5ECPB

Crystal structure of fin219-fip1 complex with ja, met and atp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transferase
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 66
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecpB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecpB01
1NHYA 3BOAA 3SBCA 1Q98A 4K7NA 5GZZB 1S3AA 1X9WB 3ZREA 5B6NA 1GLPA 2RUFA 1TXXA 1HD2A 2G2QA 4V2LA 1I5GA 5G2ZA 18GSA 2P0GA 3ZRDA 1EEMA 1C72A 1FG4A 1GSEA 1AXDA 3APQA 5G30A 3LG6A 5KN1A 4XIHA 2E0QA 5E4WA 1TP9A 2F3MA 4OFMA 4MPGA 3HY2A 5ENUA 5G1LA 1SL1B 3TOUA 4TVEA 5AGYA 4MZCA 2R3XA 5F05A 1ZYEA 4V1Ag 1TK8B 1JHBA 4NMUA 2PERA 1V57A 3ISOA 5E59A 5C00A 2MMNA 1DBYA 2OBKA 4ZL7A 3HVVA 4J2FA 2DJ2A 5INYA 4ZBDA 3E3EA 1OE8A 2EIQA 4I97A 2H1AA 5IPHA 2C1YA 4G0KA 7GSSA 2B5YA 2C8UA 4NHWA 5FHIA 1JZDA 2KUCA 1B48A 1GNEA 2HZFA 1PX6A 4MCUA 1EV9A 3KTBA 2HSYA 2C0FA 4FYUA 4PGTA 2KOKA 2LNSA 1Q4JA 2BJXA 3GKKA 2EIRA 1FHEA 2E2MA 2CX3A 1XOBA 4K6XA 1GSQA 3SWLA 4EF0A 3UBLA 4KX4A 3QD9A 1OC3A 4PNGA 4ZXGA 1K0OA 1MEKA 5CRHA 1AQVA 4GTUA 5DCHA 4OFNA 1FW1A 2DIZA 3GX0A 4IGJA 2NBSA 2VO4A 4XTSA 5ECOB 1TDIA 3VI5A 1F2EA 1QXHA 5DAKB 2GT5A 2VM2A 2B3SA 3GHAA 2WCIA 5DQYA 1A8YA 3J7Yk 4IW9A 3FKFA 1SJ6A 3CRUA 2I3YA 2I1UA 1O85A 1TW9A 4IS0A 3APSA 4IVFA 5CAXA 4TR0A 3HZ4A 5ECLB 3ZMKA 5BMUA 3W8SA 3VWXA 5J5NA 4NHZA 5H5RA 3ZYWA 2MZCA 4K1FA 1S3CA 3FR6A 1GSUA 2JZRA 1GSYA 4MPFA 1U6TA 2K9FA 2IMEA 1ABAA 2AUVA 1N2AA 1WOUA 1SU9A 3HYPA 4F03A 2CVKA 2K18A 4LA1A 2C3NA 1UA5A 5IM9A 1M99A 2DBCA 2CV4A 4EDYA 1FVJA 1OC8A 1AC1A 1RQMA 1A2MA 2VL3A 5D96A 4MK3A 1G6YA 5F07A 3DKSA 5IPGA 3ZL5A 1EOGA 5IMVA 4BA7A 4GQCA 3DVXA 3UVHA 1GUMA 3HJPA 1T00A 1XFLA 3LJRA 2C3TA 2IMKA 3O3TA 4MJAA 2FWEA 2DJKA 1XWKA 16GSA 4V2MA 2AV4A 1GTBA 2C80A 3EMPA 5B6MA 2HZEB 2VL2A 2VM1A 1ZCPA 5HR1A 1XZOA 4E8HA 3DVWA 3IOSA 1K0MA 2HLSA 1GSDA 1USBA 1T8EB 2R4VA 3ZIJA 1AQWA 2OE1A 1ON4A 5D9WA 3DYRA 3FYGA 3D4MA 1HQOA 1OKTA 2AJQB 3VPQA 3R2QA 3LYKA 2FHEA 2XPEA 3FZAA 3QPMA 3KJYA 2MBTA 5CRGA 4Q5NA 1XIYA 1MDIA 4OFTA 5JCUA 1PKWA 4AJ6A 3U6VA 4PURA 2L57A 2CVBA 2H01A 2L59A 1FO5A 1SKRB 5ID2A 3IC4A 4KCEA 1XW9A 2CA8A 6GSXA 3IBHA 3L78A 3C73A 3QFAC 2QGVA 3F6DA 4ML1A 3EC3A 4AJ8A 3PGTA 5CO3A 1SKWB 3EURA 3O6TA 3J7Yb 4BWQA 4POKA 3CYNA 1THXA 2OACA 1ZZYA 1PL1A 2LEGA 2OBIA 2P31A 2TRXA 2XBIA 2M80A 1XBSA 3F9UA 2BTOT 5DJMA 3DIEA 3LQ7A 1JZWA 1RW1A 2H72A 1ERVA 8GSSA 3CSHA 3ZIVA 4F0BA 5DAKA 5ECKB 4MZBA 1PN9A 2ZUPA 5IQYA 2F51A 1O81A 2OADA 1K0DA 3GRXA 1W4VA 5IOWA 1M0UA 2H0IA 1F3AA 2GSRA 2X8GA 4MJCA 4AGSA 3GKXA 2QKEA 2UZ8A 5G5EA 2VLTA 2FWFA 3KH7A 3TKSE 3UOMA 4ZBAA 1JZRA 2PMTA 2HFDA 3KM6A 3DGQA 3VWVA 1ZYQB 3TJFA 2HSHA 2GSSA 3TB2A 2J23A 2FWHA 4WETA 3EU4A 3DWVA 1CQHA 1I9DA 4FYBA 1PQNA 5AN1A 3V1WA 3CTGA 1BEDA 1R5AA 5ABRA 19GSA 5A4UA 1TJDA 3N5OA 4ZB8A 2YPMA 4F2IA 1SD8A 1U88A 4TOPA 3QAWA 4KDYA 2GQKA 3G7YA 1SK1A 4ECBA 1V98A 2H19A 2XC2A 3BBYA 3P2AA 4G0LA 3FZ9A 3TJJA 4GF0A 2L4QA 5EPFA 3IK7A 5DDLA 1ILOA 1CQGA 4XHMA 3A5WA 3P8WA 4N10A 2LQOA 2H0GA 1BYEA 2ES7A 2YCDA 4Z7XA 1TI3A 3FEUA 4K8MA 5G31A 3L9SA 1YKCA 2I9HA 3TJKA 4POBA 1DSBA 2HZEA 5G5FA 4HJ2A 4IQAA 3OR5A 4ISDA 2L5LA 3GUSA 3IHQA 2YV7A 1KNGA 2LNTA 1YEXA 2B7KA 1K3YA 1O6JA 4L8EA 4PQIA 1WIKA 3DEXA 2MYGA 4WR4A 1YJ6A 4TR1B 3EWLA 3ZITA 3W8JA 2HQTA 1Z6NA 2LRCA 3LGCA 4MH2A 3KXOA 4KF9A 2VCWA 1GP1A 1Z3EA 2DJ3A 3LSZA 1B4PA 2RIIA 3IPZA 4KUNA 4N11A 1UVZA 1B4QA 1DE1A 2IWTA 5J9CA 1T3BA 3A2VA 3VLNA 6GSUA 3A2XA 3TKRA 5JWRB 4FO5A 4P3YB 4F0CA 2QSIA 3EVIA 3ED3A 1GTIA 2RUEA 4GLTA 3ZVJD 2VCZA 4TXOB 17GSA 3CRTA 1A24A 4HI7A 5AISA 1TU8A 4GSNA 1XVQA 1EZKA 2AYTA 4ECJA 3ME7A 4GWRA 1E6BA 4NV2A 4TW5A 5CRWA 3ZVJA 4WBJA 4TR4A 3BCKA 4Q5QA 12GSA 5JWQB 2IIYA 1TK0B 3VWUA 5D9VA 4OO5A 3US3A 2Z9SA 2O89A 2I81A 3HKRA 3C1RA 2M46A 4ML6A 2WJUA 2AHEA 3FW2A 1SD9A 2F8FA 2YJHA 3F4SA 1FVKA 3F8UA 3QCPA 1LBKA 2H1BA 2H8LA 3FZ4A 1AAZA 1ZMAA 1YF0A 4IJ3A 4EL1A 1X5DA 3APOA 1KBNA 4G9HA 2VUPA 1ERUA 2HRKB 2F8AA 20GSA 2JU5A 2R2JA 1KEBA 4TKYA 5A5KA 2DIYA 4GCIA 3FHKA 5D9TA 2FD3A 4L5LA 1R5PA 1GL8A 1ZOFA 3UL3A 2O8VB 4HDEA 4PX1A 1X0RA 9GSSA 1T4YA 2NPBA 1XPVA 1K0BA 3KP9A 4BVYB 2HSMB 4MDCA 1TKDB 5ID2B 1XW5A 3GNJA 3ERWA 4F9ZA 2HRFA 5DBQA 2DLXA 6GSVA 1ACVA 2GSQA 4PTSA 4PNFA 4LL1B 3H4KA 2R5GA 3CSIA 3FRCA 3Q74A 2B6MA 1AQXA 3RHBA 4DEJA 1Z7PA 3GX8A 5GAPD 2B7JA 2NDOA 3RBTA 4MA9A 3FY7A 3RHCA 5J4UA 3TJBA 1EOHA 2NTOA 4I8BA 3BCIA 2IFQB 2K8VA 5A4WA 4NXIA 5KN3A 1JLWA 3DRNA 4ZB9A 3P90A 2N5BA 3LEFA 3F4TA 3QAVA 1SL0B 2EIOA 3CBUA 1A2LA 4RQXA 4MH3A 3H1NA 2FNOA 4TR1A 4WBRD 3M9JA 1K0NA 3RAZA 1FAAA 1M2DA 2YV9A 2OE3A 3TDGA 2YOIA 3GL5A 3GIXA 1F9MA 2H76A 4RQRA 2G0FA 2O85A 5HFKA 3C1SA 5CP1A 4DSQA 5DQSA 4YAPA 4JR4A 4V2NA 4O92A 2ON7A 1F37A 4Q5RA 5F0GA 1QMVA 2JZTA 2IMFA 2WGRA 3NZNA 4IP1A 3HJOA 1Z7RA 5EVOA 1GTAA 2X99A 2GDRA 5FWGA 2VAFA 4YQUA 1Y6EA 3A2WA 3CMIA 2CZ3A 2X8CA 1V9WA 1T1VA 4J57E 3ZFLA 3EINA 1OVNA 2KP2A 1VRSD 3I43A 5J3RA 4ZBBA 4USSA 4TXOA 3G7JA 1OE7A 4K0NA 4XS6A 2H66A 2H74A 5CRDA 3KZQA 3WGEA 3WD6A 5COHA 3I69A 1TRWA 1NM3A 4MF5A 2B1LA 2CZ2A 4HQZA 1TOFA 2GTUA 1X5CA 1SYXA 4ULXA 1YY7A 3HJMA 4V1Ap 2LJAA 2KLXA 2F9SA 3N9JA 3UBKA 2AB6A 2YWIA 3KEBA 2VLUA 1TTZA 3HXSA 2PUKC 2LSTA 5ELGA 4TRXA 2L6DA 3MWHA 6GSSA 3TCOA 4WXTA 1TRVA 2HRKA 4PXOA 4ILFA 3ZMLA 3W6GA 2YANA 2VL9A 3C71A 5L71A 3Q6OA 1R7HA 1OC9B 5G1KA 4AJ7A 4DVCA 4OMVA 1IYIA 4EE0A 2QC7A 1WRYA 1Z6MA 3DXBA 1F6MC 4HS1A 4JZQA 3EU3A 4KNDA 4ZILA 3U5RE 4BVYA 6GSWA 2HSMA 3M3MA 4IBPA 5ECIB 3S9FA 1G7OA 1EP7A 1ERTA 2WS2A 1YZXA 1SL2B 1ZL9A 4I5QA 1U3AA 1NSWA 4XCSA 5ECPB 2OA7A 4L0WA 1T7PB 5GSTA 4KB3A 3LORA 1SK2A 1VF1A 2ZCTA 1FB6A 2GQMA 1HNBA 1YQ1A 4HUAA 1O7UA 2CVDA 4FQUA 1THOA 1M9BA 3HDCA 3IC8A 1QFNA 1WMJA 2IFQA 1UN2A 1X9SB 1TK5B 1JZOA 4IJIA 2C0GA 1EEJA 1XWAA 4JRRA 3FR3A 1SYRA 5C04A 1M7TA 2MBSA 4XRDA 4HZ4A 1VGLA 2D2ZA 2PU9C 2GZZA 2CAQA 1Y25A 3KCMA 4IELA 4H86A 5LCZA 3E9JB 2JZSA 4OO4A 3HD5A 1PMTA 3C8EA 5ECNB 4HU7A 1J0FA 1XOAA 1WJKA 2RM6A 1XWBA 3IDVA 2LS5A 2DJ0A 3NIVA 5D93A 3D4TA 3GSSA 2YN1A 3M8NA 1T4ZA 2H71A 4BWSA 3AY8A 1IYHA 5B7CA 4FYCA 3GN3A 2PN8A 3TUEA 1WP0A 1PA3A 3O76A 3H79A 1O73A 4MABA 1VF2A 2H6XA 1K0CA 4BPYA 1U3IA 1SK0A 4JR6A 2V6KA 5CYYA 4KSOA 6GSYA 3GTUB 3PH9A 4WF4A 2O7KA 4WEYA 1EP8A 3TOTA 3F3RA 1ZGNA 2PBJA 2FLSA 2JSYA 3IR4A 1F3BA 1M2BA 2IMDA 3EYTA 2BMXA 2XBQA 4EVMA 2IN3A 2WULA 2KP1A 3HZ8A 4KW6A 4TR3A 4E8EA 2P5QA 2YNXA 1B9YC 2LJKA 2MMAA 4PQHA 5ECSA 3UIWA 2N5FA 1YDKA 3D21A 1EV4A 5IOXA 1SJZA 4F82A 1Z9HA 3KTLA 1JFUA 3F3QA 2C0EA 3UVTA 2A2SA 1XWCA 2GS3A 3QMXA 3VFIA 1OC9A 3P7XA 2B1KA 2E2GA 1YKAA 3HCZA 4EKZA 11GSA 2LKUA 2DMLA 1TU7A 2K6VA 1LU4A 4OCEA 4MF6A 3H8QA 3WT2A 3GYKA 5GSSA 4HEA2 5H5QA 3L4NA 3F63A 2JL4A 2C3QA 2PVQA 4OWYA 2V41A 4X43A 3BD2A 5IO0A 3MDKA 4HOJA 3RPNA 2EC4A 2FY6A 5JCWA 2A2RA 3F4RA 3M9KA 1H75A 3F6FA 1GH2A 1URMA 2LRTA 2A4VA 1EGOA 5HQPA 1V58A 2YZUA 1U87A 4G10A 4L0UA 2L4CA 1DE2A 5HFIA 1XW6A 2H6YA 3LFLA 3Q18A 1K0AA 3ZFBA 1TRSA 3CSJA 5HR0A 3BJ5A 4G0IA 3VURA 22GSA 3KMNA 2VIMA 1A8LA 5IMFA 1GUKA 4KAEA 3TKPA 4CHSA 2CQ9A 5ECMB 3D5JA 4XS4B 3TKQA 4POMA 3TKSA 5EL8A 1H4OA 5H5SA 2HE3A 1GUHA 4GXZA 4ECIA 4GRFA 4LL4B 3D22A 4MF7A 4DSSB 3TRXA 4NV5A 4BL7B 2H73A 3TJGA 4ZB6A 1BX9A 2HSNB 1TI1A 2VOCA 1QK8A 2YJ7A 3L9VA 5J41A 1W89A 1GWCA 5KEJA 1QQ2A 3GURA 5IIZA 2H1DA 2DJ1A 3KD0A 3GV1A 1PGTA 4KA0A 4POLA 4IP6A 1A2JA 3CXGA 1AW9A 4BVXB 4EDZA 2L5OA 3GTUA 4EC0A 5ECHB 4K7IA 4WKWA 4KH7A 2O87A 2VD1A 2FCHA 2JACA 5D8IA 4KE3A 3UAPA 3E0UA 5ECRB 4LMWA 3HVSA 1KTEA 4TN8A 2XHFA 1G6WA 4HJMA 1M9AA 1MD4A 5D9XA 5AIXA 4HQSA 2XPDA 1V40A 4CW9A 1PRXA 1BG5A 4K0GA 1UC7A 2VLVA 4O5RA 2R6KA 1BAYA 4QQ7A 5JCGA 3DD3A 2LQQA 5KN0A 4ZIJA 5HR2A 3MAKA 5IMCA 3QFBC 2WRTA 3FR9A 1PX7A 3IAS2 1GLQA 3L9UA 4MZWA 2LV3A 3JCML 2E7PA 3QR6A 1O8WA 4ZL9A 5KN2A 2OJLA 1GULA 4JU5A 2YWOA 1J9BA 2FA4A 4HZ2A 4IHUA 2P5RA 4IN0A 2GQLA 3FZ5A 1GSSA 1MTCA 5B8AA 4MJBA 4YQMA 3WYWA 3G9BA 4D73B 1PD21 2H70A 1SKSB 1XCCA 1ST9A 5DCGA 4ZL8A 1PSQA 13GSA 3IXRA 1J08A 2FUG2 5DALB 2ZNMA 4I2UA 2IMIA 4K2DA 2WB9A 2VCVA 3EE2A 4RI7A 1MDJA 3GMFA 2K8SA 3IRAA 2YP6A 4I6XA 4XS4A 2DC5A 3IK9A 4NWYA 1XWGA 1SJIA 2WDUA 2MMOA 5IMDA 5ECQB 4J56E 1S3DA 3I6AA 3H93A 3GH9A 3LWAA 2HRNA 5DJLA 4MLYA 3TKSC 3EMXA 2NVLA 2DSAA 2J9HA 1GNWA 2YZHA 3HA9A 4DSSA 3LXZA 4G2EA 4BL7A 2V32A 1OAZA 2REMA 3M0FA 4ACSA 3LXTA 2B5EA 1FOVA 3KGKA 1G7EA 1X9MB 3L0HA 5EY6A 2HNLA 4XS1A 2GSTA 1A0RP 4MMMA 4IKHA 1DUGA 1NW2A 3PPUA 1HYUA 1WE0A 4RI6A 5DVBA 3IA1A 4EXJA 2YWMA 2HRAA 3GKNA 2JSZA 1LJRA 4PUAA 4KCAA 2DMMA 2PGTA 3TRQA 1YEPA 5F8BA 2VCQA 1K3LA 4KGIA 2CAIA 1R4WA 4BVXA 2TRCP 5CNWA 5J9BA 1HNAA 1PL2A 5F06A 2CX4A 1A23A 4O32A 3PINA 2WZ9A 3ERFA 3D6IA 1Z5YE 1GTUA 1OKDA 4XRAA 4GSSA 1AUCA 1SENA 2PPTA 4LMVA 3LYPA 3WGDA 2IPAA 5IO2A 2H6ZA 4NAXA 1PKZA 2OE0A 3C7MA 3I9V2 1VF3A 3KIJA 2IJYA 1XVWA 1BQ7A 2VCTA 2DJJA 4KDUA 2HXKA 5CREA 5GAND 3TRPA 5HR3A 2GGTA 2CT6A 3UEMA 4K9ZA 3PR8A 3Q19A 4GQFA 4ECCA 4L5OA 2V6OA 5A4VA 2FWGA 5D73A 3GKMA 3VK9A 2VCXA 2PVOC 5B8BA 2H1GA 1JLVA 4PQ1A 3HHVA 1WWJA 2WFCA 3RDWA 4O7HA 2RM5A 3VWWA 3CTFA 3DMLA 3A3TA 1O8XA 3ZTLA 4JBBA 1EGRA 1MD3A 1BJXA 1B9XC 3GL3A 2B5XA 5ELAA 4EO3A 1B8XA 5LNKe 3QOUA 5LD0A 4G19A 3VPTA 4PUFC 1VF4A 3KP8A 1K3OA 2FGXA 3ZLPA 2AAWA 2YWNA 2HI7A 4CDOA 2I4AA 2M72A 14GSA 4D73A 2IL3A 2ALBA 1GRXA 1YF1A 2VD0A 5DALA 1R26A 2C0DA 4KDXA 3MNGA 1OYJA 4IQ1A 1FB0A 3WGXA 4Q5FA 3GFKA 3MSZA 4N0ZA 1EWXA 1ML6A 4QL7A 2LJRA 3NOFA 3D0ZA 2GZPA 1QUWA 1TRUA 1RK4A 4MJEA 2FA8A 3GH6A 4GSTA 2KHPA 4YQVA 2V1MA 1NHOA 5IMZA 3TGZA 5IMAA 1N8JA 2C4JA 3QDNA 4MP4A 3KH9A 3UMAA 1MDKA 3IAM2 2V2GA 2OKAA 4FH8A 2R37A 3F0IA 1G0TA 2ON5A 1V2AA 3IE3A 3VI7A 3UJ1A 4N0VA 2LUSA 4EUYA 10GSA 6GSTA 4FIWA 4K7OA 4ID0A 2H30A 4X1UA 4AF2A 2N5AA 2GZYA 4NPBA 2RLIA 2GLRA 2VL2C 2H0HA 2PWJA 2JADA 3RPPA 4YAVA 1GSFA 2HYXA 3G7IA 1X5EA 1QGVA 1ERWA 3GA4A 4JE1A 4X0XA 2X8HA 3HVXA 2GVPA 2H75A 1M2AA 2LRNA 1E2YA 4OCFA 5FT3A 2LTKA 2L6CA 2HT9A 3GSTA 4YH2A 4JEDA 5AIVA 4KSMA 1AIUA 5JWOB 3FK8A 4OD7A 4RUVA 4N30A 3M1GA 2X64A 5HFGA 2GT6A 4WF5A 3WT1A 4TXVA 4QL9A 3ERGA 4WR5A 3IV4A 3K8NA 3ZZXA 4HU9A 1A0FA 4LLRA 3UARA 1XXUA 3R3EA 4DSRA 1WPIA 4I2TA 2MMZA 3ME8A 3QAGA 3KMOA 2TIRA 1HNCA
