4HZ4A

Crystal structure of glutathione s-transferase b4xh91 (target efi-501787) from actinobacillus pleuropneumoniae
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
215
structure length
215
Chain Sequence
MITLHYLKQSCSHRIVWLLEALGLDYELKIYDRLEGTGFAPEELKAQHPLGKAPVLQDGDLVLAEGNAIIQHLLDRYDTENRFTPAHKTDAYSNYVYWLAISASMFSANLLALVSKKGDLGDFAQYTNAQVGLYFSHVEKSLEGKTWIVGEQLTGADFALSFPLQWGLNYVNKADYPNITRYLEQIETHPAYLKANEKTDGGLDLSRFAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione-S-transferase
publication title Crystal structure of glutathione s-transferase b4xh91 from Actinobacillus pleuropneumoniae
rcsb
source organism Actinobacillus pleuropneumoniae
molecule tags Transferase
total genus 87
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4hz4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hz4A01
4OCFA 3FRCA 3HCZA 3HA9A 4JE1A 2XPEA 1K0MA 1F9MA 3VWXA 1J08A 2PMTA 4TOPA 3GYKA 1B9YC 4IS0A 5IMVA 1V40A 2MBTA 1QMVA 2IMIA 4IJIA 2HE3A 1TKDB 3LJRA 1V9WA 1A0FA 2YZHA 4MH3A 1EEJA 3VWWA 4EDYA 2XBQA 5KN2A 2ES7A 2LKUA 22GSA 4O32A 4LMVA 2FLSA 2QSIA 2DC5A 3ZVJA 2PGTA 3WYWA 3UEMA 2CVKA 3US3A 2K6VA 1FO5A 3DEXA 5D8IA 4WBJA 5ECIB 4MCUA 1MTCA 4HUAA 5LD0A 3IA1A 3TKSA 1PX6A 3L9VA 4JZQA 3L4NA 4KNDA 3RPNA 1GSEA 4EF0A 1PL2A 3ZMKA 1XW5A 3ZLPA 4ZXGA 1S3CA 2HSHA 3KEBA 5F06A 5D93A 4ACSA 2XBIA 1EV4A 3KH9A 1WPIA 3A5WA 1V2AA 2WZ9A 3GH9A 3VI5A 2A2SA 3F4TA 3GFKA 4OO4A 3Q18A 1QGVA 1HYUA 4LL1B 2DJ1A 2FA8A 3KXOA 1NSWA 2OADA 4K2DA 1TK5B 2KHPA 1TW9A 1SKSB 2VM2A 1XIYA 1A8YA 4V1Ag 4TXVA 5ECLB 2V2GA 1HD2A 3VURA 1JZDA 1ON4A 5DAKB 2V41A 5JCUA 1O8XA 4EDZA 1AC1A 4ECBA 2VCXA 2C0FA 4ZL7A 1WIKA 4IHUA 3WT2A 1AQVA 2FNOA 1A0RP 2CX3A 4OFMA 2JZSA 5AIVA 1XFLA 1PX7A 4EUYA 1Z9HA 1ILOA 3L9UA 4XRDA 1ERWA 1UN2A 2LEGA 2I9HA 3GX8A 1PD21 2AB6A 3ERFA 9GSSA 3IPZA 4XS6A 4WEYA 2LJAA 4PGTA 4KA0A 3EMXA 1G7OA 3GTUA 6GSSA 4KSOA 4BVYA 4PURA 2JU5A 2FA4A 1VF1A 1THXA 2XPDA 1XWGA 2K9FA 5F0GA 4TXOA 5ABRA 2H19A 5LNKe 1OKTA 4KUNA 5IMZA 3KIJA 2IMDA 2L6DA 3QFBC 2HSYA 1TK0B 2C0DA 2FY6A 2QGVA 3HXSA 2FWEA 3FY7A 4KCAA 1TU7A 3M3MA 3EWLA 3IAS2 4NV2A 5ID2A 4MF7A 1OC8A 1TI3A 3APQA 1KBNA 1YJ6A 5A4UA 2LQQA 3W8JA 6GSVA 3WGDA 3M9JA 2C4JA 2FWFA 2YJ7A 2V6KA 2LS5A 4MABA 1ACVA 2X8GA 1OVNA 2I81A 3RAZA 3KTLA 1UC7A 3GL5A 1AQXA 3FZ9A 4JR6A 5D9TA 3WGXA 4V1Ap 2CVBA 1B9XC 3TKSC 4I6XA 3HZ8A 5ELAA 5DQYA 3IC8A 1JZOA 3Q6OA 2E0QA 4NV5A 2DJ3A 3HHVA 4ECCA 1GWCA 3MNGA 5D73A 1SU9A 4RQRA 4CDOA 5AN1A 2JZTA 2VLVA 4MJCA 3A2VA 2M80A 1SENA 1TRSA 4KGIA 3TGZA 2VM1A 1X9MB 3P8WA 4PXOA 1R7HA 2WCIA 1U3AA 2JACA 4D73A 2G2QA 2NBSA 2OA7A 3FW2A 1GLPA 3TUEA 4N10A 5COHA 2FWGA 1PKZA 3APSA 5J5NA 1K0BA 1KNGA 3D5JA 3DVWA 3H8QA 1PSQA 4ZL9A 3EC3A 1VRSD 2B3SA 3ZZXA 1FVKA 1A8LA 2D2ZA 1XPVA 1ERVA 4MA9A 5HFKA 3DMLA 2RUEA 1GNEA 1ZYQB 2C0EA 1XWBA 2MYGA 4MF6A 1CQGA 1F2EA 1R26A 5ECRB 4HQSA 4X43A 2YV9A 3GH6A 1B4QA 4AJ7A 1T4ZA 7GSSA 2DBCA 3F8UA 2H6XA 4IP6A 1Z7RA 3Q74A 4OO5A 3O6TA 3W6GA 1YQ1A 4I97A 1GTBA 3CRTA 2L5LA 3CTGA 3UBLA 3EURA 4HU9A 4ZB6A 2TRXA 4I2UA 5DVBA 2RM5A 1LJRA 3P90A 4DSSA 3C8EA 3LYKA 1N2AA 3HZ4A 1T3BA 1WRYA 4N11A 1F37A 4BVXB 1QK8A 3FK8A 2ZUPA 4ISDA 2L5OA 2ZCTA 3CSIA 2IJYA 2Z9SA 2VL2A 3CTFA 4F0BA 4XIHA 4TR4A 1U3IA 4K0NA 1ML6A 2H30A 2H72A 3I6AA 3C1SA 3NIVA 2X8HA 5D9XA 3UMAA 1SYRA 3OR5A 4WXTA 4F9ZA 5DJMA 3CYNA 2OE1A 2IMEA 3VWUA 2IFQA 1H4OA 2VUPA 5G5FA 5CRWA 2J9HA 3CBUA 1Q4JA 1SJ6A 3W8SA 4TR3A 4MZWA 1ST9A 4NMUA 3TB2A 3PR8A 2CV4A 3CSJA 1M2AA 3ZYWA 4GF0A 4J57E 2LUSA 4I5QA 3M1GA 3ERWA 4K1FA 1EOGA 5ECKB 4ZB8A 1WE0A 2H70A 4YQVA 5J4UA 3QFAC 4L5LA 1GP1A 2YWNA 4ECIA 11GSA 1EEMA 1OYJA 5CREA 2DMLA 5CO3A 2VOCA 3ZFBA 4K6XA 4NWYA 1G7EA 4N30A 1R4WA 3KM6A 4ML6A 5GSTA 5ECSA 4PUFC 1E6BA 3H1NA 2YWOA 4RQXA 2GT5A 1Z7PA 2F8AA 4HJMA 1URMA 4H86A 1Q98A 2P31A 3IXRA 5DALB 1JHBA 1V58A 4ZL8A 14GSA 1J9BA 2YCDA 2VLUA 2HZEB 1BG5A 2HRKB 1EGOA 2GLRA 1XOAA 5A5KA 1S3DA 5HQPA 4XS4A 4N0VA 5ECPB 1QXHA 1M2DA 3NOFA 1LBKA 4MP4A 1U88A 2NPBA 1T4YA 5CRHA 17GSA 4KDXA 5J3RA 3LWAA 1THOA 1WWJA 2EIRA 2LNSA 2LRTA 3LGCA 2E7PA 3UARA 4L0WA 3TJJA 4G19A 3PGTA 1BJXA 1IYIA 5ECOB 2KLXA 1FB6A 1EP8A 3ME7A 2C8UA 4HDEA 2HRNA 1K3LA 5A4WA 4TVEA 3GKNA 1K0NA 1AIUA 2ZNMA 3GNJA 4KE3A 3SWLA 1JZRA 4ID0A 1F3AA 2RUFA 4KW6A 4WR5A 3FR3A 4POMA 1N8JA 4HI7A 1A2JA 3G7YA 3H93A 3GSTA 3L78A 5JWRB 2VL2C 4NAXA 2HSMA 1JZWA 4GQFA 4KH7A 2NVLA 3FEUA 2LV3A 3TKQA 1X9WB 3EU4A 1FG4A 2JL4A 2HI7A 2R37A 4AJ6A 2H71A 5G5EA 1KEBA 4XCSA 3C73A 12GSA 3GN3A 2JZRA 3V1WA 1XVWA 3KH7A 1G6YA 4IGJA 3R2QA 3R3EA 2N5FA 2YANA 2GS3A 3UOMA 2A4VA 3BCIA 4GQCA 1EWXA 3P2AA 4MLYA 5DAKA 3F3QA 1UA5A 2VLTA 4NHZA 4JU5A 4MZBA 1G6WA 1BAYA 4ECJA 3GHAA 4L8EA 2P5QA 2X99A 2LSTA 5IQYA 3TKPA 2CX4A 3LYPA 2F8FA 2CZ2A 4G0KA 2H1BA 2EC4A 3GKKA 4O5RA 3QMXA 4RI7A 2GVPA 3D21A 4RI6A 3HJOA 4HQZA 4O7HA 1SKWB 1K0DA 2KP2A 2HT9A 1OE8A 4MK3A 4XTSA 2NDOA 1BQ7A 5IMCA 1T7PB 3NZNA 5AIXA 2HXKA 5FWGA 4AJ8A 4DSRA 3O3TA 4PTSA 2MMNA 2M46A 3HJMA 2VD1A 4EE0A 2C0GA 1F6MC 5EVOA 1YZXA 4EO3A 1A24A 1TP9A 1FHEA 2P5RA 3I9V2 4Q5RA 4BA7A 2B5XA 4CHSA 4G0IA 3KGKA 2CZ3A 2H0GA 3E3EA 3CXGA 2H66A 2PN8A 1GUKA 4EVMA 5IMDA 4F2IA 2H0HA 4GLTA 5KN1A 1M9BA 5GSSA 1EV9A 4MPGA 4HS1A 2KUCA 1R5AA 2YWMA 3UJ1A 4DVCA 1H75A 3GIXA 3A2WA 3EINA 4TW5A 5IIZA 1V57A 2B7KA 5IO0A 2C1YA 4MZCA 1O85A 4KCEA 1SD9A 3BCKA 3K8NA 4NHWA 4MJBA 2GZYA 3L9SA 3ZTLA 4E8EA 2H74A 3GURA 2AYTA 4GSNA 2JADA 3BJ5A 3KMOA 3N9JA 4K7OA 1T1VA 1EOHA 3VI7A 2O8VB 4ILFA 4KF9A 1YF1A 4K7IA 4EL1A 1RW1A 4ZBDA 1XOBA 3GTUB 1MDJA 4WETA 3VK9A 4BVYB 2B6MA 3EMPA 1OC9A 2L57A 4DEJA 2L4QA 2L59A 1OAZA 1X5CA 3RHCA 2WFCA 5IPGA 4MF5A 5GAPD 1O6JA 4BL7A 