1U87A

Crystal structure of the 26 kda glutathione s-transferase y7f mutant from schistosoma japonicum complexed with glutathione
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
209
structure length
209
Chain Sequence
MSPILGFWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-Transferase 26 kDa
publication title Crystallographic and Thermodynamic Analysis of the Binding of S-Octylglutathione to the Tyr 7 to Phe Mutant of Glutathione S-Transferase from Schistosoma japonicum(,)
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 56
structure length 209
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1u87A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1u87A01
4EDYA 4HDEA 3VWUA 5D9TA 2KP1A 2HZEA 1PKWA 3LXZA 2CT6A 1SJIA 5E4WA 2YJ7A 1OC3A 4L8EA 4CDOA 3HKRA 4LL4B 4G2EA 2H19A 4HOJA 3I6AA 4K6XA 1EEJA 4WR5A 1A23A 2JACA 5F0GA 3O3TA 3NOFA 4MZBA 5DJMA 5ECOB 1A2JA 4RUVA 2C80A 4NHZA 1GSEA 1IYIA 4WKWA 3QCPA 3CXGA 1V57A 2OACA 2H6YA 4GQCA 1O6JA 4OD7A 3A2VA 2VM1A 1JZDA 1Z6MA 2IMFA 1NHYA 1QGVA 1C72A 3UARA 1OE8A 1U6TA 4O7HA 4O32A 2DJ1A 4EKZA 3CTFA 2H6XA 4WBRD 1N8JA 2FLSA 1JZWA 1F9MA 4ECBA 2OBKA 2WB9A 1AAZA 1PX7A 3A2WA 2Z9SA 1G7EA 1MD4A 5B7CA 2FA8A 2GT5A 3F9UA 2GZZA 1TK5B 2CZ3A 3EURA 5DVBA 4TVEA 1GNEA 2PVQA 5DAKA 11GSA 3P7XA 3TKRA 2LV3A 3LXTA 1K0CA 3IPZA 1YKAA 1K0BA 5ECKB 5AISA 5J4UA 1YF1A 4XCSA 3D4TA 4GLTA 2HNLA 3IDVA 4X0XA 3FR6A 2FWFA 2B1LA 2GTUA 3RAZA 1THOA 4TKYA 5ECLB 1K3YA 3SWLA 1A0FA 3QD9A 3GSSA 2H66A 2WULA 1B8XA 2B3SA 1W4VA 2LRTA 1V98A 4YH2A 3DMLA 1PA3A 4KNDA 4WF5A 1H75A 2LJKA 4KSOA 1GH2A 2DJ0A 2MMAA 3KM6A 2BTOT 3ZLPA 3A2XA 5GSTA 2YANA 3EYTA 3GKXA 5KN2A 4Q5NA 1TRVA 1ZCPA 3FZ4A 4F9ZA 4PX1A 3Q18A 5CAXA 2GSRA 4V2NA 2H71A 4X1UA 4XS4B 2OKAA 4H86A 4QL7A 4ML1A 1A8YA 2H73A 3UMAA 2GS3A 2HSHA 3HVVA 4PTSA 1WMJA 4PUAA 3E0UA 4PURA 2DIZA 5JWRB 1AQWA 3DD3A 3WD6A 5DALA 4MABA 1CQHA 3FRCA 2ES7A 4POBA 1Z3EA 3IC4A 1XXUA 4KH7A 4PQHA 1Y6EA 2KHPA 2YWOA 4RQRA 1QFNA 1JLVA 4KE3A 2CX3A 2LKUA 4V1Ap 5CRWA 3RPNA 2AV4A 3DKSA 3DVXA 3ZL5A 5JCWA 3D21A 3G7JA 1U87A 4BVXA 5GSSA 3FZAA 3TKPA 3IBHA 3R2QA 4GF0A 4BPYA 1G6WA 5ECMB 1V9WA 2YNXA 2I4AA 1CQGA 4AJ6A 4P3YB 4MF7A 5L71A 1TU7A 3GIXA 5F8BA 4HUAA 3DWVA 4HJMA 4IN0A 1JZOA 3TRXA 2LS5A 2A4VA 3FR9A 3PINA 5G1KA 5DBQA 3N9JA 3EU4A 5F05A 3UIWA 4J57E 9GSSA 4I5QA 2NTOA 3VK9A 5IM9A 2KP2A 1TXXA 1EZKA 5BMUA 3ZFBA 4G0KA 2VCTA 2C3NA 4G0LA 1FB6A 1PL1A 2FA4A 4WETA 2P31A 4JU5A 2H74A 2PERA 2KUCA 5IIZA 4HJ2A 3TKSA 1TOFA 3CTGA 2R3XA 4MDCA 1OE7A 2FD3A 1U3IA 3HYPA 1VF4A 2L59A 2H0IA 3HVSA 4FIWA 4JR6A 3BCKA 3CMIA 3V1WA 2UZ8A 1ON4A 2L4QA 3I69A 4MJAA 2IMEA 2C8UA 1KNGA 1OKDA 3G7IA 4HQSA 3HJOA 3GN3A 3TB2A 2O8VB 6GSUA 1AXDA 5EPFA 3KEBA 3ERFA 1OYJA 1EV4A 5G30A 4D73B 1SL2B 2AHEA 4IQAA 2DMMA 1UN2A 3LGCA 1XWGA 4BL7B 4IGJA 1GLQA 4WR4A 2M80A 5KN0A 3AY8A 1MDJA 4I6XA 1O85A 1JFUA 3U6VA 4IELA 1T3BA 2H6ZA 1SYRA 2MMZA 2WFCA 3M1GA 1M2BA 4YQUA 4N10A 2I3YA 4TW5A 3N5OA 2N5AA 3J7Yb 1AQXA 2H0HA 2WRTA 5HQPA 3VPTA 2XPEA 4J2FA 5CP1A 5EY6A 3H1NA 3MWHA 1HNBA 3GFKA 4TR1B 4V1Ag 3IK9A 5HR2A 3IK7A 4ZBBA 2FCHA 3GNJA 4MH3A 1SK0A 2RUEA 3UAPA 1PL2A 5ECHB 2VD1A 1YEXA 1KTEA 2EIRA 3KD0A 1FO5A 3U5RE 1V2AA 2B7JA 4LA1A 4ILFA 3C1RA 4O5RA 2CAIA 1R26A 2F9SA 1X9SB 4POMA 3CSHA 3F3RA 3RBTA 1OKTA 1GRXA 4AJ8A 3G7YA 3GL3A 3QMXA 3IRAA 3IV4A 1F6MC 2LRCA 1XOAA 2HRNA 1O81A 2JSYA 4EVMA 1FG4A 5FT3A 1B4PA 2XPDA 4V2MA 2GSTA 3J7Yk 2X8HA 2WGRA 2VLVA 3TJJA 4PNGA 3LQ7A 5G5EA 2PN8A 2GT6A 3RPPA 5JCUA 1FB0A 3S9FA 1R5PA 3D4MA 2PVOC 5IQYA 8GSSA 2DMLA 3LYKA 5D9XA 3GH6A 3IHQA 2J23A 1K0MA 3UJ1A 3C7MA 4EXJA 5COHA 4XHMA 1GTAA 3DRNA 3F3QA 4GRFA 5DQYA 3F6FA 4POKA 3VPQA 3FYGA 3FK8A 1ZZYA 1MEKA 2ON7A 4WXTA 2HSYA 5HFGA 4TOPA 2LJAA 4IKHA 2RM5A 1ML6A 1V58A 4MLYA 1M2DA 3GSTA 3HZ4A 5A4VA 3ED3A 1PGTA 3WYWA 1XVWA 5AGYA 5ECIB 1JLWA 2ALBA 3D6IA 4XS1A 3K8NA 2C4JA 4IP1A 3TKQA 5A4UA 2GZYA 3R3EA 4RQXA 3Q19A 1EGOA 1VGLA 12GSA 4ECJA 2WDUA 4KX4A 3QDNA 4PXOA 2NDOA 3ZITA 2IIYA 2HE3A 1MTCA 2DJ2A 6GSVA 3IC8A 1GUKA 3ERWA 3KZQA 2R4VA 1U3AA 3KP8A 4OMVA 2R2JA 1SKSB 2IFQB 2XC2A 3ERGA 2VCVA 2DBCA 2V2GA 3EVIA 3BJ5A 3DGQA 3BBYA 1BQ7A 4IQ1A 2RUFA 4XS4A 4TR0A 2HSNB 3O6TA 1SKWB 2MZCA 2OE1A 1WOUA 2FWEA 5IMCA 4X43A 3EC3A 3KCMA 5IMFA 1WE0A 3OR5A 4BWSA 1I9DA 4MH2A 4V2LA 2CA8A 3HD5A 3I9V2 3L9SA 1X9MB 2RM6A 3WGEA 2F8AA 1URMA 1M2AA 1O8WA 2GZPA 1PMTA 2PMTA 1ZMAA 1YJ6A 3GRXA 2DSAA 2CZ2A 3EWLA 5D73A 3FY7A 1R4WA 5C00A 4DVCA 2GQMA 5E59A 20GSA 3CYNA 2HXKA 4XRDA 3E9JB 3IE3A 4MPFA 1Z7RA 1TP9A 2H1GA 5EVOA 4GWRA 4N0ZA 2C0DA 2LQOA 4ZL9A 1G0TA 4DEJA 4IBPA 3ZRDA 3RHBA 1XOBA 3BCIA 1H4OA 5B6NA 1IYHA 1PQNA 3HA9A 1XVQA 1S3AA 2PWJA 3HJPA 1YQ1A 1GTBA 3WT1A 2E2MA 1F3AA 4G10A 4L0WA 1BYEA 4TXVA 4KAEA 4PNFA 4FYBA 1G7OA 1WJKA 3HVXA 1YKCA 5LCZA 1AW9A 1E6BA 2O89A 2VCQA 3FR3A 4BA7A 5IOWA 3O76A 1K3OA 5D96A 2CAQA 5AIVA 1TTZA 1GWCA 5D8IA 2DC5A 2GSSA 5DDLA 1M99A 3QAWA 4EDZA 4KUNA 3H4KA 5HR1A 4IHUA 4Q5RA 4GSNA 3HCZA 4K7OA 5J41A 2XBQA 5A5KA 4KA0A 1EGRA 2QKEA 3D5JA 3EU3A 1ERUA 2C1YA 2LJRA 4ZILA 2HT9A 4JBBA 3GMFA 3ZMLA 3PGTA 2YN1A 4RI6A 2JZSA 1GSYA 2E0QA 4D73A 2WZ9A 4IW9A 2K9FA 4DSRA 2K8VA 3CSJA 1G6YA 2YWIA 2DLXA 6GSXA 1GUHA 2HI7A 3UBLA 1SK1A 4MCUA 1SL0B 1J0FA 2YOIA 5HFKA 5HR3A 3WT2A 5FHIA 4L5OA 3FKFA 2JADA 5A4WA 5G2ZA 3LFLA 5F06A 4HI7A 1O8XA 4XIHA 2AJQB 1UVZA 5CNWA 2H70A 4GSTA 2H1DA 5IO2A 4MPGA 3LEFA 4RI7A 4TR1A 2JZTA 1KEBA 4MJBA 1EP8A 1MD3A 2AAWA 17GSA 1F37A 4OO4A 1GUMA 2TIRA 1NSWA 5IPGA 4WBJA 1QUWA 3ZVJA 1GSDA 2ZUPA 2OJLA 3ZTLA 3VLNA 1T4ZA 4LLRA 1TRSA 1B9YC 1SD9A 2YP6A 2CVDA 2IMIA 3ZIVA 1S3CA 4ZL8A 3GURA 1VF2A 2TRXA 1XW9A 3KGKA 5IOXA 1ST9A 4Q5FA 2K8SA 2YZHA 4TRXA 2NPBA 3VWXA 5CRDA 4K8MA 3F4RA 2B6MA 5B8BA 1AQVA 4F0BA 3F6DA 1SJZA 2HLSA 22GSA 5J5NA 4DSSB 1WP0A 1Z6NA 2HRFA 2L6DA 2FNOA 4ACSA 2VAFA 3ME8A 4MP4A 5JWOB 2TRCP 2EC4A 1SD8A 3KTLA 2VCZA 2H0GA 4JEDA 3TGZA 2BJXA 1XWKA 2X8CA 1M9BA 3FZ5A 1JHBA 4FQUA 4K9ZA 3VI7A 1GSUA 4KCAA 3HXSA 2B5YA 1ABAA 2K6VA 3M8NA 4MA9A 4OCFA 2OA7A 5IMVA 1LBKA 5CYYA 3TKSC 1OC8A 2I1UA 1TKDB 2EIOA 2VCWA 4E8EA 2LQQA 4IS0A 4KSMA 4LMVA 4OWYA 1O73A 2WJUA 1HNCA 6GSWA 2GLRA 3C8EA 2PBJA 2VO4A 4ECIA 1GNWA 1VF1A 4OFNA 2REMA 2I9HA 2HSMA 5J9BA 1EP7A 1V40A 3TCOA 3TRPA 1PRXA 5KN1A 3WGXA 2KLXA 4J56E 1NHOA 5IMZA 2GQLA 1I5GA 4BVYB 2JL4A 1SL1B 1PSQA 4LMWA 2IFQA 3DEXA 5DQSA 1YF0A 5IO0A 1FVJA 1X9WB 3UEMA 1ZL9A 2DIYA 3APSA 3TKSE 1XCCA 1UC7A 2L5LA 3US3A 2HRKB 2VLUA 2IN3A 5D9WA 1W89A 1MDKA 1J9BA 1FW1A 5D93A 1LJRA 3GKMA 3ZMKA 2L5OA 4OFTA 3GTUB 1XW5A 2CVKA 2G0FA 4BWQA 1TK8B 1R5AA 4LL1B 1WPIA 2LRNA 2EIQA 2VUPA 1FHEA 3PPUA 1RK4A 5ENUA 3ISOA 2M46A 2LUSA 1USBA 4MZCA 2CVBA 4K0GA 4JZQA 3LORA 1Z7PA 3HZ8A 3IA1A 1M7TA 4TR3A 3D0ZA 1JZRA 2IJYA 1O7UA 5AIXA 1XW6A 4FYUA 3GA4A 2VL9A 3KP9A 4F82A 3KH9A 4DSQA 2C3TA 1EOHA 3ZZXA 2MMOA 1K3LA 4MF6A 3DYRA 2MBTA 2L4CA 5JCGA 1BEDA 2VOCA 5FWGA 1ACVA 4MF5A 3W6GA 5H5RA 1EV9A 1XBSA 4XTSA 2A2RA 2HQTA 2C3QA 2PUKC 3W8JA 1PD21 1THXA 1TJDA 4GSSA 5ELGA 1A0RP 2O87A 2CV4A 3GKNA 3LJRA 3UOMA 16GSA 1AIUA 3Q74A 3LSZA 4YQVA 2CQ9A 5F07A 4ML6A 3WGDA 4ZB8A 1TRWA 1GSSA 5IMDA 2VD0A 4ZXGA 1T1VA 3M3MA 5KEJA 2F3MA 5ELAA 3TOUA 1A2MA 3H8QA 2JU5A 3F4SA 4HQZA 1M0UA 2RIIA 2D2ZA 2L6CA 2B1KA 1N2AA 2OE0A 2YV7A 1XIYA 3G9BA 1E2YA 4I97A 1K0AA 3IOSA 2V1MA 3DIEA 4EUYA 5CREA 3L4NA 3TJFA 2OADA 3CRUA 1XFLA 4TR4A 2H8LA 1GSFA 3M9KA 5KN3A 2IPAA 2HFDA 3VWVA 2LSTA 2MMNA 3GX0A 4ZBAA 3C1SA 1FVKA 3QPMA 3TRQA 5C04A 3A3TA 4TXOB 1QQ2A 1Q98A 4Z7XA 1PN9A 1B9XC 3F4TA 3IR4A 3F8UA 3SBCA 1XZOA 4HS1A 4WF4A 5H5QA 2MYGA 14GSA 2YPMA 3CBUA 1NW2A 2FHEA 3VFIA 1VF3A 3ZREA 4YAVA 2YCDA 2R5GA 5ABRA 3HJMA 1B4QA 3RDWA 1EWXA 2I81A 4KW6A 4KB3A 1OC9B 1ERWA 1S3DA 2GQKA 2FY6A 2YWNA 1SU9A 3JCML 3D22A 10GSA 1DBYA 2V41A 5EL8A 2DJ3A 1FAAA 1GL8A 4IVFA 1TRUA 4NMUA 1TW9A 3GL5A 1SKRB 4PUFC 1HD2A 1XPVA 1LU4A 3VURA 3GYKA 1K0DA 2P5QA 2H30A 2IMKA 2C0EA 2QC7A 2H75A 1XWAA 1T8EB 3M9JA 3C71A 1ERTA 13GSA 3E3EA 4NV5A 1SJ6A 1HNAA 1EEMA 4PQ1A 1T7PB 2XHFA 4MZWA 4GCIA 5ID2B 1B48A 5LD0A 2N5FA 2A2SA 2GGTA 4DSSA 3IAM2 2ZNMA 2LTKA 3EMXA 1M9AA 4NV2A 3VWWA 3GUSA 1T4YA 2G2QA 3HY2A 3QFBC 1AC1A 2FWGA 5IMAA 4IP6A 5J9CA 6GSSA 1DE2A 2K18A 1QK8A 1TI1A 1VRSD 3QFAC 2IL3A 2IMDA 5D9VA 2X99A 1WRYA 2HZEB 3ME7A 4KDUA 4HEA2 4GQFA 4ISDA 1ZOFA 2WS2A 1SK2A 4FYCA 2LNSA 4JE1A 3CRTA 1WIKA 4ID0A 4BL7A 5ECQB 1A2LA 3LYPA 5B8AA 4N11A 3KMOA 4EE0A 1Z5YE 4KGIA 2DJKA 1ZYQB 4ZB6A 4QQ7A 4NXIA 1GTIA 5DCGA 4KF9A 3QOUA 3HDCA 2E7PA 3LG6A 4MK3A 3KXOA 2YJHA 3H93A 1K0NA 4JR4A 1ZYEA 4IJIA 4WEYA 5ECPB 3APOA 2PGTA 2N5BA 1J08A 2R6KA 2E2GA 5GAPD 2VLTA 5JWQB 4BVYA 1Y25A 3F63A 4ZB9A 2F51A 3NZNA 3BD2A 2FUG2 3GV1A 4GTUA 4G9HA 2OBIA 5CRGA 2QSIA 5INYA 2NBSA 5HR0A 1GP1A 4F0CA 1YY7A 4NAXA 2VCXA 3KIJA 4JRRA 2X8GA 1GULA 1TU8A 4EO3A 4HU9A 4L5LA 5DAKB 4F03A 4OCEA 2O85A 4MJCA 2HRKA 4K1FA 4ULXA 2PPTA 1BX9A 3BOAA 4PQIA 2C0FA 3QR6A 4KDXA 1QXHA 2H01A 4K2DA 2PU9C 3GTUA 1YZXA 3KMNA 4G19A 3EMPA 6GSYA 4FH8A 1DE1A 4EL1A 1ZGNA 1QMVA 4HU7A 2IWTA 4NPBA 2KOKA 1OAZA 3LWAA 4ZL7A 4I2TA 3TJBA 2AUVA 2ZCTA 2R37A 1SENA 1TI3A 1GSQA 3ZIJA 4QL9A 1X5EA 3M0FA 4HZ4A 1X0RA 2BMXA 4I2UA 1F2EA 4N0VA 4KCEA 4F2IA 3L9UA 3P2AA 3VI5A 1R7HA 5B6MA 2AYTA 2HZFA 3QAVA 4L0UA 2MBSA 1YEPA 4MMMA 3EE2A 2FGXA 3H79A 3KH7A 3L9VA 2P0GA 4HZ2A 4YAPA 2HYXA 4AF2A 3MNGA 2B7KA 4EC0A 2VL3A 4NHWA 1WWJA 7GSSA 3P90A 3P8WA 3GKKA 3MSZA 5DALB 3UBKA 5J3RA 5CRHA 1HYUA 1KBNA 1TK0B 5ECNB 3DVWA 3PR8A 1YDKA 3MDKA 4MJEA 5G1LA 2YZUA 2H76A 2DJJA 3L0HA 4ECCA 3ZVJD 2X64A 3MAKA 4YQMA 5AN1A 3ZFLA 2QGVA 1XWCA 3UVTA 2FWHA 3EINA 1Q4JA 5CO3A 4K7NA 1RQMA 1BJXA 2GVPA 2M72A 1X5CA 2WCIA 1A8LA 2P5RA 5GZZB 4NWYA 3A5WA 5HFIA 2V32A 1RW1A 4G0IA 4BVXB 2ON5A 2JZRA 3CSIA 3I43A 4CHSA 3TDGA 2H1AA 2H1BA 1GTUA 3FHKA 3FEUA 1FOVA 4EF0A 1ERVA 18GSA 1EOGA 5ECSA 3UVHA 1K0OA 1TDIA 3APQA 4TXOA 2B5EA 1AUCA 4IJ3A 2GDRA 2LNTA 5G5FA 3TJGA 1DUGA 1U88A 2YWMA 3TJKA 4K0NA 3PH9A 4OFMA 3TUEA 1BAYA 5G31A 4AJ7A 3RHCA 2H72A 4TN8A 2F8FA 2J9HA 4ZBDA 2VL2A 2YV9A 1Z9HA 1X5DA 1DSBA 1ILOA 1HQOA 2AB6A 4AGSA 1OC9A 3NIVA 3UL3A 3TOTA 4O92A 6GSTA 1A24A 1BG5A 3W8SA 1MDIA 4KDYA 3FZ9A 1PKZA 3L78A 3IAS2 4ZIJA 2XBIA 3GH9A 4USSA 3DXBA 1T00A 3F0IA 2V6KA 1OVNA 2VL2C 2CX4A 5ECRB 5DJLA 2B5XA 2VM2A 1F3BA 5LNKe 2RLIA 2V6OA 5GAND 4XS6A 5IPHA 4POLA 1GLPA 2C0GA 4CW9A 2VIMA 3QAGA 2O7KA 3FW2A 2L57A 3C73A 2GSQA 4XRAA 1XWBA 5ID2A 5DCHA 4OO5A 4Q5QA 4N30A 3GX8A 2HSMB 1NM3A 3KJYA 4GXZA 5H5SA 2NVLA 3HHVA 19GSA 2OE3A 3IXRA 3Q6OA 2LEGA 1SYXA 2HRAA 4K7IA 3GHAA 4PGTA 3ZYWA 3KTBA 4I8BA 1UA5A 4FO5A 1PX6A 2JSZA 4E8HA
