4BL7B

Crystal structure of the aimp3-mrs n-terminal domain complex in different space group
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
SMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFSHIQHYPGIRQHLSSVVFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE--TRNA LIGASE, CYTOPLASMIC
publication title Crystal Structure of the Aimp3-Mrs N-Terminal Domain Complex in Different Space Group
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 58
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4bl7B02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bl7B01
4IW9A 2HSMB 3IE3A 3LQ7A 1GSQA 3DD3A 3QAVA 4ISDA 3MAKA 1GTIA 4YAVA 5DDLA 1LBKA 5F8BA 1LJRA 5FHIA 3IBHA 4KDXA 1XW6A 4MZWA 1GUHA 2WRTA 3ZFBA 2PERA 4ZB8A 4HZ2A 4Q5QA 1XWKA 1XW5A 4MF5A 17GSA 4IBPA 5AIVA 4MDCA 3LYPA 2HRKA 4JEDA 4KGIA 3TOUA 4BVXA 13GSA 1B48A 3LXTA 4YH2A 5IQYA 3C8EA 4PURA 2VCVA 1GTBA 3QR6A 5F06A 1Y6EA 4KAEA 4E8EA 4O92A 1K0BA 4GF0A 3UBKA 3IK7A 3M1GA 6GSYA 2F8FA 3AY8A 1K0OA 3UARA 3HKRA 4GTUA 5A5KA 3F63A 4YQVA 16GSA 1TDIA 5A4VA 6GSTA 4NAXA 5DCGA 1ML6A 3VI5A 2C8UA 3DGQA 1GSYA 4EXJA 2V6KA 2IMKA 5ELGA 1YY7A 1PX6A 2PMTA 2VD1A 4ZBAA 3VURA 5HFKA 3U6VA 2WDUA 3R2QA 5G5FA 1AW9A 4F0BA 4Q5RA 1PN9A 3NIVA 1F2EA 4KE3A 5AISA 4BL7B 4G0KA 4G0IA 4PUAA 3F6FA 4PGTA 4IVFA 4MPFA 4IQAA 3UBLA 2DSAA 4OMVA 3ZFLA 1M0UA 4MF7A 3KMOA 5DQSA 2ON7A 2VCTA 1GNWA 3ZMKA 2A2RA 3KXOA 3EE2A 3Q19A 2DC5A 5F07A 5DAKB 3TGZA 4KF9A 2F3MA 2HSNB 1ZGNA 5ECNB 1EOHA 2FNOA 1TU8A 4PQIA 1PL2A 1MTCA 5GSTA 4KH7A 2FHEA 2OACA 2OA7A 3CSHA 1EOGA 5AGYA 1IYIA 3M3MA 5ECHB 3HJMA 4G9HA 1K3YA 3IK9A 5DJLA 1AXDA 1GSSA 3QAGA 5ECQB 1B8XA 2R6KA 1GTAA 2PGTA 8GSSA 1U3IA 4IS0A 4J2FA 3VWXA 2CA8A 4PTSA 1PL1A 4RI6A 4ECJA 1XWGA 9GSSA 1PX7A 3LXZA 3MDKA 4WR5A 3WD6A 1K0DA 1M9BA 2ON5A 4EDZA 3ERGA 1K0AA 4JZQA 5ELAA 2C4JA 2CVDA 2GSQA 4HZ4A 2PVQA 3KJYA 5ECSA 4KX4A 1GSUA 3WYWA 5J41A 3N5OA 4KDUA 1M99A 5F0GA 3GTUB 3LFLA 3P8WA 2CAQA 4OFMA 5LCZA 4MF6A 1PKWA 1YJ6A 3O76A 2HRAA 2VCZA 1U87A 1RK4A 5J4UA 1UA5A 1BAYA 5D9WA 5FWGA 2OADA 3I69A 1U88A 3IC8A 6GSUA 4ID0A 5JCUA 1HNAA 2CZ2A 4GSSA 3VI7A 4BVYA 1AQXA 1AQWA 1GWCA 1MD3A 3ISOA 19GSA 2X64A 2YV7A 1K3OA 4HI7A 4L5OA 5DJMA 2HRKB 4BVXB 3R3EA 5KEJA 1Z9HA 2GTUA 1R5AA 3ERFA 6GSSA 1GSDA 3FR6A 1MD4A 1GTUA 1M9AA 1K0CA 1ZL9A 3IR4A 1TU7A 4TOPA 5D9TA 5D9VA 5ECRB 3TOTA 1N2AA 5ECLB 5B7CA 3CBUA 4YQUA 1FHEA 4GSNA 5D73A 3KTLA 3SWLA 3Q18A 4IJIA 10GSA 3LJRA 2YV9A 5DALB 3PPUA 4ZXGA 2C3TA 4KDYA 1PGTA 2CZ3A 2IMIA 4WR4A 2VCXA 2R4VA 3VPTA 4BL7A 1F3BA 1V2AA 1HNBA 1HQOA 4NHZA 4ZB6A 5EY6A 22GSA 1IYHA 4MPGA 3UAPA 3BBYA 3P90A 2VD0A 4MK3A 5J5NA 6GSVA 4OFNA 4AGSA 4MP4A 2J9HA 1GNEA 5DAKA 4EE0A 4GSTA 3GURA 2IL3A 4O7HA 5AIXA 2WJUA 1BYEA 3CSJA 3FRCA 4L8EA 3LSZA 5AN1A 4HJ2A 5GZZB 3VK9A 6GSXA 1PKZA 5ECKB 5ECOB 3CRUA 5LD0A 5EVOA 1JLWA 4YAPA 3QAWA 2C80A 1GULA 1OKTA 5F05A 4F0CA 1GUMA 3G7IA 4JBBA 4ZBDA 4DEJA 2HSMA 4KSMA 4RI7A 3I6AA 4YQMA 3FR9A 2YCDA 1YQ1A 20GSA 2HQTA 3CSIA 5ECPB 3UVHA 3D0ZA 4E8HA 1K3LA 4G19A 4N0VA 1OYJA 2GDRA 1TW9A 4EC0A 2JL4A 3GUSA 2PBJA 5ECIB 2HNLA 4ACSA 1YDKA 1G6YA 4G10A 4NHWA 1EV9A 4LMWA 3GTUA 4PX1A 1VF1A 5EL8A 2D2ZA 3PR8A 1K0MA 2AHEA 3GSTA 1GSFA 4OFTA 3F6DA 3ZMLA 4IELA 1OE8A 4LMVA 2WB9A 4L5LA 3EINA 12GSA 3FYGA 3G7JA 2AB6A 2GSSA 1DUGA 1USBA 3FR3A 2VO4A 4ECCA 4IKHA 5G5EA 1GLPA 1E6BA 4G0LA 4ECBA 3HJOA 2AAWA 1FW1A 4ZB9A 1GSEA 4BVYB 1BX9A 4CHSA 2A2SA 1V40A 2GSTA 4K0GA 4PNGA 3M8NA 4I97A 1KBNA 2CAIA 3GSSA 5JCWA 2N5FA 3CRTA 3KM6A 7GSSA 1JZRA 4ZBBA 4FQUA 3M0FA 4GLTA 4QQ7A 1K0NA 1F3AA 3H1NA 5DALA 11GSA 3KMNA 1VF4A 1GUKA 5GSSA 2VCQA 1PD21 3FY7A 2VCWA 1PA3A 3VLNA 4Q5NA 4PXOA 5FT3A 14GSA 1VF2A 5BMUA 2C3QA 1YKCA 4IGJA 3GH6A 1BG5A 1G7OA 2NTOA 4Q5FA 3O3TA 3GX0A 1OE7A 2GSRA 1NHYA 2C3NA 5D9XA 3PGTA 1EEMA 6GSWA 1VF3A 3RBTA 4ECIA 1AQVA 4GCIA 3LYKA 5A4WA 3VPQA 2WS2A 4PNFA 1HNCA 4EDYA 1GLQA 1JLVA 4K0NA 1G6WA 1B4PA 1PMTA 2R5GA 2UZ8A 2LJRA 4PQHA 4HOJA 3W8SA 2GLRA 5A4UA 18GSA 1EV4A 4USSA 4F03A 1Q4JA 3L0HA 3N9JA 5ECMB 3LG6A 3Q74A 2R3XA 1C72A 1A0FA 4IQ1A
chains in the Genus database with same CATH superfamily
3LQ7A 4MH3A 3DD3A 3QAVA 4ISDA 2OBKA 5F8BA 5H5SA 5FHIA 3IBHA 2V2GA 2WZSA 1QGVA 3Q6OA 4MZWA 3KZQA 2XBQA 2EC4A 3ZFBA 1DSBA 4HZ2A 2IPAA 1XWKA 1S4BP 5IMDA 3HJPA 2AUVA 2V1MA 1Z5YE 4MDCA 1OKDA 3LYPA 2PWJA 2HRKA 3TOUA 4MA9A 1W89A 3UJ1A 1B48A 1S3DA 3LXTA 1A0RP 4YH2A 2VKZG 4PHZC 1AUCA 4L0UA 1GP1A 3HZ8A 1M3IA 4KAEA 4E8EA 3DXBA 4KSOA 2YWIA 5B6MA 1EGOA 1K0OA 2MMOA 1CQHA 2EIOA 1TDIA 4HSCX 6GSTA 1SYXA 1ML6A 3VI5A 4BIKA 1TOFA 3EU3A 1SYRA 2C8UA 3DGQA 3GFKA 4K8MA 3GRXA 1ZYEA 4POBA 2RUFA 3K8NA 2WDUA 2FWFA 2A4VA 4F0BA 4Q5RA 1PN9A 1F2EA 5AISA 3EVIA 3HVNA 4BL7B 4TRXA 2IJYA 4G0IA 4PGTA 2WFCA 3F4TA 4IQAA 5KOXA 3UBLA 3RPPA 3ZRDA 2H1GA 3FZAA 3V1WA 5A1NB 4JR4A 3P7XA 4AJ8A 1JZOA 2UV8G 2LUSA 4XS4B 1XFLA 5DCHA 4QL9A 3HD5A 3TUEA 1VGLA 2DC5A 5F07A 5DAKB 3TGZA 1O85A 2L6CA 2LJKA 2JACA 5ECNB 4XS6A 4AF2A 2H8LA 3RPNA 1TU8A 1PL2A 2DIYA 4HEA2 5CRGA 2OACA 3US3A 4JE1A 1IYIA 5DJLA 1AXDA 1VRSD 1WE0A 1GTAA 2HYXA 2PGTA 1NM3A 1PN0A 2CA8A 3E9JB 4POMA 1PL1A 1XWGA 2B6MA 4TXOA 9GSSA 2GGTA 3LXZA 4RQRA 2L4QA 2OE0A 1ERWA 2GT5A 2C4JA 2GSQA 3S9FA 2GVPA 3WGDA 5J41A 2PN8A 2OT3A 4OFMA 3KD0A 4N11A 5E59A 3O76A 2ZCTA 1M2DA 2VCZA 2CVKA 5FWGA 6GSUA 3IC8A 4GSSA 4BVYA 1AQXA 2TIRA 3A2VA 3EMPA 4WEYA 3KIJA 1I9DA 2YV7A 2RM6A 1V58A 3HDCA 2LKUA 3ZREA 3R3EA 4O5RA 4TXVA 2GTUA 1R5AA 3ERFA 2NPBA 3CMIA 1MD4A 1GTUA 3IV4A 2NDOA 3RHCA 5ECLB 1O6JA 2IFQA 2G2QA 2EIRA 3KTLA 3FHKA 1OVNA 4IJIA 2GQKA 3TB2A 1V98A 4PQ1A 2GZPA 2LJAA 2GZZA 3LGCA 1A23A 5DALB 1HYUA 2VUPA 3GX8A 4NPBA 2C3TA 1M7TA 2VM2A 5IM9A 1JHBA 1PGTA 1RQMA 3DRNA 2IMIA 2VCXA 1QQ2A 4NMUA 1F3BA 1F6MC 3FKFA 22GSA 1IYHA 4MPGA 5KN0A 2OE1A 4XIHA 3F0IA 3CYNA 3VWUA 5A34A 3P90A 4MZBA 4MK3A 4KW6A 4Z7XA 4HS1A 3DYRA 1T4ZA 2IN3A 4GSTA 4ML1A 1SL0B 5CAXA 1BQ7A 3ZTLA 4DSQA 2CT6A 3PINA 1SKRB 2N5BA 1TI1A 1NW2A 2H0HA 2ES7A 2HI7A 2O89A 3CTFA 1XIYA 3CRUA 4YAPA 3QAWA 4F0CA 4WKWA 1GUMA 5E4WA 3G7IA 3DVXA 1XVQA 1SKWB 4FYCA 2K6VA 3FR9A 2E2MA 5IMVA 4AKXB 4G19A 2GDRA 3IHQA 3FMWA 1PSQA 1GL8A 3IOSA 2E2GA 2LEGA 4G10A 2L59A 1EV9A 4LMWA 2H76A 3QCPA 1SK0A 4K7IA 1VF1A 1O7UA 4V2MA 2D2ZA 1K0MA 1GSFA 3ZMLA 1OE8A 1R7HA 2WB9A 2B5EA 2VLTA 2GSSA 1USBA 4IKHA 1GLPA 4G0LA 2YWMA 4K1FA 5DVBA 1FB6A 4QL7A 1GSEA 1BX9A 4MABA 5COHA 3C1RA 1MEKA 2GSTA 1YEWC 4K0GA 1FVJA 5J40A 3CTGA 4PNGA 1KBNA 2N5FA 2MYGA 3KM6A 1PFOA 1JZRA 4ZBBA 3GL5A 2RUEA 2FY6A 3EURA 1K0NA 1F3AA 5GSSA 4TKYA 2LSTA 3LORA 4MJEA 5G1LA 3ZYWA 3VLNA 2FWEA 1TRSA 4EIPA 3RGBC 2NVLA 14GSA 1VF2A 2C0DA 2C3QA 2PU9C 1BG5A 2YWOA 3HYPA 2GSRA 1NHYA 2LNTA 3A3TA 2EIQA 1EEMA 3HVSA 3VWWA 1AQVA 2GZYA 4GCIA 3LYKA 2CQ9A 5A4WA 3ERWA 1XOAA 2YJ7A 1SJZA 4N10A 1R5PA 2C0EA 4OWYA 1GLQA 4CY6A 4K0NA 2ALBA 2CV4A 2FGXA 2O87A 1PMTA 3DWVA 1THXA 2B5YA 4F2IA 1FOHA 1MDKA 5JCGA 3D6IA 1EGRA 5G2ZA 1EV4A 4USSA 2TRCP 1WWJA 3N9JA 2XPEA 2VOCA 2P5RA 5J3RA 2K8SA 1B9XC 4XRDA 3TKSA 3RAZA 1ERVA 1GSQA 3HY2A 4I8BA 2B7JA 4YAVA 2N5AA 5J9CA 2WW0A 3H8QA 3QOUA 3CXGA 4GQCA 1GUHA 1TK0B 2K8VA 4ZB8A 3I43A 2P0GA 2GQMA 3QDNA 4MLYA 1XW5A 17GSA 5AIVA 4RQXA 4BVXA 4W66A 2HFDA 2H1LA 1ILOA 4O5UA 1V57A 3C8EA 3HCZA 2HZEB 5H5RA 3EMXA 5A5KA 4GTUA 3F63A 4IJ3A 1FB0A 1I1IP 2K9FA 16GSA 5A4VA 1XCCA 5H5QA 3FZ5A 5KN1A 2KUCA 2L5OA 1GSYA 2V6KA 1SL2B 5ELGA 1YY7A 1PX6A 2PMTA 4LL1B 2WW3A 3MYDA 5HFKA 4YKGA 5HR3A 4KE3A 3F6FA 4G2EA 1G0TA 4MPFA 1RW1A 1NHOA 3ME8A 4WBRD 3J7Yk 2DSAA 4OMVA 4I2UA 1XW9A 1SU9A 3GA4A 4MF7A 5CP1A 3KMOA 5DQSA 1S3CA 5L71A 2VCTA 3LWAA 1GNWA 5IPHA 3ZMKA 3DKSA 3EE2A 3KH7A 4IHUA 4KF9A 1ZYQB 1U3AA 2VL2A 2HSNB 1EOHA 2LS5A 3KH9A 4AKIA 1KNGA 1MTCA 5GSTA 3ZIVA 1WJKA 3D4MA 4HJMA 5G31A 1K3YA 1GRXA 1GSSA 