4QQ7A 3ZREA 4J2FA 3M0FA 3FYGA 5INYA 1XWAA 3KP9A 1O73A 1NHYA 1SK1A 4F82A 3HVSA 2ON7A 3L0HA 1AUCA 2UZ8A 1DE2A 2RLIA 3TRXA 3APOA 3BOAA 2DSAA 2PPTA 5FHIA 3VLNA 1HQOA 5IPHA 3F3RA 3TCOA 1ERTA 3FZ4A 2E2GA 4AF2A 3PINA 1BYEA 3DKSA 1SL0B 20GSA 2YJHA 3EVIA 3EE2A 3DD3A 4PUAA 5ECNB 1GRXA 4RUVA 1W89A 4POKA 4Q5QA 5ECHB 3IAM2 8GSSA 4E8HA 2DIYA 4BVXA 1PGTA 1XW9A 1QQ2A 1XCCA 2LRNA 1K0CA 1SL1B 5FT3A 5G1KA 3AY8A 4G10A 2C3TA 1GNWA 1GULA 1IYHA 1JLWA 3CSHA 4Q5NA 1ZCPA 1AXDA 2BTOT 2FD3A 3F63A 4K0GA 5HR0A 5H5RA 2HRFA 2H0IA 2VIMA 3LEFA 1X0RA 3LXTA 3DXBA 3G7IA 2DJ0A 3KMNA 1A23A 1M2BA 2HSNB 4LMWA 2NTOA 4O92A 5F05A 4IELA 4ZIJA 4KSMA 2VL3A 4D73B 4IVFA 3IK9A 1GTAA 3F9UA 5KN3A 1PKWA 3GV1A 3I69A 2LTKA 4ZBAA 2GQMA 6GSTA 2CQ9A 2R3XA 2VCZA 1ZGNA 1OKDA 2CT6A 4JEDA 5H5SA 4WBRD 1SD8A 2V6OA 2IMKA 3D22A 2H1GA 4TKYA 4ZBBA 3KD0A 1M9AA 3KTBA 2KP1A 1Y6EA 2OE3A 1MEKA 5DCHA 1HNCA 4V2NA 3UAPA 5IO2A 1DBYA 2K8SA 2IWTA 4J56E 4I2TA 2GSSA 3I43A 1MDIA 2BMXA 3LG6A 4K8MA 4IQ1A 4WF5A 4FYUA 2CAIA 3BD2A 3RDWA 2J23A 1TJDA 1X5DA 3E0UA 2OBKA 2H6ZA 4CW9A 5G2ZA 5DALA 5HR2A 4YH2A 2XHFA 1YEPA 1PQNA 1O7UA 2CAQA 3GMFA 2HRKA 3QD9A 4TR0A 3G9BA 1K0OA 4MJAA 3HVXA 4X0XA 2WULA 3QDNA 3QOUA 4WKWA 3GA4A 3PH9A 1Y25A 4F0CA 1SK0A 1X9SB 1A2MA 4KAEA 2R2JA 3QAVA 1K3OA 3IRAA 3BBYA 3IK7A 3DRNA 4GSTA 1AW9A 1FOVA 4G9HA 6GSYA 2MMOA 2IFQB 5B6NA 5KEJA 1ZOFA 2H73A 4GRFA 2LRCA 1HNBA 3QAGA 2H1AA 2VCQA 2DJ2A 3FZAA 3D6IA 3DIEA 1GTIA 4POLA 2E2MA 4GSSA 5C00A 3EU3A 4P3YB 3VWVA 1MDKA 3ME8A 5IMAA 4XS1A 3MDKA 1ERUA 1VF3A 3HD5A 2OACA 2AUVA 1TXXA 1AAZA 1PA3A 2REMA 1TK8B 2K18A 3IHQA 5JWOB 2GSQA 3CRUA 6GSWA 2YZUA 1TRVA 4MPFA 3GKXA 5B8AA 2L4CA 4OCEA 1HNAA 2F9SA 2O89A 2O7KA 3VFIA 19GSA 3GRXA 2FUG2 4HOJA 6GSUA 4TN8A 2R4VA 2HZFA 3TJBA 4TR1B 3HDCA 4PQHA 1TU8A 2XC2A 2H1DA 3LXZA 1I5GA 2RIIA 5B6MA 3TOUA 5CNWA 4POBA 1NW2A 3ISOA 3UL3A 2GQKA 2CA8A 3D4MA 4KX4A 4PNGA 2O85A 2R6KA 1VF2A 5IOWA 1NM3A 1XXUA 4XS4B 3U5RE 4GTUA 3GSSA 3U6VA 2PUKC 4N0ZA 1BEDA 1TRWA 1RK4A 1TRUA 2GGTA 5B7CA 1VF4A 2GDRA 4FH8A 4ML1A 1TI1A 4OFTA 1NHOA 3IR4A 2MMZA 5JCWA 4G0LA 3MWHA 1B48A 1GSSA 2YN1A 2YNXA 2DJKA 1EZKA 1YDKA 4FYBA 2OJLA 2K8VA 4IQAA 1ABAA 1MD4A 1G0TA 3KZQA 3WGEA 3TJFA 2P0GA 1Z6MA 2HFDA 5F8BA 1GSQA 3TKRA 1YF0A 1XWCA 5BMUA 2DJJA 1FW1A 3H79A 3ZITA 2H75A 1Z6NA 2M72A 2VCTA 3F4SA 1M0UA 2H76A 2HSMB 4IJ3A 3E9JB 2HLSA 4BWQA 4BPYA 3C1RA 5D96A 2GZZA 3VPTA 1SKRB 4ZILA 3VPQA 3GUSA 1WP0A 3RBTA 1B4PA 2PBJA 5AGYA 1ZYEA 5E59A 2TIRA 1DUGA 5CRGA 3S9FA 2HQTA 1OE7A 2DLXA 1O81A 1W4VA 3MSZA 3IE3A 2VCWA 3JCML 2WRTA 3WD6A 1SJIA 2EIOA 3HYPA 5DQSA 2VD0A 1YEXA 3Q19A 5CYYA 3O76A 4NPBA 4WF4A 1JFUA 5KN0A 3LFLA 5DCGA 3IC4A 5A4VA 2B5EA 2KOKA 2PU9C 4YAPA 5AISA 5DBQA 1FB0A 2GT6A 3IOSA 2DMMA 2LNTA 2X64A 1DE1A 3QCPA 1R5PA 2MMAA 1Z3EA 1SJZA 2O87A 3C7MA 3F4RA 4QL9A 2H01A 1YKCA 5IMFA 2QKEA 1WOUA 1X5EA 3M9KA 2N5BA 1A2LA 4PQ1A 1DSBA 3A3TA 2WJUA 2OE0A 1OC3A 4MDCA 2R5GA 2GQLA 1BX9A 1Z5YE 1PN9A 1M99A 4KDUA 2IMFA 1TOFA 3DVXA 2C80A 1VGLA 1GL8A 2IL3A 1GTUA 1GSYA 4AGSA 2MBSA 2A2RA 2V1MA 4LL4B 4XRAA 1KTEA 4V2LA 4FQUA 2GTUA 4MJEA 3TRQA 3ZVJD 2IN3A 2YPMA 6GSXA 3H4KA 4OWYA 5DJLA 5EL8A 2VAFA 4FO5A 3QR6A 2H6YA 4HZ2A 4YQMA 2RM6A 2FHEA 4NXIA 3GKMA 4G2EA 2YOIA 3ZL5A 1LU4A 3IV4A 3QAWA 4WR4A 2GZPA 18GSA 3F6DA 3ZIJA 2B5YA 1SYXA 4TXOB 2C3QA 3TKSE 5LCZA 3HJPA 4JRRA 5G30A 2PVQA 3KP8A 5IM9A 4F03A 2C3NA 4IW9A 3HKRA 4BWSA 4IBPA 3IDVA 2B7JA 5J9BA 2B1KA 2LQOA 1E2YA 2ON5A 2AHEA 1T8EB 5ID2B 4EXJA 1QUWA 1XWKA 3N5OA 5G31A 5J41A 3MAKA 5CRDA 4L0UA 2WGRA 1AQWA 2B1LA 4ULXA 5DDLA 5ELGA 2HRAA 1GLQA 3DYRA 3LQ7A 4FYCA 1U87A 3LORA 2PWJA 2I1UA 3D0ZA 4OFNA 3J7Yk 1OC9B 2VL9A 3DWVA 4Q5FA 4FIWA 4OMVA 2JSZA 4L5OA 2YP6A 2PVOC 2G0FA 5GZZB 4HJ2A 1ZL9A 4GWRA 3LSZA 3ZMLA 4LA1A 1QFNA 3TDGA 5HR1A 4BL7B 2BJXA 2VCVA 1PMTA 4ZB9A 5ECQB 1U6TA 3F6FA 1SK2A 4PX1A 1WJKA 3TRPA 5G1LA 5GAND 5C04A 2FWHA 1I9DA 2N5AA 2PERA 4HU7A 2HYXA 3F0IA 5ECMB 3UBKA 4EC0A 1PL1A 5EPFA 10GSA 3J7Yb 2AAWA 5HFGA 4GXZA 1B8XA 3ZFLA 2GSRA 4KDYA 1C72A 4HZ4A 4HEA2 4USSA 3FZ5A 2H8LA 3UIWA 1XVQA 1SL2B 3UVHA 3A2XA 1USBA 3TOTA 2QC7A 2WDUA 1GH2A 2ALBA 4Z7XA 1F3BA 1S3AA 4MMMA 3G7JA 2FCHA 3IBHA 4YAVA 3FKFA 1MD3A 2IPAA 3GL3A 1O8WA 2CVDA 5CP1A 5ENUA 2EIQA 2V32A 3KCMA 5IOXA 4DSQA 5H5QA 1PRXA 4LLRA 1WMJA 1YKAA 3UVTA 4JR4A 5EY6A 2I4AA 3DGQA 2F3MA 2YV7A 2I3YA 1K0AA 4IN0A 3M8NA 4DSSB 2VO4A 1JLVA 5F07A 2AJQB 3HVVA 2JSYA 2HZEA 5J9CA 2L6CA 2LJRA 5HFIA 1V98A 3TJGA 3WT1A 2FGXA 3ZIVA 3HY2A 5JCGA 4I8BA 1M7TA 3QPMA 1GSUA 3GX0A 3KJYA 1T00A 4OD7A 1J0FA 1ZZYA 2LJKA 5D9WA 5JWQB 2WB9A 3SBCA 4KB3A 2OBIA 2HNLA 1FAAA 3CMIA 1XBSA 1ZMAA 3TJKA 4V2MA 1GUMA 1XW6A 2MZCA 4XHMA 16GSA 4PNFA 3C71A 2TRCP 3EYTA 3RPPA 4K7NA 4PQIA 13GSA 5B8BA 3P7XA 4JBBA 2IIYA 4MH2A 4TR1A 1UVZA 1K3YA 3PPUA 5D9VA 2GSTA 4IKHA 4K9ZA 4EKZA 1TTZA 4QL7A 1YY7A 2AV4A 1RQMA 1XZOA 2YWIA 3ZRDA 5L71A 1FVJA 1EP7A 2OKAA 3FHKA 5E4WA 1GSDA 3ERGA 4GCIA 1GSFA 1CQHA 1TDIA 2DIZA 3ED3A 5HR3A 1GUHA 4YQUA 3RHBA 3FR9A 3D4TA 2X8CA 4IP1A 2F51A 4X1UA 2WS2A 3FR6A 1EGRA 4TRXA 5CAXA
chains in the Genus database with same CATH superfamily