chains in the Genus database with same CATH superfamily
1FOHA 1NHYA 3BOAA 3SBCA 1Q98A 4K7NA 5GZZB 1S3AA 1X9WB 3ZREA 5B6NA 1GLPA 2RUFA 1TXXA 1HD2A 2G2QA 4V2LA 1I5GA 5G2ZA 18GSA 2P0GA 3ZRDA 1EEMA 1C72A 1FG4A 1GSEA 1AXDA 3APQA 5G30A 3LG6A 5KN1A 4CY8A 4XIHA 2E0QA 5E4WA 1TP9A 2F3MA 4OFMA 4MPGA 5A34B 3HY2A 5ENUA 5G1LA 1SL1B 3TOUA 4TVEA 5AGYA 4MZCA 2R3XA 5F05A 1ZYEA 4V1Ag 1TK8B 1JHBA 4NMUA 2PERA 1V57A 3ISOA 5E59A 5C00A 2MMNA 1DBYA 2OBKA 4ZL7A 3HVVA 4J2FA 2DJ2A 5INYA 4ZBDA 3E3EA 1OE8A 2EIQA 4I97A 2H1AA 5IPHA 2C1YA 4G0KA 7GSSA 2B5YA 2C8UA 4NHWA 5FHIA 1JZDA 2KUCA 1B48A 1GNEA 2HZFA 4YKFA 1PX6A 4MCUA 1EV9A 3KTBA 2HSYA 2WVXB 2C0FA 4FYUA 4PGTA 2KOKA 2X49A 2A2PA 2LNSA 5J47A 1Q4JA 2BJXA 3GKKA 2EIRA 1FHEA 2E2MA 2CX3A 4PI2C 1PN0A 1XOBA 4K6XA 1GSQA 3SWLA 4EF0A 3UBLA 4KX4A 3QD9A 1OC3A 4PNGA 4ZXGA 1K0OA 1MEKA 5CRHA 1SVMA 1AQVA 4GTUA 4AKHA 5DCHA 4OFNA 1FW1A 2DIZA 3GX0A 4IGJA 2NBSA 2VO4A 4XTSA 5ECOB 1TDIA 3VI5A 1F2EA 1QXHA 5DAKB 2GT5A 2VM2A 2B3SA 3GHAA 2WCIA 5DQYA 1A8YA 3J7Yk 4IW9A 3FKFA 1SJ6A 3CRUA 2I3YA 2I1UA 1O85A 1TW9A 3RGBC 4IS0A 3APSA 2QA2A 4IVFA 5CAXA 4TR0A 3HZ4A 5ECLB 3ZMKA 5BMUA 3W8SA 3VWXA 5J5NA 4NHZA 5H5RA 3ZYWA 2MZCA 4K1FA 1S3CA 3FR6A 1GSUA 2JZRA 1GSYA 4MPFA 1U6TA 2K9FA 2IMEA 1ABAA 2AUVA 1N2AA 1WOUA 1SU9A 3HYPA 4F03A 2CVKA 2K18A 4LA1A 2C3NA 1UA5A 5IM9A 1M99A 1BG1A 2DBCA 5J4YA 2CV4A 4AKGA 4HSCX 4EDYA 1FVJA 1OC8A 1AC1A 1RQMA 1A2MA 2VL3A 5D96A 1M3JA 1Y1UA 4MK3A 1G6YA 5F07A 3DKSA 5IPGA 3ZL5A 1EOGA 5IMVA 4BA7A 4GQCA 3DVXA 3UVHA 1GUMA 3HJPA 1T00A 1XFLA 3LJRA 2C3TA 2IMKA 3O3TA 4MJAA 2FWEA 2DJKA 1XWKA 16GSA 4V2MA 2AV4A 1GTBA 2C80A 3EMPA 5B6MA 2HZEB 2VL2A 2VM1A 1ZCPA 5HR1A 1XZOA 4E8HA 3DVWA 3IOSA 1K0MA 5A34A 1GSDA 1USBA 2HLSA 1T8EB 2R4VA 3ZIJA 1AQWA 2OE1A 1ON4A 5D9WA 3DYRA 3FYGA 3D4MA 1HQOA 1OKTA 2AJQB 3VPQA 3R2QA 3LYKA 2FHEA 2XPEA 3FZAA 3QPMA 3KJYA 2MBTA 5CRGA 4Q5NA 1XIYA 2WVZA 1MDIA 2OT3A 4OFTA 5JCUA 1PKWA 4AJ6A 3U6VA 4FXYP 4PURA 2CVBA 2H01A 2L57A 2L59A 1FO5A 1SKRB 5ID2A 3IC4A 4EIPA 4KCEA 2VKZG 1XW9A 2CA8A 6GSXA 2WVXA 3IBHA 3L78A 3C73A 3QFAC 2QGVA 3F6DA 4ML1A 3EC3A 4AJ8A 2WW2A 3PGTA 2X4AA 5CO3A 1SKWB 3EURA 3O6TA 3J7Yb 3HMJG 4BWQA 4POKA 3CYNA 1THXA 2OACA 4QMKA 1ZZYA 1PL1A 2LEGA 2OBIA 2P31A 2TRXA 2XBIA 2M80A 1XBSA 3F9UA 2BTOT 5DJMA 3DIEA 3LQ7A 1JZWA 1RW1A 2H72A 1ERVA 8GSSA 3CSHA 3ZIVA 4F0BA 5DAKA 5ECKB 4MZBA 1PN9A 2ZUPA 5IQYA 2F51A 1O81A 2OADA 1K0DA 3GRXA 1W4VA 5IOWA 1M0UA 2H0IA 1F3AA 2GSRA 2X8GA 4MJCA 4AGSA 3GKXA 2QKEA 2UZ8A 2O5VA 5G5EA 2VLTA 3CQFA 2FWFA 3KH7A 3TKSE 3UOMA 4ZBAA 1JZRA 2PMTA 2HFDA 3KM6A 3DGQA 3VWVA 1ZYQB 3TJFA 2HSHA 2GSSA 3MYDA 3TB2A 2J23A 2FWHA 4WETA 5BRTA 3EU4A 3DWVA 1CQHA 1I9DA 4FYBA 1PQNA 5AN1A 3V1WA 3CTGA 1BEDA 1R5AA 5ABRA 19GSA 5A4UA 1TJDA 3N5OA 4ZB8A 2YPMA 4F2IA 1SD8A 1U88A 4TOPA 3QAWA 4KDYA 2GQKA 3G7YA 1SK1A 4ECBA 1V98A 2H19A 2XC2A 3BBYA 3P2AA 4G0LA 3FZ9A 3TJJA 4GF0A 4YKGA 2L4QA 5EPFA 3IK7A 5DDLA 1ILOA 3EPTA 1CQGA 4XHMA 3A5WA 2EFHA 3P8WA 4N10A 2LQOA 2H0GA 1BYEA 2ES7A 2YCDA 4Z7XA 1TI3A 3FEUA 4K8MA 5G31A 3L9SA 1YKCA 2I9HA 3TJKA 4POBA 1DSBA 2HZEA 5G5FA 4HJ2A 4IQAA 3OR5A 4ISDA 2L5LA 3GUSA 3IHQA 2YV7A 1KNGA 2LNTA 1YEXA 2B7KA 1K3YA 1O6JA 4L8EA 4PQIA 1WIKA 3DEXA 2MYGA 4WR4A 1YJ6A 4TR1B 3EWLA 3ZITA 3W8JA 2HQTA 1Z6NA 2LRCA 3LGCA 4MH2A 3KXOA 4KF9A 2VCWA 1GP1A 1Z3EA 2DJ3A 3LSZA 5J40A 1B4PA 2RIIA 3IPZA 4KUNA 4N11A 1UVZA 2EFDA 1B4QA 1DE1A 2IWTA 5J9CA 1T3BA 3A2VA 3VLNA 6GSUA 3A2XA 3TKRA 5JWRB 5KOWA 4FO5A 4P3YB 4F0CA 2R0CA 3RFRC 2QSIA 3EVIA 3ED3A 1GTIA 2RUEA 4GLTA 3ZVJD 2VCZA 4TXOB 2WW3A 17GSA 3CRTA 1A24A 4HI7A 5AISA 1TU8A 4GSNA 1XVQA 1EZKA 2AYTA 4ECJA 3ME7A 4GWRA 1E6BA 4NV2A 4TW5A 5CRWA 3ZVJA 4WBJA 4TR4A 4AI6A 3BCKA 4Q5QA 12GSA 5JWQB 2IIYA 2DKHA 1TK0B 4O5QA 3VWUA 5D9VA 4OO5A 3US3A 2Z9SA 2O89A 2I81A 3HKRA 3C1RA 2M46A 3MIXA 4ML6A 2WJUA 2AHEA 3FW2A 1SD9A 2F8FA 2YJHA 3F4SA 2WW1A 1FVKA 3F8UA 1LBKA 2H1BA 2H8LA 3QCPA 3FZ4A 1AAZA 1ZMAA 1YF0A 4IJ3A 4EL1A 1X5DA 3APOA 1KBNA 4G9HA 2VUPA 1ERUA 2HRKB 1TXUA 2F8AA 20GSA 2JU5A 2R2JA 1KEBA 4TKYA 5A5KA 2H1LA 2DIYA 4GCIA 3FHKA 5D9TA 2FD3A 4L5LA 1R5PA 1GL8A 1ZOFA 3UL3A 2O8VB 4HDEA 4PX1A 1X0RA 9GSSA 1T4YA 2NPBA 1XPVA 1K0BA 3KP9A 4BVYB 2HSMB 4MDCA 1TKDB 5ID2B 1XW5A 3GNJA 3ERWA 4K5SA 4F9ZA 2HRFA 5DBQA 2DLXA 6GSVA 1ACVA 2GSQA 4PTSA 4PNFA 4LL1B 3H4KA 2R5GA 3CSIA 3FRCA 3Q74A 2B6MA 1AQXA 3RHBA 4DEJA 1Z7PA 3GX8A 5GAPD 2B7JA 2NDOA 3RBTA 4MA9A 3FY7A 3RHCA 5J4UA 3TJBA 1EOHA 2NTOA 4I8BA 3BCIA 2IFQB 2K8VA 5A4WA 4NXIA 5KN3A 2UV8G 1JLWA 3DRNA 4ZB9A 2WW0A 3P90A 2N5BA 3LEFA 3F4TA 3QAVA 1SL0B 2EIOA 3CBUA 1A2LA 4RQXA 4MH3A 3H1NA 2FNOA 4TR1A 4WBRD 3M9JA 1K0NA 3RAZA 1FAAA 1M2DA 2YV9A 2OE3A 3TDGA 2YOIA 3GL5A 3GIXA 1F9MA 2H76A 4RQRA 2G0FA 2O85A 5HFKA 3C1SA 5CP1A 4DSQA 5DQSA 4YAPA 4JR4A 4EIQA 4V2NA 4O92A 2ON7A 1F37A 4Q5RA 5F0GA 1QMVA 2JZTA 2IMFA 2WGRA 3NZNA 4IP1A 3HJOA 1Z7RA 1YEWC 5EVOA 1GTAA 2X99A 2GDRA 5FWGA 2VAFA 2R0PA 4YQUA 1Y6EA 3A2WA 3CMIA 2CZ3A 2X8CA 1V9WA 2WZSA 1T1VA 4J57E 3ZFLA 3EINA 1OVNA 2KP2A 1VRSD 3I43A 5J3RA 4ZBBA 4USSA 4TXOA 3G7JA 1OE7A 4K0NA 4XS6A 1M3IA 2H66A 2H74A 5CRDA 3KZQA 3WGEA 3WD6A 5COHA 3I69A 1TRWA 1NM3A 4MF5A 2B1LA 2CZ2A 4HQZA 1TOFA 4ZB7A 2GTUA 1X5CA 1SYXA 4ULXA 1YY7A 3HJMA 4V1Ap 2LJAA 2KLXA 2F9SA 3N9JA 3UBKA 2AB6A 2YWIA 3KEBA 2O36A 2VLUA 1TTZA 3HXSA 2PUKC 2LSTA 5ELGA 4TRXA 2L6DA 3MWHA 6GSSA 3TCOA 4WXTA 1TRVA 2HRKA 4PXOA 4ILFA 3ZMLA 1I1IP 3W6GA 2YANA 2VL9A 3C71A 5L71A 3Q6OA 1R7HA 1OC9B 5G1KA 4AJ7A 2HSNA 4DVCA 4OMVA 1IYIA 4EE0A 2QC7A 1WRYA 1Z6MA 3DXBA 1F6MC 4HS1A 4JZQA 3EU3A 4KNDA 4ZILA 3U5RE 4BVYA 6GSWA 2HSMA 3IHGA 3CHXC 3M3MA 4IBPA 5ECIB 3S9FA 1G7OA 1EP7A 1ERTA 2WS2A 1YZXA 1SL2B 1ZL9A 4I5QA 1U3AA 1NSWA 4XCSA 5ECPB 2OA7A 4L0WA 1T7PB 5GSTA 4KB3A 3LORA 1SK2A 1VF1A 2ZCTA 1FB6A 2GQMA 1HNBA 1YQ1A 4HUAA 1O7UA 2CVDA 4FQUA 1THOA 1M9BA 3HDCA 3IC8A 1QFNA 1WMJA 2IFQA 1UN2A 1X9SB 1TK5B 1JZOA 4IJIA 2C0GA 1EEJA 1XWAA 4JRRA 3FR3A 1SYRA 5C04A 1M7TA 2MBSA 4XRDA 4HZ4A 1VGLA 2D2ZA 2PU9C 2GZZA 2CAQA 1Y25A 3KCMA 4Z2TA 4IELA 4H86A 5LCZA 3E9JB 2JZSA 4OO4A 3HD5A 1PMTA 3C8EA 5ECNB 4HU7A 1J0FA 1XOAA 1WJKA 2RM6A 1XWBA 3IDVA 2LS5A 2DJ0A 3NIVA 5D93A 3D4TA 3GSSA 2YN1A 3M8NA 4K2XA 1T4ZA 2H71A 4BWSA 3AY8A 1IYHA 5B7CA 5A5HB 4FYCA 3GN3A 4GDFA 2PN8A 3TUEA 1WP0A 1PA3A 3O76A 3H79A 1O73A 4MABA 1VF2A 2H6XA 1K0CA 4BPYA 1U3IA 1SK0A 4JR6A 2V6KA 5CYYA 4KSOA 4BIKA 6GSYA 3GTUB 3PH9A 4WF4A 2O7KA 4WEYA 1EP8A 3TOTA 3F3RA 1ZGNA 2PBJA 2FLSA 2JSYA 3IR4A 1F3BA 1M2BA 2IMDA 3EYTA 2BMXA 2XBQA 4EVMA 2IN3A 2WULA 2KP1A 3HZ8A 4KW6A 4TR3A 4E8EA 2P5QA 2YNXA 1B9YC 2LJKA 2MMAA 4PQHA 5ECSA 3UIWA 2N5FA 4X4JA 1YDKA 3D21A 1EV4A 5IOXA 1SJZA 4F82A 1Z9HA 3KTLA 1JFUA 3F3QA 2C0EA 3UVTA 4Z2RA 2A2SA 1XWCA 2GS3A 3QMXA 3VFIA 1OC9A 3P7XA 3TU3B 2B1KA 2E2GA 1YKAA 3HCZA 4EKZA 11GSA 2LKUA 2DMLA 1TU7A 2K6VA 1LU4A 4OCEA 4MF6A 3H8QA 3WT2A 3GYKA 5GSSA 4HEA2 5H5QA 3L4NA 3F63A 2JL4A 2C3QA 2PVQA 4OWYA 2V41A 4X43A 3BD2A 5IO0A 3MDKA 4HOJA 3RPNA 2EC4A 2FY6A 5JCWA 2A2RA 3F4RA 3M9KA 1H75A 3F6FA 1GH2A 1URMA 2LRTA 2A4VA 1EGOA 5HQPA 1V58A 2YZUA 1U87A 4G10A 4L0UA 2L4CA 2O3EA 1DE2A 5HFIA 1XW6A 2H6YA 3LFLA 3Q18A 4O5UA 1K0AA 3ZFBA 1TRSA 3CSJA 5HR0A 3BJ5A 4G0IA 3VURA 22GSA 3KMNA 2VIMA 1A8LA 5IMFA 1GUKA 4KAEA 3TKPA 4CHSA 2CQ9A 5ECMB 3D5JA 4XS4B 3TKQA 4POMA 3TKSA 5EL8A 1H4OA 5H5SA 2QA1A 2HE3A 1GUHA 4GXZA 4ECIA 4GRFA 4LL4B 3D22A 4MF7A 4DSSB 3TRXA 4NV5A 4BL7B 4K5RA 2H73A 4ICYA 3TJGA 4ZB6A 1BX9A 2HSNB 1TI1A 2VOCA 1QK8A 2YJ7A 3L9VA 5J41A 1W89A 1GWCA 3A5IA 5A5HA 5KEJA 1QQ2A 3GURA 5IIZA 2H1DA 2DJ1A 3KD0A 3GV1A 1PGTA 4KA0A 1BF5A 4POLA 4IP6A 1A2JA 3CXGA 1AW9A 4BVXB 5KOXA 4EDZA 2L5OA 3GTUA 4EC0A 5ECHB 4K7IA 4WKWA 4KH7A 2O87A 1SVLA 2VD1A 2FCHA 2JACA 5D8IA 2A4HA 4KE3A 3UAPA 3E0UA 1S4BP 5ECRB 4LMWA 3HVSA 1SVOA 1KTEA 4TN8A 2XHFA 1G6WA 4HJMA 1M9AA 1MD4A 5D9XA 5AIXA 4HQSA 2XPDA 1V40A 4N3ZA 4CW9A 1PRXA 1BG5A 4K0GA 1UC7A 2VLVA 4O5RA 2R6KA 1BAYA 4QQ7A 5JCGA 3DD3A 2LQQA 5KN0A 4ZIJA 5HR2A 3MAKA 5IMCA 3QFBC 2WRTA 3FR9A 1PX7A 3IAS2 1GLQA 3L9UA 2EFEA 4MZWA 2LV3A 3JCML 2E7PA 3QR6A 1O8WA 2EFCA 4ZL9A 4W66A 5KN2A 2OJLA 1GULA 2DKIA 4JU5A 2YWOA 1J9BA 2FA4A 4HZ2A 4IHUA 2P5RA 4IN0A 4G01A 2GQLA 3FZ5A 1GSSA 1MTCA 5B8AA 4MJBA 4YQMA 3WYWA 3G9BA 4D73B 5A1NB 1PD21 2H70A 1SKSB 1XCCA 1ST9A 5DCGA 4ZL8A 1PSQA 13GSA 1ZYNA 3IXRA 1J08A 2FUG2 5DALB 2ZNMA 4I2UA 2IMIA 4K2DA 2WB9A 2VCVA 3EE2A 4RI7A 1MDJA 4Z2UA 3GMFA 2K8SA 3IRAA 2YP6A 1XG8A 4I6XA 4XS4A 2DC5A 3IK9A 4NWYA 1XWGA 1SJIA 2WDUA 2MMOA 5IMDA 5ECQB 4J56E 1S3DA 3I6AA 3H93A 3GH9A 3LWAA 2HRNA 5DJLA 4MLYA 3TKSC 3EMXA 2NVLA 2DSAA 2J9HA 1GNWA 2YZHA 3HA9A 4DSSA 3LXZA 4G2EA 4BL7A 3CWGA 2V32A 1OAZA 2REMA 3M0FA 4ACSA 3LXTA 4PHZC 2B5EA 1FOVA 3KGKA 1G7EA 1X9MB 2WVYA 5J4VA 3L0HA 5EY6A 2HNLA 4XS1A 2GSTA 1A0RP 4MMMA 4IKHA 1DUGA 1NW2A 3PPUA 1HYUA 1WE0A 4RI6A 5DVBA 3IA1A 4EXJA 2YWMA 2HRAA 3GKNA 2JSZA 1LJRA 4PUAA 4KCAA 2DMMA 2PGTA 3TRQA 1YEPA 5F8BA 2VCQA 1K3LA 4KGIA 2CAIA 1R4WA 4BVXA 2TRCP 5CNWA 5J9BA 1HNAA 1PL2A 1S3RA 5F06A 2CX4A 1A23A 4O32A 3PINA 2WZ9A 3ERFA 3D6IA 1Z5YE 1GTUA 1OKDA 4XRAA 4GSSA 1AUCA 1SENA 2PPTA 4LMVA 3LYPA 3WGDA 2IPAA 5IO2A 4E68A 2H6ZA 4NAXA 1PKZA 2OE0A 3C7MA 3I9V2 1VF3A 3KIJA 2IJYA 2R0GA 1XVWA 1BQ7A 2VCTA 2DJJA 4KDUA 2HXKA 5CREA 5GAND 3TRPA 5HR3A 2GGTA 2CT6A 3UEMA 4K9ZA 3PR8A 3Q19A 4GQFA 4ECCA 4L5OA 2V6OA 5A4VA 2FWGA 5D73A 3GKMA 3VK9A 2VCXA 2PVOC 5B8BA 2H1GA 1JLVA 4PQ1A 3HHVA 1WWJA 2WFCA 3RDWA 4O7HA 2RM5A 3VWWA 3CTFA 3DMLA 3A3TA 1O8XA 3ZTLA 4JBBA 1EGRA 1MD3A 1BJXA 1B9XC 3GL3A 2B5XA 5ELAA 4EO3A 1B8XA 5LNKe 3QOUA 5LD0A 4G19A 3VPTA 4PUFC 1VF4A 3KP8A 1K3OA 2FGXA 3ZLPA 2AAWA 2YWNA 2HI7A 4CDOA 2I4AA 2M72A 14GSA 4D73A 5A1NA 2IL3A 2ALBA 1GRXA 1YF1A 2VD0A 5DALA 1R26A 2C0DA 4KDXA 3MNGA 1OYJA 4IQ1A 1FB0A 3WGXA 4Q5FA 3GFKA 3MSZA 4N0ZA 1EWXA 1ML6A 4QL7A 2LJRA 3NOFA 3D0ZA 2GZPA 1QUWA 1TRUA 1RK4A 4MJEA 2FA8A 3GH6A 4GSTA 2KHPA 3LW9A 4YQVA 2V1MA 1NHOA 5IMZA 3TGZA 5IMAA 1N8JA 2C4JA 3QDNA 4AKIA 4MP4A 3KH9A 3UMAA 1MDKA 3IAM2 2V2GA 2OKAA 4FH8A 2R37A 3F0IA 1G0TA 2ON5A 1V2AA 3IE3A 4PI0C 3VI7A 1YVLA 3UJ1A 4N0VA 2LUSA 3FMWA 4EUYA 10GSA 6GSTA 4FIWA 4K7OA 4MNNA 4ID0A 2H30A 4X1UA 4AF2A 2N5AA 4AKXB 2GZYA 4NPBA 2RLIA 2GLRA 2VL2C 2H0HA 2PWJA 2JADA 3RPPA 4YAVA 1GSFA 1PFOA 2HYXA 3G7IA 1X5EA 1QGVA 3HVNA 1ERWA 3GA4A 4A5PA 4JE1A 4X0XA 2X8HA 3HVXA 2GVPA 2H75A 1M2AA 2LRNA 1E2YA 4OCFA 5FT3A 2LTKA 2L6CA 2HT9A 3GSTA 4YH2A 4JEDA 5AIVA 4KSMA 1AIUA 5JWOB 3FK8A 4OD7A 5BMUB 4RUVA 4N30A 4CY6A 3M1GA 2X64A 5HFGA 2GT6A 4WF5A 3WT1A 4TXVA 4QL9A 3ERGA 4WR5A 3IV4A 3K8NA 3ZZXA 1ZYPA 4HU9A 1A0FA 4LLRA 3UARA 1XXUA 3R3EA 4DSRA 1WPIA 4I2TA 1N25A 2MMZA 3ME8A 3QAGA 3KMOA 2TIRA 1HNCA
