1U87A

Crystal structure of the 26 kda glutathione s-transferase y7f mutant from schistosoma japonicum complexed with glutathione
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
209
structure length
209
Chain Sequence
MSPILGFWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-Transferase 26 kDa
publication title Crystallographic and Thermodynamic Analysis of the Binding of S-Octylglutathione to the Tyr 7 to Phe Mutant of Glutathione S-Transferase from Schistosoma japonicum(,)
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 56
structure length 209
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1u87A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1u87A01
3FEUA 5ECPB 3IPZA 3JCML 5ECQB 1FVJA 4E8EA 5CO3A 6GSYA 4ECCA 1TK5B 2C3NA 1TRUA 3HJPA 3Q18A 4CDOA 5JWOB 1U87A 2GGTA 2CT6A 2JZRA 3KD0A 1ST9A 5KN3A 1PRXA 4GF0A 2VL2A 4LLRA 1H4OA 2GZPA 3LYPA 2BJXA 4PNFA 1YQ1A 4P3YB 16GSA 3PPUA 5H5RA 2KLXA 3NOFA 3DD3A 4MLYA 3UARA 2VL3A 3QDNA 1J0FA 4ZIJA 4GQCA 2VUPA 2OE0A 5ECIB 2YN1A 3DXBA 3HKRA 1GH2A 3LFLA 1FAAA 2CVKA 3UVHA 4EDZA 1WWJA 4L0WA 1OVNA 1M2AA 2VLUA 1X9MB 1PGTA 1N8JA 2IIYA 3H8QA 4KGIA 3TJFA 1M0UA 1U88A 4XS6A 1SL0B 1XXUA 1Y25A 4LMWA 3A2WA 4ZILA 1SL2B 3UL3A 2L4CA 3IV4A 6GSVA 3WT1A 1Z3EA 2YZHA 4TR3A 2IMEA 3TJBA 1EGRA 3BCKA 5J4UA 4IJ3A 1TJDA 5DCGA 2YJHA 5DAKA 3RBTA 2YOIA 4GQFA 3CSJA 3A2VA 18GSA 3UBKA 3F63A 1W89A 4MH2A 1K3YA 2KP1A 3G7YA 3QD9A 4Z7XA 3QAGA 1GUKA 2RM5A 2TIRA 3R2QA 2H1GA 2V1MA 1PSQA 2IN3A 4NPBA 3VWUA 4F0CA 5FHIA 1GSFA 1TP9A 5H5SA 3GYKA 1A0FA 1O85A 1K3LA 3ERGA 4IHUA 1SU9A 3FY7A 3DVWA 4CW9A 3FW2A 4MPFA 2EIOA 2YWIA 3TB2A 1Z6NA 2L5OA 5AIVA 2LEGA 1OE7A 2RUFA 1T4ZA 5IOXA 3EINA 2HI7A 1ZCPA 2QSIA 2E2MA 4HUAA 4MH3A 4DEJA 1IYHA 3HA9A 1EV9A 5JCUA 3GMFA 2DBCA 3O3TA 3WGDA 4OFNA 3CYNA 4XRAA 1GTIA 3IK9A 2BMXA 1ILOA 1XZOA 2DIZA 5DAKB 2E0QA 3IR4A 4HZ2A 3GL3A 1QGVA 1B4QA 4MJEA 2H1DA 3HVVA 2D2ZA 1ERUA 2GT5A 5GSSA 2DMLA 2PBJA 1XWGA 3EWLA 3P90A 1EP7A 2HQTA 4N0ZA 2MMZA 1PD21 2LJAA 3LEFA 3FK8A 5B8BA 3F6FA 3ZMKA 4K9ZA 4GRFA 1Z7RA 3GTUB 3FZ4A 2XPDA 2O87A 1AIUA 4GWRA 1BQ7A 2VCZA 2LRTA 4YAVA 2PPTA 5HR2A 2X8GA 4LL4B 2C0DA 1A2MA 4WEYA 4L8EA 3IDVA 3FZ9A 2I1UA 4HEA2 5FT3A 2AB6A 2DJ2A 4YAPA 4NHWA 1EEJA 3V1WA 1NHOA 3HJMA 1FB6A 4XCSA 4Q5FA 4D73B 2HZEA 1U3AA 4LMVA 4PTSA 3P2AA 4IS0A 1IYIA 1XWBA 5HR3A 4KDYA 1GTBA 3KP9A 1ACVA 1Z6MA 4NV2A 4ZL9A 4V2LA 3KXOA 2L4QA 2ZNMA 5EPFA 5IMFA 4H86A 2H8LA 5GSTA 1TRSA 1V2AA 3KZQA 1M99A 1X5DA 2VL2C 3G7JA 1TXXA 2AHEA 3ERWA 2OBIA 2GLRA 1H75A 2JZTA 4GCIA 4EC0A 1WRYA 1FO5A 4F2IA 2LJRA 1XIYA 2GQKA 5JWQB 4EF0A 3A2XA 2DJ0A 2DMMA 5B6NA 1SJ6A 4FH8A 4BVYA 4X43A 4XHMA 1HNAA 3I69A 4G0LA 4FYUA 3CRTA 2AUVA 1F3AA 2MMOA 3NIVA 1XW5A 2H0IA 5ECOB 4GLTA 4TXOA 4JU5A 1DBYA 4K7OA 4CHSA 1K0OA 2P0GA 4N30A 4I2UA 3K8NA 5EY6A 2XPEA 3APSA 1YJ6A 5B7CA 2NVLA 2WULA 3IC4A 5D9VA 2F3MA 4NMUA 2HT9A 3WYWA 3C71A 2CQ9A 3C1RA 3TJJA 3D0ZA 2EIRA 1Q4JA 5D9TA 1JLVA 2DJKA 3N9JA 4IP1A 4O5RA 3TCOA 1JFUA 2LUSA 4OCEA 3GUSA 3LORA 4AGSA 2A2SA 2FA8A 4O7HA 3EE2A 1YEXA 1AC1A 3L9VA 3HJOA 2N5AA 2IJYA 3F9UA 1O7UA 3VWWA 4HU9A 3H1NA 2H72A 2WS2A 1WPIA 1GUHA 1GNEA 3DRNA 1FB0A 2DSAA 8GSSA 4RI6A 2YNXA 4GSTA 2CVBA 1VF4A 4IELA 1Q98A 4BL7A 3O76A 1A8LA 3GL5A 4EKZA 1OC9A 1SKWB 1ERTA 5JCGA 3L4NA 1MDKA 3DEXA 1TK8B 12GSA 3OR5A 2NTOA 1YF0A 4JR4A 3EC3A 4QL9A 1R7HA 5IMZA 4O92A 2N5BA 1BX9A 2C1YA 2JADA 3EMXA 2RLIA 2GSSA 1SK0A 2F8AA 4TXVA 4KX4A 2L6CA 2YWOA 4IJIA 4BPYA 1GNWA 3F6DA 4IGJA 4WR5A 4FQUA 1ZL9A 3CTGA 1FHEA 2DLXA 1A2LA 3HZ8A 2H75A 1SJIA 2LNTA 4QL7A 3GKXA 3GFKA 5IM9A 1XW6A 2RIIA 2H30A 4DSSA 2OE3A 5F07A 2OKAA 5ECRB 5IMCA 4IW9A 5G2ZA 2JSYA 2WZ9A 5ELAA 5FWGA 1GRXA 1THXA 4L5OA 2I3YA 2ZUPA 2VD0A 2E2GA 4V2NA 1XFLA 4PX1A 4BL7B 1OC9B 2NBSA 2R4VA 2F51A 4Q5QA 2YV9A 2CAQA 3QOUA 6GSXA 3ZLPA 3ZIVA 2PN8A 2FCHA 5IIZA 1KBNA 4PURA 4K1FA 1S3AA 2BTOT 1ON4A 3ZL5A 2VCVA 3VFIA 1ZOFA 2O89A 3CSIA 1J9BA 2LRNA 4MJCA 4MJBA 5DVBA 1MD3A 3EU3A 1AUCA 1G6YA 3VWVA 4V2MA 4POBA 1X5EA 4LL1B 3LJRA 3BCIA 3Q6OA 3CRUA 4DSSB 4IBPA 2H6YA 2FA4A 5ECMB 5HR1A 2HSNB 1PQNA 4XS4A 1WOUA 3WD6A 2LS5A 5HFIA 1SENA 2O8VB 3ZVJD 1O8XA 1YDKA 1OC8A 1SKSB 1QXHA 1TOFA 3UJ1A 2YPMA 2H19A 4I5QA 2H0HA 1DE2A 2MMNA 3F4TA 2C0EA 2CAIA 3MAKA 3KGKA 3VK9A 1SL1B 2IMFA 4KSMA 2M46A 4IN0A 2VD1A 4KUNA 1G0TA 1YKAA 1JZOA 2H1BA 2LV3A 3UVTA 4KW6A 1X0RA 3GHAA 1MDJA 2HFDA 4PUFC 4PQ1A 5CP1A 5IMVA 5IQYA 2YV7A 4HDEA 1J08A 5B6MA 3TJGA 3DVXA 2I4AA 2WJUA 1HNBA 4V1Ap 1EOHA 4MMMA 2IFQA 1OC3A 5CREA 3IRAA 1O73A 3EURA 1DSBA 5E59A 2VCXA 3F4SA 1T4YA 1K0MA 3TKQA 4I2TA 5ID2A 1TRWA 4XS4B 2LQQA 5BMUA 2HRKA 5IMAA 2GSTA 3E3EA 5J5NA 5CRGA 2YP6A 2WFCA 1AAZA 2FWEA 5LNKe 3HVXA 3J7Yk 4KCAA 1LJRA 1ZYEA 2YWMA 2H6ZA 2AJQB 2LNSA 3IK7A 4IQ1A 2GZYA 4AJ7A 1NHYA 1XCCA 1TRVA 4JR6A 1VF3A 1EGOA 2X8CA 2H66A 4N10A 2XHFA 3LWAA 1GL8A 2FHEA 1A24A 2FY6A 3H79A 3IE3A 4DSRA 2B3SA 3ZTLA 3ZRDA 1GSYA 2H70A 1AXDA 3TKSC 1PA3A 1TK0B 3IC8A 3Q19A 4JBBA 2PGTA 5CNWA 1BYEA 4WKWA 1GLPA 4ECJA 5G1LA 5IPHA 3LQ7A 1EWXA 2P5QA 4FO5A 1T7PB 2B5XA 2GTUA 2HRKB 1XWKA 4KNDA 1JZWA 4TR1A 3HDCA 2HRFA 2VOCA 2KOKA 3J7Yb 4ZBDA 1PMTA 3ZIJA 5G5FA 1PX6A 2V6KA 2K18A 6GSWA 2H01A 3D5JA 2OBKA 2M72A 5ECKB 1K0NA 3G7IA 1ZYQB 4YQVA 3HZ4A 2K9FA 4ML1A 3UEMA 3M0FA 1AQVA 4J56E 4JRRA 1XW9A 5J9BA 1I9DA 4GXZA 2L6DA 2IL3A 2M80A 3ZZXA 2ALBA 1NSWA 3ZFBA 1SD8A 1T1VA 3I9V2 3KTLA 1CQGA 2L5LA 1UA5A 4AJ6A 3IAS2 4G0IA 5COHA 1OAZA 3ZREA 2G0FA 2P5RA 2OJLA 1QMVA 2JU5A 1V40A 1F2EA 1WIKA 1OYJA 4K7IA 3CSHA 2FGXA 3ZVJA 1F9MA 4IQAA 2VAFA 1BAYA 3QFAC 3D6IA 3IHQA 2B6MA 1XOAA 2V41A 4KB3A 1YZXA 3MWHA 4TKYA 4NAXA 4I97A 2FWHA 4YH2A 1AQXA 5F8BA 2GS3A 4LA1A 3VLNA 4JEDA 4MJAA 1R26A 3QFBC 2EIQA 3F8UA 2YWNA 5KN2A 1SKRB 2MMAA 2QC7A 3EU4A 2VO4A 1RQMA 2MBTA 5KN0A 4G2EA 1GSDA 1WJKA 1V98A 3APOA 1VRSD 3QAVA 1JZDA 4POLA 1R5PA 3KH9A 3CXGA 2VCQA 2HZFA 2FWFA 4ZBAA 1DE1A 4EVMA 3QR6A 4BVXA 3KCMA 5AISA 3BOAA 2KHPA 3TKPA 3GURA 2X64A 3P7XA 1BG5A 2HXKA 4POKA 3ZMLA 2CA8A 1BEDA 2DJ3A 3KMOA 2MYGA 2PERA 5IO0A 3GX8A 3TRXA 2HZEB 2OA7A 1ERWA 1TU8A 1U6TA 2HRAA 2EC4A 4BWSA 4KSOA 2GSQA 3M3MA 4DSQA 1NM3A 3KP8A 1XVQA 1B9YC 5ELGA 4RQXA 4RQRA 3FKFA 4POMA 5CRDA 3CMIA 20GSA 5HFGA 2V32A 2XBQA 4K0NA 2B5EA 3ED3A 2NPBA 1MDIA 2HSHA 2X99A 2GZZA 3BBYA 6GSSA 1TI1A 5G1KA 2DJ1A 3DKSA 2MBSA 4KDUA 1PL2A 5D93A 2B1LA 4TOPA 13GSA 1EOGA 3TRPA 2PUKC 2H0GA 3LG6A 1HQOA 4KH7A 4BVYB 2L59A 4K0GA 4TXOB 3QCPA 4IVFA 2E7PA 5F06A 4PUAA 2PMTA 2LRCA 2JACA 4HU7A 3HHVA 1M2BA 3I6AA 3DIEA 2B7KA 3TKSA 6GSTA 1YY7A 2R2JA 5J41A 3M9KA 1ERVA 3D4MA 2PWJA 2WCIA 5LCZA 2GQLA 4JZQA 3E0UA 3GKMA 2GT6A 5J9CA 2OADA 3ERFA 1X9SB 2DC5A 1B48A 1C72A 4KE3A 1R5AA 1RW1A 4OCFA 4MDCA 5H5QA 5D96A 2CZ2A 4NHZA 4XIHA 1NW2A 3KIJA 1PKWA 1Z9HA 2WDUA 9GSSA 2C8UA 3ZFLA 1W4VA 5CAXA 2V2GA 2QKEA 3FR9A 4MF7A 2HE3A 5AN1A 4L0UA 2VLVA 3UIWA 5GZZB 4K2DA 1ML6A 5A4WA 5D9WA 5DQSA 2C0FA 4RUVA 10GSA 3HY2A 4WF5A 3GRXA 4OO5A 1THOA 2UZ8A 4O32A 1KNGA 2H71A 1A8YA 1DUGA 2HLSA 2OACA 3I43A 4EDYA 5LD0A 3ZITA 4YQUA 3O6TA 1GSSA 1YKCA 5IMDA 2IMIA 3C7MA 3GNJA 5KEJA 1YF1A 5G5EA 1URMA 2JZSA 2YZUA 4I8BA 4JE1A 1M9BA 1Z7PA 1QUWA 3HXSA 3KMNA 4AJ8A 1N2AA 4MA9A 1GSEA 2CVDA 2B5YA 4OFMA 4F9ZA 2IPAA 5DCHA 4HZ4A 1UN2A 3TKSE 1ABAA 3RHCA 2LSTA 4WR4A 1MD4A 2ON5A 1G7EA 5A5KA 1SYXA 1B9XC 3ME7A 4MK3A 4IP6A 3F3QA 7GSSA 2R37A 3UOMA 2FLSA 3M9JA 2XC2A 1QFNA 4WBJA 4E8HA 3W8JA 2AV4A 3RAZA 5E4WA 4WBRD 22GSA 2FWGA 1O6JA 3KTBA 3G9BA 1OKTA 1T3BA 1FW1A 2LTKA 2QGVA 4MF6A 2K6VA 1CQHA 2N5FA 3Q74A 1JZRA 1K0DA 4TRXA 4OFTA 3FR6A 1YEPA 2RM6A 1JHBA 3S9FA 1X5CA 1XPVA 2MZCA 3IXRA 3SBCA 2TRXA 2VIMA 2F9SA 3VI5A 2AAWA 1GSQA 3GA4A 5A4UA 1O8WA 1SK2A 2C80A 4ZB8A 1WMJA 2O7KA 4KAEA 2I81A 4MCUA 1HYUA 2GQMA 4ID0A 4DVCA 3TGZA 5DBQA 1V57A 2GSRA 3BD2A 4KA0A 1S3DA 3VWXA 1JLWA 2HSMA 2X8HA 3IOSA 2V6OA 2YANA 3U5RE 3GSTA 3WGXA 1PN9A 4N11A 2VM1A 1SK1A 4HS1A 4V1Ag 3A5WA 1VF2A 2DIYA 4ACSA 4Q5RA 1QK8A 2WRTA 4YQMA 3UAPA 5CRWA 2J23A 5IO2A 3TJKA 1LBKA 3GH6A 2B7JA 11GSA 5ECNB 2CZ3A 3WT2A 1KEBA 2HYXA 3GSSA 2FNOA 2NDOA 5J3RA 2IFQB 2YJ7A 1VF1A 5F0GA 4PXOA 5D73A 3QAWA 3LGCA 2RUEA 4XTSA 1BJXA 3GIXA 2KP2A 4GTUA 3GTUA 5ID2B 2PVQA 1M9AA 1K3OA 4ZXGA 4KCEA 4J2FA 5ENUA 14GSA 2LKUA 3P8WA 4MABA 1A0RP 4ZL7A 4ISDA 3D21A 5G30A 1F37A 1F3BA 2VCTA 3EMPA 4IKHA 2FUG2 3L78A 2HSMB 1G6WA 1FOVA 3L9UA 1GTAA 1ZZYA 3GX0A 3E9JB 5L71A 4OMVA 2CX4A 3LXTA 1VGLA 3PGTA 1T00A 1SD9A 4D73A 3R3EA 2H74A 3MNGA 3UMAA 4WXTA 1KTEA 4ECBA 1M7TA 1V9WA 1G7OA 1GWCA 3GH9A 1AW9A 4PGTA 2C0GA 1SYRA 2ES7A 3FRCA 2XBIA 1B4PA 5GAPD 5B8AA 1GTUA 3DYRA 4BA7A 4G9HA 1Z5YE 4HJ2A 3GV1A 5DDLA 5CYYA 2L57A 3PINA 5DQYA 3TRQA 1A2JA 1UVZA 1XOBA 4TW5A 1R4WA 3VURA 4X1UA 4XRDA 4L5LA 3KM6A 3DGQA 4ZB6A 4ZL8A 4MP4A 2R5GA 4HQSA 2C3QA 4PQIA 5HQPA 2YCDA 3HYPA 4G0KA 1X9WB 2J9HA 2HNLA 4XS1A 2IWTA 3MDKA 2B1KA 4X0XA 4NXIA 5ABRA 4TR1B 3N5OA 1EZKA 2A2RA 1PKZA 2TRCP 5CRHA 3NZNA 4WETA 3AY8A 2C4JA 2PVOC 4EXJA 3GN3A 1TTZA 3TKRA 4KDXA 1MEKA 2LJKA 1Y6EA 3IAM2 5GAND 5D9XA 4ML6A 1K0BA 1XVWA 2AYTA 4EO3A 1MTCA 1HNCA 3GKKA 3M8NA 1I5GA 3F4RA 1AQWA 2IMKA 5ECLB 4AF2A 1E2YA 3ME8A 2H76A 3PR8A 4EE0A 1S3CA 5DALA 5F05A 4TVEA 2HSYA 3LYKA 4ZBBA 3VI7A 3HCZA 2ZCTA 3H4KA 2R3XA 1WE0A 5INYA 5JCWA 1OE8A 4PQHA 3QMXA 3KH7A 3L0HA 2K8SA 1EP8A 4ECIA 2R6KA 2O85A 4QQ7A 3MSZA 2VCWA 1T8EB 4BWQA 1FVKA 1HD2A 4K6XA 4TN8A 4G19A 4K8MA 3C8EA 3EVIA 2A4VA 1UC7A 4RI7A 5KN1A 2H73A 3FZ5A 1EEMA 3RPPA 1O81A 2G2QA 4ZB9A 3BJ5A 2Z9SA 4TR4A 5ECSA 4GSNA 1TKDB 3SWLA 2P31A 4ULXA 3LXZA 2DJJA 4K7NA 1PX7A 5DJLA 2PU9C 2C3TA 2KUCA 3APQA 3A3TA 4BVXB 2JSZA 5DJMA 4PNGA 3FHKA 3HVSA 4F82A 3L9SA 2REMA 5DALB 3EYTA 6GSUA 4FYCA 19GSA 1FG4A 3PH9A 3U6VA 2WB9A 3DMLA 2WGRA 4WF4A 2K8VA 1GSUA 4MZWA 2H6XA 2LQOA 4OO4A 2F8FA 5G31A 1E6BA 1F6MC 4Q5NA 1XWAA 1WP0A 3KJYA 2VM2A 1PL1A 5IOWA 3VPQA 4MZCA 3CTFA 4FIWA 3F0IA 4OD7A 1XBSA 2ON7A 1U3IA 3VPTA 3RDWA 2GVPA 3F3RA 1B8XA 2IMDA 2HRNA 2H1AA 3M1GA 4KF9A 1TDIA 1TU7A 1V58A 4F03A 5HR0A 2GDRA 4HI7A 1K0AA 17GSA 1M2DA 4I6XA 2VL9A 1GULA 1RK4A 3WGEA 4HQZA 1GP1A 2OE1A 3ISOA 5C00A 4MZBA 3TDGA 3IA1A 1USBA 5A4VA 2I9HA 4MF5A 3TOUA 3C73A 5AGYA 5ECHB 1XWCA 3FZAA 1ZMAA 4TR0A 1A23A 3RHBA 3CBUA 3RPNA 5IPGA 3D4TA 3W6GA 3H93A 3FR3A 1LU4A 4NV5A 4N0VA 3GKNA 3QPMA 4FYBA 1GUMA 3LSZA 2CV4A 3ZYWA 4OWYA 1OKDA 4EL1A 4HOJA 1ZGNA 5C04A 3IBHA 3D22A 4NWYA 3W8SA 3UBLA 1EV4A 4G10A 2CX3A 3C1SA 4F0BA 5D8IA 1TW9A 4EUYA 1SJZA 3HD5A 5HFKA 3FYGA 2FD3A 1GLQA 4MPGA 5AIXA 1K0CA 5EVOA 4USSA 3TOTA 2VLTA 4HJMA 3DWVA 1TI3A 4GSSA 4J57E 5EL8A 5JWRB 3TUEA 1QQ2A 4ILFA 3US3A 3KEBA 2JL4A