chains in the Genus database with same CATH superfamily
4EDYA 4HDEA 3VWUA 5D9TA 2KP1A 2HZEA 1PKWA 3LXZA 2CT6A 1SJIA 5E4WA 2YJ7A 1OC3A 4L8EA 4CDOA 3HKRA 4LL4B 4G2EA 2H19A 4HOJA 3I6AA 4K6XA 1EEJA 4WR5A 1A23A 2JACA 5F0GA 3O3TA 3NOFA 4MZBA 5DJMA 5ECOB 1A2JA 4RUVA 2C80A 4NHZA 5A5HA 1GSEA 1IYIA 4WKWA 3QCPA 3CXGA 1V57A 2OACA 2H6YA 4GQCA 1O6JA 4OD7A 3A2VA 2VM1A 1JZDA 1Z6MA 2IMFA 1NHYA 1QGVA 1C72A 3UARA 1OE8A 1U6TA 4O7HA 4O32A 2DJ1A 4EKZA 3CTFA 2H6XA 4WBRD 1N8JA 2FLSA 1JZWA 1F9MA 4ECBA 2OBKA 4PHZC 2R0PA 2WB9A 1AAZA 1PX7A 3A2WA 2Z9SA 1G7EA 1MD4A 5B7CA 2FA8A 2GT5A 3F9UA 1FOHA 2GZZA 1TK5B 2CZ3A 3EURA 5DVBA 4TVEA 1GNEA 2PVQA 5DAKA 5A1NB 11GSA 3P7XA 3TKRA 2LV3A 3LXTA 1K0CA 3IPZA 1YKAA 1K0BA 5ECKB 5AISA 5J4UA 1YF1A 4XCSA 3D4TA 4GLTA 2HNLA 3IDVA 4X0XA 1PFOA 3FR6A 2FWFA 4GDFA 2B1LA 2GTUA 3RAZA 1THOA 4TKYA 5ECLB 1K3YA 3SWLA 1A0FA 3QD9A 3GSSA 2H66A 2WULA 3HMJG 1B8XA 3IHGA 2B3SA 1W4VA 2LRTA 1V98A 4YH2A 3DMLA 2R0CA 1PA3A 4KNDA 4WF5A 1H75A 2LJKA 4KSOA 1GH2A 2DJ0A 2MMAA 3KM6A 2BTOT 3ZLPA 3A2XA 5GSTA 2YANA 3EYTA 3GKXA 5KN2A 4Q5NA 1TRVA 1ZCPA 3FZ4A 4F9ZA 4PX1A 3Q18A 5CAXA 2GSRA 5KOWA 4V2NA 2H71A 1Y1UA 4X1UA 4XS4B 1I1IP 2OKAA 4H86A 4QL7A 4ML1A 1A8YA 2H73A 3UMAA 2GS3A 2HSHA 3HVVA 4PTSA 1WMJA 4PUAA 3E0UA 4PURA 2DIZA 5JWRB 1AQWA 3DD3A 3WD6A 5DALA 4MABA 1CQHA 3FRCA 2ES7A 4POBA 1Z3EA 3IC4A 1XXUA 4KH7A 4PQHA 4PI2C 1Y6EA 2KHPA 2YWOA 4RQRA 1QFNA 1JLVA 4KE3A 2CX3A 2LKUA 4V1Ap 5CRWA 3RPNA 2AV4A 3DKSA 3DVXA 3ZL5A 5JCWA 3D21A 3G7JA 1U87A 4BVXA 5GSSA 3FZAA 3TKPA 3IBHA 3R2QA 4GF0A 4BPYA 1G6WA 5ECMB 1V9WA 2YNXA 2I4AA 1CQGA 4AJ6A 4P3YB 4MF7A 5L71A 1TU7A 3GIXA 5F8BA 4HUAA 3DWVA 4HJMA 4PI0C 4IN0A 1JZOA 3TRXA 2LS5A 2A4VA 3FR9A 3PINA 5G1KA 5DBQA 3N9JA 3EU4A 1SVLA 5F05A 3UIWA 4J57E 9GSSA 4I5QA 2NTOA 3VK9A 5IM9A 2KP2A 1TXXA 1EZKA 5BMUA 3ZFBA 4G0KA 2VCTA 2C3NA 4G0LA 1FB6A 1PL1A 2FA4A 2WW2A 4WETA 2WVXB 2P31A 4JU5A 2H74A 2PERA 2KUCA 5IIZA 4HJ2A 3TKSA 1TOFA 3CTGA 2R3XA 4MDCA 1OE7A 2FD3A 1U3IA 3HYPA 1VF4A 2L59A 4FXYP 2H0IA 3HVSA 4FIWA 4JR6A 3BCKA 3CMIA 3V1WA 2UZ8A 1ON4A 2L4QA 3I69A 4MJAA 2IMEA 2C8UA 1KNGA 1OKDA 3G7IA 4HQSA 3HJOA 3GN3A 3TB2A 2O8VB 6GSUA 1AXDA 5EPFA 3KEBA 3ERFA 1OYJA 1EV4A 5G30A 4D73B 1SL2B 2AHEA 4IQAA 2DMMA 1UN2A 3LGCA 1XWGA 4BL7B 4IGJA 1GLQA 4WR4A 2M80A 5KN0A 3AY8A 1MDJA 4I6XA 2WVYA 1O85A 1JFUA 3U6VA 4IELA 1T3BA 2H6ZA 1SVMA 1SYRA 2MMZA 2WFCA 3M1GA 1M2BA 2X49A 4YQUA 4N10A 2I3YA 4TW5A 3N5OA 2N5AA 3J7Yb 1AQXA 2H0HA 2WRTA 5HQPA 3VPTA 2XPEA 4J2FA 5CP1A 5EY6A 3H1NA 3MWHA 1HNBA 3GFKA 4TR1B 4V1Ag 3IK9A 5HR2A 3IK7A 4ZBBA 2FCHA 3GNJA 4MH3A 1SK0A 2RUEA 3UAPA 1PL2A 5ECHB 2VD1A 1YEXA 1KTEA 2EIRA 3KD0A 1FO5A 3U5RE 1V2AA 2B7JA 4LA1A 3C1RA 4ILFA 4O5RA 2CAIA 1R26A 2F9SA 1X9SB 4POMA 3CSHA 3F3RA 3RBTA 1OKTA 1GRXA 4AJ8A 3G7YA 3GL3A 3QMXA 3IRAA 3IV4A 1F6MC 2LRCA 1XOAA 2HRNA 1O81A 2JSYA 4EVMA 1FG4A 5FT3A 1B4PA 2XPDA 4V2MA 2GSTA 3J7Yk 2X8HA 2WGRA 2VLVA 3TJJA 4PNGA 3LQ7A 5G5EA 2PN8A 2GT6A 3RPPA 5JCUA 1FB0A 3S9FA 1R5PA 3D4MA 2PVOC 5IQYA 8GSSA 2DMLA 3LYKA 5D9XA 3GH6A 3IHQA 2J23A 1K0MA 3UJ1A 3C7MA 4EXJA 5COHA 4XHMA 1GTAA 1M3JA 3DRNA 3F3QA 4GRFA 5DQYA 3F6FA 4POKA 3VPQA 3FYGA 5A1NA 3FK8A 1ZZYA 1MEKA 2ON7A 4WXTA 2HSYA 5HFGA 4TOPA 2LJAA 4IKHA 2RM5A 1ML6A 1V58A 4MLYA 5J47A 1M2DA 3GSTA 4A5PA 3HZ4A 5A4VA 3ED3A 1PGTA 3WYWA 1XVWA 5AGYA 5ECIB 1JLWA 2ALBA 3D6IA 4XS1A 3K8NA 2C4JA 4IP1A 3TKQA 5A4UA 2GZYA 3R3EA 4RQXA 3Q19A 1EGOA 1VGLA 12GSA 4ECJA 4Z2UA 2WDUA 4KX4A 3QDNA 4PXOA 2NDOA 3ZITA 2IIYA 2HE3A 1MTCA 2DJ2A 6GSVA 3IC8A 1GUKA 3ERWA 3KZQA 2R4VA 1U3AA 3KP8A 4OMVA 2R2JA 1SKSB 2IFQB 2XC2A 4QMKA 3ERGA 2VCVA 2DBCA 2V2GA 3EVIA 3BJ5A 3DGQA 3BBYA 1BQ7A 4IQ1A 2RUFA 4XS4A 1S4BP 4TR0A 2HSNB 3O6TA 1SKWB 2MZCA 2OE1A 1WOUA 2FWEA 5IMCA 4X43A 3EC3A 3KCMA 5IMFA 1WE0A 3OR5A 4BWSA 1I9DA 4MH2A 4V2LA 2CA8A 3HD5A 3I9V2 3L9SA 1X9MB 2RM6A 3WGEA 2F8AA 1URMA 1M2AA 1O8WA 2GZPA 1PMTA 2PMTA 1ZMAA 1YJ6A 3GRXA 2DSAA 2CZ2A 3EWLA 5D73A 3FY7A 1R4WA 5C00A 4DVCA 2GQMA 5E59A 20GSA 3CYNA 3RFRC 2HXKA 4XRDA 3E9JB 3IE3A 4MPFA 1Z7RA 1TP9A 2H1GA 5EVOA 4GWRA 4N0ZA 2C0DA 2LQOA 4ZL9A 1G0TA 4DEJA 4IBPA 3ZRDA 3RHBA 1XOBA 3BCIA 1YVLA 1H4OA 5B6NA 1IYHA 1PQNA 3HA9A 1XVQA 1S3AA 2O5VA 2PWJA 3HJPA 1YQ1A 1GTBA 3WT1A 2E2MA 1F3AA 4G10A 4L0WA 1BYEA 4TXVA 4KAEA 4PNFA 4FYBA 1G7OA 1WJKA 3HVXA 1YKCA 5LCZA 1AW9A 1E6BA 2O89A 2VCQA 3FR3A 4BA7A 5IOWA 5A34B 3O76A 1K3OA 5D96A 2CAQA 4AKGA 4AKXB 5AIVA 2UV8G 4AKHA 1TTZA 1GWCA 2WVXA 4YKGA 5D8IA 2DC5A 4AKIA 2GSSA 5DDLA 2X4AA 1M99A 3QAWA 4EDZA 4KUNA 3H4KA 5HR1A 4IHUA 4Q5RA 4GSNA 3TU3B 3HCZA 4K7OA 5J41A 2XBQA 5A5KA 4KA0A 1EGRA 2QKEA 3D5JA 3EU3A 1ERUA 2C1YA 2LJRA 4ZILA 2HT9A 4JBBA 3GMFA 3ZMLA 3PGTA 2YN1A 4RI6A 2JZSA 1GSYA 2E0QA 4D73A 2WZ9A 4IW9A 2K9FA 4DSRA 2K8VA 3CSJA 1G6YA 2YWIA 2DLXA 6GSXA 1GUHA 2HI7A 3UBLA 1SK1A 2A4HA 4MCUA 1SL0B 1J0FA 2YOIA 5HFKA 5HR3A 3WT2A 5FHIA 4L5OA 3FKFA 2JADA 5A4WA 5G2ZA 3LFLA 5F06A 4G01A 4HI7A 1O8XA 4XIHA 4CY6A 2AJQB 1UVZA 5CNWA 2H70A 4GSTA 2H1DA 1TXUA 5IO2A 4MPGA 3LEFA 4RI7A 4TR1A 2JZTA 1KEBA 4MJBA 1EP8A 1MD3A 2AAWA 17GSA 1F37A 4OO4A 1GUMA 2TIRA 1NSWA 5IPGA 4WBJA 1QUWA 3ZVJA 1GSDA 2ZUPA 2OJLA 3ZTLA 3VLNA 1T4ZA 4LLRA 2OT3A 1TRSA 1B9YC 4K2XA 1SD9A 2YP6A 2CVDA 2IMIA 3ZIVA 1S3CA 4ZL8A 3GURA 4AI6A 1VF2A 2TRXA 1XW9A 3KGKA 5IOXA 1ST9A 4Q5FA 2K8SA 2YZHA 4TRXA 2NPBA 3VWXA 5CRDA 4K8MA 3F4RA 2B6MA 5B8BA 1AQVA 4F0BA 3F6DA 1SJZA 2HLSA 22GSA 5J5NA 4DSSB 1WP0A 1Z6NA 2HRFA 2L6DA 2FNOA 4ACSA 2VAFA 3ME8A 4MP4A 5JWOB 2TRCP 2EC4A 1SD8A 3KTLA 2VCZA 2H0GA 4JEDA 3TGZA 2BJXA 1XWKA 2X8CA 1M9BA 4W66A 3FZ5A 1JHBA 4FQUA 4K9ZA 3VI7A 1GSUA 4KCAA 3HXSA 2B5YA 1ABAA 2K6VA 3M8NA 4MA9A 4OCFA 2OA7A 5IMVA 1ZYNA 1LBKA 5CYYA 3TKSC 1OC8A 2I1UA 1TKDB 2EIOA 2VCWA 4E8EA 2LQQA 1BG1A 4IS0A 4KSMA 4LMVA 4OWYA 1O73A 2WJUA 1HNCA 4YKFA 6GSWA 2GLRA 3C8EA 3EPTA 2PBJA 2VO4A 2DKHA 4ECIA 1GNWA 1VF1A 4OFNA 2REMA 2I9HA 2HSMA 5J9BA 1EP7A 1V40A 2EFEA 3TCOA 3TRPA 1PRXA 5KN1A 3WGXA 2KLXA 4J56E 1NHOA 5IMZA 2GQLA 1I5GA 4BVYB 2JL4A 1SL1B 1PSQA 4LMWA 2IFQA 3DEXA 5DQSA 1YF0A 1XG8A 5IO0A 1FVJA 1X9WB 3UEMA 1ZL9A 2DIYA 4X4JA 2HSNA 3APSA 3TKSE 1XCCA 1UC7A 2L5LA 3US3A 2HRKB 2VLUA 2IN3A 5D9WA 1W89A 1MDKA 3MYDA 1J9BA 2QA1A 1FW1A 5D93A 1LJRA 3GKMA 3ZMKA 2L5OA 4MNNA 4OFTA 3GTUB 1XW5A 2CVKA 2G0FA 4BWQA 1TK8B 1R5AA 4LL1B 1WPIA 5KOXA 2LRNA 2EIQA 2VUPA 1FHEA 3PPUA 1RK4A 5ENUA 3ISOA 2M46A 2LUSA 1USBA 4MZCA 2CVBA 4K0GA 4JZQA 3LORA 1Z7PA 4BIKA 3HZ8A 4HSCX 3IA1A 1M7TA 4TR3A 3D0ZA 1JZRA 2IJYA 4EIQA 1O7UA 5AIXA 1XW6A 4FYUA 3GA4A 2VL9A 3KP9A 4F82A 3KH9A 4DSQA 2C3TA 1EOHA 3ZZXA 2MMOA 1K3LA 4MF6A 3DYRA 4E68A 2MBTA 1YEWC 2L4CA 5JCGA 1BEDA 2VOCA 5FWGA 1ACVA 4MF5A 3CQFA 3W6GA 5H5RA 1EV9A 1XBSA 4XTSA 2A2RA 2HQTA 2C3QA 2PUKC 3W8JA 1PD21 1THXA 1TJDA 4GSSA 5ELGA 1A0RP 2O87A 2CV4A 3GKNA 3LJRA 3UOMA 16GSA 1AIUA 3Q74A 3LSZA 4YQVA 2CQ9A 5F07A 4ML6A 3WGDA 4ZB8A 1TRWA 1GSSA 5IMDA 2H1LA 2VD0A 4ZXGA 1T1VA 3M3MA 5KEJA 2F3MA 5ELAA 3TOUA 1A2MA 3H8QA 2JU5A 3F4SA 4HQZA 1M0UA 2RIIA 2D2ZA 2L6CA 2B1KA 1N2AA 2OE0A 2YV7A 1XIYA 3G9BA 1E2YA 4I97A 1K0AA 3IOSA 2V1MA 5J4YA 3DIEA 4EUYA 5CREA 3L4NA 3TJFA 2OADA 3CRUA 1XFLA 4TR4A 2H8LA 1GSFA 3M9KA 5KN3A 2IPAA 2HFDA 3VWVA 2LSTA 2DKIA 2MMNA 1BF5A 3GX0A 4ZBAA 3C1SA 1FVKA 3QPMA 3TRQA 5C04A 3A3TA 4TXOB 1QQ2A 1Q98A 4Z7XA 1PN9A 1B9XC 3F4TA 3IR4A 3F8UA 3SBCA 1XZOA 4HS1A 4WF4A 5H5QA 2MYGA 14GSA 4Z2RA 2YPMA 3CBUA 1NW2A 2FHEA 3VFIA 1VF3A 3ZREA 4YAVA 2YCDA 2R5GA 5ABRA 3HJMA 1B4QA 3A5IA 3RDWA 1EWXA 2I81A 4KW6A 1OC9B 1ERWA 4KB3A 1S3DA 2GQKA 4EIPA 2FY6A 2YWNA 1SU9A 3JCML 2QA2A 3D22A 10GSA 1DBYA 2V41A 5EL8A 2DJ3A 1FAAA 1GL8A 4IVFA 1TRUA 4NMUA 1TW9A 3GL5A 1SKRB 4PUFC 1HD2A 1XPVA 3MIXA 1LU4A 3VURA 3GYKA 1K0DA 2P5QA 2H30A 2IMKA 2C0EA 2QC7A 2H75A 1XWAA 1T8EB 3M9JA 3C71A 1ERTA 13GSA 2WVZA 3E3EA 4NV5A 1SJ6A 1HNAA 1EEMA 4PQ1A 2O36A 1T7PB 2XHFA 4MZWA 4GCIA 4K5RA 5ID2B 1B48A 5LD0A 2N5FA 2A2SA 2GGTA 4DSSA 3IAM2 2ZNMA 2LTKA 3EMXA 1M9AA 4NV2A 3VWWA 3GUSA 1T4YA 2G2QA 3HY2A 3QFBC 1AC1A 2FWGA 5IMAA 4IP6A 5J9CA 6GSSA 1DE2A 2K18A 1QK8A 1TI1A 1VRSD 2WW1A 3QFAC 2IL3A 2IMDA 5D9VA 2X99A 2WZSA 1WRYA 2HZEB 3ME7A 2EFDA 4KDUA 4HEA2 4GQFA 4ISDA 1ZOFA 2WS2A 1SK2A 4FYCA 2LNSA 2EFHA 2EFCA 4JE1A 4O5UA 3CRTA 1WIKA 4ID0A 4BL7A 5ECQB 1A2LA 3LYPA 5A5HB 4N11A 3KMOA 5B8AA 4EE0A 1Z5YE 4KGIA 2DJKA 1ZYQB 4ZB6A 4QQ7A 4NXIA 1GTIA 5DCGA 4KF9A 1ZYPA 3QOUA 3HDCA 2E7PA 3LG6A 4MK3A 3KXOA 2YJHA 3H93A 1K0NA 4JR4A 2O3EA 1ZYEA 4IJIA 4N3ZA 4WEYA 5ECPB 3APOA 2PGTA 2N5BA 1J08A 2R6KA 2E2GA 5GAPD 2VLTA 5JWQB 4BVYA 1Y25A 3F63A 4ZB9A 2F51A 3NZNA 3BD2A 3CWGA 2FUG2 3GV1A 2R0GA 4GTUA 4G9HA 2OBIA 5CRGA 2QSIA 5INYA 2NBSA 5HR0A 1GP1A 4F0CA 1YY7A 4NAXA 2VCXA 3KIJA 4JRRA 2X8GA 1GULA 1TU8A 4EO3A 4HU9A 4L5LA 5DAKB 4F03A 4OCEA 4ICYA 2O85A 4MJCA 2HRKA 4K1FA 4K5SA 4ULXA 2PPTA 1BX9A 3BOAA 4PQIA 2C0FA 3QR6A 4KDXA 1QXHA 2H01A 4K2DA 2PU9C 3GTUA 1YZXA 3KMNA 4G19A 3EMPA 6GSYA 4FH8A 1DE1A 4EL1A 1ZGNA 1QMVA 4HU7A 2IWTA 4NPBA 2KOKA 1OAZA 3LWAA 