chains in the Genus database with same CATH topology
1FOHA 1NHYA 3BOAA 3SBCA 1Q98A 4K7NA 5GZZB 1S3AA 1X9WB 3ZREA 5B6NA 1GLPA 2RUFA 1TXXA 1HD2A 2G2QA 4V2LA 1I5GA 5G2ZA 18GSA 2P0GA 3ZRDA 1EEMA 1C72A 1FG4A 1GSEA 1AXDA 3APQA 5G30A 3LG6A 5KN1A 4CY8A 4XIHA 2E0QA 5E4WA 1TP9A 2F3MA 4OFMA 4MPGA 5A34B 3HY2A 5ENUA 5G1LA 1SL1B 3TOUA 4TVEA 5AGYA 4MZCA 2R3XA 5F05A 1ZYEA 4V1Ag 1TK8B 1JHBA 4NMUA 2PERA 1V57A 3ISOA 5E59A 5C00A 2MMNA 1DBYA 2OBKA 4ZL7A 3HVVA 4J2FA 2DJ2A 5INYA 4ZBDA 3E3EA 1OE8A 2EIQA 4I97A 2H1AA 5IPHA 2C1YA 4G0KA 7GSSA 2B5YA 2C8UA 4NHWA 5FHIA 1JZDA 2KUCA 1B48A 1GNEA 2HZFA 4YKFA 1PX6A 4MCUA 1EV9A 3KTBA 2HSYA 2C0FA 4FYUA 4PGTA 2KOKA 2X49A 2A2PA 2LNSA 5J47A 1Q4JA 2BJXA 3GKKA 2EIRA 1FHEA 2E2MA 2CX3A 1XOBA 1PN0A 4K6XA 1GSQA 3SWLA 4EF0A 3UBLA 4KX4A 3QD9A 1OC3A 4PNGA 4ZXGA 1K0OA 1MEKA 5CRHA 1SVMA 1AQVA 4GTUA 4AKHA 5DCHA 4OFNA 1FW1A 2DIZA 3GX0A 4IGJA 2NBSA 2VO4A 4XTSA 5ECOB 1TDIA 3VI5A 1F2EA 1QXHA 5DAKB 2GT5A 2VM2A 2B3SA 3GHAA 2WCIA 5DQYA 1A8YA 3J7Yk 4IW9A 3FKFA 1SJ6A 3CRUA 2I3YA 2I1UA 1O85A 1TW9A 4IS0A 3APSA 2QA2A 4IVFA 5CAXA 4TR0A 3HZ4A 5ECLB 3ZMKA 5BMUA 3W8SA 3VWXA 5J5NA 4NHZA 5H5RA 3ZYWA 2MZCA 4K1FA 1S3CA 3FR6A 1GSUA 2JZRA 1GSYA 4MPFA 1U6TA 2K9FA 2IMEA 1ABAA 2AUVA 1N2AA 1WOUA 1SU9A 3HYPA 4F03A 2CVKA 2K18A 4LA1A 2C3NA 1UA5A 5IM9A 1M99A 1BG1A 2DBCA 5J4YA 2CV4A 4AKGA 4EDYA 1FVJA 1OC8A 1AC1A 1RQMA 1A2MA 2VL3A 5D96A 1Y1UA 4MK3A 1G6YA 5F07A 3DKSA 5IPGA 3ZL5A 1EOGA 5IMVA 4BA7A 4GQCA 3DVXA 3UVHA 1GUMA 3HJPA 1T00A 1XFLA 3LJRA 2C3TA 2IMKA 3O3TA 4MJAA 2FWEA 2DJKA 1XWKA 16GSA 4V2MA 2AV4A 1GTBA 2C80A 3EMPA 5B6MA 2HZEB 2VL2A 2VM1A 1ZCPA 5HR1A 1XZOA 4E8HA 3DVWA 3IOSA 1K0MA 5A34A 1GSDA 1USBA 2HLSA 1T8EB 2R4VA 3ZIJA 1AQWA 2OE1A 1ON4A 5D9WA 3DYRA 3FYGA 3D4MA 1HQOA 1OKTA 2AJQB 3VPQA 3R2QA 3LYKA 2FHEA 2XPEA 3FZAA 3QPMA 3KJYA 2MBTA 5CRGA 4Q5NA 1XIYA 1MDIA 2OT3A 4OFTA 5JCUA 1PKWA 4AJ6A 3U6VA 4PURA 2L57A 2CVBA 2H01A 2L59A 1FO5A 1SKRB 5ID2A 3IC4A 4EIPA 4KCEA 2VKZG 1XW9A 2CA8A 6GSXA 3IBHA 3L78A 3C73A 3QFAC 2QGVA 3F6DA 4ML1A 3EC3A 4AJ8A 3PGTA 2X4AA 5CO3A 1SKWB 3EURA 3O6TA 3J7Yb 3HMJG 4BWQA 4POKA 3CYNA 1THXA 2OACA 4QMKA 1ZZYA 1PL1A 2LEGA 2OBIA 2P31A 2TRXA 2XBIA 2M80A 1XBSA 3F9UA 2BTOT 5DJMA 3DIEA 3LQ7A 1JZWA 1RW1A 2H72A 1ERVA 8GSSA 3CSHA 3ZIVA 4F0BA 5DAKA 5ECKB 4MZBA 1PN9A 2ZUPA 5IQYA 2F51A 1O81A 2OADA 1K0DA 3GRXA 1W4VA 5IOWA 1M0UA 2H0IA 1F3AA 2GSRA 2X8GA 4MJCA 4AGSA 3GKXA 2QKEA 2UZ8A 2O5VA 5G5EA 2VLTA 2FWFA 3KH7A 3TKSE 3UOMA 4ZBAA 1JZRA 2PMTA 2HFDA 3KM6A 3DGQA 3VWVA 1ZYQB 3TJFA 2HSHA 2GSSA 3MYDA 3TB2A 2J23A 2FWHA 4WETA 5BRTA 3EU4A 3DWVA 1CQHA 1I9DA 4FYBA 1PQNA 5AN1A 3V1WA 3CTGA 1BEDA 1R5AA 5ABRA 19GSA 5A4UA 1TJDA 3N5OA 4ZB8A 2YPMA 4F2IA 1SD8A 1U88A 4TOPA 3QAWA 4KDYA 2GQKA 3G7YA 1SK1A 4ECBA 1V98A 2H19A 2XC2A 3BBYA 3P2AA 4G0LA 3FZ9A 3TJJA 4GF0A 4YKGA 2L4QA 5EPFA 3IK7A 5DDLA 1ILOA 3EPTA 1CQGA 4XHMA 3A5WA 2EFHA 3P8WA 4N10A 2LQOA 2H0GA 1BYEA 2ES7A 2YCDA 4Z7XA 1TI3A 3FEUA 4K8MA 5G31A 3L9SA 1YKCA 2I9HA 3TJKA 4POBA 1DSBA 2HZEA 5G5FA 4HJ2A 4IQAA 3OR5A 4ISDA 2L5LA 3GUSA 3IHQA 2YV7A 1KNGA 2LNTA 1YEXA 2B7KA 1K3YA 1O6JA 4L8EA 4PQIA 1WIKA 3DEXA 2MYGA 4WR4A 1YJ6A 4TR1B 3EWLA 3ZITA 3W8JA 2HQTA 1Z6NA 2LRCA 3LGCA 4MH2A 3KXOA 4KF9A 2VCWA 1GP1A 1Z3EA 2DJ3A 3LSZA 5J40A 1B4PA 2RIIA 3IPZA 4KUNA 4N11A 1UVZA 2EFDA 1B4QA 1DE1A 2IWTA 5J9CA 1T3BA 3A2VA 3VLNA 6GSUA 3A2XA 3TKRA 5JWRB 5KOWA 4FO5A 4P3YB 4F0CA 2R0CA 2QSIA 3EVIA 3ED3A 1GTIA 2RUEA 4GLTA 3ZVJD 2VCZA 4TXOB 17GSA 3CRTA 1A24A 4HI7A 5AISA 1TU8A 4GSNA 1XVQA 1EZKA 2AYTA 4ECJA 3ME7A 4GWRA 1E6BA 4NV2A 4TW5A 5CRWA 3ZVJA 4WBJA 4TR4A 4AI6A 3BCKA 4Q5QA 12GSA 5JWQB 2IIYA 2DKHA 1TK0B 4O5QA 3VWUA 5D9VA 4OO5A 3US3A 2Z9SA 2O89A 2I81A 3HKRA 3C1RA 2M46A 3MIXA 4ML6A 2WJUA 2AHEA 3FW2A 1SD9A 2F8FA 2YJHA 3F4SA 1FVKA 3F8UA 1LBKA 2H1BA 2H8LA 3QCPA 3FZ4A 1AAZA 1ZMAA 1YF0A 4IJ3A 4EL1A 1X5DA 3APOA 1KBNA 4G9HA 2VUPA 1ERUA 2HRKB 1TXUA 2F8AA 20GSA 2JU5A 2R2JA 1KEBA 4TKYA 5A5KA 2H1LA 2DIYA 4GCIA 3FHKA 5D9TA 2FD3A 4L5LA 1R5PA 1GL8A 1ZOFA 3UL3A 2O8VB 4HDEA 4PX1A 1X0RA 9GSSA 1T4YA 2NPBA 1XPVA 1K0BA 3KP9A 4BVYB 2HSMB 4MDCA 1TKDB 5ID2B 1XW5A 3GNJA 3ERWA 4K5SA 4F9ZA 2HRFA 5DBQA 2DLXA 6GSVA 1ACVA 2GSQA 4PTSA 4PNFA 4LL1B 3H4KA 2R5GA 3CSIA 3FRCA 3Q74A 2B6MA 1AQXA 3RHBA 4DEJA 1Z7PA 3GX8A 5GAPD 2B7JA 2NDOA 3RBTA 4MA9A 3FY7A 3RHCA 5J4UA 3TJBA 1EOHA 2NTOA 4I8BA 3BCIA 2IFQB 2K8VA 5A4WA 4NXIA 5KN3A 2UV8G 1JLWA 3DRNA 4ZB9A 3P90A 2N5BA 3LEFA 3F4TA 3QAVA 1SL0B 2EIOA 3CBUA 1A2LA 4RQXA 4MH3A 3H1NA 2FNOA 4TR1A 4WBRD 3M9JA 1K0NA 3RAZA 1FAAA 1M2DA 2YV9A 2OE3A 3TDGA 2YOIA 3GL5A 3GIXA 1F9MA 2H76A 4RQRA 2G0FA 2O85A 5HFKA 3C1SA 5CP1A 4DSQA 5DQSA 4YAPA 4JR4A 4EIQA 4V2NA 4O92A 2ON7A 1F37A 4Q5RA 5F0GA 1QMVA 2JZTA 2IMFA 2WGRA 3NZNA 4IP1A 3HJOA 1Z7RA 5EVOA 1GTAA 2X99A 2GDRA 5FWGA 2VAFA 2R0PA 4YQUA 1Y6EA 3A2WA 3CMIA 2CZ3A 2X8CA 1V9WA 1T1VA 4J57E 3ZFLA 3EINA 1OVNA 2KP2A 1VRSD 3I43A 5J3RA 4ZBBA 4USSA 4TXOA 3G7JA 1OE7A 4K0NA 4XS6A 2H66A 2H74A 5CRDA 3KZQA 3WGEA 3WD6A 5COHA 3I69A 1TRWA 1NM3A 4MF5A 2B1LA 2CZ2A 4HQZA 1TOFA 4ZB7A 2GTUA 1X5CA 1SYXA 4ULXA 1YY7A 3HJMA 4V1Ap 2LJAA 2KLXA 2F9SA 3N9JA 3UBKA 2AB6A 2YWIA 3KEBA 2VLUA 1TTZA 3HXSA 2PUKC 2LSTA 5ELGA 4TRXA 2L6DA 3MWHA 6GSSA 3TCOA 4WXTA 1TRVA 2HRKA 4PXOA 4ILFA 3ZMLA 3W6GA 2YANA 2VL9A 3C71A 5L71A 3Q6OA 1R7HA 1OC9B 5G1KA 4AJ7A 2HSNA 4DVCA 4OMVA 1IYIA 4EE0A 2QC7A 1WRYA 1Z6MA 3DXBA 1F6MC 4HS1A 4JZQA 3EU3A 4KNDA 4ZILA 3U5RE 4BVYA 6GSWA 2HSMA 3IHGA 3M3MA 4IBPA 5ECIB 3S9FA 1G7OA 1EP7A 1ERTA 2WS2A 1YZXA 1SL2B 1ZL9A 4I5QA 1U3AA 1NSWA 4XCSA 5ECPB 2OA7A 4L0WA 1T7PB 5GSTA 4KB3A 3LORA 1SK2A 1VF1A 2ZCTA 1FB6A 2GQMA 1HNBA 1YQ1A 4HUAA 1O7UA 2CVDA 4FQUA 1THOA 1M9BA 3HDCA 3IC8A 1QFNA 1WMJA 2IFQA 1UN2A 1X9SB 1TK5B 1JZOA 4IJIA 2C0GA 1EEJA 1XWAA 4JRRA 3FR3A 1SYRA 5C04A 1M7TA 2MBSA 4XRDA 4HZ4A 1VGLA 2D2ZA 2PU9C 2GZZA 2CAQA 1Y25A 3KCMA 4Z2TA 4IELA 4H86A 5LCZA 3E9JB 2JZSA 4OO4A 3HD5A 1PMTA 3C8EA 5ECNB 4HU7A 1J0FA 1XOAA 1WJKA 2RM6A 1XWBA 3IDVA 2LS5A 2DJ0A 3NIVA 5D93A 3D4TA 3GSSA 2YN1A 3M8NA 4K2XA 1T4ZA 2H71A 4BWSA 3AY8A 1IYHA 5B7CA 5A5HB 4FYCA 3GN3A 4GDFA 2PN8A 3TUEA 1WP0A 1PA3A 3O76A 3H79A 1O73A 4MABA 1VF2A 2H6XA 1K0CA 4BPYA 1U3IA 1SK0A 4JR6A 2V6KA 5CYYA 4KSOA 6GSYA 3GTUB 3PH9A 4WF4A 2O7KA 4WEYA 1EP8A 3TOTA 3F3RA 1ZGNA 2PBJA 2FLSA 2JSYA 3IR4A 1F3BA 1M2BA 2IMDA 3EYTA 2BMXA 2XBQA 4EVMA 2IN3A 2WULA 2KP1A 3HZ8A 4KW6A 4TR3A 4E8EA 2P5QA 2YNXA 1B9YC 2LJKA 2MMAA 4PQHA 5ECSA 3UIWA 2N5FA 4X4JA 1YDKA 3D21A 1EV4A 5IOXA 1SJZA 4F82A 1Z9HA 3KTLA 1JFUA 3F3QA 2C0EA 3UVTA 4Z2RA 2A2SA 1XWCA 2GS3A 3QMXA 3VFIA 1OC9A 3P7XA 3TU3B 2B1KA 2E2GA 1YKAA 3HCZA 4EKZA 11GSA 2LKUA 2DMLA 1TU7A 2K6VA 1LU4A 4OCEA 4MF6A 3H8QA 3WT2A 3GYKA 5GSSA 4HEA2 5H5QA 3L4NA 3F63A 2JL4A 2C3QA 2PVQA 4OWYA 2V41A 4X43A 3BD2A 5IO0A 3MDKA 4HOJA 3RPNA 2EC4A 2FY6A 5JCWA 2A2RA 3F4RA 3M9KA 1H75A 3F6FA 1GH2A 1URMA 2LRTA 2A4VA 1EGOA 5HQPA 1V58A 2YZUA 1U87A 4G10A 4L0UA 2L4CA 1DE2A 5HFIA 1XW6A 2H6YA 3LFLA 3Q18A 4O5UA 1K0AA 3ZFBA 1TRSA 3CSJA 5HR0A 3BJ5A 4G0IA 3VURA 22GSA 3KMNA 2VIMA 1A8LA 5IMFA 1GUKA 4KAEA 3TKPA 4CHSA 2CQ9A 5ECMB 3D5JA 4XS4B 3TKQA 4POMA 3TKSA 5EL8A 1H4OA 5H5SA 2QA1A 2HE3A 1GUHA 4GXZA 4ECIA 4GRFA 4LL4B 3D22A 4MF7A 4DSSB 3TRXA 4NV5A 4BL7B 4K5RA 2H73A 4ICYA 3TJGA 4ZB6A 1BX9A 2HSNB 1TI1A 2VOCA 1QK8A 2YJ7A 3L9VA 5J41A 1W89A 1GWCA 3A5IA 5A5HA 5KEJA 1QQ2A 3GURA 5IIZA 2H1DA 2DJ1A 3KD0A 3GV1A 1PGTA 4KA0A 1BF5A 4POLA 4IP6A 1A2JA 3CXGA 1AW9A 4BVXB 5KOXA 4EDZA 2L5OA 3GTUA 4EC0A 5ECHB 4K7IA 4WKWA 4KH7A 2O87A 1SVLA 2VD1A 2FCHA 2JACA 5D8IA 2A4HA 4KE3A 3UAPA 3E0UA 5ECRB 4LMWA 3HVSA 1SVOA 1KTEA 4TN8A 2XHFA 1G6WA 4HJMA 1M9AA 1MD4A 5D9XA 5AIXA 4HQSA 2XPDA 1V40A 4N3ZA 4CW9A 1PRXA 1BG5A 4K0GA 1UC7A 2VLVA 4O5RA 2R6KA 1BAYA 4QQ7A 5JCGA 3DD3A 2LQQA 5KN0A 4ZIJA 5HR2A 3MAKA 5IMCA 3QFBC 2WRTA 3FR9A 1PX7A 3IAS2 1GLQA 3L9UA 2EFEA 4MZWA 2LV3A 3JCML 2E7PA 3QR6A 1O8WA 2EFCA 4ZL9A 4W66A 5KN2A 2OJLA 1GULA 2DKIA 4JU5A 2YWOA 1J9BA 2FA4A 4HZ2A 4IHUA 2P5RA 4IN0A 4G01A 2GQLA 3FZ5A 1GSSA 1MTCA 5B8AA 4MJBA 4YQMA 3WYWA 3G9BA 4D73B 5A1NB 1PD21 2H70A 1SKSB 1XCCA 1ST9A 5DCGA 4ZL8A 1PSQA 13GSA 1ZYNA 3IXRA 1J08A 2FUG2 5DALB 2ZNMA 4I2UA 2IMIA 4K2DA 2WB9A 2VCVA 3EE2A 4RI7A 1MDJA 4Z2UA 3GMFA 2K8SA 3IRAA 2YP6A 4I6XA 4XS4A 2DC5A 3IK9A 4NWYA 1XWGA 1SJIA 2WDUA 2MMOA 5IMDA 5ECQB 