chains in the Genus database with same CATH superfamily
3FEUA 5ECPB 3IPZA 3JCML 5ECQB 1FVJA 4E8EA 5CO3A 6GSYA 4ECCA 1TK5B 2C3NA 1TRUA 3HJPA 3Q18A 4CDOA 5JWOB 1U87A 1ZYNA 2GGTA 2CT6A 2JZRA 3KD0A 1ST9A 5KN3A 2DKIA 1PRXA 4GF0A 2VL2A 4LLRA 1H4OA 2GZPA 3LYPA 2BJXA 4PNFA 2DKHA 1YQ1A 4P3YB 4Z2RA 16GSA 3PPUA 5H5RA 2KLXA 3NOFA 3DD3A 4MLYA 3UARA 2VL3A 3QDNA 1J0FA 4ZIJA 4GQCA 2VUPA 2OE0A 5ECIB 2YN1A 3DXBA 3HKRA 1GH2A 3LFLA 1FAAA 2CVKA 3UVHA 4EDZA 1WWJA 4L0WA 1OVNA 1M2AA 2VLUA 1X9MB 1PGTA 1N8JA 2IIYA 3H8QA 4K2XA 4KGIA 3TJFA 1M0UA 1U88A 4XS6A 1SL0B 1XXUA 1Y25A 5J40A 4LMWA 3A2WA 4ZILA 1SL2B 3UL3A 2L4CA 3IV4A 6GSVA 3WT1A 1Z3EA 2YZHA 4TR3A 2IMEA 3TJBA 4EIPA 1EGRA 3BCKA 5J4UA 4IJ3A 1TJDA 5DCGA 2YJHA 5DAKA 3RBTA 2YOIA 4GQFA 3CSJA 3A2VA 18GSA 3UBKA 3F63A 1W89A 4MH2A 1K3YA 2KP1A 3G7YA 3QD9A 4Z7XA 3QAGA 1GUKA 2RM5A 2TIRA 3R2QA 2H1GA 2V1MA 1PSQA 2IN3A 4NPBA 3VWUA 4F0CA 1YVLA 5FHIA 1GSFA 1TP9A 5H5SA 3GYKA 1A0FA 1O85A 1K3LA 3ERGA 4IHUA 1SU9A 3FY7A 3DVWA 4CW9A 3FW2A 4MPFA 2EIOA 2YWIA 3TB2A 2WW2A 1Z6NA 3HVNA 2L5OA 5AIVA 2LEGA 1OE7A 2RUFA 1T4ZA 5IOXA 3EINA 2HI7A 1ZCPA 2QSIA 2E2MA 4HUAA 4MH3A 4DEJA 1IYHA 3HA9A 1EV9A 5JCUA 3GMFA 2DBCA 3O3TA 3WGDA 4OFNA 3CYNA 4XRAA 1GTIA 3IK9A 2BMXA 1ILOA 1XZOA 2DIZA 5DAKB 2EFCA 2E0QA 3IR4A 4HZ2A 2R0PA 3GL3A 1QGVA 1B4QA 4MJEA 2H1DA 3HVVA 2D2ZA 1ERUA 2GT5A 5GSSA 2DMLA 1S4BP 4Z2UA 2PBJA 1XWGA 3EWLA 3P90A 1EP7A 2HQTA 4N0ZA 2MMZA 4AI6A 1PD21 2LJAA 3LEFA 3FK8A 5B8BA 3F6FA 3ZMKA 4K9ZA 4GRFA 4AKIA 1Z7RA 3GTUB 3FZ4A 2XPDA 2O87A 1AIUA 4GWRA 1BQ7A 2VCZA 4GDFA 2LRTA 4YAVA 2PPTA 3A5IA 5HR2A 2X8GA 4LL4B 2C0DA 1A2MA 4WEYA 4L8EA 3IDVA 3FZ9A 2I1UA 4HEA2 5FT3A 2AB6A 2DJ2A 4YAPA 4NHWA 1EEJA 2R0CA 3V1WA 1NHOA 3HJMA 2O5VA 1FB6A 4XCSA 4Q5FA 4D73B 2HZEA 1U3AA 4LMVA 4PTSA 3P2AA 4IS0A 1IYIA 1XWBA 5HR3A 4KDYA 1GTBA 3KP9A 1ACVA 4E68A 1Z6MA 4NV2A 4ZL9A 4V2LA 3KXOA 2L4QA 2ZNMA 5EPFA 5IMFA 4H86A 2H8LA 5GSTA 3MIXA 1TRSA 1V2AA 3KZQA 1M99A 1X5DA 2VL2C 3G7JA 1TXXA 2AHEA 3ERWA 2OBIA 2GLRA 1H75A 2JZTA 4GCIA 4EC0A 1WRYA 1FO5A 4F2IA 2LJRA 1XIYA 2GQKA 5JWQB 4EF0A 2EFDA 3A2XA 2DJ0A 2DMMA 5B6NA 1SJ6A 4FH8A 4BVYA 4X43A 4XHMA 1HNAA 3I69A 5A1NB 4G0LA 4FYUA 3CRTA 2AUVA 1F3AA 2MMOA 3NIVA 1XW5A 2H0IA 5ECOB 4GLTA 4TXOA 4JU5A 1DBYA 4K7OA 4CHSA 1K0OA 2P0GA 3CHXC 4N30A 2WVXA 4I2UA 3K8NA 5EY6A 2XPEA 4A5PA 3APSA 1YJ6A 5B7CA 2NVLA 2WULA 3IC4A 5D9VA 2F3MA 4NMUA 2HT9A 3WYWA 3C71A 2CQ9A 2VKZG 3C1RA 3TJJA 3D0ZA 2EIRA 1Q4JA 5D9TA 1JLVA 2DJKA 3N9JA 4IP1A 4O5RA 3TCOA 1JFUA 2LUSA 4OCEA 3GUSA 3LORA 4AGSA 2A2SA 5A5HA 2FA8A 4O7HA 3EE2A 1YEXA 1AC1A 3L9VA 3HJOA 2N5AA 2IJYA 3F9UA 1O7UA 4FXYP 3VWWA 4HU9A 4AKGA 3H1NA 2H72A 2WS2A 1WPIA 1GUHA 1GNEA 3DRNA 1FB0A 2DSAA 8GSSA 4RI6A 2YNXA 4GSTA 2CVBA 5BRTA 1VF4A 4IELA 2WVXB 1Q98A 4BL7A 3O76A 1A8LA 5J4VA 3GL5A 4HSCX 4EKZA 1OC9A 1SKWB 1ERTA 5JCGA 3L4NA 1MDKA 3DEXA 1TK8B 12GSA 3OR5A 2NTOA 1YF0A 4JR4A 3EC3A 4QL9A 1R7HA 5IMZA 5J4YA 4O92A 2N5BA 5KOWA 1BX9A 4O5QA 2C1YA 2JADA 3EMXA 2RLIA 2GSSA 1SK0A 2F8AA 4TXVA 4KX4A 2L6CA 2YWOA 4IJIA 4BPYA 1GNWA 3F6DA 2WZSA 4IGJA 3EPTA 4WR5A 4FQUA 1ZL9A 5A5HB 3CTGA 1FHEA 2DLXA 1A2LA 3HZ8A 2H75A 1SJIA 2LNTA 4QL7A 3GKXA 3GFKA 5IM9A 1XW6A 2RIIA 2H30A 4DSSA 2OE3A 5F07A 2OKAA 5ECRB 5IMCA 4IW9A 5G2ZA 2JSYA 2WZ9A 5ELAA 5FWGA 1GRXA 1THXA 4L5OA 4K5SA 2I3YA 2ZUPA 2VD0A 2E2GA 4V2NA 1XFLA 4PX1A 4BL7B 2EFEA 1OC9B 2NBSA 2R4VA 2F51A 4Q5QA 2YV9A 2CAQA 3QOUA 6GSXA 3ZLPA 3ZIVA 2PN8A 2FCHA 5IIZA 1KBNA 4PURA 4K1FA 1S3AA 2BTOT 1ON4A 3ZL5A 2VCVA 3VFIA 1ZOFA 2O89A 3CSIA 1J9BA 2LRNA 4Z2TA 4MJCA 4MJBA 5DVBA 1MD3A 3EU3A 1AUCA 1G6YA 3VWVA 4V2MA 4POBA 1X5EA 4LL1B 3LJRA 3BCIA 3Q6OA 3CRUA 4DSSB 4IBPA 2H6YA 2FA4A 5ECMB 1YEWC 5HR1A 2HSNB 1PQNA 4XS4A 1WOUA 3WD6A 2LS5A 5HFIA 1SENA 2O8VB 3ZVJD 1O8XA 1YDKA 1OC8A 1SKSB 1QXHA 1TOFA 3UJ1A 2YPMA 2H19A 4I5QA 2H0HA 1DE2A 2MMNA 3F4TA 2C0EA 2CAIA 3MAKA 3KGKA 3VK9A 1SL1B 2IMFA 4KSMA 2M46A 4IN0A 2VD1A 4KUNA 1G0TA 1YKAA 1JZOA 2H1BA 2LV3A 3UVTA 4KW6A 1X0RA 3GHAA 1MDJA 2HFDA 4PUFC 4PQ1A 5CP1A 5IMVA 5IQYA 2R0GA 2YV7A 4HDEA 1J08A 5B6MA 3TJGA 3HMJG 3DVXA 2I4AA 2WJUA 1HNBA 4V1Ap 1EOHA 4MMMA 2IFQA 1OC3A 5CREA 3IRAA 1S3RA 1O73A 3EURA 1DSBA 5E59A 2O3EA 2VCXA 3F4SA 1T4YA 1K0MA 3TKQA 3CWGA 4I2TA 2A4HA 5ID2A 1TRWA 4XS4B 2LQQA 5BMUA 2HRKA 5IMAA 2GSTA 3E3EA 5J5NA 5CRGA 2O36A 2YP6A 2WFCA 1AAZA 2FWEA 5LNKe 3HVXA 3J7Yk 4KCAA 1LJRA 1ZYEA 2YWMA 2H6ZA 2AJQB 2LNSA 3IK7A 4IQ1A 2GZYA 4AJ7A 1NHYA 1XCCA 1TRVA 4JR6A 1VF3A 1EGOA 2X8CA 2H66A 4N10A 2XHFA 3LWAA 1GL8A 2FHEA 1A24A 2FY6A 3H79A 3IE3A 4DSRA 2B3SA 3ZTLA 3ZRDA 1GSYA 2H70A 1AXDA 2OT3A 3TKSC 1PA3A 1TK0B 3IC8A 3Q19A 4JBBA 2PGTA 5CNWA 1BYEA 4WKWA 1GLPA 4ECJA 5G1LA 5IPHA 4YKGA 3LQ7A 1XG8A 1EWXA 2P5QA 5BMUB 4FO5A 4ZB7A 1T7PB 2B5XA 2GTUA 2HRKB 1XWKA 1M3JA 4KNDA 1JZWA 4TR1A 3HDCA 2HRFA 2VOCA 2KOKA 3J7Yb 4ZBDA 1PMTA 3ZIJA 5G5FA 1PX6A 2V6KA 2K18A 6GSWA 2H01A 3D5JA 2OBKA 2M72A 5ECKB 1K0NA 3G7IA 1ZYQB 4YQVA 3HZ4A 1FOHA 2K9FA 4ML1A 3UEMA 3M0FA 1AQVA 4J56E 4JRRA 1XW9A 5J9BA 1I9DA 4GXZA 2L6DA 2IL3A 2M80A 3ZZXA 2ALBA 1NSWA 3ZFBA 1SD8A 1T1VA 3I9V2 3KTLA 1CQGA 2L5LA 2X4AA 1UA5A 2WVYA 4AJ6A 3IAS2 4G0IA 5COHA 1OAZA 3ZREA 2G0FA 2P5RA 2OJLA 1QMVA 2JU5A 1V40A 1F2EA 1WIKA 4O5UA 1OYJA 4K7IA 3CSHA 2FGXA 3ZVJA 1F9MA 4IQAA 2VAFA 1BAYA 3QFAC 3D6IA 3IHQA 2B6MA 1XOAA 2V41A 4KB3A 1YZXA 3MWHA 4TKYA 4NAXA 4I97A 2FWHA 4YH2A 1AQXA 5F8BA 2GS3A 4LA1A 3VLNA 4JEDA 4AKHA 4MJAA 1R26A 3QFBC 2EIQA 3F8UA 2YWNA 5KN2A 1SKRB 2MMAA 2QC7A 3EU4A 2VO4A 1RQMA 2MBTA 5KN0A 4G2EA 1GSDA 1WJKA 1V98A 3APOA 1VRSD 3QAVA 1JZDA 4POLA 1R5PA 3KH9A 3CXGA 2VCQA 2HZFA 2FWFA 4ZBAA 1DE1A 4EVMA 2QA1A 3QR6A 4BVXA 3KCMA 5AISA 3BOAA 2KHPA 3TKPA 3GURA 2X64A 3P7XA 1BG5A 2HXKA 4POKA 3ZMLA 3IHGA 2CA8A 1BEDA 2DJ3A 3KMOA 2MYGA 2PERA 5KOXA 5IO0A 3GX8A 3TRXA 2HZEB 5J47A 2OA7A 1ERWA 1TU8A 1U6TA 2HRAA 2EC4A 4BWSA 4KSOA 2GSQA 3M3MA 4DSQA 1NM3A 3FMWA 3KP8A 1XVQA 1B9YC 5ELGA 4RQXA 4RQRA 3FKFA 4POMA 5CRDA 3CMIA 20GSA 5HFGA 2V32A 2XBQA 4K0NA 2B5EA 3ED3A 2NPBA 1MDIA 2HSHA 2X99A 2GZZA 3BBYA 6GSSA 1TI1A 5G1KA 2DJ1A 3DKSA 2MBSA 4KDUA 1PL2A 5D93A 2B1LA 4TOPA 13GSA 1EOGA 3TRPA 4PI2C 2PUKC 2H0GA 3LG6A 1HQOA 4KH7A 4BVYB 2L59A 4K0GA 4TXOB 3QCPA 4IVFA 2E7PA 5F06A 4PUAA 2PMTA 2LRCA 4ICYA 2JACA 4HU7A 3HHVA 1M2BA 3I6AA 3DIEA 2B7KA 3TKSA 6GSTA 1YY7A 2R2JA 5J41A 3M9KA 1ERVA 3D4MA 2PWJA 2WCIA 5LCZA 2GQLA 4JZQA 3E0UA 3GKMA 2GT6A 5J9CA 2OADA 3ERFA 1X9SB 2DC5A 1B48A 1C72A 4KE3A 1R5AA 1RW1A 2X49A 4K5RA 4OCFA 4MDCA 5H5QA 5D96A 2CZ2A 4NHZA 4XIHA 1NW2A 3KIJA 1PKWA 1Z9HA 2WDUA 9GSSA 2C8UA 3ZFLA 1W4VA 5CAXA 4MNNA 2V2GA 3RFRC 2QKEA 3FR9A 4MF7A 2HE3A 5AN1A 4L0UA 2VLVA 3UIWA 5GZZB 4K2DA 1ML6A 5A4WA 5D9WA 5DQSA 2C0FA 4RUVA 10GSA 3HY2A 4WF5A 3GRXA 4OO5A 1THOA 2UZ8A 4O32A 1KNGA 2H71A 1A8YA 1DUGA 3LW9A 2HLSA 2OACA 3I43A 4EDYA 5LD0A 3ZITA 4YQUA 3O6TA 1GSSA 1YKCA 5IMDA 2IMIA 3C7MA 3GNJA 5KEJA 1YF1A 4PI0C 5G5EA 1URMA 2JZSA 2YZUA 4I8BA 4JE1A 1M9BA 1Z7PA 1QUWA 3HXSA 3KMNA 4AJ8A 1N2AA 4MA9A 1GSEA 2CVDA 2B5YA 4OFMA 4F9ZA 2IPAA 5DCHA 4HZ4A 1UN2A 3TKSE 1ABAA 3RHCA 2LSTA 4WR4A 1MD4A 2ON5A 1G7EA 5A5KA 1SYXA 1B9XC 3ME7A 4MK3A 4IP6A 3F3QA 7GSSA 2R37A 3UOMA 2FLSA 2XC2A 3M9JA 1QFNA 4WBJA 4E8HA 3W8JA 2AV4A 3RAZA 4N3ZA 5E4WA 4WBRD 22GSA 2FWGA 1O6JA 3KTBA 3G9BA 1OKTA 1T3BA 1FW1A 2LTKA 2QGVA 4MF6A 2K6VA 1CQHA 2N5FA 3Q74A 1JZRA 1K0DA 4TRXA 4OFTA 3FR6A 1YEPA 2RM6A 1JHBA 3S9FA 1X5CA 1XPVA 2MZCA 3IXRA 3SBCA 2TRXA 2VIMA 2F9SA 3VI5A 2AAWA 1GSQA 3GA4A 5A4UA 1O8WA 5A34A 1SK2A 2C80A 4ZB8A 1WMJA 2O7KA 4KAEA 2I81A 4MCUA 1HYUA 2GQMA 1SVOA 4ID0A 4BIKA 4DVCA 3TGZA 5DBQA 1V57A 2GSRA 3BD2A 4KA0A 1S3DA 3VWXA 1JLWA 1PFOA 2HSMA 2X8HA 3IOSA 2V6OA 2YANA 3U5RE 3GSTA 3WGXA 1PN9A 4N11A 2VM1A 1SK1A 4HS1A 4V1Ag 3A5WA 1VF2A 2DIYA 4ACSA 4Q5RA 1QK8A 2WRTA 4YQMA 3UAPA 5CRWA 2J23A 5IO2A 3TJKA 1LBKA 3GH6A 2B7JA 11GSA 5ECNB 2CZ3A 3WT2A 1KEBA 2HYXA 3GSSA 2FNOA 2NDOA 5J3RA 2IFQB 2YJ7A 1VF1A 5F0GA 1BG1A 1SVMA 4PXOA 2QA2A 1Y1UA 5D73A 3QAWA 3LGCA 5A34B 2RUEA 4XTSA 1BJXA 3GIXA 2KP2A 4GTUA 3GTUA 5ID2B 2PVQA 1M9AA 1K3OA 4ZXGA 4KCEA 4J2FA 5ENUA 14GSA 2LKUA 3P8WA 4CY6A 4MABA 1A0RP 4ZL7A 4ISDA 3D21A 5G30A 1F37A 1F3BA 2VCTA 3EMPA 4IKHA 2FUG2 3L78A 2HSMB 1G6WA 1FOVA 3L9UA 1GTAA 1ZZYA 3GX0A 3E9JB 5L71A 4OMVA 2CX4A 3LXTA 1VGLA 3PGTA 1T00A 1SD9A 4D73A 3R3EA 2H74A 3MNGA 3UMAA 4WXTA 1KTEA 4ECBA 1M7TA 1V9WA 1G7OA 2WW1A 1GWCA 3GH9A 1AW9A 4PGTA 2C0GA 1SYRA 2ES7A 3FRCA 2XBIA 1B4PA 5GAPD 4X4JA 5B8AA 1GTUA 3DYRA 4BA7A 4G9HA 1Z5YE 4HJ2A 3GV1A 5DDLA 5CYYA 2L57A 3PINA 5DQYA 3TRQA 3CQFA 1A2JA 1UVZA 1XOBA 4TW5A 1R4WA 3VURA 4X1UA 4XRDA 4L5LA 3KM6A 3DGQA 4QMKA 4YKFA 4ZB6A 1ZYPA 4ZL8A 1TXUA 4MP4A 2R5GA 4HQSA 2C3QA 4PQIA 5HQPA 2YCDA 3HYPA 4G0KA 1X9WB 5A1NA 2J9HA 2HNLA 4XS1A 2IWTA 3MDKA 2B1KA 4X0XA 4NXIA 5ABRA 4TR1B 3N5OA 1EZKA 2A2RA 1PKZA 2TRCP 5CRHA 3NZNA 4WETA 3AY8A 2C4JA 2PVOC 4EXJA 4AKXB 3GN3A 1TTZA 3TKRA 2EFHA 4KDXA 1MEKA 2LJKA 1Y6EA 3IAM2 5GAND 4G01A 5D9XA 4ML6A 