3QAGA 5ECQB 1MDIA 2X99A 2K18A 1B8XA 1R4WA 8GSSA 3I9V2 3HXSA 1U3IA 4K7OA 4IS0A 3CHXC 3L4NA 4PTSA 4KB3A 1PRXA 4RI6A 1X5EA 4WR5A 3L9UA 1ZMAA 3TJJA 3RDWA 3HMJG 2A4HA 4H86A 3TRPA 2XBIA 3H93A 4HU9A 1T8EB 5B8BA 3WYWA 3TJBA 3DVWA 3TDGA 5F0GA 2PVOC 4MF6A 3MSZA 1PKWA 2R0GA 4I6XA 1RK4A 5J4UA 1X9WB 1U88A 2MMNA 1ZOFA 1HNAA 2CZ2A 3VI7A 4IP6A 1GWCA 1AQWA 19GSA 2X64A 1K3OA 4MMMA 4L5OA 5DJMA 2VL2C 4DVCA 2HRKB 1OC8A 2B3SA 3H79A 3U5RE 1K0CA 1ZL9A 1BF5A 1TU7A 3QFBC 5B7CA 4LA1A 4YQUA 5C00A 3SWLA 10GSA 2EFHA 4FYBA 1QK8A 4ZXGA 4HUAA 4BWSA 4BL7A 4Z2TA 1HQOA 5BMUB 3HZ4A 4NHZA 5EY6A 3EU4A 2CVBA 4V1Ap 1N8JA 2B5XA 2EFEA 2R0CA 2DMLA 2KP1A 4CY8A 1CQGA 3OR5A 5LNKe 1TRWA 1TRVA 5C04A 5DAKA 4EE0A 5ID2B 1X9MB 2BMXA 2YOIA 5AIXA 3WT2A 4N0ZA 3IAM2 4Z2UA 4L8EA 3LSZA 2LTKA 3FZ4A 3TJGA 3GIXA 1JLWA 4IP1A 2C80A 1OKTA 4ZBDA 4DEJA 2HSMA 1TXXA 4FH8A 4YQMA 3TKSE 3TJKA 2QKEA 2H66A 4F9ZA 3D5JA 3UVHA 3UIWA 3D0ZA 3GH9A 5JWRB 2DJ0A 1TW9A 4EC0A 5JWOB 5G1KA 4I2TA 1F37A 5ECIB 1EZKA 1SK1A 3EC3A 1G6YA 5HFIA 3QD9A 2FWGA 4TXOB 1X9SB 1T7PB 3M9JA 4WF5A 3GSTA 1JZWA 4IELA 3F8UA 3FYGA 2DLXA 1J08A 1Q98A 1JZDA 4FXYP 1OC9B 1SK2A 4WBJA 1AIUA 2QA2A 1O8XA 4L0WA 4ECBA 3MWHA 4KNDA 2YN1A 1TP9A 1XZOA 1Y1UA 4AI6A 2AAWA 1FW1A 4BVYB 4V2NA 2R2JA 1XWAA 1TXUA 1V40A 3ZVJD 2H75A 3EPTA 3IC4A 4TR1B 1PQNA 2L4CA 3CRTA 3J7Yb 7GSSA 2MMZA 4KUNA 4IN0A 4FQUA 2H01A 1WMJA 3M0FA 4GRFA 2IWTA 4Z2RA 3W8JA 4QQ7A 2V41A 2E7PA 5DALA 11GSA 4K2DA 4KA0A 1VF4A 1GUKA 2RM5A 4HU7A 3FY7A 2VCWA 2IFQB 4G01A 2QC7A 2VLUA 4PXOA 1M2BA 1SVLA 1TKDB 1YKCA 2RLIA 2DJJA 1OE7A 4YKFA 5D9XA 1A2LA 1VF3A 2LNSA 1X5CA 2XC2A 3G7YA 1ON4A 3LW9A 5HFGA 2LQOA 1SJIA 4PNFA 5CRDA 1ZYPA 4GQFA 2KLXA 1HNCA 4EDYA 4NXIA 1JLVA 2R5GA 5B6NA 2UZ8A 4OO5A 4HOJA 2GLRA 2E0QA 4KCAA 1WOUA 1XWCA 3EWLA 4F03A 1Q4JA 3L0HA 5ECMB 3F4RA 1C72A 3ZL5A 2YZHA 4PI0C 1A0FA 4O32A 4IQ1A 1ZYNA 4IW9A 3EYTA 4AKGA 2C0GA 2FLSA 3MAKA 5DDLA 1LJRA 3VFIA 2H74A 4KDXA 2DJ3A 1XW6A 4FO5A 2PERA 4Q5QA 2LQQA 4MF5A 4IBPA 1E2YA 3RFRC 4TR3A 4OO4A 1DBYA 5KOWA 4JEDA 4KGIA 3KTBA 3TRXA 2HRNA 3BCIA 2VCVA 1GTBA 4ZIJA 4O92A 1K0BA 4GF0A 1QMVA 1OAZA 3IK7A 4NWYA 2M72A 5D8IA 2F8FA 3HKRA 2H30A 4AKHA 2VL3A 1ZZYA 3IHGA 3GKKA 2ZUPA 3DEXA 4EIQA 1XG8A 4EXJA 2MZCA 1A8LA 2IMKA 2REMA 3FZ9A 3VURA 2G0FA 2VD1A 2BJXA 2HXKA 2MBTA 3U6VA 4N30A 3R2QA 5G5FA 2CX3A 3NIVA 1J0FA 1EP7A 2IIYA 4G0KA 5IOXA 1UVZA 5BRTA 2H1DA 2IMEA 1S3RA 4RUVA 4IVFA 1SVMA 3JCML 1Z6MA 3APQA 2H73A 2ON7A 2KP2A 3KP8A 2A2RA 3TKRA 4HDEA 2F3MA 3TU3B 2FNOA 4GXZA 4HQZA 2H6ZA 2FA8A 2FHEA 3BCKA 1EOGA 4MJBA 2QA1A 1ST9A 4K5SA 5HR1A 4J2FA 3VWXA 3A2WA 4ECJA 2L5LA 2PPTA 1PX7A 3MDKA 1K0DA 1M9BA 3M9KA 4EDZA 2HLSA 5ELAA 4JZQA 5IMAA 1FG4A 4HZ4A 4K6XA 3KJYA 3ZVJA 1LU4A 1B9YC 2PUKC 3N5OA 3QPMA 3GTUB 2X8GA 5CRWA 3P8WA 1MDJA 2CAQA 2I4AA 4K2XA 1FO5A 3UL3A 4LLRA 2H6XA 2HRAA 2QSIA 1KEBA 1BAYA 1G7EA 3I69A 2KOKA 2QGVA 4DSSA 1SVOA 3IXRA 1FAAA 4ICYA 4D73B 4P3YB 4HI7A 3TCOA 4BVXB 3ED3A 5DBQA 5A5HA 6GSSA 1GSDA 4ZL8A 5ENUA 1M9AA 2AV4A 4J56E 1H75A 4CDOA 3IR4A 4JRRA 4TOPA 5ECRB 2R0PA 1ZCPA 3CQFA 1ERUA 3CBUA 2X4AA 2FCHA 1FHEA 4XTSA 3TKSC 4GSNA 4ULXA 1V9WA 3Q18A 2YP6A 4ZB7A 4I5QA 4MH2A 4WF4A 2DMMA 4WR4A 2R4VA 4ML6A 3VPTA 2TRXA 4N3ZA 5CYYA 1V2AA 4BPYA 1Z3EA 4ZB6A 3KCMA 1NSWA 3UAPA 2V6OA 1WRYA 2YANA 2I81A 4HQSA 2VD0A 5J5NA 4QMKA 4OFNA 1YZXA 4MP4A 2J9HA 4F82A 4GDFA 3W6GA 2Z9SA 3FW2A 5G30A 3ME7A 4O7HA 2WJUA 3CSJA 2WVXB 3FRCA 5AN1A 1XOBA 1YKAA 3HA9A 3VK9A 6GSXA 3PH9A 2C0FA 2H71A 1HD2A 1M2AA 4MCUA 3GHAA 5KN3A 1GULA 3BOAA 4JBBA 4RI7A 3IPZA 2JADA 3TJFA 1YQ1A 3TKQA 2VIMA 1SKSB 4N0VA 1T1VA 3C73A 1J9BA 3H4KA 1H4OA 3F9UA 4ACSA 1YDKA 4JU5A 2HE3A 2GQLA 2WGRA 5J47A 5D93A 2LRNA 2IMFA 2F8AA 5B8AA 5EL8A 3F3QA 3PR8A 3GKXA 3P2AA 2AHEA 4OFTA 3F6DA 1UN2A 3QFAC 3FK8A 4L5LA 4JR6A 3EINA 3HHVA 5EPFA 1DUGA 3FR3A 1U6TA 4ZILA 1YVLA 3HVXA 1ACVA 4XHMA 1E6BA 3FEUA 5ABRA 4NV2A 1JFUA 2WW2A 4ZB9A 3UVTA 2FD3A 5INYA 2A2SA 3SBCA 1XPVA 2M46A 3M8NA 2XHFA 1QFNA 1UC7A 2CAIA 3GSSA 1FOVA 2C1YA 1ABAA 4ZL7A 4GLTA 1Z7PA 4EUYA 3H1NA 3G9BA 2NBSA 1WP0A 3E3EA 2JU5A 5IOWA 4TN8A 2AYTA 4EO3A 1X0RA 4XRAA 2DKHA 2P5QA 5BMUA 2B7KA 2MMAA 3ZLPA 4IGJA 4WETA 2HSYA 5A1NA 2YZUA 1ERTA 2O5VA 2NTOA 4KCEA 2WW1A 2V32A 3MIXA 4XS4A 3L9VA 2LRTA 2FUG2 3PGTA 6GSWA 4ILFA 3RBTA 1EEJA 4ECIA 5IPGA 3D4TA 5ID2A 3ZIJA 3BD2A 4POLA 2JSZA 3VPQA 3VWVA 2WS2A 4TVEA 4MJCA 1B4PA 2GT6A 5J4YA 3DMLA 2CX4A 2RIIA 3NOFA 3KEBA 3C7MA 5KN2A 3W8SA 5A4UA 18GSA 1M3JA 4OD7A 3LG6A 1FVKA 3NZNA 3Q74A 2FA4A 2YWNA 2HSMB 3IE3A 3IAS2 4WXTA 1GTIA 5IO0A 1LBKA 4MNNA 2I1UA 5JWQB 4EL1A 3UOMA 1Y25A 1F9MA 2BTOT 2WRTA 4XCSA 3ZZXA 1TK8B 1OC9A 2JZSA 2WCIA 3IRAA 1YEXA 13GSA 2OKAA 5IMFA 5IQYA 4PURA 4TW5A 1XVWA 5F06A 3QR6A 1Y6EA 3WGXA 4MJAA 3WT1A 3BJ5A 4TR1A 3UBKA 3M1GA 2A2PA 4FYUA 4NV5A 6GSYA 2OJLA 3AY8A 3UARA 1YEPA 4YQVA 2OBIA 4OCFA 1URMA 4NAXA 5DCGA 2WVYA 2X8HA 2YJHA 5J4VA 2I3YA 4ZBAA 2VM1A 2MBSA 2I9HA 1AW9A 5GAND 4PUAA 2H70A 2YPMA 4PI2C 2H1BA 1R26A 3ZFLA 1M0UA 3D22A 5A34B 3ZITA 1T00A 3GYKA 3GKNA 3HVVA 4XS1A 1T3BA 3KXOA 2HSHA 1SD8A 2HZFA 3Q19A 2VAFA 2AJQB 4TR4A 1ZGNA 4BA7A 2DJ1A 4PQIA 1A2MA 5CNWA 1TTZA 2DKIA 2LV3A 4KH7A 1SD9A 2OA7A 5CRHA 3CSHA 5AGYA 5ECHB 3M3MA 3HJMA 4G9HA 1O8WA 3IK9A 1EP8A 4ZL9A 5HR2A 2R6KA 1TRUA 2X49A 2DJKA 1Z6NA 1GH2A 3C71A 3KGKA 5CO3A 3WD6A 2WULA 4O5QA 5IMCA 2ON5A 2O85A 3D21A 5IMZA 3ERGA 3UEMA 1A24A 1K0AA 2CVDA 2PVQA 3O6TA 5ECSA 4EF0A 4KX4A 1GSUA 4KDUA 1M99A 4A5PA 3LFLA 4X1UA 3E0UA 5LCZA 5J9BA 1YJ6A 1SJ6A 1U87A 1UA5A 5D9WA 4PUFC 2OADA 2VLVA 3C1SA 4ID0A 5JCUA 2WZ9A 3CWGA 1MD3A 1A8YA 3ISOA 1YF1A 2L6DA 4AJ6A 5KEJA 3GNJA 1Z9HA 1DE1A 3FR6A 2XPDA 3TOTA 5D9TA 5D9VA 4V2LA 1N2AA 4POKA 2P31A 2YNXA 1Z7RA 5D73A 1B4QA 1N25A 1TI3A 2EFCA 5HQPA 2H0IA 3LJRA 3A5WA 2YV9A 3PPUA 2M80A 1A2JA 4KDYA 5GAPD 3GN3A 5D96A 4AJ7A 2CZ3A 2L57A 1QUWA 1BEDA 1HNBA 1EWXA 2EFDA 2HT9A 2H6YA 3L9SA 3BBYA 4TR0A 4E68A 3TRQA 3L78A 2KHPA 6GSVA 1XBSA 1THOA 1OC3A 4AGSA 1BJXA 1I5GA 1GNEA 2WVZA 3GURA 2O3EA 2IL3A 1KTEA 4OCEA 3A5IA 1W4VA 1BYEA 4HJ2A 3F3RA 5CREA 5GZZB 1PKZA 5ECKB 5ECOB 2IMDA 5LD0A 5EVOA 5F05A 2O7KA 3APSA 5IIZA 2DBCA 4KSMA 3I6AA 2YCDA 20GSA 2HQTA 4FIWA 3CSIA 3QMXA 1TJDA 5ECPB 4E8HA 1K3LA 1S3AA 1OYJA 1SENA 2JL4A 3GUSA 2PBJA 4EKZA 2HNLA 3IDVA 4DSRA 2H1AA 3A2XA 4NHWA 2HRFA 3GTUA 1O73A 4PX1A 2GS3A 2DJ2A 3TKPA 2JZTA 3DIEA 4LMVA 3IA1A 2H72A 1QXHA 12GSA 3G7JA 2AB6A 5HR0A 4LL4B 2VO4A 4ECCA 4D73A 2LRCA 5G5EA 2HZEA 3APOA 1DE2A 3HJOA 3LEFA 2O36A 5DQYA 1X5DA 4DSSB 4CHSA 2FWHA 2JSYA 3MNGA 1T4YA 4I97A 5JCWA 2B1KA 2B1LA 5A5HB 4V1Ag 3GKMA 1WIKA 3KMNA 4BWQA 2VCQA 1PD21 1AC1A 1PA3A 4Q5NA 3UMAA 1TK5B 5FT3A 4GWRA 2O8VB 4J57E 4K5RA 1XWBA 3GH6A 1G7OA 2F51A 4Q5FA 2OE3A 3O3TA 3GX0A 2R37A 5IO2A 4X43A 2C3NA 2JZRA 1AAZA 1YF0A 4EVMA 2HSNA 2J23A 1WPIA 1O81A 4X0XA 2X8CA 3RHBA 4CW9A 3WGEA 2WVXA 1BG1A 1SL1B 2VL9A 1XXUA 1G6WA 4K7NA 3GMFA 2LJRA 4PQHA 4X4JA 2F9SA 3F4SA 2H19A 3GV1A 4MZCA 2H0GA 2DIZA 3KP9A 3GL3A 2ZNMA 2R3XA 4K9ZA
chains in the Genus database with same CATH topology