4OCFA 3FRCA 3HCZA 3HA9A 4JE1A 2XPEA 1K0MA 1F9MA 3VWXA 1J08A 2EFCA 2PMTA 4TOPA 3GYKA 1B9YC 4IS0A 5IMVA 1V40A 2MBTA 1QMVA 2IMIA 4IJIA 2HE3A 1TKDB 3LJRA 3LW9A 1V9WA 1A0FA 2YZHA 4MH3A 1EEJA 2WVYA 3VWWA 4EDYA 2XBQA 5KN2A 2ES7A 2LKUA 22GSA 4O32A 4LMVA 2FLSA 2QSIA 2DC5A 3ZVJA 2PGTA 3WYWA 3UEMA 2CVKA 3US3A 2K6VA 1FO5A 3DEXA 5D8IA 5A34A 4ZB7A 4WBJA 5ECIB 4MCUA 1MTCA 4HUAA 5LD0A 3IA1A 3TKSA 1PX6A 3L9VA 4ICYA 4JZQA 3L4NA 4KNDA 3RPNA 1GSEA 4EF0A 1PL2A 3ZMKA 1XW5A 3ZLPA 4ZXGA 1S3CA 2HSHA 3KEBA 5F06A 5D93A 4ACSA 2XBIA 1EV4A 3KH9A 1WPIA 3A5WA 1V2AA 2WZ9A 3GH9A 5BRTA 3VI5A 2A2SA 3F4TA 3GFKA 4OO4A 3Q18A 1QGVA 1HYUA 4N3ZA 4LL1B 2DJ1A 2FA8A 3KXOA 1NSWA 2OADA 4K2DA 1TK5B 2KHPA 1TW9A 1SKSB 2VM2A 1XIYA 1A8YA 4V1Ag 4TXVA 5ECLB 2V2GA 1HD2A 3VURA 1JZDA 1ON4A 5DAKB 2V41A 5JCUA 1O8XA 4EDZA 1AC1A 2EFHA 4ECBA 2VCXA 2C0FA 4ZL7A 1WIKA 4IHUA 3WT2A 5BMUB 1AQVA 2FNOA 1A0RP 2CX3A 4OFMA 2JZSA 5AIVA 1XFLA 1PX7A 4EUYA 1Z9HA 1ILOA 3L9UA 4Z2RA 4XRDA 1ERWA 1UN2A 2LEGA 2I9HA 3GX8A 1PD21 2AB6A 3ERFA 9GSSA 3IPZA 4XS6A 4WEYA 2LJAA 4PGTA 4KA0A 3EMXA 1G7OA 3GTUA 6GSSA 4KSOA 4BVYA 1S4BP 4PURA 2JU5A 2FA4A 1VF1A 1THXA 2XPDA 2X4AA 1XWGA 2K9FA 5F0GA 4TXOA 5ABRA 2H19A 5LNKe 1OKTA 4KUNA 5IMZA 3KIJA 4X4JA 2IMDA 2L6DA 3QFBC 2QA1A 2HSYA 1TK0B 2C0DA 2FY6A 2QGVA 3HXSA 2FWEA 3FY7A 4KCAA 1TU7A 3M3MA 3EWLA 3IAS2 4NV2A 5ID2A 4MF7A 1OC8A 1TI3A 3APQA 1KBNA 1YJ6A 5A4UA 2LQQA 4EIPA 3W8JA 2VKZG 6GSVA 3WGDA 3M9JA 2C4JA 2FWFA 2YJ7A 2V6KA 2LS5A 4MABA 1ACVA 2X8GA 4K2XA 1OVNA 2I81A 3RAZA 3KTLA 1PN0A 1UC7A 5KOWA 3GL5A 1AQXA 3FZ9A 4JR6A 5D9TA 3WGXA 4V1Ap 2CVBA 1B9XC 3TKSC 4I6XA 3HZ8A 1I1IP 5ELAA 5DQYA 3IC8A 5J4YA 1JZOA 3Q6OA 2E0QA 4NV5A 2DJ3A 3HHVA 4ECCA 1GWCA 3MNGA 5D73A 1SU9A 4RQRA 4CDOA 5AN1A 2JZTA 2VLVA 4MJCA 2HSNA 3A2VA 2M80A 1SENA 1TRSA 4KGIA 3TGZA 2VM1A 1X9MB 3P8WA 4PXOA 1R7HA 2WCIA 1U3AA 2JACA 4D73A 2QA2A 2G2QA 2NBSA 2OA7A 3FW2A 1GLPA 3TUEA 1TXUA 4N10A 5COHA 2FWGA 1PKZA 3APSA 1Y1UA 5J5NA 1K0BA 1KNGA 3D5JA 3DVWA 3H8QA 1PSQA 4ZL9A 3EC3A 1YEWC 1VRSD 2B3SA 3ZZXA 1FVKA 1A8LA 2D2ZA 1M3IA 1XPVA 5KOXA 1ERVA 4MA9A 5HFKA 3DMLA 2RUEA 1GNEA 1ZYQB 2C0EA 1XWBA 2MYGA 4MF6A 1CQGA 1F2EA 5A5HB 1R26A 5ECRB 4HQSA 4X43A 2YV9A 3GH6A 1B4QA 4AJ7A 1T4ZA 7GSSA 2DBCA 3F8UA 2H6XA 4IP6A 1Z7RA 3Q74A 4OO5A 3O6TA 3W6GA 1YQ1A 4I97A 1GTBA 3CRTA 2L5LA 2A2PA 3CTGA 3UBLA 3EURA 4HU9A 4ZB6A 2TRXA 4I2UA 5DVBA 2RM5A 1LJRA 3P90A 4DSSA 3C8EA 3LYKA 1N2AA 3HZ4A 1T3BA 1WRYA 4N11A 1F37A 4BVXB 1QK8A 3FK8A 2ZUPA 4ISDA 2L5OA 2ZCTA 3CSIA 2IJYA 2Z9SA 2VL2A 3CTFA 4F0BA 4XIHA 4TR4A 1U3IA 4K0NA 1ML6A 2H30A 2H72A 3HMJG 3I6AA 3C1SA 3NIVA 2X8HA 5D9XA 3UMAA 1SYRA 3OR5A 4K5RA 4WXTA 4F9ZA 5DJMA 3CYNA 2OE1A 2IMEA 3VWUA 5J40A 2IFQA 1H4OA 2VUPA 5G5FA 5CRWA 1N25A 2J9HA 3CBUA 1Q4JA 1SJ6A 3W8SA 4TR3A 4MZWA 2OT3A 1ST9A 4NMUA 3TB2A 3PR8A 2CV4A 3CSJA 1M2AA 3ZYWA 4GF0A 4J57E 3TU3B 2LUSA 4I5QA 3M1GA 3ERWA 4K1FA 1EOGA 5ECKB 4ZB8A 5J47A 1WE0A 2H70A 4YQVA 5J4UA 3QFAC 4L5LA 1GP1A 2YWNA 4ECIA 11GSA 1EEMA 1OYJA 5CREA 2DMLA 5CO3A 2VOCA 3ZFBA 4A5PA 4K6XA 4NWYA 1G7EA 4N30A 1R4WA 3KM6A 4ML6A 5GSTA 5ECSA 4PUFC 1E6BA 3H1NA 2YWOA 4RQXA 2GT5A 1Z7PA 2F8AA 4HJMA 1URMA 4H86A 1Q98A 2P31A 3IXRA 5DALB 1JHBA 1V58A 2R0CA 4ZL8A 14GSA 1J9BA 2YCDA 2VLUA 2HZEB 1BG5A 2HRKB 1EGOA 2GLRA 1XOAA 5A5KA 1S3DA 5HQPA 4XS4A 4N0VA 5ECPB 1QXHA 1M2DA 3NOFA 1LBKA 4MP4A 1U88A 2NPBA 1T4YA 5CRHA 17GSA 4KDXA 5J3RA 3LWAA 1THOA 1WWJA 2EIRA 2LNSA 2LRTA 3LGCA 2E7PA 3UARA 4L0WA 1SVLA 3TJJA 4G19A 3PGTA 1BJXA 1IYIA 5ECOB 2KLXA 4E68A 1FB6A 1EP8A 4PHZC 3ME7A 2C8UA 4HDEA 2HRNA 1K3LA 5A4WA 4TVEA 3GKNA 1K0NA 1AIUA 2ZNMA 3GNJA 4KE3A 3SWLA 1S3RA 1JZRA 4ID0A 1F3AA 2RUFA 4KW6A 4WR5A 3FR3A 4POMA 1N8JA 4HI7A 1A2JA 3G7YA 3H93A 2O5VA 2WW3A 3GSTA 4PI0C 3L78A 4Z2TA 5JWRB 2VL2C 4NAXA 2HSMA 1JZWA 4FXYP 4GQFA 4KH7A 2NVLA 3FEUA 2LV3A 3TKQA 1X9WB 4GDFA 3EU4A 1FG4A 2JL4A 2HI7A 2R37A 4AJ6A 2H71A 5G5EA 1KEBA 4XCSA 1SVOA 2O3EA 3C73A 12GSA 3EPTA 3GN3A 2JZRA 3V1WA 1XVWA 3KH7A 1G6YA 4IGJA 3R2QA 3R3EA 2N5FA 1YVLA 2GS3A 2YANA 3UOMA 2A4VA 3BCIA 4GQCA 1EWXA 3P2AA 4MLYA 5DAKA 3F3QA 1UA5A 2VLTA 4NHZA 4JU5A 4MZBA 1G6WA 1BAYA 4ECJA 3GHAA 4L8EA 2P5QA 2X99A 2LSTA 3RGBC 5IQYA 3TKPA 4HSCX 2CX4A 3LYPA 2F8FA 2CZ2A 4G0KA 2DKHA 2H1BA 2EC4A 3GKKA 4O5RA 3QMXA 4RI7A 2GVPA 3D21A 4RI6A 3HJOA 4HQZA 4O7HA 1SKWB 1K0DA 2KP2A 2HT9A 1OE8A 4MK3A 4XTSA 2NDOA 1BQ7A 5IMCA 1T7PB 3NZNA 5AIXA 2HXKA 5FWGA 2O36A 4AJ8A 4DSRA 3O3TA 4PTSA 2MMNA 2M46A 3HJMA 2VD1A 4EE0A 2C0GA 1F6MC 5EVOA 1YZXA 4EO3A 1A24A 1TP9A 1FHEA 2P5RA 3I9V2 4Q5RA 4BA7A 2B5XA 4CHSA 4G0IA 3KGKA 2CZ3A 2H0GA 3E3EA 3CXGA 2H66A 2PN8A 1GUKA 4EVMA 5IMDA 4F2IA 2H0HA 4GLTA 5KN1A 1M9BA 5GSSA 1EV9A 4MPGA 4HS1A 2KUCA 1R5AA 2YWMA 3UJ1A 2A4HA 4DVCA 1H75A 3GIXA 3A2WA 3EINA 4TW5A 5IIZA 1V57A 2B7KA 5IO0A 2C1YA 4MZCA 1O85A 4KCEA 1SD9A 3BCKA 3K8NA 4NHWA 4MJBA 3MYDA 2GZYA 3L9SA 3ZTLA 4E8EA 2H74A 3GURA 2AYTA 4GSNA 2JADA 3BJ5A 3KMOA 3N9JA 4K7OA 1T1VA 4AKHA 1EOHA 3VI7A 2O8VB 4ILFA 4KF9A 1YF1A 4K7IA 4EL1A 1RW1A 4ZBDA 1XOBA 3GTUB 1MDJA 4WETA 3VK9A 4BVYB 2B6MA 4QMKA 3EMPA 1OC9A 2L57A 4DEJA 2L4QA 2L59A 1OAZA 1X5CA 3RHCA 2WFCA 5IPGA 4MF5A 5GAPD 1O6JA 4BL7A 4QQ7A 3ZREA 4J2FA 3M0FA 3FYGA 5INYA 1XWAA 1O73A 3KP9A 1NHYA 1SK1A 4AI6A 4F82A 3HVSA 1ZYPA 2ON7A 3L0HA 1AUCA 2UZ8A 1DE2A 2RLIA 3TRXA 3APOA 3BOAA 2DSAA 2PPTA 5FHIA 3VLNA 1HQOA 5IPHA 3F3RA 3TCOA 1ERTA 3FZ4A 2E2GA 4AF2A 3PINA 1BYEA 3DKSA 1SL0B 20GSA 2YJHA 3EVIA 3EE2A 3DD3A 4PUAA 5ECNB 1GRXA 4RUVA 1W89A 4POKA 4Q5QA 5ECHB 3IAM2 8GSSA 4E8HA 2DIYA 4BVXA 1PGTA 1XW9A 1QQ2A 1XCCA 2LRNA 1K0CA 1SL1B 5FT3A 5G1KA 3AY8A 4G10A 2C3TA 1GNWA 1GULA 1IYHA 1JLWA 3CSHA 4Q5NA 1ZCPA 1AXDA 2BTOT 2FD3A 3F63A 4K0GA 5HR0A 5H5RA 2HRFA 2H0IA 2VIMA 1SVMA 3LEFA 1X0RA 3LXTA 3DXBA 3G7IA 2DJ0A 3KMNA 1A23A 1M2BA 2HSNB 4LMWA 2NTOA 4O92A 5F05A 4IELA 4ZIJA 4KSMA 2VL3A 4D73B 4IVFA 3IK9A 4BIKA 1GTAA 3F9UA 5KN3A 1PKWA 3GV1A 3I69A 2EFEA 2LTKA 1ZYNA 2R0GA 4ZBAA 2GQMA 3A5IA 6GSTA 2CQ9A 2R3XA 2VCZA 1ZGNA 1OKDA 2CT6A 4JEDA 5H5SA 2X49A 4WBRD 1SD8A 2V6OA 2IMKA 3D22A 2H1GA 4TKYA 4ZBBA 3KD0A 1M9AA 3KTBA 2KP1A 1Y6EA 2OE3A 1MEKA 5DCHA 1HNCA 4V2NA 3UAPA 5IO2A 1DBYA 2K8SA 2IWTA 4CY6A 4J56E 