1K0BA 1XVWA 2AYTA 4EO3A 1MTCA 1HNCA 3GKKA 3M8NA 1I5GA 3F4RA 1AQWA 2IMKA 2A2PA 5ECLB 4AF2A 1E2YA 2H1LA 3ME8A 4PHZC 2H76A 3PR8A 4EE0A 1S3CA 5DALA 5F05A 1PN0A 4TVEA 2HSYA 3LYKA 3MYDA 4ZBBA 3VI7A 3HCZA 2ZCTA 3H4KA 2R3XA 1WE0A 5INYA 5JCWA 1OE8A 4PQHA 3QMXA 3KH7A 3L0HA 2K8SA 1EP8A 4ECIA 2R6KA 2O85A 4QQ7A 3MSZA 2VCWA 1T8EB 4BWQA 1FVKA 1HD2A 4K6XA 4TN8A 4G19A 4K8MA 3C8EA 3EVIA 2A4VA 1UC7A 4RI7A 5KN1A 2H73A 3FZ5A 1EEMA 3RPPA 1O81A 2G2QA 4ZB9A 3BJ5A 2Z9SA 1M3IA 4TR4A 5ECSA 4GSNA 1TKDB 3SWLA 2P31A 4ULXA 3LXZA 2DJJA 4K7NA 1PX7A 5DJLA 2PU9C 2C3TA 3RGBC 2KUCA 3A3TA 3APQA 4BVXB 2JSZA 5DJMA 4PNGA 1BF5A 3FHKA 2WW3A 3HVSA 4F82A 3L9SA 2REMA 5DALB 3EYTA 4CY8A 6GSUA 4FYCA 2UV8G 19GSA 1FG4A 3PH9A 3U6VA 2WB9A 3DMLA 2WGRA 1SVLA 4WF4A 2K8VA 1GSUA 4MZWA 2H6XA 2LQOA 4OO4A 2F8FA 5G31A 1E6BA 2WW0A 1F6MC 4Q5NA 1XWAA 1WP0A 3KJYA 2VM2A 1PL1A 5IOWA 3VPQA 4MZCA 3CTFA 4FIWA 3F0IA 4OD7A 1XBSA 2ON7A 1U3IA 3VPTA 3RDWA 2GVPA 3F3RA 1B8XA 2IMDA 2HRNA 2H1AA 3M1GA 4KF9A 1TDIA 1TU7A 4W66A 1V58A 4F03A 5HR0A 2GDRA 4HI7A 1K0AA 17GSA 1M2DA 2VL9A 4I6XA 1GULA 1RK4A 3WGEA 4HQZA 1GP1A 2OE1A 3ISOA 5C00A 4MZBA 3TDGA 3IA1A 1USBA 5A4VA 2I9HA 4MF5A 3TOUA 3C73A 5AGYA 2WVZA 5ECHB 1XWCA 3FZAA 1ZMAA 4TR0A 1A23A 3RHBA 3CBUA 3RPNA 5IPGA 3D4TA 2HSNA 3W6GA 3H93A 3FR3A 1LU4A 4NV5A 4N0VA 3GKNA 3QPMA 4FYBA 1GUMA 3LSZA 1N25A 2CV4A 3ZYWA 4OWYA 1OKDA 4EL1A 4HOJA 1ZGNA 5C04A 3IBHA 3D22A 4NWYA 3W8SA 3UBLA 1EV4A 4G10A 2CX3A 3C1SA 4F0BA 5D8IA 1TW9A 4EUYA 1SJZA 3HD5A 5HFKA 3FYGA 2FD3A 1GLQA 4MPGA 5AIXA 1K0CA 5EVOA 4USSA 3TOTA 2VLTA 3TU3B 4HJMA 1I1IP 3DWVA 4EIQA 1TI3A 4GSSA 4J57E 5EL8A 5JWRB 3TUEA 1QQ2A 4ILFA 3US3A 3KEBA 2JL4A
chains in the Genus database with same CATH topology
3FEUA 5ECPB 3IPZA 3JCML 5ECQB 1FVJA 4E8EA 5CO3A 6GSYA 4ECCA 1TK5B 2C3NA 1TRUA 3HJPA 3Q18A 4CDOA 5JWOB 1U87A 1ZYNA 2GGTA 2CT6A 2JZRA 3KD0A 1ST9A 5KN3A 2DKIA 1PRXA 4GF0A 2VL2A 4LLRA 1H4OA 2GZPA 3LYPA 2BJXA 4PNFA 2DKHA 1YQ1A 4P3YB 4Z2RA 16GSA 3PPUA 5H5RA 2KLXA 3NOFA 3DD3A 4MLYA 3UARA 2VL3A 3QDNA 1J0FA 4ZIJA 4GQCA 2VUPA 2OE0A 5ECIB 2YN1A 3DXBA 3HKRA 1GH2A 3LFLA 1FAAA 2CVKA 3UVHA 4EDZA 1WWJA 4L0WA 1OVNA 1M2AA 2VLUA 1X9MB 1PGTA 1N8JA 2IIYA 3H8QA 4K2XA 4KGIA 3TJFA 1M0UA 1U88A 4XS6A 1SL0B 1XXUA 1Y25A 5J40A 4LMWA 3A2WA 4ZILA 1SL2B 3UL3A 2L4CA 3IV4A 6GSVA 3WT1A 1Z3EA 2YZHA 4TR3A 2IMEA 3TJBA 4EIPA 1EGRA 3BCKA 5J4UA 4IJ3A 1TJDA 5DCGA 2YJHA 5DAKA 3RBTA 2YOIA 4GQFA 3CSJA 3A2VA 18GSA 3UBKA 3F63A 1W89A 4MH2A 1K3YA 2KP1A 3G7YA 3QD9A 4Z7XA 3QAGA 1GUKA 2RM5A 2TIRA 3R2QA 2H1GA 2V1MA 1PSQA 2IN3A 4NPBA 3VWUA 4F0CA 1YVLA 5FHIA 1GSFA 1TP9A 5H5SA 3GYKA 1A0FA 1O85A 1K3LA 3ERGA 4IHUA 1SU9A 3FY7A 3DVWA 4CW9A 3FW2A 4MPFA 2EIOA 2YWIA 3TB2A 1Z6NA 2L5OA 5AIVA 2LEGA 1OE7A 2RUFA 1T4ZA 5IOXA 3EINA 2HI7A 1ZCPA 2QSIA 2E2MA 4HUAA 4MH3A 4DEJA 1IYHA 3HA9A 1EV9A 5JCUA 3GMFA 2DBCA 3O3TA 3WGDA 4OFNA 3CYNA 4XRAA 1GTIA 3IK9A 2BMXA 1ILOA 1XZOA 2DIZA 5DAKB 2EFCA 2E0QA 3IR4A 4HZ2A 2R0PA 3GL3A 1QGVA 1B4QA 4MJEA 2H1DA 3HVVA 2D2ZA 1ERUA 2GT5A 5GSSA 2DMLA 4Z2UA 2PBJA 1XWGA 3EWLA 3P90A 1EP7A 2HQTA 4N0ZA 2MMZA 4AI6A 1PD21 2LJAA 3LEFA 3FK8A 5B8BA 3F6FA 3ZMKA 4K9ZA 4GRFA 4AKIA 1Z7RA 3GTUB 3FZ4A 2XPDA 2O87A 1AIUA 4GWRA 1BQ7A 2VCZA 4GDFA 2LRTA 4YAVA 2PPTA 3A5IA 5HR2A 2X8GA 4LL4B 2C0DA 1A2MA 4WEYA 4L8EA 3IDVA 3FZ9A 2I1UA 4HEA2 5FT3A 2AB6A 2DJ2A 4YAPA 4NHWA 1EEJA 2R0CA 3V1WA 1NHOA 3HJMA 2O5VA 1FB6A 4XCSA 4Q5FA 4D73B 2HZEA 1U3AA 4LMVA 4PTSA 3P2AA 4IS0A 1IYIA 1XWBA 5HR3A 4KDYA 1GTBA 3KP9A 1ACVA 4E68A 1Z6MA 4NV2A 4ZL9A 4V2LA 3KXOA 2L4QA 2ZNMA 5EPFA 5IMFA 4H86A 2H8LA 5GSTA 3MIXA 1TRSA 1V2AA 3KZQA 1M99A 1X5DA 2VL2C 3G7JA 1TXXA 2AHEA 3ERWA 2OBIA 2GLRA 1H75A 2JZTA 4GCIA 4EC0A 1WRYA 1FO5A 4F2IA 2LJRA 1XIYA 2GQKA 5JWQB 4EF0A 2EFDA 3A2XA 2DJ0A 2DMMA 5B6NA 1SJ6A 4FH8A 4BVYA 4X43A 4XHMA 1HNAA 3I69A 5A1NB 4G0LA 4FYUA 3CRTA 2AUVA 1F3AA 2MMOA 3NIVA 1XW5A 2H0IA 5ECOB 4GLTA 4TXOA 4JU5A 1DBYA 4K7OA 4CHSA 1K0OA 2P0GA 4N30A 4I2UA 3K8NA 5EY6A 2XPEA 4A5PA 3APSA 1YJ6A 5B7CA 2NVLA 2WULA 3IC4A 5D9VA 2F3MA 4NMUA 2HT9A 3WYWA 3C71A 2CQ9A 2VKZG 3C1RA 3TJJA 3D0ZA 2EIRA 1Q4JA 5D9TA 1JLVA 2DJKA 3N9JA 4IP1A 4O5RA 3TCOA 1JFUA 2LUSA 4OCEA 3GUSA 3LORA 4AGSA 2A2SA 5A5HA 2FA8A 4O7HA 3EE2A 1YEXA 1AC1A 3L9VA 3HJOA 2N5AA 2IJYA 3F9UA 1O7UA 3VWWA 4HU9A 4AKGA 3H1NA 2H72A 2WS2A 1WPIA 1GUHA 1GNEA 3DRNA 1FB0A 2DSAA 8GSSA 4RI6A 2YNXA 4GSTA 2CVBA 5BRTA 1VF4A 4IELA 1Q98A 4BL7A 3O76A 1A8LA 5J4VA 3GL5A 4EKZA 1OC9A 1SKWB 1ERTA 5JCGA 3L4NA 1MDKA 3DEXA 1TK8B 12GSA 3OR5A 2NTOA 1YF0A 4JR4A 3EC3A 4QL9A 1R7HA 5IMZA 5J4YA 4O92A 2N5BA 5KOWA 1BX9A 4O5QA 2C1YA 2JADA 3EMXA 2RLIA 2GSSA 1SK0A 2F8AA 4TXVA 4KX4A 2L6CA 2YWOA 4IJIA 4BPYA 1GNWA 3F6DA 4IGJA 3EPTA 4WR5A 4FQUA 1ZL9A 5A5HB 3CTGA 1FHEA 2DLXA 1A2LA 3HZ8A 2H75A 1SJIA 2LNTA 4QL7A 3GKXA 3GFKA 5IM9A 1XW6A 2RIIA 2H30A 4DSSA 2OE3A 5F07A 2OKAA 5ECRB 5IMCA 4IW9A 5G2ZA 2JSYA 2WZ9A 5ELAA 5FWGA 1GRXA 1THXA 4L5OA 4K5SA 2I3YA 2ZUPA 2VD0A 2E2GA 4V2NA 1XFLA 4PX1A 4BL7B 2EFEA 1OC9B 2NBSA 2R4VA 2F51A 4Q5QA 2YV9A 2CAQA 3QOUA 6GSXA 3ZLPA 3ZIVA 2PN8A 2FCHA 5IIZA 1KBNA 4PURA 4K1FA 1S3AA 2BTOT 1ON4A 3ZL5A 2VCVA 3VFIA 1ZOFA 2O89A 3CSIA 1J9BA 2LRNA 4Z2TA 4MJCA 4MJBA 5DVBA 1MD3A 3EU3A 1AUCA 1G6YA 3VWVA 4V2MA 4POBA 1X5EA 4LL1B 3LJRA 3BCIA 3Q6OA 3CRUA 4DSSB 4IBPA 2H6YA 2FA4A 5ECMB 5HR1A 2HSNB 1PQNA 4XS4A 1WOUA 3WD6A 2LS5A 5HFIA 1SENA 2O8VB 3ZVJD 1O8XA 1YDKA 1OC8A 1SKSB 1QXHA 1TOFA 3UJ1A 2YPMA 2H19A 4I5QA 2H0HA 1DE2A 2MMNA 3F4TA 2C0EA 2CAIA 3MAKA 3KGKA 3VK9A 1SL1B 2IMFA 4KSMA 2M46A 4IN0A 2VD1A 4KUNA 1G0TA 1YKAA 1JZOA 2H1BA 2LV3A 3UVTA 4KW6A 1X0RA 3GHAA 1MDJA 2HFDA 4PUFC 4PQ1A 5CP1A 5IMVA 5IQYA 2R0GA 2YV7A 4HDEA 1J08A 5B6MA 3TJGA 3HMJG 3DVXA 2I4AA 2WJUA 1HNBA 4V1Ap 1EOHA 4MMMA 2IFQA 1OC3A 5CREA 3IRAA 1O73A 3EURA 1DSBA 5E59A 2VCXA 3F4SA 1T4YA 1K0MA 3TKQA 3CWGA 4I2TA 2A4HA 5ID2A 1TRWA 4XS4B 2LQQA 5BMUA 2HRKA 5IMAA 2GSTA 3E3EA 5J5NA 5CRGA 2YP6A 2WFCA 1AAZA 2FWEA 5LNKe 3HVXA 3J7Yk 4KCAA 1LJRA 1ZYEA 2YWMA 2H6ZA 2AJQB 2LNSA 3IK7A 4IQ1A 2GZYA 4AJ7A 1NHYA 1XCCA 1TRVA 4JR6A 1VF3A 1EGOA 2X8CA 2H66A 4N10A 2XHFA 3LWAA 1GL8A 2FHEA 1A24A 2FY6A 3H79A 3IE3A 4DSRA 2B3SA 3ZTLA 3ZRDA 1GSYA 2H70A 1AXDA 2OT3A 3TKSC 1PA3A 1TK0B 3IC8A 3Q19A 4JBBA 2PGTA 5CNWA 1BYEA 4WKWA 1GLPA 4ECJA 5G1LA 5IPHA 4YKGA 3LQ7A 1EWXA 2P5QA 5BMUB 4FO5A 4ZB7A 1T7PB 2B5XA 2GTUA 2HRKB 1XWKA 4KNDA 1JZWA 4TR1A 3HDCA 2HRFA 2VOCA 2KOKA 3J7Yb 4ZBDA 1PMTA 3ZIJA 5G5FA 1PX6A 2V6KA 2K18A 6GSWA 2H01A 3D5JA 2OBKA 2M72A 5ECKB 1K0NA 3G7IA 1ZYQB 4YQVA 3HZ4A 1FOHA 2K9FA 4ML1A 3UEMA 3M0FA 1AQVA 4J56E 4JRRA 1XW9A 5J9BA 1I9DA 4GXZA 2L6DA 2IL3A 2M80A 3ZZXA 2ALBA 1NSWA 3ZFBA 1SD8A 1T1VA 3I9V2 3KTLA 1CQGA 2L5LA 2X4AA 1UA5A 4AJ6A 3IAS2 4G0IA 5COHA 1OAZA 3ZREA 2G0FA 2P5RA 2OJLA 1QMVA 2JU5A 1V40A 1F2EA 1WIKA 4O5UA 1OYJA 4K7IA 3CSHA 2FGXA 3ZVJA 1F9MA 4IQAA 2VAFA 1BAYA 3QFAC 3D6IA 3IHQA 2B6MA 1XOAA 2V41A 4KB3A 1YZXA 3MWHA 4TKYA 4NAXA 4I97A 2FWHA 4YH2A 1AQXA 5F8BA 2GS3A 4LA1A 3VLNA 4JEDA 4AKHA 4MJAA 1R26A 3QFBC 2EIQA 3F8UA 2YWNA 5KN2A 1SKRB 2MMAA 2QC7A 3EU4A 2VO4A 1RQMA 2MBTA 5KN0A 4G2EA 1GSDA 1WJKA 1V98A 3APOA 1VRSD 3QAVA 1JZDA 4POLA 1R5PA 3KH9A 3CXGA 2VCQA 2HZFA 2FWFA 4ZBAA 1DE1A 4EVMA 2QA1A 3QR6A 4BVXA 3KCMA 5AISA 3BOAA 2KHPA 3TKPA 3GURA 2X64A 3P7XA 1BG5A 2HXKA 4POKA 3ZMLA 3IHGA 2CA8A 1BEDA 2DJ3A 3KMOA 2MYGA 2PERA 5KOXA 5IO0A 3GX8A 3TRXA 2HZEB 5J47A 2OA7A 1ERWA 1TU8A 1U6TA 2HRAA 2EC4A 4BWSA 4KSOA 2GSQA 3M3MA 4DSQA 1NM3A 3FMWA 3KP8A 1XVQA 1B9YC 5ELGA 4RQXA 4RQRA 3FKFA 4POMA 5CRDA 3CMIA 20GSA 5HFGA 2V32A 2XBQA 4K0NA 2B5EA 3ED3A 2NPBA 1MDIA 2HSHA 2X99A 2GZZA 3BBYA 6GSSA 1TI1A 5G1KA 2DJ1A 3DKSA 2MBSA 4KDUA 1PL2A 5D93A 2B1LA 4TOPA 13GSA 1EOGA 3TRPA 2PUKC 2H0GA 3LG6A 1HQOA 4KH7A 4BVYB 2L59A 4K0GA 4TXOB 3QCPA 4IVFA 2E7PA 5F06A 4PUAA 2PMTA 2LRCA 4ICYA 2JACA 4HU7A 3HHVA 1M2BA 3I6AA 3DIEA 2B7KA 3TKSA 6GSTA 1YY7A 2R2JA 5J41A 3M9KA 1ERVA 3D4MA 2PWJA 2WCIA 5LCZA 2GQLA 4JZQA 3E0UA 3GKMA 2GT6A 5J9CA 2OADA 3ERFA 1X9SB 2DC5A 1B48A 1C72A 4KE3A 1R5AA 1RW1A 2X49A 4K5RA 4OCFA 4MDCA 5H5QA 5D96A 2CZ2A 4NHZA 4XIHA 1NW2A 3KIJA 1PKWA 1Z9HA 2WDUA 9GSSA 2C8UA 3ZFLA 1W4VA 5CAXA 4MNNA 2V2GA 2QKEA 3FR9A 4MF7A 2HE3A 5AN1A 4L0UA 2VLVA 3UIWA 5GZZB 4K2DA 1ML6A 5A4WA 5D9WA 5DQSA 2C0FA 4RUVA 10GSA 3HY2A 4WF5A 3GRXA 4OO5A 1THOA 2UZ8A 4O32A 1KNGA 2H71A 1A8YA 1DUGA 3LW9A 2HLSA 2OACA 3I43A 4EDYA 5LD0A 3ZITA 4YQUA 3O6TA 1GSSA 1YKCA 5IMDA 2IMIA 3C7MA 3GNJA 5KEJA 1YF1A 5G5EA 1URMA 2JZSA 2YZUA 4I8BA 4JE1A 1M9BA 1Z7PA 1QUWA 3HXSA 3KMNA 4AJ8A 1N2AA 4MA9A 1GSEA 2CVDA 2B5YA 4OFMA 4F9ZA 2IPAA 5DCHA 4HZ4A 1UN2A 3TKSE 1ABAA 3RHCA 2LSTA 4WR4A 1MD4A 2ON5A 1G7EA 5A5KA 1SYXA 1B9XC 3ME7A 4MK3A 4IP6A 3F3QA 7GSSA 2R37A 3UOMA 2FLSA 3M9JA 2XC2A 1QFNA 4WBJA 4E8HA 3W8JA 2AV4A 3RAZA 4N3ZA 5E4WA 4WBRD 22GSA 2FWGA 1O6JA 3KTBA 3G9BA 1OKTA 1T3BA 1FW1A 2LTKA 2QGVA 4MF6A 2K6VA 1CQHA 2N5FA 3Q74A 1JZRA 1K0DA 4TRXA 4OFTA 3FR6A 1YEPA 2RM6A 1JHBA 3S9FA 1X5CA 1XPVA 2MZCA 3IXRA 3SBCA 2TRXA 2VIMA 2F9SA 3VI5A 2AAWA 1GSQA 3GA4A 5A4UA 1O8WA 5A34A 1SK2A 2C80A 4ZB8A 1WMJA 2O7KA 4KAEA 2I81A 4MCUA 1HYUA 2GQMA 1SVOA 4ID0A 4DVCA 3TGZA 5DBQA 1V57A 2GSRA 3BD2A 4KA0A 1S3DA 3VWXA 1JLWA 2HSMA 2X8HA 3IOSA 2V6OA 2YANA 3U5RE 3GSTA 3WGXA 1PN9A 4N11A 2VM1A 1SK1A 4HS1A 4V1Ag 3A5WA 1VF2A 2DIYA 4ACSA 4Q5RA 1QK8A 2WRTA 4YQMA 3UAPA 5CRWA 2J23A 5IO2A 3TJKA 1LBKA 3GH6A 2B7JA 11GSA 5ECNB 2CZ3A 3WT2A 1KEBA 2HYXA 3GSSA 2FNOA 2NDOA 5J3RA 2IFQB 2YJ7A 1VF1A 5F0GA 1BG1A 1SVMA 4PXOA 2QA2A 1Y1UA 5D73A 3QAWA 3LGCA 5A34B 2RUEA 4XTSA 1BJXA 3GIXA 2KP2A 4GTUA 3GTUA 5ID2B 2PVQA 1M9AA 1K3OA 4ZXGA 4KCEA 4J2FA 5ENUA 14GSA 2LKUA 3P8WA 4CY6A 4MABA 1A0RP 4ZL7A 4ISDA 3D21A 5G30A 1F37A 1F3BA 2VCTA 3EMPA 4IKHA 2FUG2 3L78A 2HSMB 1G6WA 1FOVA 