4J56E 1S3DA 3I6AA 3H93A 3GH9A 3LWAA 2HRNA 5DJLA 4MLYA 3TKSC 3EMXA 2NVLA 2DSAA 2J9HA 1GNWA 2YZHA 3HA9A 4DSSA 3LXZA 4G2EA 4BL7A 3CWGA 2V32A 1OAZA 2REMA 3M0FA 4ACSA 3LXTA 2B5EA 1FOVA 3KGKA 1G7EA 1X9MB 5J4VA 3L0HA 5EY6A 2HNLA 4XS1A 2GSTA 1A0RP 4MMMA 4IKHA 1DUGA 1NW2A 3PPUA 1HYUA 1WE0A 4RI6A 5DVBA 3IA1A 4EXJA 2YWMA 2HRAA 3GKNA 2JSZA 1LJRA 4PUAA 4KCAA 2DMMA 2PGTA 3TRQA 1YEPA 5F8BA 2VCQA 1K3LA 4KGIA 2CAIA 1R4WA 4BVXA 2TRCP 5CNWA 5J9BA 1HNAA 1PL2A 5F06A 2CX4A 1A23A 4O32A 3PINA 2WZ9A 3ERFA 3D6IA 1Z5YE 1GTUA 1OKDA 4XRAA 4GSSA 1AUCA 1SENA 2PPTA 4LMVA 3LYPA 3WGDA 2IPAA 5IO2A 4E68A 2H6ZA 4NAXA 1PKZA 2OE0A 3C7MA 3I9V2 1VF3A 3KIJA 2IJYA 2R0GA 1XVWA 1BQ7A 2VCTA 2DJJA 4KDUA 2HXKA 5CREA 5GAND 3TRPA 5HR3A 2GGTA 2CT6A 3UEMA 4K9ZA 3PR8A 3Q19A 4GQFA 4ECCA 4L5OA 2V6OA 5A4VA 2FWGA 5D73A 3GKMA 3VK9A 2VCXA 2PVOC 5B8BA 2H1GA 1JLVA 4PQ1A 3HHVA 1WWJA 2WFCA 3RDWA 4O7HA 2RM5A 3VWWA 3CTFA 3DMLA 3A3TA 1O8XA 3ZTLA 4JBBA 1EGRA 1MD3A 1BJXA 1B9XC 3GL3A 2B5XA 5ELAA 4EO3A 1B8XA 5LNKe 3QOUA 5LD0A 4G19A 3VPTA 4PUFC 1VF4A 3KP8A 1K3OA 2FGXA 3ZLPA 2AAWA 2YWNA 2HI7A 4CDOA 2I4AA 2M72A 14GSA 4D73A 5A1NA 2IL3A 2ALBA 1GRXA 1YF1A 2VD0A 5DALA 1R26A 2C0DA 4KDXA 3MNGA 1OYJA 4IQ1A 1FB0A 3WGXA 4Q5FA 3GFKA 3MSZA 4N0ZA 1EWXA 1ML6A 4QL7A 2LJRA 3NOFA 3D0ZA 2GZPA 1QUWA 1TRUA 1RK4A 4MJEA 2FA8A 3GH6A 4GSTA 2KHPA 3LW9A 4YQVA 2V1MA 1NHOA 5IMZA 3TGZA 5IMAA 1N8JA 2C4JA 3QDNA 4AKIA 4MP4A 3KH9A 3UMAA 1MDKA 3IAM2 2V2GA 2OKAA 4FH8A 2R37A 3F0IA 1G0TA 2ON5A 1V2AA 3IE3A 3VI7A 1YVLA 3UJ1A 4N0VA 2LUSA 3FMWA 4EUYA 10GSA 6GSTA 4FIWA 4K7OA 4MNNA 4ID0A 2H30A 4X1UA 4AF2A 2N5AA 4AKXB 2GZYA 4NPBA 2RLIA 2GLRA 2VL2C 2H0HA 2PWJA 2JADA 3RPPA 4YAVA 1GSFA 2HYXA 3G7IA 1X5EA 1QGVA 1ERWA 3GA4A 4A5PA 4JE1A 4X0XA 2X8HA 3HVXA 2GVPA 2H75A 1M2AA 2LRNA 1E2YA 4OCFA 5FT3A 2LTKA 2L6CA 2HT9A 3GSTA 4YH2A 4JEDA 5AIVA 4KSMA 1AIUA 5JWOB 3FK8A 4OD7A 5BMUB 4RUVA 4N30A 4CY6A 3M1GA 2X64A 5HFGA 2GT6A 4WF5A 3WT1A 4TXVA 4QL9A 3ERGA 4WR5A 3IV4A 3K8NA 3ZZXA 1ZYPA 4HU9A 1A0FA 4LLRA 3UARA 1XXUA 3R3EA 4DSRA 1WPIA 4I2TA 1N25A 2MMZA 3ME8A 3QAGA 3KMOA 2TIRA 1HNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHY A;  3BOA A;  3SBC A;  1Q98 A;  4K7N A;  5GZZ B;  1S3A A;  1X9W B;  3ZRE A;  5B6N A;  1GLP A;  2RUF A;  1TXX A;  1HD2 A;  2G2Q A;  4V2L A;  1I5G A;  5G2Z A;  18GS A;  2P0G A;  3ZRD A;  1EEM A;  1C72 A;  1FG4 A;  1GSE A;  1AXD A;  3APQ A;  5G30 A;  3LG6 A;  5KN1 A;  4XIH A;  2E0Q A;  5E4W A;  1TP9 A;  2F3M A;  4OFM A;  4MPG A;  3HY2 A;  5ENU A;  5G1L A;  1SL1 B;  3TOU A;  4TVE A;  5AGY A;  4MZC A;  2R3X A;  5F05 A;  1ZYE A;  4V1A g;  1TK8 B;  1JHB A;  4NMU A;  2PER A;  1V57 A;  3ISO A;  5E59 A;  5C00 A;  2MMN A;  1DBY A;  2OBK A;  4ZL7 A;  3HVV A;  4J2F A;  2DJ2 A;  5INY A;  4ZBD A;  3E3E A;  1OE8 A;  2EIQ A;  4I97 A;  2H1A A;  5IPH A;  2C1Y A;  4G0K A;  7GSS A;  2B5Y A;  2C8U A;  4NHW A;  5FHI A;  1JZD A;  2KUC A;  1B48 A;  1GNE A;  2HZF A;  1PX6 A;  4MCU A;  1EV9 A;  3KTB A;  2HSY A;  2C0F A;  4FYU A;  4PGT A;  2KOK A;  2LNS A;  1Q4J A;  2BJX A;  3GKK A;  2EIR A;  1FHE A;  2E2M A;  2CX3 A;  1XOB A;  4K6X A;  1GSQ A;  3SWL A;  4EF0 A;  3UBL A;  4KX4 A;  3QD9 A;  1OC3 A;  4PNG A;  4ZXG A;  1K0O A;  1MEK A;  5CRH A;  1AQV A;  4GTU A;  5DCH A;  4OFN A;  1FW1 A;  2DIZ A;  3GX0 A;  4IGJ A;  2NBS A;  2VO4 A;  4XTS A;  5ECO B;  1TDI A;  3VI5 A;  1F2E A;  1QXH A;  5DAK B;  2GT5 A;  2VM2 A;  2B3S A;  3GHA A;  2WCI A;  5DQY A;  1A8Y A;  3J7Y k;  4IW9 A;  3FKF A;  1SJ6 A;  3CRU A;  2I3Y A;  2I1U A;  1O85 A;  1TW9 A;  4IS0 A;  3APS A;  4IVF A;  5CAX A;  4TR0 A;  3HZ4 A;  5ECL B;  3ZMK A;  5BMU A;  3W8S A;  3VWX A;  5J5N A;  4NHZ A;  5H5R A;  3ZYW A;  2MZC A;  4K1F A;  1S3C A;  3FR6 A;  1GSU A;  2JZR A;  1GSY A;  4MPF A;  1U6T A;  2K9F A;  2IME A;  1ABA A;  2AUV A;  1N2A A;  1WOU A;  1SU9 A;  3HYP A;  4F03 A;  2CVK A;  2K18 A;  4LA1 A;  2C3N A;  1UA5 A;  5IM9 A;  1M99 A;  2DBC A;  2CV4 A;  4EDY A;  1FVJ A;  1OC8 A;  1AC1 A;  1RQM A;  1A2M A;  2VL3 A;  5D96 A;  4MK3 A;  1G6Y A;  5F07 A;  3DKS A;  5IPG A;  3ZL5 A;  1EOG A;  5IMV A;  4BA7 A;  4GQC A;  3DVX A;  3UVH A;  1GUM A;  3HJP A;  1T00 A;  1XFL A;  3LJR A;  2C3T A;  2IMK A;  3O3T A;  4MJA A;  2FWE A;  2DJK A;  1XWK A;  16GS A;  4V2M A;  2AV4 A;  1GTB A;  2C80 A;  3EMP A;  5B6M A;  2HZE B;  2VL2 A;  2VM1 A;  1ZCP A;  5HR1 A;  1XZO A;  4E8H A;  3DVW A;  3IOS A;  1K0M A;  2HLS A;  1GSD A;  1USB A;  1T8E B;  2R4V A;  3ZIJ A;  1AQW A;  2OE1 A;  1ON4 A;  5D9W A;  3DYR A;  3FYG A;  3D4M A;  1HQO A;  1OKT A;  2AJQ B;  3VPQ A;  3R2Q A;  3LYK A;  2FHE A;  2XPE A;  3FZA A;  3QPM A;  3KJY A;  2MBT A;  5CRG A;  4Q5N A;  1XIY A;  1MDI A;  4OFT A;  5JCU A;  1PKW A;  4AJ6 A;  3U6V A;  4PUR A;  2L57 A;  2CVB A;  2H01 A;  2L59 A;  1FO5 A;  1SKR B;  5ID2 A;  3IC4 A;  4KCE A;  1XW9 A;  2CA8 A;  6GSX A;  3IBH A;  3L78 A;  3C73 A;  3QFA C;  2QGV A;  3F6D A;  4ML1 A;  3EC3 A;  4AJ8 A;  3PGT A;  5CO3 A;  1SKW B;  3EUR A;  3O6T A;  3J7Y b;  4BWQ A;  4POK A;  3CYN A;  1THX A;  2OAC A;  1ZZY A;  1PL1 A;  2LEG A;  2OBI A;  2P31 A;  2TRX A;  2XBI A;  2M80 A;  1XBS A;  3F9U A;  2BTO T;  5DJM A;  3DIE A;  3LQ7 A;  1JZW A;  1RW1 A;  2H72 A;  1ERV A;  8GSS A;  3CSH A;  3ZIV A;  4F0B A;  5DAK A;  5ECK B;  4MZB A;  1PN9 A;  2ZUP A;  5IQY A;  2F51 A;  1O81 A;  2OAD A;  1K0D A;  3GRX A;  1W4V A;  5IOW A;  1M0U A;  2H0I A;  1F3A A;  2GSR A;  2X8G A;  4MJC A;  4AGS A;  3GKX A;  2QKE A;  2UZ8 A;  5G5E A;  2VLT A;  2FWF A;  3KH7 A;  3TKS E;  3UOM A;  4ZBA A;  1JZR A;  2PMT A;  2HFD A;  3KM6 A;  3DGQ A;  3VWV A;  1ZYQ B;  3TJF A;  2HSH A;  2GSS A;  3TB2 A;  2J23 A;  2FWH A;  4WET A;  3EU4 A;  3DWV A;  1CQH A;  1I9D A;  4FYB A;  1PQN A;  5AN1 A;  3V1W A;  3CTG A;  1BED A;  1R5A A;  5ABR A;  19GS A;  5A4U A;  1TJD A;  3N5O A;  4ZB8 A;  2YPM A;  4F2I A;  1SD8 A;  1U88 A;  4TOP A;  3QAW A;  4KDY A;  2GQK A;  3G7Y A;  1SK1 A;  4ECB A;  1V98 A;  2H19 A;  2XC2 A;  3BBY A;  3P2A A;  4G0L A;  3FZ9 A;  3TJJ A;  4GF0 A;  2L4Q A;  5EPF A;  3IK7 A;  5DDL A;  1ILO A;  1CQG A;  4XHM A;  3A5W A;  3P8W A;  4N10 A;  2LQO A;  2H0G A;  1BYE A;  2ES7 A;  2YCD A;  4Z7X A;  1TI3 A;  3FEU A;  4K8M A;  5G31 A;  3L9S A;  1YKC A;  2I9H A;  3TJK A;  4POB A;  1DSB A;  2HZE A;  5G5F A;  4HJ2 A;  4IQA A;  3OR5 A;  4ISD A;  2L5L A;  3GUS A;  3IHQ A;  2YV7 A;  1KNG A;  2LNT A;  1YEX A;  2B7K A;  1K3Y A;  1O6J A;  4L8E A;  4PQI A;  1WIK A;  3DEX A;  2MYG A;  4WR4 A;  1YJ6 A;  4TR1 B;  3EWL A;  3ZIT A;  3W8J A;  2HQT A;  1Z6N A;  2LRC A;  3LGC A;  4MH2 A;  3KXO A;  4KF9 A;  2VCW A;  1GP1 A;  1Z3E A;  2DJ3 A;  3LSZ A;  1B4P A;  2RII A;  3IPZ A;  4KUN A;  4N11 A;  1UVZ A;  1B4Q A;  1DE1 A;  2IWT A;  5J9C A;  1T3B A;  3A2V A;  3VLN A;  6GSU A;  3A2X A;  3TKR A;  5JWR B;  4FO5 A;  4P3Y B;  4F0C A;  2QSI A;  3EVI A;  3ED3 A;  1GTI A;  2RUE A;  4GLT A;  3ZVJ D;  2VCZ A;  4TXO B;  17GS A;  3CRT A;  1A24 A;  4HI7 A;  5AIS A;  1TU8 A;  4GSN A;  1XVQ A;  1EZK A;  2AYT A;  4ECJ A;  3ME7 A;  4GWR A;  1E6B A;  4NV2 A;  4TW5 A;  5CRW A;  3ZVJ A;  4WBJ A;  4TR4 A;  3BCK A;  4Q5Q A;  12GS A;  5JWQ B;  2IIY A;  1TK0 B;  3VWU A;  5D9V A;  4OO5 A;  3US3 A;  2Z9S A;  2O89 A;  2I81 A;  3HKR A;  3C1R A;  2M46 A;  4ML6 A;  2WJU A;  2AHE A;  3FW2 A;  1SD9 A;  2F8F A;  2YJH A;  3F4S A;  1FVK A;  3F8U A;  3QCP A;  1LBK A;  2H1B A;  2H8L A;  3FZ4 A;  1AAZ A;  1ZMA A;  1YF0 A;  4IJ3 A;  4EL1 A;  1X5D A;  3APO A;  1KBN A;  4G9H A;  2VUP A;  1ERU A;  2HRK B;  2F8A A;  20GS A;  2JU5 A;  2R2J A;  1KEB A;  4TKY A;  5A5K A;  2DIY A;  4GCI A;  3FHK A;  5D9T A;  2FD3 A;  4L5L A;  1R5P A;  1GL8 A;  1ZOF A;  3UL3 A;  2O8V B;  4HDE A;  4PX1 A;  1X0R A;  9GSS A;  1T4Y A;  2NPB A;  1XPV A;  1K0B A;  3KP9 A;  4BVY B;  2HSM B;  4MDC A;  1TKD B;  5ID2 B;  1XW5 A;  3GNJ A;  3ERW A;  4F9Z A;  2HRF A;  5DBQ A;  2DLX A;  6GSV A;  1ACV A;  2GSQ A;  4PTS A;  4PNF A;  4LL1 B;  3H4K A;  2R5G A;  3CSI A;  3FRC A;  3Q74 A;  2B6M A;  1AQX A;  3RHB A;  4DEJ A;  1Z7P A;  3GX8 A;  5GAP D;  2B7J A;  2NDO A;  3RBT A;  4MA9 A;  3FY7 A;  3RHC A;  5J4U A;  3TJB A;  1EOH A;  2NTO A;  4I8B A;  3BCI A;  2IFQ B;  2K8V A;  5A4W A;  4NXI A;  5KN3 A;  1JLW A;  3DRN A;  4ZB9 A;  3P90 A;  2N5B A;  3LEF A;  3F4T A;  3QAV A;  1SL0 B;  2EIO A;  3CBU A;  1A2L A;  4RQX A;  4MH3 A;  3H1N A;  2FNO A;  4TR1 A;  4WBR D;  3M9J A;  1K0N A;  3RAZ A;  1FAA A;  1M2D A;  2YV9 A;  2OE3 A;  3TDG A;  2YOI A;  3GL5 A;  3GIX A;  1F9M A;  2H76 A;  4RQR A;  2G0F A;  2O85 A;  5HFK A;  3C1S A;  5CP1 A;  4DSQ A;  5DQS A;  4YAP A;  4JR4 A;  4V2N A;  4O92 A;  2ON7 A;  1F37 A;  4Q5R A;  5F0G A;  1QMV A;  2JZT A;  2IMF A;  2WGR A;  3NZN A;  4IP1 A;  3HJO A;  1Z7R A;  5EVO A;  1GTA A;  2X99 A;  2GDR A;  5FWG A;  2VAF A;  4YQU A;  1Y6E A;  3A2W A;  3CMI A;  2CZ3 A;  2X8C A;  1V9W A;  1T1V A;  4J57 E;  3ZFL A;  3EIN A;  1OVN A;  2KP2 A;  1VRS D;  3I43 A;  5J3R A;  4ZBB A;  4USS A;  4TXO A;  3G7J A;  1OE7 A;  4K0N A;  4XS6 A;  2H66 A;  2H74 A;  5CRD A;  3KZQ A;  3WGE A;  3WD6 A;  5COH A;  3I69 A;  1TRW A;  1NM3 A;  4MF5 A;  2B1L A;  2CZ2 A;  4HQZ A;  1TOF A;  2GTU A;  1X5C A;  1SYX A;  4ULX A;  1YY7 A;  3HJM A;  4V1A p;  2LJA A;  2KLX A;  2F9S A;  3N9J A;  3UBK A;  2AB6 A;  2YWI A;  3KEB A;  2VLU A;  1TTZ A;  3HXS A;  2PUK C;  2LST A;  5ELG A;  4TRX A;  2L6D A;  3MWH A;  6GSS A;  3TCO A;  4WXT A;  1TRV A;  2HRK A;  4PXO A;  4ILF A;  3ZML A;  3W6G A;  2YAN A;  2VL9 A;  3C71 A;  5L71 A;  3Q6O A;  1R7H A;  1OC9 B;  5G1K A;  4AJ7 A;  4DVC A;  4OMV