4BL7B

Crystal structure of the aimp3-mrs n-terminal domain complex in different space group
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
SMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFSHIQHYPGIRQHLSSVVFIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords METHIONINE--TRNA LIGASE, CYTOPLASMIC
publication title Crystal Structure of the Aimp3-Mrs N-Terminal Domain Complex in Different Space Group
rcsb
source organism Homo sapiens
total genus 58
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4bl7B02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bl7B01
1ZL9A 4ZB9A 2N5FA 1MD3A 4GCIA 4MPGA 5G5FA 3GSTA 1GTIA 2J9HA 4WR5A 4MP4A 4EDYA 2R3XA 2NTOA 1K3LA 2FNOA 4FQUA 3HKRA 4ZB8A 3W8SA 6GSXA 1GULA 2VCZA 6GSTA 1XW6A 5A4VA 4J2FA 4MK3A 3FY7A 1PX6A 3GSSA 1U87A 5ECQB 4L5OA 2GSRA 4USSA 4L8EA 1LJRA 1FHEA 2JL4A 3PGTA 4IJIA 3CSIA 1K0BA 5F8BA 6GSYA 1GUMA 4ISDA 5B7CA 4E8EA 2V6KA 5ECPB 1K3OA 1DUGA 1K0DA 3EINA 3PPUA 4MF5A 1JLWA 1GSEA 4ID0A 5J41A 2ON5A 2CZ3A 1OE8A 1EEMA 4MF6A 5ECIB 2F8FA 3UVHA 1BG5A 4K0GA 2CAIA 5ECKB 5ECHB 3TOTA 2ON7A 1V2AA 2YV7A 3CRUA 4PTSA 1PKZA 1B4PA 3M0FA 4Q5NA 2CAQA 2GSSA 1EV9A 1PX7A 3VWXA 4F03A 3CBUA 3CRTA 4HJ2A 2C80A 4YAVA 4ZBDA 5DQSA 2IL3A 1GLPA 1GTAA 1MD4A 4GSSA 5FHIA 3F6FA 4MF7A 4OMVA 3RBTA 2CA8A 2PGTA 2WJUA 1EOHA 3LYKA 3VPTA 3WYWA 5BMUA 4PQIA 4ECJA 2HNLA 1AQWA 1M9BA 4PURA 4PQHA 5AN1A 1OE7A 4YH2A 1B8XA 1EOGA 1YKCA 2C4JA 2FHEA 5F0GA 4OFTA 1OYJA 3VI7A 5ECRB 4IW9A 1JLVA 1YQ1A 2HQTA 3O76A 4I97A 1TU8A 3HJMA 1K3YA 2C3NA 5AISA 2GSTA 4IGJA 4LMVA 1AQVA 4IKHA 18GSA 1JZRA 1GSYA 3D0ZA 3QAGA 3LQ7A 5D9WA 3Q19A 1C72A 5EL8A 3IK7A 4IELA 4Q5QA 3C8EA 4AGSA 3VPQA 1M9AA 1IYHA 3LXZA 3LYPA 1PL1A 3CSHA 3FR6A 3IE3A 4GF0A 4K0NA 2IMKA 3IC8A 3GTUA 3VK9A 1A0FA 2CVDA 3IK9A 3ERFA 3U6VA 2D2ZA 5ELGA 4BL7A 5DAKA 1TDIA 2GDRA 1Y6EA 3NIVA 4IBPA 1B48A 5EVOA 5D9XA 5GZZB 5GSTA 1MTCA 5D9TA 2VCXA 3FYGA 3GH6A 5EY6A 3F63A 1XWKA 1M0UA 4OFMA 1OKTA 3UBKA 4BVXA 1EV4A 4OFNA 12GSA 2R6KA 4JEDA 4HI7A 4ZBBA 2VO4A 4MDCA 4IVFA 2PERA 13GSA 3G7IA 1AQXA 3KMNA 4KDYA 3VURA 1E6BA 1K0OA 4IQAA 1F3AA 4NAXA 1K0CA 1GWCA 4LMWA 3HJOA 10GSA 4MZWA 2PVQA 2IMIA 4PX1A 3O3TA 4KDXA 1PGTA 4EC0A 5A4WA 4Q5FA 2VD1A 4ECCA 2YV9A 2GTUA 5DALA 4RI7A 6GSWA 1BX9A 1XWGA 5J4UA 1VF1A 2HSMA 4PNGA 1GUKA 1UA5A 3QR6A 3GTUB 4ZBAA 2LJRA 1K0MA 3LJRA 3SWLA 2WS2A 3PR8A 3ZFLA 4YQVA 4BL7B 5DAKB 3UAPA 4KF9A 1ZGNA 6GSVA 5FWGA 4E8HA 4O92A 5AIVA 2F3MA 1YY7A 5ECNB 4Q5RA 5F06A 3N5OA 1BAYA 1IYIA 4YAPA 5IQYA 1U3IA 3GUSA 5AIXA 5DJLA 6GSSA 3MAKA 3R2QA 4WR4A 3ZMLA 4BVXB 3MDKA 4NHWA 3ERGA 3LSZA 4GSNA 4KH7A 2PMTA 3R3EA 5D9VA 4ZXGA 3KM6A 4BVYA 4G0KA 3Q18A 2GSQA 4L5LA 6GSUA 9GSSA 4GLTA 1K0NA 1VF3A 4PGTA 4F0BA 1HNCA 1PL2A 16GSA 3VLNA 4O7HA 1PD21 1GSSA 4KE3A 3M3MA 3FR3A 2R5GA 1TU7A 1HQOA 4KDUA 2X64A 4MPFA 4EE0A 5GSSA 5G5EA 5KEJA 2VCQA 1BYEA 5DALB 2CZ2A 3P90A 2OA7A 5D73A 22GSA 1G6YA 5F07A 4HZ2A 14GSA 1GSDA 1F2EA 3F6DA 1TW9A 1GSUA 1G7OA 5ECSA 3IR4A 2HSMB 2DSAA 1GLQA 4TOPA 3LG6A 2HRKA 4PUAA 5ECLB 3LXTA 4KGIA 3UBLA 3BBYA 1FW1A 1G6WA 1AXDA 1XW5A 1YJ6A 4HZ4A 2UZ8A 1GTUA 2A2SA 4QQ7A 3DGQA 11GSA 5A4UA 1GTBA 5ELAA 5DJMA 4KSMA 3L0HA 3KMOA 4G10A 2R4VA 2HSNB 3I6AA 4GSTA 1HNBA 4EXJA 3TOUA 3IBHA 3KXOA 1U88A 3ZMKA 5JCWA 20GSA 3ZFBA 2A2RA 4DEJA 3GX0A 4KX4A 2OADA 4BVYB 4G0IA 1R5AA 3P8WA 5AGYA 7GSSA 4PXOA 1Q4JA 5LD0A 1F3BA 3M8NA 5F05A 1VF4A 5ECMB 3EE2A 3FR9A 4JBBA 4G9HA 3N9JA 4ECBA 1Z9HA 3KTLA 1GNWA 5JCUA 2AAWA 4ECIA 1N2AA 1ML6A 3VI5A 4ZB6A 4GTUA 2YCDA 1PMTA 5LCZA 1GSQA 4HOJA 4CHSA 1GNEA 3ISOA 2AHEA 4JZQA 1HNAA 2HRAA 2C8UA 5FT3A 3AY8A 4RI6A 4EDZA 1KBNA 3LFLA 4NHZA 1AW9A 3QAWA 19GSA 4YQUA 1NHYA 5DDLA 2HRKB 4KAEA 3KJYA 1V40A 5J5NA 3DD3A 5DCGA 2GLRA 3WD6A 1PA3A 1USBA 5HFKA 3UARA 1YDKA 2C3TA 2WRTA 1PN9A 3FRCA 2VCTA 3M1GA 3CSJA 3G7JA 1VF2A 3H1NA 1M99A 4G19A 4IQ1A 4G0LA 2DC5A 3GURA 4ACSA 17GSA 5A5KA 2C3QA 2VCVA 3Q74A 1RK4A 2WB9A 4N0VA 8GSSA 2OACA 4F0CA 1GUHA 1GSFA 2VD0A 2VCWA 3QAVA 1K0AA 2AB6A 2PBJA 1LBKA 4PNFA 2WDUA 1PKWA 5ECOB 4IS0A 3I69A 3TGZA 4YQMA
chains in the Genus database with same CATH superfamily
2N5FA 2MBSA 4EIQA 1AC1A 1I5GA 3LEFA 1T00A 1PRXA 4EDYA 1XOAA 2R3XA 3WGEA 2NPBA 4ZB8A 6GSXA 3GX8A 4K6XA 4J2FA 1M3JA 1UVZA 2K9FA 1T7PB 2OJLA 1ZOFA 3GSSA 1U87A 4USSA 1XG8A 2H8LA 3ZITA 5B7CA 3GHAA 1Q98A 2JZTA 1U6TA 1PSQA 5GAND 3RPPA 1UC7A 4ID0A 3ED3A 2QC7A 1EEMA 3GKKA 4MF6A 5ECIB 2ZCTA 4JE1A 4F82A 1FOVA 4WF4A 4RQXA 2YV7A 3IHGA 2RLIA 1PX7A 1Z3EA 1WPIA 3CBUA 3CRTA 2KLXA 4FXYP 4YAVA 5DQSA 2IL3A 1THOA 1MD4A 5EPFA 4MF7A 1XFLA 4WF5A 3IA1A 5D8IA 4POMA 1EOHA 4OCEA 3F9UA 2X8GA 3WGXA 5IPHA 4PQIA 2HNLA 2YJ7A 5KN1A 1OE7A 3GKXA 1I1IP 3D4MA 1ZYPA 2WW2A 2FHEA 4HDEA 4GQFA 5B8BA 5A5HB 3ZVJD 1OYJA 5ECRB 2REMA 2H73A 3O76A 2M80A 2X99A 3FHKA 3HJMA 3I9V2 4AKIA 1WIKA 4MH2A 4IGJA 4IKHA 3WGDA 1N8JA 4MJCA 3IK7A 1Z6MA 4GQCA 3EVIA 5HR2A 3FEUA 3IOSA 3IE3A 3NZNA 1X5EA 4K0NA 5DBQA 2IMKA 4D73B 2KOKA 4DSSB 3K8NA 3ERFA 3U6VA 2C0GA 3FKFA 2D2ZA 5ELGA 1KNGA 5DAKA 2HE3A 3C1SA 1XZOA 2GDRA 4IBPA 1B48A 1ON4A 2QKEA 3P7XA 1MTCA 3UVTA 4QL7A 3H8QA 4QL9A 1XWKA 1M0UA 3KEBA 1SENA 3CHXC 5BMUB 2TRXA 1QQ2A 4JEDA 1PQNA 5DQYA 5A1NB 1J08A 2VL9A 2E0QA 3RHCA 2VKZG 1PN0A 3GA4A 3EU3A 1K0OA 3FZ9A 1Z7PA 4NAXA 3RHBA 3HJOA 10GSA 3L9SA 4PX1A 4K8MA 1SD8A 3ZREA 2FWHA 2RM5A 1MDJA 2YV9A 1LU4A 1O7UA 4HQZA 5BRTA 4I8BA 2CV4A 1M2BA 3BCIA 2DKIA 4PNGA 2VM2A 4N11A 1UA5A 4AI6A 5HQPA 2WS2A 5IOXA 3ZIVA 2YWIA 4BL7B 4X4JA 3UAPA 2H01A 1TOFA 2MMAA 5AIVA 4K9ZA 1T8EB 2F3MA 3TB2A 5ECNB 1NSWA 4X0XA 4Q5RA 4LL1B 5F06A 3N5OA 2B5YA 2HSNA 5ID2B 3F4RA 3MAKA 3TRPA 2FA8A 3GRXA 2PN8A 4NHWA 2I3YA 1M3IA 1A2LA 4OCFA 3L4NA 2O89A 2PMTA 3IDVA 2DIYA 4BVYA 2GS3A 3F0IA 5E4WA 9GSSA 1VF3A 4F0BA 1FVKA 4LL4B 4PI0C 1PL2A 16GSA 4WBRD 3CXGA 2R37A 2MZCA 1PD21 1GSSA 1EGOA 4KE3A 4KA0A 3FZAA 2R5GA 1HQOA 2LJKA 2FLSA 4MPFA 4I2UA 5G5EA 3HD5A 1ERUA 2VCQA 1BYEA 5C00A 1CQGA 3TCOA 5DALB 2CZ2A 5D73A 2N5AA 3F3QA 3WT2A 2QA1A 1AAZA 5ECSA 3IR4A 2CVKA 2R0PA 1RQMA 4EL1A 4PUAA 4KGIA 3BBYA 1FW1A 1YJ6A 2CX4A 2HRFA 4G2EA 3HA9A 2YNXA 4KW6A 3TRQA 5A4UA 3GNJA 3QDNA 1TI3A 2B1KA 3KMOA 3GIXA 3I6AA 4XCSA 4EXJA 5A34A 4ZL7A 1QMVA 1U88A 3EMXA 4FYCA 5JCWA 3ZFBA 3C71A 4AKHA 2FUG2 2OBKA 5KN3A 3M9KA 4G0IA 4BA7A 3KGKA 7GSSA 2BTOT 4PXOA 1Q4JA 1ERTA 5LD0A 3M8NA 1G0TA 1VF4A 2LQOA 3IAM2 2LS5A 3FR9A 1Z9HA 2XPEA 3F3RA 2YN1A 3QOUA 1PMTA 4HSCX 4HOJA 3HDCA 4KCEA 1OC8A 1HNAA 1R26A 4RI6A 5J9BA 4DSQA 5IOWA 1KBNA 4NHZA 4GRFA 2I81A 3QAWA 4YQUA 4N30A 1NHYA 5J4VA 1V40A 2V6OA 2VM1A 2B3SA 3QFBC 4RUVA 1A8YA 2GLRA 3WD6A 3UARA 3TJJA 3PINA 4W66A 1H4OA 3IRAA 3S9FA 1T3BA 3TRXA 2C0FA 1VF2A 3NOFA 4MJAA 4G0LA 1UN2A 3GURA 4ACSA 3P2AA 2WFCA 3KD0A 2NVLA 1SJZA 1GUHA 1GSFA 2VAFA 1WWJA 1T4ZA 1K0AA 4MZBA 5CRWA 3MIXA 3EU4A 3TU3B 4EUYA 2WDUA 1PKWA 3EWLA 4NWYA 2IN3A 4K7OA 1ZL9A 2A4HA 4K5RA 4MPGA 1MDIA 3GYKA 1V98A 2J9HA 2XC2A 3VWVA 4WR5A 4FH8A 4MJBA 1SK2A 1URMA 2LNSA 5A5HA 3VFIA 2NTOA 2DJJA 3HKRA 3W8SA 5HR0A 6GSTA 4MK3A 3FY7A 4O32A 3D21A 4BIKA 4L8EA 3APOA 4V2MA 1FHEA 3PGTA 4IJIA 1FOHA 1Z7RA 3UJ1A 2DJ2A 6GSYA 3FK8A 2V6KA 2WZ9A 2I1UA 1K3OA 3J7Yk 3MWHA 2ON5A 2CZ3A 3US3A 1ILOA 4ML1A 2HXKA 1SL0B 3MYDA 2ZUPA 4D73A 4K0GA 3QFAC 2CAIA 3TOTA 1V2AA 2DBCA 4PTSA 1TRSA 5L71A 2GSSA 3ERWA 5J9CA 4H86A 3GV1A 2C80A 3TKPA 1GLPA 1GTAA 2GVPA 3RBTA 3CMIA 2PGTA 4ULXA 3VWUA 3VPTA 2F8AA 2X4AA 2JSZA 4MABA 2KP2A 5BMUA 1M9BA 3U5RE 4YH2A 1B8XA 1SJ6A 2WW0A 3LORA 2C4JA 5F0GA 2P5QA 1JLVA 2L5LA 1YQ1A 1YEPA 4IN0A 3MNGA 1TU8A 2OBIA 2JSYA 4WKWA 2H74A 2GSTA 4CY6A 1JZRA 4EO3A 3LQ7A 5D9WA 1RW1A 4IELA 4Q5QA 2DJ3A 1IYHA 3LXZA 1QK8A 1X9MB 3CSHA 2LNTA 2PVOC 4GF0A 1NHOA 1I9DA 2M46A 3HVSA 3VK9A 4V1Ap 1SKSB 1X5CA 5CP1A 1M2DA 4A5PA 3HVNA 4BL7A 