3L9UA 1GTAA 1ZZYA 3GX0A 3E9JB 5L71A 4OMVA 2CX4A 3LXTA 1VGLA 3PGTA 1T00A 1SD9A 4D73A 3R3EA 2H74A 3MNGA 3UMAA 4WXTA 1KTEA 4ECBA 1M7TA 1V9WA 1G7OA 1GWCA 3GH9A 1AW9A 4PGTA 2C0GA 1SYRA 2ES7A 3FRCA 2XBIA 1B4PA 5GAPD 4X4JA 5B8AA 1GTUA 3DYRA 4BA7A 4G9HA 1Z5YE 4HJ2A 3GV1A 5DDLA 5CYYA 2L57A 3PINA 5DQYA 3TRQA 1A2JA 1UVZA 1XOBA 4TW5A 1R4WA 3VURA 4X1UA 4XRDA 4L5LA 3KM6A 3DGQA 4QMKA 4YKFA 4ZB6A 1ZYPA 4ZL8A 1TXUA 4MP4A 2R5GA 4HQSA 2C3QA 4PQIA 5HQPA 2YCDA 3HYPA 4G0KA 1X9WB 5A1NA 2J9HA 2HNLA 4XS1A 2IWTA 3MDKA 2B1KA 4X0XA 4NXIA 5ABRA 4TR1B 3N5OA 1EZKA 2A2RA 1PKZA 2TRCP 5CRHA 3NZNA 4WETA 3AY8A 2C4JA 2PVOC 4EXJA 4AKXB 3GN3A 1TTZA 3TKRA 2EFHA 4KDXA 1MEKA 2LJKA 1Y6EA 3IAM2 5GAND 4G01A 5D9XA 4ML6A 1K0BA 1XVWA 2AYTA 4EO3A 1MTCA 1HNCA 3GKKA 3M8NA 1I5GA 3F4RA 1AQWA 2IMKA 2A2PA 5ECLB 4AF2A 1E2YA 2H1LA 3ME8A 2H76A 3PR8A 4EE0A 1S3CA 5DALA 5F05A 1PN0A 4TVEA 2HSYA 3LYKA 3MYDA 4ZBBA 3VI7A 3HCZA 2ZCTA 3H4KA 2R3XA 1WE0A 5INYA 5JCWA 1OE8A 4PQHA 3QMXA 3KH7A 3L0HA 2K8SA 1EP8A 4ECIA 2R6KA 2O85A 4QQ7A 3MSZA 2VCWA 1T8EB 4BWQA 1FVKA 1HD2A 4K6XA 4TN8A 4G19A 4K8MA 3C8EA 3EVIA 2A4VA 1UC7A 4RI7A 5KN1A 2H73A 3FZ5A 1EEMA 3RPPA 1O81A 2G2QA 4ZB9A 3BJ5A 2Z9SA 4TR4A 5ECSA 4GSNA 1TKDB 3SWLA 2P31A 4ULXA 3LXZA 2DJJA 4K7NA 1PX7A 5DJLA 2PU9C 2C3TA 2KUCA 3APQA 3A3TA 4BVXB 2JSZA 5DJMA 4PNGA 1BF5A 3FHKA 3HVSA 4F82A 3L9SA 2REMA 5DALB 3EYTA 4CY8A 6GSUA 4FYCA 2UV8G 19GSA 1FG4A 3PH9A 3U6VA 2WB9A 3DMLA 2WGRA 1SVLA 4WF4A 2K8VA 1GSUA 4MZWA 2H6XA 2LQOA 4OO4A 2F8FA 5G31A 1E6BA 1F6MC 4Q5NA 1XWAA 1WP0A 3KJYA 2VM2A 1PL1A 5IOWA 3VPQA 4MZCA 3CTFA 4FIWA 3F0IA 4OD7A 1XBSA 2ON7A 1U3IA 3VPTA 3RDWA 2GVPA 3F3RA 1B8XA 2IMDA 2HRNA 2H1AA 3M1GA 4KF9A 1TDIA 1TU7A 4W66A 1V58A 4F03A 5HR0A 2GDRA 4HI7A 1K0AA 17GSA 1M2DA 2VL9A 4I6XA 1GULA 1RK4A 3WGEA 4HQZA 1GP1A 2OE1A 3ISOA 5C00A 4MZBA 3TDGA 3IA1A 1USBA 5A4VA 2I9HA 4MF5A 3TOUA 3C73A 5AGYA 5ECHB 1XWCA 3FZAA 1ZMAA 4TR0A 1A23A 3RHBA 3CBUA 3RPNA 5IPGA 3D4TA 2HSNA 3W6GA 3H93A 3FR3A 1LU4A 4NV5A 4N0VA 3GKNA 3QPMA 4FYBA 1GUMA 3LSZA 1N25A 2CV4A 3ZYWA 4OWYA 1OKDA 4EL1A 4HOJA 1ZGNA 5C04A 3IBHA 3D22A 4NWYA 3W8SA 3UBLA 1EV4A 4G10A 2CX3A 3C1SA 4F0BA 5D8IA 1TW9A 4EUYA 1SJZA 3HD5A 5HFKA 3FYGA 2FD3A 1GLQA 4MPGA 5AIXA 1K0CA 5EVOA 4USSA 3TOTA 2VLTA 3TU3B 4HJMA 3DWVA 4EIQA 1TI3A 4GSSA 4J57E 5EL8A 5JWRB 3TUEA 1QQ2A 4ILFA 3US3A 3KEBA 2JL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEU A;  5ECP B;  3IPZ A;  3JCM L;  5ECQ B;  1FVJ A;  4E8E A;  5CO3 A;  6GSY A;  4ECC A;  1TK5 B;  2C3N A;  1TRU A;  3HJP A;  3Q18 A;  4CDO A;  5JWO B;  1U87 A;  2GGT A;  2CT6 A;  2JZR A;  3KD0 A;  1ST9 A;  5KN3 A;  1PRX A;  4GF0 A;  2VL2 A;  4LLR A;  1H4O A;  2GZP A;  3LYP A;  2BJX A;  4PNF A;  1YQ1 A;  4P3Y B;  16GS A;  3PPU A;  5H5R A;  2KLX A;  3NOF A;  3DD3 A;  4MLY A;  3UAR A;  2VL3 A;  3QDN A;  1J0F A;  4ZIJ A;  4GQC A;  2VUP A;  2OE0 A;  5ECI B;  2YN1 A;  3DXB A;  3HKR A;  1GH2 A;  3LFL A;  1FAA A;  2CVK A;  3UVH A;  4EDZ A;  1WWJ A;  4L0W A;  1OVN A;  1M2A A;  2VLU A;  1X9M B;  1PGT A;  1N8J A;  2IIY A;  3H8Q A;  4KGI A;  3TJF A;  1M0U A;  1U88 A;  4XS6 A;  1SL0 B;  1XXU A;  1Y25 A;  4LMW A;  3A2W A;  4ZIL A;  1SL2 B;  3UL3 A;  2L4C A;  3IV4 A;  6GSV A;  3WT1 A;  1Z3E A;  2YZH A;  4TR3 A;  2IME A;  3TJB A;  1EGR A;  3BCK A;  5J4U A;  4IJ3 A;  1TJD A;  5DCG A;  2YJH A;  5DAK A;  3RBT A;  2YOI A;  4GQF A;  3CSJ A;  3A2V A;  18GS A;  3UBK A;  3F63 A;  1W89 A;  4MH2 A;  1K3Y A;  2KP1 A;  3G7Y A;  3QD9 A;  4Z7X A;  3QAG A;  1GUK A;  2RM5 A;  2TIR A;  3R2Q A;  2H1G A;  2V1M A;  1PSQ A;  2IN3 A;  4NPB A;  3VWU A;  4F0C A;  5FHI A;  1GSF A;  1TP9 A;  5H5S A;  3GYK A;  1A0F A;  1O85 A;  1K3L A;  3ERG A;  4IHU A;  1SU9 A;  3FY7 A;  3DVW A;  4CW9 A;  3FW2 A;  4MPF A;  2EIO A;  2YWI A;  3TB2 A;  1Z6N A;  2L5O A;  5AIV A;  2LEG A;  1OE7 A;  2RUF A;  1T4Z A;  5IOX A;  3EIN A;  2HI7 A;  1ZCP A;  2QSI A;  2E2M A;  4HUA A;  4MH3 A;  4DEJ A;  1IYH A;  3HA9 A;  1EV9 A;  5JCU A;  3GMF A;  2DBC A;  3O3T A;  3WGD A;  4OFN A;  3CYN A;  4XRA A;  1GTI A;  3IK9 A;  2BMX A;  1ILO A;  1XZO A;  2DIZ A;  5DAK B;  2E0Q A;  3IR4 A;  4HZ2 A;  3GL3 A;  1QGV A;  1B4Q A;  4MJE A;  2H1D A;  3HVV A;  2D2Z A;  1ERU A;  2GT5 A;  5GSS A;  2DML A;  2PBJ A;  1XWG A;  3EWL A;  3P90 A;  1EP7 A;  2HQT A;  4N0Z A;  2MMZ A;  1PD2 1;  2LJA A;  3LEF A;  3FK8 A;  5B8B A;  3F6F A;  3ZMK A;  4K9Z A;  4GRF A;  1Z7R A;  3GTU B;  3FZ4 A;  2XPD A;  2O87 A;  1AIU A;  4GWR A;  1BQ7 A;  2VCZ A;  2LRT A;  4YAV A;  2PPT A;  5HR2 A;  2X8G A;  4LL4 B;  2C0D A;  1A2M A;  4WEY A;  4L8E A;  3IDV A;  3FZ9 A;  2I1U A;  4HEA 2;  5FT3 A;  2AB6 A;  2DJ2 A;  4YAP A;  4NHW A;  1EEJ A;  3V1W A;  1NHO A;  3HJM A;  1FB6 A;  4XCS A;  4Q5F A;  4D73 B;  2HZE A;  1U3A A;  4LMV A;  4PTS A;  3P2A A;  4IS0 A;  1IYI A;  1XWB A;  5HR3 A;  4KDY A;  1GTB A;  3KP9 A;  1ACV A;  1Z6M A;  4NV2 A;  4ZL9 A;  4V2L A;  3KXO A;  2L4Q A;  2ZNM A;  5EPF A;  5IMF A;  4H86 A;  2H8L A;  5GST A;  1TRS A;  1V2A A;  3KZQ A;  1M99 A;  1X5D A;  2VL2 C;  3G7J A;  1TXX A;  2AHE A;  3ERW A;  2OBI A;  2GLR A;  1H75 A;  2JZT A;  4GCI A;  4EC0 A;  1WRY A;  1FO5 A;  4F2I A;  2LJR A;  1XIY A;  2GQK A;  5JWQ B;  4EF0 A;  3A2X A;  2DJ0 A;  2DMM A;  5B6N A;  1SJ6 A;  4FH8 A;  4BVY A;  4X43 A;  4XHM A;  1HNA A;  3I69 A;  4G0L A;  4FYU A;  3CRT A;  2AUV A;  1F3A A;  2MMO A;  3NIV A;  1XW5 A;  2H0I A;  5ECO B;  4GLT A;  4TXO A;  4JU5 A;  1DBY A;  4K7O A;  4CHS A;  1K0O A;  2P0G A;  4N30 A;  4I2U A;  3K8N A;  5EY6 A;  2XPE A;  3APS A;  1YJ6 A;  5B7C A;  2NVL A;  2WUL A;  3IC4 A;  5D9V A;  2F3M A;  4NMU A;  2HT9 A;  3WYW A;  3C71 A;  2CQ9 A;  3C1R A;  3TJJ A;  3D0Z A;  2EIR A;  1Q4J A;  5D9T A;  1JLV A;  2DJK A;  3N9J A;  4IP1 A;  4O5R A;  3TCO A;  1JFU A;  2LUS A;  4OCE A;  3GUS A;  3LOR A;  4AGS A;  2A2S A;  2FA8 A;  4O7H A;  3EE2 A;  1YEX A;  1AC1 A;  3L9V A;  3HJO A;  2N5A A;  2IJY A;  3F9U A;  1O7U A;  3VWW A;  4HU9 A;  3H1N A;  2H72 A;  2WS2 A;  1WPI A;  1GUH A;  1GNE A;  3DRN A;  1FB0 A;  2DSA A;  8GSS A;  4RI6 A;  2YNX A;  4GST A;  2CVB A;  1VF4 A;  4IEL A;  1Q98 A;  4BL7 A;  3O76 A;  1A8L A;  3GL5 A;  4EKZ A;  1OC9 A;  1SKW B;  1ERT A;  5JCG A;  3L4N A;  1MDK A;  3DEX A;  1TK8 B;  12GS A;  3OR5 A;  2NTO A;  1YF0 A;  4JR4 A;  3EC3 A;  4QL9 A;  1R7H A;  5IMZ A;  4O92 A;  2N5B A;  1BX9 A;  2C1Y A;  2JAD A;  3EMX A;  2RLI A;  2GSS A;  1SK0 A;  2F8A A;  4TXV A;  4KX4 A;  2L6C A;  2YWO A;  4IJI A;  4BPY A;  1GNW A;  3F6D A;  4IGJ A;  4WR5 A;  4FQU A;  1ZL9 A;  3CTG A;  1FHE A;  2DLX A;  1A2L A;  3HZ8 A;  2H75 A;  1SJI A;  2LNT A;  4QL7 A;  3GKX A;  3GFK A;  5IM9 A;  1XW6 A;  2RII A;  2H30 A;  4DSS A;  2OE3 A;  5F07 A;  2OKA A;  5ECR B;  5IMC A;  4IW9 A;  5G2Z A;  2JSY A;  2WZ9 A;  5ELA A;  5FWG A;  1GRX A;  1THX A;  4L5O A;  2I3Y A;  2ZUP A;  2VD0 A;  2E2G A;  4V2N A;  1XFL A;  4PX1 A;  4BL7 B;  1OC9 B;  2NBS A;  2R4V A;  2F51 A;  4Q5Q A;  2YV9 A;  2CAQ A;  3QOU A;  6GSX A;  3ZLP A;  3ZIV A;  2PN8 A;  2FCH A;  5IIZ A;  1KBN A;  4PUR A;  4K1F A;  1S3A A;  2BTO T;  1ON4 A;  3ZL5 A;  2VCV A;  3VFI A;  1ZOF A;  2O89 A;  3CSI A;  1J9B A;  2LRN A;  4MJC A;  4MJB A;  5DVB A;  1MD3 A;  3EU3 A;  1AUC A;  1G6Y A;  3VWV A;  4V2M A;  4POB A;  1X5E A;  4LL1 B;  3LJR A;  3BCI A;  3Q6O A;  3CRU A;  4DSS B;  4IBP A;  2H6Y A;  2FA4 A;  5ECM B;  5HR1 A;  2HSN B;  1PQN A;  4XS4 A;  1WOU A;  3WD6 A;  2LS5 A;  5HFI A;  1SEN A;  2O8V B;  3ZVJ D;  1O8X A;  1YDK A;  1OC8 A;  1SKS B;  1QXH A;  1TOF A;  3UJ1 A;  2YPM A;  2H19 A;  4I5Q A;  2H0H A;  1DE2 A;  2MMN A;  3F4T A;  2C0E A;  2CAI A;  3MAK A;  3KGK A;  3VK9 A;  1SL1 B;  2IMF A;  4KSM A;  2M46 A;  4IN0 A;  2VD1 A;  4KUN A;  1G0T A;  1YKA A;  1JZO A;  2H1B A;  2LV3 A;  3UVT A;  4KW6 A;  1X0R A;  3GHA A;  1MDJ A;  2HFD A;  4PUF C;  4PQ1 A;  5CP1 A;  5IMV A;  5IQY A;  2YV7 A;  4HDE A;  1J08 A;  5B6M A;  3TJG A;  3DVX A;  2I4A A;  2WJU A;  1HNB A;  4V1A p;  1EOH A;  4MMM A;  2IFQ A;  1OC3 A;  5CRE A;  3IRA A;  1O73 A;  3EUR A;  1DSB A;  5E59 A;  2VCX A;  3F4S A;  1T4Y A;  1K0M A;  3TKQ A;  4I2T A;  5ID2 A;  1TRW A;  4XS4 B;  2LQQ A;  5BMU A;  2HRK A;  5IMA A;  2GST A;  3E3E A;  5J5N A;  5CRG A;  2YP6 A;  2WFC A;  1AAZ A;  2FWE A;  5LNK e;  3HVX A;  3J7Y k;  4KCA A;  1LJR A;  1ZYE A;  2YWM A;  2H6Z A;  2AJQ B;  2LNS A;  3IK7 A;  4IQ1 A;  2GZY A;  4AJ7 A;  1NHY A;  1XCC A;  1TRV A;  4JR6 A;  1VF3 A;  1EGO A;  2X8C A;  2H66 A;  4N10 A;  2XHF A;  3LWA A;  1GL8 A;  2FHE A;  1A24 A;  2FY6 A;  3H79 A;  3IE3 A;  4DSR A;  2B3S A;  3ZTL A;  3ZRD A;  1GSY A;  2H70 A;  1AXD A;  3TKS C;  1PA3 A;  1TK0 B;  3IC8 A;  3Q19 A;  4JBB A;  2PGT A;  5CNW A;  1BYE A;  4WKW A;  1GLP A;  4ECJ A;  5G1L A;  5IPH A;  3LQ7 A;  1EWX A;  2P5Q A;  4FO5 A;  1T7P B;  2B5X A;  2GTU A;  2HRK B;  1XWK A;  4KND A;  1JZW A;  4TR1 A;  3HDC A;  2HRF A;  2VOC A;  2KOK A;  3J7Y b;  4ZBD A;  1PMT A;  3ZIJ A;  5G5F A;  1PX6 A;  2V6K A;  2K18 A;  6GSW A;  2H01 A;  3D5J A;  2OBK A;  2M72 A;  5ECK B;  1K0N A;  3G7I A;  1ZYQ B;  4YQV A;  3HZ4 A;  2K9F A;  4ML1 A;  3UEM A;  3M0F A;  1AQV A;  4J56 E;  4JRR A;  1XW9 A;  5J9B A;  1I9D A;  4GXZ A;  2L6D A;  2IL3 A;  2M80 A;  3ZZX A;  2ALB A;  1NSW A;  3ZFB A;  1SD8 A;  1T1V A;  3I9V 2;  3KTL A;  1CQG A;  2L5L A;  1UA5 A;  4AJ6 A;  3IAS 2;  4G0I A;  5COH A;  1OAZ A;  3ZRE A;  2G0F A;  2P5R A;  2OJL A;  1QMV A;  2JU5 A;  1V40 A;  1F2E A;  1WIK A;  1OYJ A;  4K7I A;  3CSH A;  2FGX A;  3ZVJ A;  1F9M A;  4IQA A;  2VAF A;  1BAY A;  3QFA C;  3D6I A;  3IHQ A;  2B6M A;  1XOA A;  2V41 A;  4KB3 A;  1YZX A;  3MWH A;  4TKY