4ZL7A 4I2TA 3TJBA 2AUVA 2ZCTA 2WW3A 2R37A 3CHXC 1SENA 1TI3A 1GSQA 3ZIJA 4QL9A 1X5EA 3M0FA 4HZ4A 3RGBC 1M3IA 1X0RA 2BMXA 4I2UA 1F2EA 4N0VA 4KCEA 4F2IA 3L9UA 3P2AA 3VI5A 1R7HA 5B6MA 2AYTA 2HZFA 3QAVA 4L0UA 2MBSA 1YEPA 4MMMA 3EE2A 2FGXA 3H79A 3KH7A 3L9VA 2P0GA 4HZ2A 4YAPA 2HYXA 4AF2A 3MNGA 2B7KA 4EC0A 2VL3A 3HVNA 4NHWA 1WWJA 7GSSA 3P90A 3P8WA 3GKKA 3MSZA 5J40A 5DALB 3UBKA 5J3RA 5CRHA 1HYUA 1KBNA 1TK0B 5ECNB 3DVWA 3PR8A 1YDKA 3MDKA 4MJEA 5G1LA 2YZUA 2H76A 2DJJA 4CY8A 4Z2TA 3L0HA 4ECCA 3ZVJD 2X64A 3MAKA 4YQMA 5AN1A 3ZFLA 2QGVA 1XWCA 2A2PA 5J4VA 3UVTA 2FWHA 3EINA 1Q4JA 5CO3A 1SVOA 4K7NA 1RQMA 1BJXA 2GVPA 2M72A 1X5CA 2WCIA 1A8LA 2P5RA 5GZZB 4NWYA 3A5WA 5HFIA 2V32A 1RW1A 4G0IA 4BVXB 2ON5A 2JZRA 3CSIA 3I43A 4CHSA 3TDGA 2H1AA 2H1BA 1GTUA 4ZB7A 3FHKA 3FEUA 1FOVA 4EF0A 1ERVA 18GSA 1EOGA 5ECSA 3UVHA 1K0OA 1TDIA 3APQA 5BRTA 4TXOA 2B5EA 2VKZG 1AUCA 4IJ3A 2GDRA 2LNTA 5G5FA 3TJGA 1DUGA 1PN0A 1U88A 2YWMA 3TJKA 4K0NA 3PH9A 4OFMA 3TUEA 1BAYA 5BMUB 5G31A 4AJ7A 3RHCA 4O5QA 2H72A 4TN8A 2F8FA 2J9HA 4ZBDA 2VL2A 2YV9A 1Z9HA 1X5DA 1DSBA 1ILOA 1HQOA 2AB6A 4AGSA 1OC9A 3NIVA 3UL3A 3TOTA 4O92A 6GSTA 1A24A 1BG5A 3W8SA 1MDIA 4KDYA 3FZ9A 1PKZA 3L78A 3IAS2 4ZIJA 2XBIA 3GH9A 4USSA 3DXBA 3F0IA 1T00A 2V6KA 1OVNA 2VL2C 2CX4A 5ECRB 5DJLA 2B5XA 2VM2A 1F3BA 5LNKe 2WW0A 1S3RA 2RLIA 2V6OA 5GAND 4XS6A 5IPHA 4POLA 1GLPA 2C0GA 4CW9A 2VIMA 3QAGA 2O7KA 5A34A 3FW2A 2L57A 3C73A 2GSQA 4XRAA 1XWBA 5ID2A 5DCHA 4OO5A 4Q5QA 4N30A 3GX8A 2HSMB 1NM3A 3KJYA 4GXZA 5H5SA 2NVLA 3HHVA 19GSA 2OE3A 3IXRA 3Q6OA 1N25A 2LEGA 1SYXA 2HRAA 4K7IA 3GHAA 4PGTA 3ZYWA 3KTBA 4I8BA 3LW9A 1UA5A 4FO5A 1PX6A 3FMWA 2JSZA 4E8HA
chains in the Genus database with same CATH topology
4EDYA 4HDEA 3VWUA 5D9TA 2KP1A 2HZEA 1PKWA 3LXZA 2CT6A 1SJIA 5E4WA 2YJ7A 1OC3A 4L8EA 4CDOA 3HKRA 4LL4B 4G2EA 2H19A 4HOJA 3I6AA 4K6XA 1EEJA 4WR5A 1A23A 2JACA 5F0GA 3O3TA 3NOFA 4MZBA 5DJMA 5ECOB 1A2JA 4RUVA 2C80A 4NHZA 5A5HA 1GSEA 1IYIA 4WKWA 3QCPA 3CXGA 1V57A 2OACA 2H6YA 4GQCA 1O6JA 4OD7A 3A2VA 2VM1A 1JZDA 1Z6MA 2IMFA 1NHYA 1QGVA 1C72A 3UARA 1OE8A 1U6TA 4O7HA 4O32A 2DJ1A 4EKZA 3CTFA 2H6XA 4WBRD 1N8JA 2FLSA 1JZWA 1F9MA 4ECBA 2OBKA 2R0PA 2WB9A 1AAZA 1PX7A 3A2WA 2Z9SA 1G7EA 1MD4A 5B7CA 2FA8A 2GT5A 3F9UA 1FOHA 2GZZA 1TK5B 2CZ3A 3EURA 5DVBA 4TVEA 1GNEA 2PVQA 5DAKA 5A1NB 11GSA 3P7XA 3TKRA 2LV3A 3LXTA 1K0CA 3IPZA 1YKAA 1K0BA 5ECKB 5AISA 5J4UA 1YF1A 4XCSA 3D4TA 4GLTA 2HNLA 3IDVA 4X0XA 3FR6A 2FWFA 4GDFA 2B1LA 2GTUA 3RAZA 1THOA 4TKYA 5ECLB 1K3YA 3SWLA 1A0FA 3QD9A 3GSSA 2H66A 2WULA 3HMJG 1B8XA 3IHGA 2B3SA 1W4VA 2LRTA 1V98A 4YH2A 3DMLA 2R0CA 1PA3A 4KNDA 4WF5A 1H75A 2LJKA 4KSOA 1GH2A 2DJ0A 2MMAA 3KM6A 2BTOT 3ZLPA 3A2XA 5GSTA 2YANA 3EYTA 3GKXA 5KN2A 4Q5NA 1TRVA 1ZCPA 3FZ4A 4F9ZA 4PX1A 3Q18A 5CAXA 2GSRA 5KOWA 4V2NA 2H71A 1Y1UA 4X1UA 4XS4B 2OKAA 4H86A 4QL7A 4ML1A 1A8YA 2H73A 3UMAA 2GS3A 2HSHA 3HVVA 4PTSA 1WMJA 4PUAA 3E0UA 4PURA 2DIZA 5JWRB 1AQWA 3DD3A 3WD6A 5DALA 4MABA 1CQHA 3FRCA 2ES7A 4POBA 1Z3EA 3IC4A 1XXUA 4KH7A 4PQHA 1Y6EA 2KHPA 2YWOA 4RQRA 1QFNA 1JLVA 4KE3A 2CX3A 2LKUA 4V1Ap 5CRWA 3RPNA 2AV4A 3DKSA 3DVXA 3ZL5A 5JCWA 3D21A 3G7JA 1U87A 4BVXA 5GSSA 3FZAA 3TKPA 3IBHA 3R2QA 4GF0A 4BPYA 1G6WA 5ECMB 1V9WA 2YNXA 2I4AA 1CQGA 4AJ6A 4P3YB 4MF7A 5L71A 1TU7A 3GIXA 5F8BA 4HUAA 3DWVA 4HJMA 4IN0A 1JZOA 3TRXA 2LS5A 2A4VA 3FR9A 3PINA 5G1KA 5DBQA 3N9JA 3EU4A 1SVLA 5F05A 3UIWA 4J57E 9GSSA 4I5QA 2NTOA 3VK9A 5IM9A 2KP2A 1TXXA 1EZKA 5BMUA 3ZFBA 4G0KA 2VCTA 2C3NA 4G0LA 1FB6A 1PL1A 2FA4A 4WETA 2P31A 4JU5A 2H74A 2PERA 2KUCA 5IIZA 4HJ2A 3TKSA 1TOFA 3CTGA 2R3XA 4MDCA 1OE7A 2FD3A 1U3IA 3HYPA 1VF4A 2L59A 2H0IA 3HVSA 4FIWA 4JR6A 3BCKA 3CMIA 3V1WA 2UZ8A 1ON4A 2L4QA 3I69A 4MJAA 2IMEA 2C8UA 1KNGA 1OKDA 3G7IA 4HQSA 3HJOA 3GN3A 3TB2A 2O8VB 6GSUA 1AXDA 5EPFA 3KEBA 3ERFA 1OYJA 1EV4A 5G30A 4D73B 1SL2B 2AHEA 4IQAA 2DMMA 1UN2A 3LGCA 1XWGA 4BL7B 4IGJA 1GLQA 4WR4A 2M80A 5KN0A 3AY8A 1MDJA 4I6XA 1O85A 1JFUA 3U6VA 4IELA 1T3BA 2H6ZA 1SVMA 1SYRA 2MMZA 2WFCA 3M1GA 1M2BA 2X49A 4YQUA 4N10A 2I3YA 4TW5A 3N5OA 2N5AA 3J7Yb 1AQXA 2H0HA 2WRTA 5HQPA 3VPTA 2XPEA 4J2FA 5CP1A 5EY6A 3H1NA 3MWHA 1HNBA 3GFKA 4TR1B 4V1Ag 3IK9A 5HR2A 3IK7A 4ZBBA 2FCHA 3GNJA 4MH3A 1SK0A 2RUEA 3UAPA 1PL2A 5ECHB 2VD1A 1YEXA 1KTEA 2EIRA 3KD0A 1FO5A 3U5RE 1V2AA 2B7JA 4LA1A 3C1RA 4ILFA 4O5RA 2CAIA 1R26A 2F9SA 1X9SB 4POMA 3CSHA 3F3RA 3RBTA 1OKTA 1GRXA 4AJ8A 3G7YA 3GL3A 3QMXA 3IRAA 3IV4A 1F6MC 2LRCA 1XOAA 2HRNA 1O81A 2JSYA 4EVMA 1FG4A 5FT3A 1B4PA 2XPDA 4V2MA 2GSTA 3J7Yk 2X8HA 2WGRA 2VLVA 3TJJA 4PNGA 3LQ7A 5G5EA 2PN8A 2GT6A 3RPPA 5JCUA 1FB0A 3S9FA 1R5PA 3D4MA 2PVOC 5IQYA 8GSSA 2DMLA 3LYKA 5D9XA 3GH6A 3IHQA 2J23A 1K0MA 3UJ1A 3C7MA 4EXJA 5COHA 4XHMA 1GTAA 3DRNA 3F3QA 4GRFA 5DQYA 3F6FA 4POKA 3VPQA 3FYGA 5A1NA 3FK8A 1ZZYA 1MEKA 2ON7A 4WXTA 2HSYA 5HFGA 4TOPA 2LJAA 4IKHA 2RM5A 1ML6A 1V58A 4MLYA 5J47A 1M2DA 3GSTA 4A5PA 3HZ4A 5A4VA 3ED3A 1PGTA 3WYWA 1XVWA 5AGYA 5ECIB 1JLWA 2ALBA 3D6IA 4XS1A 3K8NA 2C4JA 4IP1A 3TKQA 5A4UA 2GZYA 3R3EA 4RQXA 3Q19A 1EGOA 1VGLA 12GSA 4ECJA 4Z2UA 2WDUA 4KX4A 3QDNA 4PXOA 2NDOA 3ZITA 2IIYA 2HE3A 1MTCA 2DJ2A 6GSVA 3IC8A 1GUKA 3ERWA 3KZQA 2R4VA 1U3AA 3KP8A 4OMVA 2R2JA 1SKSB 2IFQB 2XC2A 4QMKA 3ERGA 2VCVA 2DBCA 2V2GA 3EVIA 3BJ5A 3DGQA 3BBYA 1BQ7A 4IQ1A 2RUFA 4XS4A 4TR0A 2HSNB 3O6TA 1SKWB 2MZCA 2OE1A 1WOUA 2FWEA 5IMCA 4X43A 3EC3A 3KCMA 5IMFA 1WE0A 3OR5A 4BWSA 1I9DA 4MH2A 4V2LA 2CA8A 3HD5A 3I9V2 3L9SA 1X9MB 2RM6A 3WGEA 2F8AA 1URMA 1M2AA 1O8WA 2GZPA 1PMTA 2PMTA 1ZMAA 1YJ6A 3GRXA 2DSAA 2CZ2A 3EWLA 5D73A 3FY7A 1R4WA 5C00A 4DVCA 2GQMA 5E59A 20GSA 3CYNA 2HXKA 4XRDA 3E9JB 3IE3A 4MPFA 1Z7RA 1TP9A 2H1GA 5EVOA 4GWRA 4N0ZA 2C0DA 2LQOA 4ZL9A 1G0TA 4DEJA 4IBPA 3ZRDA 3RHBA 1XOBA 3BCIA 1YVLA 1H4OA 5B6NA 1IYHA 1PQNA 3HA9A 1XVQA 1S3AA 2O5VA 2PWJA 3HJPA 1YQ1A 1GTBA 3WT1A 2E2MA 1F3AA 4G10A 4L0WA 1BYEA 4TXVA 4KAEA 4PNFA 4FYBA 1G7OA 1WJKA 3HVXA 1YKCA 5LCZA 1AW9A 1E6BA 2O89A 2VCQA 3FR3A 4BA7A 5IOWA 5A34B 3O76A 1K3OA 5D96A 2CAQA 4AKGA 4AKXB 5AIVA 2UV8G 4AKHA 1TTZA 1GWCA 4YKGA 5D8IA 2DC5A 4AKIA 2GSSA 5DDLA 2X4AA 1M99A 3QAWA 4EDZA 4KUNA 3H4KA 5HR1A 4IHUA 4Q5RA 4GSNA 3TU3B 3HCZA 4K7OA 5J41A 2XBQA 5A5KA 4KA0A 1EGRA 2QKEA 3D5JA 3EU3A 1ERUA 2C1YA 2LJRA 4ZILA 2HT9A 4JBBA 3GMFA 3ZMLA 3PGTA 2YN1A 4RI6A 2JZSA 1GSYA 2E0QA 4D73A 2WZ9A 4IW9A 2K9FA 4DSRA 2K8VA 3CSJA 1G6YA 2YWIA 2DLXA 6GSXA 1GUHA 2HI7A 3UBLA 1SK1A 2A4HA 4MCUA 1SL0B 1J0FA 2YOIA 5HFKA 5HR3A 3WT2A 5FHIA 4L5OA 3FKFA 2JADA 5A4WA 5G2ZA 3LFLA 5F06A 4G01A 4HI7A 1O8XA 4XIHA 4CY6A 2AJQB 1UVZA 5CNWA 2H70A 4GSTA 2H1DA 1TXUA 5IO2A 4MPGA 3LEFA 4RI7A 4TR1A 2JZTA 1KEBA 4MJBA 1EP8A 1MD3A 2AAWA 17GSA 1F37A 4OO4A 1GUMA 2TIRA 1NSWA 5IPGA 4WBJA 1QUWA 3ZVJA 1GSDA 2ZUPA 2OJLA 3ZTLA 3VLNA 1T4ZA 4LLRA 2OT3A 1TRSA 1B9YC 4K2XA 1SD9A 2YP6A 2CVDA 2IMIA 3ZIVA 1S3CA 4ZL8A 3GURA 4AI6A 1VF2A 2TRXA 1XW9A 3KGKA 5IOXA 1ST9A 4Q5FA 2K8SA 2YZHA 4TRXA 2NPBA 3VWXA 5CRDA 4K8MA 3F4RA 2B6MA 5B8BA 1AQVA 4F0BA 3F6DA 1SJZA 2HLSA 22GSA 5J5NA 4DSSB 1WP0A 1Z6NA 2HRFA 2L6DA 2FNOA 4ACSA 2VAFA 3ME8A 4MP4A 5JWOB 2TRCP 2EC4A 1SD8A 3KTLA 2VCZA 2H0GA 4JEDA 3TGZA 2BJXA 1XWKA 2X8CA 1M9BA 4W66A 3FZ5A 1JHBA 4FQUA 4K9ZA 3VI7A 1GSUA 4KCAA 3HXSA 2B5YA 1ABAA 2K6VA 3M8NA 4MA9A 4OCFA 2OA7A 5IMVA 1ZYNA 1LBKA 5CYYA 3TKSC 1OC8A 2I1UA 1TKDB 2EIOA 2VCWA 4E8EA 2LQQA 1BG1A 4IS0A 4KSMA 4LMVA 4OWYA 1O73A 2WJUA 1HNCA 4YKFA 6GSWA 2GLRA 3C8EA 3EPTA 2PBJA 2VO4A 2DKHA 4ECIA 1GNWA 1VF1A 4OFNA 2REMA 2I9HA 2HSMA 5J9BA 1EP7A 1V40A 2EFEA 3TCOA 3TRPA 1PRXA 5KN1A 3WGXA 2KLXA 4J56E 1NHOA 5IMZA 2GQLA 1I5GA 4BVYB 2JL4A 1SL1B 1PSQA 4LMWA 2IFQA 3DEXA 5DQSA 1YF0A 5IO0A 1FVJA 1X9WB 3UEMA 1ZL9A 2DIYA 4X4JA 2HSNA 3APSA 3TKSE 1XCCA 1UC7A 2L5LA 3US3A 2HRKB 2VLUA 2IN3A 5D9WA 1W89A 1MDKA 3MYDA 1J9BA 2QA1A 1FW1A 5D93A 1LJRA 3GKMA 3ZMKA 2L5OA 4MNNA 4OFTA 3GTUB 1XW5A 2CVKA 2G0FA 4BWQA 1TK8B 1R5AA 4LL1B 1WPIA 5KOXA 2LRNA 2EIQA 2VUPA 1FHEA 3PPUA 1RK4A 5ENUA 3ISOA 2M46A 2LUSA 1USBA 4MZCA 2CVBA 4K0GA 4JZQA 3LORA 1Z7PA 3HZ8A 3IA1A 1M7TA 4TR3A 3D0ZA 1JZRA 2IJYA 4EIQA 1O7UA 5AIXA 1XW6A 4FYUA 3GA4A 2VL9A 3KP9A 4F82A 3KH9A 4DSQA 2C3TA 1EOHA 3ZZXA 2MMOA 1K3LA 4MF6A 3DYRA 4E68A 2MBTA 2L4CA 5JCGA 1BEDA 2VOCA 5FWGA 1ACVA 4MF5A 3W6GA 5H5RA 1EV9A 1XBSA 4XTSA 2A2RA 2HQTA 2C3QA 2PUKC 3W8JA 1PD21 1THXA 1TJDA 4GSSA 5ELGA 1A0RP 2O87A 2CV4A 3GKNA 3LJRA 3UOMA 16GSA 1AIUA 3Q74A 3LSZA 4YQVA 2CQ9A 5F07A 4ML6A 3WGDA 4ZB8A 1TRWA 1GSSA 5IMDA 2H1LA 2VD0A 4ZXGA 1T1VA 3M3MA 5KEJA 2F3MA 5ELAA 3TOUA 1A2MA 3H8QA 2JU5A 3F4SA 4HQZA 1M0UA 2RIIA 2D2ZA 2L6CA 2B1KA 1N2AA 2OE0A 2YV7A 1XIYA 3G9BA 1E2YA 4I97A 1K0AA 3IOSA 2V1MA 5J4YA 3DIEA 4EUYA 5CREA 3L4NA 3TJFA 2OADA 3CRUA 1XFLA 4TR4A 2H8LA 1GSFA 3M9KA 5KN3A 2IPAA 2HFDA 3VWVA 2LSTA 2DKIA 2MMNA 1BF5A 3GX0A 4ZBAA 3C1SA 1FVKA 3QPMA 3TRQA 5C04A 3A3TA 4TXOB 1QQ2A 1Q98A 4Z7XA 1PN9A 1B9XC 3F4TA 3IR4A 3F8UA 3SBCA 1XZOA 4HS1A 4WF4A 5H5QA 2MYGA 14GSA 4Z2RA 2YPMA 3CBUA 1NW2A 2FHEA 3VFIA 1VF3A 3ZREA 4YAVA 2YCDA 2R5GA 5ABRA 3HJMA 1B4QA 3A5IA 3RDWA 1EWXA 2I81A 4KW6A 1OC9B 1ERWA 4KB3A 1S3DA 2GQKA 4EIPA 2FY6A 2YWNA 1SU9A 3JCML 2QA2A 3D22A 10GSA 1DBYA 2V41A 5EL8A 2DJ3A 1FAAA 1GL8A 4IVFA 1TRUA 4NMUA 1TW9A 3GL5A 1SKRB 4PUFC 1HD2A 1XPVA 3MIXA 1LU4A 3VURA 3GYKA 1K0DA 2P5QA 2H30A 2IMKA 2C0EA 2QC7A 2H75A 1XWAA 1T8EB 3M9JA 3C71A 1ERTA 13GSA 3E3EA 4NV5A 1SJ6A 1HNAA 1EEMA 4PQ1A 1T7PB 2XHFA 4MZWA 4GCIA 4K5RA 5ID2B 1B48A 5LD0A 2N5FA 2A2SA 2GGTA 4DSSA 3IAM2 2ZNMA 2LTKA 3EMXA 1M9AA 4NV2A 3VWWA 3GUSA 1T4YA 2G2QA 3HY2A 3QFBC 1AC1A 2FWGA 5IMAA 4IP6A 5J9CA 6GSSA 1DE2A 2K18A 1QK8A 1TI1A 1VRSD 3QFAC 2IL3A 2IMDA 5D9VA 2X99A 1WRYA 2HZEB 3ME7A 2EFDA 4KDUA 4HEA2 4GQFA 4ISDA 1ZOFA 2WS2A 1SK2A 4FYCA 2LNSA 2EFHA 2EFCA 4JE1A 4O5UA 3CRTA 1WIKA 