3ZLPA 1OAZA 3NIVA 3TJFA 3UOMA 2GZZA 4X43A 5CRGA 2K8SA 2HSHA 2F9SA 3JCML 1PFOA 3FYGA 3APSA 1YKAA 1A23A 4J57E 5ID2A 1F6MC 3IHQA 2RM6A 1Y25A 1WOUA 2YWNA 5J47A 1EV4A 3RFRC 1XW9A 12GSA 3KH7A 4MCUA 4ZB7A 1KTEA 2HRNA 2VO4A 4IJ3A 2VL2A 4IVFA 1QXHA 4KDYA 5G31A 4ML6A 4I6XA 4XS4B 4WXTA 1J0FA 5CRDA 4PQ1A 2O3EA 2IMIA 2R0GA 4KDXA 1PGTA 4EVMA 2VD1A 4ECCA 2GTUA 5DALA 4RI7A 1V57A 4HU7A 2WW3A 6GSWA 2XHFA 2FWEA 2GT5A 5J4UA 2JACA 2FGXA 2KP1A 1FO5A 1N25A 2LJRA 3LJRA 1V58A 3DVXA 4AF2A 1ZGNA 6GSVA 4O92A 2B5XA 4K2DA 4POKA 3HHVA 4YAPA 1U3IA 3ZTLA 5AIXA 4I2TA 6GSSA 2X8CA 3R2QA 4WR4A 2V2GA 3ZMLA 4BVXB 2LKUA 3ERGA 4GSNA 2RIIA 4KH7A 4WBJA 3R3EA 2H1BA 4O5RA 5D9VA 4ZXGA 2IIYA 4G0KA 2H0IA 4O5UA 1JZWA 4O7HA 4TXVA 1FB0A 3IC4A 3TJKA 3GKNA 2PUKC 2N5BA 1X5DA 1BQ7A 1J9BA 5GSSA 4DVCA 3L9UA 2VOCA 5J3RA 5KEJA 5CRHA 4Z2TA 2OA7A 3LWAA 22GSA 1S3AA 2DLXA 1G6YA 2H1DA 5F07A 14GSA 4TRXA 3HVVA 1Y1UA 1G7OA 3H4KA 2EC4A 1GLQA 4TOPA 2B6MA 5HFGA 3IPZA 4HUAA 3LXTA 4N0ZA 4HU9A 2VL2C 3A3TA 4HZ4A 2UZ8A 2OE3A 5IM9A 2LSTA 2J23A 3DGQA 2KHPA 3D5JA 1OC9B 1GTBA 1TRWA 4TW5A 3GL3A 4G01A 5HFIA 2R4VA 3C1RA 1HNBA 2O8VB 4BWSA 2IFQB 4PHZC 3QPMA 1SKRB 1TXXA 2XBQA 1XXUA 4DEJA 2E2GA 3FW2A 1VRSD 3RAZA 4EKZA 5AGYA 2YZUA 5IO2A 3ZIJA 4JBBA 3N9JA 2OT3A 1T4YA 5JCUA 3DKSA 1N2AA 1NW2A 3VI5A 1HD2A 4ZB6A 2YCDA 5B6MA 1S3RA 1GNEA 2TRCP 2GQMA 2H72A 2HRAA 5FT3A 3GMFA 1AW9A 2X49A 3H93A 1SD9A 5HR1A 2IMDA 3DD3A 1PA3A 1S3CA 2VIMA 1PN9A 4ILFA 1JZOA 2H19A 2AJQB 2O85A 2KUCA 2C3QA 1YEXA 1SYRA 5IMDA 1S3DA 1XWCA 2V32A 4X1UA 2VCWA 2OE1A 3KIJA 2LQQA 1GRXA 2PBJA 4PNFA 3I43A 2DKHA 1F9MA 2RUFA 3I69A 3TGZA 4YQMA 1TKDB 1TJDA 2GT6A 3J7Yb 1MD3A 3KP8A 1XPVA 3GSTA 1GTIA 5ABRA 4MP4A 2CX3A 2L5OA 2H0GA 1OVNA 4IP1A 3A5IA 2FNOA 4FQUA 2IJYA 2EIOA 1GULA 2VCZA 4NV5A 4HEA2 5A4VA 2JZSA 3LW9A 2H1LA 5ECQB 2GSRA 2H1GA 1LJRA 2JL4A 5G30A 3CSIA 2C0EA 2L6CA 1GUMA 4ISDA 5ECPB 3TKQA 3EPTA 3GFKA 1R7HA 3EINA 4MF5A 1JLWA 1YEWC 2UV8G 4K7NA 2F8FA 2MMZA 3F8UA 3UVHA 1BG5A 5ECHB 2VLUA 2ON7A 3CRUA 1SL2B 2H76A 1BG1A 1EV9A 3VWXA 2K8VA 4HJ2A 4BPYA 3EYTA 2G0FA 3MSZA 1OC3A 4GSSA 5FHIA 3TKSE 3F6FA 2L6DA 3PH9A 4AJ8A 4ECJA 3L9VA 1AQWA 3HVXA 4PQHA 1JZDA 1EOGA 2H6ZA 2WVZA 1V9WA 3VI7A 4OFTA 5CO3A 2LTKA 2A4VA 2Z9SA 4XS4A 5CNWA 3FZ5A 4I97A 2WULA 2P31A 2C0DA 2C3NA 2VLVA 4MNNA 4LMVA 1AQVA 18GSA 2FY6A 1GSYA 3HCZA 3QAGA 3Q19A 3HZ8A 1C72A 2H70A 5EL8A 2EIRA 5H5SA 3C8EA 4AGSA 3TJGA 3VPQA 1FAAA 4XHMA 1M9AA 3LYPA 2V1MA 4HS1A 2LV3A 3CTGA 4XRDA 1CQHA 3KTBA 4JR6A 2G2QA 1WJKA 1A0RP 1SYXA 4CW9A 5G1LA 1Y6EA 5HR3A 2PPTA 5GZZB 1DSBA 4TKYA 4TR1B 5GSTA 1ERWA 3RGBC 4GWRA 5D9TA 2VCXA 2IPAA 4AKXB 3F63A 2L57A 2FCHA 3OR5A 4OFMA 1OKTA 1Z6NA 3UBKA 2V41A 5JWRB 4BVXA 1F37A 4OFNA 5IMFA 4KNDA 1BEDA 3C7MA 13GSA 1AQXA 3KMNA 1E6BA 4KB3A 5JCGA 3CTFA 4IQAA 2QA2A 1F3AA 1GWCA 1O73A 2EIQA 1JFUA 3W6GA 5DVBA 4OWYA 1XWAA 1BX9A 1TK0B 4K5SA 1B9XC 1FVJA 1GUKA 3QR6A 4TR4A 3GTUB 2TIRA 2PWJA 3TJBA 3L78A 2WCIA 3ZFLA 4E68A 4YQVA 2H1AA 4FYUA 2MYGA 3DVWA 1A2MA 1MDKA 4KF9A 5FWGA 1WMJA 2OE0A 1EP7A 1OC9A 2AV4A 2XPDA 4MH3A 1FB6A 4P3YB 2LEGA 2IMEA 5DJLA 5KOWA 2H66A 2IFQA 3D4TA 3EMPA 4XTSA 4N10A 2YJHA 3CYNA 4QMKA 2VL3A 2GSQA 6GSUA 1HNCA 2B7KA 1QGVA 3FMWA 3M3MA 3FR3A 4AKGA 4KDUA 1ABAA 3BCKA 4DSRA 2X64A 2ALBA 2DMLA 3ME7A 3P90A 2BMXA 2L59A 1O8WA 2IMFA 1YZXA 1GSDA 1GSUA 4Z2RA 2HSMB 2DSAA 2EFEA 2WVXB 3LG6A 1O6JA 2E2MA 4ZIJA 3KCMA 4F2IA 5CREA 3UBLA 1G6WA 4PUFC 1XW5A 3EC3A 1GTUA 1XBSA 3IXRA 11GSA 1XCCA 5D93A 2YOIA 5DJMA 4KSMA 3L0HA 4G10A 2YWOA 2F51A 4ZILA 3TOUA 2HSYA 3IBHA 2B1LA 3KXOA 2K6VA 3IV4A 1XOBA 3KH9A 1YF0A 20GSA 2A2RA 5GAPD 4J56E 3GX0A 4KX4A 2OADA 1R5AA 3UL3A 1ZYNA 3F4SA 5F05A 2NDOA 3HYPA 1AIUA 5ECMB 1SJIA 3QD9A 4G9HA 2WW1A 4ECBA 3KTLA 1GNWA 1EWXA 1ML6A 1TRUA 3FZ4A 3O6TA 3GH9A 5LCZA 1GSQA 3VWWA 4CHSA 1HYUA 2YPMA 4TN8A 1O81A 5C04A 4AJ6A 2HZFA 2C8UA 2DJ0A 3AY8A 1R4WA 3DWVA 4MLYA 3LFLA 19GSA 4GXZA 5DDLA 2EFCA 1ZYQB 2HRKB 3KJYA 1H75A 3ZZXA 5J5NA 3C73A 1YDKA 1ACVA 2C3TA 2WRTA 1XIYA 4YKFA 3DRNA 4MZCA 4CDOA 1W89A 3M1GA 2RUEA 3CSJA 1QUWA 2LRCA 1SK1A 3E9JB 3QCPA 2WVYA 1RK4A 4TXOB 1THXA 4N0VA 8GSSA 2QSIA 1AUCA 4F0CA 5IPGA 3BOAA 2VUPA 3QAVA 2AB6A 4EF0A 1LBKA 1T1VA 2B7JA 4IS0A 1X9SB 4IP6A 4ZB9A 5IMAA 4GCIA 5G5FA 1A2JA 2VLTA 5IMVA 2HZEB 3HY2A 1K3LA 3LGCA 4YKGA 2I9HA 1EP8A 1TI1A 4ZL9A 2JU5A 1ERVA 1XW6A 3F4TA 5IIZA 1TRVA 4XS6A 1PX6A 2LUSA 3HZ4A 1E2YA 4L5OA 1X0RA 5B6NA 1W4VA 1K0BA 5F8BA 2LRNA 2WGRA 4E8EA 1GH2A 3CWGA 4JU5A 2CQ9A 4MA9A 1DUGA 1K0DA 4PI2C 3PPUA 4TVEA 1GSEA 5J41A 1OE8A 4EIPA 3UMAA 5ECKB 4KCAA 1PKZA 1B4PA 3RPNA 3M0FA 4Q5NA 1TTZA 2CAQA 1WE0A 4FYBA 1SVLA 1BJXA 2HI7A 5G1KA 2CT6A 4F03A 3HXSA 1SVOA 4LLRA 4ZBDA 4TR1A 4POLA 5H5QA 4KSOA 4OMVA 2HLSA 5CAXA 2CA8A 2WJUA 4I5QA 1TXUA 3LYKA 4JRRA 3WYWA 3IAS2 4HQSA 2MMOA 1EEJA 1O8XA 3D6IA 4K1FA 1KEBA 3BJ5A 5J40A 4PURA 5AN1A 1ZCPA 1YKCA 3ME8A 2L4CA 5J4YA 3E0UA 4FIWA 5KN0A 2E7PA 5E59A 4IW9A 3ZRDA 3A5WA 2HQTA 3KP9A 2R0CA 4ZL8A 1K3YA 2IWTA 5AISA 1EZKA 2ZNMA 1NM3A 3D0ZA 1BF5A 2QGVA 4IHUA 2M72A 2CVBA 2ES7A 2HT9A 1O85A 1PL1A 3FR6A 3UEMA 4OD7A 4AJ7A 2O87A 3IC8A 2A2PA 5IMCA 3GTUA 1A0FA 2CVDA 3IK9A 5COHA 5KOXA 2AUVA 3EURA 1TDIA 5EVOA 2H0HA 5D9XA 1G7EA 4Z2UA 3GH6A 5EY6A 4OO4A 1U3AA 1FG4A 5B8AA 1QFNA 1A8LA 3DIEA 2XBIA 1S4BP 4ICYA 3H79A 3APQA 2LRTA 4FO5A 2R6KA 4HI7A 4ZBBA 1ZYEA 2K18A 1ST9A 2MBTA 4MDCA 2PERA 1XWBA 3G7IA 3VURA 1TP9A 1A24A 4TR0A 4L0WA 4TR3A 2FA4A 1WRYA 1K0CA 3DEXA 4KUNA 4LMWA 4MZWA 2PVQA 5ENUA 3Q6OA 3O3TA 4GDFA 4EC0A 5A4WA 1R5PA 4WEYA 4Q5FA 4OO5A 3D22A 3ZYWA 3ZVJA 4L0UA 2P0GA 4MMMA 1XWGA 1DBYA 1VF1A 1B9YC 2HSMA 1DE1A 1X9WB 2WVXA 3ZL5A 4ZBAA 4RQRA 1K0MA 2YWMA 3SWLA 3PR8A 3A2VA 2JZRA 4N3ZA 5DAKB 4E8HA 1YVLA 2GQLA 1TK5B 1SU9A 2I4AA 2C1YA 1YY7A 5INYA 2OKAA 1BAYA 1IYIA 5IQYA 3GUSA 4Z7XA 4NV2A 4K2XA 3SBCA 2FD3A 3MDKA 3LSZA 1ZZYA 3HJPA 2YP6A 2NBSA 5D96A 3KM6A 4L5LA 3Q18A 4GLTA 1K0NA 4PGTA 2DJKA 2H71A 5IMZA 3VLNA 3TUEA 4LA1A 2GZYA 1B4QA 2HYXA 1TU7A 1SKWB 2H30A 2O7KA 4EE0A 3DMLA 1TK8B 5IO0A 2DIZA 2P5RA 1XVWA 2H75A 5KN2A 1SL1B 4HZ2A 1Z5YE 3A2WA 1F2EA 3F6DA 1TW9A 2EFHA 2B5EA 4XS1A 5JWQB 2HRKA 3TKSA 5ECLB 4HJMA 2EFDA 4MJEA 1AXDA 2R2JA 1GP1A 4CY8A 2DMMA 2A2SA 3GL5A 3KZQA 2WZSA 4QQ7A 3GN3A 4V2LA 5ELAA 5G2ZA 1M7TA 2LJAA 3DXBA 4BWQA 3G7YA 2HSNB 2JADA 4NMUA 4GSTA 2GZPA 2O5VA 4JR4A 1DE2A 4TXOA 3V1WA 1OKDA 4F9ZA 3ZMKA 2YANA 4BVYB 5DCHA 2MMNA 5H5RA 2BJXA 3P8WA 2GGTA 1F3BA 4DSSA 1YF1A 3EE2A 2DJ1A 3HMJG 4V1Ag 4NPBA 2AAWA 4ECIA 4K7IA 2HZEA 2H6XA 1SVMA 4NXIA 4GTUA 2GQKA 2L4QA 3ISOA 2AHEA 4JZQA 2H6YA 3CQFA 4EDZA 1MEKA 2YZHA 2HFDA 5JWOB 2PU9C 4POBA 3A2XA 5LNKe 3UIWA 4KAEA 1EGRA 5A1NA 2O36A 5DCGA 4WETA 5HFKA 1USBA 3TKRA 1VGLA 3M9JA 4V2NA 1WP0A 3FRCA 3TDGA 2VCTA 1M2AA 3G7JA 3H1NA 3QMXA 3WT1A 2X8HA 1M99A 4G19A 4IQ1A 2AYTA 2DC5A 3DYRA 17GSA 5A5KA 5A34B 3W8JA 3E3EA 2FWFA 4O5QA 5CYYA 2VCVA 3Q74A 2WB9A 1XVQA 3G9BA 1GL8A 2OACA 2VD0A 1SK0A 4XIHA 1JHBA 4XRAA 3BD2A 3GKMA 5ECOB 1ZMAA 3TKSC 3RDWA 2FWGA
chains in the Genus database with same CATH topology