A;  4NAX A;  4I97 A;  2FWH A;  4YH2 A;  1AQX A;  5F8B A;  2GS3 A;  4LA1 A;  3VLN A;  4JED A;  4MJA A;  1R26 A;  3QFB C;  2EIQ A;  3F8U A;  2YWN A;  5KN2 A;  1SKR B;  2MMA A;  2QC7 A;  3EU4 A;  2VO4 A;  1RQM A;  2MBT A;  5KN0 A;  4G2E A;  1GSD A;  1WJK A;  1V98 A;  3APO A;  1VRS D;  3QAV A;  1JZD A;  4POL A;  1R5P A;  3KH9 A;  3CXG A;  2VCQ A;  2HZF A;  2FWF A;  4ZBA A;  1DE1 A;  4EVM A;  3QR6 A;  4BVX A;  3KCM A;  5AIS A;  3BOA A;  2KHP A;  3TKP A;  3GUR A;  2X64 A;  3P7X A;  1BG5 A;  2HXK A;  4POK A;  3ZML A;  2CA8 A;  1BED A;  2DJ3 A;  3KMO A;  2MYG A;  2PER A;  5IO0 A;  3GX8 A;  3TRX A;  2HZE B;  2OA7 A;  1ERW A;  1TU8 A;  1U6T A;  2HRA A;  2EC4 A;  4BWS A;  4KSO A;  2GSQ A;  3M3M A;  4DSQ A;  1NM3 A;  3KP8 A;  1XVQ A;  1B9Y C;  5ELG A;  4RQX A;  4RQR A;  3FKF A;  4POM A;  5CRD A;  3CMI A;  20GS A;  5HFG A;  2V32 A;  2XBQ A;  4K0N A;  2B5E A;  3ED3 A;  2NPB A;  1MDI A;  2HSH A;  2X99 A;  2GZZ A;  3BBY A;  6GSS A;  1TI1 A;  5G1K A;  2DJ1 A;  3DKS A;  2MBS A;  4KDU A;  1PL2 A;  5D93 A;  2B1L A;  4TOP A;  13GS A;  1EOG A;  3TRP A;  2PUK C;  2H0G A;  3LG6 A;  1HQO A;  4KH7 A;  4BVY B;  2L59 A;  4K0G A;  4TXO B;  3QCP A;  4IVF A;  2E7P A;  5F06 A;  4PUA A;  2PMT A;  2LRC A;  2JAC A;  4HU7 A;  3HHV A;  1M2B A;  3I6A A;  3DIE A;  2B7K A;  3TKS A;  6GST A;  1YY7 A;  2R2J A;  5J41 A;  3M9K A;  1ERV A;  3D4M A;  2PWJ A;  2WCI A;  5LCZ A;  2GQL A;  4JZQ A;  3E0U A;  3GKM A;  2GT6 A;  5J9C A;  2OAD A;  3ERF A;  1X9S B;  2DC5 A;  1B48 A;  1C72 A;  4KE3 A;  1R5A A;  1RW1 A;  4OCF A;  4MDC A;  5H5Q A;  5D96 A;  2CZ2 A;  4NHZ A;  4XIH A;  1NW2 A;  3KIJ A;  1PKW A;  1Z9H A;  2WDU A;  9GSS A;  2C8U A;  3ZFL A;  1W4V A;  5CAX A;  2V2G A;  2QKE A;  3FR9 A;  4MF7 A;  2HE3 A;  5AN1 A;  4L0U A;  2VLV A;  3UIW A;  5GZZ B;  4K2D A;  1ML6 A;  5A4W A;  5D9W A;  5DQS A;  2C0F A;  4RUV A;  10GS A;  3HY2 A;  4WF5 A;  3GRX A;  4OO5 A;  1THO A;  2UZ8 A;  4O32 A;  1KNG A;  2H71 A;  1A8Y A;  1DUG A;  2HLS A;  2OAC A;  3I43 A;  4EDY A;  5LD0 A;  3ZIT A;  4YQU A;  3O6T A;  1GSS A;  1YKC A;  5IMD A;  2IMI A;  3C7M A;  3GNJ A;  5KEJ A;  1YF1 A;  5G5E A;  1URM A;  2JZS A;  2YZU A;  4I8B A;  4JE1 A;  1M9B A;  1Z7P A;  1QUW A;  3HXS A;  3KMN A;  4AJ8 A;  1N2A A;  4MA9 A;  1GSE A;  2CVD A;  2B5Y A;  4OFM A;  4F9Z A;  2IPA A;  5DCH A;  4HZ4 A;  1UN2 A;  3TKS E;  1ABA A;  3RHC A;  2LST A;  4WR4 A;  1MD4 A;  2ON5 A;  1G7E A;  5A5K A;  1SYX A;  1B9X C;  3ME7 A;  4MK3 A;  4IP6 A;  3F3Q A;  7GSS A;  2R37 A;  3UOM A;  2FLS A;  3M9J A;  2XC2 A;  1QFN A;  4WBJ A;  4E8H A;  3W8J A;  2AV4 A;  3RAZ A;  5E4W A;  4WBR D;  22GS A;  2FWG A;  1O6J A;  3KTB A;  3G9B A;  1OKT A;  1T3B A;  1FW1 A;  2LTK A;  2QGV A;  4MF6 A;  2K6V A;  1CQH A;  2N5F A;  3Q74 A;  1JZR A;  1K0D A;  4TRX A;  4OFT A;  3FR6 A;  1YEP A;  2RM6 A;  1JHB A;  3S9F A;  1X5C A;  1XPV A;  2MZC A;  3IXR A;  3SBC A;  2TRX A;  2VIM A;  2F9S A;  3VI5 A;  2AAW A;  1GSQ A;  3GA4 A;  5A4U A;  1O8W A;  1SK2 A;  2C80 A;  4ZB8 A;  1WMJ A;  2O7K A;  4KAE A;  2I81 A;  4MCU A;  1HYU A;  2GQM A;  4ID0 A;  4DVC A;  3TGZ A;  5DBQ A;  1V57 A;  2GSR A;  3BD2 A;  4KA0 A;  1S3D A;  3VWX A;  1JLW A;  2HSM A;  2X8H A;  3IOS A;  2V6O A;  2YAN A;  3U5R E;  3GST A;  3WGX A;  1PN9 A;  4N11 A;  2VM1 A;  1SK1 A;  4HS1 A;  4V1A g;  3A5W A;  1VF2 A;  2DIY A;  4ACS A;  4Q5R A;  1QK8 A;  2WRT A;  4YQM A;  3UAP A;  5CRW A;  2J23 A;  5IO2 A;  3TJK A;  1LBK A;  3GH6 A;  2B7J A;  11GS A;  5ECN B;  2CZ3 A;  3WT2 A;  1KEB A;  2HYX A;  3GSS A;  2FNO A;  2NDO A;  5J3R A;  2IFQ B;  2YJ7 A;  1VF1 A;  5F0G A;  4PXO A;  5D73 A;  3QAW A;  3LGC A;  2RUE A;  4XTS A;  1BJX A;  3GIX A;  2KP2 A;  4GTU A;  3GTU A;  5ID2 B;  2PVQ A;  1M9A A;  1K3O A;  4ZXG A;  4KCE A;  4J2F A;  5ENU A;  14GS A;  2LKU A;  3P8W A;  4MAB A;  1A0R P;  4ZL7 A;  4ISD A;  3D21 A;  5G30 A;  1F37 A;  1F3B A;  2VCT A;  3EMP A;  4IKH A;  2FUG 2;  3L78 A;  2HSM B;  1G6W A;  1FOV A;  3L9U A;  1GTA A;  1ZZY A;  3GX0 A;  3E9J B;  5L71 A;  4OMV A;  2CX4 A;  3LXT A;  1VGL A;  3PGT A;  1T00 A;  1SD9 A;  4D73 A;  3R3E A;  2H74 A;  3MNG A;  3UMA A;  4WXT A;  1KTE A;  4ECB A;  1M7T A;  1V9W A;  1G7O A;  1GWC A;  3GH9 A;  1AW9 A;  4PGT A;  2C0G A;  1SYR A;  2ES7 A;  3FRC A;  2XBI A;  1B4P A;  5GAP D;  5B8A A;  1GTU A;  3DYR A;  4BA7 A;  4G9H A;  1Z5Y E;  4HJ2 A;  3GV1 A;  5DDL A;  5CYY A;  2L57 A;  3PIN A;  5DQY A;  3TRQ A;  1A2J A;  1UVZ A;  1XOB A;  4TW5 A;  1R4W A;  3VUR A;  4X1U A;  4XRD A;  4L5L A;  3KM6 A;  3DGQ A;  4ZB6 A;  4ZL8 A;  4MP4 A;  2R5G A;  4HQS A;  2C3Q A;  4PQI A;  5HQP A;  2YCD A;  3HYP A;  4G0K A;  1X9W B;  2J9H A;  2HNL A;  4XS1 A;  2IWT A;  3MDK A;  2B1K A;  4X0X A;  4NXI A;  5ABR A;  4TR1 B;  3N5O A;  1EZK A;  2A2R A;  1PKZ A;  2TRC P;  5CRH A;  3NZN A;  4WET A;  3AY8 A;  2C4J A;  2PVO C;  4EXJ A;  3GN3 A;  1TTZ A;  3TKR A;  4KDX A;  1MEK A;  2LJK A;  1Y6E A;  3IAM 2;  5GAN D;  5D9X A;  4ML6 A;  1K0B A;  1XVW A;  2AYT A;  4EO3 A;  1MTC A;  1HNC A;  3GKK A;  3M8N A;  1I5G A;  3F4R A;  1AQW A;  2IMK A;  5ECL B;  4AF2 A;  1E2Y A;  3ME8 A;  2H76 A;  3PR8 A;  4EE0 A;  1S3C A;  5DAL A;  5F05 A;  4TVE A;  2HSY A;  3LYK A;  4ZBB A;  3VI7 A;  3HCZ A;  2ZCT A;  3H4K A;  2R3X A;  1WE0 A;  5INY A;  5JCW A;  1OE8 A;  4PQH A;  3QMX A;  3KH7 A;  3L0H A;  2K8S A;  1EP8 A;  4ECI A;  2R6K A;  2O85 A;  4QQ7 A;  3MSZ A;  2VCW A;  1T8E B;  4BWQ A;  1FVK A;  1HD2 A;  4K6X A;  4TN8 A;  4G19 A;  4K8M A;  3C8E A;  3EVI A;  2A4V A;  1UC7 A;  4RI7 A;  5KN1 A;  2H73 A;  3FZ5 A;  1EEM A;  3RPP A;  1O81 A;  2G2Q A;  4ZB9 A;  3BJ5 A;  2Z9S A;  4TR4 A;  5ECS A;  4GSN A;  1TKD B;  3SWL A;  2P31 A;  4ULX A;  3LXZ A;  2DJJ A;  4K7N A;  1PX7 A;  5DJL A;  2PU9 C;  2C3T A;  2KUC A;  3APQ A;  3A3T A;  4BVX B;  2JSZ A;  5DJM A;  4PNG A;  3FHK A;  3HVS A;  4F82 A;  3L9S A;  2REM A;  5DAL B;  3EYT A;  6GSU A;  4FYC A;  19GS A;  1FG4 A;  3PH9 A;  3U6V A;  2WB9 A;  3DML A;  2WGR A;  4WF4 A;  2K8V A;  1GSU A;  4MZW A;  2H6X A;  2LQO A;  4OO4 A;  2F8F A;  5G31 A;  1E6B A;  1F6M C;  4Q5N A;  1XWA A;  1WP0 A;  3KJY A;  2VM2 A;  1PL1 A;  5IOW A;  3VPQ A;  4MZC A;  3CTF A;  4FIW A;  3F0I A;  4OD7 A;  1XBS A;  2ON7 A;  1U3I A;  3VPT A;  3RDW A;  2GVP A;  3F3R A;  1B8X A;  2IMD A;  2HRN A;  2H1A A;  3M1G A;  4KF9 A;  1TDI A;  1TU7 A;  1V58 A;  4F03 A;  5HR0 A;  2GDR A;  4HI7 A;  1K0A A;  17GS A;  1M2D A;  4I6X A;  2VL9 A;  1GUL A;  1RK4 A;  3WGE A;  4HQZ A;  1GP1 A;  2OE1 A;  3ISO A;  5C00 A;  4MZB A;  3TDG A;  3IA1 A;  1USB A;  5A4V A;  2I9H A;  4MF5 A;  3TOU A;  3C73 A;  5AGY A;  5ECH B;  1XWC A;  3FZA A;  1ZMA A;  4TR0 A;  1A23 A;  3RHB A;  3CBU A;  3RPN A;  5IPG A;  3D4T A;  3W6G A;  3H93 A;  3FR3 A;  1LU4 A;  4NV5 A;  4N0V A;  3GKN A;  3QPM A;  4FYB A;  1GUM A;  3LSZ A;  2CV4 A;  3ZYW A;  4OWY A;  1OKD A;  4EL1 A;  4HOJ A;  1ZGN A;  5C04 A;  3IBH A;  3D22 A;  4NWY A;  3W8S A;  3UBL A;  1EV4 A;  4G10 A;  2CX3 A;  3C1S A;  4F0B A;  5D8I A;  1TW9 A;  4EUY A;  1SJZ A;  3HD5 A;  5HFK A;  3FYG A;  2FD3 A;  1GLQ A;  4MPG A;  5AIX A;  1K0C A;  5EVO A;  4USS A;  3TOT A;  2VLT A;  4HJM A;  3DWV A;  1TI3 A;  4GSS A;  4J57 E;  5EL8 A;  5JWR B;  3TUE A;  1QQ2 A;  4ILF A;  3US3 A;  3KEB A;  2JL4 A; 
#chains in the Genus database with same CATH topology
 3FEU A;  5ECP B;  3IPZ A;  3JCM L;  5ECQ B;  1FVJ A;  4E8E A;  5CO3 A;  6GSY A;  4ECC A;  1TK5 B;  2C3N A;  1TRU A;  3HJP A;  3Q18 A;  4CDO A;  5JWO B;  1U87 A;  1ZYN A;  2GGT A;  2CT6 A;  2JZR A;  3KD0 A;  1ST9 A;  5KN3 A;  2DKI A;  1PRX A;  4GF0 A;  2VL2 A;  4LLR A;  1H4O A;  2GZP A;  3LYP A;  2BJX A;  4PNF A;  2DKH A;  1YQ1 A;  4P3Y B;  4Z2R A;  16GS A;  3PPU A;  5H5R A;  2KLX A;  3NOF A;  3DD3 A;  4MLY A;  3UAR A;  2VL3 A;  3QDN A;  1J0F A;  4ZIJ A;  4GQC A;  2VUP A;  2OE0 A;  5ECI B;  2YN1 A;  3DXB A;  3HKR A;  1GH2 A;  3LFL A;  1FAA A;  2CVK A;  3UVH A;  4EDZ A;  1WWJ A;  4L0W A;  1OVN A;  1M2A A;  2VLU A;  1X9M B;  1PGT A;  1N8J A;  2IIY A;  3H8Q A;  4K2X A;  4KGI A;  3TJF A;  1M0U A;  1U88 A;  4XS6 A;  1SL0 B;  1XXU A;  1Y25 A;  5J40 A;  4LMW A;  3A2W A;  4ZIL A;  1SL2 B;  3UL3 A;  2L4C A;  3IV4 A;  6GSV A;  3WT1 A;  1Z3E A;  2YZH A;  4TR3 A;  2IME A;  3TJB A;  4EIP A;  1EGR A;  3BCK A;  5J4U A;  4IJ3 A;  1TJD A;  5DCG A;  2YJH A;  5DAK A;  3RBT A;  2YOI A;  4GQF A;  3CSJ A;  3A2V A;  18GS A;  3UBK A;  3F63 A;  1W89 A;  4MH2 A;  1K3Y A;  2KP1 A;  3G7Y A;  3QD9 A;  4Z7X A;  3QAG A;  1GUK A;  2RM5 A;  2TIR A;  3R2Q A;  2H1G A;  2V1M A;  1PSQ A;  2IN3 A;  4NPB A;  3VWU A;  4F0C A;  1YVL A;  5FHI A;  1GSF A;  1TP9 A;  5H5S A;  3GYK A;  1A0F A;  1O85 A;  1K3L A;  3ERG A;  4IHU A;  1SU9 A;  3FY7 A;  3DVW A;  4CW9 A;  3FW2 A;  4MPF A;  2EIO A;  2YWI A;  3TB2 A;  2WW2 A;  1Z6N A;  3HVN A;  2L5O A;  5AIV A;  2LEG A;  1OE7 A;  2RUF A;  1T4Z A;  5IOX A;  3EIN A;  2HI7 A;  1ZCP A;  2QSI A;  2E2M A;  4HUA A;  4MH3 A;  4DEJ A;  1IYH A;  3HA9 A;  1EV9 A;  5JCU A;  3GMF A;  2DBC A;  3O3T A;  3WGD A;  4OFN A;  3CYN A;  4XRA A;  1GTI A;  3IK9 A;  2BMX A;  1ILO A;  1XZO A;  2DIZ A;  5DAK B;  2EFC A;  2E0Q A;  3IR4 A;  4HZ2 A;  2R0P A;  3GL3 A;  1QGV A;  1B4Q A;  4MJE A;  2H1D A;  3HVV A;  2D2Z A;  1ERU A;  2GT5 A;  5GSS A;  2DML A;  1S4B P;  4Z2U A;  2PBJ A;  1XWG A;  3EWL A;  3P90 A;  1EP7 A;  2HQT A;  4N0Z A;  2MMZ A;  4AI6 A;  1PD2 1;  2LJA A;  3LEF A;  3FK8 A;  5B8B A;  3F6F A;  3ZMK A;  4K9Z A;  4GRF A;  4AKI A;  1Z7R A;  3GTU B;  3FZ4 A;  2XPD A;  2O87 A;  1AIU A;  4GWR A;  1BQ7 A;  2VCZ A;  4GDF A;  2LRT A;  4YAV