4ID0A 4BL7A 5ECQB 1A2LA 3LYPA 5A5HB 4N11A 3KMOA 5B8AA 4EE0A 1Z5YE 4KGIA 2DJKA 1ZYQB 4ZB6A 4QQ7A 4NXIA 1GTIA 5DCGA 4KF9A 1ZYPA 3QOUA 3HDCA 2E7PA 3LG6A 4MK3A 3KXOA 2YJHA 3H93A 1K0NA 4JR4A 1ZYEA 4IJIA 4N3ZA 4WEYA 5ECPB 3APOA 2PGTA 2N5BA 1J08A 2R6KA 2E2GA 5GAPD 2VLTA 5JWQB 4BVYA 1Y25A 3F63A 4ZB9A 2F51A 3NZNA 3BD2A 3CWGA 2FUG2 3GV1A 2R0GA 4GTUA 4G9HA 2OBIA 5CRGA 2QSIA 5INYA 2NBSA 5HR0A 1GP1A 4F0CA 1YY7A 4NAXA 2VCXA 3KIJA 4JRRA 2X8GA 1GULA 1TU8A 4EO3A 4HU9A 4L5LA 5DAKB 4F03A 4OCEA 4ICYA 2O85A 4MJCA 2HRKA 4K1FA 4K5SA 4ULXA 2PPTA 1BX9A 3BOAA 4PQIA 2C0FA 3QR6A 4KDXA 1QXHA 2H01A 4K2DA 2PU9C 3GTUA 1YZXA 3KMNA 4G19A 3EMPA 6GSYA 4FH8A 1DE1A 4EL1A 1ZGNA 1QMVA 4HU7A 2IWTA 4NPBA 2KOKA 1OAZA 3LWAA 4ZL7A 4I2TA 3TJBA 2AUVA 2ZCTA 2R37A 1SENA 1TI3A 1GSQA 3ZIJA 4QL9A 1X5EA 3M0FA 4HZ4A 1X0RA 2BMXA 4I2UA 1F2EA 4N0VA 4KCEA 4F2IA 3L9UA 3P2AA 3VI5A 1R7HA 5B6MA 2AYTA 2HZFA 3QAVA 4L0UA 2MBSA 1YEPA 4MMMA 3EE2A 2FGXA 3H79A 3KH7A 3L9VA 2P0GA 4HZ2A 4YAPA 2HYXA 4AF2A 3MNGA 2B7KA 4EC0A 2VL3A 4NHWA 1WWJA 7GSSA 3P90A 3P8WA 3GKKA 3MSZA 5J40A 5DALB 3UBKA 5J3RA 5CRHA 1HYUA 1KBNA 1TK0B 5ECNB 3DVWA 3PR8A 1YDKA 3MDKA 4MJEA 5G1LA 2YZUA 2H76A 2DJJA 4CY8A 4Z2TA 3L0HA 4ECCA 3ZVJD 3MAKA 2X64A 4YQMA 5AN1A 3ZFLA 2QGVA 1XWCA 2A2PA 5J4VA 3UVTA 2FWHA 3EINA 1Q4JA 5CO3A 1SVOA 4K7NA 1RQMA 1BJXA 2GVPA 2M72A 1X5CA 2WCIA 1A8LA 2P5RA 5GZZB 4NWYA 3A5WA 5HFIA 2V32A 1RW1A 4G0IA 4BVXB 2ON5A 2JZRA 3CSIA 3I43A 4CHSA 3TDGA 2H1AA 2H1BA 1GTUA 4ZB7A 3FHKA 3FEUA 1FOVA 4EF0A 1ERVA 18GSA 1EOGA 5ECSA 3UVHA 1K0OA 1TDIA 3APQA 5BRTA 4TXOA 2B5EA 2VKZG 1AUCA 4IJ3A 2GDRA 2LNTA 5G5FA 3TJGA 1DUGA 1PN0A 1U88A 2YWMA 3TJKA 4K0NA 3PH9A 4OFMA 3TUEA 1BAYA 5BMUB 5G31A 4AJ7A 3RHCA 4O5QA 2H72A 4TN8A 2F8FA 2J9HA 4ZBDA 2VL2A 2YV9A 1Z9HA 1X5DA 1DSBA 1ILOA 1HQOA 2AB6A 4AGSA 1OC9A 3NIVA 3UL3A 3TOTA 4O92A 6GSTA 1A24A 1BG5A 3W8SA 1MDIA 4KDYA 3FZ9A 1PKZA 3L78A 3IAS2 4ZIJA 2XBIA 3GH9A 4USSA 3DXBA 3F0IA 1T00A 2V6KA 1OVNA 2VL2C 2CX4A 5ECRB 5DJLA 2B5XA 2VM2A 1F3BA 5LNKe 2RLIA 2V6OA 5GAND 4XS6A 5IPHA 4POLA 1GLPA 2C0GA 4CW9A 2VIMA 3QAGA 2O7KA 5A34A 3FW2A 2L57A 3C73A 2GSQA 4XRAA 1XWBA 5ID2A 5DCHA 4OO5A 4Q5QA 4N30A 3GX8A 2HSMB 1NM3A 3KJYA 4GXZA 5H5SA 2NVLA 3HHVA 19GSA 2OE3A 3IXRA 3Q6OA 1N25A 2LEGA 1SYXA 2HRAA 4K7IA 3GHAA 4PGTA 3ZYWA 3KTBA 4I8BA 3LW9A 1UA5A 4FO5A 1PX6A 3FMWA 2JSZA 4E8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EDY A;  4HDE A;  3VWU A;  5D9T A;  2KP1 A;  2HZE A;  1PKW A;  3LXZ A;  2CT6 A;  1SJI A;  5E4W A;  2YJ7 A;  1OC3 A;  4L8E A;  4CDO A;  3HKR A;  4LL4 B;  4G2E A;  2H19 A;  4HOJ A;  3I6A A;  4K6X A;  1EEJ A;  4WR5 A;  1A23 A;  2JAC A;  5F0G A;  3O3T A;  3NOF A;  4MZB A;  5DJM A;  5ECO B;  1A2J A;  4RUV A;  2C80 A;  4NHZ A;  1GSE A;  1IYI A;  4WKW A;  3QCP A;  3CXG A;  1V57 A;  2OAC A;  2H6Y A;  4GQC A;  1O6J A;  4OD7 A;  3A2V A;  2VM1 A;  1JZD A;  1Z6M A;  2IMF A;  1NHY A;  1QGV A;  1C72 A;  3UAR A;  1OE8 A;  1U6T A;  4O7H A;  4O32 A;  2DJ1 A;  4EKZ A;  3CTF A;  2H6X A;  4WBR D;  1N8J A;  2FLS A;  1JZW A;  1F9M A;  4ECB A;  2OBK A;  2WB9 A;  1AAZ A;  1PX7 A;  3A2W A;  2Z9S A;  1G7E A;  1MD4 A;  5B7C A;  2FA8 A;  2GT5 A;  3F9U A;  2GZZ A;  1TK5 B;  2CZ3 A;  3EUR A;  5DVB A;  4TVE A;  1GNE A;  2PVQ A;  5DAK A;  11GS A;  3P7X A;  3TKR A;  2LV3 A;  3LXT A;  1K0C A;  3IPZ A;  1YKA A;  1K0B A;  5ECK B;  5AIS A;  5J4U A;  1YF1 A;  4XCS A;  3D4T A;  4GLT A;  2HNL A;  3IDV A;  4X0X A;  3FR6 A;  2FWF A;  2B1L A;  2GTU A;  3RAZ A;  1THO A;  4TKY A;  5ECL B;  1K3Y A;  3SWL A;  1A0F A;  3QD9 A;  3GSS A;  2H66 A;  2WUL A;  1B8X A;  2B3S A;  1W4V A;  2LRT A;  1V98 A;  4YH2 A;  3DML A;  1PA3 A;  4KND A;  4WF5 A;  1H75 A;  2LJK A;  4KSO A;  1GH2 A;  2DJ0 A;  2MMA A;  3KM6 A;  2BTO T;  3ZLP A;  3A2X A;  5GST A;  2YAN A;  3EYT A;  3GKX A;  5KN2 A;  4Q5N A;  1TRV A;  1ZCP A;  3FZ4 A;  4F9Z A;  4PX1 A;  3Q18 A;  5CAX A;  2GSR A;  4V2N A;  2H71 A;  4X1U A;  4XS4 B;  2OKA A;  4H86 A;  4QL7 A;  4ML1 A;  1A8Y A;  2H73 A;  3UMA A;  2GS3 A;  2HSH A;  3HVV A;  4PTS A;  1WMJ A;  4PUA A;  3E0U A;  4PUR A;  2DIZ A;  5JWR B;  1AQW A;  3DD3 A;  3WD6 A;  5DAL A;  4MAB A;  1CQH A;  3FRC A;  2ES7 A;  4POB A;  1Z3E A;  3IC4 A;  1XXU A;  4KH7 A;  4PQH A;  1Y6E A;  2KHP A;  2YWO A;  4RQR A;  1QFN A;  1JLV A;  4KE3 A;  2CX3 A;  2LKU A;  4V1A p;  5CRW A;  3RPN A;  2AV4 A;  3DKS A;  3DVX A;  3ZL5 A;  5JCW A;  3D21 A;  3G7J A;  1U87 A;  4BVX A;  5GSS A;  3FZA A;  3TKP A;  3IBH A;  3R2Q A;  4GF0 A;  4BPY A;  1G6W A;  5ECM B;  1V9W A;  2YNX A;  2I4A A;  1CQG A;  4AJ6 A;  4P3Y B;  4MF7 A;  5L71 A;  1TU7 A;  3GIX A;  5F8B A;  4HUA A;  3DWV A;  4HJM A;  4IN0 A;  1JZO A;  3TRX A;  2LS5 A;  2A4V A;  3FR9 A;  3PIN A;  5G1K A;  5DBQ A;  3N9J A;  3EU4 A;  5F05 A;  3UIW A;  4J57 E;  9GSS A;  4I5Q A;  2NTO A;  3VK9 A;  5IM9 A;  2KP2 A;  1TXX A;  1EZK A;  5BMU A;  3ZFB A;  4G0K A;  2VCT A;  2C3N A;  4G0L A;  1FB6 A;  1PL1 A;  2FA4 A;  4WET A;  2P31 A;  4JU5 A;  2H74 A;  2PER A;  2KUC A;  5IIZ A;  4HJ2 A;  3TKS A;  1TOF A;  3CTG A;  2R3X A;  4MDC A;  1OE7 A;  2FD3 A;  1U3I A;  3HYP A;  1VF4 A;  2L59 A;  2H0I A;  3HVS A;  4FIW A;  4JR6 A;  3BCK A;  3CMI A;  3V1W A;  2UZ8 A;  1ON4 A;  2L4Q A;  3I69 A;  4MJA A;  2IME A;  2C8U A;  1KNG A;  1OKD A;  3G7I A;  4HQS A;  3HJO A;  3GN3 A;  3TB2 A;  2O8V B;  6GSU A;  1AXD A;  5EPF A;  3KEB A;  3ERF A;  1OYJ A;  1EV4 A;  5G30 A;  4D73 B;  1SL2 B;  2AHE A;  4IQA A;  2DMM A;  1UN2 A;  3LGC A;  1XWG A;  4BL7 B;  4IGJ A;  1GLQ A;  4WR4 A;  2M80 A;  5KN0 A;  3AY8 A;  1MDJ A;  4I6X A;  1O85 A;  1JFU A;  3U6V A;  4IEL A;  1T3B A;  2H6Z A;  1SYR A;  2MMZ A;  2WFC A;  3M1G A;  1M2B A;  4YQU A;  4N10 A;  2I3Y A;  4TW5 A;  3N5O A;  2N5A A;  3J7Y b;  1AQX A;  2H0H A;  2WRT A;  5HQP A;  3VPT A;  2XPE A;  4J2F A;  5CP1 A;  5EY6 A;  3H1N A;  3MWH A;  1HNB A;  3GFK A;  4TR1 B;  4V1A g;  3IK9 A;  5HR2 A;  3IK7 A;  4ZBB A;  2FCH A;  3GNJ A;  4MH3 A;  1SK0 A;  2RUE A;  3UAP A;  1PL2 A;  5ECH B;  2VD1 A;  1YEX A;  1KTE A;  2EIR A;  3KD0 A;  1FO5 A;  3U5R E;  1V2A A;  2B7J A;  4LA1 A;  4ILF A;  3C1R A;  4O5R A;  2CAI A;  1R26 A;  2F9S A;  1X9S B;  4POM A;  3CSH A;  3F3R A;  3RBT A;  1OKT A;  1GRX A;  4AJ8 A;  3G7Y A;  3GL3 A;  3QMX A;  3IRA A;  3IV4 A;  1F6M C;  2LRC A;  1XOA A;  2HRN A;  1O81 A;  2JSY A;  4EVM A;  1FG4 A;  5FT3 A;  1B4P A;  2XPD A;  4V2M A;  2GST A;  3J7Y k;  2X8H A;  2WGR A;  2VLV A;  3TJJ A;  4PNG A;  3LQ7 A;  5G5E A;  2PN8 A;  2GT6 A;  3RPP A;  5JCU A;  1FB0 A;  3S9F A;  1R5P A;  3D4M A;  2PVO C;  5IQY A;  8GSS A;  2DML A;  3LYK A;  5D9X A;  3GH6 A;  3IHQ A;  2J23 A;  1K0M A;  3UJ1 A;  3C7M A;  4EXJ A;  5COH A;  4XHM A;  1GTA A;  3DRN A;  3F3Q A;  4GRF A;  5DQY A;  3F6F A;  4POK A;  3VPQ A;  3FYG A;  3FK8 A;  1ZZY A;  1MEK A;  2ON7 A;  4WXT A;  2HSY A;  5HFG A;  4TOP A;  2LJA A;  4IKH A;  2RM5 A;  1ML6 A;  1V58 A;  4MLY A;  1M2D A;  3GST A;  3HZ4 A;  5A4V A;  3ED3 A;  1PGT A;  3WYW A;  1XVW A;  5AGY A;  5ECI B;  1JLW A;  2ALB A;  3D6I A;  4XS1 A;  3K8N A;  2C4J A;  4IP1 A;  3TKQ A;  5A4U A;  2GZY A;  3R3E A;  4RQX A;  3Q19 A;  1EGO A;  1VGL A;  12GS A;  4ECJ A;  2WDU A;  4KX4 A;  3QDN A;  4PXO A;  2NDO A;  3ZIT A;  2IIY A;  2HE3 A;  1MTC A;  2DJ2 A;  6GSV A;  3IC8 A;  1GUK A;  3ERW A;  3KZQ A;  2R4V A;  1U3A A;  3KP8 A;  4OMV A;  2R2J A;  1SKS B;  2IFQ B;  2XC2 A;  3ERG A;  2VCV A;  2DBC A;  2V2G A;  3EVI A;  3BJ5 A;  3DGQ A;  3BBY A;  1BQ7 A;  4IQ1 A;  2RUF A;  4XS4 A;  4TR0 A;  2HSN B;  3O6T A;  1SKW B;  2MZC A;  2OE1 A;  1WOU A;  2FWE A;  5IMC A;  4X43 A;  3EC3 A;  3KCM A;  5IMF A;  1WE0 A;  3OR5 A;  4BWS A;  1I9D A;  4MH2 A;  4V2L A;  2CA8 A;  3HD5 A;  3I9V 2;  3L9S A;  1X9M B;  2RM6 A;  3WGE A;  2F8A A;  1URM A;  1M2A A;  1O8W A;  2GZP A;  1PMT A;  2PMT A;  1ZMA A;  1YJ6 A;  3GRX A;  2DSA A;  2CZ2 A;  3EWL A;  5D73 A;  3FY7 A;  1R4W A;  5C00 A;  4DVC A;  2GQM A;  5E59 A;  20GS A;  3CYN A;  2HXK A;  4XRD A;  3E9J B;  3IE3 A;  4MPF A;  1Z7R A;  1TP9 A;  2H1G A;  5EVO A;  4GWR A;  4N0Z A;  2C0D A;  2LQO A;  4ZL9 A;  1G0T A;  4DEJ A;  4IBP A;  3ZRD A;  3RHB A;  1XOB A;  3BCI A;  1H4O A;  5B6N A;  1IYH A;  1PQN A;  3HA9 A;  1XVQ A;  1S3A A;  2PWJ A;  3HJP A;  1YQ1 A;  1GTB A;  3WT1 A;  2E2M A;  1F3A A;  4G10 A;  4L0W A;  1BYE A;  4TXV A;  4KAE A;  4PNF A;  4FYB A;  1G7O A;  1WJK A;  3HVX A;  1YKC A;  5LCZ A;  1AW9 A;  1E6B A;  2O89 A;  2VCQ A;  3FR3 A;  4BA7 A;  5IOW A;  3O76 A;  1K3O A;  5D96 A;  2CAQ A;  5AIV A;  1TTZ A;  1GWC A;  5D8I A;  2DC5 A;  2GSS A;  5DDL A;  1M99 A;  3QAW A;  4EDZ A;  4KUN A;  3H4K A;  5HR1 A;  4IHU A;  4Q5R A;  4GSN A;  3HCZ A;  4K7O A;  5J41 A;  2XBQ A;  5A5K A;  4KA0 A;  1EGR A;  2QKE A;  3D5J A;  3EU3 A;  1ERU A;  2C1Y A;  2LJR A;  4ZIL A;  2HT9 A;  4JBB A;  3GMF A;  3ZML A;  3PGT A;  2YN1 A;  4RI6 A;  2JZS A;  1GSY A;  2E0Q A;  4D73 A;  2WZ9 A;  4IW9 A;  2K9F A;  4DSR A;  2K8V A;  3CSJ A;  1G6Y A;  2YWI A;  2DLX A;  6GSX A;  1GUH A;  2HI7 A;  3UBL A;  1SK1 A;  4MCU A;  1SL0 B;  1J0F A;  2YOI A;  5HFK A;  5HR3 A;  3WT2 A;  5FHI A;  4L5O A;  3FKF A;  2JAD A;  5A4W A;  5G2Z A;  3LFL A;  5F06 A;  4HI7 A;  1O8X A;  4XIH A;  2AJQ B;  1UVZ A;  5CNW A;  2H70 A;  4GST A;  2H1D A;  5IO2 A;  4MPG A;  3LEF A;  4RI7 A;  4TR1 A;  2JZT A;  1KEB A;  4MJB A;  1EP8 A;  1MD3 A;  2AAW A;  17GS A;  1F37 A;  4OO4 A;  1GUM A;  2TIR A;  1NSW A;  5IPG A;  4WBJ A;  1QUW A;  3ZVJ A;  1GSD A;  2ZUP A;  2OJL A;  3ZTL A;  3VLN A;  1T4Z A;  4LLR A;  1TRS A;  1B9Y C;  1SD9 A;  2YP6 A;  2CVD A;  2IMI A;  3ZIV A;  1S3C A;  4ZL8 A;  3GUR A;  