2N5FA 2MBSA 4EIQA 1AC1A 1I5GA 3LEFA 1T00A 1PRXA 4EDYA 1XOAA 2R3XA 3WGEA 2NPBA 4ZB8A 6GSXA 3GX8A 4K6XA 4J2FA 1UVZA 2K9FA 1T7PB 2OJLA 1ZOFA 3GSSA 1U87A 4USSA 2H8LA 3ZITA 5B7CA 3GHAA 1Q98A 2JZTA 1U6TA 1PSQA 5GAND 3RPPA 1UC7A 4ID0A 3ED3A 2QC7A 1EEMA 3GKKA 4MF6A 5ECIB 2ZCTA 4JE1A 4F82A 1FOVA 4WF4A 4RQXA 2YV7A 3IHGA 2RLIA 1PX7A 1Z3EA 1WPIA 3CBUA 3CRTA 2KLXA 4YAVA 5DQSA 2IL3A 1THOA 1MD4A 5EPFA 4MF7A 1XFLA 4WF5A 3IA1A 5D8IA 4POMA 1EOHA 4OCEA 3F9UA 2X8GA 3WGXA 5IPHA 4PQIA 2HNLA 2YJ7A 5KN1A 1OE7A 3GKXA 3D4MA 1ZYPA 2FHEA 4HDEA 4GQFA 5B8BA 5A5HB 3ZVJD 1OYJA 5ECRB 2REMA 2H73A 3O76A 2M80A 2X99A 3FHKA 3HJMA 3I9V2 4AKIA 1WIKA 4MH2A 4IGJA 4IKHA 3WGDA 1N8JA 4MJCA 3IK7A 1Z6MA 4GQCA 3EVIA 5HR2A 3FEUA 3IOSA 3IE3A 3NZNA 1X5EA 4K0NA 5DBQA 2IMKA 4D73B 2KOKA 4DSSB 3K8NA 3ERFA 3U6VA 2C0GA 3FKFA 2D2ZA 5ELGA 1KNGA 5DAKA 2HE3A 3C1SA 1XZOA 2GDRA 4IBPA 1B48A 1ON4A 2QKEA 3P7XA 1MTCA 3UVTA 4QL7A 3H8QA 4QL9A 1XWKA 1M0UA 3KEBA 1SENA 5BMUB 2TRXA 1QQ2A 4JEDA 1PQNA 5DQYA 5A1NB 1J08A 2VL9A 2E0QA 3RHCA 2VKZG 1PN0A 3GA4A 3EU3A 1K0OA 3FZ9A 1Z7PA 4NAXA 3RHBA 3HJOA 10GSA 3L9SA 4PX1A 4K8MA 1SD8A 3ZREA 2FWHA 2RM5A 1MDJA 2YV9A 1LU4A 1O7UA 4HQZA 5BRTA 4I8BA 2CV4A 1M2BA 3BCIA 2DKIA 4PNGA 2VM2A 4N11A 1UA5A 4AI6A 5HQPA 2WS2A 5IOXA 3ZIVA 2YWIA 4BL7B 4X4JA 3UAPA 2H01A 1TOFA 2MMAA 5AIVA 4K9ZA 1T8EB 2F3MA 3TB2A 5ECNB 1NSWA 4X0XA 4Q5RA 4LL1B 5F06A 3N5OA 2B5YA 2HSNA 5ID2B 3F4RA 3MAKA 3TRPA 2FA8A 3GRXA 2PN8A 4NHWA 2I3YA 1A2LA 4OCFA 3L4NA 2O89A 2PMTA 3IDVA 2DIYA 4BVYA 2GS3A 3F0IA 5E4WA 9GSSA 1VF3A 4F0BA 1FVKA 4LL4B 1PL2A 16GSA 4WBRD 3CXGA 2R37A 2MZCA 1PD21 1GSSA 1EGOA 4KE3A 4KA0A 3FZAA 2R5GA 1HQOA 2LJKA 2FLSA 4MPFA 4I2UA 5G5EA 3HD5A 1ERUA 2VCQA 1BYEA 5C00A 1CQGA 3TCOA 5DALB 2CZ2A 5D73A 2N5AA 3F3QA 3WT2A 2QA1A 1AAZA 5ECSA 3IR4A 2CVKA 2R0PA 1RQMA 4EL1A 4PUAA 4KGIA 3BBYA 1FW1A 1YJ6A 2CX4A 2HRFA 4G2EA 3HA9A 2YNXA 4KW6A 3TRQA 5A4UA 3GNJA 3QDNA 1TI3A 2B1KA 3KMOA 3GIXA 3I6AA 4XCSA 4EXJA 5A34A 4ZL7A 1QMVA 1U88A 3EMXA 4FYCA 5JCWA 3ZFBA 3C71A 4AKHA 2FUG2 2OBKA 5KN3A 3M9KA 4G0IA 4BA7A 3KGKA 7GSSA 2BTOT 4PXOA 1Q4JA 1ERTA 5LD0A 3M8NA 1G0TA 1VF4A 2LQOA 3IAM2 2LS5A 3FR9A 1Z9HA 2XPEA 3F3RA 2YN1A 3QOUA 1PMTA 4HOJA 3HDCA 4KCEA 1OC8A 1HNAA 1R26A 4RI6A 5J9BA 4DSQA 5IOWA 1KBNA 4NHZA 4GRFA 2I81A 3QAWA 4YQUA 4N30A 1NHYA 5J4VA 1V40A 2V6OA 2VM1A 2B3SA 3QFBC 4RUVA 1A8YA 2GLRA 3WD6A 3UARA 3TJJA 3PINA 4W66A 1H4OA 3IRAA 3S9FA 1T3BA 3TRXA 2C0FA 1VF2A 3NOFA 4MJAA 4G0LA 1UN2A 3GURA 4ACSA 3P2AA 2WFCA 3KD0A 2NVLA 1SJZA 1GUHA 1GSFA 2VAFA 1WWJA 1T4ZA 1K0AA 4MZBA 5CRWA 3MIXA 3EU4A 3TU3B 4EUYA 2WDUA 1PKWA 3EWLA 4NWYA 2IN3A 4K7OA 1ZL9A 2A4HA 4K5RA 4MPGA 1MDIA 3GYKA 1V98A 2J9HA 2XC2A 3VWVA 4WR5A 4FH8A 4MJBA 1SK2A 1URMA 2LNSA 5A5HA 3VFIA 2NTOA 2DJJA 3HKRA 3W8SA 5HR0A 6GSTA 4MK3A 3FY7A 4O32A 3D21A 4L8EA 3APOA 4V2MA 1FHEA 3PGTA 4IJIA 1FOHA 1Z7RA 3UJ1A 2DJ2A 6GSYA 3FK8A 2V6KA 2WZ9A 2I1UA 1K3OA 3J7Yk 3MWHA 2ON5A 2CZ3A 3US3A 1ILOA 4ML1A 2HXKA 1SL0B 3MYDA 2ZUPA 4D73A 4K0GA 3QFAC 2CAIA 3TOTA 1V2AA 2DBCA 4PTSA 1TRSA 5L71A 2GSSA 3ERWA 5J9CA 4H86A 3GV1A 2C80A 3TKPA 1GLPA 1GTAA 2GVPA 3RBTA 3CMIA 2PGTA 4ULXA 3VWUA 3VPTA 2F8AA 2X4AA 2JSZA 4MABA 2KP2A 5BMUA 1M9BA 3U5RE 4YH2A 1B8XA 1SJ6A 3LORA 2C4JA 5F0GA 2P5QA 1JLVA 2L5LA 1YQ1A 1YEPA 4IN0A 3MNGA 1TU8A 2OBIA 2JSYA 4WKWA 2H74A 2GSTA 4CY6A 1JZRA 4EO3A 3LQ7A 5D9WA 1RW1A 4IELA 4Q5QA 2DJ3A 1IYHA 3LXZA 1QK8A 1X9MB 3CSHA 2LNTA 2PVOC 4GF0A 1NHOA 1I9DA 2M46A 3HVSA 3VK9A 4V1Ap 1SKSB 1X5CA 5CP1A 1M2DA 4A5PA 4BL7A 3ZLPA 1OAZA 3NIVA 3TJFA 3UOMA 2GZZA 4X43A 5CRGA 2K8SA 2HSHA 2F9SA 3JCML 3FYGA 3APSA 1YKAA 1A23A 4J57E 5ID2A 1F6MC 3IHQA 2RM6A 1Y25A 1WOUA 2YWNA 5J47A 1EV4A 1XW9A 12GSA 3KH7A 4MCUA 4ZB7A 1KTEA 2HRNA 2VO4A 4IJ3A 2VL2A 4IVFA 1QXHA 4KDYA 5G31A 4ML6A 4I6XA 4XS4B 4WXTA 1J0FA 5CRDA 4PQ1A 2IMIA 2R0GA 4KDXA 1PGTA 4EVMA 2VD1A 4ECCA 2GTUA 5DALA 4RI7A 1V57A 4HU7A 6GSWA 2XHFA 2FWEA 2GT5A 5J4UA 2JACA 2FGXA 2KP1A 1FO5A 1N25A 2LJRA 3LJRA 1V58A 3DVXA 4AF2A 1ZGNA 6GSVA 4O92A 2B5XA 4K2DA 4POKA 3HHVA 4YAPA 1U3IA 3ZTLA 5AIXA 4I2TA 6GSSA 2X8CA 3R2QA 4WR4A 2V2GA 3ZMLA 4BVXB 2LKUA 3ERGA 4GSNA 2RIIA 4KH7A 4WBJA 3R3EA 2H1BA 4O5RA 5D9VA 4ZXGA 2IIYA 4G0KA 2H0IA 4O5UA 1JZWA 4O7HA 4TXVA 1FB0A 3IC4A 3TJKA 3GKNA 2PUKC 2N5BA 1X5DA 1BQ7A 1J9BA 5GSSA 4DVCA 3L9UA 2VOCA 5J3RA 5KEJA 5CRHA 4Z2TA 2OA7A 3LWAA 22GSA 1S3AA 2DLXA 1G6YA 2H1DA 5F07A 14GSA 4TRXA 3HVVA 1Y1UA 1G7OA 3H4KA 2EC4A 1GLQA 4TOPA 2B6MA 5HFGA 3IPZA 4HUAA 3LXTA 4N0ZA 4HU9A 2VL2C 3A3TA 4HZ4A 2UZ8A 2OE3A 5IM9A 2LSTA 2J23A 3DGQA 2KHPA 3D5JA 1OC9B 1GTBA 1TRWA 4TW5A 3GL3A 4G01A 5HFIA 2R4VA 3C1RA 1HNBA 2O8VB 4BWSA 2IFQB 3QPMA 1SKRB 1TXXA 2XBQA 1XXUA 4DEJA 2E2GA 3FW2A 1VRSD 3RAZA 4EKZA 5AGYA 2YZUA 5IO2A 3ZIJA 4JBBA 3N9JA 2OT3A 1T4YA 5JCUA 3DKSA 1N2AA 1NW2A 3VI5A 1HD2A 4ZB6A 2YCDA 5B6MA 1GNEA 2TRCP 2GQMA 2H72A 2HRAA 5FT3A 3GMFA 1AW9A 2X49A 3H93A 1SD9A 5HR1A 2IMDA 3DD3A 1PA3A 1S3CA 2VIMA 1PN9A 4ILFA 1JZOA 2H19A 2AJQB 2O85A 2KUCA 2C3QA 1YEXA 1SYRA 5IMDA 1S3DA 1XWCA 2V32A 4X1UA 2VCWA 2OE1A 3KIJA 2LQQA 1GRXA 2PBJA 4PNFA 3I43A 2DKHA 1F9MA 2RUFA 3I69A 3TGZA 4YQMA 1TKDB 1TJDA 2GT6A 3J7Yb 1MD3A 3KP8A 1XPVA 3GSTA 1GTIA 5ABRA 4MP4A 2CX3A 2L5OA 2H0GA 1OVNA 4IP1A 3A5IA 2FNOA 4FQUA 2IJYA 2EIOA 1GULA 2VCZA 4NV5A 4HEA2 5A4VA 2JZSA 3LW9A 2H1LA 5ECQB 2GSRA 2H1GA 1LJRA 2JL4A 5G30A 3CSIA 2C0EA 2L6CA 1GUMA 4ISDA 5ECPB 3TKQA 3EPTA 3GFKA 1R7HA 3EINA 4MF5A 1JLWA 2UV8G 4K7NA 2F8FA 2MMZA 3F8UA 3UVHA 1BG5A 5ECHB 2VLUA 2ON7A 3CRUA 1SL2B 2H76A 1BG1A 1EV9A 3VWXA 2K8VA 4HJ2A 4BPYA 3EYTA 2G0FA 3MSZA 1OC3A 4GSSA 5FHIA 3TKSE 3F6FA 2L6DA 3PH9A 4AJ8A 4ECJA 3L9VA 1AQWA 3HVXA 4PQHA 1JZDA 1EOGA 2H6ZA 1V9WA 3VI7A 4OFTA 5CO3A 2LTKA 2A4VA 2Z9SA 4XS4A 5CNWA 3FZ5A 4I97A 2WULA 2P31A 2C0DA 2C3NA 2VLVA 4MNNA 4LMVA 1AQVA 18GSA 2FY6A 1GSYA 3HCZA 3QAGA 3Q19A 3HZ8A 1C72A 2H70A 5EL8A 2EIRA 5H5SA 3C8EA 4AGSA 3TJGA 3VPQA 1FAAA 4XHMA 1M9AA 3LYPA 2V1MA 4HS1A 2LV3A 3CTGA 4XRDA 1CQHA 3KTBA 4JR6A 2G2QA 1WJKA 1A0RP 1SYXA 4CW9A 5G1LA 1Y6EA 5HR3A 2PPTA 5GZZB 1DSBA 4TKYA 4TR1B 5GSTA 1ERWA 4GWRA 5D9TA 2VCXA 2IPAA 4AKXB 3F63A 2L57A 2FCHA 3OR5A 4OFMA 1OKTA 1Z6NA 3UBKA 2V41A 5JWRB 4BVXA 1F37A 4OFNA 5IMFA 4KNDA 1BEDA 3C7MA 13GSA 1AQXA 3KMNA 1E6BA 4KB3A 5JCGA 3CTFA 4IQAA 2QA2A 1F3AA 1GWCA 1O73A 2EIQA 1JFUA 3W6GA 5DVBA 4OWYA 1XWAA 1BX9A 1TK0B 4K5SA 1B9XC 1FVJA 1GUKA 3QR6A 4TR4A 3GTUB 2TIRA 2PWJA 3TJBA 3L78A 2WCIA 3ZFLA 4E68A 4YQVA 2H1AA 4FYUA 2MYGA 3DVWA 1A2MA 1MDKA 4KF9A 5FWGA 1WMJA 2OE0A 1EP7A 1OC9A 2AV4A 2XPDA 4MH3A 1FB6A 4P3YB 2LEGA 2IMEA 5DJLA 5KOWA 2H66A 2IFQA 3D4TA 3EMPA 4XTSA 4N10A 2YJHA 3CYNA 4QMKA 2VL3A 2GSQA 6GSUA 1HNCA 2B7KA 1QGVA 3FMWA 3M3MA 3FR3A 4AKGA 4KDUA 1ABAA 3BCKA 4DSRA 2X64A 2ALBA 2DMLA 3ME7A 3P90A 2BMXA 2L59A 1O8WA 2IMFA 1YZXA 1GSDA 1GSUA 4Z2RA 2HSMB 2DSAA 2EFEA 3LG6A 1O6JA 2E2MA 4ZIJA 3KCMA 4F2IA 5CREA 3UBLA 1G6WA 4PUFC 1XW5A 3EC3A 1GTUA 1XBSA 3IXRA 11GSA 1XCCA 5D93A 2YOIA 5DJMA 4KSMA 3L0HA 4G10A 2YWOA 2F51A 4ZILA 3TOUA 2HSYA 3IBHA 2B1LA 3KXOA 2K6VA 3IV4A 1XOBA 3KH9A 1YF0A 20GSA 2A2RA 5GAPD 4J56E 3GX0A 4KX4A 2OADA 1R5AA 3UL3A 1ZYNA 3F4SA 5F05A 2NDOA 3HYPA 1AIUA 5ECMB 1SJIA 3QD9A 4G9HA 4ECBA 3KTLA 1GNWA 1EWXA 1ML6A 1TRUA 3FZ4A 3O6TA 3GH9A 5LCZA 1GSQA 3VWWA 4CHSA 1HYUA 2YPMA 4TN8A 1O81A 5C04A 4AJ6A 2HZFA 2C8UA 2DJ0A 3AY8A 1R4WA 3DWVA 4MLYA 3LFLA 19GSA 4GXZA 5DDLA 2EFCA 1ZYQB 2HRKB 3KJYA 1H75A 3ZZXA 5J5NA 3C73A 1YDKA 1ACVA 2C3TA 2WRTA 1XIYA 4YKFA 3DRNA 4MZCA 4CDOA 1W89A 3M1GA 2RUEA 3CSJA 1QUWA 2LRCA 1SK1A 3E9JB 3QCPA 1RK4A 4TXOB 1THXA 4N0VA 8GSSA 2QSIA 1AUCA 4F0CA 5IPGA 3BOAA 2VUPA 3QAVA 2AB6A 4EF0A 1LBKA 1T1VA 2B7JA 4IS0A 1X9SB 4IP6A 4ZB9A 5IMAA 4GCIA 5G5FA 1A2JA 2VLTA 5IMVA 2HZEB 3HY2A 1K3LA 3LGCA 4YKGA 2I9HA 1EP8A 1TI1A 4ZL9A 2JU5A 1ERVA 1XW6A 3F4TA 5IIZA 1TRVA 4XS6A 1PX6A 2LUSA 3HZ4A 1E2YA 4L5OA 1X0RA 5B6NA 1W4VA 1K0BA 5F8BA 2LRNA 2WGRA 4E8EA 1GH2A 3CWGA 4JU5A 2CQ9A 4MA9A 1DUGA 1K0DA 3PPUA 4TVEA 1GSEA 5J41A 1OE8A 4EIPA 3UMAA 5ECKB 4KCAA 1PKZA 1B4PA 3RPNA 3M0FA 4Q5NA 1TTZA 2CAQA 1WE0A 4FYBA 1SVLA 1BJXA 2HI7A 5G1KA 2CT6A 4F03A 3HXSA 1SVOA 4LLRA 4ZBDA 4TR1A 4POLA 5H5QA 4KSOA 4OMVA 2HLSA 5CAXA 2CA8A 2WJUA 4I5QA 1TXUA 3LYKA 4JRRA 3WYWA 3IAS2 4HQSA 2MMOA 1EEJA 1O8XA 3D6IA 4K1FA 1KEBA 3BJ5A 5J40A 4PURA 5AN1A 1ZCPA 1YKCA 3ME8A 2L4CA 5J4YA 3E0UA 4FIWA 5KN0A 2E7PA 5E59A 4IW9A 3ZRDA 3A5WA 2HQTA 3KP9A 2R0CA 4ZL8A 1K3YA 2IWTA 5AISA 1EZKA 2ZNMA 1NM3A 3D0ZA 1BF5A 2QGVA 4IHUA 