A;  2PPT A;  3A5I A;  5HR2 A;  2X8G A;  4LL4 B;  2C0D A;  1A2M A;  4WEY A;  4L8E A;  3IDV A;  3FZ9 A;  2I1U A;  4HEA 2;  5FT3 A;  2AB6 A;  2DJ2 A;  4YAP A;  4NHW A;  1EEJ A;  2R0C A;  3V1W A;  1NHO A;  3HJM A;  2O5V A;  1FB6 A;  4XCS A;  4Q5F A;  4D73 B;  2HZE A;  1U3A A;  4LMV A;  4PTS A;  3P2A A;  4IS0 A;  1IYI A;  1XWB A;  5HR3 A;  4KDY A;  1GTB A;  3KP9 A;  1ACV A;  4E68 A;  1Z6M A;  4NV2 A;  4ZL9 A;  4V2L A;  3KXO A;  2L4Q A;  2ZNM A;  5EPF A;  5IMF A;  4H86 A;  2H8L A;  5GST A;  3MIX A;  1TRS A;  1V2A A;  3KZQ A;  1M99 A;  1X5D A;  2VL2 C;  3G7J A;  1TXX A;  2AHE A;  3ERW A;  2OBI A;  2GLR A;  1H75 A;  2JZT A;  4GCI A;  4EC0 A;  1WRY A;  1FO5 A;  4F2I A;  2LJR A;  1XIY A;  2GQK A;  5JWQ B;  4EF0 A;  2EFD A;  3A2X A;  2DJ0 A;  2DMM A;  5B6N A;  1SJ6 A;  4FH8 A;  4BVY A;  4X43 A;  4XHM A;  1HNA A;  3I69 A;  5A1N B;  4G0L A;  4FYU A;  3CRT A;  2AUV A;  1F3A A;  2MMO A;  3NIV A;  1XW5 A;  2H0I A;  5ECO B;  4GLT A;  4TXO A;  4JU5 A;  1DBY A;  4K7O A;  4CHS A;  1K0O A;  2P0G A;  3CHX C;  4N30 A;  2WVX A;  4I2U A;  3K8N A;  5EY6 A;  2XPE A;  4A5P A;  3APS A;  1YJ6 A;  5B7C A;  2NVL A;  2WUL A;  3IC4 A;  5D9V A;  2F3M A;  4NMU A;  2HT9 A;  3WYW A;  3C71 A;  2CQ9 A;  2VKZ G;  3C1R A;  3TJJ A;  3D0Z A;  2EIR A;  1Q4J A;  5D9T A;  1JLV A;  2DJK A;  3N9J A;  4IP1 A;  4O5R A;  3TCO A;  1JFU A;  2LUS A;  4OCE A;  3GUS A;  3LOR A;  4AGS A;  2A2S A;  5A5H A;  2FA8 A;  4O7H A;  3EE2 A;  1YEX A;  1AC1 A;  3L9V A;  3HJO A;  2N5A A;  2IJY A;  3F9U A;  1O7U A;  4FXY P;  3VWW A;  4HU9 A;  4AKG A;  3H1N A;  2H72 A;  2WS2 A;  1WPI A;  1GUH A;  1GNE A;  3DRN A;  1FB0 A;  2DSA A;  8GSS A;  4RI6 A;  2YNX A;  4GST A;  2CVB A;  5BRT A;  1VF4 A;  4IEL A;  2WVX B;  1Q98 A;  4BL7 A;  3O76 A;  1A8L A;  5J4V A;  3GL5 A;  4HSC X;  4EKZ A;  1OC9 A;  1SKW B;  1ERT A;  5JCG A;  3L4N A;  1MDK A;  3DEX A;  1TK8 B;  12GS A;  3OR5 A;  2NTO A;  1YF0 A;  4JR4 A;  3EC3 A;  4QL9 A;  1R7H A;  5IMZ A;  5J4Y A;  4O92 A;  2N5B A;  5KOW A;  1BX9 A;  4O5Q A;  2C1Y A;  2JAD A;  3EMX A;  2RLI A;  2GSS A;  1SK0 A;  2F8A A;  4TXV A;  4KX4 A;  2L6C A;  2YWO A;  4IJI A;  4BPY A;  1GNW A;  3F6D A;  2WZS A;  4IGJ A;  3EPT A;  4WR5 A;  4FQU A;  1ZL9 A;  5A5H B;  3CTG A;  1FHE A;  2DLX A;  1A2L A;  3HZ8 A;  2H75 A;  1SJI A;  2LNT A;  4QL7 A;  3GKX A;  3GFK A;  5IM9 A;  1XW6 A;  2RII A;  2H30 A;  4DSS A;  2OE3 A;  5F07 A;  2OKA A;  5ECR B;  5IMC A;  4IW9 A;  5G2Z A;  2JSY A;  2WZ9 A;  5ELA A;  5FWG A;  1GRX A;  1THX A;  4L5O A;  4K5S A;  2I3Y A;  2ZUP A;  2VD0 A;  2E2G A;  4V2N A;  1XFL A;  4PX1 A;  4BL7 B;  2EFE A;  1OC9 B;  2NBS A;  2R4V A;  2F51 A;  4Q5Q A;  2YV9 A;  2CAQ A;  3QOU A;  6GSX A;  3ZLP A;  3ZIV A;  2PN8 A;  2FCH A;  5IIZ A;  1KBN A;  4PUR A;  4K1F A;  1S3A A;  2BTO T;  1ON4 A;  3ZL5 A;  2VCV A;  3VFI A;  1ZOF A;  2O89 A;  3CSI A;  1J9B A;  2LRN A;  4Z2T A;  4MJC A;  4MJB A;  5DVB A;  1MD3 A;  3EU3 A;  1AUC A;  1G6Y A;  3VWV A;  4V2M A;  4POB A;  1X5E A;  4LL1 B;  3LJR A;  3BCI A;  3Q6O A;  3CRU A;  4DSS B;  4IBP A;  2H6Y A;  2FA4 A;  5ECM B;  1YEW C;  5HR1 A;  2HSN B;  1PQN A;  4XS4 A;  1WOU A;  3WD6 A;  2LS5 A;  5HFI A;  1SEN A;  2O8V B;  3ZVJ D;  1O8X A;  1YDK A;  1OC8 A;  1SKS B;  1QXH A;  1TOF A;  3UJ1 A;  2YPM A;  2H19 A;  4I5Q A;  2H0H A;  1DE2 A;  2MMN A;  3F4T A;  2C0E A;  2CAI A;  3MAK A;  3KGK A;  3VK9 A;  1SL1 B;  2IMF A;  4KSM A;  2M46 A;  4IN0 A;  2VD1 A;  4KUN A;  1G0T A;  1YKA A;  1JZO A;  2H1B A;  2LV3 A;  3UVT A;  4KW6 A;  1X0R A;  3GHA A;  1MDJ A;  2HFD A;  4PUF C;  4PQ1 A;  5CP1 A;  5IMV A;  5IQY A;  2R0G A;  2YV7 A;  4HDE A;  1J08 A;  5B6M A;  3TJG A;  3HMJ G;  3DVX A;  2I4A A;  2WJU A;  1HNB A;  4V1A p;  1EOH A;  4MMM A;  2IFQ A;  1OC3 A;  5CRE A;  3IRA A;  1S3R A;  1O73 A;  3EUR A;  1DSB A;  5E59 A;  2O3E A;  2VCX A;  3F4S A;  1T4Y A;  1K0M A;  3TKQ A;  3CWG A;  4I2T A;  2A4H A;  5ID2 A;  1TRW A;  4XS4 B;  2LQQ A;  5BMU A;  2HRK A;  5IMA A;  2GST A;  3E3E A;  5J5N A;  5CRG A;  2O36 A;  2YP6 A;  2WFC A;  1AAZ A;  2FWE A;  5LNK e;  3HVX A;  3J7Y k;  4KCA A;  1LJR A;  1ZYE A;  2YWM A;  2H6Z A;  2AJQ B;  2LNS A;  3IK7 A;  4IQ1 A;  2GZY A;  4AJ7 A;  1NHY A;  1XCC A;  1TRV A;  4JR6 A;  1VF3 A;  1EGO A;  2X8C A;  2H66 A;  4N10 A;  2XHF A;  3LWA A;  1GL8 A;  2FHE A;  1A24 A;  2FY6 A;  3H79 A;  3IE3 A;  4DSR A;  2B3S A;  3ZTL A;  3ZRD A;  1GSY A;  2H70 A;  1AXD A;  2OT3 A;  3TKS C;  1PA3 A;  1TK0 B;  3IC8 A;  3Q19 A;  4JBB A;  2PGT A;  5CNW A;  1BYE A;  4WKW A;  1GLP A;  4ECJ A;  5G1L A;  5IPH A;  4YKG A;  3LQ7 A;  1XG8 A;  1EWX A;  2P5Q A;  5BMU B;  4FO5 A;  4ZB7 A;  1T7P B;  2B5X A;  2GTU A;  2HRK B;  1XWK A;  1M3J A;  4KND A;  1JZW A;  4TR1 A;  3HDC A;  2HRF A;  2VOC A;  2KOK A;  3J7Y b;  4ZBD A;  1PMT A;  3ZIJ A;  5G5F A;  1PX6 A;  2V6K A;  2K18 A;  6GSW A;  2H01 A;  3D5J A;  2OBK A;  2M72 A;  5ECK B;  1K0N A;  3G7I A;  1ZYQ B;  4YQV A;  3HZ4 A;  1FOH A;  2K9F A;  4ML1 A;  3UEM A;  3M0F A;  1AQV A;  4J56 E;  4JRR A;  1XW9 A;  5J9B A;  1I9D A;  4GXZ A;  2L6D A;  2IL3 A;  2M80 A;  3ZZX A;  2ALB A;  1NSW A;  3ZFB A;  1SD8 A;  1T1V A;  3I9V 2;  3KTL A;  1CQG A;  2L5L A;  2X4A A;  1UA5 A;  2WVY A;  4AJ6 A;  3IAS 2;  4G0I A;  5COH A;  1OAZ A;  3ZRE A;  2G0F A;  2P5R A;  2OJL A;  1QMV A;  2JU5 A;  1V40 A;  1F2E A;  1WIK A;  4O5U A;  1OYJ A;  4K7I A;  3CSH A;  2FGX A;  3ZVJ A;  1F9M A;  4IQA A;  2VAF A;  1BAY A;  3QFA C;  3D6I A;  3IHQ A;  2B6M A;  1XOA A;  2V41 A;  4KB3 A;  1YZX A;  3MWH A;  4TKY A;  4NAX A;  4I97 A;  2FWH A;  4YH2 A;  1AQX A;  5F8B A;  2GS3 A;  4LA1 A;  3VLN A;  4JED A;  4AKH A;  4MJA A;  1R26 A;  3QFB C;  2EIQ A;  3F8U A;  2YWN A;  5KN2 A;  1SKR B;  2MMA A;  2QC7 A;  3EU4 A;  2VO4 A;  1RQM A;  2MBT A;  5KN0 A;  4G2E A;  1GSD A;  1WJK A;  1V98 A;  3APO A;  1VRS D;  3QAV A;  1JZD A;  4POL A;  1R5P A;  3KH9 A;  3CXG A;  2VCQ A;  2HZF A;  2FWF A;  4ZBA A;  1DE1 A;  4EVM A;  2QA1 A;  3QR6 A;  4BVX A;  3KCM A;  5AIS A;  3BOA A;  2KHP A;  3TKP A;  3GUR A;  2X64 A;  3P7X A;  1BG5 A;  2HXK A;  4POK A;  3ZML A;  3IHG A;  2CA8 A;  1BED A;  2DJ3 A;  3KMO A;  2MYG A;  2PER A;  5KOX A;  5IO0 A;  3GX8 A;  3TRX A;  2HZE B;  5J47 A;  2OA7 A;  1ERW A;  1TU8 A;  1U6T A;  2HRA A;  2EC4 A;  4BWS A;  4KSO A;  2GSQ A;  3M3M A;  4DSQ A;  1NM3 A;  3FMW A;  3KP8 A;  1XVQ A;  1B9Y C;  5ELG A;  4RQX A;  4RQR A;  3FKF A;  4POM A;  5CRD A;  3CMI A;  20GS A;  5HFG A;  2V32 A;  2XBQ A;  4K0N A;  2B5E A;  3ED3 A;  2NPB A;  1MDI A;  2HSH A;  2X99 A;  2GZZ A;  3BBY A;  6GSS A;  1TI1 A;  5G1K A;  2DJ1 A;  3DKS A;  2MBS A;  4KDU A;  1PL2 A;  5D93 A;  2B1L A;  4TOP A;  13GS A;  1EOG A;  3TRP A;  4PI2 C;  2PUK C;  2H0G A;  3LG6 A;  1HQO A;  4KH7 A;  4BVY B;  2L59 A;  4K0G A;  4TXO B;  3QCP A;  4IVF A;  2E7P A;  5F06 A;  4PUA A;  2PMT A;  2LRC A;  4ICY A;  2JAC A;  4HU7 A;  3HHV A;  1M2B A;  3I6A A;  3DIE A;  2B7K A;  3TKS A;  6GST A;  1YY7 A;  2R2J A;  5J41 A;  3M9K A;  1ERV A;  3D4M A;  2PWJ A;  2WCI A;  5LCZ A;  2GQL A;  4JZQ A;  3E0U A;  3GKM A;  2GT6 A;  5J9C A;  2OAD A;  3ERF A;  1X9S B;  2DC5 A;  1B48 A;  1C72 A;  4KE3 A;  1R5A A;  1RW1 A;  2X49 A;  4K5R A;  4OCF A;  4MDC A;  5H5Q A;  5D96 A;  2CZ2 A;  4NHZ A;  4XIH A;  1NW2 A;  3KIJ A;  1PKW A;  1Z9H A;  2WDU A;  9GSS A;  2C8U A;  3ZFL A;  1W4V A;  5CAX A;  4MNN A;  2V2G A;  3RFR C;  2QKE A;  3FR9 A;  4MF7 A;  2HE3 A;  5AN1 A;  4L0U A;  2VLV A;  3UIW A;  5GZZ B;  4K2D A;  1ML6 A;  5A4W A;  5D9W A;  5DQS A;  2C0F A;  4RUV A;  10GS A;  3HY2 A;  4WF5 A;  3GRX A;  4OO5 A;  1THO A;  2UZ8 A;  4O32 A;  1KNG A;  2H71 A;  1A8Y A;  1DUG A;  3LW9 A;  2HLS A;  2OAC A;  3I43 A;  4EDY A;  5LD0 A;  3ZIT A;  4YQU A;  3O6T A;  1GSS A;  1YKC A;  5IMD A;  2IMI A;  3C7M A;  3GNJ A;  5KEJ A;  1YF1 A;  4PI0 C;  5G5E A;  1URM A;  2JZS A;  2YZU A;  4I8B A;  4JE1 A;  1M9B A;  1Z7P A;  1QUW A;  3HXS A;  3KMN A;  4AJ8 A;  1N2A A;  4MA9 A;  1GSE A;  2CVD A;  2B5Y A;  4OFM A;  4F9Z A;  2IPA A;  5DCH A;  4HZ4 A;  1UN2 A;  3TKS E;  1ABA A;  3RHC A;  2LST A;  4WR4 A;  1MD4 A;  2ON5 A;  1G7E A;  5A5K A;  1SYX A;  1B9X C;  3ME7 A;  4MK3 A;  4IP6 A;  3F3Q A;  7GSS A;  2R37 A;  3UOM A;  2FLS A;  2XC2 A;  3M9J A;  1QFN A;  4WBJ A;  4E8H A;  3W8J A;  2AV4 A;  3RAZ A;  4N3Z A;  5E4W A;  4WBR D;  22GS A;  2FWG A;  1O6J A;  3KTB A;  3G9B A;  1OKT A;  1T3B A;  1FW1 A;  2LTK A;  2QGV A;  4MF6 A;  2K6V A;  1CQH A;  2N5F A;  3Q74 A;  1JZR A;  1K0D A;  4TRX A;  4OFT A;  3FR6 A;  1YEP A;  2RM6 A;  1JHB A;  3S9F A;  1X5C A;  1XPV A;  2MZC A;  3IXR A;  3SBC A;  2TRX A;  2VIM A;  2F9S A;  3VI5 A;  2AAW A;  1GSQ A;  3GA4 A;  5A4U A;  1O8W A;  5A34 A;  1SK2 A;  2C80 A;  4ZB8 A;  1WMJ A;  2O7K A;  4KAE A;  2I81 A;  4MCU A;  1HYU A;  2GQM A;  1SVO A;  4ID0 A;  4BIK A;  4DVC A;  3TGZ A;  5DBQ A;  1V57 A;  2GSR A;  3BD2 A;  4KA0 A;  1S3D A;  3VWX A;  1JLW A;  1PFO A;  2HSM A;  2X8H A;  3IOS A;  2V6O A;  2YAN A;  3U5R E;  3GST A;  3WGX A;  1PN9 A;  4N11 A;  2VM1 A;  1SK1 A;  4HS1 A;  4V1A g;  3A5W A;  1VF2 A;  2DIY A;  4ACS A;  4Q5R A;  1QK8 A;  2WRT A;  4YQM A;  3UAP A;  5CRW A;  2J23 A;  5IO2 A;  3TJK A;  1LBK A;  3GH6 A;  2B7J A;  11GS A;  5ECN B;  2CZ3 A;  3WT2 A;  1KEB A;  2HYX A;  3GSS A;  2FNO A;  2NDO A;  5J3R A;  2IFQ B;  2YJ7 A;  1VF1 A;  5F0G A;  1BG1 A;  1SVM A;  4PXO A;  2QA2 A;  1Y1U A;  5D73 A;  3QAW A;  3LGC A;  5A34 B;  2RUE A;  4XTS A;  1BJX A;  3GIX A;  2KP2 A;  4GTU A;  3GTU A;  5ID2 B;  2PVQ A;  1M9A A;  1K3O A;  4ZXG A;  4KCE A;  4J2F A;  5ENU A;  14GS A;  2LKU A;  3P8W