3LQ7A 4MH3A 3DD3A 3QAVA 4ISDA 2OBKA 5F8BA 5H5SA 5FHIA 3IBHA 2V2GA 1QGVA 3Q6OA 4MZWA 3KZQA 2XBQA 2EC4A 3ZFBA 1DSBA 4HZ2A 2IPAA 1XWKA 5IMDA 3HJPA 2AUVA 2V1MA 1Z5YE 4MDCA 1OKDA 3LYPA 2PWJA 2HRKA 3TOUA 4MA9A 1W89A 3UJ1A 1B48A 1S3DA 3LXTA 1A0RP 4YH2A 2VKZG 1AUCA 4L0UA 1GP1A 3HZ8A 4KAEA 4E8EA 3DXBA 4KSOA 2YWIA 5B6MA 1EGOA 1K0OA 2MMOA 1CQHA 2EIOA 1TDIA 6GSTA 1SYXA 1ML6A 3VI5A 1TOFA 3EU3A 1SYRA 2C8UA 3DGQA 3GFKA 4K8MA 3GRXA 1ZYEA 4POBA 2RUFA 3K8NA 2WDUA 2FWFA 2A4VA 4F0BA 4Q5RA 1PN9A 1F2EA 5AISA 3EVIA 4BL7B 4TRXA 2IJYA 4G0IA 4PGTA 2WFCA 3F4TA 4IQAA 5KOXA 3UBLA 3RPPA 3ZRDA 2H1GA 3FZAA 3V1WA 5A1NB 4JR4A 3P7XA 4AJ8A 1JZOA 2UV8G 2LUSA 4XS4B 1XFLA 5DCHA 4QL9A 3HD5A 3TUEA 1VGLA 2DC5A 5F07A 5DAKB 3TGZA 1O85A 2L6CA 2LJKA 2JACA 5ECNB 4XS6A 4AF2A 2H8LA 3RPNA 1TU8A 1PL2A 2DIYA 4HEA2 5CRGA 2OACA 3US3A 4JE1A 1IYIA 5DJLA 1AXDA 1VRSD 1WE0A 1GTAA 2HYXA 2PGTA 1NM3A 1PN0A 2CA8A 3E9JB 4POMA 1PL1A 1XWGA 2B6MA 4TXOA 9GSSA 2GGTA 3LXZA 4RQRA 2L4QA 2OE0A 1ERWA 2GT5A 2C4JA 2GSQA 3S9FA 2GVPA 3WGDA 5J41A 2PN8A 2OT3A 4OFMA 3KD0A 4N11A 5E59A 3O76A 2ZCTA 1M2DA 2VCZA 2CVKA 5FWGA 6GSUA 3IC8A 4GSSA 4BVYA 1AQXA 2TIRA 3A2VA 3EMPA 4WEYA 3KIJA 1I9DA 2YV7A 2RM6A 1V58A 3HDCA 2LKUA 3ZREA 3R3EA 4O5RA 4TXVA 2GTUA 1R5AA 3ERFA 2NPBA 3CMIA 1MD4A 1GTUA 3IV4A 2NDOA 3RHCA 5ECLB 1O6JA 2IFQA 2G2QA 2EIRA 3KTLA 3FHKA 1OVNA 4IJIA 2GQKA 3TB2A 1V98A 4PQ1A 2GZPA 2LJAA 2GZZA 3LGCA 1A23A 5DALB 1HYUA 2VUPA 3GX8A 4NPBA 2C3TA 1M7TA 2VM2A 5IM9A 1JHBA 1PGTA 1RQMA 3DRNA 2IMIA 2VCXA 1QQ2A 4NMUA 1F3BA 1F6MC 3FKFA 22GSA 1IYHA 4MPGA 5KN0A 2OE1A 4XIHA 3F0IA 3CYNA 3VWUA 5A34A 3P90A 4MZBA 4MK3A 4KW6A 4Z7XA 4HS1A 3DYRA 1T4ZA 2IN3A 4GSTA 4ML1A 1SL0B 5CAXA 1BQ7A 3ZTLA 4DSQA 2CT6A 3PINA 1SKRB 2N5BA 1TI1A 1NW2A 2H0HA 2ES7A 2HI7A 2O89A 3CTFA 1XIYA 3CRUA 4YAPA 3QAWA 4F0CA 4WKWA 1GUMA 5E4WA 3G7IA 3DVXA 1XVQA 1SKWB 4FYCA 2K6VA 3FR9A 2E2MA 5IMVA 4AKXB 4G19A 2GDRA 3IHQA 3FMWA 1PSQA 1GL8A 3IOSA 2E2GA 2LEGA 4G10A 2L59A 1EV9A 4LMWA 2H76A 3QCPA 1SK0A 4K7IA 1VF1A 1O7UA 4V2MA 2D2ZA 1K0MA 1GSFA 3ZMLA 1OE8A 1R7HA 2WB9A 2B5EA 2VLTA 2GSSA 1USBA 4IKHA 1GLPA 4G0LA 2YWMA 4K1FA 5DVBA 1FB6A 4QL7A 1GSEA 1BX9A 4MABA 5COHA 3C1RA 1MEKA 2GSTA 4K0GA 1FVJA 5J40A 3CTGA 4PNGA 1KBNA 2N5FA 2MYGA 3KM6A 1JZRA 4ZBBA 3GL5A 2RUEA 2FY6A 3EURA 1K0NA 1F3AA 5GSSA 4TKYA 2LSTA 3LORA 4MJEA 5G1LA 3ZYWA 3VLNA 2FWEA 1TRSA 4EIPA 2NVLA 14GSA 1VF2A 2C0DA 2C3QA 2PU9C 1BG5A 2YWOA 3HYPA 2GSRA 1NHYA 2LNTA 3A3TA 2EIQA 1EEMA 3HVSA 3VWWA 1AQVA 2GZYA 4GCIA 3LYKA 2CQ9A 5A4WA 3ERWA 1XOAA 2YJ7A 1SJZA 4N10A 1R5PA 2C0EA 4OWYA 1GLQA 4CY6A 4K0NA 2ALBA 2CV4A 2FGXA 2O87A 1PMTA 3DWVA 1THXA 2B5YA 4F2IA 1FOHA 1MDKA 5JCGA 3D6IA 1EGRA 5G2ZA 1EV4A 4USSA 2TRCP 1WWJA 3N9JA 2XPEA 2VOCA 2P5RA 5J3RA 2K8SA 1B9XC 4XRDA 3TKSA 3RAZA 1ERVA 1GSQA 3HY2A 4I8BA 2B7JA 4YAVA 2N5AA 5J9CA 3H8QA 3QOUA 3CXGA 4GQCA 1GUHA 1TK0B 2K8VA 4ZB8A 3I43A 2P0GA 2GQMA 3QDNA 4MLYA 1XW5A 17GSA 5AIVA 4RQXA 4BVXA 4W66A 2HFDA 2H1LA 1ILOA 4O5UA 1V57A 3C8EA 3HCZA 2HZEB 5H5RA 3EMXA 5A5KA 4GTUA 3F63A 4IJ3A 1FB0A 2K9FA 16GSA 5A4VA 1XCCA 5H5QA 3FZ5A 5KN1A 2KUCA 2L5OA 1GSYA 2V6KA 1SL2B 5ELGA 1YY7A 1PX6A 2PMTA 4LL1B 3MYDA 5HFKA 4YKGA 5HR3A 4KE3A 3F6FA 4G2EA 1G0TA 4MPFA 1RW1A 1NHOA 3ME8A 4WBRD 3J7Yk 2DSAA 4OMVA 4I2UA 1XW9A 1SU9A 3GA4A 4MF7A 5CP1A 3KMOA 5DQSA 1S3CA 5L71A 2VCTA 3LWAA 1GNWA 5IPHA 3ZMKA 3DKSA 3EE2A 3KH7A 4IHUA 4KF9A 1ZYQB 1U3AA 2VL2A 2HSNB 1EOHA 2LS5A 3KH9A 4AKIA 1KNGA 1MTCA 5GSTA 3ZIVA 1WJKA 3D4MA 4HJMA 5G31A 1K3YA 1GRXA 1GSSA 3QAGA 5ECQB 1MDIA 2X99A 2K18A 1B8XA 1R4WA 8GSSA 3I9V2 3HXSA 1U3IA 4K7OA 4IS0A 3L4NA 4PTSA 4KB3A 1PRXA 4RI6A 1X5EA 4WR5A 3L9UA 1ZMAA 3TJJA 3RDWA 3HMJG 2A4HA 4H86A 3TRPA 2XBIA 3H93A 4HU9A 1T8EB 5B8BA 3WYWA 3TJBA 3DVWA 3TDGA 5F0GA 2PVOC 4MF6A 3MSZA 1PKWA 2R0GA 4I6XA 1RK4A 5J4UA 1X9WB 1U88A 2MMNA 1ZOFA 1HNAA 2CZ2A 3VI7A 4IP6A 1GWCA 1AQWA 19GSA 2X64A 1K3OA 4MMMA 4L5OA 5DJMA 2VL2C 4DVCA 2HRKB 1OC8A 2B3SA 3H79A 3U5RE 1K0CA 1ZL9A 1BF5A 1TU7A 3QFBC 5B7CA 4LA1A 4YQUA 5C00A 3SWLA 10GSA 2EFHA 4FYBA 1QK8A 4ZXGA 4HUAA 4BWSA 4BL7A 4Z2TA 1HQOA 5BMUB 3HZ4A 4NHZA 5EY6A 3EU4A 2CVBA 4V1Ap 1N8JA 2B5XA 2EFEA 2R0CA 2DMLA 2KP1A 4CY8A 1CQGA 3OR5A 5LNKe 1TRWA 1TRVA 5C04A 5DAKA 4EE0A 5ID2B 1X9MB 2BMXA 2YOIA 5AIXA 3WT2A 4N0ZA 3IAM2 4Z2UA 4L8EA 3LSZA 2LTKA 3FZ4A 3TJGA 3GIXA 1JLWA 4IP1A 2C80A 1OKTA 4ZBDA 4DEJA 2HSMA 1TXXA 4FH8A 4YQMA 3TKSE 3TJKA 2QKEA 2H66A 4F9ZA 3D5JA 3UVHA 3UIWA 3D0ZA 3GH9A 5JWRB 2DJ0A 1TW9A 4EC0A 5JWOB 5G1KA 4I2TA 1F37A 5ECIB 1EZKA 1SK1A 3EC3A 1G6YA 5HFIA 3QD9A 2FWGA 4TXOB 1X9SB 1T7PB 3M9JA 4WF5A 3GSTA 1JZWA 4IELA 3F8UA 3FYGA 2DLXA 1J08A 1Q98A 1JZDA 1OC9B 1SK2A 4WBJA 1AIUA 2QA2A 1O8XA 4L0WA 4ECBA 3MWHA 4KNDA 2YN1A 1TP9A 1XZOA 1Y1UA 4AI6A 2AAWA 1FW1A 4BVYB 4V2NA 2R2JA 1XWAA 1TXUA 1V40A 3ZVJD 2H75A 3EPTA 3IC4A 4TR1B 1PQNA 2L4CA 3CRTA 3J7Yb 7GSSA 2MMZA 4KUNA 4IN0A 4FQUA 2H01A 1WMJA 3M0FA 4GRFA 2IWTA 4Z2RA 3W8JA 4QQ7A 2V41A 2E7PA 5DALA 11GSA 4K2DA 4KA0A 1VF4A 1GUKA 2RM5A 4HU7A 3FY7A 2VCWA 2IFQB 4G01A 2QC7A 2VLUA 4PXOA 1M2BA 1SVLA 1TKDB 1YKCA 2RLIA 2DJJA 1OE7A 4YKFA 5D9XA 1A2LA 1VF3A 2LNSA 1X5CA 2XC2A 3G7YA 1ON4A 3LW9A 5HFGA 2LQOA 1SJIA 4PNFA 5CRDA 1ZYPA 4GQFA 2KLXA 1HNCA 4EDYA 4NXIA 1JLVA 2R5GA 5B6NA 2UZ8A 4OO5A 4HOJA 2GLRA 2E0QA 4KCAA 1WOUA 1XWCA 3EWLA 4F03A 1Q4JA 3L0HA 5ECMB 3F4RA 1C72A 3ZL5A 2YZHA 1A0FA 4O32A 4IQ1A 1ZYNA 4IW9A 3EYTA 4AKGA 2C0GA 2FLSA 3MAKA 5DDLA 1LJRA 3VFIA 2H74A 4KDXA 2DJ3A 1XW6A 4FO5A 2PERA 4Q5QA 2LQQA 4MF5A 4IBPA 1E2YA 4TR3A 4OO4A 1DBYA 5KOWA 4JEDA 4KGIA 3KTBA 3TRXA 2HRNA 3BCIA 2VCVA 1GTBA 4ZIJA 4O92A 1K0BA 4GF0A 1QMVA 1OAZA 3IK7A 4NWYA 2M72A 5D8IA 2F8FA 3HKRA 2H30A 4AKHA 2VL3A 1ZZYA 3IHGA 3GKKA 2ZUPA 3DEXA 4EIQA 4EXJA 2MZCA 1A8LA 2IMKA 2REMA 3FZ9A 3VURA 2G0FA 2VD1A 2BJXA 2HXKA 2MBTA 3U6VA 4N30A 3R2QA 5G5FA 2CX3A 3NIVA 1J0FA 1EP7A 2IIYA 4G0KA 5IOXA 1UVZA 5BRTA 2H1DA 2IMEA 4RUVA 4IVFA 1SVMA 3JCML 1Z6MA 3APQA 2H73A 2ON7A 2KP2A 3KP8A 2A2RA 3TKRA 4HDEA 2F3MA 3TU3B 2FNOA 4GXZA 4HQZA 2H6ZA 2FA8A 2FHEA 3BCKA 1EOGA 4MJBA 2QA1A 1ST9A 4K5SA 5HR1A 4J2FA 3VWXA 3A2WA 4ECJA 2L5LA 2PPTA 1PX7A 3MDKA 1K0DA 1M9BA 3M9KA 4EDZA 2HLSA 5ELAA 4JZQA 5IMAA 1FG4A 4HZ4A 4K6XA 3KJYA 3ZVJA 1LU4A 1B9YC 2PUKC 3N5OA 3QPMA 3GTUB 2X8GA 5CRWA 3P8WA 1MDJA 2CAQA 2I4AA 4K2XA 1FO5A 3UL3A 4LLRA 2H6XA 2HRAA 2QSIA 1KEBA 1BAYA 1G7EA 3I69A 2KOKA 2QGVA 4DSSA 1SVOA 3IXRA 1FAAA 4ICYA 4D73B 4P3YB 4HI7A 3TCOA 4BVXB 3ED3A 5DBQA 5A5HA 6GSSA 1GSDA 4ZL8A 5ENUA 1M9AA 2AV4A 4J56E 1H75A 4CDOA 3IR4A 4JRRA 4TOPA 5ECRB 2R0PA 1ZCPA 1ERUA 3CBUA 2X4AA 2FCHA 1FHEA 4XTSA 3TKSC 4GSNA 4ULXA 1V9WA 3Q18A 2YP6A 4ZB7A 4I5QA 4MH2A 4WF4A 2DMMA 4WR4A 2R4VA 4ML6A 3VPTA 2TRXA 4N3ZA 5CYYA 1V2AA 4BPYA 1Z3EA 4ZB6A 3KCMA 1NSWA 3UAPA 2V6OA 1WRYA 2YANA 2I81A 4HQSA 2VD0A 5J5NA 4QMKA 4OFNA 1YZXA 4MP4A 2J9HA 4F82A 4GDFA 3W6GA 2Z9SA 3FW2A 5G30A 3ME7A 4O7HA 2WJUA 3CSJA 3FRCA 5AN1A 1XOBA 1YKAA 3HA9A 3VK9A 6GSXA 3PH9A 2C0FA 2H71A 1HD2A 1M2AA 4MCUA 3GHAA 5KN3A 1GULA 3BOAA 4JBBA 4RI7A 3IPZA 2JADA 3TJFA 1YQ1A 3TKQA 2VIMA 1SKSB 4N0VA 1T1VA 3C73A 1J9BA 3H4KA 1H4OA 3F9UA 4ACSA 1YDKA 4JU5A 2HE3A 2GQLA 2WGRA 5J47A 5D93A 2LRNA 2IMFA 2F8AA 5B8AA 5EL8A 3F3QA 3PR8A 3GKXA 3P2AA 2AHEA 4OFTA 3F6DA 1UN2A 3QFAC 3FK8A 4L5LA 4JR6A 3EINA 3HHVA 5EPFA 1DUGA 3FR3A 1U6TA 4ZILA 1YVLA 3HVXA 1ACVA 4XHMA 1E6BA 3FEUA 5ABRA 4NV2A 1JFUA 4ZB9A 3UVTA 2FD3A 5INYA 2A2SA 3SBCA 1XPVA 2M46A 3M8NA 2XHFA 1QFNA 1UC7A 2CAIA 3GSSA 1FOVA 2C1YA 1ABAA 4ZL7A 4GLTA 1Z7PA 4EUYA 3H1NA 3G9BA 2NBSA 1WP0A 3E3EA 2JU5A 5IOWA 4TN8A 2AYTA 4EO3A 1X0RA 4XRAA 2DKHA 2P5QA 5BMUA 2B7KA 2MMAA 3ZLPA 4IGJA 4WETA 2HSYA 5A1NA 2YZUA 1ERTA 2O5VA 2NTOA 4KCEA 2V32A 3MIXA 4XS4A 3L9VA 2LRTA 2FUG2 3PGTA 6GSWA 4ILFA 3RBTA 1EEJA 4ECIA 5IPGA 3D4TA 5ID2A 3ZIJA 3BD2A 4POLA 2JSZA 3VPQA 3VWVA 2WS2A 4TVEA 4MJCA 1B4PA 2GT6A 5J4YA 3DMLA 2CX4A 2RIIA 3NOFA 3KEBA 3C7MA 5KN2A 3W8SA 5A4UA 18GSA 4OD7A 3LG6A 1FVKA 3NZNA 3Q74A 2FA4A 2YWNA 2HSMB 3IE3A 3IAS2 4WXTA 1GTIA 5IO0A 1LBKA 4MNNA 2I1UA 5JWQB 4EL1A 3UOMA 1Y25A 1F9MA 2BTOT 2WRTA 4XCSA 3ZZXA 1TK8B 1OC9A 2JZSA 2WCIA 3IRAA 1YEXA 13GSA 2OKAA 5IMFA 5IQYA 4PURA 4TW5A 1XVWA 5F06A 3QR6A 1Y6EA 3WGXA 4MJAA 3WT1A 3BJ5A 4TR1A 3UBKA 3M1GA 2A2PA 4FYUA 4NV5A 6GSYA 2OJLA 3AY8A 3UARA 1YEPA 4YQVA 2OBIA 4OCFA 1URMA 4NAXA 5DCGA 2X8HA 2YJHA 5J4VA 2I3YA 4ZBAA 2VM1A 2MBSA 2I9HA 1AW9A 5GAND 4PUAA 2H70A 2YPMA 2H1BA 1R26A 3ZFLA 1M0UA 3D22A 5A34B 3ZITA 1T00A 3GYKA 3GKNA 3HVVA 4XS1A 