2M72A 2CVBA 2ES7A 2HT9A 1O85A 1PL1A 3FR6A 3UEMA 4OD7A 4AJ7A 2O87A 3IC8A 2A2PA 5IMCA 3GTUA 1A0FA 2CVDA 3IK9A 5COHA 5KOXA 2AUVA 3EURA 1TDIA 5EVOA 2H0HA 5D9XA 1G7EA 4Z2UA 3GH6A 5EY6A 4OO4A 1U3AA 1FG4A 5B8AA 1QFNA 1A8LA 3DIEA 2XBIA 4ICYA 3H79A 3APQA 2LRTA 4FO5A 2R6KA 4HI7A 4ZBBA 1ZYEA 2K18A 1ST9A 2MBTA 4MDCA 2PERA 1XWBA 3G7IA 3VURA 1TP9A 1A24A 4TR0A 4L0WA 4TR3A 2FA4A 1WRYA 1K0CA 3DEXA 4KUNA 4LMWA 4MZWA 2PVQA 5ENUA 3Q6OA 3O3TA 4GDFA 4EC0A 5A4WA 1R5PA 4WEYA 4Q5FA 4OO5A 3D22A 3ZYWA 3ZVJA 4L0UA 2P0GA 4MMMA 1XWGA 1DBYA 1VF1A 1B9YC 2HSMA 1DE1A 1X9WB 3ZL5A 4ZBAA 4RQRA 1K0MA 2YWMA 3SWLA 3PR8A 3A2VA 2JZRA 4N3ZA 5DAKB 4E8HA 1YVLA 2GQLA 1TK5B 1SU9A 2I4AA 2C1YA 1YY7A 5INYA 2OKAA 1BAYA 1IYIA 5IQYA 3GUSA 4Z7XA 4NV2A 4K2XA 3SBCA 2FD3A 3MDKA 3LSZA 1ZZYA 3HJPA 2YP6A 2NBSA 5D96A 3KM6A 4L5LA 3Q18A 4GLTA 1K0NA 4PGTA 2DJKA 2H71A 5IMZA 3VLNA 3TUEA 4LA1A 2GZYA 1B4QA 2HYXA 1TU7A 1SKWB 2H30A 2O7KA 4EE0A 3DMLA 1TK8B 5IO0A 2DIZA 2P5RA 1XVWA 2H75A 5KN2A 1SL1B 4HZ2A 1Z5YE 3A2WA 1F2EA 3F6DA 1TW9A 2EFHA 2B5EA 4XS1A 5JWQB 2HRKA 3TKSA 5ECLB 4HJMA 2EFDA 4MJEA 1AXDA 2R2JA 1GP1A 4CY8A 2DMMA 2A2SA 3GL5A 3KZQA 4QQ7A 3GN3A 4V2LA 5ELAA 5G2ZA 1M7TA 2LJAA 3DXBA 4BWQA 3G7YA 2HSNB 2JADA 4NMUA 4GSTA 2GZPA 2O5VA 4JR4A 1DE2A 4TXOA 3V1WA 1OKDA 4F9ZA 3ZMKA 2YANA 4BVYB 5DCHA 2MMNA 5H5RA 2BJXA 3P8WA 2GGTA 1F3BA 4DSSA 1YF1A 3EE2A 2DJ1A 3HMJG 4V1Ag 4NPBA 2AAWA 4ECIA 4K7IA 2HZEA 2H6XA 1SVMA 4NXIA 4GTUA 2GQKA 2L4QA 3ISOA 2AHEA 4JZQA 2H6YA 4EDZA 1MEKA 2YZHA 2HFDA 5JWOB 2PU9C 4POBA 3A2XA 5LNKe 3UIWA 4KAEA 1EGRA 5A1NA 5DCGA 4WETA 5HFKA 1USBA 3TKRA 1VGLA 3M9JA 4V2NA 1WP0A 3FRCA 3TDGA 2VCTA 1M2AA 3G7JA 3H1NA 3QMXA 3WT1A 2X8HA 1M99A 4G19A 4IQ1A 2AYTA 2DC5A 3DYRA 17GSA 5A5KA 5A34B 3W8JA 3E3EA 2FWFA 4O5QA 5CYYA 2VCVA 3Q74A 2WB9A 1XVQA 3G9BA 1GL8A 2OACA 2VD0A 1SK0A 4XIHA 1JHBA 4XRAA 3BD2A 3GKMA 5ECOB 1ZMAA 3TKSC 3RDWA 2FWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZL9 A;  4ZB9 A;  2N5F A;  1MD3 A;  4GCI A;  4MPG A;  5G5F A;  3GST A;  1GTI A;  2J9H A;  4WR5 A;  4MP4 A;  4EDY A;  2R3X A;  2NTO A;  1K3L A;  2FNO A;  4FQU A;  3HKR A;  4ZB8 A;  3W8S A;  6GSX A;  1GUL A;  2VCZ A;  6GST A;  1XW6 A;  5A4V A;  4J2F A;  4MK3 A;  3FY7 A;  1PX6 A;  3GSS A;  1U87 A;  5ECQ B;  4L5O A;  2GSR A;  4USS A;  4L8E A;  1LJR A;  1FHE A;  2JL4 A;  3PGT A;  4IJI A;  3CSI A;  1K0B A;  5F8B A;  6GSY A;  1GUM A;  4ISD A;  5B7C A;  4E8E A;  2V6K A;  5ECP B;  1K3O A;  1DUG A;  1K0D A;  3EIN A;  3PPU A;  4MF5 A;  1JLW A;  1GSE A;  4ID0 A;  5J41 A;  2ON5 A;  2CZ3 A;  1OE8 A;  1EEM A;  4MF6 A;  5ECI B;  2F8F A;  3UVH A;  1BG5 A;  4K0G A;  2CAI A;  5ECK B;  5ECH B;  3TOT A;  2ON7 A;  1V2A A;  2YV7 A;  3CRU A;  4PTS A;  1PKZ A;  1B4P A;  3M0F A;  4Q5N A;  2CAQ A;  2GSS A;  1EV9 A;  1PX7 A;  3VWX A;  4F03 A;  3CBU A;  3CRT A;  4HJ2 A;  2C80 A;  4YAV A;  4ZBD A;  5DQS A;  2IL3 A;  1GLP A;  1GTA A;  1MD4 A;  4GSS A;  5FHI A;  3F6F A;  4MF7 A;  4OMV A;  3RBT A;  2CA8 A;  2PGT A;  2WJU A;  1EOH A;  3LYK A;  3VPT A;  3WYW A;  5BMU A;  4PQI A;  4ECJ A;  2HNL A;  1AQW A;  1M9B A;  4PUR A;  4PQH A;  5AN1 A;  1OE7 A;  4YH2 A;  1B8X A;  1EOG A;  1YKC A;  2C4J A;  2FHE A;  5F0G A;  4OFT A;  1OYJ A;  3VI7 A;  5ECR B;  4IW9 A;  1JLV A;  1YQ1 A;  2HQT A;  3O76 A;  4I97 A;  1TU8 A;  3HJM A;  1K3Y A;  2C3N A;  5AIS A;  2GST A;  4IGJ A;  4LMV A;  1AQV A;  4IKH A;  18GS A;  1JZR A;  1GSY A;  3D0Z A;  3QAG A;  3LQ7 A;  5D9W A;  3Q19 A;  1C72 A;  5EL8 A;  3IK7 A;  4IEL A;  4Q5Q A;  3C8E A;  4AGS A;  3VPQ A;  1M9A A;  1IYH A;  3LXZ A;  3LYP A;  1PL1 A;  3CSH A;  3FR6 A;  3IE3 A;  4GF0 A;  4K0N A;  2IMK A;  3IC8 A;  3GTU A;  3VK9 A;  1A0F A;  2CVD A;  3IK9 A;  3ERF A;  3U6V A;  2D2Z A;  5ELG A;  4BL7 A;  5DAK A;  1TDI A;  2GDR A;  1Y6E A;  3NIV A;  4IBP A;  1B48 A;  5EVO A;  5D9X A;  5GZZ B;  5GST A;  1MTC A;  5D9T A;  2VCX A;  3FYG A;  3GH6 A;  5EY6 A;  3F63 A;  1XWK A;  1M0U A;  4OFM A;  1OKT A;  3UBK A;  4BVX A;  1EV4 A;  4OFN A;  12GS A;  2R6K A;  4JED A;  4HI7 A;  4ZBB A;  2VO4 A;  4MDC A;  4IVF A;  2PER A;  13GS A;  3G7I A;  1AQX A;  3KMN A;  4KDY A;  3VUR A;  1E6B A;  1K0O A;  4IQA A;  1F3A A;  4NAX A;  1K0C A;  1GWC A;  4LMW A;  3HJO A;  10GS A;  4MZW A;  2PVQ A;  2IMI A;  4PX1 A;  3O3T A;  4KDX A;  1PGT A;  4EC0 A;  5A4W A;  4Q5F A;  2VD1 A;  4ECC A;  2YV9 A;  2GTU A;  5DAL A;  4RI7 A;  6GSW A;  1BX9 A;  1XWG A;  5J4U A;  1VF1 A;  2HSM A;  4PNG A;  1GUK A;  1UA5 A;  3QR6 A;  3GTU B;  4ZBA A;  2LJR A;  1K0M A;  3LJR A;  3SWL A;  2WS2 A;  3PR8 A;  3ZFL A;  4YQV A;  4BL7 B;  5DAK B;  3UAP A;  4KF9 A;  1ZGN A;  6GSV A;  5FWG A;  4E8H A;  4O92 A;  5AIV A;  2F3M A;  1YY7 A;  5ECN B;  4Q5R A;  5F06 A;  3N5O A;  1BAY A;  1IYI A;  4YAP A;  5IQY A;  1U3I A;  3GUS A;  5AIX A;  5DJL A;  6GSS A;  3MAK A;  3R2Q A;  4WR4 A;  3ZML A;  4BVX B;  3MDK A;  4NHW A;  3ERG A;  3LSZ A;  4GSN A;  4KH7 A;  2PMT A;  3R3E A;  5D9V A;  4ZXG A;  3KM6 A;  4BVY A;  4G0K A;  3Q18 A;  2GSQ A;  4L5L A;  6GSU A;  9GSS A;  4GLT A;  1K0N A;  1VF3 A;  4PGT A;  4F0B A;  1HNC A;  1PL2 A;  16GS A;  3VLN A;  4O7H A;  1PD2 1;  1GSS A;  4KE3 A;  3M3M A;  3FR3 A;  2R5G A;  1TU7 A;  1HQO A;  4KDU A;  2X64 A;  4MPF A;  4EE0 A;  5GSS A;  5G5E A;  5KEJ A;  2VCQ A;  1BYE A;  5DAL B;  2CZ2 A;  3P90 A;  2OA7 A;  5D73 A;  22GS A;  1G6Y A;  5F07 A;  4HZ2 A;  14GS A;  1GSD A;  1F2E A;  3F6D A;  1TW9 A;  1GSU A;  1G7O A;  5ECS A;  3IR4 A;  2HSM B;  2DSA A;  1GLQ A;  4TOP A;  3LG6 A;  2HRK A;  4PUA A;  5ECL B;  3LXT A;  4KGI A;  3UBL A;  3BBY A;  1FW1 A;  1G6W A;  1AXD A;  1XW5 A;  1YJ6 A;  4HZ4 A;  2UZ8 A;  1GTU A;  2A2S A;  4QQ7 A;  3DGQ A;  11GS A;  5A4U A;  1GTB A;  5ELA A;  5DJM A;  4KSM A;  3L0H A;  3KMO A;  4G10 A;  2R4V A;  2HSN B;  3I6A A;  4GST A;  1HNB A;  4EXJ A;  3TOU A;  3IBH A;  3KXO A;  1U88 A;  3ZMK A;  5JCW A;  20GS A;  3ZFB A;  2A2R A;  4DEJ A;  3GX0 A;  4KX4 A;  2OAD A;  4BVY B;  4G0I A;  1R5A A;  3P8W A;  5AGY A;  7GSS A;  4PXO A;  1Q4J A;  5LD0 A;  1F3B A;  3M8N A;  5F05 A;  1VF4 A;  5ECM B;  3EE2 A;  3FR9 A;  4JBB A;  4G9H A;  3N9J A;  4ECB A;  1Z9H A;  3KTL A;  1GNW A;  5JCU A;  2AAW A;  4ECI A;  1N2A A;  1ML6 A;  3VI5 A;  4ZB6 A;  4GTU A;  2YCD A;  1PMT A;  5LCZ A;  1GSQ A;  4HOJ A;  4CHS A;  1GNE A;  3ISO A;  2AHE A;  4JZQ A;  1HNA A;  2HRA A;  2C8U A;  5FT3 A;  3AY8 A;  4RI6 A;  4EDZ A;  1KBN A;  3LFL A;  4NHZ A;  1AW9 A;  3QAW A;  19GS A;  4YQU A;  1NHY A;  5DDL A;  2HRK B;  4KAE A;  3KJY A;  1V40 A;  5J5N A;  3DD3 A;  5DCG A;  2GLR A;  3WD6 A;  1PA3 A;  1USB A;  5HFK A;  3UAR A;  1YDK A;  2C3T A;  2WRT A;  1PN9 A;  3FRC A;  2VCT A;  3M1G A;  3CSJ A;  3G7J A;  1VF2 A;  3H1N A;  1M99 A;  4G19 A;  4IQ1 A;  4G0L A;  2DC5 A;  3GUR A;  4ACS A;  17GS A;  5A5K A;  2C3Q A;  2VCV A;  3Q74 A;  1RK4 A;  2WB9 A;  4N0V A;  8GSS A;  2OAC A;  4F0C A;  1GUH A;  1GSF A;  2VD0 A;  2VCW A;  3QAV A;  1K0A A;  2AB6 A;  2PBJ A;  1LBK A;  4PNF A;  2WDU A;  1PKW A;  5ECO B;  4IS0 A;  3I69 A;  3TGZ A;  4YQM A; 
#chains in the Genus database with same CATH topology