A;  4CY6 A;  4MAB A;  1A0R P;  4ZL7 A;  4ISD A;  3D21 A;  5G30 A;  1F37 A;  1F3B A;  2VCT A;  3EMP A;  4IKH A;  2FUG 2;  3L78 A;  2HSM B;  1G6W A;  1FOV A;  3L9U A;  1GTA A;  1ZZY A;  3GX0 A;  3E9J B;  5L71 A;  4OMV A;  2CX4 A;  3LXT A;  1VGL A;  3PGT A;  1T00 A;  1SD9 A;  4D73 A;  3R3E A;  2H74 A;  3MNG A;  3UMA A;  4WXT A;  1KTE A;  4ECB A;  1M7T A;  1V9W A;  1G7O A;  2WW1 A;  1GWC A;  3GH9 A;  1AW9 A;  4PGT A;  2C0G A;  1SYR A;  2ES7 A;  3FRC A;  2XBI A;  1B4P A;  5GAP D;  4X4J A;  5B8A A;  1GTU A;  3DYR A;  4BA7 A;  4G9H A;  1Z5Y E;  4HJ2 A;  3GV1 A;  5DDL A;  5CYY A;  2L57 A;  3PIN A;  5DQY A;  3TRQ A;  3CQF A;  1A2J A;  1UVZ A;  1XOB A;  4TW5 A;  1R4W A;  3VUR A;  4X1U A;  4XRD A;  4L5L A;  3KM6 A;  3DGQ A;  4QMK A;  4YKF A;  4ZB6 A;  1ZYP A;  4ZL8 A;  1TXU A;  4MP4 A;  2R5G A;  4HQS A;  2C3Q A;  4PQI A;  5HQP A;  2YCD A;  3HYP A;  4G0K A;  1X9W B;  5A1N A;  2J9H A;  2HNL A;  4XS1 A;  2IWT A;  3MDK A;  2B1K A;  4X0X A;  4NXI A;  5ABR A;  4TR1 B;  3N5O A;  1EZK A;  2A2R A;  1PKZ A;  2TRC P;  5CRH A;  3NZN A;  4WET A;  3AY8 A;  2C4J A;  2PVO C;  4EXJ A;  4AKX B;  3GN3 A;  1TTZ A;  3TKR A;  2EFH A;  4KDX A;  1MEK A;  2LJK A;  1Y6E A;  3IAM 2;  5GAN D;  4G01 A;  5D9X A;  4ML6 A;  1K0B A;  1XVW A;  2AYT A;  4EO3 A;  1MTC A;  1HNC A;  3GKK A;  3M8N A;  1I5G A;  3F4R A;  1AQW A;  2IMK A;  2A2P A;  5ECL B;  4AF2 A;  1E2Y A;  2H1L A;  3ME8 A;  4PHZ C;  2H76 A;  3PR8 A;  4EE0 A;  1S3C A;  5DAL A;  5F05 A;  1PN0 A;  4TVE A;  2HSY A;  3LYK A;  3MYD A;  4ZBB A;  3VI7 A;  3HCZ A;  2ZCT A;  3H4K A;  2R3X A;  1WE0 A;  5INY A;  5JCW A;  1OE8 A;  4PQH A;  3QMX A;  3KH7 A;  3L0H A;  2K8S A;  1EP8 A;  4ECI A;  2R6K A;  2O85 A;  4QQ7 A;  3MSZ A;  2VCW A;  1T8E B;  4BWQ A;  1FVK A;  1HD2 A;  4K6X A;  4TN8 A;  4G19 A;  4K8M A;  3C8E A;  3EVI A;  2A4V A;  1UC7 A;  4RI7 A;  5KN1 A;  2H73 A;  3FZ5 A;  1EEM A;  3RPP A;  1O81 A;  2G2Q A;  4ZB9 A;  3BJ5 A;  2Z9S A;  1M3I A;  4TR4 A;  5ECS A;  4GSN A;  1TKD B;  3SWL A;  2P31 A;  4ULX A;  3LXZ A;  2DJJ A;  4K7N A;  1PX7 A;  5DJL A;  2PU9 C;  2C3T A;  3RGB C;  2KUC A;  3A3T A;  3APQ A;  4BVX B;  2JSZ A;  5DJM A;  4PNG A;  1BF5 A;  3FHK A;  2WW3 A;  3HVS A;  4F82 A;  3L9S A;  2REM A;  5DAL B;  3EYT A;  4CY8 A;  6GSU A;  4FYC A;  2UV8 G;  19GS A;  1FG4 A;  3PH9 A;  3U6V A;  2WB9 A;  3DML A;  2WGR A;  1SVL A;  4WF4 A;  2K8V A;  1GSU A;  4MZW A;  2H6X A;  2LQO A;  4OO4 A;  2F8F A;  5G31 A;  1E6B A;  2WW0 A;  1F6M C;  4Q5N A;  1XWA A;  1WP0 A;  3KJY A;  2VM2 A;  1PL1 A;  5IOW A;  3VPQ A;  4MZC A;  3CTF A;  4FIW A;  3F0I A;  4OD7 A;  1XBS A;  2ON7 A;  1U3I A;  3VPT A;  3RDW A;  2GVP A;  3F3R A;  1B8X A;  2IMD A;  2HRN A;  2H1A A;  3M1G A;  4KF9 A;  1TDI A;  1TU7 A;  4W66 A;  1V58 A;  4F03 A;  5HR0 A;  2GDR A;  4HI7 A;  1K0A A;  17GS A;  1M2D A;  2VL9 A;  4I6X A;  1GUL A;  1RK4 A;  3WGE A;  4HQZ A;  1GP1 A;  2OE1 A;  3ISO A;  5C00 A;  4MZB A;  3TDG A;  3IA1 A;  1USB A;  5A4V A;  2I9H A;  4MF5 A;  3TOU A;  3C73 A;  5AGY A;  2WVZ A;  5ECH B;  1XWC A;  3FZA A;  1ZMA A;  4TR0 A;  1A23 A;  3RHB A;  3CBU A;  3RPN A;  5IPG A;  3D4T A;  2HSN A;  3W6G A;  3H93 A;  3FR3 A;  1LU4 A;  4NV5 A;  4N0V A;  3GKN A;  3QPM A;  4FYB A;  1GUM A;  3LSZ A;  1N25 A;  2CV4 A;  3ZYW A;  4OWY A;  1OKD A;  4EL1 A;  4HOJ A;  1ZGN A;  5C04 A;  3IBH A;  3D22 A;  4NWY A;  3W8S A;  3UBL A;  1EV4 A;  4G10 A;  2CX3 A;  3C1S A;  4F0B A;  5D8I A;  1TW9 A;  4EUY A;  1SJZ A;  3HD5 A;  5HFK A;  3FYG A;  2FD3 A;  1GLQ A;  4MPG A;  5AIX A;  1K0C A;  5EVO A;  4USS A;  3TOT A;  2VLT A;  3TU3 B;  4HJM A;  1I1I P;  3DWV A;  4EIQ A;  1TI3 A;  4GSS A;  4J57 E;  5EL8 A;  5JWR B;  3TUE A;  1QQ2 A;  4ILF A;  3US3 A;  3KEB A;  2JL4 A; 
#chains in the Genus database with same CATH homology
 3FEU A;  5ECP B;  3IPZ A;  3JCM L;  5ECQ B;  1FVJ A;  4E8E A;  5CO3 A;  6GSY A;  4ECC A;  1TK5 B;  2C3N A;  1TRU A;  3HJP A;  3Q18 A;  4CDO A;  5JWO B;  1U87 A;  1ZYN A;  2GGT A;  2CT6 A;  2JZR A;  3KD0 A;  1ST9 A;  5KN3 A;  2DKI A;  1PRX A;  4GF0 A;  2VL2 A;  4LLR A;  1H4O A;  2GZP A;  3LYP A;  2BJX A;  4PNF A;  2DKH A;  1YQ1 A;  4P3Y B;  4Z2R A;  16GS A;  3PPU A;  5H5R A;  2KLX A;  3NOF A;  3DD3 A;  4MLY A;  3UAR A;  2VL3 A;  3QDN A;  1J0F A;  4ZIJ A;  4GQC A;  2VUP A;  2OE0 A;  5ECI B;  2YN1 A;  3DXB A;  3HKR A;  1GH2 A;  3LFL A;  1FAA A;  2CVK A;  3UVH A;  4EDZ A;  1WWJ A;  4L0W A;  1OVN A;  1M2A A;  2VLU A;  1X9M B;  1PGT A;  1N8J A;  2IIY A;  3H8Q A;  4K2X A;  4KGI A;  3TJF A;  1M0U A;  1U88 A;  4XS6 A;  1SL0 B;  1XXU A;  1Y25 A;  5J40 A;  4LMW A;  3A2W A;  4ZIL A;  1SL2 B;  3UL3 A;  2L4C A;  3IV4 A;  6GSV A;  3WT1 A;  1Z3E A;  2YZH A;  4TR3 A;  2IME A;  3TJB A;  4EIP A;  1EGR A;  3BCK A;  5J4U A;  4IJ3 A;  1TJD A;  5DCG A;  2YJH A;  5DAK A;  3RBT A;  2YOI A;  4GQF A;  3CSJ A;  3A2V A;  18GS A;  3UBK A;  3F63 A;  1W89 A;  4MH2 A;  1K3Y A;  2KP1 A;  3G7Y A;  3QD9 A;  4Z7X A;  3QAG A;  1GUK A;  2RM5 A;  2TIR A;  3R2Q A;  2H1G A;  2V1M A;  1PSQ A;  2IN3 A;  4NPB A;  3VWU A;  4F0C A;  1YVL A;  5FHI A;  1GSF A;  1TP9 A;  5H5S A;  3GYK A;  1A0F A;  1O85 A;  1K3L A;  3ERG A;  4IHU A;  1SU9 A;  3FY7 A;  3DVW A;  4CW9 A;  3FW2 A;  4MPF A;  2EIO A;  2YWI A;  3TB2 A;  1Z6N A;  2L5O A;  5AIV A;  2LEG A;  1OE7 A;  2RUF A;  1T4Z A;  5IOX A;  3EIN A;  2HI7 A;  1ZCP A;  2QSI A;  2E2M A;  4HUA A;  4MH3 A;  4DEJ A;  1IYH A;  3HA9 A;  1EV9 A;  5JCU A;  3GMF A;  2DBC A;  3O3T A;  3WGD A;  4OFN A;  3CYN A;  4XRA A;  1GTI A;  3IK9 A;  2BMX A;  1ILO A;  1XZO A;  2DIZ A;  5DAK B;  2EFC A;  2E0Q A;  3IR4 A;  4HZ2 A;  2R0P A;  3GL3 A;  1QGV A;  1B4Q A;  4MJE A;  2H1D A;  3HVV A;  2D2Z A;  1ERU A;  2GT5 A;  5GSS A;  2DML A;  4Z2U A;  2PBJ A;  1XWG A;  3EWL A;  3P90 A;  1EP7 A;  2HQT A;  4N0Z A;  2MMZ A;  4AI6 A;  1PD2 1;  2LJA A;  3LEF A;  3FK8 A;  5B8B A;  3F6F A;  3ZMK A;  4K9Z A;  4GRF A;  4AKI A;  1Z7R A;  3GTU B;  3FZ4 A;  2XPD A;  2O87 A;  1AIU A;  4GWR A;  1BQ7 A;  2VCZ A;  4GDF A;  2LRT A;  4YAV A;  2PPT A;  3A5I A;  5HR2 A;  2X8G A;  4LL4 B;  2C0D A;  1A2M A;  4WEY A;  4L8E A;  3IDV A;  3FZ9 A;  2I1U A;  4HEA 2;  5FT3 A;  2AB6 A;  2DJ2 A;  4YAP A;  4NHW A;  1EEJ A;  2R0C A;  3V1W A;  1NHO A;  3HJM A;  2O5V A;  1FB6 A;  4XCS A;  4Q5F A;  4D73 B;  2HZE A;  1U3A A;  4LMV A;  4PTS A;  3P2A A;  4IS0 A;  1IYI A;  1XWB A;  5HR3 A;  4KDY A;  1GTB A;  3KP9 A;  1ACV A;  4E68 A;  1Z6M A;  4NV2 A;  4ZL9 A;  4V2L A;  3KXO A;  2L4Q A;  2ZNM A;  5EPF A;  5IMF A;  4H86 A;  2H8L A;  5GST A;  3MIX A;  1TRS A;  1V2A A;  3KZQ A;  1M99 A;  1X5D A;  2VL2 C;  3G7J A;  1TXX A;  2AHE A;  3ERW A;  2OBI A;  2GLR A;  1H75 A;  2JZT A;  4GCI A;  4EC0 A;  1WRY A;  1FO5 A;  4F2I A;  2LJR A;  1XIY A;  2GQK A;  5JWQ B;  4EF0 A;  2EFD A;  3A2X A;  2DJ0 A;  2DMM A;  5B6N A;  1SJ6 A;  4FH8 A;  4BVY A;  4X43 A;  4XHM A;  1HNA A;  3I69 A;  5A1N B;  4G0L A;  4FYU A;  3CRT A;  2AUV A;  1F3A A;  2MMO A;  3NIV A;  1XW5 A;  2H0I A;  5ECO B;  4GLT A;  4TXO A;  4JU5 A;  1DBY A;  4K7O A;  4CHS A;  1K0O A;  2P0G A;  4N30 A;  4I2U A;  3K8N A;  5EY6 A;  2XPE A;  4A5P A;  3APS A;  1YJ6 A;  5B7C A;  2NVL A;  2WUL A;  3IC4 A;  5D9V A;  2F3M A;  4NMU A;  2HT9 A;  3WYW A;  3C71 A;  2CQ9 A;  2VKZ G;  3C1R A;  3TJJ A;  3D0Z A;  2EIR A;  1Q4J A;  5D9T A;  1JLV A;  2DJK A;  3N9J A;  4IP1 A;  4O5R A;  3TCO A;  1JFU A;  2LUS A;  4OCE A;  3GUS A;  3LOR A;  4AGS A;  2A2S A;  5A5H A;  2FA8 A;  4O7H A;  3EE2 A;  1YEX A;  1AC1 A;  3L9V A;  3HJO A;  2N5A A;  2IJY A;  3F9U A;  1O7U A;  3VWW A;  4HU9 A;  4AKG A;  3H1N A;  2H72 A;  2WS2 A;  1WPI A;  1GUH A;  1GNE A;  3DRN A;  1FB0 A;  2DSA A;  8GSS A;  4RI6 A;  2YNX A;  4GST A;  2CVB A;  5BRT A;  1VF4 A;  4IEL A;  1Q98 A;  4BL7 A;  3O76 A;  1A8L A;  5J4V A;  3GL5 A;  4EKZ A;  1OC9 A;  1SKW B;  1ERT A;  5JCG A;  3L4N A;  1MDK A;  3DEX A;  1TK8 B;  12GS A;  3OR5 A;  2NTO A;  1YF0 A;  4JR4 A;  3EC3 A;  4QL9 A;  1R7H A;  5IMZ A;  5J4Y A;  4O92 A;  2N5B A;  5KOW A;  1BX9 A;  4O5Q A;  2C1Y A;  2JAD A;  3EMX A;  2RLI A;  2GSS A;  1SK0 A;  2F8A A;  4TXV A;  4KX4 A;  2L6C A;  2YWO A;  4IJI A;  4BPY A;  1GNW A;  3F6D A;  4IGJ A;  3EPT A;  4WR5 A;  4FQU A;  1ZL9 A;  5A5H B;  3CTG A;  1FHE A;  2DLX A;  1A2L A;  3HZ8 A;  2H75 A;  1SJI A;  2LNT A;  4QL7 A;  3GKX A;  3GFK A;  5IM9 A;  1XW6 A;  2RII A;  2H30 A;  4DSS A;  2OE3 A;  5F07 A;  2OKA A;  5ECR B;  5IMC A;  4IW9 A;  5G2Z A;  2JSY A;  2WZ9 A;  5ELA A;  5FWG A;  1GRX A;  1THX A;  4L5O A;  4K5S A;  2I3Y A;  2ZUP A;  2VD0 A;  2E2G A;  4V2N A;  1XFL A;  4PX1 A;  4BL7 B;  2EFE A;  1OC9 B;  2NBS A;  2R4V A;  2F51 A;  4Q5Q A;  2YV9 A;  2CAQ A;  3QOU A;  6GSX A;  3ZLP A;  3ZIV A;  2PN8 A;  2FCH A;  5IIZ A;  1KBN A;  4PUR A;  4K1F A;  1S3A A;  2BTO T;  1ON4 A;  3ZL5 A;  2VCV A;  3VFI A;  1ZOF A;  2O89 A;  3CSI A;  1J9B A;  2LRN A;  4Z2T A;  4MJC A;  4MJB A;  5DVB A;  1MD3 A;  3EU3 A;  1AUC A;  1G6Y A;  3VWV A;  4V2M A;  4POB A;  1X5E A;  4LL1 B;  3LJR A;  3BCI A;  3Q6O A;  3CRU A;  4DSS B;  4IBP A;  2H6Y A;  2FA4 A;  5ECM B;  5HR1 A;  2HSN B;  1PQN A;  4XS4 A;  1WOU A;  3WD6 A;  2LS5 A;  5HFI A;  1SEN A;  2O8V B;  3ZVJ D;  1O8X A;  1YDK A;  1OC8 A;  1SKS B;  1QXH A;  1TOF A;  3UJ1 A;  2YPM A;  2H19 A;  4I5Q A;  2H0H A;  1DE2 A;  2MMN A;  3F4T A;  2C0E A;  2CAI A;  3MAK A;  3KGK A;  3VK9 A;  1SL1 B;  2IMF A;  4KSM A;  2M46 A;  4IN0 A;  2VD1 A;  4KUN A;  1G0T A;  1YKA A;  1JZO A;  2H1B A;  2LV3 A;  3UVT A;  4KW6 A;  1X0R A;  3GHA A;  1MDJ A;  2HFD A;  4PUF C;  4PQ1 A;  5CP1 A;  5IMV A;  5IQY