1VF2 A;  2TRX A;  1XW9 A;  3KGK A;  5IOX A;  1ST9 A;  4Q5F A;  2K8S A;  2YZH A;  4TRX A;  2NPB A;  3VWX A;  5CRD A;  4K8M A;  3F4R A;  2B6M A;  5B8B A;  1AQV A;  4F0B A;  3F6D A;  1SJZ A;  2HLS A;  22GS A;  5J5N A;  4DSS B;  1WP0 A;  1Z6N A;  2HRF A;  2L6D A;  2FNO A;  4ACS A;  2VAF A;  3ME8 A;  4MP4 A;  5JWO B;  2TRC P;  2EC4 A;  1SD8 A;  3KTL A;  2VCZ A;  2H0G A;  4JED A;  3TGZ A;  2BJX A;  1XWK A;  2X8C A;  1M9B A;  3FZ5 A;  1JHB A;  4FQU A;  4K9Z A;  3VI7 A;  1GSU A;  4KCA A;  3HXS A;  2B5Y A;  1ABA A;  2K6V A;  3M8N A;  4MA9 A;  4OCF A;  2OA7 A;  5IMV A;  1LBK A;  5CYY A;  3TKS C;  1OC8 A;  2I1U A;  1TKD B;  2EIO A;  2VCW A;  4E8E A;  2LQQ A;  4IS0 A;  4KSM A;  4LMV A;  4OWY A;  1O73 A;  2WJU A;  1HNC A;  6GSW A;  2GLR A;  3C8E A;  2PBJ A;  2VO4 A;  4ECI A;  1GNW A;  1VF1 A;  4OFN A;  2REM A;  2I9H A;  2HSM A;  5J9B A;  1EP7 A;  1V40 A;  3TCO A;  3TRP A;  1PRX A;  5KN1 A;  3WGX A;  2KLX A;  4J56 E;  1NHO A;  5IMZ A;  2GQL A;  1I5G A;  4BVY B;  2JL4 A;  1SL1 B;  1PSQ A;  4LMW A;  2IFQ A;  3DEX A;  5DQS A;  1YF0 A;  5IO0 A;  1FVJ A;  1X9W B;  3UEM A;  1ZL9 A;  2DIY A;  3APS A;  3TKS E;  1XCC A;  1UC7 A;  2L5L A;  3US3 A;  2HRK B;  2VLU A;  2IN3 A;  5D9W A;  1W89 A;  1MDK A;  1J9B A;  1FW1 A;  5D93 A;  1LJR A;  3GKM A;  3ZMK A;  2L5O A;  4OFT A;  3GTU B;  1XW5 A;  2CVK A;  2G0F A;  4BWQ A;  1TK8 B;  1R5A A;  4LL1 B;  1WPI A;  2LRN A;  2EIQ A;  2VUP A;  1FHE A;  3PPU A;  1RK4 A;  5ENU A;  3ISO A;  2M46 A;  2LUS A;  1USB A;  4MZC A;  2CVB A;  4K0G A;  4JZQ A;  3LOR A;  1Z7P A;  3HZ8 A;  3IA1 A;  1M7T A;  4TR3 A;  3D0Z A;  1JZR A;  2IJY A;  1O7U A;  5AIX A;  1XW6 A;  4FYU A;  3GA4 A;  2VL9 A;  3KP9 A;  4F82 A;  3KH9 A;  4DSQ A;  2C3T A;  1EOH A;  3ZZX A;  2MMO A;  1K3L A;  4MF6 A;  3DYR A;  2MBT A;  2L4C A;  5JCG A;  1BED A;  2VOC A;  5FWG A;  1ACV A;  4MF5 A;  3W6G A;  5H5R A;  1EV9 A;  1XBS A;  4XTS A;  2A2R A;  2HQT A;  2C3Q A;  2PUK C;  3W8J A;  1PD2 1;  1THX A;  1TJD A;  4GSS A;  5ELG A;  1A0R P;  2O87 A;  2CV4 A;  3GKN A;  3LJR A;  3UOM A;  16GS A;  1AIU A;  3Q74 A;  3LSZ A;  4YQV A;  2CQ9 A;  5F07 A;  4ML6 A;  3WGD A;  4ZB8 A;  1TRW A;  1GSS A;  5IMD A;  2VD0 A;  4ZXG A;  1T1V A;  3M3M A;  5KEJ A;  2F3M A;  5ELA A;  3TOU A;  1A2M A;  3H8Q A;  2JU5 A;  3F4S A;  4HQZ A;  1M0U A;  2RII A;  2D2Z A;  2L6C A;  2B1K A;  1N2A A;  2OE0 A;  2YV7 A;  1XIY A;  3G9B A;  1E2Y A;  4I97 A;  1K0A A;  3IOS A;  2V1M A;  3DIE A;  4EUY A;  5CRE A;  3L4N A;  3TJF A;  2OAD A;  3CRU A;  1XFL A;  4TR4 A;  2H8L A;  1GSF A;  3M9K A;  5KN3 A;  2IPA A;  2HFD A;  3VWV A;  2LST A;  2MMN A;  3GX0 A;  4ZBA A;  3C1S A;  1FVK A;  3QPM A;  3TRQ A;  5C04 A;  3A3T A;  4TXO B;  1QQ2 A;  1Q98 A;  4Z7X A;  1PN9 A;  1B9X C;  3F4T A;  3IR4 A;  3F8U A;  3SBC A;  1XZO A;  4HS1 A;  4WF4 A;  5H5Q A;  2MYG A;  14GS A;  2YPM A;  3CBU A;  1NW2 A;  2FHE A;  3VFI A;  1VF3 A;  3ZRE A;  4YAV A;  2YCD A;  2R5G A;  5ABR A;  3HJM A;  1B4Q A;  3RDW A;  1EWX A;  2I81 A;  4KW6 A;  4KB3 A;  1OC9 B;  1ERW A;  1S3D A;  2GQK A;  2FY6 A;  2YWN A;  1SU9 A;  3JCM L;  3D22 A;  10GS A;  1DBY A;  2V41 A;  5EL8 A;  2DJ3 A;  1FAA A;  1GL8 A;  4IVF A;  1TRU A;  4NMU A;  1TW9 A;  3GL5 A;  1SKR B;  4PUF C;  1HD2 A;  1XPV A;  1LU4 A;  3VUR A;  3GYK A;  1K0D A;  2P5Q A;  2H30 A;  2IMK A;  2C0E A;  2QC7 A;  2H75 A;  1XWA A;  1T8E B;  3M9J A;  3C71 A;  1ERT A;  13GS A;  3E3E A;  4NV5 A;  1SJ6 A;  1HNA A;  1EEM A;  4PQ1 A;  1T7P B;  2XHF A;  4MZW A;  4GCI A;  5ID2 B;  1B48 A;  5LD0 A;  2N5F A;  2A2S A;  2GGT A;  4DSS A;  3IAM 2;  2ZNM A;  2LTK A;  3EMX A;  1M9A A;  4NV2 A;  3VWW A;  3GUS A;  1T4Y A;  2G2Q A;  3HY2 A;  3QFB C;  1AC1 A;  2FWG A;  5IMA A;  4IP6 A;  5J9C A;  6GSS A;  1DE2 A;  2K18 A;  1QK8 A;  1TI1 A;  1VRS D;  3QFA C;  2IL3 A;  2IMD A;  5D9V A;  2X99 A;  1WRY A;  2HZE B;  3ME7 A;  4KDU A;  4HEA 2;  4GQF A;  4ISD A;  1ZOF A;  2WS2 A;  1SK2 A;  4FYC A;  2LNS A;  4JE1 A;  3CRT A;  1WIK A;  4ID0 A;  4BL7 A;  5ECQ B;  1A2L A;  3LYP A;  5B8A A;  4N11 A;  3KMO A;  4EE0 A;  1Z5Y E;  4KGI A;  2DJK A;  1ZYQ B;  4ZB6 A;  4QQ7 A;  4NXI A;  1GTI A;  5DCG A;  4KF9 A;  3QOU A;  3HDC A;  2E7P A;  3LG6 A;  4MK3 A;  3KXO A;  2YJH A;  3H93 A;  1K0N A;  4JR4 A;  1ZYE A;  4IJI A;  4WEY A;  5ECP B;  3APO A;  2PGT A;  2N5B A;  1J08 A;  2R6K A;  2E2G A;  5GAP D;  2VLT A;  5JWQ B;  4BVY A;  1Y25 A;  3F63 A;  4ZB9 A;  2F51 A;  3NZN A;  3BD2 A;  2FUG 2;  3GV1 A;  4GTU A;  4G9H A;  2OBI A;  5CRG A;  2QSI A;  5INY A;  2NBS A;  5HR0 A;  1GP1 A;  4F0C A;  1YY7 A;  4NAX A;  2VCX A;  3KIJ A;  4JRR A;  2X8G A;  1GUL A;  1TU8 A;  4EO3 A;  4HU9 A;  4L5L A;  5DAK B;  4F03 A;  4OCE A;  2O85 A;  4MJC A;  2HRK A;  4K1F A;  4ULX A;  2PPT A;  1BX9 A;  3BOA A;  4PQI A;  2C0F A;  3QR6 A;  4KDX A;  1QXH A;  2H01 A;  4K2D A;  2PU9 C;  3GTU A;  1YZX A;  3KMN A;  4G19 A;  3EMP A;  6GSY A;  4FH8 A;  1DE1 A;  4EL1 A;  1ZGN A;  1QMV A;  4HU7 A;  2IWT A;  4NPB A;  2KOK A;  1OAZ A;  3LWA A;  4ZL7 A;  4I2T A;  3TJB A;  2AUV A;  2ZCT A;  2R37 A;  1SEN A;  1TI3 A;  1GSQ A;  3ZIJ A;  4QL9 A;  1X5E A;  3M0F A;  4HZ4 A;  1X0R A;  2BMX A;  4I2U A;  1F2E A;  4N0V A;  4KCE A;  4F2I A;  3L9U A;  3P2A A;  3VI5 A;  1R7H A;  5B6M A;  2AYT A;  2HZF A;  3QAV A;  4L0U A;  2MBS A;  1YEP A;  4MMM A;  3EE2 A;  2FGX A;  3H79 A;  3KH7 A;  3L9V A;  2P0G A;  4HZ2 A;  4YAP A;  2HYX A;  4AF2 A;  3MNG A;  2B7K A;  4EC0 A;  2VL3 A;  4NHW A;  1WWJ A;  7GSS A;  3P90 A;  3P8W A;  3GKK A;  3MSZ A;  5DAL B;  3UBK A;  5J3R A;  5CRH A;  1HYU A;  1KBN A;  1TK0 B;  5ECN B;  3DVW A;  3PR8 A;  1YDK A;  3MDK A;  4MJE A;  5G1L A;  2YZU A;  2H76 A;  2DJJ A;  3L0H A;  4ECC A;  3ZVJ D;  2X64 A;  3MAK A;  4YQM A;  5AN1 A;  3ZFL A;  2QGV A;  1XWC A;  3UVT A;  2FWH A;  3EIN A;  1Q4J A;  5CO3 A;  4K7N A;  1RQM A;  1BJX A;  2GVP A;  2M72 A;  1X5C A;  2WCI A;  1A8L A;  2P5R A;  5GZZ B;  4NWY A;  3A5W A;  5HFI A;  2V32 A;  1RW1 A;  4G0I A;  4BVX B;  2ON5 A;  2JZR A;  3CSI A;  3I43 A;  4CHS A;  3TDG A;  2H1A A;  2H1B A;  1GTU A;  3FHK A;  3FEU A;  1FOV A;  4EF0 A;  1ERV A;  18GS A;  1EOG A;  5ECS A;  3UVH A;  1K0O A;  1TDI A;  3APQ A;  4TXO A;  2B5E A;  1AUC A;  4IJ3 A;  2GDR A;  2LNT A;  5G5F A;  3TJG A;  1DUG A;  1U88 A;  2YWM A;  3TJK A;  4K0N A;  3PH9 A;  4OFM A;  3TUE A;  1BAY A;  5G31 A;  4AJ7 A;  3RHC A;  2H72 A;  4TN8 A;  2F8F A;  2J9H A;  4ZBD A;  2VL2 A;  2YV9 A;  1Z9H A;  1X5D A;  1DSB A;  1ILO A;  1HQO A;  2AB6 A;  4AGS A;  1OC9 A;  3NIV A;  3UL3 A;  3TOT A;  4O92 A;  6GST A;  1A24 A;  1BG5 A;  3W8S A;  1MDI A;  4KDY A;  3FZ9 A;  1PKZ A;  3L78 A;  3IAS 2;  4ZIJ A;  2XBI A;  3GH9 A;  4USS A;  3DXB A;  1T00 A;  3F0I A;  2V6K A;  1OVN A;  2VL2 C;  2CX4 A;  5ECR B;  5DJL A;  2B5X A;  2VM2 A;  1F3B A;  5LNK e;  2RLI A;  2V6O A;  5GAN D;  4XS6 A;  5IPH A;  4POL A;  1GLP A;  2C0G A;  4CW9 A;  2VIM A;  3QAG A;  2O7K A;  3FW2 A;  2L57 A;  3C73 A;  2GSQ A;  4XRA A;  1XWB A;  5ID2 A;  5DCH A;  4OO5 A;  4Q5Q A;  4N30 A;  3GX8 A;  2HSM B;  1NM3 A;  3KJY A;  4GXZ A;  5H5S A;  2NVL A;  3HHV A;  19GS A;  2OE3 A;  3IXR A;  3Q6O A;  2LEG A;  1SYX A;  2HRA A;  4K7I A;  3GHA A;  4PGT A;  3ZYW A;  3KTB A;  4I8B A;  1UA5 A;  4FO5 A;  1PX6 A;  2JSZ A;  4E8H A; 
#chains in the Genus database with same CATH topology
 4EDY A;  4HDE A;  3VWU A;  5D9T A;  2KP1 A;  2HZE A;  1PKW A;  3LXZ A;  2CT6 A;  1SJI A;  5E4W A;  2YJ7 A;  1OC3 A;  4L8E A;  4CDO A;  3HKR A;  4LL4 B;  4G2E A;  2H19 A;  4HOJ A;  3I6A A;  4K6X A;  1EEJ A;  4WR5 A;  1A23 A;  2JAC A;  5F0G A;  3O3T A;  3NOF A;  4MZB A;  5DJM A;  5ECO B;  1A2J A;  4RUV A;  2C80 A;  4NHZ A;  5A5H A;  1GSE A;  1IYI A;  4WKW A;  3QCP A;  3CXG A;  1V57 A;  2OAC A;  2H6Y A;  4GQC A;  1O6J A;  4OD7 A;  3A2V A;  2VM1 A;  1JZD A;  1Z6M A;  2IMF A;  1NHY A;  1QGV A;  1C72 A;  3UAR A;  1OE8 A;  1U6T A;  4O7H A;  4O32 A;  2DJ1 A;  4EKZ A;  3CTF A;  2H6X A;  4WBR D;  1N8J A;  2FLS A;  1JZW A;  1F9M A;  4ECB A;  2OBK A;  4PHZ C;  2R0P A;  2WB9 A;  1AAZ A;  1PX7 A;  3A2W A;  2Z9S A;  1G7E A;  1MD4 A;  5B7C A;  2FA8 A;  2GT5 A;  3F9U A;  1FOH A;  2GZZ A;  1TK5 B;  2CZ3 A;  3EUR A;  5DVB A;  4TVE A;  1GNE A;  2PVQ A;  5DAK A;  5A1N B;  11GS A;  3P7X A;  3TKR A;  2LV3 A;  3LXT A;  1K0C A;  3IPZ A;  1YKA A;  1K0B A;  5ECK B;  5AIS A;  5J4U A;  1YF1 A;  4XCS A;  3D4T A;  4GLT A;  2HNL A;  3IDV A;  4X0X A;  1PFO A;  3FR6 A;  2FWF A;  4GDF A;  2B1L A;  2GTU A;  3RAZ A;  1THO A;  4TKY A;  5ECL B;  1K3Y A;  3SWL A;  1A0F A;  3QD9 A;  3GSS A;  2H66 A;  2WUL A;  3HMJ G;  1B8X A;  3IHG A;  2B3S A;  1W4V A;  2LRT A;  1V98 A;  4YH2 A;  3DML A;  2R0C A;  1PA3 A;  4KND A;  4WF5 A;  1H75 A;  2LJK A;  4KSO A;  1GH2 A;  2DJ0 A;  2MMA A;  3KM6 A;  2BTO T;  3ZLP A;  3A2X A;  5GST A;  2YAN A;  3EYT A;  3GKX A;  5KN2 A;  4Q5N A;  1TRV A;  1ZCP A;  3FZ4 A;  4F9Z A;  4PX1 A;  3Q18 A;  5CAX A;  2GSR A;  5KOW A;  4V2N A;  2H71 A;  1Y1U A;  4X1U A;  4XS4 B;  1I1I P;  2OKA A;  4H86 A;  4QL7 A;  4ML1 A;  1A8Y A;  2H73 A;  3UMA A;  2GS3 A;  2HSH A;  3HVV A;  4PTS A;  1WMJ A;  4PUA A;  3E0U A;  4PUR A;  2DIZ A;  5JWR B;  1AQW A;  3DD3 A;  3WD6 A;  5DAL A;  4MAB A;  1CQH A;  3FRC A;  2ES7 A;  4POB A;  1Z3E A;  3IC4 A;  1XXU A;  4KH7 A;  4PQH A;  4PI2 C;  1Y6E A;  2KHP A;  2YWO A;  4RQR A;  1QFN A;  1JLV A;  4KE3 A;  2CX3 A;  2LKU A;  4V1A p;  5CRW A;  3RPN A;  2AV4 A;  3DKS A;  3DVX A;  3ZL5 A;  5JCW A;  3D21 A;  3G7J A;  1U87 A;  4BVX A;  5GSS A;  3FZA A;  3TKP A;  3IBH A;  3R2Q A;  4GF0 A;  4BPY A;  1G6W A;  5ECM B;  1V9W