A;  1IYI A;  4EE0 A;  2QC7 A;  1WRY A;  1Z6M A;  3DXB A;  1F6M C;  4HS1 A;  4JZQ A;  3EU3 A;  4KND A;  4ZIL A;  3U5R E;  4BVY A;  6GSW A;  2HSM A;  3M3M A;  4IBP A;  5ECI B;  3S9F A;  1G7O A;  1EP7 A;  1ERT A;  2WS2 A;  1YZX A;  1SL2 B;  1ZL9 A;  4I5Q A;  1U3A A;  1NSW A;  4XCS A;  5ECP B;  2OA7 A;  4L0W A;  1T7P B;  5GST A;  4KB3 A;  3LOR A;  1SK2 A;  1VF1 A;  2ZCT A;  1FB6 A;  2GQM A;  1HNB A;  1YQ1 A;  4HUA A;  1O7U A;  2CVD A;  4FQU A;  1THO A;  1M9B A;  3HDC A;  3IC8 A;  1QFN A;  1WMJ A;  2IFQ A;  1UN2 A;  1X9S B;  1TK5 B;  1JZO A;  4IJI A;  2C0G A;  1EEJ A;  1XWA A;  4JRR A;  3FR3 A;  1SYR A;  5C04 A;  1M7T A;  2MBS A;  4XRD A;  4HZ4 A;  1VGL A;  2D2Z A;  2PU9 C;  2GZZ A;  2CAQ A;  1Y25 A;  3KCM A;  4IEL A;  4H86 A;  5LCZ A;  3E9J B;  2JZS A;  4OO4 A;  3HD5 A;  1PMT A;  3C8E A;  5ECN B;  4HU7 A;  1J0F A;  1XOA A;  1WJK A;  2RM6 A;  1XWB A;  3IDV A;  2LS5 A;  2DJ0 A;  3NIV A;  5D93 A;  3D4T A;  3GSS A;  2YN1 A;  3M8N A;  1T4Z A;  2H71 A;  4BWS A;  3AY8 A;  1IYH A;  5B7C A;  4FYC A;  3GN3 A;  2PN8 A;  3TUE A;  1WP0 A;  1PA3 A;  3O76 A;  3H79 A;  1O73 A;  4MAB A;  1VF2 A;  2H6X A;  1K0C A;  4BPY A;  1U3I A;  1SK0 A;  4JR6 A;  2V6K A;  5CYY A;  4KSO A;  6GSY A;  3GTU B;  3PH9 A;  4WF4 A;  2O7K A;  4WEY A;  1EP8 A;  3TOT A;  3F3R A;  1ZGN A;  2PBJ A;  2FLS A;  2JSY A;  3IR4 A;  1F3B A;  1M2B A;  2IMD A;  3EYT A;  2BMX A;  2XBQ A;  4EVM A;  2IN3 A;  2WUL A;  2KP1 A;  3HZ8 A;  4KW6 A;  4TR3 A;  4E8E A;  2P5Q A;  2YNX A;  1B9Y C;  2LJK A;  2MMA A;  4PQH A;  5ECS A;  3UIW A;  2N5F A;  1YDK A;  3D21 A;  1EV4 A;  5IOX A;  1SJZ A;  4F82 A;  1Z9H A;  3KTL A;  1JFU A;  3F3Q A;  2C0E A;  3UVT A;  2A2S A;  1XWC A;  2GS3 A;  3QMX A;  3VFI A;  1OC9 A;  3P7X A;  2B1K A;  2E2G A;  1YKA A;  3HCZ A;  4EKZ A;  11GS A;  2LKU A;  2DML A;  1TU7 A;  2K6V A;  1LU4 A;  4OCE A;  4MF6 A;  3H8Q A;  3WT2 A;  3GYK A;  5GSS A;  4HEA 2;  5H5Q A;  3L4N A;  3F63 A;  2JL4 A;  2C3Q A;  2PVQ A;  4OWY A;  2V41 A;  4X43 A;  3BD2 A;  5IO0 A;  3MDK A;  4HOJ A;  3RPN A;  2EC4 A;  2FY6 A;  5JCW A;  2A2R A;  3F4R A;  3M9K A;  1H75 A;  3F6F A;  1GH2 A;  1URM A;  2LRT A;  2A4V A;  1EGO A;  5HQP A;  1V58 A;  2YZU A;  1U87 A;  4G10 A;  4L0U A;  2L4C A;  1DE2 A;  5HFI A;  1XW6 A;  2H6Y A;  3LFL A;  3Q18 A;  1K0A A;  3ZFB A;  1TRS A;  3CSJ A;  5HR0 A;  3BJ5 A;  4G0I A;  3VUR A;  22GS A;  3KMN A;  2VIM A;  1A8L A;  5IMF A;  1GUK A;  4KAE A;  3TKP A;  4CHS A;  2CQ9 A;  5ECM B;  3D5J A;  4XS4 B;  3TKQ A;  4POM A;  3TKS A;  5EL8 A;  1H4O A;  5H5S A;  2HE3 A;  1GUH A;  4GXZ A;  4ECI A;  4GRF A;  4LL4 B;  3D22 A;  4MF7 A;  4DSS B;  3TRX A;  4NV5 A;  4BL7 B;  2H73 A;  3TJG A;  4ZB6 A;  1BX9 A;  2HSN B;  1TI1 A;  2VOC A;  1QK8 A;  2YJ7 A;  3L9V A;  5J41 A;  1W89 A;  1GWC A;  5KEJ A;  1QQ2 A;  3GUR A;  5IIZ A;  2H1D A;  2DJ1 A;  3KD0 A;  3GV1 A;  1PGT A;  4KA0 A;  4POL A;  4IP6 A;  1A2J A;  3CXG A;  1AW9 A;  4BVX B;  4EDZ A;  2L5O A;  3GTU A;  4EC0 A;  5ECH B;  4K7I A;  4WKW A;  4KH7 A;  2O87 A;  2VD1 A;  2FCH A;  2JAC A;  5D8I A;  4KE3 A;  3UAP A;  3E0U A;  5ECR B;  4LMW A;  3HVS A;  1KTE A;  4TN8 A;  2XHF A;  1G6W A;  4HJM A;  1M9A A;  1MD4 A;  5D9X A;  5AIX A;  4HQS A;  2XPD A;  1V40 A;  4CW9 A;  1PRX A;  1BG5 A;  4K0G A;  1UC7 A;  2VLV A;  4O5R A;  2R6K A;  1BAY A;  4QQ7 A;  5JCG A;  3DD3 A;  2LQQ A;  5KN0 A;  4ZIJ A;  5HR2 A;  3MAK A;  5IMC A;  3QFB C;  2WRT A;  3FR9 A;  1PX7 A;  3IAS 2;  1GLQ A;  3L9U A;  4MZW A;  2LV3 A;  3JCM L;  2E7P A;  3QR6 A;  1O8W A;  4ZL9 A;  5KN2 A;  2OJL A;  1GUL A;  4JU5 A;  2YWO A;  1J9B A;  2FA4 A;  4HZ2 A;  4IHU A;  2P5R A;  4IN0 A;  2GQL A;  3FZ5 A;  1GSS A;  1MTC A;  5B8A A;  4MJB A;  4YQM A;  3WYW A;  3G9B A;  4D73 B;  1PD2 1;  2H70 A;  1SKS B;  1XCC A;  1ST9 A;  5DCG A;  4ZL8 A;  1PSQ A;  13GS A;  3IXR A;  1J08 A;  2FUG 2;  5DAL B;  2ZNM A;  4I2U A;  2IMI A;  4K2D A;  2WB9 A;  2VCV A;  3EE2 A;  4RI7 A;  1MDJ A;  3GMF A;  2K8S A;  3IRA A;  2YP6 A;  4I6X A;  4XS4 A;  2DC5 A;  3IK9 A;  4NWY A;  1XWG A;  1SJI A;  2WDU A;  2MMO A;  5IMD A;  5ECQ B;  4J56 E;  1S3D A;  3I6A A;  3H93 A;  3GH9 A;  3LWA A;  2HRN A;  5DJL A;  4MLY A;  3TKS C;  3EMX A;  2NVL A;  2DSA A;  2J9H A;  1GNW A;  2YZH A;  3HA9 A;  4DSS A;  3LXZ A;  4G2E A;  4BL7 A;  2V32 A;  1OAZ A;  2REM A;  3M0F A;  4ACS A;  3LXT A;  2B5E A;  1FOV A;  3KGK A;  1G7E A;  1X9M B;  3L0H A;  5EY6 A;  2HNL A;  4XS1 A;  2GST A;  1A0R P;  4MMM A;  4IKH A;  1DUG A;  1NW2 A;  3PPU A;  1HYU A;  1WE0 A;  4RI6 A;  5DVB A;  3IA1 A;  4EXJ A;  2YWM A;  2HRA A;  3GKN A;  2JSZ A;  1LJR A;  4PUA A;  4KCA A;  2DMM A;  2PGT A;  3TRQ A;  1YEP A;  5F8B A;  2VCQ A;  1K3L A;  4KGI A;  2CAI A;  1R4W A;  4BVX A;  2TRC P;  5CNW A;  5J9B A;  1HNA A;  1PL2 A;  5F06 A;  2CX4 A;  1A23 A;  4O32 A;  3PIN A;  2WZ9 A;  3ERF A;  3D6I A;  1Z5Y E;  1GTU A;  1OKD A;  4XRA A;  4GSS A;  1AUC A;  1SEN A;  2PPT A;  4LMV A;  3LYP A;  3WGD A;  2IPA A;  5IO2 A;  2H6Z A;  4NAX A;  1PKZ A;  2OE0 A;  3C7M A;  3I9V 2;  1VF3 A;  3KIJ A;  2IJY A;  1XVW A;  1BQ7 A;  2VCT A;  2DJJ A;  4KDU A;  2HXK A;  5CRE A;  5GAN D;  3TRP A;  5HR3 A;  2GGT A;  2CT6 A;  3UEM A;  4K9Z A;  3PR8 A;  3Q19 A;  4GQF A;  4ECC A;  4L5O A;  2V6O A;  5A4V A;  2FWG A;  5D73 A;  3GKM A;  3VK9 A;  2VCX A;  2PVO C;  5B8B A;  2H1G A;  1JLV A;  4PQ1 A;  3HHV A;  1WWJ A;  2WFC A;  3RDW A;  4O7H A;  2RM5 A;  3VWW A;  3CTF A;  3DML A;  3A3T A;  1O8X A;  3ZTL A;  4JBB A;  1EGR A;  1MD3 A;  1BJX A;  1B9X C;  3GL3 A;  2B5X A;  5ELA A;  4EO3 A;  1B8X A;  5LNK e;  3QOU A;  5LD0 A;  4G19 A;  3VPT A;  4PUF C;  1VF4 A;  3KP8 A;  1K3O A;  2FGX A;  3ZLP A;  2AAW A;  2YWN A;  2HI7 A;  4CDO A;  2I4A A;  2M72 A;  14GS A;  4D73 A;  2IL3 A;  2ALB A;  1GRX A;  1YF1 A;  2VD0 A;  5DAL A;  1R26 A;  2C0D A;  4KDX A;  3MNG A;  1OYJ A;  4IQ1 A;  1FB0 A;  3WGX A;  4Q5F A;  3GFK A;  3MSZ A;  4N0Z A;  1EWX A;  1ML6 A;  4QL7 A;  2LJR A;  3NOF A;  3D0Z A;  2GZP A;  1QUW A;  1TRU A;  1RK4 A;  4MJE A;  2FA8 A;  3GH6 A;  4GST A;  2KHP A;  4YQV A;  2V1M A;  1NHO A;  5IMZ A;  3TGZ A;  5IMA A;  1N8J A;  2C4J A;  3QDN A;  4MP4 A;  3KH9 A;  3UMA A;  1MDK A;  3IAM 2;  2V2G A;  2OKA A;  4FH8 A;  2R37 A;  3F0I A;  1G0T A;  2ON5 A;  1V2A A;  3IE3 A;  3VI7 A;  3UJ1 A;  4N0V A;  2LUS A;  4EUY A;  10GS A;  6GST A;  4FIW A;  4K7O A;  4ID0 A;  2H30 A;  4X1U A;  4AF2 A;  2N5A A;  2GZY A;  4NPB A;  2RLI A;  2GLR A;  2VL2 C;  2H0H A;  2PWJ A;  2JAD A;  3RPP A;  4YAV A;  1GSF A;  2HYX A;  3G7I A;  1X5E A;  1QGV A;  1ERW A;  3GA4 A;  4JE1 A;  4X0X A;  2X8H A;  3HVX A;  2GVP A;  2H75 A;  1M2A A;  2LRN A;  1E2Y A;  4OCF A;  5FT3 A;  2LTK A;  2L6C A;  2HT9 A;  3GST A;  4YH2 A;  4JED A;  5AIV A;  4KSM A;  1AIU A;  5JWO B;  3FK8 A;  4OD7 A;  4RUV A;  4N30 A;  3M1G A;  2X64 A;  5HFG A;  2GT6 A;  4WF5 A;  3WT1 A;  4TXV A;  4QL9 A;  3ERG A;  4WR5 A;  3IV4 A;  3K8N A;  3ZZX A;  4HU9 A;  1A0F A;  4LLR A;  3UAR A;  1XXU A;  3R3E A;  4DSR A;  1WPI A;  4I2T A;  2MMZ A;  3ME8 A;  3QAG A;  3KMO A;  2TIR A;  1HNC A; 
#chains in the Genus database with same CATH topology
 1FOH A;  1NHY A;  3BOA A;  3SBC A;  1Q98 A;  4K7N A;  5GZZ B;  1S3A A;  1X9W B;  3ZRE A;  5B6N A;  1GLP A;  2RUF A;  1TXX A;  1HD2 A;  2G2Q A;  4V2L A;  1I5G A;  5G2Z A;  18GS A;  2P0G A;  3ZRD A;  1EEM A;  1C72 A;  1FG4 A;  1GSE A;  1AXD A;  3APQ A;  5G30 A;  3LG6 A;  5KN1 A;  4CY8 A;  4XIH A;  2E0Q A;  5E4W A;  1TP9 A;  2F3M A;  4OFM A;  4MPG A;  5A34 B;  3HY2 A;  5ENU A;  5G1L A;  1SL1 B;  3TOU A;  4TVE A;  5AGY A;  4MZC A;  2R3X A;  5F05 A;  1ZYE A;  4V1A g;  1TK8 B;  1JHB A;  4NMU A;  2PER A;  1V57 A;  3ISO A;  5E59 A;  5C00 A;  2MMN A;  1DBY A;  2OBK A;  4ZL7 A;  3HVV A;  4J2F A;  2DJ2 A;  5INY A;  4ZBD A;  3E3E A;  1OE8 A;  2EIQ A;  4I97 A;  2H1A A;  5IPH A;  2C1Y A;  4G0K A;  7GSS A;  2B5Y A;  2C8U A;  4NHW A;  5FHI A;  1JZD A;  2KUC A;  1B48 A;  1GNE A;  2HZF A;  4YKF A;  1PX6 A;  4MCU A;  1EV9 A;  3KTB A;  2HSY A;  2WVX B;  2C0F A;  4FYU A;  4PGT A;  2KOK A;  2X49 A;  2A2P A;  2LNS A;  5J47 A;  1Q4J A;  2BJX A;  3GKK A;  2EIR A;  1FHE A;  2E2M A;  2CX3 A;  4PI2 C;  1PN0 A;  1XOB A;  4K6X A;  1GSQ A;  3SWL A;  4EF0 A;  3UBL A;  4KX4 A;  3QD9 A;  1OC3 A;  4PNG A;  4ZXG A;  1K0O A;  1MEK A;  5CRH A;  1SVM A;  1AQV A;  4GTU A;  4AKH A;  5DCH A;  4OFN A;  1FW1 A;  2DIZ A;  3GX0 A;  4IGJ A;  2NBS A;  2VO4 A;  4XTS A;  5ECO B;  1TDI A;  3VI5 A;  1F2E A;  1QXH A;  5DAK B;  2GT5 A;  2VM2 A;  2B3S A;  3GHA A;  2WCI A;  5DQY A;  1A8Y A;  3J7Y k;  4IW9 A;  3FKF A;  1SJ6 A;  3CRU A;  2I3Y A;  2I1U A;  1O85 A;  1TW9 A;  3RGB C;  4IS0 A;  3APS A;  2QA2 A;  4IVF A;  5CAX A;  4TR0 A;  3HZ4 A;  5ECL B;  3ZMK A;  5BMU A;  3W8S A;  3VWX A;  5J5N A;  4NHZ A;  5H5R A;  3ZYW A;  2MZC A;  4K1F A;  1S3C A;  3FR6 A;  1GSU A;  2JZR A;  1GSY A;  4MPF A;  1U6T A;  2K9F A;  2IME A;  1ABA A;  2AUV A;  1N2A A;  1WOU A;  1SU9 A;  3HYP A;  4F03 A;  2CVK A;  2K18 A;  4LA1 A;  2C3N A;  1UA5 A;  5IM9 A;  1M99 A;  1BG1 A;  2DBC A;  5J4Y A;  2CV4 A;  4AKG A;  4HSC X;  4EDY A;  1FVJ A;  1OC8 A;  1AC1 A;  1RQM A;  1A2M A;  2VL3 A;  5D96 A;  1M3J A;  1Y1U A;  4MK3 A;  1G6Y A;  5F07 A;  3DKS A;  5IPG A;  3ZL5 A;  1EOG A;  5IMV A;  4BA7 A;  4GQC A;  3DVX A;  3UVH A;  1GUM A;  3HJP A;  1T00 A;  1XFL A;  3LJR A;  2C3T A;  2IMK A;  3O3T A;  4MJA A;  2FWE A;  2DJK A;  1XWK A;  16GS A;  4V2M A;  2AV4 A;  1GTB A;  2C80 A;  3EMP A;  5B6M A;  2HZE B;  2VL2 A;  2VM1 A;  1ZCP A;  5HR1 A;  