4I2TA 2GSSA 3I43A 1MDIA 2BMXA 3LG6A 4K8MA 4IQ1A 4WF5A 4FYUA 2CAIA 3BD2A 3RDWA 2J23A 1TJDA 1X5DA 3E0UA 2OBKA 2H6ZA 4CW9A 5G2ZA 5DALA 5HR2A 4YH2A 2XHFA 1YEPA 1PQNA 1O7UA 2CAQA 3GMFA 2HRKA 3MIXA 3QD9A 4TR0A 3G9BA 1K0OA 2WZSA 3HVXA 4MJAA 4X0XA 2WULA 3QDNA 3QOUA 4WKWA 3GA4A 3PH9A 1Y25A 4F0CA 1SK0A 1X9SB 1A2MA 4KAEA 2R2JA 3QAVA 1K3OA 3IRAA 3BBYA 3IK7A 3DRNA 4GSTA 1AW9A 1FOVA 5A1NA 4G9HA 6GSYA 2WW1A 2MMOA 2IFQB 5B6NA 5KEJA 1ZOFA 2H73A 4GRFA 2LRCA 1HNBA 3QAGA 2H1AA 2VCQA 2DJ2A 3FZAA 3D6IA 3DIEA 1GTIA 4POLA 2E2MA 4GSSA 5C00A 3EU3A 4P3YB 3VWVA 1MDKA 3ME8A 5IMAA 4XS1A 3MDKA 1ERUA 1VF3A 3HD5A 2OACA 2AUVA 1TXXA 1AAZA 1PA3A 2REMA 1TK8B 2K18A 3IHQA 5JWOB 2GSQA 3CRUA 6GSWA 2YZUA 1TRVA 4MPFA 3GKXA 5B8AA 2L4CA 4MNNA 4OCEA 1HNAA 2O89A 2F9SA 2O7KA 4AKGA 2DKIA 3VFIA 19GSA 3GRXA 2FUG2 4HOJA 6GSUA 4TN8A 2R4VA 2HZFA 3TJBA 4TR1B 3HDCA 4PQHA 1TU8A 2XC2A 2H1DA 3LXZA 1I5GA 2RIIA 5B6MA 3TOUA 5CNWA 4POBA 1NW2A 3ISOA 3UL3A 1BF5A 2GQKA 2CA8A 3D4MA 4KX4A 4PNGA 2O85A 2R6KA 1VF2A 5IOWA 1NM3A 1XXUA 4XS4B 3U5RE 4GTUA 3GSSA 3U6VA 2PUKC 4N0ZA 2EFDA 1BEDA 1TRWA 1RK4A 1TRUA 2GGTA 5B7CA 1VF4A 2GDRA 4FH8A 4ML1A 1TI1A 4OFTA 1NHOA 3IR4A 2MMZA 5JCWA 4G0LA 3MWHA 1B48A 1GSSA 2WVXB 2YN1A 2YNXA 2DJKA 1EZKA 3FMWA 1YDKA 4FYBA 2OJLA 2K8VA 4IQAA 1ABAA 1MD4A 1G0TA 3KZQA 3WGEA 3TJFA 2P0GA 1Z6MA 2HFDA 5F8BA 1GSQA 3TKRA 1YF0A 1XWCA 5BMUA 2DJJA 1FW1A 3H79A 3ZITA 2H75A 1Z6NA 2M72A 2VCTA 3F4SA 1M0UA 2H76A 2HSMB 4IJ3A 3E9JB 2HLSA 4BWQA 4BPYA 3C1RA 5D96A 2GZZA 3VPTA 1SKRB 4ZILA 3VPQA 3GUSA 1WP0A 3RBTA 1B4PA 2PBJA 5AGYA 1ZYEA 5E59A 2TIRA 1DUGA 5A34B 5CRGA 3S9FA 2HQTA 1OE7A 2WW0A 2DLXA 1O81A 1W4VA 3MSZA 3IE3A 2VCWA 3JCML 2WRTA 3WD6A 1SJIA 2EIOA 3HYPA 5DQSA 2VD0A 1YEXA 3Q19A 5CYYA 3O76A 4NPBA 4WF4A 1JFUA 4K5SA 5KN0A 3LFLA 5DCGA 3IC4A 5A4VA 2B5EA 2KOKA 2PU9C 4YAPA 3CWGA 5AISA 5DBQA 1FB0A 2GT6A 3IOSA 2DMMA 1FOHA 2X64A 2LNTA 1DE1A 3QCPA 1R5PA 2MMAA 1Z3EA 1SJZA 2O87A 3C7MA 3F4RA 4QL9A 2H01A 1YKCA 5IMFA 2QKEA 1WOUA 1X5EA 3M9KA 2N5BA 1A2LA 4PQ1A 1DSBA 3A3TA 2WJUA 2OE0A 1OC3A 4MDCA 2R5GA 2GQLA 1BX9A 1Z5YE 1PN9A 1M99A 4KDUA 2IMFA 1TOFA 3DVXA 2C80A 1VGLA 1GL8A 2IL3A 1GTUA 1GSYA 4AGSA 2MBSA 2A2RA 2V1MA 4LL4B 4XRAA 1KTEA 4CY8A 4V2LA 4FQUA 2GTUA 4MJEA 3TRQA 3ZVJD 2IN3A 2YPMA 6GSXA 3H4KA 4OWYA 5DJLA 5EL8A 2VAFA 4FO5A 3QR6A 2H6YA 4HZ2A 4YQMA 2RM6A 2FHEA 4NXIA 2R0PA 3GKMA 4G2EA 2YOIA 3ZL5A 1LU4A 3IV4A 3QAWA 4WR4A 2GZPA 18GSA 3CQFA 3F6DA 3ZIJA 2B5YA 1SYXA 4TXOB 2C3QA 3TKSE 5LCZA 3HJPA 4JRRA 5G30A 2PVQA 3KP8A 5IM9A 1BG1A 4G01A 4F03A 2C3NA 4IW9A 3HKRA 4BWSA 4IBPA 3IDVA 2B7JA 5A5HA 5J9BA 2B1KA 2LQOA 1E2YA 2ON5A 2AHEA 1T8EB 3CHXC 5ID2B 4EXJA 1QUWA 1XWKA 3N5OA 5G31A 5J41A 3MAKA 5CRDA 4L0UA 2H1LA 2WGRA 1AQWA 2B1LA 4ULXA 5DDLA 5ELGA 2HRAA 1GLQA 3DYRA 3LQ7A 4FYCA 3HVNA 1U87A 3LORA 2PWJA 2I1UA 3D0ZA 1PFOA 4OFNA 3J7Yk 1OC9B 2VL9A 3DWVA 4Q5FA 4FIWA 4OMVA 2JSZA 4YKFA 4L5OA 2YP6A 2PVOC 2G0FA 5GZZB 4HJ2A 1ZL9A 4GWRA 3LSZA 3ZMLA 4LA1A 1QFNA 3TDGA 5HR1A 4BL7B 2BJXA 2VCVA 2WW2A 1PMTA 4ZB9A 5ECQB 1U6TA 3F6FA 1SK2A 4W66A 4PX1A 1WJKA 3TRPA 5G1LA 5GAND 5C04A 1XG8A 2FWHA 1I9DA 2N5AA 2PERA 4HU7A 2HYXA 3F0IA 5ECMB 3UBKA 4EC0A 1PL1A 5EPFA 10GSA 4EIQA 3J7Yb 2AAWA 5HFGA 4GXZA 1B8XA 3ZFLA 2GSRA 4KDYA 1C72A 4HZ4A 4HEA2 4USSA 3FZ5A 2H8LA 3UIWA 1XVQA 1SL2B 3UVHA 3A2XA 1USBA 3TOTA 2QC7A 2WDUA 1GH2A 2ALBA 2UV8G 4Z7XA 1F3BA 1S3AA 4MMMA 3G7JA 2FCHA 3IBHA 4YAVA 3FKFA 1MD3A 2IPAA 3RFRC 3GL3A 1O8WA 2CVDA 5CP1A 5ENUA 2EIQA 2V32A 3KCMA 5IOXA 4DSQA 5H5QA 1PRXA 4LLRA 1WMJA 1YKAA 3UVTA 4JR4A 2WVZA 5EY6A 2I4AA 3DGQA 2F3MA 2YV7A 2I3YA 1K0AA 4IN0A 3M8NA 4DSSB 2VO4A 1JLVA 5F07A 2AJQB 3HVVA 2JSYA 4O5UA 2HZEA 5J9CA 2L6CA 2LJRA 4PI2C 5HFIA 1V98A 4O5QA 4AKXB 3TJGA 3WT1A 2FGXA 3ZIVA 3HY2A 5JCGA 4I8BA 1M7TA 1GSUA 3GX0A 3KJYA 3QPMA 1T00A 4OD7A 1J0FA 1ZZYA 2LJKA 5D9WA 5JWQB 2WB9A 3SBCA 4KB3A 2OBIA 4YKGA 2HNLA 1FAAA 3CMIA 1XBSA 1M3JA 1ZMAA 3TJKA 4V2MA 1GUMA 1XW6A 2MZCA 4XHMA 4AKIA 16GSA 4PNFA 3C71A 2TRCP 3EYTA 3RPPA 4K7NA 4PQIA 4Z2UA 3IHGA 13GSA 5B8BA 3P7XA 4JBBA 2IIYA 4MH2A 4TR1A 1UVZA 1K3YA 3PPUA 5D9VA 2GSTA 4IKHA 4K9ZA 4EKZA 1TTZA 4QL7A 1YY7A 2AV4A 5J4VA 1RQMA 1XZOA 2YWIA 3ZRDA 5L71A 1FVJA 1EP7A 2OKAA 3FHKA 5E4WA 1GSDA 3ERGA 4GCIA 1GSFA 1CQHA 1TDIA 2DIZA 3ED3A 5HR3A 1GUHA 4YQUA 3RHBA 3FR9A 3D4TA 2X8CA 4IP1A 2F51A 5A1NB 4X1UA 2WS2A 3FR6A 1EGRA 2WVXA 4TRXA 5CAXA
chains in the Genus database with same CATH topology
4OCFA 3FRCA 3HCZA 3HA9A 4JE1A 2XPEA 1K0MA 1F9MA 3VWXA 1J08A 2EFCA 2PMTA 4TOPA 3GYKA 1B9YC 4IS0A 5IMVA 1V40A 2MBTA 1QMVA 2IMIA 4IJIA 2HE3A 1TKDB 3LJRA 3LW9A 1V9WA 1A0FA 2YZHA 4MH3A 1EEJA 3VWWA 4EDYA 2XBQA 5KN2A 2ES7A 2LKUA 22GSA 4O32A 4LMVA 2FLSA 2QSIA 2DC5A 3ZVJA 2PGTA 3WYWA 3UEMA 2CVKA 3US3A 2K6VA 1FO5A 3DEXA 5D8IA 5A34A 4ZB7A 4WBJA 5ECIB 4MCUA 1MTCA 4HUAA 5LD0A 3IA1A 3TKSA 1PX6A 3L9VA 4ICYA 4JZQA 3L4NA 4KNDA 3RPNA 1GSEA 4EF0A 1PL2A 3ZMKA 1XW5A 3ZLPA 4ZXGA 1S3CA 2HSHA 3KEBA 5F06A 5D93A 4ACSA 2XBIA 1EV4A 3KH9A 1WPIA 3A5WA 1V2AA 2WZ9A 3GH9A 5BRTA 3VI5A 2A2SA 3F4TA 3GFKA 4OO4A 3Q18A 1QGVA 1HYUA 4N3ZA 4LL1B 2DJ1A 2FA8A 3KXOA 1NSWA 2OADA 4K2DA 1TK5B 2KHPA 1TW9A 1SKSB 2VM2A 1XIYA 1A8YA 4V1Ag 4TXVA 5ECLB 2V2GA 1HD2A 3VURA 1JZDA 1ON4A 5DAKB 2V41A 5JCUA 1O8XA 4EDZA 1AC1A 2EFHA 4ECBA 2VCXA 2C0FA 4ZL7A 1WIKA 4IHUA 3WT2A 5BMUB 1AQVA 2FNOA 1A0RP 2CX3A 4OFMA 2JZSA 5AIVA 1XFLA 1PX7A 4EUYA 1Z9HA 1ILOA 3L9UA 4Z2RA 4XRDA 1ERWA 1UN2A 2LEGA 2I9HA 3GX8A 1PD21 2AB6A 3ERFA 9GSSA 3IPZA 4XS6A 4WEYA 2LJAA 4PGTA 4KA0A 3EMXA 1G7OA 3GTUA 6GSSA 4KSOA 4BVYA 4PURA 2JU5A 2FA4A 1VF1A 1THXA 2XPDA 2X4AA 1XWGA 2K9FA 5F0GA 4TXOA 5ABRA 