1T3BA 3KXOA 2HSHA 1SD8A 2HZFA 3Q19A 2VAFA 2AJQB 4TR4A 1ZGNA 4BA7A 2DJ1A 4PQIA 1A2MA 5CNWA 1TTZA 2DKIA 2LV3A 4KH7A 1SD9A 2OA7A 5CRHA 3CSHA 5AGYA 5ECHB 3M3MA 3HJMA 4G9HA 1O8WA 3IK9A 1EP8A 4ZL9A 5HR2A 2R6KA 1TRUA 2X49A 2DJKA 1Z6NA 1GH2A 3C71A 3KGKA 5CO3A 3WD6A 2WULA 4O5QA 5IMCA 2ON5A 2O85A 3D21A 5IMZA 3ERGA 3UEMA 1A24A 1K0AA 2CVDA 2PVQA 3O6TA 5ECSA 4EF0A 4KX4A 1GSUA 4KDUA 1M99A 4A5PA 3LFLA 4X1UA 3E0UA 5LCZA 5J9BA 1YJ6A 1SJ6A 1U87A 1UA5A 5D9WA 4PUFC 2OADA 2VLVA 3C1SA 4ID0A 5JCUA 2WZ9A 3CWGA 1MD3A 1A8YA 3ISOA 1YF1A 2L6DA 4AJ6A 5KEJA 3GNJA 1Z9HA 1DE1A 3FR6A 2XPDA 3TOTA 5D9TA 5D9VA 4V2LA 1N2AA 4POKA 2P31A 2YNXA 1Z7RA 5D73A 1B4QA 1N25A 1TI3A 2EFCA 5HQPA 2H0IA 3LJRA 3A5WA 2YV9A 3PPUA 2M80A 1A2JA 4KDYA 5GAPD 3GN3A 5D96A 4AJ7A 2CZ3A 2L57A 1QUWA 1BEDA 1HNBA 1EWXA 2EFDA 2HT9A 2H6YA 3L9SA 3BBYA 4TR0A 4E68A 3TRQA 3L78A 2KHPA 6GSVA 1XBSA 1THOA 1OC3A 4AGSA 1BJXA 1I5GA 1GNEA 3GURA 2IL3A 1KTEA 4OCEA 3A5IA 1W4VA 1BYEA 4HJ2A 3F3RA 5CREA 5GZZB 1PKZA 5ECKB 5ECOB 2IMDA 5LD0A 5EVOA 5F05A 2O7KA 3APSA 5IIZA 2DBCA 4KSMA 3I6AA 2YCDA 20GSA 2HQTA 4FIWA 3CSIA 3QMXA 1TJDA 5ECPB 4E8HA 1K3LA 1S3AA 1OYJA 1SENA 2JL4A 3GUSA 2PBJA 4EKZA 2HNLA 3IDVA 4DSRA 2H1AA 3A2XA 4NHWA 2HRFA 3GTUA 1O73A 4PX1A 2GS3A 2DJ2A 3TKPA 2JZTA 3DIEA 4LMVA 3IA1A 2H72A 1QXHA 12GSA 3G7JA 2AB6A 5HR0A 4LL4B 2VO4A 4ECCA 4D73A 2LRCA 5G5EA 2HZEA 3APOA 1DE2A 3HJOA 3LEFA 5DQYA 1X5DA 4DSSB 4CHSA 2FWHA 2JSYA 3MNGA 1T4YA 4I97A 5JCWA 2B1KA 2B1LA 5A5HB 4V1Ag 3GKMA 1WIKA 3KMNA 4BWQA 2VCQA 1PD21 1AC1A 1PA3A 4Q5NA 3UMAA 1TK5B 5FT3A 4GWRA 2O8VB 4J57E 4K5RA 1XWBA 3GH6A 1G7OA 2F51A 4Q5FA 2OE3A 3O3TA 3GX0A 2R37A 5IO2A 4X43A 2C3NA 2JZRA 1AAZA 1YF0A 4EVMA 2HSNA 2J23A 1WPIA 1O81A 4X0XA 2X8CA 3RHBA 4CW9A 3WGEA 1BG1A 1SL1B 2VL9A 1XXUA 1G6WA 4K7NA 3GMFA 2LJRA 4PQHA 4X4JA 2F9SA 3F4SA 2H19A 3GV1A 4MZCA 2H0GA 2DIZA 3KP9A 3GL3A 2ZNMA 2R3XA 4K9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IW9 A;  2HSM B;  3IE3 A;  3LQ7 A;  1GSQ A;  3DD3 A;  3QAV A;  4ISD A;  3MAK A;  1GTI A;  4YAV A;  5DDL A;  1LBK A;  5F8B A;  1LJR A;  5FHI A;  3IBH A;  4KDX A;  1XW6 A;  4MZW A;  1GUH A;  2WRT A;  3ZFB A;  2PER A;  4ZB8 A;  4HZ2 A;  4Q5Q A;  1XWK A;  1XW5 A;  4MF5 A;  17GS A;  4IBP A;  5AIV A;  4MDC A;  3LYP A;  2HRK A;  4JED A;  4KGI A;  3TOU A;  4BVX A;  13GS A;  1B48 A;  3LXT A;  4YH2 A;  5IQY A;  3C8E A;  4PUR A;  2VCV A;  1GTB A;  3QR6 A;  5F06 A;  1Y6E A;  4KAE A;  4E8E A;  4O92 A;  1K0B A;  4GF0 A;  3UBK A;  3IK7 A;  3M1G A;  6GSY A;  2F8F A;  3AY8 A;  1K0O A;  3UAR A;  3HKR A;  4GTU A;  5A5K A;  3F63 A;  4YQV A;  16GS A;  1TDI A;  5A4V A;  6GST A;  4NAX A;  5DCG A;  1ML6 A;  3VI5 A;  2C8U A;  3DGQ A;  1GSY A;  4EXJ A;  2V6K A;  2IMK A;  5ELG A;  1YY7 A;  1PX6 A;  2PMT A;  2VD1 A;  4ZBA A;  3VUR A;  5HFK A;  3U6V A;  2WDU A;  3R2Q A;  5G5F A;  1AW9 A;  4F0B A;  4Q5R A;  1PN9 A;  3NIV A;  1F2E A;  4KE3 A;  5AIS A;  4BL7 B;  4G0K A;  4G0I A;  4PUA A;  3F6F A;  4PGT A;  4IVF A;  4MPF A;  4IQA A;  3UBL A;  2DSA A;  4OMV A;  3ZFL A;  1M0U A;  4MF7 A;  3KMO A;  5DQS A;  2ON7 A;  2VCT A;  1GNW A;  3ZMK A;  2A2R A;  3KXO A;  3EE2 A;  3Q19 A;  2DC5 A;  5F07 A;  5DAK B;  3TGZ A;  4KF9 A;  2F3M A;  2HSN B;  1ZGN A;  5ECN B;  1EOH A;  2FNO A;  1TU8 A;  4PQI A;  1PL2 A;  1MTC A;  5GST A;  4KH7 A;  2FHE A;  2OAC A;  2OA7 A;  3CSH A;  1EOG A;  5AGY A;  1IYI A;  3M3M A;  5ECH B;  3HJM A;  4G9H A;  1K3Y A;  3IK9 A;  5DJL A;  1AXD A;  1GSS A;  3QAG A;  5ECQ B;  1B8X A;  2R6K A;  1GTA A;  2PGT A;  8GSS A;  1U3I A;  4IS0 A;  4J2F A;  3VWX A;  2CA8 A;  4PTS A;  1PL1 A;  4RI6 A;  4ECJ A;  1XWG A;  9GSS A;  1PX7 A;  3LXZ A;  3MDK A;  4WR5 A;  3WD6 A;  1K0D A;  1M9B A;  2ON5 A;  4EDZ A;  3ERG A;  1K0A A;  4JZQ A;  5ELA A;  2C4J A;  2CVD A;  2GSQ A;  4HZ4 A;  2PVQ A;  3KJY A;  5ECS A;  4KX4 A;  1GSU A;  3WYW A;  5J41 A;  3N5O A;  4KDU A;  1M99 A;  5F0G A;  3GTU B;  3LFL A;  3P8W A;  2CAQ A;  4OFM A;  5LCZ A;  4MF6 A;  1PKW A;  1YJ6 A;  3O76 A;  2HRA A;  2VCZ A;  1U87 A;  1RK4 A;  5J4U A;  1UA5 A;  1BAY A;  5D9W A;  5FWG A;  2OAD A;  3I69 A;  1U88 A;  3IC8 A;  6GSU A;  4ID0 A;  5JCU A;  1HNA A;  2CZ2 A;  4GSS A;  3VI7 A;  4BVY A;  1AQX A;  1AQW A;  1GWC A;  1MD3 A;  3ISO A;  19GS A;  2X64 A;  2YV7 A;  1K3O A;  4HI7 A;  4L5O A;  5DJM A;  2HRK B;  4BVX B;  3R3E A;  5KEJ A;  1Z9H A;  2GTU A;  1R5A A;  3ERF A;  6GSS A;  1GSD A;  3FR6 A;  1MD4 A;  1GTU A;  1M9A A;  1K0C A;  1ZL9 A;  3IR4 A;  1TU7 A;  4TOP A;  5D9T A;  5D9V A;  5ECR B;  3TOT A;  1N2A A;  5ECL B;  5B7C A;  3CBU A;  4YQU A;  1FHE A;  4GSN A;  5D73 A;  3KTL A;  3SWL A;  3Q18 A;  4IJI A;  10GS A;  3LJR A;  2YV9 A;  5DAL B;  3PPU A;  4ZXG A;  2C3T A;  4KDY A;  1PGT A;  2CZ3 A;  2IMI A;  4WR4 A;  2VCX A;  2R4V A;  3VPT A;  4BL7 A;  1F3B A;  1V2A A;  1HNB A;  1HQO A;  4NHZ A;  4ZB6 A;  5EY6 A;  22GS A;  1IYH A;  4MPG A;  3UAP A;  3BBY A;  3P90 A;  2VD0 A;  4MK3 A;  5J5N A;  6GSV A;  4OFN A;  4AGS A;  4MP4 A;  2J9H A;  1GNE A;  5DAK A;  4EE0 A;  4GST A;  3GUR A;  2IL3 A;  4O7H A;  5AIX A;  2WJU A;  1BYE A;  3CSJ A;  3FRC A;  4L8E A;  3LSZ A;  5AN1 A;  4HJ2 A;  5GZZ B;  3VK9 A;  6GSX A;  1PKZ A;  5ECK B;  5ECO B;  3CRU A;  5LD0 A;  5EVO A;  1JLW A;  4YAP A;  3QAW A;  2C80 A;  1GUL A;  1OKT A;  5F05 A;  4F0C A;  1GUM A;  3G7I A;  4JBB A;  4ZBD A;  4DEJ A;  2HSM A;  4KSM A;  4RI7 A;  3I6A A;  4YQM A;  3FR9 A;  2YCD A;  1YQ1 A;  20GS A;  2HQT A;  3CSI A;  5ECP B;  3UVH A;  3D0Z A;  4E8H A;  1K3L A;  4G19 A;  4N0V A;  1OYJ A;  2GDR A;  1TW9 A;  4EC0 A;  2JL4 A;  3GUS A;  2PBJ A;  5ECI B;  2HNL A;  4ACS A;  1YDK A;  1G6Y A;  4G10 A;  4NHW A;  1EV9 A;  4LMW A;  3GTU A;  4PX1 A;  1VF1 A;  5EL8 A;  2D2Z A;  3PR8 A;  1K0M A;  2AHE A;  3GST A;  1GSF A;  4OFT A;  3F6D A;  3ZML A;  4IEL A;  1OE8 A;  4LMV A;  2WB9 A;  4L5L A;  3EIN A;  12GS A;  3FYG A;  3G7J A;  2AB6 A;  2GSS A;  1DUG A;  1USB A;  3FR3 A;  2VO4 A;  4ECC A;  4IKH A;  5G5E A;  1GLP A;  1E6B A;  4G0L A;  4ECB A;  3HJO A;  2AAW A;  1FW1 A;  4ZB9 A;  1GSE A;  4BVY B;  1BX9 A;  4CHS A;  2A2S A;  1V40 A;  2GST A;  4K0G A;  4PNG A;  3M8N A;  4I97 A;  1KBN A;  2CAI A;  3GSS A;  5JCW A;  2N5F A;  3CRT A;  3KM6 A;  7GSS A;  1JZR A;  4ZBB A;  4FQU A;  3M0F A;  4GLT A;  4QQ7 A;  1K0N A;  1F3A A;  3H1N A;  5DAL A;  11GS A;  3KMN A;  1VF4 A;  1GUK A;  5GSS A;  2VCQ A;  1PD2 1;  3FY7 A;  2VCW A;  1PA3 A;  3VLN A;  4Q5N A;  4PXO A;  5FT3 A;  14GS A;  1VF2 A;  5BMU A;  2C3Q A;  1YKC A;  4IGJ A;  3GH6 A;  1BG5 A;  1G7O A;  2NTO A;  4Q5F A;  3O3T A;  3GX0 A;  1OE7 A;  2GSR A;  1NHY A;  2C3N A;  5D9X A;  3PGT A;  1EEM A;  6GSW A;  1VF3 A;  3RBT A;  4ECI A;  1AQV A;  4GCI A;  3LYK A;  5A4W A;  3VPQ A;  2WS2 A;  4PNF A;  1HNC A;  4EDY A;  1GLQ A;  1JLV A;  4K0N A;  1G6W A;  1B4P A;  1PMT A;  2R5G A;  2UZ8 A;  2LJR A;  4PQH A;  4HOJ A;  3W8S A;  2GLR A;  5A4U A;  18GS A;  1EV4 A;  4USS A;  4F03 A;  1Q4J A;  3L0H A;  3N9J A;  5ECM B;  3LG6 A;  3Q74 A;  2R3X A;  1C72 A;  1A0F A;  4IQ1 A; 
#chains in the Genus database with same CATH topology