 2N5F A;  2MBS A;  4EIQ A;  1AC1 A;  1I5G A;  3LEF A;  1T00 A;  1PRX A;  4EDY A;  1XOA A;  2R3X A;  3WGE A;  2NPB A;  4ZB8 A;  6GSX A;  3GX8 A;  4K6X A;  4J2F A;  1M3J A;  1UVZ A;  2K9F A;  1T7P B;  2OJL A;  1ZOF A;  3GSS A;  1U87 A;  4USS A;  1XG8 A;  2H8L A;  3ZIT A;  5B7C A;  3GHA A;  1Q98 A;  2JZT A;  1U6T A;  1PSQ A;  5GAN D;  3RPP A;  1UC7 A;  4ID0 A;  3ED3 A;  2QC7 A;  1EEM A;  3GKK A;  4MF6 A;  5ECI B;  2ZCT A;  4JE1 A;  4F82 A;  1FOV A;  4WF4 A;  4RQX A;  2YV7 A;  3IHG A;  2RLI A;  1PX7 A;  1Z3E A;  1WPI A;  3CBU A;  3CRT A;  2KLX A;  4FXY P;  4YAV A;  5DQS A;  2IL3 A;  1THO A;  1MD4 A;  5EPF A;  4MF7 A;  1XFL A;  4WF5 A;  3IA1 A;  5D8I A;  4POM A;  1EOH A;  4OCE A;  3F9U A;  2X8G A;  3WGX A;  5IPH A;  4PQI A;  2HNL A;  2YJ7 A;  5KN1 A;  1OE7 A;  3GKX A;  1I1I P;  3D4M A;  1ZYP A;  2WW2 A;  2FHE A;  4HDE A;  4GQF A;  5B8B A;  5A5H B;  3ZVJ D;  1OYJ A;  5ECR B;  2REM A;  2H73 A;  3O76 A;  2M80 A;  2X99 A;  3FHK A;  3HJM A;  3I9V 2;  4AKI A;  1WIK A;  4MH2 A;  4IGJ A;  4IKH A;  3WGD A;  1N8J A;  4MJC A;  3IK7 A;  1Z6M A;  4GQC A;  3EVI A;  5HR2 A;  3FEU A;  3IOS A;  3IE3 A;  3NZN A;  1X5E A;  4K0N A;  5DBQ A;  2IMK A;  4D73 B;  2KOK A;  4DSS B;  3K8N A;  3ERF A;  3U6V A;  2C0G A;  3FKF A;  2D2Z A;  5ELG A;  1KNG A;  5DAK A;  2HE3 A;  3C1S A;  1XZO A;  2GDR A;  4IBP A;  1B48 A;  1ON4 A;  2QKE A;  3P7X A;  1MTC A;  3UVT A;  4QL7 A;  3H8Q A;  4QL9 A;  1XWK A;  1M0U A;  3KEB A;  1SEN A;  3CHX C;  5BMU B;  2TRX A;  1QQ2 A;  4JED A;  1PQN A;  5DQY A;  5A1N B;  1J08 A;  2VL9 A;  2E0Q A;  3RHC A;  2VKZ G;  1PN0 A;  3GA4 A;  3EU3 A;  1K0O A;  3FZ9 A;  1Z7P A;  4NAX A;  3RHB A;  3HJO A;  10GS A;  3L9S A;  4PX1 A;  4K8M A;  1SD8 A;  3ZRE A;  2FWH A;  2RM5 A;  1MDJ A;  2YV9 A;  1LU4 A;  1O7U A;  4HQZ A;  5BRT A;  4I8B A;  2CV4 A;  1M2B A;  3BCI A;  2DKI A;  4PNG A;  2VM2 A;  4N11 A;  1UA5 A;  4AI6 A;  5HQP A;  2WS2 A;  5IOX A;  3ZIV A;  2YWI A;  4BL7 B;  4X4J A;  3UAP A;  2H01 A;  1TOF A;  2MMA A;  5AIV A;  4K9Z A;  1T8E B;  2F3M A;  3TB2 A;  5ECN B;  1NSW A;  4X0X A;  4Q5R A;  4LL1 B;  5F06 A;  3N5O A;  2B5Y A;  2HSN A;  5ID2 B;  3F4R A;  3MAK A;  3TRP A;  2FA8 A;  3GRX A;  2PN8 A;  4NHW A;  2I3Y A;  1M3I A;  1A2L A;  4OCF A;  3L4N A;  2O89 A;  2PMT A;  3IDV A;  2DIY A;  4BVY A;  2GS3 A;  3F0I A;  5E4W A;  9GSS A;  1VF3 A;  4F0B A;  1FVK A;  4LL4 B;  4PI0 C;  1PL2 A;  16GS A;  4WBR D;  3CXG A;  2R37 A;  2MZC A;  1PD2 1;  1GSS A;  1EGO A;  4KE3 A;  4KA0 A;  3FZA A;  2R5G A;  1HQO A;  2LJK A;  2FLS A;  4MPF A;  4I2U A;  5G5E A;  3HD5 A;  1ERU A;  2VCQ A;  1BYE A;  5C00 A;  1CQG A;  3TCO A;  5DAL B;  2CZ2 A;  5D73 A;  2N5A A;  3F3Q A;  3WT2 A;  2QA1 A;  1AAZ A;  5ECS A;  3IR4 A;  2CVK A;  2R0P A;  1RQM A;  4EL1 A;  4PUA A;  4KGI A;  3BBY A;  1FW1 A;  1YJ6 A;  2CX4 A;  2HRF A;  4G2E A;  3HA9 A;  2YNX A;  4KW6 A;  3TRQ A;  5A4U A;  3GNJ A;  3QDN A;  1TI3 A;  2B1K A;  3KMO A;  3GIX A;  3I6A A;  4XCS A;  4EXJ A;  5A34 A;  4ZL7 A;  1QMV A;  1U88 A;  3EMX A;  4FYC A;  5JCW A;  3ZFB A;  3C71 A;  4AKH A;  2FUG 2;  2OBK A;  5KN3 A;  3M9K A;  4G0I A;  4BA7 A;  3KGK A;  7GSS A;  2BTO T;  4PXO A;  1Q4J A;  1ERT A;  5LD0 A;  3M8N A;  1G0T A;  1VF4 A;  2LQO A;  3IAM 2;  2LS5 A;  3FR9 A;  1Z9H A;  2XPE A;  3F3R A;  2YN1 A;  3QOU A;  1PMT A;  4HSC X;  4HOJ A;  3HDC A;  4KCE A;  1OC8 A;  1HNA A;  1R26 A;  4RI6 A;  5J9B A;  4DSQ A;  5IOW A;  1KBN A;  4NHZ A;  4GRF A;  2I81 A;  3QAW A;  4YQU A;  4N30 A;  1NHY A;  5J4V A;  1V40 A;  2V6O A;  2VM1 A;  2B3S A;  3QFB C;  4RUV A;  1A8Y A;  2GLR A;  3WD6 A;  3UAR A;  3TJJ A;  3PIN A;  4W66 A;  1H4O A;  3IRA A;  3S9F A;  1T3B A;  3TRX A;  2C0F A;  1VF2 A;  3NOF A;  4MJA A;  4G0L A;  1UN2 A;  3GUR A;  4ACS A;  3P2A A;  2WFC A;  3KD0 A;  2NVL A;  1SJZ A;  1GUH A;  1GSF A;  2VAF A;  1WWJ A;  1T4Z A;  1K0A A;  4MZB A;  5CRW A;  3MIX A;  3EU4 A;  3TU3 B;  4EUY A;  2WDU A;  1PKW A;  3EWL A;  4NWY A;  2IN3 A;  4K7O A;  1ZL9 A;  2A4H A;  4K5R A;  4MPG A;  1MDI A;  3GYK A;  1V98 A;  2J9H A;  2XC2 A;  3VWV A;  4WR5 A;  4FH8 A;  4MJB A;  1SK2 A;  1URM A;  2LNS A;  5A5H A;  3VFI A;  2NTO A;  2DJJ A;  3HKR A;  3W8S A;  5HR0 A;  6GST A;  4MK3 A;  3FY7 A;  4O32 A;  3D21 A;  4BIK A;  4L8E A;  3APO A;  4V2M A;  1FHE A;  3PGT A;  4IJI A;  1FOH A;  1Z7R A;  3UJ1 A;  2DJ2 A;  6GSY A;  3FK8 A;  2V6K A;  2WZ9 A;  2I1U A;  1K3O A;  3J7Y k;  3MWH A;  2ON5 A;  2CZ3 A;  3US3 A;  1ILO A;  4ML1 A;  2HXK A;  1SL0 B;  3MYD A;  2ZUP A;  4D73 A;  4K0G A;  3QFA C;  2CAI A;  3TOT A;  1V2A A;  2DBC A;  4PTS A;  1TRS A;  5L71 A;  2GSS A;  3ERW A;  5J9C A;  4H86 A;  3GV1 A;  2C80 A;  3TKP A;  1GLP A;  1GTA A;  2GVP A;  3RBT A;  3CMI A;  2PGT A;  4ULX A;  3VWU A;  3VPT A;  2F8A A;  2X4A A;  2JSZ A;  4MAB A;  2KP2 A;  5BMU A;  1M9B A;  3U5R E;  4YH2 A;  1B8X A;  1SJ6 A;  2WW0 A;  3LOR A;  2C4J A;  5F0G A;  2P5Q A;  1JLV A;  2L5L A;  1YQ1 A;  1YEP A;  4IN0 A;  3MNG A;  1TU8 A;  2OBI A;  2JSY A;  4WKW A;  2H74 A;  2GST A;  4CY6 A;  1JZR A;  4EO3 A;  3LQ7 A;  5D9W A;  1RW1 A;  4IEL A;  4Q5Q A;  2DJ3 A;  1IYH A;  3LXZ A;  1QK8 A;  1X9M B;  3CSH A;  2LNT A;  2PVO C;  4GF0 A;  1NHO A;  1I9D A;  2M46 A;  3HVS A;  3VK9 A;  4V1A p;  1SKS B;  1X5C A;  5CP1 A;  1M2D A;  4A5P A;  3HVN A;  4BL7 A;  3ZLP A;  1OAZ A;  3NIV A;  3TJF A;  3UOM A;  2GZZ A;  4X43 A;  5CRG A;  2K8S A;  2HSH A;  2F9S A;  3JCM L;  1PFO A;  3FYG A;  3APS A;  1YKA A;  1A23 A;  4J57 E;  5ID2 A;  1F6M C;  3IHQ A;  2RM6 A;  1Y25 A;  1WOU A;  2YWN A;  5J47 A;  1EV4 A;  3RFR C;  1XW9 A;  12GS A;  3KH7 A;  4MCU A;  4ZB7 A;  1KTE A;  2HRN A;  2VO4 A;  4IJ3 A;  2VL2 A;  4IVF A;  1QXH A;  4KDY A;  5G31 A;  4ML6 A;  4I6X A;  4XS4 B;  4WXT A;  1J0F A;  5CRD A;  4PQ1 A;  2O3E A;  2IMI A;  2R0G A;  4KDX A;  1PGT A;  4EVM A;  2VD1 A;  4ECC A;  2GTU A;  5DAL A;  4RI7 A;  1V57 A;  4HU7 A;  2WW3 A;  6GSW A;  2XHF A;  2FWE A;  2GT5 A;  5J4U A;  2JAC A;  2FGX A;  2KP1 A;  1FO5 A;  1N25 A;  2LJR A;  3LJR A;  1V58 A;  3DVX A;  4AF2 A;  1ZGN A;  6GSV A;  4O92 A;  2B5X A;  4K2D A;  4POK A;  3HHV A;  4YAP A;  1U3I A;  3ZTL A;  5AIX A;  4I2T A;  6GSS A;  2X8C A;  3R2Q A;  4WR4 A;  2V2G A;  3ZML A;  4BVX B;  2LKU A;  3ERG A;  4GSN A;  2RII A;  4KH7 A;  4WBJ A;  3R3E A;  2H1B A;  4O5R A;  5D9V A;  4ZXG A;  2IIY A;  4G0K A;  2H0I A;  4O5U A;  1JZW A;  4O7H A;  4TXV A;  1FB0 A;  3IC4 A;  3TJK A;  3GKN A;  2PUK C;  2N5B A;  1X5D A;  1BQ7 A;  1J9B A;  5GSS A;  4DVC A;  3L9U A;  2VOC A;  5J3R A;  5KEJ A;  5CRH A;  4Z2T A;  2OA7 A;  3LWA A;  22GS A;  1S3A A;  2DLX A;  1G6Y A;  2H1D A;  5F07 A;  14GS A;  4TRX A;  3HVV A;  1Y1U A;  1G7O A;  3H4K A;  2EC4 A;  1GLQ A;  4TOP A;  2B6M A;  5HFG A;  3IPZ A;  4HUA A;  3LXT A;  4N0Z A;  4HU9 A;  2VL2 C;  3A3T A;  4HZ4 A;  2UZ8 A;  2OE3 A;  5IM9 A;  2LST A;  2J23 A;  3DGQ A;  2KHP A;  3D5J A;  1OC9 B;  1GTB A;  1TRW A;  4TW5 A;  3GL3 A;  4G01 A;  5HFI A;  2R4V A;  3C1R A;  1HNB A;  2O8V B;  4BWS A;  2IFQ B;  4PHZ C;  3QPM A;  1SKR B;  1TXX A;  2XBQ A;  1XXU A;  4DEJ A;  2E2G A;  3FW2 A;  1VRS D;  3RAZ A;  4EKZ A;  5AGY A;  2YZU A;  5IO2 A;  3ZIJ A;  4JBB A;  3N9J A;  2OT3 A;  1T4Y A;  5JCU A;  3DKS A;  1N2A A;  1NW2 A;  3VI5 A;  1HD2 A;  4ZB6 A;  2YCD A;  5B6M A;  1S3R A;  1GNE A;  2TRC P;  2GQM A;  2H72 A;  2HRA A;  5FT3 A;  3GMF A;  1AW9 A;  2X49 A;  3H93 A;  1SD9 A;  5HR1 A;  2IMD A;  3DD3 A;  1PA3 A;  1S3C A;  2VIM A;  1PN9 A;  4ILF A;  1JZO A;  2H19 A;  2AJQ B;  2O85 A;  2KUC A;  2C3Q A;  1YEX A;  1SYR A;  5IMD A;  1S3D A;  1XWC A;  2V32 A;  4X1U A;  2VCW A;  2OE1 A;  3KIJ A;  2LQQ A;  1GRX A;  2PBJ A;  4PNF A;  3I43 A;  2DKH A;  1F9M A;  2RUF A;  3I69 A;  3TGZ A;  4YQM A;  1TKD B;  1TJD A;  2GT6 A;  3J7Y b;  1MD3 A;  3KP8 A;  1XPV A;  3GST A;  1GTI A;  5ABR A;  4MP4 A;  2CX3 A;  2L5O A;  2H0G A;  1OVN A;  4IP1 A;  3A5I A;  2FNO A;  4FQU A;  2IJY A;  2EIO A;  1GUL A;  2VCZ A;  4NV5 A;  4HEA 2;  5A4V A;  2JZS A;  3LW9 A;  2H1L A;  5ECQ B;  2GSR A;  2H1G A;  1LJR A;  2JL4 A;  5G30 A;  3CSI A;  2C0E A;  2L6C A;  1GUM A;  4ISD A;  5ECP B;  3TKQ A;  3EPT A;  3GFK A;  1R7H