A;  2YNX A;  2I4A A;  1CQG A;  4AJ6 A;  4P3Y B;  4MF7 A;  5L71 A;  1TU7 A;  3GIX A;  5F8B A;  4HUA A;  3DWV A;  4HJM A;  4PI0 C;  4IN0 A;  1JZO A;  3TRX A;  2LS5 A;  2A4V A;  3FR9 A;  3PIN A;  5G1K A;  5DBQ A;  3N9J A;  3EU4 A;  1SVL A;  5F05 A;  3UIW A;  4J57 E;  9GSS A;  4I5Q A;  2NTO A;  3VK9 A;  5IM9 A;  2KP2 A;  1TXX A;  1EZK A;  5BMU A;  3ZFB A;  4G0K A;  2VCT A;  2C3N A;  4G0L A;  1FB6 A;  1PL1 A;  2FA4 A;  2WW2 A;  4WET A;  2WVX B;  2P31 A;  4JU5 A;  2H74 A;  2PER A;  2KUC A;  5IIZ A;  4HJ2 A;  3TKS A;  1TOF A;  3CTG A;  2R3X A;  4MDC A;  1OE7 A;  2FD3 A;  1U3I A;  3HYP A;  1VF4 A;  2L59 A;  4FXY P;  2H0I A;  3HVS A;  4FIW A;  4JR6 A;  3BCK A;  3CMI A;  3V1W A;  2UZ8 A;  1ON4 A;  2L4Q A;  3I69 A;  4MJA A;  2IME A;  2C8U A;  1KNG A;  1OKD A;  3G7I A;  4HQS A;  3HJO A;  3GN3 A;  3TB2 A;  2O8V B;  6GSU A;  1AXD A;  5EPF A;  3KEB A;  3ERF A;  1OYJ A;  1EV4 A;  5G30 A;  4D73 B;  1SL2 B;  2AHE A;  4IQA A;  2DMM A;  1UN2 A;  3LGC A;  1XWG A;  4BL7 B;  4IGJ A;  1GLQ A;  4WR4 A;  2M80 A;  5KN0 A;  3AY8 A;  1MDJ A;  4I6X A;  2WVY A;  1O85 A;  1JFU A;  3U6V A;  4IEL A;  1T3B A;  2H6Z A;  1SVM A;  1SYR A;  2MMZ A;  2WFC A;  3M1G A;  1M2B A;  2X49 A;  4YQU A;  4N10 A;  2I3Y A;  4TW5 A;  3N5O A;  2N5A A;  3J7Y b;  1AQX A;  2H0H A;  2WRT A;  5HQP A;  3VPT A;  2XPE A;  4J2F A;  5CP1 A;  5EY6 A;  3H1N A;  3MWH A;  1HNB A;  3GFK A;  4TR1 B;  4V1A g;  3IK9 A;  5HR2 A;  3IK7 A;  4ZBB A;  2FCH A;  3GNJ A;  4MH3 A;  1SK0 A;  2RUE A;  3UAP A;  1PL2 A;  5ECH B;  2VD1 A;  1YEX A;  1KTE A;  2EIR A;  3KD0 A;  1FO5 A;  3U5R E;  1V2A A;  2B7J A;  4LA1 A;  3C1R A;  4ILF A;  4O5R A;  2CAI A;  1R26 A;  2F9S A;  1X9S B;  4POM A;  3CSH A;  3F3R A;  3RBT A;  1OKT A;  1GRX A;  4AJ8 A;  3G7Y A;  3GL3 A;  3QMX A;  3IRA A;  3IV4 A;  1F6M C;  2LRC A;  1XOA A;  2HRN A;  1O81 A;  2JSY A;  4EVM A;  1FG4 A;  5FT3 A;  1B4P A;  2XPD A;  4V2M A;  2GST A;  3J7Y k;  2X8H A;  2WGR A;  2VLV A;  3TJJ A;  4PNG A;  3LQ7 A;  5G5E A;  2PN8 A;  2GT6 A;  3RPP A;  5JCU A;  1FB0 A;  3S9F A;  1R5P A;  3D4M A;  2PVO C;  5IQY A;  8GSS A;  2DML A;  3LYK A;  5D9X A;  3GH6 A;  3IHQ A;  2J23 A;  1K0M A;  3UJ1 A;  3C7M A;  4EXJ A;  5COH A;  4XHM A;  1GTA A;  1M3J A;  3DRN A;  3F3Q A;  4GRF A;  5DQY A;  3F6F A;  4POK A;  3VPQ A;  3FYG A;  5A1N A;  3FK8 A;  1ZZY A;  1MEK A;  2ON7 A;  4WXT A;  2HSY A;  5HFG A;  4TOP A;  2LJA A;  4IKH A;  2RM5 A;  1ML6 A;  1V58 A;  4MLY A;  5J47 A;  1M2D A;  3GST A;  4A5P A;  3HZ4 A;  5A4V A;  3ED3 A;  1PGT A;  3WYW A;  1XVW A;  5AGY A;  5ECI B;  1JLW A;  2ALB A;  3D6I A;  4XS1 A;  3K8N A;  2C4J A;  4IP1 A;  3TKQ A;  5A4U A;  2GZY A;  3R3E A;  4RQX A;  3Q19 A;  1EGO A;  1VGL A;  12GS A;  4ECJ A;  4Z2U A;  2WDU A;  4KX4 A;  3QDN A;  4PXO A;  2NDO A;  3ZIT A;  2IIY A;  2HE3 A;  1MTC A;  2DJ2 A;  6GSV A;  3IC8 A;  1GUK A;  3ERW A;  3KZQ A;  2R4V A;  1U3A A;  3KP8 A;  4OMV A;  2R2J A;  1SKS B;  2IFQ B;  2XC2 A;  4QMK A;  3ERG A;  2VCV A;  2DBC A;  2V2G A;  3EVI A;  3BJ5 A;  3DGQ A;  3BBY A;  1BQ7 A;  4IQ1 A;  2RUF A;  4XS4 A;  1S4B P;  4TR0 A;  2HSN B;  3O6T A;  1SKW B;  2MZC A;  2OE1 A;  1WOU A;  2FWE A;  5IMC A;  4X43 A;  3EC3 A;  3KCM A;  5IMF A;  1WE0 A;  3OR5 A;  4BWS A;  1I9D A;  4MH2 A;  4V2L A;  2CA8 A;  3HD5 A;  3I9V 2;  3L9S A;  1X9M B;  2RM6 A;  3WGE A;  2F8A A;  1URM A;  1M2A A;  1O8W A;  2GZP A;  1PMT A;  2PMT A;  1ZMA A;  1YJ6 A;  3GRX A;  2DSA A;  2CZ2 A;  3EWL A;  5D73 A;  3FY7 A;  1R4W A;  5C00 A;  4DVC A;  2GQM A;  5E59 A;  20GS A;  3CYN A;  3RFR C;  2HXK A;  4XRD A;  3E9J B;  3IE3 A;  4MPF A;  1Z7R A;  1TP9 A;  2H1G A;  5EVO A;  4GWR A;  4N0Z A;  2C0D A;  2LQO A;  4ZL9 A;  1G0T A;  4DEJ A;  4IBP A;  3ZRD A;  3RHB A;  1XOB A;  3BCI A;  1YVL A;  1H4O A;  5B6N A;  1IYH A;  1PQN A;  3HA9 A;  1XVQ A;  1S3A A;  2O5V A;  2PWJ A;  3HJP A;  1YQ1 A;  1GTB A;  3WT1 A;  2E2M A;  1F3A A;  4G10 A;  4L0W A;  1BYE A;  4TXV A;  4KAE A;  4PNF A;  4FYB A;  1G7O A;  1WJK A;  3HVX A;  1YKC A;  5LCZ A;  1AW9 A;  1E6B A;  2O89 A;  2VCQ A;  3FR3 A;  4BA7 A;  5IOW A;  5A34 B;  3O76 A;  1K3O A;  5D96 A;  2CAQ A;  4AKG A;  4AKX B;  5AIV A;  2UV8 G;  4AKH A;  1TTZ A;  1GWC A;  2WVX A;  4YKG A;  5D8I A;  2DC5 A;  4AKI A;  2GSS A;  5DDL A;  2X4A A;  1M99 A;  3QAW A;  4EDZ A;  4KUN A;  3H4K A;  5HR1 A;  4IHU A;  4Q5R A;  4GSN A;  3TU3 B;  3HCZ A;  4K7O A;  5J41 A;  2XBQ A;  5A5K A;  4KA0 A;  1EGR A;  2QKE A;  3D5J A;  3EU3 A;  1ERU A;  2C1Y A;  2LJR A;  4ZIL A;  2HT9 A;  4JBB A;  3GMF A;  3ZML A;  3PGT A;  2YN1 A;  4RI6 A;  2JZS A;  1GSY A;  2E0Q A;  4D73 A;  2WZ9 A;  4IW9 A;  2K9F A;  4DSR A;  2K8V A;  3CSJ A;  1G6Y A;  2YWI A;  2DLX A;  6GSX A;  1GUH A;  2HI7 A;  3UBL A;  1SK1 A;  2A4H A;  4MCU A;  1SL0 B;  1J0F A;  2YOI A;  5HFK A;  5HR3 A;  3WT2 A;  5FHI A;  4L5O A;  3FKF A;  2JAD A;  5A4W A;  5G2Z A;  3LFL A;  5F06 A;  4G01 A;  4HI7 A;  1O8X A;  4XIH A;  4CY6 A;  2AJQ B;  1UVZ A;  5CNW A;  2H70 A;  4GST A;  2H1D A;  1TXU A;  5IO2 A;  4MPG A;  3LEF A;  4RI7 A;  4TR1 A;  2JZT A;  1KEB A;  4MJB A;  1EP8 A;  1MD3 A;  2AAW A;  17GS A;  1F37 A;  4OO4 A;  1GUM A;  2TIR A;  1NSW A;  5IPG A;  4WBJ A;  1QUW A;  3ZVJ A;  1GSD A;  2ZUP A;  2OJL A;  3ZTL A;  3VLN A;  1T4Z A;  4LLR A;  2OT3 A;  1TRS A;  1B9Y C;  4K2X A;  1SD9 A;  2YP6 A;  2CVD A;  2IMI A;  3ZIV A;  1S3C A;  4ZL8 A;  3GUR A;  4AI6 A;  1VF2 A;  2TRX A;  1XW9 A;  3KGK A;  5IOX A;  1ST9 A;  4Q5F A;  2K8S A;  2YZH A;  4TRX A;  2NPB A;  3VWX A;  5CRD A;  4K8M A;  3F4R A;  2B6M A;  5B8B A;  1AQV A;  4F0B A;  3F6D A;  1SJZ A;  2HLS A;  22GS A;  5J5N A;  4DSS B;  1WP0 A;  1Z6N A;  2HRF A;  2L6D A;  2FNO A;  4ACS A;  2VAF A;  3ME8 A;  4MP4 A;  5JWO B;  2TRC P;  2EC4 A;  1SD8 A;  3KTL A;  2VCZ A;  2H0G A;  4JED A;  3TGZ A;  2BJX A;  1XWK A;  2X8C A;  1M9B A;  4W66 A;  3FZ5 A;  1JHB A;  4FQU A;  4K9Z A;  3VI7 A;  1GSU A;  4KCA A;  3HXS A;  2B5Y A;  1ABA A;  2K6V A;  3M8N A;  4MA9 A;  4OCF A;  2OA7 A;  5IMV A;  1ZYN A;  1LBK A;  5CYY A;  3TKS C;  1OC8 A;  2I1U A;  1TKD B;  2EIO A;  2VCW A;  4E8E A;  2LQQ A;  1BG1 A;  4IS0 A;  4KSM A;  4LMV A;  4OWY A;  1O73 A;  2WJU A;  1HNC A;  4YKF A;  6GSW A;  2GLR A;  3C8E A;  3EPT A;  2PBJ A;  2VO4 A;  2DKH A;  4ECI A;  1GNW A;  1VF1 A;  4OFN A;  2REM A;  2I9H A;  2HSM A;  5J9B A;  1EP7 A;  1V40 A;  2EFE A;  3TCO A;  3TRP A;  1PRX A;  5KN1 A;  3WGX A;  2KLX A;  4J56 E;  1NHO A;  5IMZ A;  2GQL A;  1I5G A;  4BVY B;  2JL4 A;  1SL1 B;  1PSQ A;  4LMW A;  2IFQ A;  3DEX A;  5DQS A;  1YF0 A;  1XG8 A;  5IO0 A;  1FVJ A;  1X9W B;  3UEM A;  1ZL9 A;  2DIY A;  4X4J A;  2HSN A;  3APS A;  3TKS E;  1XCC A;  1UC7 A;  2L5L A;  3US3 A;  2HRK B;  2VLU A;  2IN3 A;  5D9W A;  1W89 A;  1MDK A;  3MYD A;  1J9B A;  2QA1 A;  1FW1 A;  5D93 A;  1LJR A;  3GKM A;  3ZMK A;  2L5O A;  4MNN A;  4OFT A;  3GTU B;  1XW5 A;  2CVK A;  2G0F A;  4BWQ A;  1TK8 B;  1R5A A;  4LL1 B;  1WPI A;  5KOX A;  2LRN A;  2EIQ A;  2VUP A;  1FHE A;  3PPU A;  1RK4 A;  5ENU A;  3ISO A;  2M46 A;  2LUS A;  1USB A;  4MZC A;  2CVB A;  4K0G A;  4JZQ A;  3LOR A;  1Z7P A;  4BIK A;  3HZ8 A;  4HSC X;  3IA1 A;  1M7T A;  4TR3 A;  3D0Z A;  1JZR A;  2IJY A;  4EIQ A;  1O7U A;  5AIX A;  1XW6 A;  4FYU A;  3GA4 A;  2VL9 A;  3KP9 A;  4F82 A;  3KH9 A;  4DSQ A;  2C3T A;  1EOH A;  3ZZX A;  2MMO A;  1K3L A;  4MF6 A;  3DYR A;  4E68 A;  2MBT A;  1YEW C;  2L4C A;  5JCG A;  1BED A;  2VOC A;  5FWG A;  1ACV A;  4MF5 A;  3CQF A;  3W6G A;  5H5R A;  1EV9 A;  1XBS A;  4XTS A;  2A2R A;  2HQT A;  2C3Q A;  2PUK C;  3W8J A;  1PD2 1;  1THX A;  1TJD A;  4GSS A;  5ELG A;  1A0R P;  2O87 A;  2CV4 A;  3GKN A;  3LJR A;  3UOM A;  16GS A;  1AIU A;  3Q74 A;  3LSZ A;  4YQV A;  2CQ9 A;  5F07 A;  4ML6 A;  3WGD A;  4ZB8 A;  1TRW A;  1GSS A;  5IMD A;  2H1L A;  2VD0 A;  4ZXG A;  1T1V A;  3M3M A;  5KEJ A;  2F3M A;  5ELA A;  3TOU A;  1A2M A;  3H8Q A;  2JU5 A;  3F4S A;  4HQZ A;  1M0U A;  2RII A;  2D2Z A;  2L6C A;  2B1K A;  1N2A A;  2OE0 A;  2YV7 A;  1XIY A;  3G9B A;  1E2Y A;  4I97 A;  1K0A A;  3IOS A;  2V1M A;  5J4Y A;  3DIE A;  4EUY A;  5CRE A;  3L4N A;  3TJF A;  2OAD A;  3CRU A;  1XFL A;  4TR4 A;  2H8L A;  1GSF A;  3M9K A;  5KN3 A;  2IPA A;  2HFD A;  3VWV A;  2LST A;  2DKI A;  2MMN A;  1BF5 A;  3GX0 A;  4ZBA A;  3C1S A;  1FVK A;  3QPM A;  3TRQ A;  5C04 A;  3A3T A;  4TXO B;  1QQ2 A;  1Q98 A;  4Z7X A;  1PN9 A;  1B9X C;  3F4T A;  3IR4 A;  3F8U A;  3SBC A;  1XZO A;  4HS1 A;  4WF4 A;  5H5Q A;  2MYG A;  14GS A;  4Z2R A;  2YPM A;  3CBU A;  1NW2 A;  2FHE A;  3VFI A;  1VF3 A;  3ZRE A;  4YAV A;  2YCD A;  2R5G A;  5ABR A;  3HJM A;  1B4Q A;  3A5I A;  3RDW A;  1EWX A;  2I81 A;  4KW6 A;  1OC9 B;  1ERW A;  4KB3 A;  1S3D A;  2GQK A;  4EIP A;  2FY6 A;  2YWN A;  1SU9 A;  3JCM L;  2QA2 A;  3D22 A;  10GS A;  1DBY A;  2V41 A;  5EL8 A;  2DJ3 A;  1FAA A;  1GL8 A;  4IVF A;  1TRU A;  4NMU A;  1TW9 A;  3GL5 A;  1SKR B;  4PUF C;  1HD2 A;  1XPV A;  3MIX A;  1LU4 A;  3VUR A;  3GYK A;  1K0D A;  2P5Q A;  2H30 A;  2IMK A;  2C0E A;  2QC7 A;  2H75 A;  1XWA A;  1T8E B;  3M9J A;  3C71 A;  1ERT A;  13GS A;  2WVZ A;  3E3E A;  4NV5 A;  1SJ6 A;  1HNA A;  1EEM A;  4PQ1 A;  2O36 A;  1T7P B;  2XHF A;  4MZW A;  4GCI A;  4K5R A;  5ID2 B;  1B48 A;  5LD0 A;  2N5F A;  2A2S A;  2GGT A;  4DSS A;  3IAM 2;  2ZNM A;  2LTK A;  3EMX A;  1M9A A;  4NV2 A;  3VWW A;  3GUS A;  1T4Y A;  2G2Q A;  3HY2 A;  3QFB C;  1AC1 A;  2FWG A;  5IMA A;  4IP6 A;  5J9C A;  6GSS A;  1DE2 A;  2K18 A;  1QK8 A;  1TI1 A;  1VRS D;  2WW1 A;  3QFA C;  2IL3 A;  2IMD A;  5D9V A;  2X99 A;  2WZS A;  1WRY