 3LQ7 A;  4MH3 A;  3DD3 A;  3QAV A;  4ISD A;  2OBK A;  5F8B A;  5H5S A;  5FHI A;  3IBH A;  2V2G A;  2WZS A;  1QGV A;  3Q6O A;  4MZW A;  3KZQ A;  2XBQ A;  2EC4 A;  3ZFB A;  1DSB A;  4HZ2 A;  2IPA A;  1XWK A;  1S4B P;  5IMD A;  3HJP A;  2AUV A;  2V1M A;  1Z5Y E;  4MDC A;  1OKD A;  3LYP A;  2PWJ A;  2HRK A;  3TOU A;  4MA9 A;  1W89 A;  3UJ1 A;  1B48 A;  1S3D A;  3LXT A;  1A0R P;  4YH2 A;  2VKZ G;  4PHZ C;  1AUC A;  4L0U A;  1GP1 A;  3HZ8 A;  1M3I A;  4KAE A;  4E8E A;  3DXB A;  4KSO A;  2YWI A;  5B6M A;  1EGO A;  1K0O A;  2MMO A;  1CQH A;  2EIO A;  1TDI A;  4HSC X;  6GST A;  1SYX A;  1ML6 A;  3VI5 A;  4BIK A;  1TOF A;  3EU3 A;  1SYR A;  2C8U A;  3DGQ A;  3GFK A;  4K8M A;  3GRX A;  1ZYE A;  4POB A;  2RUF A;  3K8N A;  2WDU A;  2FWF A;  2A4V A;  4F0B A;  4Q5R A;  1PN9 A;  1F2E A;  5AIS A;  3EVI A;  3HVN A;  4BL7 B;  4TRX A;  2IJY A;  4G0I A;  4PGT A;  2WFC A;  3F4T A;  4IQA A;  5KOX A;  3UBL A;  3RPP A;  3ZRD A;  2H1G A;  3FZA A;  3V1W A;  5A1N B;  4JR4 A;  3P7X A;  4AJ8 A;  1JZO A;  2UV8 G;  2LUS A;  4XS4 B;  1XFL A;  5DCH A;  4QL9 A;  3HD5 A;  3TUE A;  1VGL A;  2DC5 A;  5F07 A;  5DAK B;  3TGZ A;  1O85 A;  2L6C A;  2LJK A;  2JAC A;  5ECN B;  4XS6 A;  4AF2 A;  2H8L A;  3RPN A;  1TU8 A;  1PL2 A;  2DIY A;  4HEA 2;  5CRG A;  2OAC A;  3US3 A;  4JE1 A;  1IYI A;  5DJL A;  1AXD A;  1VRS D;  1WE0 A;  1GTA A;  2HYX A;  2PGT A;  1NM3 A;  1PN0 A;  2CA8 A;  3E9J B;  4POM A;  1PL1 A;  1XWG A;  2B6M A;  4TXO A;  9GSS A;  2GGT A;  3LXZ A;  4RQR A;  2L4Q A;  2OE0 A;  1ERW A;  2GT5 A;  2C4J A;  2GSQ A;  3S9F A;  2GVP A;  3WGD A;  5J41 A;  2PN8 A;  2OT3 A;  4OFM A;  3KD0 A;  4N11 A;  5E59 A;  3O76 A;  2ZCT A;  1M2D A;  2VCZ A;  2CVK A;  5FWG A;  6GSU A;  3IC8 A;  4GSS A;  4BVY A;  1AQX A;  2TIR A;  3A2V A;  3EMP A;  4WEY A;  3KIJ A;  1I9D A;  2YV7 A;  2RM6 A;  1V58 A;  3HDC A;  2LKU A;  3ZRE A;  3R3E A;  4O5R A;  4TXV A;  2GTU A;  1R5A A;  3ERF A;  2NPB A;  3CMI A;  1MD4 A;  1GTU A;  3IV4 A;  2NDO A;  3RHC A;  5ECL B;  1O6J A;  2IFQ A;  2G2Q A;  2EIR A;  3KTL A;  3FHK A;  1OVN A;  4IJI A;  2GQK A;  3TB2 A;  1V98 A;  4PQ1 A;  2GZP A;  2LJA A;  2GZZ A;  3LGC A;  1A23 A;  5DAL B;  1HYU A;  2VUP A;  3GX8 A;  4NPB A;  2C3T A;  1M7T A;  2VM2 A;  5IM9 A;  1JHB A;  1PGT A;  1RQM A;  3DRN A;  2IMI A;  2VCX A;  1QQ2 A;  4NMU A;  1F3B A;  1F6M C;  3FKF A;  22GS A;  1IYH A;  4MPG A;  5KN0 A;  2OE1 A;  4XIH A;  3F0I A;  3CYN A;  3VWU A;  5A34 A;  3P90 A;  4MZB A;  4MK3 A;  4KW6 A;  4Z7X A;  4HS1 A;  3DYR A;  1T4Z A;  2IN3 A;  4GST A;  4ML1 A;  1SL0 B;  5CAX A;  1BQ7 A;  3ZTL A;  4DSQ A;  2CT6 A;  3PIN A;  1SKR B;  2N5B A;  1TI1 A;  1NW2 A;  2H0H A;  2ES7 A;  2HI7 A;  2O89 A;  3CTF A;  1XIY A;  3CRU A;  4YAP A;  3QAW A;  4F0C A;  4WKW A;  1GUM A;  5E4W A;  3G7I A;  3DVX A;  1XVQ A;  1SKW B;  4FYC A;  2K6V A;  3FR9 A;  2E2M A;  5IMV A;  4AKX B;  4G19 A;  2GDR A;  3IHQ A;  3FMW A;  1PSQ A;  1GL8 A;  3IOS A;  2E2G A;  2LEG A;  4G10 A;  2L59 A;  1EV9 A;  4LMW A;  2H76 A;  3QCP A;  1SK0 A;  4K7I A;  1VF1 A;  1O7U A;  4V2M A;  2D2Z A;  1K0M A;  1GSF A;  3ZML A;  1OE8 A;  1R7H A;  2WB9 A;  2B5E A;  2VLT A;  2GSS A;  1USB A;  4IKH A;  1GLP A;  4G0L A;  2YWM A;  4K1F A;  5DVB A;  1FB6 A;  4QL7 A;  1GSE A;  1BX9 A;  4MAB A;  5COH A;  3C1R A;  1MEK A;  2GST A;  1YEW C;  4K0G A;  1FVJ A;  5J40 A;  3CTG A;  4PNG A;  1KBN A;  2N5F A;  2MYG A;  3KM6 A;  1PFO A;  1JZR A;  4ZBB A;  3GL5 A;  2RUE A;  2FY6 A;  3EUR A;  1K0N A;  1F3A A;  5GSS A;  4TKY A;  2LST A;  3LOR A;  4MJE A;  5G1L A;  3ZYW A;  3VLN A;  2FWE A;  1TRS A;  4EIP A;  3RGB C;  2NVL A;  14GS A;  1VF2 A;  2C0D A;  2C3Q A;  2PU9 C;  1BG5 A;  2YWO A;  3HYP A;  2GSR A;  1NHY A;  2LNT A;  3A3T A;  2EIQ A;  1EEM A;  3HVS A;  3VWW A;  1AQV A;  2GZY A;  4GCI A;  3LYK A;  2CQ9 A;  5A4W A;  3ERW A;  1XOA A;  2YJ7 A;  1SJZ A;  4N10 A;  1R5P A;  2C0E A;  4OWY A;  1GLQ A;  4CY6 A;  4K0N A;  2ALB A;  2CV4 A;  2FGX A;  2O87 A;  1PMT A;  3DWV A;  1THX A;  2B5Y A;  4F2I A;  1FOH A;  1MDK A;  5JCG A;  3D6I A;  1EGR A;  5G2Z A;  1EV4 A;  4USS A;  2TRC P;  1WWJ A;  3N9J A;  2XPE A;  2VOC A;  2P5R A;  5J3R A;  2K8S A;  1B9X C;  4XRD A;  3TKS A;  3RAZ A;  1ERV A;  1GSQ A;  3HY2 A;  4I8B A;  2B7J A;  4YAV A;  2N5A A;  5J9C A;  2WW0 A;  3H8Q A;  3QOU A;  3CXG A;  4GQC A;  1GUH A;  1TK0 B;  2K8V A;  4ZB8 A;  3I43 A;  2P0G A;  2GQM A;  3QDN A;  4MLY A;  1XW5 A;  17GS A;  5AIV A;  4RQX A;  4BVX A;  4W66 A;  2HFD A;  2H1L A;  1ILO A;  4O5U A;  1V57 A;  3C8E A;  3HCZ A;  2HZE B;  5H5R A;  3EMX A;  5A5K A;  4GTU A;  3F63 A;  4IJ3 A;  1FB0 A;  1I1I P;  2K9F A;  16GS A;  5A4V A;  1XCC A;  5H5Q A;  3FZ5 A;  5KN1 A;  2KUC A;  2L5O A;  1GSY A;  2V6K A;  1SL2 B;  5ELG A;  1YY7 A;  1PX6 A;  2PMT A;  4LL1 B;  2WW3 A;  3MYD A;  5HFK A;  4YKG A;  5HR3 A;  4KE3 A;  3F6F A;  4G2E A;  1G0T A;  4MPF A;  1RW1 A;  1NHO A;  3ME8 A;  4WBR D;  3J7Y k;  2DSA A;  4OMV A;  4I2U A;  1XW9 A;  1SU9 A;  3GA4 A;  4MF7 A;  5CP1 A;  3KMO A;  5DQS A;  1S3C A;  5L71 A;  2VCT A;  3LWA A;  1GNW A;  5IPH A;  3ZMK A;  3DKS A;  3EE2 A;  3KH7 A;  4IHU A;  4KF9 A;  1ZYQ B;  1U3A A;  2VL2 A;  2HSN B;  1EOH A;  2LS5 A;  3KH9 A;  4AKI A;  1KNG A;  1MTC A;  5GST A;  3ZIV A;  1WJK A;  3D4M A;  4HJM A;  5G31 A;  1K3Y A;  1GRX A;  1GSS A;  3QAG A;  5ECQ B;  1MDI A;  2X99 A;  2K18 A;  1B8X A;  1R4W A;  8GSS A;  3I9V 2;  3HXS A;  1U3I A;  4K7O A;  4IS0 A;  3CHX C;  3L4N A;  4PTS A;  4KB3 A;  1PRX A;  4RI6 A;  1X5E A;  4WR5 A;  3L9U A;  1ZMA A;  3TJJ A;  3RDW A;  3HMJ G;  2A4H A;  4H86 A;  3TRP A;  2XBI A;  3H93 A;  4HU9 A;  1T8E B;  5B8B A;  3WYW A;  3TJB A;  3DVW A;  3TDG A;  5F0G A;  2PVO C;  4MF6 A;  3MSZ A;  1PKW A;  2R0G A;  4I6X A;  1RK4 A;  5J4U A;  1X9W B;  1U88 A;  2MMN A;  1ZOF A;  1HNA A;  2CZ2 A;  3VI7 A;  4IP6 A;  1GWC A;  1AQW A;  19GS A;  2X64 A;  1K3O A;  4MMM A;  4L5O A;  5DJM A;  2VL2 C;  4DVC A;  2HRK B;  1OC8 A;  2B3S A;  3H79 A;  3U5R E;  1K0C A;  1ZL9 A;  1BF5 A;  1TU7 A;  3QFB C;  5B7C A;  4LA1 A;  4YQU A;  5C00 A;  3SWL A;  10GS A;  2EFH A;  4FYB A;  1QK8 A;  4ZXG A;  4HUA A;  4BWS A;  4BL7 A;  4Z2T A;  1HQO A;  5BMU B;  3HZ4 A;  4NHZ A;  5EY6 A;  3EU4 A;  2CVB A;  4V1A p;  1N8J A;  2B5X A;  2EFE A;  2R0C A;  2DML A;  2KP1 A;  4CY8 A;  1CQG A;  3OR5 A;  5LNK e;  1TRW A;  1TRV A;  5C04 A;  5DAK A;  4EE0 A;  5ID2 B;  1X9M B;  2BMX A;  2YOI A;  5AIX A;  3WT2 A;  4N0Z A;  3IAM 2;  4Z2U A;  4L8E A;  3LSZ A;  2LTK A;  3FZ4 A;  3TJG A;  3GIX A;  1JLW A;  4IP1 A;  2C80 A;  1OKT A;  4ZBD A;  4DEJ A;  2HSM A;  1TXX A;  4FH8 A;  4YQM A;  3TKS E;  3TJK A;  2QKE A;  2H66 A;  4F9Z A;  3D5J A;  3UVH A;  3UIW A;  3D0Z A;  3GH9 A;  5JWR B;  2DJ0 A;  1TW9 A;  4EC0 A;  5JWO B;  5G1K A;  4I2T A;  1F37 A;  5ECI B;  1EZK A;  1SK1 A;  3EC3 A;  1G6Y A;  5HFI A;  3QD9 A;  2FWG A;  4TXO B;  1X9S B;  1T7P B;  3M9J A;  4WF5 A;  3GST A;  1JZW A;  4IEL A;  3F8U A;  3FYG A;  2DLX A;  1J08 A;  1Q98 A;  1JZD A;  4FXY P;  1OC9 B;  1SK2 A;  4WBJ A;  1AIU A;  2QA2 A;  1O8X A;  4L0W A;  4ECB A;  3MWH A;  4KND A;  2YN1 A;  1TP9 A;  1XZO A;  1Y1U A;  4AI6 A;  2AAW A;  1FW1 A;  4BVY B;  4V2N A;  2R2J A;  1XWA A;  1TXU A;  1V40 A;  3ZVJ D;  2H75 A;  3EPT A;  3IC4 A;  4TR1 B;  1PQN A;  2L4C A;  3CRT A;  3J7Y b;  7GSS A;  2MMZ A;  4KUN A;  4IN0 A;  4FQU A;  2H01 A;  1WMJ A;  3M0F A;  4GRF A;  2IWT A;  4Z2R A;  3W8J A;  4QQ7 A;  2V41 A;  2E7P A;  5DAL A;  11GS A;  4K2D A;  4KA0 A;  1VF4 A;  1GUK A;  2RM5 A;  4HU7 A;  3FY7 A;  2VCW A;  2IFQ B;  4G01 A;  2QC7 A;  2VLU A;  4PXO A;  1M2B A;  1SVL A;  1TKD B;  1YKC A;  2RLI A;  2DJJ A;  1OE7 A;  4YKF A;  5D9X A;  1A2L A;  1VF3 A;  2LNS A;  1X5C A;  2XC2 A;  3G7Y A;  1ON4 A;  3LW9 A;  5HFG A;  2LQO A;  1SJI A;  4PNF A;  5CRD A;  1ZYP A;  4GQF A;  2KLX A;  1HNC A;  4EDY A;  4NXI A;  1JLV A;  2R5G A;  5B6N A;  2UZ8 A;  4OO5 A;  4HOJ A;  2GLR A;  2E0Q A;  4KCA A;  1WOU A;  1XWC A;  3EWL A;  4F03 A;  1Q4J A;  3L0H A;  5ECM B;  3F4R A;  1C72 A;  3ZL5 A;  2YZH A;  4PI0 C;  1A0F A;  4O32 A;  4IQ1 A;  1ZYN A;  4IW9 A;  3EYT A;  4AKG A;  2C0G A;  2FLS A;  3MAK A;  5DDL