A;  3EIN A;  4MF5 A;  1JLW A;  1YEW C;  2UV8 G;  4K7N A;  2F8F A;  2MMZ A;  3F8U A;  3UVH A;  1BG5 A;  5ECH B;  2VLU A;  2ON7 A;  3CRU A;  1SL2 B;  2H76 A;  1BG1 A;  1EV9 A;  3VWX A;  2K8V A;  4HJ2 A;  4BPY A;  3EYT A;  2G0F A;  3MSZ A;  1OC3 A;  4GSS A;  5FHI A;  3TKS E;  3F6F A;  2L6D A;  3PH9 A;  4AJ8 A;  4ECJ A;  3L9V A;  1AQW A;  3HVX A;  4PQH A;  1JZD A;  1EOG A;  2H6Z A;  2WVZ A;  1V9W A;  3VI7 A;  4OFT A;  5CO3 A;  2LTK A;  2A4V A;  2Z9S A;  4XS4 A;  5CNW A;  3FZ5 A;  4I97 A;  2WUL A;  2P31 A;  2C0D A;  2C3N A;  2VLV A;  4MNN A;  4LMV A;  1AQV A;  18GS A;  2FY6 A;  1GSY A;  3HCZ A;  3QAG A;  3Q19 A;  3HZ8 A;  1C72 A;  2H70 A;  5EL8 A;  2EIR A;  5H5S A;  3C8E A;  4AGS A;  3TJG A;  3VPQ A;  1FAA A;  4XHM A;  1M9A A;  3LYP A;  2V1M A;  4HS1 A;  2LV3 A;  3CTG A;  4XRD A;  1CQH A;  3KTB A;  4JR6 A;  2G2Q A;  1WJK A;  1A0R P;  1SYX A;  4CW9 A;  5G1L A;  1Y6E A;  5HR3 A;  2PPT A;  5GZZ B;  1DSB A;  4TKY A;  4TR1 B;  5GST A;  1ERW A;  3RGB C;  4GWR A;  5D9T A;  2VCX A;  2IPA A;  4AKX B;  3F63 A;  2L57 A;  2FCH A;  3OR5 A;  4OFM A;  1OKT A;  1Z6N A;  3UBK A;  2V41 A;  5JWR B;  4BVX A;  1F37 A;  4OFN A;  5IMF A;  4KND A;  1BED A;  3C7M A;  13GS A;  1AQX A;  3KMN A;  1E6B A;  4KB3 A;  5JCG A;  3CTF A;  4IQA A;  2QA2 A;  1F3A A;  1GWC A;  1O73 A;  2EIQ A;  1JFU A;  3W6G A;  5DVB A;  4OWY A;  1XWA A;  1BX9 A;  1TK0 B;  4K5S A;  1B9X C;  1FVJ A;  1GUK A;  3QR6 A;  4TR4 A;  3GTU B;  2TIR A;  2PWJ A;  3TJB A;  3L78 A;  2WCI A;  3ZFL A;  4E68 A;  4YQV A;  2H1A A;  4FYU A;  2MYG A;  3DVW A;  1A2M A;  1MDK A;  4KF9 A;  5FWG A;  1WMJ A;  2OE0 A;  1EP7 A;  1OC9 A;  2AV4 A;  2XPD A;  4MH3 A;  1FB6 A;  4P3Y B;  2LEG A;  2IME A;  5DJL A;  5KOW A;  2H66 A;  2IFQ A;  3D4T A;  3EMP A;  4XTS A;  4N10 A;  2YJH A;  3CYN A;  4QMK A;  2VL3 A;  2GSQ A;  6GSU A;  1HNC A;  2B7K A;  1QGV A;  3FMW A;  3M3M A;  3FR3 A;  4AKG A;  4KDU A;  1ABA A;  3BCK A;  4DSR A;  2X64 A;  2ALB A;  2DML A;  3ME7 A;  3P90 A;  2BMX A;  2L59 A;  1O8W A;  2IMF A;  1YZX A;  1GSD A;  1GSU A;  4Z2R A;  2HSM B;  2DSA A;  2EFE A;  2WVX B;  3LG6 A;  1O6J A;  2E2M A;  4ZIJ A;  3KCM A;  4F2I A;  5CRE A;  3UBL A;  1G6W A;  4PUF C;  1XW5 A;  3EC3 A;  1GTU A;  1XBS A;  3IXR A;  11GS A;  1XCC A;  5D93 A;  2YOI A;  5DJM A;  4KSM A;  3L0H A;  4G10 A;  2YWO A;  2F51 A;  4ZIL A;  3TOU A;  2HSY A;  3IBH A;  2B1L A;  3KXO A;  2K6V A;  3IV4 A;  1XOB A;  3KH9 A;  1YF0 A;  20GS A;  2A2R A;  5GAP D;  4J56 E;  3GX0 A;  4KX4 A;  2OAD A;  1R5A A;  3UL3 A;  1ZYN A;  3F4S A;  5F05 A;  2NDO A;  3HYP A;  1AIU A;  5ECM B;  1SJI A;  3QD9 A;  4G9H A;  2WW1 A;  4ECB A;  3KTL A;  1GNW A;  1EWX A;  1ML6 A;  1TRU A;  3FZ4 A;  3O6T A;  3GH9 A;  5LCZ A;  1GSQ A;  3VWW A;  4CHS A;  1HYU A;  2YPM A;  4TN8 A;  1O81 A;  5C04 A;  4AJ6 A;  2HZF A;  2C8U A;  2DJ0 A;  3AY8 A;  1R4W A;  3DWV A;  4MLY A;  3LFL A;  19GS A;  4GXZ A;  5DDL A;  2EFC A;  1ZYQ B;  2HRK B;  3KJY A;  1H75 A;  3ZZX A;  5J5N A;  3C73 A;  1YDK A;  1ACV A;  2C3T A;  2WRT A;  1XIY A;  4YKF A;  3DRN A;  4MZC A;  4CDO A;  1W89 A;  3M1G A;  2RUE A;  3CSJ A;  1QUW A;  2LRC A;  1SK1 A;  3E9J B;  3QCP A;  2WVY A;  1RK4 A;  4TXO B;  1THX A;  4N0V A;  8GSS A;  2QSI A;  1AUC A;  4F0C A;  5IPG A;  3BOA A;  2VUP A;  3QAV A;  2AB6 A;  4EF0 A;  1LBK A;  1T1V A;  2B7J A;  4IS0 A;  1X9S B;  4IP6 A;  4ZB9 A;  5IMA A;  4GCI A;  5G5F A;  1A2J A;  2VLT A;  5IMV A;  2HZE B;  3HY2 A;  1K3L A;  3LGC A;  4YKG A;  2I9H A;  1EP8 A;  1TI1 A;  4ZL9 A;  2JU5 A;  1ERV A;  1XW6 A;  3F4T A;  5IIZ A;  1TRV A;  4XS6 A;  1PX6 A;  2LUS A;  3HZ4 A;  1E2Y A;  4L5O A;  1X0R A;  5B6N A;  1W4V A;  1K0B A;  5F8B A;  2LRN A;  2WGR A;  4E8E A;  1GH2 A;  3CWG A;  4JU5 A;  2CQ9 A;  4MA9 A;  1DUG A;  1K0D A;  4PI2 C;  3PPU A;  4TVE A;  1GSE A;  5J41 A;  1OE8 A;  4EIP A;  3UMA A;  5ECK B;  4KCA A;  1PKZ A;  1B4P A;  3RPN A;  3M0F A;  4Q5N A;  1TTZ A;  2CAQ A;  1WE0 A;  4FYB A;  1SVL A;  1BJX A;  2HI7 A;  5G1K A;  2CT6 A;  4F03 A;  3HXS A;  1SVO A;  4LLR A;  4ZBD A;  4TR1 A;  4POL A;  5H5Q A;  4KSO A;  4OMV A;  2HLS A;  5CAX A;  2CA8 A;  2WJU A;  4I5Q A;  1TXU A;  3LYK A;  4JRR A;  3WYW A;  3IAS 2;  4HQS A;  2MMO A;  1EEJ A;  1O8X A;  3D6I A;  4K1F A;  1KEB A;  3BJ5 A;  5J40 A;  4PUR A;  5AN1 A;  1ZCP A;  1YKC A;  3ME8 A;  2L4C A;  5J4Y A;  3E0U A;  4FIW A;  5KN0 A;  2E7P A;  5E59 A;  4IW9 A;  3ZRD A;  3A5W A;  2HQT A;  3KP9 A;  2R0C A;  4ZL8 A;  1K3Y A;  2IWT A;  5AIS A;  1EZK A;  2ZNM A;  1NM3 A;  3D0Z A;  1BF5 A;  2QGV A;  4IHU A;  2M72 A;  2CVB A;  2ES7 A;  2HT9 A;  1O85 A;  1PL1 A;  3FR6 A;  3UEM A;  4OD7 A;  4AJ7 A;  2O87 A;  3IC8 A;  2A2P A;  5IMC A;  3GTU A;  1A0F A;  2CVD A;  3IK9 A;  5COH A;  5KOX A;  2AUV A;  3EUR A;  1TDI A;  5EVO A;  2H0H A;  5D9X A;  1G7E A;  4Z2U A;  3GH6 A;  5EY6 A;  4OO4 A;  1U3A A;  1FG4 A;  5B8A A;  1QFN A;  1A8L A;  3DIE A;  2XBI A;  1S4B P;  4ICY A;  3H79 A;  3APQ A;  2LRT A;  4FO5 A;  2R6K A;  4HI7 A;  4ZBB A;  1ZYE A;  2K18 A;  1ST9 A;  2MBT A;  4MDC A;  2PER A;  1XWB A;  3G7I A;  3VUR A;  1TP9 A;  1A24 A;  4TR0 A;  4L0W A;  4TR3 A;  2FA4 A;  1WRY A;  1K0C A;  3DEX A;  4KUN A;  4LMW A;  4MZW A;  2PVQ A;  5ENU A;  3Q6O A;  3O3T A;  4GDF A;  4EC0 A;  5A4W A;  1R5P A;  4WEY A;  4Q5F A;  4OO5 A;  3D22 A;  3ZYW A;  3ZVJ A;  4L0U A;  2P0G A;  4MMM A;  1XWG A;  1DBY A;  1VF1 A;  1B9Y C;  2HSM A;  1DE1 A;  1X9W B;  2WVX A;  3ZL5 A;  4ZBA A;  4RQR A;  1K0M A;  2YWM A;  3SWL A;  3PR8 A;  3A2V A;  2JZR A;  4N3Z A;  5DAK B;  4E8H A;  1YVL A;  2GQL A;  1TK5 B;  1SU9 A;  2I4A A;  2C1Y A;  1YY7 A;  5INY A;  2OKA A;  1BAY A;  1IYI A;  5IQY A;  3GUS A;  4Z7X A;  4NV2 A;  4K2X A;  3SBC A;  2FD3 A;  3MDK A;  3LSZ A;  1ZZY A;  3HJP A;  2YP6 A;  2NBS A;  5D96 A;  3KM6 A;  4L5L A;  3Q18 A;  4GLT A;  1K0N A;  4PGT A;  2DJK A;  2H71 A;  5IMZ A;  3VLN A;  3TUE A;  4LA1 A;  2GZY A;  1B4Q A;  2HYX A;  1TU7 A;  1SKW B;  2H30 A;  2O7K A;  4EE0 A;  3DML A;  1TK8 B;  5IO0 A;  2DIZ A;  2P5R A;  1XVW A;  2H75 A;  5KN2 A;  1SL1 B;  4HZ2 A;  1Z5Y E;  3A2W A;  1F2E A;  3F6D A;  1TW9 A;  2EFH A;  2B5E A;  4XS1 A;  5JWQ B;  2HRK A;  3TKS A;  5ECL B;  4HJM A;  2EFD A;  4MJE A;  1AXD A;  2R2J A;  1GP1 A;  4CY8 A;  2DMM A;  2A2S A;  3GL5 A;  3KZQ A;  2WZS A;  4QQ7 A;  3GN3 A;  4V2L A;  5ELA A;  5G2Z A;  1M7T A;  2LJA A;  3DXB A;  4BWQ A;  3G7Y A;  2HSN B;  2JAD A;  4NMU A;  4GST A;  2GZP A;  2O5V A;  4JR4 A;  1DE2 A;  4TXO A;  3V1W A;  1OKD A;  4F9Z A;  3ZMK A;  2YAN A;  4BVY B;  5DCH A;  2MMN A;  5H5R A;  2BJX A;  3P8W A;  2GGT A;  1F3B A;  4DSS A;  1YF1 A;  3EE2 A;  2DJ1 A;  3HMJ G;  4V1A g;  4NPB A;  2AAW A;  4ECI A;  4K7I A;  2HZE A;  2H6X A;  1SVM A;  4NXI A;  4GTU A;  2GQK A;  2L4Q A;  3ISO A;  2AHE A;  4JZQ A;  2H6Y A;  3CQF A;  4EDZ A;  1MEK A;  2YZH A;  2HFD A;  5JWO B;  2PU9 C;  4POB A;  3A2X A;  5LNK e;  3UIW A;  4KAE A;  1EGR A;  5A1N A;  2O36 A;  5DCG A;  4WET A;  5HFK A;  1USB A;  3TKR A;  1VGL A;  3M9J A;  4V2N A;  1WP0 A;  3FRC A;  3TDG A;  2VCT A;  1M2A A;  3G7J A;  3H1N A;  3QMX A;  3WT1 A;  2X8H A;  1M99 A;  4G19 A;  4IQ1 A;  2AYT A;  2DC5 A;  3DYR A;  17GS A;  5A5K A;  5A34 B;  3W8J A;  3E3E A;  2FWF A;  4O5Q A;  5CYY A;  2VCV A;  3Q74 A;  2WB9 A;  1XVQ A;  3G9B A;  1GL8 A;  2OAC A;  2VD0 A;  1SK0 A;  4XIH A;  1JHB A;  4XRA A;  3BD2 A;  3GKM A;  5ECO B;  1ZMA A;  3TKS C;  3RDW A;  2FWG A; 
#chains in the Genus database with same CATH homology