1XZO A;  4E8H A;  3DVW A;  3IOS A;  1K0M A;  5A34 A;  1GSD A;  1USB A;  2HLS A;  1T8E B;  2R4V A;  3ZIJ A;  1AQW A;  2OE1 A;  1ON4 A;  5D9W A;  3DYR A;  3FYG A;  3D4M A;  1HQO A;  1OKT A;  2AJQ B;  3VPQ A;  3R2Q A;  3LYK A;  2FHE A;  2XPE A;  3FZA A;  3QPM A;  3KJY A;  2MBT A;  5CRG A;  4Q5N A;  1XIY A;  2WVZ A;  1MDI A;  2OT3 A;  4OFT A;  5JCU A;  1PKW A;  4AJ6 A;  3U6V A;  4FXY P;  4PUR A;  2CVB A;  2H01 A;  2L57 A;  2L59 A;  1FO5 A;  1SKR B;  5ID2 A;  3IC4 A;  4EIP A;  4KCE A;  2VKZ G;  1XW9 A;  2CA8 A;  6GSX A;  2WVX A;  3IBH A;  3L78 A;  3C73 A;  3QFA C;  2QGV A;  3F6D A;  4ML1 A;  3EC3 A;  4AJ8 A;  2WW2 A;  3PGT A;  2X4A A;  5CO3 A;  1SKW B;  3EUR A;  3O6T A;  3J7Y b;  3HMJ G;  4BWQ A;  4POK A;  3CYN A;  1THX A;  2OAC A;  4QMK A;  1ZZY A;  1PL1 A;  2LEG A;  2OBI A;  2P31 A;  2TRX A;  2XBI A;  2M80 A;  1XBS A;  3F9U A;  2BTO T;  5DJM A;  3DIE A;  3LQ7 A;  1JZW A;  1RW1 A;  2H72 A;  1ERV A;  8GSS A;  3CSH A;  3ZIV A;  4F0B A;  5DAK A;  5ECK B;  4MZB A;  1PN9 A;  2ZUP A;  5IQY A;  2F51 A;  1O81 A;  2OAD A;  1K0D A;  3GRX A;  1W4V A;  5IOW A;  1M0U A;  2H0I A;  1F3A A;  2GSR A;  2X8G A;  4MJC A;  4AGS A;  3GKX A;  2QKE A;  2UZ8 A;  2O5V A;  5G5E A;  2VLT A;  3CQF A;  2FWF A;  3KH7 A;  3TKS E;  3UOM A;  4ZBA A;  1JZR A;  2PMT A;  2HFD A;  3KM6 A;  3DGQ A;  3VWV A;  1ZYQ B;  3TJF A;  2HSH A;  2GSS A;  3MYD A;  3TB2 A;  2J23 A;  2FWH A;  4WET A;  5BRT A;  3EU4 A;  3DWV A;  1CQH A;  1I9D A;  4FYB A;  1PQN A;  5AN1 A;  3V1W A;  3CTG A;  1BED A;  1R5A A;  5ABR A;  19GS A;  5A4U A;  1TJD A;  3N5O A;  4ZB8 A;  2YPM A;  4F2I A;  1SD8 A;  1U88 A;  4TOP A;  3QAW A;  4KDY A;  2GQK A;  3G7Y A;  1SK1 A;  4ECB A;  1V98 A;  2H19 A;  2XC2 A;  3BBY A;  3P2A A;  4G0L A;  3FZ9 A;  3TJJ A;  4GF0 A;  4YKG A;  2L4Q A;  5EPF A;  3IK7 A;  5DDL A;  1ILO A;  3EPT A;  1CQG A;  4XHM A;  3A5W A;  2EFH A;  3P8W A;  4N10 A;  2LQO A;  2H0G A;  1BYE A;  2ES7 A;  2YCD A;  4Z7X A;  1TI3 A;  3FEU A;  4K8M A;  5G31 A;  3L9S A;  1YKC A;  2I9H A;  3TJK A;  4POB A;  1DSB A;  2HZE A;  5G5F A;  4HJ2 A;  4IQA A;  3OR5 A;  4ISD A;  2L5L A;  3GUS A;  3IHQ A;  2YV7 A;  1KNG A;  2LNT A;  1YEX A;  2B7K A;  1K3Y A;  1O6J A;  4L8E A;  4PQI A;  1WIK A;  3DEX A;  2MYG A;  4WR4 A;  1YJ6 A;  4TR1 B;  3EWL A;  3ZIT A;  3W8J A;  2HQT A;  1Z6N A;  2LRC A;  3LGC A;  4MH2 A;  3KXO A;  4KF9 A;  2VCW A;  1GP1 A;  1Z3E A;  2DJ3 A;  3LSZ A;  5J40 A;  1B4P A;  2RII A;  3IPZ A;  4KUN A;  4N11 A;  1UVZ A;  2EFD A;  1B4Q A;  1DE1 A;  2IWT A;  5J9C A;  1T3B A;  3A2V A;  3VLN A;  6GSU A;  3A2X A;  3TKR A;  5JWR B;  5KOW A;  4FO5 A;  4P3Y B;  4F0C A;  2R0C A;  3RFR C;  2QSI A;  3EVI A;  3ED3 A;  1GTI A;  2RUE A;  4GLT A;  3ZVJ D;  2VCZ A;  4TXO B;  2WW3 A;  17GS A;  3CRT A;  1A24 A;  4HI7 A;  5AIS A;  1TU8 A;  4GSN A;  1XVQ A;  1EZK A;  2AYT A;  4ECJ A;  3ME7 A;  4GWR A;  1E6B A;  4NV2 A;  4TW5 A;  5CRW A;  3ZVJ A;  4WBJ A;  4TR4 A;  4AI6 A;  3BCK A;  4Q5Q A;  12GS A;  5JWQ B;  2IIY A;  2DKH A;  1TK0 B;  4O5Q A;  3VWU A;  5D9V A;  4OO5 A;  3US3 A;  2Z9S A;  2O89 A;  2I81 A;  3HKR A;  3C1R A;  2M46 A;  3MIX A;  4ML6 A;  2WJU A;  2AHE A;  3FW2 A;  1SD9 A;  2F8F A;  2YJH A;  3F4S A;  2WW1 A;  1FVK A;  3F8U A;  1LBK A;  2H1B A;  2H8L A;  3QCP A;  3FZ4 A;  1AAZ A;  1ZMA A;  1YF0 A;  4IJ3 A;  4EL1 A;  1X5D A;  3APO A;  1KBN A;  4G9H A;  2VUP A;  1ERU A;  2HRK B;  1TXU A;  2F8A A;  20GS A;  2JU5 A;  2R2J A;  1KEB A;  4TKY A;  5A5K A;  2H1L A;  2DIY A;  4GCI A;  3FHK A;  5D9T A;  2FD3 A;  4L5L A;  1R5P A;  1GL8 A;  1ZOF A;  3UL3 A;  2O8V B;  4HDE A;  4PX1 A;  1X0R A;  9GSS A;  1T4Y A;  2NPB A;  1XPV A;  1K0B A;  3KP9 A;  4BVY B;  2HSM B;  4MDC A;  1TKD B;  5ID2 B;  1XW5 A;  3GNJ A;  3ERW A;  4K5S A;  4F9Z A;  2HRF A;  5DBQ A;  2DLX A;  6GSV A;  1ACV A;  2GSQ A;  4PTS A;  4PNF A;  4LL1 B;  3H4K A;  2R5G A;  3CSI A;  3FRC A;  3Q74 A;  2B6M A;  1AQX A;  3RHB A;  4DEJ A;  1Z7P A;  3GX8 A;  5GAP D;  2B7J A;  2NDO A;  3RBT A;  4MA9 A;  3FY7 A;  3RHC A;  5J4U A;  3TJB A;  1EOH A;  2NTO A;  4I8B A;  3BCI A;  2IFQ B;  2K8V A;  5A4W A;  4NXI A;  5KN3 A;  2UV8 G;  1JLW A;  3DRN A;  4ZB9 A;  2WW0 A;  3P90 A;  2N5B A;  3LEF A;  3F4T A;  3QAV A;  1SL0 B;  2EIO A;  3CBU A;  1A2L A;  4RQX A;  4MH3 A;  3H1N A;  2FNO A;  4TR1 A;  4WBR D;  3M9J A;  1K0N A;  3RAZ A;  1FAA A;  1M2D A;  2YV9 A;  2OE3 A;  3TDG A;  2YOI A;  3GL5 A;  3GIX A;  1F9M A;  2H76 A;  4RQR A;  2G0F A;  2O85 A;  5HFK A;  3C1S A;  5CP1 A;  4DSQ A;  5DQS A;  4YAP A;  4JR4 A;  4EIQ A;  4V2N A;  4O92 A;  2ON7 A;  1F37 A;  4Q5R A;  5F0G A;  1QMV A;  2JZT A;  2IMF A;  2WGR A;  3NZN A;  4IP1 A;  3HJO A;  1Z7R A;  1YEW C;  5EVO A;  1GTA A;  2X99 A;  2GDR A;  5FWG A;  2VAF A;  2R0P A;  4YQU A;  1Y6E A;  3A2W A;  3CMI A;  2CZ3 A;  2X8C A;  1V9W A;  2WZS A;  1T1V A;  4J57 E;  3ZFL A;  3EIN A;  1OVN A;  2KP2 A;  1VRS D;  3I43 A;  5J3R A;  4ZBB A;  4USS A;  4TXO A;  3G7J A;  1OE7 A;  4K0N A;  4XS6 A;  1M3I A;  2H66 A;  2H74 A;  5CRD A;  3KZQ A;  3WGE A;  3WD6 A;  5COH A;  3I69 A;  1TRW A;  1NM3 A;  4MF5 A;  2B1L A;  2CZ2 A;  4HQZ A;  1TOF A;  4ZB7 A;  2GTU A;  1X5C A;  1SYX A;  4ULX A;  1YY7 A;  3HJM A;  4V1A p;  2LJA A;  2KLX A;  2F9S A;  3N9J A;  3UBK A;  2AB6 A;  2YWI A;  3KEB A;  2O36 A;  2VLU A;  1TTZ A;  3HXS A;  2PUK C;  2LST A;  5ELG A;  4TRX A;  2L6D A;  3MWH A;  6GSS A;  3TCO A;  4WXT A;  1TRV A;  2HRK A;  4PXO A;  4ILF A;  3ZML A;  1I1I P;  3W6G A;  2YAN A;  2VL9 A;  3C71 A;  5L71 A;  3Q6O A;  1R7H A;  1OC9 B;  5G1K A;  4AJ7 A;  2HSN A;  4DVC A;  4OMV A;  1IYI A;  4EE0 A;  2QC7 A;  1WRY A;  1Z6M A;  3DXB A;  1F6M C;  4HS1 A;  4JZQ A;  3EU3 A;  4KND A;  4ZIL A;  3U5R E;  4BVY A;  6GSW A;  2HSM A;  3IHG A;  3CHX C;  3M3M A;  4IBP A;  5ECI B;  3S9F A;  1G7O A;  1EP7 A;  1ERT A;  2WS2 A;  1YZX A;  1SL2 B;  1ZL9 A;  4I5Q A;  1U3A A;  1NSW A;  4XCS A;  5ECP B;  2OA7 A;  4L0W A;  1T7P B;  5GST A;  4KB3 A;  3LOR A;  1SK2 A;  1VF1 A;  2ZCT A;  1FB6 A;  2GQM A;  1HNB A;  1YQ1 A;  4HUA A;  1O7U A;  2CVD A;  4FQU A;  1THO A;  1M9B A;  3HDC A;  3IC8 A;  1QFN A;  1WMJ A;  2IFQ A;  1UN2 A;  1X9S B;  1TK5 B;  1JZO A;  4IJI A;  2C0G A;  1EEJ A;  1XWA A;  4JRR A;  3FR3 A;  1SYR A;  5C04 A;  1M7T A;  2MBS A;  4XRD A;  4HZ4 A;  1VGL A;  2D2Z A;  2PU9 C;  2GZZ A;  2CAQ A;  1Y25 A;  3KCM A;  4Z2T A;  4IEL A;  4H86 A;  5LCZ A;  3E9J B;  2JZS A;  4OO4 A;  3HD5 A;  1PMT A;  3C8E A;  5ECN B;  4HU7 A;  1J0F A;  1XOA A;  1WJK A;  2RM6 A;  1XWB A;  3IDV A;  2LS5 A;  2DJ0 A;  3NIV A;  5D93 A;  3D4T A;  3GSS A;  2YN1 A;  3M8N A;  4K2X A;  1T4Z A;  2H71 A;  4BWS A;  3AY8 A;  1IYH A;  5B7C A;  5A5H B;  4FYC A;  3GN3 A;  4GDF A;  2PN8 A;  3TUE A;  1WP0 A;  1PA3 A;  3O76 A;  3H79 A;  1O73 A;  4MAB A;  1VF2 A;  2H6X A;  1K0C A;  4BPY A;  1U3I A;  1SK0 A;  4JR6 A;  2V6K A;  5CYY A;  4KSO A;  4BIK A;  6GSY A;  3GTU B;  3PH9 A;  4WF4 A;  2O7K A;  4WEY A;  1EP8 A;  3TOT A;  3F3R A;  1ZGN A;  2PBJ A;  2FLS A;  2JSY A;  3IR4 A;  1F3B A;  1M2B A;  2IMD A;  3EYT A;  2BMX A;  2XBQ A;  4EVM A;  2IN3 A;  2WUL A;  2KP1 A;  3HZ8 A;  4KW6 A;  4TR3 A;  4E8E A;  2P5Q A;  2YNX A;  1B9Y C;  2LJK A;  2MMA A;  4PQH A;  5ECS A;  3UIW A;  2N5F A;  4X4J A;  1YDK A;  3D21 A;  1EV4 A;  5IOX A;  1SJZ A;  4F82 A;  1Z9H A;  3KTL A;  1JFU A;  3F3Q A;  2C0E A;  3UVT A;  4Z2R A;  2A2S A;  1XWC A;  2GS3 A;  3QMX A;  3VFI A;  1OC9 A;  3P7X A;  3TU3 B;  2B1K A;  2E2G A;  1YKA A;  3HCZ A;  4EKZ A;  11GS A;  2LKU A;  2DML A;  1TU7 A;  2K6V A;  1LU4 A;  4OCE A;  4MF6 A;  3H8Q A;  3WT2 A;  3GYK A;  5GSS A;  4HEA 2;  5H5Q A;  3L4N A;  3F63 A;  2JL4 A;  2C3Q A;  2PVQ A;  4OWY A;  2V41 A;  4X43 A;  3BD2 A;  5IO0 A;  3MDK A;  4HOJ A;  3RPN A;  2EC4 A;  2FY6 A;  5JCW A;  2A2R A;  3F4R A;  3M9K A;  1H75 A;  3F6F A;  1GH2 A;  1URM A;  2LRT A;  2A4V A;  1EGO A;  5HQP A;  1V58 A;  2YZU A;  1U87 A;  4G10 A;  4L0U A;  2L4C A;  2O3E A;  1DE2 A;  5HFI A;  1XW6 A;  2H6Y A;  3LFL A;  3Q18 A;  4O5U A;  1K0A A;  3ZFB A;  1TRS A;  3CSJ A;  5HR0 A;  3BJ5 A;  4G0I A;  3VUR A;  22GS A;  3KMN A;  2VIM A;  1A8L A;  5IMF A;  1GUK A;  4KAE A;  3TKP A;  4CHS A;  2CQ9 A;  5ECM B;  3D5J A;  4XS4 B;  3TKQ A;  4POM A;  3TKS A;  5EL8 A;  1H4O A;  5H5S A;  2QA1 A;  2HE3 A;  1GUH A;  4GXZ A;  4ECI A;  4GRF A;  4LL4 B;  3D22 A;  4MF7 A;  4DSS B;  3TRX A;  4NV5 A;  4BL7 B;  4K5R A;  2H73 A;  4ICY A;  3TJG A;  4ZB6 A;  1BX9 A;  2HSN B;  1TI1 A;  2VOC A;  1QK8 A;  2YJ7 A;  3L9V A;  5J41 A;  1W89 A;  1GWC A;  3A5I A;  5A5H A;  5KEJ A;  1QQ2 A;  3GUR A;  5IIZ A;  2H1D A;  2DJ1 A;  3KD0 A;  3GV1 A;  1PGT A;  4KA0 A;  1BF5 A;  4POL A;  4IP6 A;  1A2J A;  3CXG A;  1AW9 A;  4BVX B;  5KOX A;  4EDZ A;  2L5O A;  3GTU A;  4EC0 A;  5ECH B;  4K7I A;  4WKW A;  4KH7 A;  2O87 A;  1SVL A;  2VD1 A;  2FCH A;  2JAC A;  5D8I A;  2A4H A;  4KE3 A;  3UAP A;  3E0U A;  1S4B P;  5ECR B;  4LMW A;  3HVS A;  1SVO A;  1KTE A;  4TN8 A;  2XHF A;  1G6W A;  4HJM A;  1M9A A;  1MD4 A;  5D9X A;  5AIX A;  4HQS A;  2XPD A;  1V40 A;  4N3Z A;  4CW9 A;  1PRX A;  1BG5 A;  4K0G A;  1UC7 A;  2VLV A;  4O5R A;  2R6K A;  1BAY A;  4QQ7 A;  5JCG A;  3DD3 A;  2LQQ A;  5KN0 A;  4ZIJ A;  5HR2 A;  3MAK A;  5IMC A;  3QFB C;  2WRT A;  3FR9 A;  1PX7 A;  3IAS 2;  1GLQ A;  3L9U A;  2EFE A;  4MZW A;  2LV3 A;  3JCM L;  2E7P A;  3QR6 A;  1O8W A;  2EFC A;  4ZL9 A;  4W66 A;  5KN2 A;  2OJL A;  1GUL A;  2DKI A;  4JU5 A;  2YWO A;  1J9B A;  2FA4 A;  4HZ2 A;  4IHU A;  2P5R A;  4IN0 A;  4G01 A;  2GQL A;  