A;  1LJR A;  3VFI A;  2H74 A;  4KDX A;  2DJ3 A;  1XW6 A;  4FO5 A;  2PER A;  4Q5Q A;  2LQQ A;  4MF5 A;  4IBP A;  1E2Y A;  3RFR C;  4TR3 A;  4OO4 A;  1DBY A;  5KOW A;  4JED A;  4KGI A;  3KTB A;  3TRX A;  2HRN A;  3BCI A;  2VCV A;  1GTB A;  4ZIJ A;  4O92 A;  1K0B A;  4GF0 A;  1QMV A;  1OAZ A;  3IK7 A;  4NWY A;  2M72 A;  5D8I A;  2F8F A;  3HKR A;  2H30 A;  4AKH A;  2VL3 A;  1ZZY A;  3IHG A;  3GKK A;  2ZUP A;  3DEX A;  4EIQ A;  1XG8 A;  4EXJ A;  2MZC A;  1A8L A;  2IMK A;  2REM A;  3FZ9 A;  3VUR A;  2G0F A;  2VD1 A;  2BJX A;  2HXK A;  2MBT A;  3U6V A;  4N30 A;  3R2Q A;  5G5F A;  2CX3 A;  3NIV A;  1J0F A;  1EP7 A;  2IIY A;  4G0K A;  5IOX A;  1UVZ A;  5BRT A;  2H1D A;  2IME A;  1S3R A;  4RUV A;  4IVF A;  1SVM A;  3JCM L;  1Z6M A;  3APQ A;  2H73 A;  2ON7 A;  2KP2 A;  3KP8 A;  2A2R A;  3TKR A;  4HDE A;  2F3M A;  3TU3 B;  2FNO A;  4GXZ A;  4HQZ A;  2H6Z A;  2FA8 A;  2FHE A;  3BCK A;  1EOG A;  4MJB A;  2QA1 A;  1ST9 A;  4K5S A;  5HR1 A;  4J2F A;  3VWX A;  3A2W A;  4ECJ A;  2L5L A;  2PPT A;  1PX7 A;  3MDK A;  1K0D A;  1M9B A;  3M9K A;  4EDZ A;  2HLS A;  5ELA A;  4JZQ A;  5IMA A;  1FG4 A;  4HZ4 A;  4K6X A;  3KJY A;  3ZVJ A;  1LU4 A;  1B9Y C;  2PUK C;  3N5O A;  3QPM A;  3GTU B;  2X8G A;  5CRW A;  3P8W A;  1MDJ A;  2CAQ A;  2I4A A;  4K2X A;  1FO5 A;  3UL3 A;  4LLR A;  2H6X A;  2HRA A;  2QSI A;  1KEB A;  1BAY A;  1G7E A;  3I69 A;  2KOK A;  2QGV A;  4DSS A;  1SVO A;  3IXR A;  1FAA A;  4ICY A;  4D73 B;  4P3Y B;  4HI7 A;  3TCO A;  4BVX B;  3ED3 A;  5DBQ A;  5A5H A;  6GSS A;  1GSD A;  4ZL8 A;  5ENU A;  1M9A A;  2AV4 A;  4J56 E;  1H75 A;  4CDO A;  3IR4 A;  4JRR A;  4TOP A;  5ECR B;  2R0P A;  1ZCP A;  3CQF A;  1ERU A;  3CBU A;  2X4A A;  2FCH A;  1FHE A;  4XTS A;  3TKS C;  4GSN A;  4ULX A;  1V9W A;  3Q18 A;  2YP6 A;  4ZB7 A;  4I5Q A;  4MH2 A;  4WF4 A;  2DMM A;  4WR4 A;  2R4V A;  4ML6 A;  3VPT A;  2TRX A;  4N3Z A;  5CYY A;  1V2A A;  4BPY A;  1Z3E A;  4ZB6 A;  3KCM A;  1NSW A;  3UAP A;  2V6O A;  1WRY A;  2YAN A;  2I81 A;  4HQS A;  2VD0 A;  5J5N A;  4QMK A;  4OFN A;  1YZX A;  4MP4 A;  2J9H A;  4F82 A;  4GDF A;  3W6G A;  2Z9S A;  3FW2 A;  5G30 A;  3ME7 A;  4O7H A;  2WJU A;  3CSJ A;  2WVX B;  3FRC A;  5AN1 A;  1XOB A;  1YKA A;  3HA9 A;  3VK9 A;  6GSX A;  3PH9 A;  2C0F A;  2H71 A;  1HD2 A;  1M2A A;  4MCU A;  3GHA A;  5KN3 A;  1GUL A;  3BOA A;  4JBB A;  4RI7 A;  3IPZ A;  2JAD A;  3TJF A;  1YQ1 A;  3TKQ A;  2VIM A;  1SKS B;  4N0V A;  1T1V A;  3C73 A;  1J9B A;  3H4K A;  1H4O A;  3F9U A;  4ACS A;  1YDK A;  4JU5 A;  2HE3 A;  2GQL A;  2WGR A;  5J47 A;  5D93 A;  2LRN A;  2IMF A;  2F8A A;  5B8A A;  5EL8 A;  3F3Q A;  3PR8 A;  3GKX A;  3P2A A;  2AHE A;  4OFT A;  3F6D A;  1UN2 A;  3QFA C;  3FK8 A;  4L5L A;  4JR6 A;  3EIN A;  3HHV A;  5EPF A;  1DUG A;  3FR3 A;  1U6T A;  4ZIL A;  1YVL A;  3HVX A;  1ACV A;  4XHM A;  1E6B A;  3FEU A;  5ABR A;  4NV2 A;  1JFU A;  2WW2 A;  4ZB9 A;  3UVT A;  2FD3 A;  5INY A;  2A2S A;  3SBC A;  1XPV A;  2M46 A;  3M8N A;  2XHF A;  1QFN A;  1UC7 A;  2CAI A;  3GSS A;  1FOV A;  2C1Y A;  1ABA A;  4ZL7 A;  4GLT A;  1Z7P A;  4EUY A;  3H1N A;  3G9B A;  2NBS A;  1WP0 A;  3E3E A;  2JU5 A;  5IOW A;  4TN8 A;  2AYT A;  4EO3 A;  1X0R A;  4XRA A;  2DKH A;  2P5Q A;  5BMU A;  2B7K A;  2MMA A;  3ZLP A;  4IGJ A;  4WET A;  2HSY A;  5A1N A;  2YZU A;  1ERT A;  2O5V A;  2NTO A;  4KCE A;  2WW1 A;  2V32 A;  3MIX A;  4XS4 A;  3L9V A;  2LRT A;  2FUG 2;  3PGT A;  6GSW A;  4ILF A;  3RBT A;  1EEJ A;  4ECI A;  5IPG A;  3D4T A;  5ID2 A;  3ZIJ A;  3BD2 A;  4POL A;  2JSZ A;  3VPQ A;  3VWV A;  2WS2 A;  4TVE A;  4MJC A;  1B4P A;  2GT6 A;  5J4Y A;  3DML A;  2CX4 A;  2RII A;  3NOF A;  3KEB A;  3C7M A;  5KN2 A;  3W8S A;  5A4U A;  18GS A;  1M3J A;  4OD7 A;  3LG6 A;  1FVK A;  3NZN A;  3Q74 A;  2FA4 A;  2YWN A;  2HSM B;  3IE3 A;  3IAS 2;  4WXT A;  1GTI A;  5IO0 A;  1LBK A;  4MNN A;  2I1U A;  5JWQ B;  4EL1 A;  3UOM A;  1Y25 A;  1F9M A;  2BTO T;  2WRT A;  4XCS A;  3ZZX A;  1TK8 B;  1OC9 A;  2JZS A;  2WCI A;  3IRA A;  1YEX A;  13GS A;  2OKA A;  5IMF A;  5IQY A;  4PUR A;  4TW5 A;  1XVW A;  5F06 A;  3QR6 A;  1Y6E A;  3WGX A;  4MJA A;  3WT1 A;  3BJ5 A;  4TR1 A;  3UBK A;  3M1G A;  2A2P A;  4FYU A;  4NV5 A;  6GSY A;  2OJL A;  3AY8 A;  3UAR A;  1YEP A;  4YQV A;  2OBI A;  4OCF A;  1URM A;  4NAX A;  5DCG A;  2WVY A;  2X8H A;  2YJH A;  5J4V A;  2I3Y A;  4ZBA A;  2VM1 A;  2MBS A;  2I9H A;  1AW9 A;  5GAN D;  4PUA A;  2H70 A;  2YPM A;  4PI2 C;  2H1B A;  1R26 A;  3ZFL A;  1M0U A;  3D22 A;  5A34 B;  3ZIT A;  1T00 A;  3GYK A;  3GKN A;  3HVV A;  4XS1 A;  1T3B A;  3KXO A;  2HSH A;  1SD8 A;  2HZF A;  3Q19 A;  2VAF A;  2AJQ B;  4TR4 A;  1ZGN A;  4BA7 A;  2DJ1 A;  4PQI A;  1A2M A;  5CNW A;  1TTZ A;  2DKI A;  2LV3 A;  4KH7 A;  1SD9 A;  2OA7 A;  5CRH A;  3CSH A;  5AGY A;  5ECH B;  3M3M A;  3HJM A;  4G9H A;  1O8W A;  3IK9 A;  1EP8 A;  4ZL9 A;  5HR2 A;  2R6K A;  1TRU A;  2X49 A;  2DJK A;  1Z6N A;  1GH2 A;  3C71 A;  3KGK A;  5CO3 A;  3WD6 A;  2WUL A;  4O5Q A;  5IMC A;  2ON5 A;  2O85 A;  3D21 A;  5IMZ A;  3ERG A;  3UEM A;  1A24 A;  1K0A A;  2CVD A;  2PVQ A;  3O6T A;  5ECS A;  4EF0 A;  4KX4 A;  1GSU A;  4KDU A;  1M99 A;  4A5P A;  3LFL A;  4X1U A;  3E0U A;  5LCZ A;  5J9B A;  1YJ6 A;  1SJ6 A;  1U87 A;  1UA5 A;  5D9W A;  4PUF C;  2OAD A;  2VLV A;  3C1S A;  4ID0 A;  5JCU A;  2WZ9 A;  3CWG A;  1MD3 A;  1A8Y A;  3ISO A;  1YF1 A;  2L6D A;  4AJ6 A;  5KEJ A;  3GNJ A;  1Z9H A;  1DE1 A;  3FR6 A;  2XPD A;  3TOT A;  5D9T A;  5D9V A;  4V2L A;  1N2A A;  4POK A;  2P31 A;  2YNX A;  1Z7R A;  5D73 A;  1B4Q A;  1N25 A;  1TI3 A;  2EFC A;  5HQP A;  2H0I A;  3LJR A;  3A5W A;  2YV9 A;  3PPU A;  2M80 A;  1A2J A;  4KDY A;  5GAP D;  3GN3 A;  5D96 A;  4AJ7 A;  2CZ3 A;  2L57 A;  1QUW A;  1BED A;  1HNB A;  1EWX A;  2EFD A;  2HT9 A;  2H6Y A;  3L9S A;  3BBY A;  4TR0 A;  4E68 A;  3TRQ A;  3L78 A;  2KHP A;  6GSV A;  1XBS A;  1THO A;  1OC3 A;  4AGS A;  1BJX A;  1I5G A;  1GNE A;  2WVZ A;  3GUR A;  2O3E A;  2IL3 A;  1KTE A;  4OCE A;  3A5I A;  1W4V A;  1BYE A;  4HJ2 A;  3F3R A;  5CRE A;  5GZZ B;  1PKZ A;  5ECK B;  5ECO B;  2IMD A;  5LD0 A;  5EVO A;  5F05 A;  2O7K A;  3APS A;  5IIZ A;  2DBC A;  4KSM A;  3I6A A;  2YCD A;  20GS A;  2HQT A;  4FIW A;  3CSI A;  3QMX A;  1TJD A;  5ECP B;  4E8H A;  1K3L A;  1S3A A;  1OYJ A;  1SEN A;  2JL4 A;  3GUS A;  2PBJ A;  4EKZ A;  2HNL A;  3IDV A;  4DSR A;  2H1A A;  3A2X A;  4NHW A;  2HRF A;  3GTU A;  1O73 A;  4PX1 A;  2GS3 A;  2DJ2 A;  3TKP A;  2JZT A;  3DIE A;  4LMV A;  3IA1 A;  2H72 A;  1QXH A;  12GS A;  3G7J A;  2AB6 A;  5HR0 A;  4LL4 B;  2VO4 A;  4ECC A;  4D73 A;  2LRC A;  5G5E A;  2HZE A;  3APO A;  1DE2 A;  3HJO A;  3LEF A;  2O36 A;  5DQY A;  1X5D A;  4DSS B;  4CHS A;  2FWH A;  2JSY A;  3MNG A;  1T4Y A;  4I97 A;  5JCW A;  2B1K A;  2B1L A;  5A5H B;  4V1A g;  3GKM A;  1WIK A;  3KMN A;  4BWQ A;  2VCQ A;  1PD2 1;  1AC1 A;  1PA3 A;  4Q5N A;  3UMA A;  1TK5 B;  5FT3 A;  4GWR A;  2O8V B;  4J57 E;  4K5R A;  1XWB A;  3GH6 A;  1G7O A;  2F51 A;  4Q5F A;  2OE3 A;  3O3T A;  3GX0 A;  2R37 A;  5IO2 A;  4X43 A;  2C3N A;  2JZR A;  1AAZ A;  1YF0 A;  4EVM A;  2HSN A;  2J23 A;  1WPI A;  1O81 A;  4X0X A;  2X8C A;  3RHB A;  4CW9 A;  3WGE A;  2WVX A;  1BG1 A;  1SL1 B;  2VL9 A;  1XXU A;  1G6W A;  4K7N A;  3GMF A;  2LJR A;  4PQH A;  4X4J A;  2F9S A;  3F4S A;  2H19 A;  3GV1 A;  4MZC A;  2H0G A;  2DIZ A;  3KP9 A;  3GL3 A;  2ZNM A;  2R3X A;  4K9Z A; 
#chains in the Genus database with same CATH homology