 2N5F A;  2MBS A;  4EIQ A;  1AC1 A;  1I5G A;  3LEF A;  1T00 A;  1PRX A;  4EDY A;  1XOA A;  2R3X A;  3WGE A;  2NPB A;  4ZB8 A;  6GSX A;  3GX8 A;  4K6X A;  4J2F A;  1UVZ A;  2K9F A;  1T7P B;  2OJL A;  1ZOF A;  3GSS A;  1U87 A;  4USS A;  2H8L A;  3ZIT A;  5B7C A;  3GHA A;  1Q98 A;  2JZT A;  1U6T A;  1PSQ A;  5GAN D;  3RPP A;  1UC7 A;  4ID0 A;  3ED3 A;  2QC7 A;  1EEM A;  3GKK A;  4MF6 A;  5ECI B;  2ZCT A;  4JE1 A;  4F82 A;  1FOV A;  4WF4 A;  4RQX A;  2YV7 A;  3IHG A;  2RLI A;  1PX7 A;  1Z3E A;  1WPI A;  3CBU A;  3CRT A;  2KLX A;  4YAV A;  5DQS A;  2IL3 A;  1THO A;  1MD4 A;  5EPF A;  4MF7 A;  1XFL A;  4WF5 A;  3IA1 A;  5D8I A;  4POM A;  1EOH A;  4OCE A;  3F9U A;  2X8G A;  3WGX A;  5IPH A;  4PQI A;  2HNL A;  2YJ7 A;  5KN1 A;  1OE7 A;  3GKX A;  3D4M A;  1ZYP A;  2FHE A;  4HDE A;  4GQF A;  5B8B A;  5A5H B;  3ZVJ D;  1OYJ A;  5ECR B;  2REM A;  2H73 A;  3O76 A;  2M80 A;  2X99 A;  3FHK A;  3HJM A;  3I9V 2;  4AKI A;  1WIK A;  4MH2 A;  4IGJ A;  4IKH A;  3WGD A;  1N8J A;  4MJC A;  3IK7 A;  1Z6M A;  4GQC A;  3EVI A;  5HR2 A;  3FEU A;  3IOS A;  3IE3 A;  3NZN A;  1X5E A;  4K0N A;  5DBQ A;  2IMK A;  4D73 B;  2KOK A;  4DSS B;  3K8N A;  3ERF A;  3U6V A;  2C0G A;  3FKF A;  2D2Z A;  5ELG A;  1KNG A;  5DAK A;  2HE3 A;  3C1S A;  1XZO A;  2GDR A;  4IBP A;  1B48 A;  1ON4 A;  2QKE A;  3P7X A;  1MTC A;  3UVT A;  4QL7 A;  3H8Q A;  4QL9 A;  1XWK A;  1M0U A;  3KEB A;  1SEN A;  5BMU B;  2TRX A;  1QQ2 A;  4JED A;  1PQN A;  5DQY A;  5A1N B;  1J08 A;  2VL9 A;  2E0Q A;  3RHC A;  2VKZ G;  1PN0 A;  3GA4 A;  3EU3 A;  1K0O A;  3FZ9 A;  1Z7P A;  4NAX A;  3RHB A;  3HJO A;  10GS A;  3L9S A;  4PX1 A;  4K8M A;  1SD8 A;  3ZRE A;  2FWH A;  2RM5 A;  1MDJ A;  2YV9 A;  1LU4 A;  1O7U A;  4HQZ A;  5BRT A;  4I8B A;  2CV4 A;  1M2B A;  3BCI A;  2DKI A;  4PNG A;  2VM2 A;  4N11 A;  1UA5 A;  4AI6 A;  5HQP A;  2WS2 A;  5IOX A;  3ZIV A;  2YWI A;  4BL7 B;  4X4J A;  3UAP A;  2H01 A;  1TOF A;  2MMA A;  5AIV A;  4K9Z A;  1T8E B;  2F3M A;  3TB2 A;  5ECN B;  1NSW A;  4X0X A;  4Q5R A;  4LL1 B;  5F06 A;  3N5O A;  2B5Y A;  2HSN A;  5ID2 B;  3F4R A;  3MAK A;  3TRP A;  2FA8 A;  3GRX A;  2PN8 A;  4NHW A;  2I3Y A;  1A2L A;  4OCF A;  3L4N A;  2O89 A;  2PMT A;  3IDV A;  2DIY A;  4BVY A;  2GS3 A;  3F0I A;  5E4W A;  9GSS A;  1VF3 A;  4F0B A;  1FVK A;  4LL4 B;  1PL2 A;  16GS A;  4WBR D;  3CXG A;  2R37 A;  2MZC A;  1PD2 1;  1GSS A;  1EGO A;  4KE3 A;  4KA0 A;  3FZA A;  2R5G A;  1HQO A;  2LJK A;  2FLS A;  4MPF A;  4I2U A;  5G5E A;  3HD5 A;  1ERU A;  2VCQ A;  1BYE A;  5C00 A;  1CQG A;  3TCO A;  5DAL B;  2CZ2 A;  5D73 A;  2N5A A;  3F3Q A;  3WT2 A;  2QA1 A;  1AAZ A;  5ECS A;  3IR4 A;  2CVK A;  2R0P A;  1RQM A;  4EL1 A;  4PUA A;  4KGI A;  3BBY A;  1FW1 A;  1YJ6 A;  2CX4 A;  2HRF A;  4G2E A;  3HA9 A;  2YNX A;  4KW6 A;  3TRQ A;  5A4U A;  3GNJ A;  3QDN A;  1TI3 A;  2B1K A;  3KMO A;  3GIX A;  3I6A A;  4XCS A;  4EXJ A;  5A34 A;  4ZL7 A;  1QMV A;  1U88 A;  3EMX A;  4FYC A;  5JCW A;  3ZFB A;  3C71 A;  4AKH A;  2FUG 2;  2OBK A;  5KN3 A;  3M9K A;  4G0I A;  4BA7 A;  3KGK A;  7GSS A;  2BTO T;  4PXO A;  1Q4J A;  1ERT A;  5LD0 A;  3M8N A;  1G0T A;  1VF4 A;  2LQO A;  3IAM 2;  2LS5 A;  3FR9 A;  1Z9H A;  2XPE A;  3F3R A;  2YN1 A;  3QOU A;  1PMT A;  4HOJ A;  3HDC A;  4KCE A;  1OC8 A;  1HNA A;  1R26 A;  4RI6 A;  5J9B A;  4DSQ A;  5IOW A;  1KBN A;  4NHZ A;  4GRF A;  2I81 A;  3QAW A;  4YQU A;  4N30 A;  1NHY A;  5J4V A;  1V40 A;  2V6O A;  2VM1 A;  2B3S A;  3QFB C;  4RUV A;  1A8Y A;  2GLR A;  3WD6 A;  3UAR A;  3TJJ A;  3PIN A;  4W66 A;  1H4O A;  3IRA A;  3S9F A;  1T3B A;  3TRX A;  2C0F A;  1VF2 A;  3NOF A;  4MJA A;  4G0L A;  1UN2 A;  3GUR A;  4ACS A;  3P2A A;  2WFC A;  3KD0 A;  2NVL A;  1SJZ A;  1GUH A;  1GSF A;  2VAF A;  1WWJ A;  1T4Z A;  1K0A A;  4MZB A;  5CRW A;  3MIX A;  3EU4 A;  3TU3 B;  4EUY A;  2WDU A;  1PKW A;  3EWL A;  4NWY A;  2IN3 A;  4K7O A;  1ZL9 A;  2A4H A;  4K5R A;  4MPG A;  1MDI A;  3GYK A;  1V98 A;  2J9H A;  2XC2 A;  3VWV A;  4WR5 A;  4FH8 A;  4MJB A;  1SK2 A;  1URM A;  2LNS A;  5A5H A;  3VFI A;  2NTO A;  2DJJ A;  3HKR A;  3W8S A;  5HR0 A;  6GST A;  4MK3 A;  3FY7 A;  4O32 A;  3D21 A;  4L8E A;  3APO A;  4V2M A;  1FHE A;  3PGT A;  4IJI A;  1FOH A;  1Z7R A;  3UJ1 A;  2DJ2 A;  6GSY A;  3FK8 A;  2V6K A;  2WZ9 A;  2I1U A;  1K3O A;  3J7Y k;  3MWH A;  2ON5 A;  2CZ3 A;  3US3 A;  1ILO A;  4ML1 A;  2HXK A;  1SL0 B;  3MYD A;  2ZUP A;  4D73 A;  4K0G A;  3QFA C;  2CAI A;  3TOT A;  1V2A A;  2DBC A;  4PTS A;  1TRS A;  5L71 A;  2GSS A;  3ERW A;  5J9C A;  4H86 A;  3GV1 A;  2C80 A;  3TKP A;  1GLP A;  1GTA A;  2GVP A;  3RBT A;  3CMI A;  2PGT A;  4ULX A;  3VWU A;  3VPT A;  2F8A A;  2X4A A;  2JSZ A;  4MAB A;  2KP2 A;  5BMU A;  1M9B A;  3U5R E;  4YH2 A;  1B8X A;  1SJ6 A;  3LOR A;  2C4J A;  5F0G A;  2P5Q A;  1JLV A;  2L5L A;  1YQ1 A;  1YEP A;  4IN0 A;  3MNG A;  1TU8 A;  2OBI A;  2JSY A;  4WKW A;  2H74 A;  2GST A;  4CY6 A;  1JZR A;  4EO3 A;  3LQ7 A;  5D9W A;  1RW1 A;  4IEL A;  4Q5Q A;  2DJ3 A;  1IYH A;  3LXZ A;  1QK8 A;  1X9M B;  3CSH A;  2LNT A;  2PVO C;  4GF0 A;  1NHO A;  1I9D A;  2M46 A;  3HVS A;  3VK9 A;  4V1A p;  1SKS B;  1X5C A;  5CP1 A;  1M2D A;  4A5P A;  4BL7 A;  3ZLP A;  1OAZ A;  3NIV A;  3TJF A;  3UOM A;  2GZZ A;  4X43 A;  5CRG A;  2K8S A;  2HSH A;  2F9S A;  3JCM L;  3FYG A;  3APS A;  1YKA A;  1A23 A;  4J57 E;  5ID2 A;  1F6M C;  3IHQ A;  2RM6 A;  1Y25 A;  1WOU A;  2YWN A;  5J47 A;  1EV4 A;  1XW9 A;  12GS A;  3KH7 A;  4MCU A;  4ZB7 A;  1KTE A;  2HRN A;  2VO4 A;  4IJ3 A;  2VL2 A;  4IVF A;  1QXH A;  4KDY A;  5G31 A;  4ML6 A;  4I6X A;  4XS4 B;  4WXT A;  1J0F A;  5CRD A;  4PQ1 A;  2IMI A;  2R0G A;  4KDX A;  1PGT A;  4EVM A;  2VD1 A;  4ECC A;  2GTU A;  5DAL A;  4RI7 A;  1V57 A;  4HU7 A;  6GSW A;  2XHF A;  2FWE A;  2GT5 A;  5J4U A;  2JAC A;  2FGX A;  2KP1 A;  1FO5 A;  1N25 A;  2LJR A;  3LJR A;  1V58 A;  3DVX A;  4AF2 A;  1ZGN A;  6GSV A;  4O92 A;  2B5X A;  4K2D A;  4POK A;  3HHV A;  4YAP A;  1U3I A;  3ZTL A;  5AIX A;  4I2T A;  6GSS A;  2X8C A;  3R2Q A;  4WR4 A;  2V2G A;  3ZML A;  4BVX B;  2LKU A;  3ERG A;  4GSN A;  2RII A;  4KH7 A;  4WBJ A;  3R3E A;  2H1B A;  4O5R A;  5D9V A;  4ZXG A;  2IIY A;  4G0K A;  2H0I A;  4O5U A;  1JZW A;  4O7H A;  4TXV A;  1FB0 A;  3IC4 A;  3TJK A;  3GKN A;  2PUK C;  2N5B A;  1X5D A;  1BQ7 A;  1J9B A;  5GSS A;  4DVC A;  3L9U A;  2VOC A;  5J3R A;  5KEJ A;  5CRH A;  4Z2T A;  2OA7 A;  3LWA A;  22GS A;  1S3A A;  2DLX A;  1G6Y A;  2H1D A;  5F07 A;  14GS A;  4TRX A;  3HVV A;  1Y1U A;  1G7O A;  3H4K A;  2EC4 A;  1GLQ A;  4TOP A;  2B6M A;  5HFG A;  3IPZ A;  4HUA A;  3LXT A;  4N0Z A;  4HU9 A;  2VL2 C;  3A3T A;  4HZ4 A;  2UZ8 A;  2OE3 A;  5IM9 A;  2LST A;  2J23 A;  3DGQ A;  2KHP A;  3D5J A;  1OC9 B;  1GTB A;  1TRW A;  4TW5 A;  3GL3 A;  4G01 A;  5HFI A;  2R4V A;  3C1R A;  1HNB A;  2O8V B;  4BWS A;  2IFQ B;  3QPM A;  1SKR B;  1TXX A;  2XBQ A;  1XXU A;  4DEJ A;  2E2G A;  3FW2 A;  1VRS D;  3RAZ A;  4EKZ A;  5AGY A;  2YZU A;  5IO2 A;  3ZIJ A;  4JBB A;  3N9J A;  2OT3 A;  1T4Y A;  5JCU A;  3DKS A;  1N2A A;  1NW2 A;  3VI5 A;  1HD2 A;  4ZB6 A;  2YCD A;  5B6M A;  1GNE A;  2TRC P;  2GQM A;  2H72 A;  2HRA A;  5FT3 A;  3GMF A;  1AW9 A;  2X49 A;  3H93 A;  1SD9 A;  5HR1 A;  2IMD A;  3DD3 A;  1PA3 A;  1S3C A;  2VIM A;  1PN9 A;  4ILF A;  1JZO A;  2H19 A;  2AJQ B;  2O85 A;  2KUC A;  2C3Q A;  1YEX A;  1SYR A;  5IMD A;  1S3D A;  1XWC A;  2V32 A;  4X1U A;  2VCW A;  2OE1 A;  3KIJ A;  2LQQ A;  1GRX A;  2PBJ A;  4PNF A;  3I43 A;  2DKH A;  1F9M A;  2RUF A;  3I69 A;  3TGZ A;  4YQM A;  1TKD B;  1TJD A;  2GT6 A;  3J7Y b;  1MD3 A;  3KP8 A;  1XPV A;  3GST A;  1GTI A;  5ABR A;  4MP4 A;  2CX3 A;  2L5O A;  2H0G A;  1OVN A;  4IP1 A;  3A5I A;  2FNO A;  4FQU