2H19A 5LNKe 1OKTA 4KUNA 5IMZA 3KIJA 4X4JA 2IMDA 2L6DA 3QFBC 2QA1A 2HSYA 1TK0B 2C0DA 2FY6A 2QGVA 3HXSA 2FWEA 3FY7A 4KCAA 1TU7A 3M3MA 3EWLA 3IAS2 4NV2A 5ID2A 4MF7A 1OC8A 1TI3A 3APQA 1KBNA 1YJ6A 5A4UA 2LQQA 4EIPA 3W8JA 2VKZG 6GSVA 3WGDA 3M9JA 2C4JA 2FWFA 2YJ7A 2V6KA 2LS5A 4MABA 1ACVA 2X8GA 4K2XA 1OVNA 2I81A 3RAZA 3KTLA 1PN0A 1UC7A 5KOWA 3GL5A 1AQXA 3FZ9A 4JR6A 5D9TA 3WGXA 4V1Ap 2CVBA 1B9XC 3TKSC 4I6XA 3HZ8A 5ELAA 5DQYA 3IC8A 5J4YA 1JZOA 3Q6OA 2E0QA 4NV5A 2DJ3A 3HHVA 4ECCA 1GWCA 3MNGA 5D73A 1SU9A 4RQRA 4CDOA 5AN1A 2JZTA 2VLVA 4MJCA 2HSNA 3A2VA 2M80A 1SENA 1TRSA 4KGIA 3TGZA 2VM1A 1X9MB 3P8WA 4PXOA 1R7HA 2WCIA 1U3AA 2JACA 4D73A 2QA2A 2G2QA 2NBSA 2OA7A 3FW2A 1GLPA 3TUEA 1TXUA 4N10A 5COHA 2FWGA 1PKZA 3APSA 1Y1UA 5J5NA 1K0BA 1KNGA 3D5JA 3DVWA 3H8QA 1PSQA 4ZL9A 3EC3A 1VRSD 2B3SA 3ZZXA 1FVKA 1A8LA 2D2ZA 1XPVA 5KOXA 1ERVA 4MA9A 5HFKA 3DMLA 2RUEA 1GNEA 1ZYQB 2C0EA 1XWBA 2MYGA 4MF6A 1CQGA 1F2EA 5A5HB 1R26A 5ECRB 4HQSA 4X43A 2YV9A 3GH6A 1B4QA 4AJ7A 1T4ZA 7GSSA 2DBCA 3F8UA 2H6XA 4IP6A 1Z7RA 3Q74A 4OO5A 3O6TA 3W6GA 1YQ1A 4I97A 1GTBA 3CRTA 2L5LA 2A2PA 3CTGA 3UBLA 3EURA 4HU9A 4ZB6A 2TRXA 4I2UA 5DVBA 2RM5A 1LJRA 3P90A 4DSSA 3C8EA 3LYKA 1N2AA 3HZ4A 1T3BA 1WRYA 4N11A 1F37A 4BVXB 1QK8A 3FK8A 2ZUPA 4ISDA 2L5OA 2ZCTA 3CSIA 2IJYA 2Z9SA 2VL2A 3CTFA 4F0BA 4XIHA 4TR4A 1U3IA 4K0NA 1ML6A 2H30A 2H72A 3HMJG 3I6AA 3C1SA 3NIVA 2X8HA 5D9XA 3UMAA 1SYRA 3OR5A 4K5RA 4WXTA 4F9ZA 5DJMA 3CYNA 2OE1A 2IMEA 3VWUA 5J40A 2IFQA 1H4OA 2VUPA 5G5FA 5CRWA 1N25A 2J9HA 3CBUA 1Q4JA 1SJ6A 3W8SA 4TR3A 4MZWA 2OT3A 1ST9A 4NMUA 3TB2A 3PR8A 2CV4A 3CSJA 1M2AA 3ZYWA 4GF0A 4J57E 3TU3B 2LUSA 4I5QA 3M1GA 3ERWA 4K1FA 1EOGA 5ECKB 4ZB8A 5J47A 1WE0A 2H70A 4YQVA 5J4UA 3QFAC 4L5LA 1GP1A 2YWNA 4ECIA 11GSA 1EEMA 1OYJA 5CREA 2DMLA 5CO3A 2VOCA 3ZFBA 4A5PA 4K6XA 4NWYA 1G7EA 4N30A 1R4WA 3KM6A 4ML6A 5GSTA 5ECSA 4PUFC 1E6BA 3H1NA 2YWOA 4RQXA 2GT5A 1Z7PA 2F8AA 4HJMA 1URMA 4H86A 1Q98A 2P31A 3IXRA 5DALB 1JHBA 1V58A 2R0CA 4ZL8A 14GSA 1J9BA 2YCDA 2VLUA 2HZEB 1BG5A 2HRKB 1EGOA 2GLRA 1XOAA 5A5KA 1S3DA 5HQPA 4XS4A 4N0VA 5ECPB 1QXHA 1M2DA 3NOFA 1LBKA 4MP4A 1U88A 2NPBA 1T4YA 5CRHA 17GSA 4KDXA 5J3RA 3LWAA 1THOA 1WWJA 2EIRA 2LNSA 2LRTA 3LGCA 2E7PA 3UARA 4L0WA 1SVLA 3TJJA 4G19A 3PGTA 1BJXA 1IYIA 5ECOB 2KLXA 4E68A 1FB6A 1EP8A 3ME7A 2C8UA 4HDEA 2HRNA 1K3LA 5A4WA 4TVEA 3GKNA 1K0NA 1AIUA 2ZNMA 3GNJA 4KE3A 3SWLA 1JZRA 4ID0A 1F3AA 2RUFA 4KW6A 4WR5A 3FR3A 4POMA 1N8JA 4HI7A 1A2JA 3G7YA 3H93A 2O5VA 3GSTA 3L78A 4Z2TA 5JWRB 2VL2C 4NAXA 2HSMA 1JZWA 4GQFA 4KH7A 2NVLA 3FEUA 2LV3A 3TKQA 1X9WB 4GDFA 3EU4A 1FG4A 2JL4A 2HI7A 2R37A 4AJ6A 2H71A 5G5EA 1KEBA 4XCSA 1SVOA 3C73A 12GSA 3EPTA 3GN3A 2JZRA 3V1WA 1XVWA 3KH7A 1G6YA 4IGJA 3R2QA 3R3EA 2N5FA 1YVLA 2GS3A 2YANA 3UOMA 2A4VA 3BCIA 4GQCA 1EWXA 3P2AA 4MLYA 5DAKA 3F3QA 1UA5A 2VLTA 4NHZA 4JU5A 4MZBA 1G6WA 1BAYA 4ECJA 3GHAA 4L8EA 2P5QA 2X99A 2LSTA 5IQYA 3TKPA 2CX4A 3LYPA 2F8FA 2CZ2A 4G0KA 2DKHA 2H1BA 2EC4A 3GKKA 4O5RA 3QMXA 4RI7A 2GVPA 3D21A 4RI6A 3HJOA 4HQZA 4O7HA 1SKWB 1K0DA 2KP2A 2HT9A 1OE8A 4MK3A 4XTSA 2NDOA 1BQ7A 5IMCA 1T7PB 3NZNA 5AIXA 2HXKA 5FWGA 4AJ8A 4DSRA 3O3TA 4PTSA 2MMNA 2M46A 3HJMA 2VD1A 4EE0A 2C0GA 1F6MC 5EVOA 1YZXA 4EO3A 1A24A 1TP9A 1FHEA 2P5RA 3I9V2 4Q5RA 4BA7A 2B5XA 4CHSA 4G0IA 3KGKA 2CZ3A 2H0GA 3E3EA 3CXGA 2H66A 2PN8A 1GUKA 4EVMA 5IMDA 4F2IA 2H0HA 4GLTA 5KN1A 1M9BA 5GSSA 1EV9A 4MPGA 4HS1A 2KUCA 1R5AA 2YWMA 3UJ1A 2A4HA 4DVCA 1H75A 3GIXA 3A2WA 3EINA 4TW5A 5IIZA 1V57A 2B7KA 5IO0A 2C1YA 4MZCA 1O85A 4KCEA 1SD9A 3BCKA 3K8NA 4NHWA 4MJBA 3MYDA 2GZYA 3L9SA 3ZTLA 4E8EA 2H74A 3GURA 2AYTA 4GSNA 2JADA 3BJ5A 3KMOA 3N9JA 4K7OA 1T1VA 4AKHA 1EOHA 3VI7A 2O8VB 4ILFA 4KF9A 1YF1A 4K7IA 4EL1A 1RW1A 4ZBDA 1XOBA 3GTUB 1MDJA 4WETA 3VK9A 4BVYB 2B6MA 4QMKA 3EMPA 1OC9A 2L57A 4DEJA 2L4QA 2L59A 1OAZA 1X5CA 3RHCA 2WFCA 5IPGA 4MF5A 5GAPD 1O6JA 4BL7A 4QQ7A 3ZREA 4J2FA 3M0FA 3FYGA 5INYA 1XWAA 3KP9A 1O73A 1NHYA 1SK1A 4AI6A 4F82A 3HVSA 1ZYPA 2ON7A 3L0HA 1AUCA 2UZ8A 1DE2A 2RLIA 3TRXA 3APOA 3BOAA 2DSAA 2PPTA 5FHIA 3VLNA 1HQOA 5IPHA 3F3RA 3TCOA 1ERTA 3FZ4A 2E2GA 4AF2A 3PINA 1BYEA 3DKSA 1SL0B 20GSA 2YJHA 3EVIA 3EE2A 3DD3A 4PUAA 5ECNB 1GRXA 4RUVA 1W89A 4POKA 4Q5QA 5ECHB 3IAM2 8GSSA 4E8HA 2DIYA 4BVXA 1PGTA 1XW9A 1QQ2A 1XCCA 2LRNA 1K0CA 1SL1B 5FT3A 5G1KA 3AY8A 4G10A 2C3TA 1GNWA 1GULA 1IYHA 1JLWA 3CSHA 4Q5NA 1ZCPA 1AXDA 2BTOT 2FD3A 3F63A 4K0GA 5HR0A 5H5RA 2HRFA 2H0IA 2VIMA 1SVMA 3LEFA 1X0RA 3LXTA 3DXBA 3G7IA 2DJ0A 3KMNA 1A23A 1M2BA 2HSNB 4LMWA 2NTOA 4O92A 5F05A 4IELA 4ZIJA 4KSMA 2VL3A 4D73B 4IVFA 3IK9A 1GTAA 3F9UA 5KN3A 1PKWA 3GV1A 3I69A 2EFEA 2LTKA 1ZYNA 2R0GA 4ZBAA 2GQMA 3A5IA 6GSTA 2CQ9A 2R3XA 2VCZA 1ZGNA 1OKDA 2CT6A 4JEDA 5H5SA 2X49A 4WBRD 1SD8A 2V6OA 2IMKA 3D22A 2H1GA 4TKYA 4ZBBA 3KD0A 1M9AA 3KTBA 2KP1A 1Y6EA 2OE3A 1MEKA 5DCHA 1HNCA 4V2NA 3UAPA 5IO2A 1DBYA 2K8SA 2IWTA 4CY6A 4J56E 4I2TA 2GSSA 3I43A 1MDIA 2BMXA 3LG6A 4K8MA 4IQ1A 4WF5A 4FYUA 2CAIA 3BD2A 3RDWA 2J23A 1TJDA 1X5DA 3E0UA 2OBKA 2H6ZA 4CW9A 5G2ZA 5DALA 5HR2A 4YH2A 2XHFA 1YEPA 1PQNA 1O7UA 2CAQA 3GMFA 2HRKA 3MIXA 3QD9A 4TR0A 3G9BA 1K0OA 4MJAA 3HVXA 4X0XA 2WULA 3QDNA 3QOUA 4WKWA 3GA4A 3PH9A 1Y25A 4F0CA 1SK0A 1X9SB 1A2MA 4KAEA 2R2JA 3QAVA 1K3OA 3IRAA 3BBYA 3IK7A 3DRNA 4GSTA 1AW9A 1FOVA 5A1NA 4G9HA 6GSYA 2MMOA 2IFQB 5B6NA 5KEJA 1ZOFA 2H73A 4GRFA 2LRCA 1HNBA 3QAGA 2H1AA 2VCQA 2DJ2A 3FZAA 3D6IA 3DIEA 1GTIA 4POLA 2E2MA 4GSSA 5C00A 3EU3A 4P3YB 3VWVA 1MDKA 3ME8A 5IMAA 4XS1A 3MDKA 1ERUA 1VF3A 3HD5A 2OACA 2AUVA 1TXXA 1AAZA 1PA3A 2REMA 1TK8B 2K18A 3IHQA 5JWOB 2GSQA 3CRUA 6GSWA 2YZUA 1TRVA 4MPFA 3GKXA 5B8AA 2L4CA 4MNNA 4OCEA 