 3LQ7 A;  4MH3 A;  3DD3 A;  3QAV A;  4ISD A;  2OBK A;  5F8B A;  5H5S A;  5FHI A;  3IBH A;  2V2G A;  1QGV A;  3Q6O A;  4MZW A;  3KZQ A;  2XBQ A;  2EC4 A;  3ZFB A;  1DSB A;  4HZ2 A;  2IPA A;  1XWK A;  5IMD A;  3HJP A;  2AUV A;  2V1M A;  1Z5Y E;  4MDC A;  1OKD A;  3LYP A;  2PWJ A;  2HRK A;  3TOU A;  4MA9 A;  1W89 A;  3UJ1 A;  1B48 A;  1S3D A;  3LXT A;  1A0R P;  4YH2 A;  2VKZ G;  1AUC A;  4L0U A;  1GP1 A;  3HZ8 A;  4KAE A;  4E8E A;  3DXB A;  4KSO A;  2YWI A;  5B6M A;  1EGO A;  1K0O A;  2MMO A;  1CQH A;  2EIO A;  1TDI A;  6GST A;  1SYX A;  1ML6 A;  3VI5 A;  1TOF A;  3EU3 A;  1SYR A;  2C8U A;  3DGQ A;  3GFK A;  4K8M A;  3GRX A;  1ZYE A;  4POB A;  2RUF A;  3K8N A;  2WDU A;  2FWF A;  2A4V A;  4F0B A;  4Q5R A;  1PN9 A;  1F2E A;  5AIS A;  3EVI A;  4BL7 B;  4TRX A;  2IJY A;  4G0I A;  4PGT A;  2WFC A;  3F4T A;  4IQA A;  5KOX A;  3UBL A;  3RPP A;  3ZRD A;  2H1G A;  3FZA A;  3V1W A;  5A1N B;  4JR4 A;  3P7X A;  4AJ8 A;  1JZO A;  2UV8 G;  2LUS A;  4XS4 B;  1XFL A;  5DCH A;  4QL9 A;  3HD5 A;  3TUE A;  1VGL A;  2DC5 A;  5F07 A;  5DAK B;  3TGZ A;  1O85 A;  2L6C A;  2LJK A;  2JAC A;  5ECN B;  4XS6 A;  4AF2 A;  2H8L A;  3RPN A;  1TU8 A;  1PL2 A;  2DIY A;  4HEA 2;  5CRG A;  2OAC A;  3US3 A;  4JE1 A;  1IYI A;  5DJL A;  1AXD A;  1VRS D;  1WE0 A;  1GTA A;  2HYX A;  2PGT A;  1NM3 A;  1PN0 A;  2CA8 A;  3E9J B;  4POM A;  1PL1 A;  1XWG A;  2B6M A;  4TXO A;  9GSS A;  2GGT A;  3LXZ A;  4RQR A;  2L4Q A;  2OE0 A;  1ERW A;  2GT5 A;  2C4J A;  2GSQ A;  3S9F A;  2GVP A;  3WGD A;  5J41 A;  2PN8 A;  2OT3 A;  4OFM A;  3KD0 A;  4N11 A;  5E59 A;  3O76 A;  2ZCT A;  1M2D A;  2VCZ A;  2CVK A;  5FWG A;  6GSU A;  3IC8 A;  4GSS A;  4BVY A;  1AQX A;  2TIR A;  3A2V A;  3EMP A;  4WEY A;  3KIJ A;  1I9D A;  2YV7 A;  2RM6 A;  1V58 A;  3HDC A;  2LKU A;  3ZRE A;  3R3E A;  4O5R A;  4TXV A;  2GTU A;  1R5A A;  3ERF A;  2NPB A;  3CMI A;  1MD4 A;  1GTU A;  3IV4 A;  2NDO A;  3RHC A;  5ECL B;  1O6J A;  2IFQ A;  2G2Q A;  2EIR A;  3KTL A;  3FHK A;  1OVN A;  4IJI A;  2GQK A;  3TB2 A;  1V98 A;  4PQ1 A;  2GZP A;  2LJA A;  2GZZ A;  3LGC A;  1A23 A;  5DAL B;  1HYU A;  2VUP A;  3GX8 A;  4NPB A;  2C3T A;  1M7T A;  2VM2 A;  5IM9 A;  1JHB A;  1PGT A;  1RQM A;  3DRN A;  2IMI A;  2VCX A;  1QQ2 A;  4NMU A;  1F3B A;  1F6M C;  3FKF A;  22GS A;  1IYH A;  4MPG A;  5KN0 A;  2OE1 A;  4XIH A;  3F0I A;  3CYN A;  3VWU A;  5A34 A;  3P90 A;  4MZB A;  4MK3 A;  4KW6 A;  4Z7X A;  4HS1 A;  3DYR A;  1T4Z A;  2IN3 A;  4GST A;  4ML1 A;  1SL0 B;  5CAX A;  1BQ7 A;  3ZTL A;  4DSQ A;  2CT6 A;  3PIN A;  1SKR B;  2N5B A;  1TI1 A;  1NW2 A;  2H0H A;  2ES7 A;  2HI7 A;  2O89 A;  3CTF A;  1XIY A;  3CRU A;  4YAP A;  3QAW A;  4F0C A;  4WKW A;  1GUM A;  5E4W A;  3G7I A;  3DVX A;  1XVQ A;  1SKW B;  4FYC A;  2K6V A;  3FR9 A;  2E2M A;  5IMV A;  4AKX B;  4G19 A;  2GDR A;  3IHQ A;  3FMW A;  1PSQ A;  1GL8 A;  3IOS A;  2E2G A;  2LEG A;  4G10 A;  2L59 A;  1EV9 A;  4LMW A;  2H76 A;  3QCP A;  1SK0 A;  4K7I A;  1VF1 A;  1O7U A;  4V2M A;  2D2Z A;  1K0M A;  1GSF A;  3ZML A;  1OE8 A;  1R7H A;  2WB9 A;  2B5E A;  2VLT A;  2GSS A;  1USB A;  4IKH A;  1GLP A;  4G0L A;  2YWM A;  4K1F A;  5DVB A;  1FB6 A;  4QL7 A;  1GSE A;  1BX9 A;  4MAB A;  5COH A;  3C1R A;  1MEK A;  2GST A;  4K0G A;  1FVJ A;  5J40 A;  3CTG A;  4PNG A;  1KBN A;  2N5F A;  2MYG A;  3KM6 A;  1JZR A;  4ZBB A;  3GL5 A;  2RUE A;  2FY6 A;  3EUR A;  1K0N A;  1F3A A;  5GSS A;  4TKY A;  2LST A;  3LOR A;  4MJE A;  5G1L A;  3ZYW A;  3VLN A;  2FWE A;  1TRS A;  4EIP A;  2NVL A;  14GS A;  1VF2 A;  2C0D A;  2C3Q A;  2PU9 C;  1BG5 A;  2YWO A;  3HYP A;  2GSR A;  1NHY A;  2LNT A;  3A3T A;  2EIQ A;  1EEM A;  3HVS A;  3VWW A;  1AQV A;  2GZY A;  4GCI A;  3LYK A;  2CQ9 A;  5A4W A;  3ERW A;  1XOA A;  2YJ7 A;  1SJZ A;  4N10 A;  1R5P A;  2C0E A;  4OWY A;  1GLQ A;  4CY6 A;  4K0N A;  2ALB A;  2CV4 A;  2FGX A;  2O87 A;  1PMT A;  3DWV A;  1THX A;  2B5Y A;  4F2I A;  1FOH A;  1MDK A;  5JCG A;  3D6I A;  1EGR A;  5G2Z A;  1EV4 A;  4USS A;  2TRC P;  1WWJ A;  3N9J A;  2XPE A;  2VOC A;  2P5R A;  5J3R A;  2K8S A;  1B9X C;  4XRD A;  3TKS A;  3RAZ A;  1ERV A;  1GSQ A;  3HY2 A;  4I8B A;  2B7J A;  4YAV A;  2N5A A;  5J9C A;  3H8Q A;  3QOU A;  3CXG A;  4GQC A;  1GUH A;  1TK0 B;  2K8V A;  4ZB8 A;  3I43 A;  2P0G A;  2GQM A;  3QDN A;  4MLY A;  1XW5 A;  17GS A;  5AIV A;  4RQX A;  4BVX A;  4W66 A;  2HFD A;  2H1L A;  1ILO A;  4O5U A;  1V57 A;  3C8E A;  3HCZ A;  2HZE B;  5H5R A;  3EMX A;  5A5K A;  4GTU A;  3F63 A;  4IJ3 A;  1FB0 A;  2K9F A;  16GS A;  5A4V A;  1XCC A;  5H5Q A;  3FZ5 A;  5KN1 A;  2KUC A;  2L5O A;  1GSY A;  2V6K A;  1SL2 B;  5ELG A;  1YY7 A;  1PX6 A;  2PMT A;  4LL1 B;  3MYD A;  5HFK A;  4YKG A;  5HR3 A;  4KE3 A;  3F6F A;  4G2E A;  1G0T A;  4MPF A;  1RW1 A;  1NHO A;  3ME8 A;  4WBR D;  3J7Y k;  2DSA A;  4OMV A;  4I2U A;  1XW9 A;  1SU9 A;  3GA4 A;  4MF7 A;  5CP1 A;  3KMO A;  5DQS A;  1S3C A;  5L71 A;  2VCT A;  3LWA A;  1GNW A;  5IPH A;  3ZMK A;  3DKS A;  3EE2 A;  3KH7 A;  4IHU A;  4KF9 A;  1ZYQ B;  1U3A A;  2VL2 A;  2HSN B;  1EOH A;  2LS5 A;  3KH9 A;  4AKI A;  1KNG A;  1MTC A;  5GST A;  3ZIV A;  1WJK A;  3D4M A;  4HJM A;  5G31 A;  1K3Y A;  1GRX A;  1GSS A;  3QAG A;  5ECQ B;  1MDI A;  2X99 A;  2K18 A;  1B8X A;  1R4W A;  8GSS A;  3I9V 2;  3HXS A;  1U3I A;  4K7O A;  4IS0 A;  3L4N A;  4PTS A;  4KB3 A;  1PRX A;  4RI6 A;  1X5E A;  4WR5 A;  3L9U A;  1ZMA A;  3TJJ A;  3RDW A;  3HMJ G;  2A4H A;  4H86 A;  3TRP A;  2XBI A;  3H93 A;  4HU9 A;  1T8E B;  5B8B A;  3WYW A;  3TJB A;  3DVW A;  3TDG A;  5F0G A;  2PVO C;  4MF6 A;  3MSZ A;  1PKW A;  2R0G A;  4I6X A;  1RK4 A;  5J4U A;  1X9W B;  1U88 A;  2MMN A;  1ZOF A;  1HNA A;  2CZ2 A;  3VI7 A;  4IP6 A;  1GWC A;  1AQW A;  19GS A;  2X64 A;  1K3O A;  4MMM A;  4L5O A;  5DJM A;  2VL2 C;  4DVC A;  2HRK B;  1OC8 A;  2B3S A;  3H79 A;  3U5R E;  1K0C A;  1ZL9 A;  1BF5 A;  1TU7 A;  3QFB C;  5B7C A;  4LA1 A;  4YQU A;  5C00 A;  3SWL A;  10GS A;  2EFH A;  4FYB A;  1QK8 A;  4ZXG A;  4HUA A;  4BWS A;  4BL7 A;  4Z2T A;  1HQO A;  5BMU B;  3HZ4 A;  4NHZ A;  5EY6 A;  3EU4 A;  2CVB A;  4V1A p;  1N8J A;  2B5X A;  2EFE A;  2R0C A;  2DML A;  2KP1 A;  4CY8 A;  1CQG A;  3OR5 A;  5LNK e;  1TRW A;  1TRV A;  5C04 A;  5DAK A;  4EE0 A;  5ID2 B;  1X9M B;  2BMX A;  2YOI A;  5AIX A;  3WT2 A;  4N0Z A;  3IAM 2;  4Z2U A;  4L8E A;  3LSZ A;  2LTK A;  3FZ4 A;  3TJG A;  3GIX A;  1JLW A;  4IP1 A;  2C80 A;  1OKT A;  4ZBD A;  4DEJ A;  2HSM A;  1TXX A;  4FH8 A;  4YQM A;  3TKS E;  3TJK A;  2QKE A;  2H66 A;  4F9Z A;  3D5J A;  3UVH A;  3UIW A;  3D0Z A;  3GH9 A;  5JWR B;  2DJ0 A;  1TW9 A;  4EC0 A;  5JWO B;  5G1K A;  4I2T A;  1F37 A;  5ECI B;  1EZK A;  1SK1 A;  3EC3 A;  1G6Y A;  5HFI A;  3QD9 A;  2FWG A;  4TXO B;  1X9S B;  1T7P B;  3M9J A;  4WF5 A;  3GST A;  1JZW A;  4IEL A;  3F8U A;  3FYG A;  2DLX A;  1J08 A;  1Q98 A;  1JZD A;  1OC9 B;  1SK2 A;  4WBJ A;  1AIU A;  2QA2 A;  1O8X A;  4L0W A;  4ECB A;  3MWH A;  4KND A;  2YN1 A;  1TP9 A;  1XZO A;  1Y1U A;  4AI6 A;  2AAW A;  1FW1 A;  4BVY B;  4V2N A;  2R2J A;  1XWA A;  1TXU A;  1V40 A;  3ZVJ D;  2H75 A;  3EPT A;  3IC4 A;  4TR1 B;  1PQN A;  2L4C A;  3CRT A;  3J7Y b;  7GSS A;  2MMZ A;  4KUN A;  4IN0 A;  4FQU A;  2H01 A;  1WMJ A;  3M0F A;  4GRF A;  2IWT A;  4Z2R A;  3W8J A;  4QQ7 A;  2V41 A;  2E7P A;  5DAL A;  11GS A;  4K2D A;  4KA0 A;  1VF4 A;  1GUK A;  2RM5 A;  4HU7 A;  3FY7 A;  2VCW A;  2IFQ B;  4G01 A;  2QC7 A;  2VLU A;  4PXO A;  1M2B A;  1SVL A;  1TKD B;  1YKC A;  2RLI A;  2DJJ A;  1OE7 A;  4YKF A;  5D9X A;  1A2L A;  1VF3 A;  2LNS A;  1X5C A;  2XC2 A;  3G7Y A;  1ON4 A;  3LW9 A;  5HFG A;  2LQO A;  1SJI A;  4PNF A;  5CRD A;  1ZYP A;  4GQF A;  2KLX A;  1HNC A;  4EDY A;  4NXI A;  1JLV A;  2R5G A;  5B6N