A;  2IJY A;  2EIO A;  1GUL A;  2VCZ A;  4NV5 A;  4HEA 2;  5A4V A;  2JZS A;  3LW9 A;  2H1L A;  5ECQ B;  2GSR A;  2H1G A;  1LJR A;  2JL4 A;  5G30 A;  3CSI A;  2C0E A;  2L6C A;  1GUM A;  4ISD A;  5ECP B;  3TKQ A;  3EPT A;  3GFK A;  1R7H A;  3EIN A;  4MF5 A;  1JLW A;  2UV8 G;  4K7N A;  2F8F A;  2MMZ A;  3F8U A;  3UVH A;  1BG5 A;  5ECH B;  2VLU A;  2ON7 A;  3CRU A;  1SL2 B;  2H76 A;  1BG1 A;  1EV9 A;  3VWX A;  2K8V A;  4HJ2 A;  4BPY A;  3EYT A;  2G0F A;  3MSZ A;  1OC3 A;  4GSS A;  5FHI A;  3TKS E;  3F6F A;  2L6D A;  3PH9 A;  4AJ8 A;  4ECJ A;  3L9V A;  1AQW A;  3HVX A;  4PQH A;  1JZD A;  1EOG A;  2H6Z A;  1V9W A;  3VI7 A;  4OFT A;  5CO3 A;  2LTK A;  2A4V A;  2Z9S A;  4XS4 A;  5CNW A;  3FZ5 A;  4I97 A;  2WUL A;  2P31 A;  2C0D A;  2C3N A;  2VLV A;  4MNN A;  4LMV A;  1AQV A;  18GS A;  2FY6 A;  1GSY A;  3HCZ A;  3QAG A;  3Q19 A;  3HZ8 A;  1C72 A;  2H70 A;  5EL8 A;  2EIR A;  5H5S A;  3C8E A;  4AGS A;  3TJG A;  3VPQ A;  1FAA A;  4XHM A;  1M9A A;  3LYP A;  2V1M A;  4HS1 A;  2LV3 A;  3CTG A;  4XRD A;  1CQH A;  3KTB A;  4JR6 A;  2G2Q A;  1WJK A;  1A0R P;  1SYX A;  4CW9 A;  5G1L A;  1Y6E A;  5HR3 A;  2PPT A;  5GZZ B;  1DSB A;  4TKY A;  4TR1 B;  5GST A;  1ERW A;  4GWR A;  5D9T A;  2VCX A;  2IPA A;  4AKX B;  3F63 A;  2L57 A;  2FCH A;  3OR5 A;  4OFM A;  1OKT A;  1Z6N A;  3UBK A;  2V41 A;  5JWR B;  4BVX A;  1F37 A;  4OFN A;  5IMF A;  4KND A;  1BED A;  3C7M A;  13GS A;  1AQX A;  3KMN A;  1E6B A;  4KB3 A;  5JCG A;  3CTF A;  4IQA A;  2QA2 A;  1F3A A;  1GWC A;  1O73 A;  2EIQ A;  1JFU A;  3W6G A;  5DVB A;  4OWY A;  1XWA A;  1BX9 A;  1TK0 B;  4K5S A;  1B9X C;  1FVJ A;  1GUK A;  3QR6 A;  4TR4 A;  3GTU B;  2TIR A;  2PWJ A;  3TJB A;  3L78 A;  2WCI A;  3ZFL A;  4E68 A;  4YQV A;  2H1A A;  4FYU A;  2MYG A;  3DVW A;  1A2M A;  1MDK A;  4KF9 A;  5FWG A;  1WMJ A;  2OE0 A;  1EP7 A;  1OC9 A;  2AV4 A;  2XPD A;  4MH3 A;  1FB6 A;  4P3Y B;  2LEG A;  2IME A;  5DJL A;  5KOW A;  2H66 A;  2IFQ A;  3D4T A;  3EMP A;  4XTS A;  4N10 A;  2YJH A;  3CYN A;  4QMK A;  2VL3 A;  2GSQ A;  6GSU A;  1HNC A;  2B7K A;  1QGV A;  3FMW A;  3M3M A;  3FR3 A;  4AKG A;  4KDU A;  1ABA A;  3BCK A;  4DSR A;  2X64 A;  2ALB A;  2DML A;  3ME7 A;  3P90 A;  2BMX A;  2L59 A;  1O8W A;  2IMF A;  1YZX A;  1GSD A;  1GSU A;  4Z2R A;  2HSM B;  2DSA A;  2EFE A;  3LG6 A;  1O6J A;  2E2M A;  4ZIJ A;  3KCM A;  4F2I A;  5CRE A;  3UBL A;  1G6W A;  4PUF C;  1XW5 A;  3EC3 A;  1GTU A;  1XBS A;  3IXR A;  11GS A;  1XCC A;  5D93 A;  2YOI A;  5DJM A;  4KSM A;  3L0H A;  4G10 A;  2YWO A;  2F51 A;  4ZIL A;  3TOU A;  2HSY A;  3IBH A;  2B1L A;  3KXO A;  2K6V A;  3IV4 A;  1XOB A;  3KH9 A;  1YF0 A;  20GS A;  2A2R A;  5GAP D;  4J56 E;  3GX0 A;  4KX4 A;  2OAD A;  1R5A A;  3UL3 A;  1ZYN A;  3F4S A;  5F05 A;  2NDO A;  3HYP A;  1AIU A;  5ECM B;  1SJI A;  3QD9 A;  4G9H A;  4ECB A;  3KTL A;  1GNW A;  1EWX A;  1ML6 A;  1TRU A;  3FZ4 A;  3O6T A;  3GH9 A;  5LCZ A;  1GSQ A;  3VWW A;  4CHS A;  1HYU A;  2YPM A;  4TN8 A;  1O81 A;  5C04 A;  4AJ6 A;  2HZF A;  2C8U A;  2DJ0 A;  3AY8 A;  1R4W A;  3DWV A;  4MLY A;  3LFL A;  19GS A;  4GXZ A;  5DDL A;  2EFC A;  1ZYQ B;  2HRK B;  3KJY A;  1H75 A;  3ZZX A;  5J5N A;  3C73 A;  1YDK A;  1ACV A;  2C3T A;  2WRT A;  1XIY A;  4YKF A;  3DRN A;  4MZC A;  4CDO A;  1W89 A;  3M1G A;  2RUE A;  3CSJ A;  1QUW A;  2LRC A;  1SK1 A;  3E9J B;  3QCP A;  1RK4 A;  4TXO B;  1THX A;  4N0V A;  8GSS A;  2QSI A;  1AUC A;  4F0C A;  5IPG A;  3BOA A;  2VUP A;  3QAV A;  2AB6 A;  4EF0 A;  1LBK A;  1T1V A;  2B7J A;  4IS0 A;  1X9S B;  4IP6 A;  4ZB9 A;  5IMA A;  4GCI A;  5G5F A;  1A2J A;  2VLT A;  5IMV A;  2HZE B;  3HY2 A;  1K3L A;  3LGC A;  4YKG A;  2I9H A;  1EP8 A;  1TI1 A;  4ZL9 A;  2JU5 A;  1ERV A;  1XW6 A;  3F4T A;  5IIZ A;  1TRV A;  4XS6 A;  1PX6 A;  2LUS A;  3HZ4 A;  1E2Y A;  4L5O A;  1X0R A;  5B6N A;  1W4V A;  1K0B A;  5F8B A;  2LRN A;  2WGR A;  4E8E A;  1GH2 A;  3CWG A;  4JU5 A;  2CQ9 A;  4MA9 A;  1DUG A;  1K0D A;  3PPU A;  4TVE A;  1GSE A;  5J41 A;  1OE8 A;  4EIP A;  3UMA A;  5ECK B;  4KCA A;  1PKZ A;  1B4P A;  3RPN A;  3M0F A;  4Q5N A;  1TTZ A;  2CAQ A;  1WE0 A;  4FYB A;  1SVL A;  1BJX A;  2HI7 A;  5G1K A;  2CT6 A;  4F03 A;  3HXS A;  1SVO A;  4LLR A;  4ZBD A;  4TR1 A;  4POL A;  5H5Q A;  4KSO A;  4OMV A;  2HLS A;  5CAX A;  2CA8 A;  2WJU A;  4I5Q A;  1TXU A;  3LYK A;  4JRR A;  3WYW A;  3IAS 2;  4HQS A;  2MMO A;  1EEJ A;  1O8X A;  3D6I A;  4K1F A;  1KEB A;  3BJ5 A;  5J40 A;  4PUR A;  5AN1 A;  1ZCP A;  1YKC A;  3ME8 A;  2L4C A;  5J4Y A;  3E0U A;  4FIW A;  5KN0 A;  2E7P A;  5E59 A;  4IW9 A;  3ZRD A;  3A5W A;  2HQT A;  3KP9 A;  2R0C A;  4ZL8 A;  1K3Y A;  2IWT A;  5AIS A;  1EZK A;  2ZNM A;  1NM3 A;  3D0Z A;  1BF5 A;  2QGV A;  4IHU A;  2M72 A;  2CVB A;  2ES7 A;  2HT9 A;  1O85 A;  1PL1 A;  3FR6 A;  3UEM A;  4OD7 A;  4AJ7 A;  2O87 A;  3IC8 A;  2A2P A;  5IMC A;  3GTU A;  1A0F A;  2CVD A;  3IK9 A;  5COH A;  5KOX A;  2AUV A;  3EUR A;  1TDI A;  5EVO A;  2H0H A;  5D9X A;  1G7E A;  4Z2U A;  3GH6 A;  5EY6 A;  4OO4 A;  1U3A A;  1FG4 A;  5B8A A;  1QFN A;  1A8L A;  3DIE A;  2XBI A;  4ICY A;  3H79 A;  3APQ A;  2LRT A;  4FO5 A;  2R6K A;  4HI7 A;  4ZBB A;  1ZYE A;  2K18 A;  1ST9 A;  2MBT A;  4MDC A;  2PER A;  1XWB A;  3G7I A;  3VUR A;  1TP9 A;  1A24 A;  4TR0 A;  4L0W A;  4TR3 A;  2FA4 A;  1WRY A;  1K0C A;  3DEX A;  4KUN A;  4LMW A;  4MZW A;  2PVQ A;  5ENU A;  3Q6O A;  3O3T A;  4GDF A;  4EC0 A;  5A4W A;  1R5P A;  4WEY A;  4Q5F A;  4OO5 A;  3D22 A;  3ZYW A;  3ZVJ A;  4L0U A;  2P0G A;  4MMM A;  1XWG A;  1DBY A;  1VF1 A;  1B9Y C;  2HSM A;  1DE1 A;  1X9W B;  3ZL5 A;  4ZBA A;  4RQR A;  1K0M A;  2YWM A;  3SWL A;  3PR8 A;  3A2V A;  2JZR A;  4N3Z A;  5DAK B;  4E8H A;  1YVL A;  2GQL A;  1TK5 B;  1SU9 A;  2I4A A;  2C1Y A;  1YY7 A;  5INY A;  2OKA A;  1BAY A;  1IYI A;  5IQY A;  3GUS A;  4Z7X A;  4NV2 A;  4K2X A;  3SBC A;  2FD3 A;  3MDK A;  3LSZ A;  1ZZY A;  3HJP A;  2YP6 A;  2NBS A;  5D96 A;  3KM6 A;  4L5L A;  3Q18 A;  4GLT A;  1K0N A;  4PGT A;  2DJK A;  2H71 A;  5IMZ A;  3VLN A;  3TUE A;  4LA1 A;  2GZY A;  1B4Q A;  2HYX A;  1TU7 A;  1SKW B;  2H30 A;  2O7K A;  4EE0 A;  3DML A;  1TK8 B;  5IO0 A;  2DIZ A;  2P5R A;  1XVW A;  2H75 A;  5KN2 A;  1SL1 B;  4HZ2 A;  1Z5Y E;  3A2W A;  1F2E A;  3F6D A;  1TW9 A;  2EFH A;  2B5E A;  4XS1 A;  5JWQ B;  2HRK A;  3TKS A;  5ECL B;  4HJM A;  2EFD A;  4MJE A;  1AXD A;  2R2J A;  1GP1 A;  4CY8 A;  2DMM A;  2A2S A;  3GL5 A;  3KZQ A;  4QQ7 A;  3GN3 A;  4V2L A;  5ELA A;  5G2Z A;  1M7T A;  2LJA A;  3DXB A;  4BWQ A;  3G7Y A;  2HSN B;  2JAD A;  4NMU A;  4GST A;  2GZP A;  2O5V A;  4JR4 A;  1DE2 A;  4TXO A;  3V1W A;  1OKD A;  4F9Z A;  3ZMK A;  2YAN A;  4BVY B;  5DCH A;  2MMN A;  5H5R A;  2BJX A;  3P8W A;  2GGT A;  1F3B A;  4DSS A;  1YF1 A;  3EE2 A;  2DJ1 A;  3HMJ G;  4V1A g;  4NPB A;  2AAW A;  4ECI A;  4K7I A;  2HZE A;  2H6X A;  1SVM A;  4NXI A;  4GTU A;  2GQK A;  2L4Q A;  3ISO A;  2AHE A;  4JZQ A;  2H6Y A;  4EDZ A;  1MEK A;  2YZH A;  2HFD A;  5JWO B;  2PU9 C;  4POB A;  3A2X A;  5LNK e;  3UIW A;  4KAE A;  1EGR A;  5A1N A;  5DCG A;  4WET A;  5HFK A;  1USB A;  3TKR A;  1VGL A;  3M9J A;  4V2N A;  1WP0 A;  3FRC A;  3TDG A;  2VCT A;  1M2A A;  3G7J A;  3H1N A;  3QMX A;  3WT1 A;  2X8H A;  1M99 A;  4G19 A;  4IQ1 A;  2AYT A;  2DC5 A;  3DYR A;  17GS A;  5A5K A;  5A34 B;  3W8J A;  3E3E A;  2FWF A;  4O5Q A;  5CYY A;  2VCV A;  3Q74 A;  2WB9 A;  1XVQ A;  3G9B A;  1GL8 A;  2OAC A;  2VD0 A;  1SK0 A;  4XIH A;  1JHB A;  4XRA A;  3BD2 A;  3GKM A;  5ECO B;  1ZMA A;  3TKS C;  3RDW A;  2FWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...