A;  2R0G A;  2YV7 A;  4HDE A;  1J08 A;  5B6M A;  3TJG A;  3HMJ G;  3DVX A;  2I4A A;  2WJU A;  1HNB A;  4V1A p;  1EOH A;  4MMM A;  2IFQ A;  1OC3 A;  5CRE A;  3IRA A;  1O73 A;  3EUR A;  1DSB A;  5E59 A;  2VCX A;  3F4S A;  1T4Y A;  1K0M A;  3TKQ A;  3CWG A;  4I2T A;  2A4H A;  5ID2 A;  1TRW A;  4XS4 B;  2LQQ A;  5BMU A;  2HRK A;  5IMA A;  2GST A;  3E3E A;  5J5N A;  5CRG A;  2YP6 A;  2WFC A;  1AAZ A;  2FWE A;  5LNK e;  3HVX A;  3J7Y k;  4KCA A;  1LJR A;  1ZYE A;  2YWM A;  2H6Z A;  2AJQ B;  2LNS A;  3IK7 A;  4IQ1 A;  2GZY A;  4AJ7 A;  1NHY A;  1XCC A;  1TRV A;  4JR6 A;  1VF3 A;  1EGO A;  2X8C A;  2H66 A;  4N10 A;  2XHF A;  3LWA A;  1GL8 A;  2FHE A;  1A24 A;  2FY6 A;  3H79 A;  3IE3 A;  4DSR A;  2B3S A;  3ZTL A;  3ZRD A;  1GSY A;  2H70 A;  1AXD A;  2OT3 A;  3TKS C;  1PA3 A;  1TK0 B;  3IC8 A;  3Q19 A;  4JBB A;  2PGT A;  5CNW A;  1BYE A;  4WKW A;  1GLP A;  4ECJ A;  5G1L A;  5IPH A;  4YKG A;  3LQ7 A;  1EWX A;  2P5Q A;  5BMU B;  4FO5 A;  4ZB7 A;  1T7P B;  2B5X A;  2GTU A;  2HRK B;  1XWK A;  4KND A;  1JZW A;  4TR1 A;  3HDC A;  2HRF A;  2VOC A;  2KOK A;  3J7Y b;  4ZBD A;  1PMT A;  3ZIJ A;  5G5F A;  1PX6 A;  2V6K A;  2K18 A;  6GSW A;  2H01 A;  3D5J A;  2OBK A;  2M72 A;  5ECK B;  1K0N A;  3G7I A;  1ZYQ B;  4YQV A;  3HZ4 A;  1FOH A;  2K9F A;  4ML1 A;  3UEM A;  3M0F A;  1AQV A;  4J56 E;  4JRR A;  1XW9 A;  5J9B A;  1I9D A;  4GXZ A;  2L6D A;  2IL3 A;  2M80 A;  3ZZX A;  2ALB A;  1NSW A;  3ZFB A;  1SD8 A;  1T1V A;  3I9V 2;  3KTL A;  1CQG A;  2L5L A;  2X4A A;  1UA5 A;  4AJ6 A;  3IAS 2;  4G0I A;  5COH A;  1OAZ A;  3ZRE A;  2G0F A;  2P5R A;  2OJL A;  1QMV A;  2JU5 A;  1V40 A;  1F2E A;  1WIK A;  4O5U A;  1OYJ A;  4K7I A;  3CSH A;  2FGX A;  3ZVJ A;  1F9M A;  4IQA A;  2VAF A;  1BAY A;  3QFA C;  3D6I A;  3IHQ A;  2B6M A;  1XOA A;  2V41 A;  4KB3 A;  1YZX A;  3MWH A;  4TKY A;  4NAX A;  4I97 A;  2FWH A;  4YH2 A;  1AQX A;  5F8B A;  2GS3 A;  4LA1 A;  3VLN A;  4JED A;  4AKH A;  4MJA A;  1R26 A;  3QFB C;  2EIQ A;  3F8U A;  2YWN A;  5KN2 A;  1SKR B;  2MMA A;  2QC7 A;  3EU4 A;  2VO4 A;  1RQM A;  2MBT A;  5KN0 A;  4G2E A;  1GSD A;  1WJK A;  1V98 A;  3APO A;  1VRS D;  3QAV A;  1JZD A;  4POL A;  1R5P A;  3KH9 A;  3CXG A;  2VCQ A;  2HZF A;  2FWF A;  4ZBA A;  1DE1 A;  4EVM A;  2QA1 A;  3QR6 A;  4BVX A;  3KCM A;  5AIS A;  3BOA A;  2KHP A;  3TKP A;  3GUR A;  2X64 A;  3P7X A;  1BG5 A;  2HXK A;  4POK A;  3ZML A;  3IHG A;  2CA8 A;  1BED A;  2DJ3 A;  3KMO A;  2MYG A;  2PER A;  5KOX A;  5IO0 A;  3GX8 A;  3TRX A;  2HZE B;  5J47 A;  2OA7 A;  1ERW A;  1TU8 A;  1U6T A;  2HRA A;  2EC4 A;  4BWS A;  4KSO A;  2GSQ A;  3M3M A;  4DSQ A;  1NM3 A;  3FMW A;  3KP8 A;  1XVQ A;  1B9Y C;  5ELG A;  4RQX A;  4RQR A;  3FKF A;  4POM A;  5CRD A;  3CMI A;  20GS A;  5HFG A;  2V32 A;  2XBQ A;  4K0N A;  2B5E A;  3ED3 A;  2NPB A;  1MDI A;  2HSH A;  2X99 A;  2GZZ A;  3BBY A;  6GSS A;  1TI1 A;  5G1K A;  2DJ1 A;  3DKS A;  2MBS A;  4KDU A;  1PL2 A;  5D93 A;  2B1L A;  4TOP A;  13GS A;  1EOG A;  3TRP A;  2PUK C;  2H0G A;  3LG6 A;  1HQO A;  4KH7 A;  4BVY B;  2L59 A;  4K0G A;  4TXO B;  3QCP A;  4IVF A;  2E7P A;  5F06 A;  4PUA A;  2PMT A;  2LRC A;  4ICY A;  2JAC A;  4HU7 A;  3HHV A;  1M2B A;  3I6A A;  3DIE A;  2B7K A;  3TKS A;  6GST A;  1YY7 A;  2R2J A;  5J41 A;  3M9K A;  1ERV A;  3D4M A;  2PWJ A;  2WCI A;  5LCZ A;  2GQL A;  4JZQ A;  3E0U A;  3GKM A;  2GT6 A;  5J9C A;  2OAD A;  3ERF A;  1X9S B;  2DC5 A;  1B48 A;  1C72 A;  4KE3 A;  1R5A A;  1RW1 A;  2X49 A;  4K5R A;  4OCF A;  4MDC A;  5H5Q A;  5D96 A;  2CZ2 A;  4NHZ A;  4XIH A;  1NW2 A;  3KIJ A;  1PKW A;  1Z9H A;  2WDU A;  9GSS A;  2C8U A;  3ZFL A;  1W4V A;  5CAX A;  4MNN A;  2V2G A;  2QKE A;  3FR9 A;  4MF7 A;  2HE3 A;  5AN1 A;  4L0U A;  2VLV A;  3UIW A;  5GZZ B;  4K2D A;  1ML6 A;  5A4W A;  5D9W A;  5DQS A;  2C0F A;  4RUV A;  10GS A;  3HY2 A;  4WF5 A;  3GRX A;  4OO5 A;  1THO A;  2UZ8 A;  4O32 A;  1KNG A;  2H71 A;  1A8Y A;  1DUG A;  3LW9 A;  2HLS A;  2OAC A;  3I43 A;  4EDY A;  5LD0 A;  3ZIT A;  4YQU A;  3O6T A;  1GSS A;  1YKC A;  5IMD A;  2IMI A;  3C7M A;  3GNJ A;  5KEJ A;  1YF1 A;  5G5E A;  1URM A;  2JZS A;  2YZU A;  4I8B A;  4JE1 A;  1M9B A;  1Z7P A;  1QUW A;  3HXS A;  3KMN A;  4AJ8 A;  1N2A A;  4MA9 A;  1GSE A;  2CVD A;  2B5Y A;  4OFM A;  4F9Z A;  2IPA A;  5DCH A;  4HZ4 A;  1UN2 A;  3TKS E;  1ABA A;  3RHC A;  2LST A;  4WR4 A;  1MD4 A;  2ON5 A;  1G7E A;  5A5K A;  1SYX A;  1B9X C;  3ME7 A;  4MK3 A;  4IP6 A;  3F3Q A;  7GSS A;  2R37 A;  3UOM A;  2FLS A;  3M9J A;  2XC2 A;  1QFN A;  4WBJ A;  4E8H A;  3W8J A;  2AV4 A;  3RAZ A;  4N3Z A;  5E4W A;  4WBR D;  22GS A;  2FWG A;  1O6J A;  3KTB A;  3G9B A;  1OKT A;  1T3B A;  1FW1 A;  2LTK A;  2QGV A;  4MF6 A;  2K6V A;  1CQH A;  2N5F A;  3Q74 A;  1JZR A;  1K0D A;  4TRX A;  4OFT A;  3FR6 A;  1YEP A;  2RM6 A;  1JHB A;  3S9F A;  1X5C A;  1XPV A;  2MZC A;  3IXR A;  3SBC A;  2TRX A;  2VIM A;  2F9S A;  3VI5 A;  2AAW A;  1GSQ A;  3GA4 A;  5A4U A;  1O8W A;  5A34 A;  1SK2 A;  2C80 A;  4ZB8 A;  1WMJ A;  2O7K A;  4KAE A;  2I81 A;  4MCU A;  1HYU A;  2GQM A;  1SVO A;  4ID0 A;  4DVC A;  3TGZ A;  5DBQ A;  1V57 A;  2GSR A;  3BD2 A;  4KA0 A;  1S3D A;  3VWX A;  1JLW A;  2HSM A;  2X8H A;  3IOS A;  2V6O A;  2YAN A;  3U5R E;  3GST A;  3WGX A;  1PN9 A;  4N11 A;  2VM1 A;  1SK1 A;  4HS1 A;  4V1A g;  3A5W A;  1VF2 A;  2DIY A;  4ACS A;  4Q5R A;  1QK8 A;  2WRT A;  4YQM A;  3UAP A;  5CRW A;  2J23 A;  5IO2 A;  3TJK A;  1LBK A;  3GH6 A;  2B7J A;  11GS A;  5ECN B;  2CZ3 A;  3WT2 A;  1KEB A;  2HYX A;  3GSS A;  2FNO A;  2NDO A;  5J3R A;  2IFQ B;  2YJ7 A;  1VF1 A;  5F0G A;  1BG1 A;  1SVM A;  4PXO A;  2QA2 A;  1Y1U A;  5D73 A;  3QAW A;  3LGC A;  5A34 B;  2RUE A;  4XTS A;  1BJX A;  3GIX A;  2KP2 A;  4GTU A;  3GTU A;  5ID2 B;  2PVQ A;  1M9A A;  1K3O A;  4ZXG A;  4KCE A;  4J2F A;  5ENU A;  14GS A;  2LKU A;  3P8W A;  4CY6 A;  4MAB A;  1A0R P;  4ZL7 A;  4ISD A;  3D21 A;  5G30 A;  1F37 A;  1F3B A;  2VCT A;  3EMP A;  4IKH A;  2FUG 2;  3L78 A;  2HSM B;  1G6W A;  1FOV A;  3L9U A;  1GTA A;  1ZZY A;  3GX0 A;  3E9J B;  5L71 A;  4OMV A;  2CX4 A;  3LXT A;  1VGL A;  3PGT A;  1T00 A;  1SD9 A;  4D73 A;  3R3E A;  2H74 A;  3MNG A;  3UMA A;  4WXT A;  1KTE A;  4ECB A;  1M7T A;  1V9W A;  1G7O A;  1GWC A;  3GH9 A;  1AW9 A;  4PGT A;  2C0G A;  1SYR A;  2ES7 A;  3FRC A;  2XBI A;  1B4P A;  5GAP D;  4X4J A;  5B8A A;  1GTU A;  3DYR A;  4BA7 A;  4G9H A;  1Z5Y E;  4HJ2 A;  3GV1 A;  5DDL A;  5CYY A;  2L57 A;  3PIN A;  5DQY A;  3TRQ A;  1A2J A;  1UVZ A;  1XOB A;  4TW5 A;  1R4W A;  3VUR A;  4X1U A;  4XRD A;  4L5L A;  3KM6 A;  3DGQ A;  4QMK A;  4YKF A;  4ZB6 A;  1ZYP A;  4ZL8 A;  1TXU A;  4MP4 A;  2R5G A;  4HQS A;  2C3Q A;  4PQI A;  5HQP A;  2YCD A;  3HYP A;  4G0K A;  1X9W B;  5A1N A;  2J9H A;  2HNL A;  4XS1 A;  2IWT A;  3MDK A;  2B1K A;  4X0X A;  4NXI A;  5ABR A;  4TR1 B;  3N5O A;  1EZK A;  2A2R A;  1PKZ A;  2TRC P;  5CRH A;  3NZN A;  4WET A;  3AY8 A;  2C4J A;  2PVO C;  4EXJ A;  4AKX B;  3GN3 A;  1TTZ A;  3TKR A;  2EFH A;  4KDX A;  1MEK A;  2LJK A;  1Y6E A;  3IAM 2;  5GAN D;  4G01 A;  5D9X A;  4ML6 A;  1K0B A;  1XVW A;  2AYT A;  4EO3 A;  1MTC A;  1HNC A;  3GKK A;  3M8N A;  1I5G A;  3F4R A;  1AQW A;  2IMK A;  2A2P A;  5ECL B;  4AF2 A;  1E2Y A;  2H1L A;  3ME8 A;  2H76 A;  3PR8 A;  4EE0 A;  1S3C A;  5DAL A;  5F05 A;  1PN0 A;  4TVE A;  2HSY A;  3LYK A;  3MYD A;  4ZBB A;  3VI7 A;  3HCZ A;  2ZCT A;  3H4K A;  2R3X A;  1WE0 A;  5INY A;  5JCW A;  1OE8 A;  4PQH A;  3QMX A;  3KH7 A;  3L0H A;  2K8S A;  1EP8 A;  4ECI A;  2R6K A;  2O85 A;  4QQ7 A;  3MSZ A;  2VCW A;  1T8E B;  4BWQ A;  1FVK A;  1HD2 A;  4K6X A;  4TN8 A;  4G19 A;  4K8M A;  3C8E A;  3EVI A;  2A4V A;  1UC7 A;  4RI7 A;  5KN1 A;  2H73 A;  3FZ5 A;  1EEM A;  3RPP A;  1O81 A;  2G2Q A;  4ZB9 A;  3BJ5 A;  2Z9S A;  4TR4 A;  5ECS A;  4GSN A;  1TKD B;  3SWL A;  2P31 A;  4ULX A;  3LXZ A;  2DJJ A;  4K7N A;  1PX7 A;  5DJL A;  2PU9 C;  2C3T A;  2KUC A;  3APQ A;  3A3T A;  4BVX B;  2JSZ A;  5DJM A;  4PNG A;  1BF5 A;  3FHK A;  3HVS A;  4F82 A;  3L9S A;  2REM A;  5DAL B;  3EYT A;  4CY8 A;  6GSU A;  4FYC A;  2UV8 G;  19GS A;  1FG4 A;  3PH9 A;  3U6V A;  2WB9 A;  3DML A;  2WGR A;  1SVL A;  4WF4 A;  2K8V A;  1GSU A;  4MZW A;  2H6X A;  2LQO A;  4OO4 A;  2F8F A;  5G31 A;  1E6B A;  1F6M C;  4Q5N A;  1XWA A;  1WP0 A;  3KJY A;  2VM2 A;  1PL1 A;  5IOW A;  3VPQ A;  4MZC A;  3CTF A;  4FIW A;  3F0I A;  4OD7 A;  1XBS A;  2ON7 A;  1U3I A;  3VPT A;  3RDW A;  2GVP A;  3F3R A;  1B8X A;  2IMD A;  2HRN A;  2H1A A;  3M1G A;  4KF9 A;  1TDI A;  1TU7 A;  4W66 A;  1V58 A;  4F03 A;  5HR0 A;  2GDR A;  4HI7 A;  1K0A A;  17GS A;  1M2D A;  2VL9 A;  4I6X A;  1GUL A;  1RK4 A;  3WGE A;  4HQZ A;  1GP1 A;  2OE1 A;  3ISO A;  5C00 A;  4MZB A;  3TDG A;  3IA1 A;  1USB A;  5A4V A;  2I9H A;  4MF5 A;  3TOU A;  3C73 A;  5AGY A;  5ECH B;  1XWC A;  3FZA A;  1ZMA A;  4TR0 A;  1A23 A;  3RHB A;  3CBU A;  3RPN A;  5IPG A;  3D4T A;  2HSN A;  3W6G A;  3H93 A;  3FR3 A;  1LU4 A;  4NV5 A;  4N0V A;  3GKN A;  3QPM A;  4FYB A;  1GUM A;  3LSZ A;  1N25 A;  2CV4 A;  3ZYW A;  4OWY A;  1OKD A;  4EL1 A;  4HOJ A;  1ZGN A;  5C04 A;  3IBH A;  3D22 A;  4NWY A;  3W8S A;  3UBL A;  1EV4 A;  4G10 A;  2CX3 A;  3C1S A;  4F0B A;  5D8I A;  1TW9 A;  4EUY A;  1SJZ A;  3HD5 A;  5HFK A;  3FYG A;  2FD3 A;  1GLQ A;  4MPG A;  5AIX A;  1K0C A;  5EVO A;  4USS A;  3TOT A;  2VLT A;  3TU3 B;  4HJM A;  3DWV A;  4EIQ A;  1TI3 A;  4GSS A;  4J57 E;  5EL8 A;  5JWR B;  3TUE A;  1QQ2 A;  4ILF A;  3US3 A;  3KEB A;  2JL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...