1HNAA 2O89A 2F9SA 2O7KA 4AKGA 2DKIA 3VFIA 19GSA 3GRXA 2FUG2 4HOJA 6GSUA 4TN8A 2R4VA 2HZFA 3TJBA 4TR1B 3HDCA 4PQHA 1TU8A 2XC2A 2H1DA 3LXZA 1I5GA 2RIIA 5B6MA 3TOUA 5CNWA 4POBA 1NW2A 3ISOA 3UL3A 1BF5A 2GQKA 2CA8A 3D4MA 4KX4A 4PNGA 2O85A 2R6KA 1VF2A 5IOWA 1NM3A 1XXUA 4XS4B 3U5RE 4GTUA 3GSSA 3U6VA 2PUKC 4N0ZA 2EFDA 1BEDA 1TRWA 1RK4A 1TRUA 2GGTA 5B7CA 1VF4A 2GDRA 4FH8A 4ML1A 1TI1A 4OFTA 1NHOA 3IR4A 2MMZA 5JCWA 4G0LA 3MWHA 1B48A 1GSSA 2YN1A 2YNXA 2DJKA 1EZKA 3FMWA 1YDKA 4FYBA 2OJLA 2K8VA 4IQAA 1ABAA 1MD4A 1G0TA 3KZQA 3WGEA 3TJFA 2P0GA 1Z6MA 2HFDA 5F8BA 1GSQA 3TKRA 1YF0A 1XWCA 5BMUA 2DJJA 1FW1A 3H79A 3ZITA 2H75A 1Z6NA 2M72A 2VCTA 3F4SA 1M0UA 2H76A 2HSMB 4IJ3A 3E9JB 2HLSA 4BWQA 4BPYA 3C1RA 5D96A 2GZZA 3VPTA 1SKRB 4ZILA 3VPQA 3GUSA 1WP0A 3RBTA 1B4PA 2PBJA 5AGYA 1ZYEA 5E59A 2TIRA 1DUGA 5A34B 5CRGA 3S9FA 2HQTA 1OE7A 2DLXA 1O81A 1W4VA 3MSZA 3IE3A 2VCWA 3JCML 2WRTA 3WD6A 1SJIA 2EIOA 3HYPA 5DQSA 2VD0A 1YEXA 3Q19A 5CYYA 3O76A 4NPBA 4WF4A 1JFUA 4K5SA 5KN0A 3LFLA 5DCGA 3IC4A 5A4VA 2B5EA 2KOKA 2PU9C 4YAPA 3CWGA 5AISA 5DBQA 1FB0A 2GT6A 3IOSA 2DMMA 1FOHA 2X64A 2LNTA 1DE1A 3QCPA 1R5PA 2MMAA 1Z3EA 1SJZA 2O87A 3C7MA 3F4RA 4QL9A 2H01A 1YKCA 5IMFA 2QKEA 1WOUA 1X5EA 3M9KA 2N5BA 1A2LA 4PQ1A 1DSBA 3A3TA 2WJUA 2OE0A 1OC3A 4MDCA 2R5GA 2GQLA 1BX9A 1Z5YE 1PN9A 1M99A 4KDUA 2IMFA 1TOFA 3DVXA 2C80A 1VGLA 1GL8A 2IL3A 1GTUA 1GSYA 4AGSA 2MBSA 2A2RA 2V1MA 4LL4B 4XRAA 1KTEA 4CY8A 4V2LA 4FQUA 2GTUA 4MJEA 3TRQA 3ZVJD 2IN3A 2YPMA 6GSXA 3H4KA 4OWYA 5DJLA 5EL8A 2VAFA 4FO5A 3QR6A 2H6YA 4HZ2A 4YQMA 2RM6A 2FHEA 4NXIA 2R0PA 3GKMA 4G2EA 2YOIA 3ZL5A 1LU4A 3IV4A 3QAWA 4WR4A 2GZPA 18GSA 3F6DA 3ZIJA 2B5YA 1SYXA 4TXOB 2C3QA 3TKSE 5LCZA 3HJPA 4JRRA 5G30A 2PVQA 3KP8A 5IM9A 1BG1A 4G01A 4F03A 2C3NA 4IW9A 3HKRA 4BWSA 4IBPA 3IDVA 2B7JA 5A5HA 5J9BA 2B1KA 2LQOA 1E2YA 2ON5A 2AHEA 1T8EB 5ID2B 4EXJA 1QUWA 1XWKA 3N5OA 5G31A 5J41A 3MAKA 5CRDA 4L0UA 2H1LA 2WGRA 1AQWA 2B1LA 4ULXA 5DDLA 5ELGA 2HRAA 1GLQA 3DYRA 3LQ7A 4FYCA 1U87A 3LORA 2PWJA 2I1UA 3D0ZA 4OFNA 3J7Yk 1OC9B 2VL9A 3DWVA 4Q5FA 4FIWA 4OMVA 2JSZA 4YKFA 4L5OA 2YP6A 2PVOC 2G0FA 5GZZB 4HJ2A 1ZL9A 4GWRA 3LSZA 3ZMLA 4LA1A 1QFNA 3TDGA 5HR1A 4BL7B 2BJXA 2VCVA 1PMTA 4ZB9A 5ECQB 1U6TA 3F6FA 1SK2A 4W66A 4PX1A 1WJKA 3TRPA 5G1LA 5GAND 5C04A 2FWHA 1I9DA 2N5AA 2PERA 4HU7A 2HYXA 3F0IA 5ECMB 3UBKA 4EC0A 1PL1A 5EPFA 10GSA 4EIQA 3J7Yb 2AAWA 5HFGA 4GXZA 1B8XA 3ZFLA 2GSRA 4KDYA 1C72A 4HZ4A 4HEA2 4USSA 3FZ5A 2H8LA 3UIWA 1XVQA 1SL2B 3UVHA 3A2XA 1USBA 3TOTA 2QC7A 2WDUA 1GH2A 2ALBA 2UV8G 4Z7XA 1F3BA 1S3AA 4MMMA 3G7JA 2FCHA 3IBHA 4YAVA 3FKFA 1MD3A 2IPAA 3GL3A 1O8WA 2CVDA 5CP1A 5ENUA 2EIQA 2V32A 3KCMA 5IOXA 4DSQA 5H5QA 1PRXA 4LLRA 1WMJA 1YKAA 3UVTA 4JR4A 5EY6A 2I4AA 3DGQA 2F3MA 2YV7A 2I3YA 1K0AA 4IN0A 3M8NA 4DSSB 2VO4A 1JLVA 5F07A 2AJQB 3HVVA 2JSYA 4O5UA 2HZEA 5J9CA 2L6CA 2LJRA 5HFIA 1V98A 4O5QA 4AKXB 3TJGA 3WT1A 2FGXA 3ZIVA 3HY2A 5JCGA 4I8BA 1M7TA 1GSUA 3GX0A 3KJYA 3QPMA 1T00A 4OD7A 1J0FA 1ZZYA 2LJKA 5D9WA 5JWQB 2WB9A 3SBCA 4KB3A 2OBIA 4YKGA 2HNLA 1FAAA 3CMIA 1XBSA 1ZMAA 3TJKA 4V2MA 1GUMA 1XW6A 2MZCA 4XHMA 4AKIA 16GSA 4PNFA 3C71A 2TRCP 3EYTA 3RPPA 4K7NA 4PQIA 4Z2UA 3IHGA 13GSA 5B8BA 3P7XA 4JBBA 2IIYA 4MH2A 4TR1A 1UVZA 1K3YA 3PPUA 5D9VA 2GSTA 4IKHA 4K9ZA 4EKZA 1TTZA 4QL7A 1YY7A 2AV4A 5J4VA 1RQMA 1XZOA 2YWIA 3ZRDA 5L71A 1FVJA 1EP7A 2OKAA 3FHKA 5E4WA 1GSDA 3ERGA 4GCIA 1GSFA 1CQHA 1TDIA 2DIZA 3ED3A 5HR3A 1GUHA 4YQUA 3RHBA 3FR9A 3D4TA 2X8CA 4IP1A 2F51A 5A1NB 4X1UA 2WS2A 3FR6A 1EGRA 4TRXA 5CAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OCF A;  3FRC A;  3HCZ A;  3HA9 A;  4JE1 A;  2XPE A;  1K0M A;  1F9M A;  3VWX A;  1J08 A;  2PMT A;  4TOP A;  3GYK A;  1B9Y C;  4IS0 A;  5IMV A;  1V40 A;  2MBT A;  1QMV A;  2IMI A;  4IJI A;  2HE3 A;  1TKD B;  3LJR A;  1V9W A;  1A0F A;  2YZH A;  4MH3 A;  1EEJ A;  3VWW A;  4EDY A;  2XBQ A;  5KN2 A;  2ES7 A;  2LKU A;  22GS A;  4O32 A;  4LMV A;  2FLS A;  2QSI A;  2DC5 A;  3ZVJ A;  2PGT A;  3WYW A;  3UEM A;  2CVK A;  3US3 A;  2K6V A;  1FO5 A;  3DEX A;  5D8I A;  4WBJ A;  5ECI B;  4MCU A;  1MTC A;  4HUA A;  5LD0 A;  3IA1 A;  3TKS A;  1PX6 A;  3L9V A;  4JZQ A;  3L4N A;  4KND A;  3RPN A;  1GSE A;  4EF0 A;  1PL2 A;  3ZMK A;  1XW5 A;  3ZLP A;  4ZXG A;  1S3C A;  2HSH A;  3KEB A;  5F06 A;  5D93 A;  4ACS A;  2XBI A;  1EV4 A;  3KH9 A;  1WPI A;  3A5W A;  1V2A A;  2WZ9 A;  3GH9 A;  3VI5 A;  2A2S A;  3F4T A;  3GFK A;  4OO4 A;  3Q18 A;  1QGV A;  1HYU A;  4LL1 B;  2DJ1 A;  2FA8 A;  3KXO A;  1NSW A;  2OAD A;  4K2D A;  1TK5 B;  2KHP A;  1TW9 A;  1SKS B;  2VM2 A;  1XIY A;  1A8Y A;  4V1A g;  4TXV A;  5ECL B;  2V2G A;  1HD2 A;  3VUR A;  1JZD A;  1ON4 A;  5DAK B;  2V41 A;  5JCU A;  1O8X A;  4EDZ A;  1AC1 A;  4ECB A;  2VCX A;  2C0F A;  4ZL7 A;  1WIK A;  4IHU A;  3WT2 A;  1AQV A;  2FNO A;  1A0R P;  2CX3 A;  4OFM A;  2JZS A;  5AIV A;  1XFL A;  1PX7 A;  4EUY A;  1Z9H A;  1ILO A;  3L9U A;  4XRD A;  1ERW A;  1UN2 A;  2LEG A;  2I9H A;  3GX8 A;  1PD2 1;  2AB6 A;  3ERF A;  9GSS A;  3IPZ A;  4XS6 A;  4WEY A;  2LJA A;  4PGT A;  4KA0 A;  3EMX A;  1G7O A;  3GTU A;  6GSS A;  4KSO A;  4BVY A;  4PUR A;  2JU5 A;  2FA4 A;  1VF1 A;  1THX A;  2XPD A;  1XWG A;  2K9F A;  5F0G A;  4TXO A;  5ABR A;  2H19 A;  5LNK e;  1OKT A;  4KUN A;  5IMZ A;  3KIJ A;  2IMD A;  2L6D A;  3QFB C;  2HSY A;  1TK0 B;  2C0D A;  2FY6 A;  2QGV A;  3HXS A;  2FWE A;  3FY7 A;  4KCA A;  1TU7 A;  3M3M A;  3EWL A;  3IAS 2;  4NV2 A;  5ID2 A;  4MF7 A;  1OC8 A;  1TI3 A;  3APQ A;  1KBN A;  1YJ6 A;  5A4U A;  2LQQ A;  3W8J A;  6GSV A;  3WGD A;  3M9J A;  2C4J A;  2FWF A;  