3FZ5 A;  1GSS A;  1MTC A;  5B8A A;  4MJB A;  4YQM A;  3WYW A;  3G9B A;  4D73 B;  5A1N B;  1PD2 1;  2H70 A;  1SKS B;  1XCC A;  1ST9 A;  5DCG A;  4ZL8 A;  1PSQ A;  13GS A;  1ZYN A;  3IXR A;  1J08 A;  2FUG 2;  5DAL B;  2ZNM A;  4I2U A;  2IMI A;  4K2D A;  2WB9 A;  2VCV A;  3EE2 A;  4RI7 A;  1MDJ A;  4Z2U A;  3GMF A;  2K8S A;  3IRA A;  2YP6 A;  1XG8 A;  4I6X A;  4XS4 A;  2DC5 A;  3IK9 A;  4NWY A;  1XWG A;  1SJI A;  2WDU A;  2MMO A;  5IMD A;  5ECQ B;  4J56 E;  1S3D A;  3I6A A;  3H93 A;  3GH9 A;  3LWA A;  2HRN A;  5DJL A;  4MLY A;  3TKS C;  3EMX A;  2NVL A;  2DSA A;  2J9H A;  1GNW A;  2YZH A;  3HA9 A;  4DSS A;  3LXZ A;  4G2E A;  4BL7 A;  3CWG A;  2V32 A;  1OAZ A;  2REM A;  3M0F A;  4ACS A;  3LXT A;  4PHZ C;  2B5E A;  1FOV A;  3KGK A;  1G7E A;  1X9M B;  2WVY A;  5J4V A;  3L0H A;  5EY6 A;  2HNL A;  4XS1 A;  2GST A;  1A0R P;  4MMM A;  4IKH A;  1DUG A;  1NW2 A;  3PPU A;  1HYU A;  1WE0 A;  4RI6 A;  5DVB A;  3IA1 A;  4EXJ A;  2YWM A;  2HRA A;  3GKN A;  2JSZ A;  1LJR A;  4PUA A;  4KCA A;  2DMM A;  2PGT A;  3TRQ A;  1YEP A;  5F8B A;  2VCQ A;  1K3L A;  4KGI A;  2CAI A;  1R4W A;  4BVX A;  2TRC P;  5CNW A;  5J9B A;  1HNA A;  1PL2 A;  1S3R A;  5F06 A;  2CX4 A;  1A23 A;  4O32 A;  3PIN A;  2WZ9 A;  3ERF A;  3D6I A;  1Z5Y E;  1GTU A;  1OKD A;  4XRA A;  4GSS A;  1AUC A;  1SEN A;  2PPT A;  4LMV A;  3LYP A;  3WGD A;  2IPA A;  5IO2 A;  4E68 A;  2H6Z A;  4NAX A;  1PKZ A;  2OE0 A;  3C7M A;  3I9V 2;  1VF3 A;  3KIJ A;  2IJY A;  2R0G A;  1XVW A;  1BQ7 A;  2VCT A;  2DJJ A;  4KDU A;  2HXK A;  5CRE A;  5GAN D;  3TRP A;  5HR3 A;  2GGT A;  2CT6 A;  3UEM A;  4K9Z A;  3PR8 A;  3Q19 A;  4GQF A;  4ECC A;  4L5O A;  2V6O A;  5A4V A;  2FWG A;  5D73 A;  3GKM A;  3VK9 A;  2VCX A;  2PVO C;  5B8B A;  2H1G A;  1JLV A;  4PQ1 A;  3HHV A;  1WWJ A;  2WFC A;  3RDW A;  4O7H A;  2RM5 A;  3VWW A;  3CTF A;  3DML A;  3A3T A;  1O8X A;  3ZTL A;  4JBB A;  1EGR A;  1MD3 A;  1BJX A;  1B9X C;  3GL3 A;  2B5X A;  5ELA A;  4EO3 A;  1B8X A;  5LNK e;  3QOU A;  5LD0 A;  4G19 A;  3VPT A;  4PUF C;  1VF4 A;  3KP8 A;  1K3O A;  2FGX A;  3ZLP A;  2AAW A;  2YWN A;  2HI7 A;  4CDO A;  2I4A A;  2M72 A;  14GS A;  4D73 A;  5A1N A;  2IL3 A;  2ALB A;  1GRX A;  1YF1 A;  2VD0 A;  5DAL A;  1R26 A;  2C0D A;  4KDX A;  3MNG A;  1OYJ A;  4IQ1 A;  1FB0 A;  3WGX A;  4Q5F A;  3GFK A;  3MSZ A;  4N0Z A;  1EWX A;  1ML6 A;  4QL7 A;  2LJR A;  3NOF A;  3D0Z A;  2GZP A;  1QUW A;  1TRU A;  1RK4 A;  4MJE A;  2FA8 A;  3GH6 A;  4GST A;  2KHP A;  3LW9 A;  4YQV A;  2V1M A;  1NHO A;  5IMZ A;  3TGZ A;  5IMA A;  1N8J A;  2C4J A;  3QDN A;  4AKI A;  4MP4 A;  3KH9 A;  3UMA A;  1MDK A;  3IAM 2;  2V2G A;  2OKA A;  4FH8 A;  2R37 A;  3F0I A;  1G0T A;  2ON5 A;  1V2A A;  3IE3 A;  4PI0 C;  3VI7 A;  1YVL A;  3UJ1 A;  4N0V A;  2LUS A;  3FMW A;  4EUY A;  10GS A;  6GST A;  4FIW A;  4K7O A;  4MNN A;  4ID0 A;  2H30 A;  4X1U A;  4AF2 A;  2N5A A;  4AKX B;  2GZY A;  4NPB A;  2RLI A;  2GLR A;  2VL2 C;  2H0H A;  2PWJ A;  2JAD A;  3RPP A;  4YAV A;  1GSF A;  1PFO A;  2HYX A;  3G7I A;  1X5E A;  1QGV A;  3HVN A;  1ERW A;  3GA4 A;  4A5P A;  4JE1 A;  4X0X A;  2X8H A;  3HVX A;  2GVP A;  2H75 A;  1M2A A;  2LRN A;  1E2Y A;  4OCF A;  5FT3 A;  2LTK A;  2L6C A;  2HT9 A;  3GST A;  4YH2 A;  4JED A;  5AIV A;  4KSM A;  1AIU A;  5JWO B;  3FK8 A;  4OD7 A;  5BMU B;  4RUV A;  4N30 A;  4CY6 A;  3M1G A;  2X64 A;  5HFG A;  2GT6 A;  4WF5 A;  3WT1 A;  4TXV A;  4QL9 A;  3ERG A;  4WR5 A;  3IV4 A;  3K8N A;  3ZZX A;  1ZYP A;  4HU9 A;  1A0F A;  4LLR A;  3UAR A;  1XXU A;  3R3E A;  4DSR A;  1WPI A;  4I2T A;  1N25 A;  2MMZ A;  3ME8 A;  3QAG A;  3KMO A;  2TIR A;  1HNC A; 
#chains in the Genus database with same CATH homology
 1FOH A;  1NHY A;  3BOA A;  3SBC A;  1Q98 A;  4K7N A;  5GZZ B;  1S3A A;  1X9W B;  3ZRE A;  5B6N A;  1GLP A;  2RUF A;  1TXX A;  1HD2 A;  2G2Q A;  4V2L A;  1I5G A;  5G2Z A;  18GS A;  2P0G A;  3ZRD A;  1EEM A;  1C72 A;  1FG4 A;  1GSE A;  1AXD A;  3APQ A;  5G30 A;  3LG6 A;  5KN1 A;  4CY8 A;  4XIH A;  2E0Q A;  5E4W A;  1TP9 A;  2F3M A;  4OFM A;  4MPG A;  5A34 B;  3HY2 A;  5ENU A;  5G1L A;  1SL1 B;  3TOU A;  4TVE A;  5AGY A;  4MZC A;  2R3X A;  5F05 A;  1ZYE A;  4V1A g;  1TK8 B;  1JHB A;  4NMU A;  2PER A;  1V57 A;  3ISO A;  5E59 A;  5C00 A;  2MMN A;  1DBY A;  2OBK A;  4ZL7 A;  3HVV A;  4J2F A;  2DJ2 A;  5INY A;  4ZBD A;  3E3E A;  1OE8 A;  2EIQ A;  4I97 A;  2H1A A;  5IPH A;  2C1Y A;  4G0K A;  7GSS A;  2B5Y A;  2C8U A;  4NHW A;  5FHI A;  1JZD A;  2KUC A;  1B48 A;  1GNE A;  2HZF A;  4YKF A;  1PX6 A;  4MCU A;  1EV9 A;  3KTB A;  2HSY A;  2C0F A;  4FYU A;  4PGT A;  2KOK A;  2X49 A;  2A2P A;  2LNS A;  5J47 A;  1Q4J A;  2BJX A;  3GKK A;  2EIR A;  1FHE A;  2E2M A;  2CX3 A;  1XOB A;  1PN0 A;  4K6X A;  1GSQ A;  3SWL A;  4EF0 A;  3UBL A;  4KX4 A;  3QD9 A;  1OC3 A;  4PNG A;  4ZXG A;  1K0O A;  1MEK A;  5CRH A;  1SVM A;  1AQV A;  4GTU A;  4AKH A;  5DCH A;  4OFN A;  1FW1 A;  2DIZ A;  3GX0 A;  4IGJ A;  2NBS A;  2VO4 A;  4XTS A;  5ECO B;  1TDI A;  3VI5 A;  1F2E A;  1QXH A;  5DAK B;  2GT5 A;  2VM2 A;  2B3S A;  3GHA A;  2WCI A;  5DQY A;  1A8Y A;  3J7Y k;  4IW9 A;  3FKF A;  1SJ6 A;  3CRU A;  2I3Y A;  2I1U A;  1O85 A;  1TW9 A;  4IS0 A;  3APS A;  2QA2 A;  4IVF A;  5CAX A;  4TR0 A;  3HZ4 A;  5ECL B;  3ZMK A;  5BMU A;  3W8S A;  3VWX A;  5J5N A;  4NHZ A;  5H5R A;  3ZYW A;  2MZC A;  4K1F A;  1S3C A;  3FR6 A;  1GSU A;  2JZR A;  1GSY A;  4MPF A;  1U6T A;  2K9F A;  2IME A;  1ABA A;  2AUV A;  1N2A A;  1WOU A;  1SU9 A;  3HYP A;  4F03 A;  2CVK A;  2K18 A;  4LA1 A;  2C3N A;  1UA5 A;  5IM9 A;  1M99 A;  1BG1 A;  2DBC A;  5J4Y A;  2CV4 A;  4AKG A;  4EDY A;  1FVJ A;  1OC8 A;  1AC1 A;  1RQM A;  1A2M A;  2VL3 A;  5D96 A;  1Y1U A;  4MK3 A;  1G6Y A;  5F07 A;  3DKS A;  5IPG A;  3ZL5 A;  1EOG A;  5IMV A;  4BA7 A;  4GQC A;  3DVX A;  3UVH A;  1GUM A;  3HJP A;  1T00 A;  1XFL A;  3LJR A;  2C3T A;  2IMK A;  3O3T A;  4MJA A;  2FWE A;  2DJK A;  1XWK A;  16GS A;  4V2M A;  2AV4 A;  1GTB A;  2C80 A;  3EMP A;  5B6M A;  2HZE B;  2VL2 A;  2VM1 A;  1ZCP A;  5HR1 A;  1XZO A;  4E8H A;  3DVW A;  3IOS A;  1K0M A;  5A34 A;  1GSD A;  1USB A;  2HLS A;  1T8E B;  2R4V A;  3ZIJ A;  1AQW A;  2OE1 A;  1ON4 A;  5D9W A;  3DYR A;  3FYG A;  3D4M A;  1HQO A;  1OKT A;  2AJQ B;  3VPQ A;  3R2Q A;  3LYK A;  2FHE A;  2XPE A;  3FZA A;  3QPM A;  3KJY A;  2MBT A;  5CRG A;  4Q5N A;  1XIY A;  1MDI A;  2OT3 A;  4OFT A;  5JCU A;  1PKW A;  4AJ6 A;  3U6V A;  4PUR A;  2L57 A;  2CVB A;  2H01 A;  2L59 A;  1FO5 A;  1SKR B;  5ID2 A;  3IC4 A;  4EIP A;  4KCE A;  2VKZ G;  1XW9 A;  2CA8 A;  6GSX A;  3IBH A;  3L78 A;  3C73 A;  3QFA C;  2QGV A;  3F6D A;  4ML1 A;  3EC3 A;  4AJ8 A;  3PGT A;  2X4A A;  5CO3 A;  1SKW B;  3EUR A;  3O6T A;  3J7Y b;  3HMJ G;  4BWQ A;  4POK A;  3CYN A;  1THX A;  2OAC A;  4QMK A;  1ZZY A;  1PL1 A;  2LEG A;  2OBI A;  2P31 A;  2TRX A;  2XBI A;  2M80 A;  1XBS A;  3F9U A;  2BTO T;  5DJM A;  3DIE A;  3LQ7 A;  1JZW A;  1RW1 A;  2H72 A;  1ERV A;  8GSS A;  3CSH A;  3ZIV A;  4F0B A;  5DAK A;  5ECK B;  4MZB A;  1PN9 A;  2ZUP A;  5IQY A;  2F51 A;  1O81 A;  2OAD A;  1K0D A;  3GRX A;  1W4V A;  5IOW A;  1M0U A;  2H0I A;  1F3A A;  2GSR A;  2X8G A;  4MJC A;  4AGS A;  3GKX A;  2QKE A;  2UZ8 A;  2O5V A;  5G5E A;  2VLT A;  2FWF A;  3KH7 A;  3TKS E;  3UOM A;  4ZBA A;  1JZR A;  2PMT A;  2HFD A;  3KM6 A;  3DGQ A;  3VWV A;  1ZYQ B;  3TJF A;  2HSH A;  2GSS A;  3MYD A;  3TB2 A;  2J23 A;  2FWH A;  4WET A;  5BRT A;  3EU4 A;  3DWV A;  1CQH A;  1I9D A;  4FYB A;  1PQN A;  5AN1 A;  3V1W A;  3CTG A;  1BED A;  1R5A A;  5ABR A;  19GS A;  5A4U A;  1TJD A;  3N5O A;  4ZB8 A;  2YPM A;  4F2I A;  1SD8 A;  1U88 A;  4TOP A;  3QAW A;  4KDY A;  2GQK A;  3G7Y A;  1SK1 A;  4ECB A;  1V98 A;  2H19 A;  2XC2 A;  3BBY A;  3P2A A;  4G0L A;  3FZ9 A;  3TJJ A;  4GF0 A;  4YKG A;  2L4Q A;  5EPF A;  3IK7 A;  5DDL A;  1ILO A;  3EPT A;  1CQG A;  4XHM A;  3A5W A;  2EFH A;  3P8W A;  4N10 A;  2LQO A;  2H0G A;  1BYE A;  2ES7 A;  2YCD A;  4Z7X A;  1TI3 A;  3FEU A;  4K8M A;  5G31 A;  3L9S A;  1YKC A;  2I9H A;  3TJK A;  4POB A;  1DSB A;  2HZE A;  5G5F A;  4HJ2 A;  4IQA A;  3OR5 A;  4ISD A;  2L5L A;  3GUS A;  3IHQ A;  2YV7 A;  1KNG A;  2LNT A;  1YEX A;  2B7K A;  1K3Y A;  1O6J A;  4L8E A;  4PQI A;  1WIK A;  3DEX A;  2MYG A;  4WR4 A;  1YJ6 A;  4TR1 B;  3EWL A;  3ZIT A;  3W8J A;  2HQT A;  1Z6N A;  2LRC A;  3LGC A;  4MH2 A;  3KXO A;  4KF9 A;  2VCW A;  1GP1 A;  1Z3E A;  2DJ3 A;  3LSZ A;  5J40 A;  1B4P A;  2RII A;  3IPZ A;  4KUN A;  4N11 A;  1UVZ A;  2EFD A;  1B4Q A;  1DE1 A;  2IWT A;  5J9C A;  1T3B A;  3A2V A;  3VLN A;  6GSU A;  3A2X A;  3TKR A;  5JWR B;  5KOW A;  4FO5 A;  4P3Y B;  4F0C A;  2R0C A;  2QSI A;  3EVI A;  3ED3 A;  1GTI A;  2RUE A;  4GLT A;  3ZVJ D;  2VCZ A;  4TXO B;  17GS A;  3CRT A;  1A24 A;  4HI7 A;  5AIS A;  1TU8 A;  4GSN A;  1XVQ A;  1EZK A;  2AYT A;  4ECJ A;  3ME7 A;  4GWR A;  1E6B A;  4NV2 A;  4TW5 A;  5CRW A;  3ZVJ A;  4WBJ A;  4TR4 A;  4AI6 A;  3BCK A;  4Q5Q A;  12GS A;  5JWQ B;  2IIY A;  2DKH A;  1TK0 B;  4O5Q A;  3VWU A;  5D9V A;  4OO5 A;  3US3 A;  2Z9S A;  2O89 A;  2I81 A;  3HKR A;  3C1R A;  2M46 A;  3MIX A;  4ML6 A;  2WJU A;  2AHE A;  3FW2 A;  1SD9 A;  2F8F A;  2YJH A;  3F4S A;  1FVK A;  3F8U A;  1LBK A;  2H1B A;  2H8L A;  3QCP A;  3FZ4 A;  1AAZ A;  1ZMA A;  1YF0 A;  4IJ3 A;  4EL1 A;  1X5D A;  3APO A;  1KBN A;  4G9H A;  2VUP A;  1ERU A;  2HRK B;  1TXU A;  2F8A A;  20GS A;  2JU5 A;  2R2J A;  1KEB A;  4TKY A;  5A5K A;  2H1L A;  2DIY A;  4GCI A;  3FHK A;  5D9T A;  2FD3 