A;  2HZE B;  3ME7 A;  2EFD A;  4KDU A;  4HEA 2;  4GQF A;  4ISD A;  1ZOF A;  2WS2 A;  1SK2 A;  4FYC A;  2LNS A;  2EFH A;  2EFC A;  4JE1 A;  4O5U A;  3CRT A;  1WIK A;  4ID0 A;  4BL7 A;  5ECQ B;  1A2L A;  3LYP A;  5A5H B;  4N11 A;  3KMO A;  5B8A A;  4EE0 A;  1Z5Y E;  4KGI A;  2DJK A;  1ZYQ B;  4ZB6 A;  4QQ7 A;  4NXI A;  1GTI A;  5DCG A;  4KF9 A;  1ZYP A;  3QOU A;  3HDC A;  2E7P A;  3LG6 A;  4MK3 A;  3KXO A;  2YJH A;  3H93 A;  1K0N A;  4JR4 A;  2O3E A;  1ZYE A;  4IJI A;  4N3Z A;  4WEY A;  5ECP B;  3APO A;  2PGT A;  2N5B A;  1J08 A;  2R6K A;  2E2G A;  5GAP D;  2VLT A;  5JWQ B;  4BVY A;  1Y25 A;  3F63 A;  4ZB9 A;  2F51 A;  3NZN A;  3BD2 A;  3CWG A;  2FUG 2;  3GV1 A;  2R0G A;  4GTU A;  4G9H A;  2OBI A;  5CRG A;  2QSI A;  5INY A;  2NBS A;  5HR0 A;  1GP1 A;  4F0C A;  1YY7 A;  4NAX A;  2VCX A;  3KIJ A;  4JRR A;  2X8G A;  1GUL A;  1TU8 A;  4EO3 A;  4HU9 A;  4L5L A;  5DAK B;  4F03 A;  4OCE A;  4ICY A;  2O85 A;  4MJC A;  2HRK A;  4K1F A;  4K5S A;  4ULX A;  2PPT A;  1BX9 A;  3BOA A;  4PQI A;  2C0F A;  3QR6 A;  4KDX A;  1QXH A;  2H01 A;  4K2D A;  2PU9 C;  3GTU A;  1YZX A;  3KMN A;  4G19 A;  3EMP A;  6GSY A;  4FH8 A;  1DE1 A;  4EL1 A;  1ZGN A;  1QMV A;  4HU7 A;  2IWT A;  4NPB A;  2KOK A;  1OAZ A;  3LWA A;  4ZL7 A;  4I2T A;  3TJB A;  2AUV A;  2ZCT A;  2WW3 A;  2R37 A;  3CHX C;  1SEN A;  1TI3 A;  1GSQ A;  3ZIJ A;  4QL9 A;  1X5E A;  3M0F A;  4HZ4 A;  3RGB C;  1M3I A;  1X0R A;  2BMX A;  4I2U A;  1F2E A;  4N0V A;  4KCE A;  4F2I A;  3L9U A;  3P2A A;  3VI5 A;  1R7H A;  5B6M A;  2AYT A;  2HZF A;  3QAV A;  4L0U A;  2MBS A;  1YEP A;  4MMM A;  3EE2 A;  2FGX A;  3H79 A;  3KH7 A;  3L9V A;  2P0G A;  4HZ2 A;  4YAP A;  2HYX A;  4AF2 A;  3MNG A;  2B7K A;  4EC0 A;  2VL3 A;  3HVN A;  4NHW A;  1WWJ A;  7GSS A;  3P90 A;  3P8W A;  3GKK A;  3MSZ A;  5J40 A;  5DAL B;  3UBK A;  5J3R A;  5CRH A;  1HYU A;  1KBN A;  1TK0 B;  5ECN B;  3DVW A;  3PR8 A;  1YDK A;  3MDK A;  4MJE A;  5G1L A;  2YZU A;  2H76 A;  2DJJ A;  4CY8 A;  4Z2T A;  3L0H A;  4ECC A;  3ZVJ D;  2X64 A;  3MAK A;  4YQM A;  5AN1 A;  3ZFL A;  2QGV A;  1XWC A;  2A2P A;  5J4V A;  3UVT A;  2FWH A;  3EIN A;  1Q4J A;  5CO3 A;  1SVO A;  4K7N A;  1RQM A;  1BJX A;  2GVP A;  2M72 A;  1X5C A;  2WCI A;  1A8L A;  2P5R A;  5GZZ B;  4NWY A;  3A5W A;  5HFI A;  2V32 A;  1RW1 A;  4G0I A;  4BVX B;  2ON5 A;  2JZR A;  3CSI A;  3I43 A;  4CHS A;  3TDG A;  2H1A A;  2H1B A;  1GTU A;  4ZB7 A;  3FHK A;  3FEU A;  1FOV A;  4EF0 A;  1ERV A;  18GS A;  1EOG A;  5ECS A;  3UVH A;  1K0O A;  1TDI A;  3APQ A;  5BRT A;  4TXO A;  2B5E A;  2VKZ G;  1AUC A;  4IJ3 A;  2GDR A;  2LNT A;  5G5F A;  3TJG A;  1DUG A;  1PN0 A;  1U88 A;  2YWM A;  3TJK A;  4K0N A;  3PH9 A;  4OFM A;  3TUE A;  1BAY A;  5BMU B;  5G31 A;  4AJ7 A;  3RHC A;  4O5Q A;  2H72 A;  4TN8 A;  2F8F A;  2J9H A;  4ZBD A;  2VL2 A;  2YV9 A;  1Z9H A;  1X5D A;  1DSB A;  1ILO A;  1HQO A;  2AB6 A;  4AGS A;  1OC9 A;  3NIV A;  3UL3 A;  3TOT A;  4O92 A;  6GST A;  1A24 A;  1BG5 A;  3W8S A;  1MDI A;  4KDY A;  3FZ9 A;  1PKZ A;  3L78 A;  3IAS 2;  4ZIJ A;  2XBI A;  3GH9 A;  4USS A;  3DXB A;  3F0I A;  1T00 A;  2V6K A;  1OVN A;  2VL2 C;  2CX4 A;  5ECR B;  5DJL A;  2B5X A;  2VM2 A;  1F3B A;  5LNK e;  2WW0 A;  1S3R A;  2RLI A;  2V6O A;  5GAN D;  4XS6 A;  5IPH A;  4POL A;  1GLP A;  2C0G A;  4CW9 A;  2VIM A;  3QAG A;  2O7K A;  5A34 A;  3FW2 A;  2L57 A;  3C73 A;  2GSQ A;  4XRA A;  1XWB A;  5ID2 A;  5DCH A;  4OO5 A;  4Q5Q A;  4N30 A;  3GX8 A;  2HSM B;  1NM3 A;  3KJY A;  4GXZ A;  5H5S A;  2NVL A;  3HHV A;  19GS A;  2OE3 A;  3IXR A;  3Q6O A;  1N25 A;  2LEG A;  1SYX A;  2HRA A;  4K7I A;  3GHA A;  4PGT A;  3ZYW A;  3KTB A;  4I8B A;  3LW9 A;  1UA5 A;  4FO5 A;  1PX6 A;  3FMW A;  2JSZ A;  4E8H A; 
#chains in the Genus database with same CATH homology
 4EDY A;  4HDE A;  3VWU A;  5D9T A;  2KP1 A;  2HZE A;  1PKW A;  3LXZ A;  2CT6 A;  1SJI A;  5E4W A;  2YJ7 A;  1OC3 A;  4L8E A;  4CDO A;  3HKR A;  4LL4 B;  4G2E A;  2H19 A;  4HOJ A;  3I6A A;  4K6X A;  1EEJ A;  4WR5 A;  1A23 A;  2JAC A;  5F0G A;  3O3T A;  3NOF A;  4MZB A;  5DJM A;  5ECO B;  1A2J A;  4RUV A;  2C80 A;  4NHZ A;  5A5H A;  1GSE A;  1IYI A;  4WKW A;  3QCP A;  3CXG A;  1V57 A;  2OAC A;  2H6Y A;  4GQC A;  1O6J A;  4OD7 A;  3A2V A;  2VM1 A;  1JZD A;  1Z6M A;  2IMF A;  1NHY A;  1QGV A;  1C72 A;  3UAR A;  1OE8 A;  1U6T A;  4O7H A;  4O32 A;  2DJ1 A;  4EKZ A;  3CTF A;  2H6X A;  4WBR D;  1N8J A;  2FLS A;  1JZW A;  1F9M A;  4ECB A;  2OBK A;  2R0P A;  2WB9 A;  1AAZ A;  1PX7 A;  3A2W A;  2Z9S A;  1G7E A;  1MD4 A;  5B7C A;  2FA8 A;  2GT5 A;  3F9U A;  1FOH A;  2GZZ A;  1TK5 B;  2CZ3 A;  3EUR A;  5DVB A;  4TVE A;  1GNE A;  2PVQ A;  5DAK A;  5A1N B;  11GS A;  3P7X A;  3TKR A;  2LV3 A;  3LXT A;  1K0C A;  3IPZ A;  1YKA A;  1K0B A;  5ECK B;  5AIS A;  5J4U A;  1YF1 A;  4XCS A;  3D4T A;  4GLT A;  2HNL A;  3IDV A;  4X0X A;  3FR6 A;  2FWF A;  4GDF A;  2B1L A;  2GTU A;  3RAZ A;  1THO A;  4TKY A;  5ECL B;  1K3Y A;  3SWL A;  1A0F A;  3QD9 A;  3GSS A;  2H66 A;  2WUL A;  3HMJ G;  1B8X A;  3IHG A;  2B3S A;  1W4V A;  2LRT A;  1V98 A;  4YH2 A;  3DML A;  2R0C A;  1PA3 A;  4KND A;  4WF5 A;  1H75 A;  2LJK A;  4KSO A;  1GH2 A;  2DJ0 A;  2MMA A;  3KM6 A;  2BTO T;  3ZLP A;  3A2X A;  5GST A;  2YAN A;  3EYT A;  3GKX A;  5KN2 A;  4Q5N A;  1TRV A;  1ZCP A;  3FZ4 A;  4F9Z A;  4PX1 A;  3Q18 A;  5CAX A;  2GSR A;  5KOW A;  4V2N A;  2H71 A;  1Y1U A;  4X1U A;  4XS4 B;  2OKA A;  4H86 A;  4QL7 A;  4ML1 A;  1A8Y A;  2H73 A;  3UMA A;  2GS3 A;  2HSH A;  3HVV A;  4PTS A;  1WMJ A;  4PUA A;  3E0U A;  4PUR A;  2DIZ A;  5JWR B;  1AQW A;  3DD3 A;  3WD6 A;  5DAL A;  4MAB A;  1CQH A;  3FRC A;  2ES7 A;  4POB A;  1Z3E A;  3IC4 A;  1XXU A;  4KH7 A;  4PQH A;  1Y6E A;  2KHP A;  2YWO A;  4RQR A;  1QFN A;  1JLV A;  4KE3 A;  2CX3 A;  2LKU A;  4V1A p;  5CRW A;  3RPN A;  2AV4 A;  3DKS A;  3DVX A;  3ZL5 A;  5JCW A;  3D21 A;  3G7J A;  1U87 A;  4BVX A;  5GSS A;  3FZA A;  3TKP A;  3IBH A;  3R2Q A;  4GF0 A;  4BPY A;  1G6W A;  5ECM B;  1V9W A;  2YNX A;  2I4A A;  1CQG A;  4AJ6 A;  4P3Y B;  4MF7 A;  5L71 A;  1TU7 A;  3GIX A;  5F8B A;  4HUA A;  3DWV A;  4HJM A;  4IN0 A;  1JZO A;  3TRX A;  2LS5 A;  2A4V A;  3FR9 A;  3PIN A;  5G1K A;  5DBQ A;  3N9J A;  3EU4 A;  1SVL A;  5F05 A;  3UIW A;  4J57 E;  9GSS A;  4I5Q A;  2NTO A;  3VK9 A;  5IM9 A;  2KP2 A;  1TXX A;  1EZK A;  5BMU A;  3ZFB A;  4G0K A;  2VCT A;  2C3N A;  4G0L A;  1FB6 A;  1PL1 A;  2FA4 A;  4WET A;  2P31 A;  4JU5 A;  2H74 A;  2PER A;  2KUC A;  5IIZ A;  4HJ2 A;  3TKS A;  1TOF A;  3CTG A;  2R3X A;  4MDC A;  1OE7 A;  2FD3 A;  1U3I A;  3HYP A;  1VF4 A;  2L59 A;  2H0I A;  3HVS A;  4FIW A;  4JR6 A;  3BCK A;  3CMI A;  3V1W A;  2UZ8 A;  1ON4 A;  2L4Q A;  3I69 A;  4MJA A;  2IME A;  2C8U A;  1KNG A;  1OKD A;  3G7I A;  4HQS A;  3HJO A;  3GN3 A;  3TB2 A;  2O8V B;  6GSU A;  1AXD A;  5EPF A;  3KEB A;  3ERF A;  1OYJ A;  1EV4 A;  5G30 A;  4D73 B;  1SL2 B;  2AHE A;  4IQA A;  2DMM A;  1UN2 A;  3LGC A;  1XWG A;  4BL7 B;  4IGJ A;  1GLQ A;  4WR4 A;  2M80 A;  5KN0 A;  3AY8 A;  1MDJ A;  4I6X A;  1O85 A;  1JFU A;  3U6V A;  4IEL A;  1T3B A;  2H6Z A;  1SVM A;  1SYR A;  2MMZ A;  2WFC A;  3M1G A;  1M2B A;  2X49 A;  4YQU A;  4N10 A;  2I3Y A;  4TW5 A;  3N5O A;  2N5A A;  3J7Y b;  1AQX A;  2H0H A;  2WRT A;  5HQP A;  3VPT A;  2XPE A;  4J2F A;  5CP1 A;  5EY6 A;  3H1N A;  3MWH A;  1HNB A;  3GFK A;  4TR1 B;  4V1A g;  3IK9 A;  5HR2 A;  3IK7 A;  4ZBB A;  2FCH A;  3GNJ A;  4MH3 A;  1SK0 A;  2RUE A;  3UAP A;  1PL2 A;  5ECH B;  2VD1 A;  1YEX A;  1KTE A;  2EIR A;  3KD0 A;  1FO5 A;  3U5R E;  1V2A A;  2B7J A;  4LA1 A;  3C1R A;  4ILF A;  4O5R A;  2CAI A;  1R26 A;  2F9S A;  1X9S B;  4POM A;  3CSH A;  3F3R A;  3RBT A;  1OKT A;  1GRX A;  4AJ8 A;  3G7Y A;  3GL3 A;  3QMX A;  3IRA A;  3IV4 A;  1F6M C;  2LRC A;  1XOA A;  2HRN A;  1O81 A;  2JSY A;  4EVM A;  1FG4 A;  5FT3 A;  1B4P A;  2XPD A;  4V2M A;  2GST A;  3J7Y k;  2X8H A;  2WGR A;  2VLV A;  3TJJ A;  4PNG A;  3LQ7 A;  5G5E A;  2PN8 A;  2GT6 A;  3RPP A;  5JCU A;  1FB0 A;  3S9F A;  1R5P A;  3D4M A;  2PVO C;  5IQY A;  8GSS A;  2DML A;  3LYK A;  5D9X A;  3GH6 A;  3IHQ A;  2J23 A;  1K0M A;  3UJ1 A;  3C7M A;  4EXJ A;  5COH A;  4XHM A;  1GTA A;  3DRN A;  3F3Q A;  4GRF A;  5DQY A;  3F6F A;  4POK A;  3VPQ A;  3FYG A;  5A1N A;  3FK8 A;  1ZZY A;  1MEK A;  2ON7 A;  4WXT A;  2HSY A;  5HFG A;  4TOP A;  2LJA A;  4IKH A;  2RM5 A;  1ML6 A;  1V58 A;  4MLY A;  5J47 A;  1M2D A;  3GST A;  4A5P A;  3HZ4 A;  5A4V A;  3ED3 A;  1PGT A;  3WYW A;  1XVW A;  5AGY A;  5ECI B;  1JLW A;  2ALB A;  3D6I A;  4XS1 A;  3K8N A;  2C4J A;  4IP1 A;  3TKQ A;  5A4U A;  2GZY A;  3R3E A;  4RQX A;  3Q19 A;  1EGO A;  1VGL A;  12GS A;  4ECJ A;  4Z2U A;  2WDU A;  4KX4 A;  3QDN A;  4PXO A;  2NDO A;  3ZIT A;  2IIY A;  2HE3 A;  1MTC A;  2DJ2 A;  6GSV A;  3IC8 A;  1GUK A;  3ERW A;  3KZQ A;  2R4V A;  1U3A A;  3KP8 A;  4OMV A;  2R2J A;  1SKS B;  2IFQ B;  2XC2 A;  4QMK A;  3ERG A;  2VCV A;  2DBC A;  2V2G A;  3EVI A;  3BJ5 A;  3DGQ A;  3BBY A;  1BQ7 A;  4IQ1 A;  2RUF A;  4XS4 A;  4TR0 A;  2HSN B;  3O6T A;  1SKW B;  2MZC A;  2OE1 A;  1WOU A;  2FWE A;  5IMC A;  4X43 A;  3EC3 A;  3KCM A;  5IMF A;  1WE0 A;  3OR5 A;  4BWS A;  1I9D A;  4MH2 A;  4V2L A;  2CA8 A;  3HD5 A;  3I9V 2;  3L9S A;  1X9M B;  2RM6 A;  3WGE A;  2F8A A;  1URM A;  1M2A A;  1O8W A;  2GZP A;  1PMT A;  2PMT A;  1ZMA A;  1YJ6 A;  3GRX A;  2DSA A;  2CZ2 A;  3EWL A;  5D73 A;  3FY7 A;  1R4W A;  5C00 A;  4DVC A;  2GQM A;  5E59 A;  20GS A;  3CYN A;  2HXK A;  4XRD A;  3E9J B;  3IE3 A;  4MPF A;  1Z7R A;  1TP9 