2YJ7 A;  2V6K A;  2LS5 A;  4MAB A;  1ACV A;  2X8G A;  1OVN A;  2I81 A;  3RAZ A;  3KTL A;  1UC7 A;  3GL5 A;  1AQX A;  3FZ9 A;  4JR6 A;  5D9T A;  3WGX A;  4V1A p;  2CVB A;  1B9X C;  3TKS C;  4I6X A;  3HZ8 A;  5ELA A;  5DQY A;  3IC8 A;  1JZO A;  3Q6O A;  2E0Q A;  4NV5 A;  2DJ3 A;  3HHV A;  4ECC A;  1GWC A;  3MNG A;  5D73 A;  1SU9 A;  4RQR A;  4CDO A;  5AN1 A;  2JZT A;  2VLV A;  4MJC A;  3A2V A;  2M80 A;  1SEN A;  1TRS A;  4KGI A;  3TGZ A;  2VM1 A;  1X9M B;  3P8W A;  4PXO A;  1R7H A;  2WCI A;  1U3A A;  2JAC A;  4D73 A;  2G2Q A;  2NBS A;  2OA7 A;  3FW2 A;  1GLP A;  3TUE A;  4N10 A;  5COH A;  2FWG A;  1PKZ A;  3APS A;  5J5N A;  1K0B A;  1KNG A;  3D5J A;  3DVW A;  3H8Q A;  1PSQ A;  4ZL9 A;  3EC3 A;  1VRS D;  2B3S A;  3ZZX A;  1FVK A;  1A8L A;  2D2Z A;  1XPV A;  1ERV A;  4MA9 A;  5HFK A;  3DML A;  2RUE A;  1GNE A;  1ZYQ B;  2C0E A;  1XWB A;  2MYG A;  4MF6 A;  1CQG A;  1F2E A;  1R26 A;  5ECR B;  4HQS A;  4X43 A;  2YV9 A;  3GH6 A;  1B4Q A;  4AJ7 A;  1T4Z A;  7GSS A;  2DBC A;  3F8U A;  2H6X A;  4IP6 A;  1Z7R A;  3Q74 A;  4OO5 A;  3O6T A;  3W6G A;  1YQ1 A;  4I97 A;  1GTB A;  3CRT A;  2L5L A;  3CTG A;  3UBL A;  3EUR A;  4HU9 A;  4ZB6 A;  2TRX A;  4I2U A;  5DVB A;  2RM5 A;  1LJR A;  3P90 A;  4DSS A;  3C8E A;  3LYK A;  1N2A A;  3HZ4 A;  1T3B A;  1WRY A;  4N11 A;  1F37 A;  4BVX B;  1QK8 A;  3FK8 A;  2ZUP A;  4ISD A;  2L5O A;  2ZCT A;  3CSI A;  2IJY A;  2Z9S A;  2VL2 A;  3CTF A;  4F0B A;  4XIH A;  4TR4 A;  1U3I A;  4K0N A;  1ML6 A;  2H30 A;  2H72 A;  3I6A A;  3C1S A;  3NIV A;  2X8H A;  5D9X A;  3UMA A;  1SYR A;  3OR5 A;  4WXT A;  4F9Z A;  5DJM A;  3CYN A;  2OE1 A;  2IME A;  3VWU A;  2IFQ A;  1H4O A;  2VUP A;  5G5F A;  5CRW A;  2J9H A;  3CBU A;  1Q4J A;  1SJ6 A;  3W8S A;  4TR3 A;  4MZW A;  1ST9 A;  4NMU A;  3TB2 A;  3PR8 A;  2CV4 A;  3CSJ A;  1M2A A;  3ZYW A;  4GF0 A;  4J57 E;  2LUS A;  4I5Q A;  3M1G A;  3ERW A;  4K1F A;  1EOG A;  5ECK B;  4ZB8 A;  1WE0 A;  2H70 A;  4YQV A;  5J4U A;  3QFA C;  4L5L A;  1GP1 A;  2YWN A;  4ECI A;  11GS A;  1EEM A;  1OYJ A;  5CRE A;  2DML A;  5CO3 A;  2VOC A;  3ZFB A;  4K6X A;  4NWY A;  1G7E A;  4N30 A;  1R4W A;  3KM6 A;  4ML6 A;  5GST A;  5ECS A;  4PUF C;  1E6B A;  3H1N A;  2YWO A;  4RQX A;  2GT5 A;  1Z7P A;  2F8A A;  4HJM A;  1URM A;  4H86 A;  1Q98 A;  2P31 A;  3IXR A;  5DAL B;  1JHB A;  1V58 A;  4ZL8 A;  14GS A;  1J9B A;  2YCD A;  2VLU A;  2HZE B;  1BG5 A;  2HRK B;  1EGO A;  2GLR A;  1XOA A;  5A5K A;  1S3D A;  5HQP A;  4XS4 A;  4N0V A;  5ECP B;  1QXH A;  1M2D A;  3NOF A;  1LBK A;  4MP4 A;  1U88 A;  2NPB A;  1T4Y A;  5CRH A;  17GS A;  4KDX A;  5J3R A;  3LWA A;  1THO A;  1WWJ A;  2EIR A;  2LNS A;  2LRT A;  3LGC A;  2E7P A;  3UAR A;  4L0W A;  3TJJ A;  4G19 A;  3PGT A;  1BJX A;  1IYI A;  5ECO B;  2KLX A;  1FB6 A;  1EP8 A;  3ME7 A;  2C8U A;  4HDE A;  2HRN A;  1K3L A;  5A4W A;  4TVE A;  3GKN A;  1K0N A;  1AIU A;  2ZNM A;  3GNJ A;  4KE3 A;  3SWL A;  1JZR A;  4ID0 A;  1F3A A;  2RUF A;  4KW6 A;  4WR5 A;  3FR3 A;  4POM A;  1N8J A;  4HI7 A;  1A2J A;  3G7Y A;  3H93 A;  3GST A;  3L78 A;  5JWR B;  2VL2 C;  4NAX A;  2HSM A;  1JZW A;  4GQF A;  4KH7 A;  2NVL A;  3FEU A;  2LV3 A;  3TKQ A;  1X9W B;  3EU4 A;  1FG4 A;  2JL4 A;  2HI7 A;  2R37 A;  4AJ6 A;  2H71 A;  5G5E A;  1KEB A;  4XCS A;  3C73 A;  12GS A;  3GN3 A;  2JZR A;  3V1W A;  1XVW A;  3KH7 A;  1G6Y A;  4IGJ A;  3R2Q A;  3R3E A;  2N5F A;  2YAN A;  2GS3 A;  3UOM A;  2A4V A;  3BCI A;  4GQC A;  1EWX A;  3P2A A;  4MLY A;  5DAK A;  3F3Q A;  1UA5 A;  2VLT A;  4NHZ A;  4JU5 A;  4MZB A;  1G6W A;  1BAY A;  4ECJ A;  3GHA A;  4L8E A;  2P5Q A;  2X99 A;  2LST A;  5IQY A;  3TKP A;  2CX4 A;  3LYP A;  2F8F A;  2CZ2 A;  4G0K A;  2H1B A;  2EC4 A;  3GKK A;  4O5R A;  3QMX A;  4RI7 A;  2GVP A;  3D21 A;  4RI6 A;  3HJO A;  4HQZ A;  4O7H A;  1SKW B;  1K0D A;  2KP2 A;  2HT9 A;  1OE8 A;  4MK3 A;  4XTS A;  2NDO A;  1BQ7 A;  5IMC A;  1T7P B;  3NZN A;  5AIX A;  2HXK A;  5FWG A;  4AJ8 A;  4DSR A;  3O3T A;  4PTS A;  2MMN A;  2M46 A;  3HJM A;  2VD1 A;  4EE0 A;  2C0G A;  1F6M C;  5EVO A;  1YZX A;  4EO3 A;  1A24 A;  1TP9 A;  1FHE A;  2P5R A;  3I9V 2;  4Q5R A;  4BA7 A;  2B5X A;  4CHS A;  4G0I A;  3KGK A;  2CZ3 A;  2H0G A;  3E3E A;  3CXG A;  2H66 A;  2PN8 A;  1GUK A;  4EVM A;  5IMD A;  4F2I A;  2H0H A;  4GLT A;  5KN1 A;  1M9B A;  5GSS A;  1EV9 A;  4MPG A;  4HS1 A;  2KUC A;  1R5A A;  2YWM A;  3UJ1 A;  4DVC A;  1H75 A;  3GIX A;  3A2W A;  3EIN A;  4TW5 A;  5IIZ A;  1V57 A;  2B7K A;  5IO0 A;  2C1Y A;  4MZC A;  1O85 A;  4KCE A;  1SD9 A;  3BCK A;  3K8N A;  4NHW A;  4MJB A;  2GZY A;  3L9S A;  3ZTL A;  4E8E A;  2H74 A;  3GUR A;  2AYT A;  4GSN A;  2JAD A;  3BJ5 A;  3KMO A;  3N9J A;  4K7O A;  1T1V A;  1EOH A;  3VI7 A;  2O8V B;  4ILF A;  4KF9 A;  1YF1 A;  4K7I A;  4EL1 A;  1RW1 A;  4ZBD A;  1XOB A;  3GTU B;  1MDJ A;  4WET A;  3VK9 A;  4BVY B;  2B6M A;  3EMP A;  1OC9 A;  2L57 A;  4DEJ A;  2L4Q A;  2L59 A;  1OAZ A;  1X5C A;  3RHC A;  2WFC A;  5IPG A;  4MF5 A;  5GAP D;  1O6J A;  4BL7 A;  4QQ7 A;  3ZRE A;  4J2F A;  3M0F A;  3FYG A;  5INY A;  1XWA A;  3KP9 A;  1O73 A;  1NHY A;  1SK1 A;  4F82 A;  3HVS A;  2ON7 A;  3L0H A;  1AUC A;  2UZ8 A;  1DE2 A;  2RLI A;  3TRX A;  3APO A;  3BOA A;  2DSA A;  2PPT A;  5FHI A;  3VLN A;  1HQO A;  5IPH A;  3F3R A;  3TCO A;  1ERT A;  3FZ4 A;  2E2G A;  4AF2 A;  3PIN A;  1BYE A;  3DKS A;  1SL0 B;  20GS A;  2YJH A;  3EVI A;  3EE2 A;  3DD3 A;  4PUA A;  5ECN B;  1GRX A;  4RUV A;  1W89 A;  4POK A;  4Q5Q A;  5ECH B;  3IAM 2;  8GSS A;  4E8H A;  2DIY A;  4BVX