A;  2UZ8 A;  4OO5 A;  4HOJ A;  2GLR A;  2E0Q A;  4KCA A;  1WOU A;  1XWC A;  3EWL A;  4F03 A;  1Q4J A;  3L0H A;  5ECM B;  3F4R A;  1C72 A;  3ZL5 A;  2YZH A;  1A0F A;  4O32 A;  4IQ1 A;  1ZYN A;  4IW9 A;  3EYT A;  4AKG A;  2C0G A;  2FLS A;  3MAK A;  5DDL A;  1LJR A;  3VFI A;  2H74 A;  4KDX A;  2DJ3 A;  1XW6 A;  4FO5 A;  2PER A;  4Q5Q A;  2LQQ A;  4MF5 A;  4IBP A;  1E2Y A;  4TR3 A;  4OO4 A;  1DBY A;  5KOW A;  4JED A;  4KGI A;  3KTB A;  3TRX A;  2HRN A;  3BCI A;  2VCV A;  1GTB A;  4ZIJ A;  4O92 A;  1K0B A;  4GF0 A;  1QMV A;  1OAZ A;  3IK7 A;  4NWY A;  2M72 A;  5D8I A;  2F8F A;  3HKR A;  2H30 A;  4AKH A;  2VL3 A;  1ZZY A;  3IHG A;  3GKK A;  2ZUP A;  3DEX A;  4EIQ A;  4EXJ A;  2MZC A;  1A8L A;  2IMK A;  2REM A;  3FZ9 A;  3VUR A;  2G0F A;  2VD1 A;  2BJX A;  2HXK A;  2MBT A;  3U6V A;  4N30 A;  3R2Q A;  5G5F A;  2CX3 A;  3NIV A;  1J0F A;  1EP7 A;  2IIY A;  4G0K A;  5IOX A;  1UVZ A;  5BRT A;  2H1D A;  2IME A;  4RUV A;  4IVF A;  1SVM A;  3JCM L;  1Z6M A;  3APQ A;  2H73 A;  2ON7 A;  2KP2 A;  3KP8 A;  2A2R A;  3TKR A;  4HDE A;  2F3M A;  3TU3 B;  2FNO A;  4GXZ A;  4HQZ A;  2H6Z A;  2FA8 A;  2FHE A;  3BCK A;  1EOG A;  4MJB A;  2QA1 A;  1ST9 A;  4K5S A;  5HR1 A;  4J2F A;  3VWX A;  3A2W A;  4ECJ A;  2L5L A;  2PPT A;  1PX7 A;  3MDK A;  1K0D A;  1M9B A;  3M9K A;  4EDZ A;  2HLS A;  5ELA A;  4JZQ A;  5IMA A;  1FG4 A;  4HZ4 A;  4K6X A;  3KJY A;  3ZVJ A;  1LU4 A;  1B9Y C;  2PUK C;  3N5O A;  3QPM A;  3GTU B;  2X8G A;  5CRW A;  3P8W A;  1MDJ A;  2CAQ A;  2I4A A;  4K2X A;  1FO5 A;  3UL3 A;  4LLR A;  2H6X A;  2HRA A;  2QSI A;  1KEB A;  1BAY A;  1G7E A;  3I69 A;  2KOK A;  2QGV A;  4DSS A;  1SVO A;  3IXR A;  1FAA A;  4ICY A;  4D73 B;  4P3Y B;  4HI7 A;  3TCO A;  4BVX B;  3ED3 A;  5DBQ A;  5A5H A;  6GSS A;  1GSD A;  4ZL8 A;  5ENU A;  1M9A A;  2AV4 A;  4J56 E;  1H75 A;  4CDO A;  3IR4 A;  4JRR A;  4TOP A;  5ECR B;  2R0P A;  1ZCP A;  1ERU A;  3CBU A;  2X4A A;  2FCH A;  1FHE A;  4XTS A;  3TKS C;  4GSN A;  4ULX A;  1V9W A;  3Q18 A;  2YP6 A;  4ZB7 A;  4I5Q A;  4MH2 A;  4WF4 A;  2DMM A;  4WR4 A;  2R4V A;  4ML6 A;  3VPT A;  2TRX A;  4N3Z A;  5CYY A;  1V2A A;  4BPY A;  1Z3E A;  4ZB6 A;  3KCM A;  1NSW A;  3UAP A;  2V6O A;  1WRY A;  2YAN A;  2I81 A;  4HQS A;  2VD0 A;  5J5N A;  4QMK A;  4OFN A;  1YZX A;  4MP4 A;  2J9H A;  4F82 A;  4GDF A;  3W6G A;  2Z9S A;  3FW2 A;  5G30 A;  3ME7 A;  4O7H A;  2WJU A;  3CSJ A;  3FRC A;  5AN1 A;  1XOB A;  1YKA A;  3HA9 A;  3VK9 A;  6GSX A;  3PH9 A;  2C0F A;  2H71 A;  1HD2 A;  1M2A A;  4MCU A;  3GHA A;  5KN3 A;  1GUL A;  3BOA A;  4JBB A;  4RI7 A;  3IPZ A;  2JAD A;  3TJF A;  1YQ1 A;  3TKQ A;  2VIM A;  1SKS B;  4N0V A;  1T1V A;  3C73 A;  1J9B A;  3H4K A;  1H4O A;  3F9U A;  4ACS A;  1YDK A;  4JU5 A;  2HE3 A;  2GQL A;  2WGR A;  5J47 A;  5D93 A;  2LRN A;  2IMF A;  2F8A A;  5B8A A;  5EL8 A;  3F3Q A;  3PR8 A;  3GKX A;  3P2A A;  2AHE A;  4OFT A;  3F6D A;  1UN2 A;  3QFA C;  3FK8 A;  4L5L A;  4JR6 A;  3EIN A;  3HHV A;  5EPF A;  1DUG A;  3FR3 A;  1U6T A;  4ZIL A;  1YVL A;  3HVX A;  1ACV A;  4XHM A;  1E6B A;  3FEU A;  5ABR A;  4NV2 A;  1JFU A;  4ZB9 A;  3UVT A;  2FD3 A;  5INY A;  2A2S A;  3SBC A;  1XPV A;  2M46 A;  3M8N A;  2XHF A;  1QFN A;  1UC7 A;  2CAI A;  3GSS A;  1FOV A;  2C1Y A;  1ABA A;  4ZL7 A;  4GLT A;  1Z7P A;  4EUY A;  3H1N A;  3G9B A;  2NBS A;  1WP0 A;  3E3E A;  2JU5 A;  5IOW A;  4TN8 A;  2AYT A;  4EO3 A;  1X0R A;  4XRA A;  2DKH A;  2P5Q A;  5BMU A;  2B7K A;  2MMA A;  3ZLP A;  4IGJ A;  4WET A;  2HSY A;  5A1N A;  2YZU A;  1ERT A;  2O5V A;  2NTO A;  4KCE A;  2V32 A;  3MIX A;  4XS4 A;  3L9V A;  2LRT A;  2FUG 2;  3PGT A;  6GSW A;  4ILF A;  3RBT A;  1EEJ A;  4ECI A;  5IPG A;  3D4T A;  5ID2 A;  3ZIJ A;  3BD2 A;  4POL A;  2JSZ A;  3VPQ A;  3VWV A;  2WS2 A;  4TVE A;  4MJC A;  1B4P A;  2GT6 A;  5J4Y A;  3DML A;  2CX4 A;  2RII A;  3NOF A;  3KEB A;  3C7M A;  5KN2 A;  3W8S A;  5A4U A;  18GS A;  4OD7 A;  3LG6 A;  1FVK A;  3NZN A;  3Q74 A;  2FA4 A;  2YWN A;  2HSM B;  3IE3 A;  3IAS 2;  4WXT A;  1GTI A;  5IO0 A;  1LBK A;  4MNN A;  2I1U A;  5JWQ B;  4EL1 A;  3UOM A;  1Y25 A;  1F9M A;  2BTO T;  2WRT A;  4XCS A;  3ZZX A;  1TK8 B;  1OC9 A;  2JZS A;  2WCI A;  3IRA A;  1YEX A;  13GS A;  2OKA A;  5IMF A;  5IQY A;  4PUR A;  4TW5 A;  1XVW A;  5F06 A;  3QR6 A;  1Y6E A;  3WGX A;  4MJA A;  3WT1 A;  3BJ5 A;  4TR1 A;  3UBK A;  3M1G A;  2A2P A;  4FYU A;  4NV5 A;  6GSY A;  2OJL A;  3AY8 A;  3UAR A;  1YEP A;  4YQV A;  2OBI A;  4OCF A;  1URM A;  4NAX A;  5DCG A;  2X8H A;  2YJH A;  5J4V A;  2I3Y A;  4ZBA A;  2VM1 A;  2MBS A;  2I9H A;  1AW9 A;  5GAN D;  4PUA A;  2H70 A;  2YPM A;  2H1B A;  1R26 A;  3ZFL A;  1M0U A;  3D22 A;  5A34 B;  3ZIT A;  1T00 A;  3GYK A;  3GKN A;  3HVV A;  4XS1 A;  1T3B A;  3KXO A;  2HSH A;  1SD8 A;  2HZF A;  3Q19 A;  2VAF A;  2AJQ B;  4TR4 A;  1ZGN A;  4BA7 A;  2DJ1 A;  4PQI A;  1A2M A;  5CNW A;  1TTZ A;  2DKI A;  2LV3 A;  4KH7 A;  1SD9 A;  2OA7 A;  5CRH A;  3CSH A;  5AGY A;  5ECH B;  3M3M A;  3HJM A;  4G9H A;  1O8W A;  3IK9 A;  1EP8 A;  4ZL9 A;  5HR2 A;  2R6K A;  1TRU A;  2X49 A;  2DJK A;  1Z6N A;  1GH2 A;  3C71 A;  3KGK A;  5CO3 A;  3WD6 A;  2WUL A;  4O5Q A;  5IMC A;  2ON5 A;  2O85 A;  3D21 A;  5IMZ A;  3ERG A;  3UEM A;  1A24 A;  1K0A A;  2CVD A;  2PVQ A;  3O6T A;  5ECS A;  4EF0 A;  4KX4 A;  1GSU A;  4KDU A;  1M99 A;  4A5P A;  3LFL A;  4X1U A;  3E0U A;  5LCZ A;  5J9B A;  1YJ6 A;  1SJ6 A;  1U87 A;  1UA5 A;  5D9W A;  4PUF C;  2OAD A;  2VLV A;  3C1S A;  4ID0 A;  5JCU A;  2WZ9 A;  3CWG A;  1MD3 A;  1A8Y A;  3ISO A;  1YF1 A;  2L6D A;  4AJ6 A;  5KEJ A;  3GNJ A;  1Z9H A;  1DE1 A;  3FR6 A;  2XPD A;  3TOT A;  5D9T A;  5D9V A;  4V2L A;  1N2A A;  4POK A;  2P31 A;  2YNX A;  1Z7R A;  5D73 A;  1B4Q A;  1N25 A;  1TI3 A;  2EFC A;  5HQP A;  2H0I A;  3LJR A;  3A5W A;  2YV9 A;  3PPU A;  2M80 A;  1A2J A;  4KDY A;  5GAP D;  3GN3 A;  5D96 A;  4AJ7 A;  2CZ3 A;  2L57 A;  1QUW A;  1BED A;  1HNB A;  1EWX A;  2EFD A;  2HT9 A;  2H6Y A;  3L9S A;  3BBY A;  4TR0 A;  4E68 A;  3TRQ A;  3L78 A;  2KHP A;  6GSV A;  1XBS A;  1THO A;  1OC3 A;  4AGS A;  1BJX A;  1I5G A;  1GNE A;  3GUR A;  2IL3 A;  1KTE A;  4OCE A;  3A5I A;  1W4V A;  1BYE A;  4HJ2 A;  3F3R A;  5CRE A;  5GZZ B;  1PKZ A;  5ECK B;  5ECO B;  2IMD A;  5LD0 A;  5EVO A;  5F05 A;  2O7K A;  3APS A;  5IIZ A;  2DBC A;  4KSM A;  3I6A A;  2YCD A;  20GS A;  2HQT A;  4FIW A;  3CSI A;  3QMX A;  1TJD A;  5ECP B;  4E8H A;  1K3L A;  1S3A A;  1OYJ A;  1SEN A;  2JL4 A;  3GUS A;  2PBJ A;  4EKZ A;  2HNL A;  3IDV A;  4DSR A;  2H1A A;  3A2X A;  4NHW A;  2HRF A;  3GTU A;  1O73 A;  4PX1 A;  2GS3 A;  2DJ2 A;  3TKP A;  2JZT A;  3DIE A;  4LMV A;  3IA1 A;  2H72 A;  1QXH A;  12GS A;  3G7J A;  2AB6 A;  5HR0 A;  4LL4 B;  2VO4 A;  4ECC A;  4D73 A;  2LRC A;  5G5E A;  2HZE A;  3APO A;  1DE2 A;  3HJO A;  3LEF A;  5DQY A;  1X5D A;  4DSS B;  4CHS A;  2FWH A;  2JSY A;  3MNG A;  1T4Y A;  4I97 A;  5JCW A;  2B1K A;  2B1L A;  5A5H B;  4V1A g;  3GKM A;  1WIK A;  3KMN A;  4BWQ A;  2VCQ A;  1PD2 1;  1AC1 A;  1PA3 A;  4Q5N A;  3UMA A;  1TK5 B;  5FT3 A;  4GWR A;  2O8V B;  4J57 E;  4K5R A;  1XWB A;  3GH6 A;  1G7O A;  2F51 A;  4Q5F A;  2OE3 A;  3O3T A;  3GX0 A;  2R37 A;  5IO2 A;  4X43 A;  2C3N A;  2JZR A;  1AAZ A;  1YF0 A;  4EVM A;  2HSN A;  2J23 A;  1WPI A;  1O81 A;  4X0X A;  2X8C A;  3RHB A;  4CW9 A;  3WGE A;  1BG1 A;  1SL1 B;  2VL9 A;  1XXU A;  1G6W A;  4K7N A;  3GMF A;  2LJR A;  4PQH A;  4X4J A;  2F9S A;  3F4S A;  2H19 A;  3GV1 A;  4MZC A;  2H0G A;  2DIZ A;  3KP9 A;  3GL3 A;  2ZNM A;  2R3X A;  4K9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...