A;  2H1G A;  5EVO A;  4GWR A;  4N0Z A;  2C0D A;  2LQO A;  4ZL9 A;  1G0T A;  4DEJ A;  4IBP A;  3ZRD A;  3RHB A;  1XOB A;  3BCI A;  1YVL A;  1H4O A;  5B6N A;  1IYH A;  1PQN A;  3HA9 A;  1XVQ A;  1S3A A;  2O5V A;  2PWJ A;  3HJP A;  1YQ1 A;  1GTB A;  3WT1 A;  2E2M A;  1F3A A;  4G10 A;  4L0W A;  1BYE A;  4TXV A;  4KAE A;  4PNF A;  4FYB A;  1G7O A;  1WJK A;  3HVX A;  1YKC A;  5LCZ A;  1AW9 A;  1E6B A;  2O89 A;  2VCQ A;  3FR3 A;  4BA7 A;  5IOW A;  5A34 B;  3O76 A;  1K3O A;  5D96 A;  2CAQ A;  4AKG A;  4AKX B;  5AIV A;  2UV8 G;  4AKH A;  1TTZ A;  1GWC A;  4YKG A;  5D8I A;  2DC5 A;  4AKI A;  2GSS A;  5DDL A;  2X4A A;  1M99 A;  3QAW A;  4EDZ A;  4KUN A;  3H4K A;  5HR1 A;  4IHU A;  4Q5R A;  4GSN A;  3TU3 B;  3HCZ A;  4K7O A;  5J41 A;  2XBQ A;  5A5K A;  4KA0 A;  1EGR A;  2QKE A;  3D5J A;  3EU3 A;  1ERU A;  2C1Y A;  2LJR A;  4ZIL A;  2HT9 A;  4JBB A;  3GMF A;  3ZML A;  3PGT A;  2YN1 A;  4RI6 A;  2JZS A;  1GSY A;  2E0Q A;  4D73 A;  2WZ9 A;  4IW9 A;  2K9F A;  4DSR A;  2K8V A;  3CSJ A;  1G6Y A;  2YWI A;  2DLX A;  6GSX A;  1GUH A;  2HI7 A;  3UBL A;  1SK1 A;  2A4H A;  4MCU A;  1SL0 B;  1J0F A;  2YOI A;  5HFK A;  5HR3 A;  3WT2 A;  5FHI A;  4L5O A;  3FKF A;  2JAD A;  5A4W A;  5G2Z A;  3LFL A;  5F06 A;  4G01 A;  4HI7 A;  1O8X A;  4XIH A;  4CY6 A;  2AJQ B;  1UVZ A;  5CNW A;  2H70 A;  4GST A;  2H1D A;  1TXU A;  5IO2 A;  4MPG A;  3LEF A;  4RI7 A;  4TR1 A;  2JZT A;  1KEB A;  4MJB A;  1EP8 A;  1MD3 A;  2AAW A;  17GS A;  1F37 A;  4OO4 A;  1GUM A;  2TIR A;  1NSW A;  5IPG A;  4WBJ A;  1QUW A;  3ZVJ A;  1GSD A;  2ZUP A;  2OJL A;  3ZTL A;  3VLN A;  1T4Z A;  4LLR A;  2OT3 A;  1TRS A;  1B9Y C;  4K2X A;  1SD9 A;  2YP6 A;  2CVD A;  2IMI A;  3ZIV A;  1S3C A;  4ZL8 A;  3GUR A;  4AI6 A;  1VF2 A;  2TRX A;  1XW9 A;  3KGK A;  5IOX A;  1ST9 A;  4Q5F A;  2K8S A;  2YZH A;  4TRX A;  2NPB A;  3VWX A;  5CRD A;  4K8M A;  3F4R A;  2B6M A;  5B8B A;  1AQV A;  4F0B A;  3F6D A;  1SJZ A;  2HLS A;  22GS A;  5J5N A;  4DSS B;  1WP0 A;  1Z6N A;  2HRF A;  2L6D A;  2FNO A;  4ACS A;  2VAF A;  3ME8 A;  4MP4 A;  5JWO B;  2TRC P;  2EC4 A;  1SD8 A;  3KTL A;  2VCZ A;  2H0G A;  4JED A;  3TGZ A;  2BJX A;  1XWK A;  2X8C A;  1M9B A;  4W66 A;  3FZ5 A;  1JHB A;  4FQU A;  4K9Z A;  3VI7 A;  1GSU A;  4KCA A;  3HXS A;  2B5Y A;  1ABA A;  2K6V A;  3M8N A;  4MA9 A;  4OCF A;  2OA7 A;  5IMV A;  1ZYN A;  1LBK A;  5CYY A;  3TKS C;  1OC8 A;  2I1U A;  1TKD B;  2EIO A;  2VCW A;  4E8E A;  2LQQ A;  1BG1 A;  4IS0 A;  4KSM A;  4LMV A;  4OWY A;  1O73 A;  2WJU A;  1HNC A;  4YKF A;  6GSW A;  2GLR A;  3C8E A;  3EPT A;  2PBJ A;  2VO4 A;  2DKH A;  4ECI A;  1GNW A;  1VF1 A;  4OFN A;  2REM A;  2I9H A;  2HSM A;  5J9B A;  1EP7 A;  1V40 A;  2EFE A;  3TCO A;  3TRP A;  1PRX A;  5KN1 A;  3WGX A;  2KLX A;  4J56 E;  1NHO A;  5IMZ A;  2GQL A;  1I5G A;  4BVY B;  2JL4 A;  1SL1 B;  1PSQ A;  4LMW A;  2IFQ A;  3DEX A;  5DQS A;  1YF0 A;  5IO0 A;  1FVJ A;  1X9W B;  3UEM A;  1ZL9 A;  2DIY A;  4X4J A;  2HSN A;  3APS A;  3TKS E;  1XCC A;  1UC7 A;  2L5L A;  3US3 A;  2HRK B;  2VLU A;  2IN3 A;  5D9W A;  1W89 A;  1MDK A;  3MYD A;  1J9B A;  2QA1 A;  1FW1 A;  5D93 A;  1LJR A;  3GKM A;  3ZMK A;  2L5O A;  4MNN A;  4OFT A;  3GTU B;  1XW5 A;  2CVK A;  2G0F A;  4BWQ A;  1TK8 B;  1R5A A;  4LL1 B;  1WPI A;  5KOX A;  2LRN A;  2EIQ A;  2VUP A;  1FHE A;  3PPU A;  1RK4 A;  5ENU A;  3ISO A;  2M46 A;  2LUS A;  1USB A;  4MZC A;  2CVB A;  4K0G A;  4JZQ A;  3LOR A;  1Z7P A;  3HZ8 A;  3IA1 A;  1M7T A;  4TR3 A;  3D0Z A;  1JZR A;  2IJY A;  4EIQ A;  1O7U A;  5AIX A;  1XW6 A;  4FYU A;  3GA4 A;  2VL9 A;  3KP9 A;  4F82 A;  3KH9 A;  4DSQ A;  2C3T A;  1EOH A;  3ZZX A;  2MMO A;  1K3L A;  4MF6 A;  3DYR A;  4E68 A;  2MBT A;  2L4C A;  5JCG A;  1BED A;  2VOC A;  5FWG A;  1ACV A;  4MF5 A;  3W6G A;  5H5R A;  1EV9 A;  1XBS A;  4XTS A;  2A2R A;  2HQT A;  2C3Q A;  2PUK C;  3W8J A;  1PD2 1;  1THX A;  1TJD A;  4GSS A;  5ELG A;  1A0R P;  2O87 A;  2CV4 A;  3GKN A;  3LJR A;  3UOM A;  16GS A;  1AIU A;  3Q74 A;  3LSZ A;  4YQV A;  2CQ9 A;  5F07 A;  4ML6 A;  3WGD A;  4ZB8 A;  1TRW A;  1GSS A;  5IMD A;  2H1L A;  2VD0 A;  4ZXG A;  1T1V A;  3M3M A;  5KEJ A;  2F3M A;  5ELA A;  3TOU A;  1A2M A;  3H8Q A;  2JU5 A;  3F4S A;  4HQZ A;  1M0U A;  2RII A;  2D2Z A;  2L6C A;  2B1K A;  1N2A A;  2OE0 A;  2YV7 A;  1XIY A;  3G9B A;  1E2Y A;  4I97 A;  1K0A A;  3IOS A;  2V1M A;  5J4Y A;  3DIE A;  4EUY A;  5CRE A;  3L4N A;  3TJF A;  2OAD A;  3CRU A;  1XFL A;  4TR4 A;  2H8L A;  1GSF A;  3M9K A;  5KN3 A;  2IPA A;  2HFD A;  3VWV A;  2LST A;  2DKI A;  2MMN A;  1BF5 A;  3GX0 A;  4ZBA A;  3C1S A;  1FVK A;  3QPM A;  3TRQ A;  5C04 A;  3A3T A;  4TXO B;  1QQ2 A;  1Q98 A;  4Z7X A;  1PN9 A;  1B9X C;  3F4T A;  3IR4 A;  3F8U A;  3SBC A;  1XZO A;  4HS1 A;  4WF4 A;  5H5Q A;  2MYG A;  14GS A;  4Z2R A;  2YPM A;  3CBU A;  1NW2 A;  2FHE A;  3VFI A;  1VF3 A;  3ZRE A;  4YAV A;  2YCD A;  2R5G A;  5ABR A;  3HJM A;  1B4Q A;  3A5I A;  3RDW A;  1EWX A;  2I81 A;  4KW6 A;  1OC9 B;  1ERW A;  4KB3 A;  1S3D A;  2GQK A;  4EIP A;  2FY6 A;  2YWN A;  1SU9 A;  3JCM L;  2QA2 A;  3D22 A;  10GS A;  1DBY A;  2V41 A;  5EL8 A;  2DJ3 A;  1FAA A;  1GL8 A;  4IVF A;  1TRU A;  4NMU A;  1TW9 A;  3GL5 A;  1SKR B;  4PUF C;  1HD2 A;  1XPV A;  3MIX A;  1LU4 A;  3VUR A;  3GYK A;  1K0D A;  2P5Q A;  2H30 A;  2IMK A;  2C0E A;  2QC7 A;  2H75 A;  1XWA A;  1T8E B;  3M9J A;  3C71 A;  1ERT A;  13GS A;  3E3E A;  4NV5 A;  1SJ6 A;  1HNA A;  1EEM A;  4PQ1 A;  1T7P B;  2XHF A;  4MZW A;  4GCI A;  4K5R A;  5ID2 B;  1B48 A;  5LD0 A;  2N5F A;  2A2S A;  2GGT A;  4DSS A;  3IAM 2;  2ZNM A;  2LTK A;  3EMX A;  1M9A A;  4NV2 A;  3VWW A;  3GUS A;  1T4Y A;  2G2Q A;  3HY2 A;  3QFB C;  1AC1 A;  2FWG A;  5IMA A;  4IP6 A;  5J9C A;  6GSS A;  1DE2 A;  2K18 A;  1QK8 A;  1TI1 A;  1VRS D;  3QFA C;  2IL3 A;  2IMD A;  5D9V A;  2X99 A;  1WRY A;  2HZE B;  3ME7 A;  2EFD A;  4KDU A;  4HEA 2;  4GQF A;  4ISD A;  1ZOF A;  2WS2 A;  1SK2 A;  4FYC A;  2LNS A;  2EFH A;  2EFC A;  4JE1 A;  4O5U A;  3CRT A;  1WIK A;  4ID0 A;  4BL7 A;  5ECQ B;  1A2L A;  3LYP A;  5A5H B;  4N11 A;  3KMO A;  5B8A A;  4EE0 A;  1Z5Y E;  4KGI A;  2DJK A;  1ZYQ B;  4ZB6 A;  4QQ7 A;  4NXI A;  1GTI A;  5DCG A;  4KF9 A;  1ZYP A;  3QOU A;  3HDC A;  2E7P A;  3LG6 A;  4MK3 A;  3KXO A;  2YJH A;  3H93 A;  1K0N A;  4JR4 A;  1ZYE A;  4IJI A;  4N3Z A;  4WEY A;  5ECP B;  3APO A;  2PGT A;  2N5B A;  1J08 A;  2R6K A;  2E2G A;  5GAP D;  2VLT A;  5JWQ B;  4BVY A;  1Y25 A;  3F63 A;  4ZB9 A;  2F51 A;  3NZN A;  3BD2 A;  3CWG A;  2FUG 2;  3GV1 A;  2R0G A;  4GTU A;  4G9H A;  2OBI A;  5CRG A;  2QSI A;  5INY A;  2NBS A;  5HR0 A;  1GP1 A;  4F0C A;  1YY7 A;  4NAX A;  2VCX A;  3KIJ A;  4JRR A;  2X8G A;  1GUL A;  1TU8 A;  4EO3 A;  4HU9 A;  4L5L A;  5DAK B;  4F03 A;  4OCE A;  4ICY A;  2O85 A;  4MJC A;  2HRK A;  4K1F A;  4K5S A;  4ULX A;  2PPT A;  1BX9 A;  3BOA A;  4PQI A;  2C0F A;  3QR6 A;  4KDX A;  1QXH A;  2H01 A;  4K2D A;  2PU9 C;  3GTU A;  1YZX A;  3KMN A;  4G19 A;  3EMP A;  6GSY A;  4FH8 A;  1DE1 A;  4EL1 A;  1ZGN A;  1QMV A;  4HU7 A;  2IWT A;  4NPB A;  2KOK A;  1OAZ A;  3LWA A;  4ZL7 A;  4I2T A;  3TJB A;  2AUV A;  2ZCT A;  2R37 A;  1SEN A;  1TI3 A;  1GSQ A;  3ZIJ A;  4QL9 A;  1X5E A;  3M0F A;  4HZ4 A;  1X0R A;  2BMX A;  4I2U A;  1F2E A;  4N0V A;  4KCE A;  4F2I A;  3L9U A;  3P2A A;  3VI5 A;  1R7H A;  5B6M A;  2AYT A;  2HZF A;  3QAV A;  4L0U A;  2MBS A;  1YEP A;  4MMM A;  3EE2 A;  2FGX A;  3H79 A;  3KH7 A;  3L9V A;  2P0G A;  4HZ2 A;  4YAP A;  2HYX A;  4AF2 A;  3MNG A;  2B7K A;  4EC0 A;  2VL3 A;  4NHW A;  1WWJ A;  7GSS A;  3P90 A;  3P8W A;  3GKK A;  3MSZ A;  5J40 A;  5DAL B;  3UBK A;  5J3R A;  5CRH A;  1HYU A;  1KBN A;  1TK0 B;  5ECN B;  3DVW A;  3PR8 A;  1YDK A;  3MDK A;  4MJE A;  5G1L A;  2YZU A;  2H76 A;  2DJJ A;  4CY8 A;  4Z2T A;  3L0H A;  4ECC A;  3ZVJ D;  3MAK A;  2X64 A;  4YQM A;  5AN1 A;  3ZFL A;  2QGV A;  1XWC A;  2A2P A;  5J4V A;  3UVT A;  2FWH A;  3EIN A;  1Q4J A;  5CO3 A;  1SVO A;  4K7N A;  1RQM A;  1BJX A;  2GVP A;  2M72 A;  1X5C A;  2WCI A;  1A8L A;  2P5R A;  5GZZ B;  4NWY A;  3A5W A;  5HFI A;  2V32 A;  1RW1 A;  4G0I A;  4BVX B;  2ON5 A;  2JZR A;  3CSI A;  3I43 A;  4CHS A;  3TDG A;  2H1A A;  2H1B A;  1GTU A;  4ZB7 A;  3FHK A;  3FEU A;  1FOV A;  4EF0 A;  1ERV A;  18GS A;  1EOG A;  5ECS A;  3UVH A;  1K0O A;  1TDI A;  3APQ A;  5BRT A;  4TXO A;  2B5E A;  2VKZ G;  1AUC A;  4IJ3 A;  2GDR A;  2LNT A;  5G5F A;  3TJG A;  1DUG A;  1PN0 A;  1U88 A;  2YWM A;  3TJK A;  4K0N A;  3PH9 A;  4OFM A;  3TUE A;  1BAY A;  5BMU B;  5G31 A;  4AJ7 A;  3RHC A;  4O5Q A;  2H72 A;  4TN8 A;  2F8F A;  2J9H A;  4ZBD A;  2VL2 A;  2YV9 A;  1Z9H A;  1X5D A;  1DSB A;  1ILO A;  1HQO A;  2AB6 A;  4AGS A;  1OC9 A;  3NIV A;  3UL3 A;  3TOT A;  4O92 A;  6GST A;  1A24 A;  1BG5 A;  3W8S A;  1MDI A;  4KDY A;  3FZ9 A;  1PKZ A;  3L78 A;  3IAS 2;  4ZIJ A;  2XBI A;  3GH9 A;  4USS A;  3DXB A;  3F0I A;  1T00 A;  2V6K A;  1OVN A;  2VL2 C;  2CX4 A;  5ECR B;  5DJL A;  2B5X A;  2VM2 A;  1F3B A;  5LNK e;  2RLI A;  2V6O A;  5GAN D;  4XS6 A;  5IPH A;  4POL A;  1GLP A;  2C0G A;  4CW9 A;  2VIM A;  3QAG A;  2O7K A;  5A34 A;  3FW2 A;  2L57 A;  3C73 A;  2GSQ A;  4XRA A;  1XWB A;  5ID2 A;  5DCH A;  4OO5 A;  4Q5Q A;  4N30 A;  3GX8 A;  2HSM B;  1NM3 A;  3KJY A;  4GXZ A;  5H5S A;  2NVL A;  3HHV A;  19GS A;  2OE3 A;  3IXR A;  3Q6O A;  1N25 A;  2LEG A;  1SYX A;  2HRA A;  4K7I A;  3GHA A;  4PGT A;  3ZYW A;  3KTB A;  4I8B A;  3LW9 A;  1UA5 A;  4FO5 A;  1PX6 A;  3FMW A;  2JSZ A;  4E8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...