A;  3L0H A;  1JZO A;  2KP2 A;  4AI6 A;  3LQ7 A;  1WPI A;  3ZMK A;  1SYX A;  3CYN A;  1AQV A;  2XC2 A;  4IS0 A;  4HJM A;  5HR1 A;  4N10 A;  5J4Y A;  1YF0 A;  2DIZ A;  1N2A A;  1ABA A;  5IMZ A;  3CSH A;  4G9H A;  3EIN A;  4IJ3 A;  3GRX A;  4F9Z A;  1A8L A;  4OFT A;  3AY8 A;  2VCW A;  4F0C A;  4XS4 B;  3HHV A;  2IME A;  2HLS A;  2VAF A;  4ISD A;  1I5G A;  2WRT A;  4TR0 A;  2D2Z A;  3ZVJ A;  1XOA A;  3L9S A;  2YCD A;  3LXZ A;  1SK1 A;  3LG6 A;  3APQ A;  3A2W A;  1W89 A;  4F2I A;  2CQ9 A;  3W8J A;  3GNJ A;  3IBH A;  1EOH A;  1B48 A;  2HQT A;  5EPF A;  5IMD A;  5KN3 A;  1GP1 A;  4BVY A;  4LMW A;  1GLP A;  5DAL A;  5JWO B;  3F3R A;  5A5H B;  2B5E A;  3C71 A;  2HRK A;  4GSN A;  5IMV A;  2JAC A;  3D0Z A;  2VLV A;  2FWE A;  3UBK A;  5G30 A;  4ZIL A;  1PRX A;  5D96 A;  1BYE A;  3KTL A;  2YJH A;  3LWA A;  2CVD A;  4XRA A;  3ZIT A;  2GVP A;  4OO5 A;  4BWQ A;  1JLW A;  2KLX A;  4H86 A;  2GZP A;  4KF9 A;  5FHI A;  1T00 A;  2DJ2 A;  1I9D A;  5ECP B;  2DJ0 A;  1BX9 A;  4POM A;  2WB9 A;  2GDR A;  4EUY A;  1XOB A;  3UVH A;  4KAE A;  2N5A A;  2R6K A;  2WFC A;  5LCZ A;  2EIQ A;  2TIR A;  1O7U A;  1O6J A;  3TCO A;  4Z2R A;  13GS A;  2C1Y A;  3P90 A;  3UJ1 A;  2F8A A;  5J5N A;  2OAC A;  5FT3 A;  2F8F A;  2HRF A;  3HXS A;  2CVK A;  1SYR A;  1YKC A;  4IVF A;  1G7E A;  2DLX A;  4MJA A;  5D8I A;  3UBL A;  2O89 A;  1JZW A;  4WF5 A;  1TW9 A;  1O81 A;  1GTU A;  2LRT A;  3TU3 B;  2R5G A;  5IPH A;  4IHU A;  3GUS A;  1GUL A;  1HNB A;  4RUV A;  2PVQ A;  1ERW A;  5DAK A;  3CTG A;  2UZ8 A;  4ZBA A;  4K1F A;  1R26 A;  1PL1 A;  3D4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...