A;  4L5L A;  1R5P A;  1GL8 A;  1ZOF A;  3UL3 A;  2O8V B;  4HDE A;  4PX1 A;  1X0R A;  9GSS A;  1T4Y A;  2NPB A;  1XPV A;  1K0B A;  3KP9 A;  4BVY B;  2HSM B;  4MDC A;  1TKD B;  5ID2 B;  1XW5 A;  3GNJ A;  3ERW A;  4K5S A;  4F9Z A;  2HRF A;  5DBQ A;  2DLX A;  6GSV A;  1ACV A;  2GSQ A;  4PTS A;  4PNF A;  4LL1 B;  3H4K A;  2R5G A;  3CSI A;  3FRC A;  3Q74 A;  2B6M A;  1AQX A;  3RHB A;  4DEJ A;  1Z7P A;  3GX8 A;  5GAP D;  2B7J A;  2NDO A;  3RBT A;  4MA9 A;  3FY7 A;  3RHC A;  5J4U A;  3TJB A;  1EOH A;  2NTO A;  4I8B A;  3BCI A;  2IFQ B;  2K8V A;  5A4W A;  4NXI A;  5KN3 A;  2UV8 G;  1JLW A;  3DRN A;  4ZB9 A;  3P90 A;  2N5B A;  3LEF A;  3F4T A;  3QAV A;  1SL0 B;  2EIO A;  3CBU A;  1A2L A;  4RQX A;  4MH3 A;  3H1N A;  2FNO A;  4TR1 A;  4WBR D;  3M9J A;  1K0N A;  3RAZ A;  1FAA A;  1M2D A;  2YV9 A;  2OE3 A;  3TDG A;  2YOI A;  3GL5 A;  3GIX A;  1F9M A;  2H76 A;  4RQR A;  2G0F A;  2O85 A;  5HFK A;  3C1S A;  5CP1 A;  4DSQ A;  5DQS A;  4YAP A;  4JR4 A;  4EIQ A;  4V2N A;  4O92 A;  2ON7 A;  1F37 A;  4Q5R A;  5F0G A;  1QMV A;  2JZT A;  2IMF A;  2WGR A;  3NZN A;  4IP1 A;  3HJO A;  1Z7R A;  5EVO A;  1GTA A;  2X99 A;  2GDR A;  5FWG A;  2VAF A;  2R0P A;  4YQU A;  1Y6E A;  3A2W A;  3CMI A;  2CZ3 A;  2X8C A;  1V9W A;  1T1V A;  4J57 E;  3ZFL A;  3EIN A;  1OVN A;  2KP2 A;  1VRS D;  3I43 A;  5J3R A;  4ZBB A;  4USS A;  4TXO A;  3G7J A;  1OE7 A;  4K0N A;  4XS6 A;  2H66 A;  2H74 A;  5CRD A;  3KZQ A;  3WGE A;  3WD6 A;  5COH A;  3I69 A;  1TRW A;  1NM3 A;  4MF5 A;  2B1L A;  2CZ2 A;  4HQZ A;  1TOF A;  4ZB7 A;  2GTU A;  1X5C A;  1SYX A;  4ULX A;  1YY7 A;  3HJM A;  4V1A p;  2LJA A;  2KLX A;  2F9S A;  3N9J A;  3UBK A;  2AB6 A;  2YWI A;  3KEB A;  2VLU A;  1TTZ A;  3HXS A;  2PUK C;  2LST A;  5ELG A;  4TRX A;  2L6D A;  3MWH A;  6GSS A;  3TCO A;  4WXT A;  1TRV A;  2HRK A;  4PXO A;  4ILF A;  3ZML A;  3W6G A;  2YAN A;  2VL9 A;  3C71 A;  5L71 A;  3Q6O A;  1R7H A;  1OC9 B;  5G1K A;  4AJ7 A;  2HSN A;  4DVC A;  4OMV A;  1IYI A;  4EE0 A;  2QC7 A;  1WRY A;  1Z6M A;  3DXB A;  1F6M C;  4HS1 A;  4JZQ A;  3EU3 A;  4KND A;  4ZIL A;  3U5R E;  4BVY A;  6GSW A;  2HSM A;  3IHG A;  3M3M A;  4IBP A;  5ECI B;  3S9F A;  1G7O A;  1EP7 A;  1ERT A;  2WS2 A;  1YZX A;  1SL2 B;  1ZL9 A;  4I5Q A;  1U3A A;  1NSW A;  4XCS A;  5ECP B;  2OA7 A;  4L0W A;  1T7P B;  5GST A;  4KB3 A;  3LOR A;  1SK2 A;  1VF1 A;  2ZCT A;  1FB6 A;  2GQM A;  1HNB A;  1YQ1 A;  4HUA A;  1O7U A;  2CVD A;  4FQU A;  1THO A;  1M9B A;  3HDC A;  3IC8 A;  1QFN A;  1WMJ A;  2IFQ A;  1UN2 A;  1X9S B;  1TK5 B;  1JZO A;  4IJI A;  2C0G A;  1EEJ A;  1XWA A;  4JRR A;  3FR3 A;  1SYR A;  5C04 A;  1M7T A;  2MBS A;  4XRD A;  4HZ4 A;  1VGL A;  2D2Z A;  2PU9 C;  2GZZ A;  2CAQ A;  1Y25 A;  3KCM A;  4Z2T A;  4IEL A;  4H86 A;  5LCZ A;  3E9J B;  2JZS A;  4OO4 A;  3HD5 A;  1PMT A;  3C8E A;  5ECN B;  4HU7 A;  1J0F A;  1XOA A;  1WJK A;  2RM6 A;  1XWB A;  3IDV A;  2LS5 A;  2DJ0 A;  3NIV A;  5D93 A;  3D4T A;  3GSS A;  2YN1 A;  3M8N A;  4K2X A;  1T4Z A;  2H71 A;  4BWS A;  3AY8 A;  1IYH A;  5B7C A;  5A5H B;  4FYC A;  3GN3 A;  4GDF A;  2PN8 A;  3TUE A;  1WP0 A;  1PA3 A;  3O76 A;  3H79 A;  1O73 A;  4MAB A;  1VF2 A;  2H6X A;  1K0C A;  4BPY A;  1U3I A;  1SK0 A;  4JR6 A;  2V6K A;  5CYY A;  4KSO A;  6GSY A;  3GTU B;  3PH9 A;  4WF4 A;  2O7K A;  4WEY A;  1EP8 A;  3TOT A;  3F3R A;  1ZGN A;  2PBJ A;  2FLS A;  2JSY A;  3IR4 A;  1F3B A;  1M2B A;  2IMD A;  3EYT A;  2BMX A;  2XBQ A;  4EVM A;  2IN3 A;  2WUL A;  2KP1 A;  3HZ8 A;  4KW6 A;  4TR3 A;  4E8E A;  2P5Q A;  2YNX A;  1B9Y C;  2LJK A;  2MMA A;  4PQH A;  5ECS A;  3UIW A;  2N5F A;  4X4J A;  1YDK A;  3D21 A;  1EV4 A;  5IOX A;  1SJZ A;  4F82 A;  1Z9H A;  3KTL A;  1JFU A;  3F3Q A;  2C0E A;  3UVT A;  4Z2R A;  2A2S A;  1XWC A;  2GS3 A;  3QMX A;  3VFI A;  1OC9 A;  3P7X A;  3TU3 B;  2B1K A;  2E2G A;  1YKA A;  3HCZ A;  4EKZ A;  11GS A;  2LKU A;  2DML A;  1TU7 A;  2K6V A;  1LU4 A;  4OCE A;  4MF6 A;  3H8Q A;  3WT2 A;  3GYK A;  5GSS A;  4HEA 2;  5H5Q A;  3L4N A;  3F63 A;  2JL4 A;  2C3Q A;  2PVQ A;  4OWY A;  2V41 A;  4X43 A;  3BD2 A;  5IO0 A;  3MDK A;  4HOJ A;  3RPN A;  2EC4 A;  2FY6 A;  5JCW A;  2A2R A;  3F4R A;  3M9K A;  1H75 A;  3F6F A;  1GH2 A;  1URM A;  2LRT A;  2A4V A;  1EGO A;  5HQP A;  1V58 A;  2YZU A;  1U87 A;  4G10 A;  4L0U A;  2L4C A;  1DE2 A;  5HFI A;  1XW6 A;  2H6Y A;  3LFL A;  3Q18 A;  4O5U A;  1K0A A;  3ZFB A;  1TRS A;  3CSJ A;  5HR0 A;  3BJ5 A;  4G0I A;  3VUR A;  22GS A;  3KMN A;  2VIM A;  1A8L A;  5IMF A;  1GUK A;  4KAE A;  3TKP A;  4CHS A;  2CQ9 A;  5ECM B;  3D5J A;  4XS4 B;  3TKQ A;  4POM A;  3TKS A;  5EL8 A;  1H4O A;  5H5S A;  2QA1 A;  2HE3 A;  1GUH A;  4GXZ A;  4ECI A;  4GRF A;  4LL4 B;  3D22 A;  4MF7 A;  4DSS B;  3TRX A;  4NV5 A;  4BL7 B;  4K5R A;  2H73 A;  4ICY A;  3TJG A;  4ZB6 A;  1BX9 A;  2HSN B;  1TI1 A;  2VOC A;  1QK8 A;  2YJ7 A;  3L9V A;  5J41 A;  1W89 A;  1GWC A;  3A5I A;  5A5H A;  5KEJ A;  1QQ2 A;  3GUR A;  5IIZ A;  2H1D A;  2DJ1 A;  3KD0 A;  3GV1 A;  1PGT A;  4KA0 A;  1BF5 A;  4POL A;  4IP6 A;  1A2J A;  3CXG A;  1AW9 A;  4BVX B;  5KOX A;  4EDZ A;  2L5O A;  3GTU A;  4EC0 A;  5ECH B;  4K7I A;  4WKW A;  4KH7 A;  2O87 A;  1SVL A;  2VD1 A;  2FCH A;  2JAC A;  5D8I A;  2A4H A;  4KE3 A;  3UAP A;  3E0U A;  5ECR B;  4LMW A;  3HVS A;  1SVO A;  1KTE A;  4TN8 A;  2XHF A;  1G6W A;  4HJM A;  1M9A A;  1MD4 A;  5D9X A;  5AIX A;  4HQS A;  2XPD A;  1V40 A;  4N3Z A;  4CW9 A;  1PRX A;  1BG5 A;  4K0G A;  1UC7 A;  2VLV A;  4O5R A;  2R6K A;  1BAY A;  4QQ7 A;  5JCG A;  3DD3 A;  2LQQ A;  5KN0 A;  4ZIJ A;  5HR2 A;  3MAK A;  5IMC A;  3QFB C;  2WRT A;  3FR9 A;  1PX7 A;  3IAS 2;  1GLQ A;  3L9U A;  2EFE A;  4MZW A;  2LV3 A;  3JCM L;  2E7P A;  3QR6 A;  1O8W A;  2EFC A;  4ZL9 A;  4W66 A;  5KN2 A;  2OJL A;  1GUL A;  2DKI A;  4JU5 A;  2YWO A;  1J9B A;  2FA4 A;  4HZ2 A;  4IHU A;  2P5R A;  4IN0 A;  4G01 A;  2GQL A;  3FZ5 A;  1GSS A;  1MTC A;  5B8A A;  4MJB A;  4YQM A;  3WYW A;  3G9B A;  4D73 B;  5A1N B;  1PD2 1;  2H70 A;  1SKS B;  1XCC A;  1ST9 A;  5DCG A;  4ZL8 A;  1PSQ A;  13GS A;  1ZYN A;  3IXR A;  1J08 A;  2FUG 2;  5DAL B;  2ZNM A;  4I2U A;  2IMI A;  4K2D A;  2WB9 A;  2VCV A;  3EE2 A;  4RI7 A;  1MDJ A;  4Z2U A;  3GMF A;  2K8S A;  3IRA A;  2YP6 A;  4I6X A;  4XS4 A;  2DC5 A;  3IK9 A;  4NWY A;  1XWG A;  1SJI A;  2WDU A;  2MMO A;  5IMD A;  5ECQ B;  4J56 E;  1S3D A;  3I6A A;  3H93 A;  3GH9 A;  3LWA A;  2HRN A;  5DJL A;  4MLY A;  3TKS C;  3EMX A;  2NVL A;  2DSA A;  2J9H A;  1GNW A;  2YZH A;  3HA9 A;  4DSS A;  3LXZ A;  4G2E A;  4BL7 A;  3CWG A;  2V32 A;  1OAZ A;  2REM A;  3M0F A;  4ACS A;  3LXT A;  2B5E A;  1FOV A;  3KGK A;  1G7E A;  1X9M B;  5J4V A;  3L0H A;  5EY6 A;  2HNL A;  4XS1 A;  2GST A;  1A0R P;  4MMM A;  4IKH A;  1DUG A;  1NW2 A;  3PPU A;  1HYU A;  1WE0 A;  4RI6 A;  5DVB A;  3IA1 A;  4EXJ A;  2YWM A;  2HRA A;  3GKN A;  2JSZ A;  1LJR A;  4PUA A;  4KCA A;  2DMM A;  2PGT A;  3TRQ A;  1YEP A;  5F8B A;  2VCQ A;  1K3L A;  4KGI A;  2CAI A;  1R4W A;  4BVX A;  2TRC P;  5CNW A;  5J9B A;  1HNA A;  1PL2 A;  5F06 A;  2CX4 A;  1A23 A;  4O32 A;  3PIN A;  2WZ9 A;  3ERF A;  3D6I A;  1Z5Y E;  1GTU A;  1OKD A;  4XRA A;  4GSS A;  1AUC A;  1SEN A;  2PPT A;  4LMV A;  3LYP A;  3WGD A;  2IPA A;  5IO2 A;  4E68 A;  2H6Z A;  4NAX A;  1PKZ A;  2OE0 A;  3C7M A;  3I9V 2;  1VF3 A;  3KIJ A;  2IJY A;  2R0G A;  1XVW A;  1BQ7 A;  2VCT A;  2DJJ A;  4KDU A;  2HXK A;  5CRE A;  5GAN D;  3TRP A;  5HR3 A;  2GGT A;  2CT6 A;  3UEM A;  4K9Z A;  3PR8 A;  3Q19 A;  4GQF A;  4ECC A;  4L5O A;  2V6O A;  5A4V A;  2FWG A;  5D73 A;  3GKM A;  3VK9 A;  2VCX A;  2PVO C;  5B8B A;  2H1G A;  1JLV A;  4PQ1 A;  3HHV A;  1WWJ A;  2WFC A;  3RDW A;  4O7H A;  2RM5 A;  3VWW A;  3CTF A;  3DML A;  3A3T A;  1O8X A;  3ZTL A;  4JBB A;  1EGR A;  1MD3 A;  1BJX A;  1B9X C;  3GL3 A;  2B5X A;  5ELA A;  4EO3 A;  1B8X A;  5LNK e;  3QOU A;  5LD0 A;  4G19 A;  3VPT A;  4PUF C;  1VF4 A;  3KP8 A;  1K3O A;  2FGX A;  3ZLP A;  2AAW A;  2YWN A;  2HI7 A;  4CDO A;  2I4A A;  2M72 A;  14GS A;  4D73 A;  5A1N A;  2IL3 A;  2ALB A;  1GRX A;  1YF1 A;  2VD0 A;  5DAL A;  1R26 A;  2C0D A;  4KDX A;  3MNG A;  1OYJ A;  4IQ1 A;  1FB0 A;  3WGX A;  4Q5F A;  3GFK A;  3MSZ A;  4N0Z A;  1EWX A;  1ML6 A;  4QL7 A;  2LJR A;  3NOF A;  3D0Z A;  2GZP A;  1QUW A;  1TRU A;  1RK4 A;  4MJE A;  2FA8 A;  3GH6 A;  4GST A;  2KHP A;  3LW9 A;  4YQV A;  2V1M A;  1NHO A;  5IMZ A;  3TGZ A;  5IMA A;  1N8J A;  2C4J A;  3QDN A;  4AKI A;  4MP4 A;  3KH9 A;  3UMA A;  1MDK A;  3IAM 2;  2V2G A;  2OKA A;  4FH8 A;  2R37 A;  3F0I A;  1G0T A;  2ON5 A;  1V2A A;  3IE3 A;  3VI7 A;  1YVL A;  3UJ1 A;  4N0V A;  2LUS A;  3FMW A;  4EUY A;  10GS A;  6GST A;  4FIW A;  4K7O A;  4MNN A;  4ID0 A;  2H30 A;  4X1U A;  4AF2 A;  2N5A A;  4AKX B;  2GZY A;  4NPB A;  2RLI A;  2GLR A;  2VL2 C;  2H0H A;  2PWJ A;  2JAD A;  3RPP A;  4YAV A;  1GSF A;  2HYX A;  3G7I A;  1X5E A;  1QGV A;  1ERW A;  3GA4 A;  4A5P A;  4JE1 A;  4X0X A;  2X8H A;  3HVX A;  2GVP A;  2H75 A;  1M2A A;  2LRN A;  1E2Y A;  4OCF A;  5FT3 A;  2LTK A;  2L6C A;  2HT9 A;  3GST A;  4YH2 A;  4JED A;  5AIV A;  4KSM A;  1AIU A;  5JWO B;  3FK8 A;  4OD7 A;  5BMU B;  4RUV A;  4N30 A;  4CY6 A;  3M1G A;  2X64 A;  5HFG A;  2GT6 A;  4WF5 A;  3WT1 A;  4TXV A;  4QL9 A;  3ERG A;  4WR5 A;  3IV4 A;  3K8N A;  3ZZX A;  1ZYP A;  4HU9 A;  1A0F A;  4LLR A;  3UAR A;  1XXU A;  3R3E A;  4DSR A;  1WPI A;  4I2T A;  1N25 A;  2MMZ A;  3ME8 A;  3QAG A;  3KMO A;  2TIR A;  1HNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...