A;  1PGT A;  1XW9 A;  1QQ2 A;  1XCC A;  2LRN A;  1K0C A;  1SL1 B;  5FT3 A;  5G1K A;  3AY8 A;  4G10 A;  2C3T A;  1GNW A;  1GUL A;  1IYH A;  1JLW A;  3CSH A;  4Q5N A;  1ZCP A;  1AXD A;  2BTO T;  2FD3 A;  3F63 A;  4K0G A;  5HR0 A;  5H5R A;  2HRF A;  2H0I A;  2VIM A;  3LEF A;  1X0R A;  3LXT A;  3DXB A;  3G7I A;  2DJ0 A;  3KMN A;  1A23 A;  1M2B A;  2HSN B;  4LMW A;  2NTO A;  4O92 A;  5F05 A;  4IEL A;  4ZIJ A;  4KSM A;  2VL3 A;  4D73 B;  4IVF A;  3IK9 A;  1GTA A;  3F9U A;  5KN3 A;  1PKW A;  3GV1 A;  3I69 A;  2LTK A;  4ZBA A;  2GQM A;  6GST A;  2CQ9 A;  2R3X A;  2VCZ A;  1ZGN A;  1OKD A;  2CT6 A;  4JED A;  5H5S A;  4WBR D;  1SD8 A;  2V6O A;  2IMK A;  3D22 A;  2H1G A;  4TKY A;  4ZBB A;  3KD0 A;  1M9A A;  3KTB A;  2KP1 A;  1Y6E A;  2OE3 A;  1MEK A;  5DCH A;  1HNC A;  4V2N A;  3UAP A;  5IO2 A;  1DBY A;  2K8S A;  2IWT A;  4J56 E;  4I2T A;  2GSS A;  3I43 A;  1MDI A;  2BMX A;  3LG6 A;  4K8M A;  4IQ1 A;  4WF5 A;  4FYU A;  2CAI A;  3BD2 A;  3RDW A;  2J23 A;  1TJD A;  1X5D A;  3E0U A;  2OBK A;  2H6Z A;  4CW9 A;  5G2Z A;  5DAL A;  5HR2 A;  4YH2 A;  2XHF A;  1YEP A;  1PQN A;  1O7U A;  2CAQ A;  3GMF A;  2HRK A;  3QD9 A;  4TR0 A;  3G9B A;  1K0O A;  4MJA A;  3HVX A;  4X0X A;  2WUL A;  3QDN A;  3QOU A;  4WKW A;  3GA4 A;  3PH9 A;  1Y25 A;  4F0C A;  1SK0 A;  1X9S B;  1A2M A;  4KAE A;  2R2J A;  3QAV A;  1K3O A;  3IRA A;  3BBY A;  3IK7 A;  3DRN A;  4GST A;  1AW9 A;  1FOV A;  4G9H A;  6GSY A;  2MMO A;  2IFQ B;  5B6N A;  5KEJ A;  1ZOF A;  2H73 A;  4GRF A;  2LRC A;  1HNB A;  3QAG A;  2H1A A;  2VCQ A;  2DJ2 A;  3FZA A;  3D6I A;  3DIE A;  1GTI A;  4POL A;  2E2M A;  4GSS A;  5C00 A;  3EU3 A;  4P3Y B;  3VWV A;  1MDK A;  3ME8 A;  5IMA A;  4XS1 A;  3MDK A;  1ERU A;  1VF3 A;  3HD5 A;  2OAC A;  2AUV A;  1TXX A;  1AAZ A;  1PA3 A;  2REM A;  1TK8 B;  2K18 A;  3IHQ A;  5JWO B;  2GSQ A;  3CRU A;  6GSW A;  2YZU A;  1TRV A;  4MPF A;  3GKX A;  5B8A A;  2L4C A;  4OCE A;  1HNA A;  2F9S A;  2O89 A;  2O7K A;  3VFI A;  19GS A;  3GRX A;  2FUG 2;  4HOJ A;  6GSU A;  4TN8 A;  2R4V A;  2HZF A;  3TJB A;  4TR1 B;  3HDC A;  4PQH A;  1TU8 A;  2XC2 A;  2H1D A;  3LXZ A;  1I5G A;  2RII A;  5B6M A;  3TOU A;  5CNW A;  4POB A;  1NW2 A;  3ISO A;  3UL3 A;  2GQK A;  2CA8 A;  3D4M A;  4KX4 A;  4PNG A;  2O85 A;  2R6K A;  1VF2 A;  5IOW A;  1NM3 A;  1XXU A;  4XS4 B;  3U5R E;  4GTU A;  3GSS A;  3U6V A;  2PUK C;  4N0Z A;  1BED A;  1TRW A;  1RK4 A;  1TRU A;  2GGT A;  5B7C A;  1VF4 A;  2GDR A;  4FH8 A;  4ML1 A;  1TI1 A;  4OFT A;  1NHO A;  3IR4 A;  2MMZ A;  5JCW A;  4G0L A;  3MWH A;  1B48 A;  1GSS A;  2YN1 A;  2YNX A;  2DJK A;  1EZK A;  1YDK A;  4FYB A;  2OJL A;  2K8V A;  4IQA A;  1ABA A;  1MD4 A;  1G0T A;  3KZQ A;  3WGE A;  3TJF A;  2P0G A;  1Z6M A;  2HFD A;  5F8B A;  1GSQ A;  3TKR A;  1YF0 A;  1XWC A;  5BMU A;  2DJJ A;  1FW1 A;  3H79 A;  3ZIT A;  2H75 A;  1Z6N A;  2M72 A;  2VCT A;  3F4S A;  1M0U A;  2H76 A;  2HSM B;  4IJ3 A;  3E9J B;  2HLS A;  4BWQ A;  4BPY A;  3C1R A;  5D96 A;  2GZZ A;  3VPT A;  1SKR B;  4ZIL A;  3VPQ A;  3GUS A;  1WP0 A;  3RBT A;  1B4P A;  2PBJ A;  5AGY A;  1ZYE A;  5E59 A;  2TIR A;  1DUG A;  5CRG A;  3S9F A;  2HQT A;  1OE7 A;  2DLX A;  1O81 A;  1W4V A;  3MSZ A;  3IE3 A;  2VCW A;  3JCM L;  2WRT A;  3WD6 A;  1SJI A;  2EIO A;  3HYP A;  5DQS A;  2VD0 A;  1YEX A;  3Q19 A;  5CYY A;  3O76 A;  4NPB A;  4WF4 A;  1JFU A;  5KN0 A;  3LFL A;  5DCG A;  3IC4 A;  5A4V A;  2B5E A;  2KOK A;  2PU9 C;  4YAP A;  5AIS A;  5DBQ A;  1FB0 A;  2GT6 A;  3IOS A;  2DMM A;  2LNT A;  2X64 A;  1DE1 A;  3QCP A;  1R5P A;  2MMA A;  1Z3E A;  1SJZ A;  2O87 A;  3C7M A;  3F4R A;  4QL9 A;  2H01 A;  1YKC A;  5IMF A;  2QKE A;  1WOU A;  1X5E A;  3M9K A;  2N5B A;  1A2L A;  4PQ1 A;  1DSB A;  3A3T A;  2WJU A;  2OE0 A;  1OC3 A;  4MDC A;  2R5G A;  2GQL A;  1BX9 A;  1Z5Y E;  1PN9 A;  1M99 A;  4KDU A;  2IMF A;  1TOF A;  3DVX A;  2C80 A;  1VGL A;  1GL8 A;  2IL3 A;  1GTU A;  1GSY A;  4AGS A;  2MBS A;  2A2R A;  2V1M A;  4LL4 B;  4XRA A;  1KTE A;  4V2L A;  4FQU A;  2GTU A;  4MJE A;  3TRQ A;  3ZVJ D;  2IN3 A;  2YPM A;  6GSX A;  3H4K A;  4OWY A;  5DJL A;  5EL8 A;  2VAF A;  4FO5 A;  3QR6 A;  2H6Y A;  4HZ2 A;  4YQM A;  2RM6 A;  2FHE A;  4NXI A;  3GKM A;  4G2E A;  2YOI A;  3ZL5 A;  1LU4 A;  3IV4 A;  3QAW A;  4WR4 A;  2GZP A;  18GS A;  3F6D A;  3ZIJ A;  2B5Y A;  1SYX A;  4TXO B;  2C3Q A;  3TKS E;  5LCZ A;  3HJP A;  4JRR A;  5G30 A;  2PVQ A;  3KP8 A;  5IM9 A;  4F03 A;  2C3N A;  4IW9 A;  3HKR A;  4BWS A;  4IBP A;  3IDV A;  2B7J A;  5J9B A;  2B1K A;  2LQO A;  1E2Y A;  2ON5 A;  2AHE A;  1T8E B;  5ID2 B;  4EXJ A;  1QUW A;  1XWK A;  3N5O A;  5G31 A;  5J41 A;  3MAK A;  5CRD A;  4L0U A;  2WGR A;  1AQW A;  2B1L A;  4ULX A;  5DDL A;  5ELG A;  2HRA A;  1GLQ A;  3DYR A;  3LQ7 A;  4FYC A;  1U87 A;  3LOR A;  2PWJ A;  2I1U A;  3D0Z A;  4OFN A;  3J7Y k;  1OC9 B;  2VL9 A;  3DWV A;  4Q5F A;  4FIW A;  4OMV A;  2JSZ A;  4L5O A;  2YP6 A;  2PVO C;  2G0F A;  5GZZ B;  4HJ2 A;  1ZL9 A;  4GWR A;  3LSZ A;  3ZML A;  4LA1 A;  1QFN A;  3TDG A;  5HR1 A;  4BL7 B;  2BJX A;  2VCV A;  1PMT A;  4ZB9 A;  5ECQ B;  1U6T A;  3F6F A;  1SK2 A;  4PX1 A;  1WJK A;  3TRP A;  5G1L A;  5GAN D;  5C04 A;  2FWH A;  1I9D A;  2N5A A;  2PER A;  4HU7 A;  2HYX A;  3F0I A;  5ECM B;  3UBK A;  4EC0 A;  1PL1 A;  5EPF A;  10GS A;  3J7Y b;  2AAW A;  5HFG A;  4GXZ A;  1B8X A;  3ZFL A;  2GSR A;  4KDY A;  1C72 A;  4HZ4 A;  4HEA 2;  4USS A;  3FZ5 A;  2H8L A;  3UIW A;  1XVQ A;  1SL2 B;  3UVH A;  3A2X A;  1USB A;  3TOT A;  2QC7 A;  2WDU A;  1GH2 A;  2ALB A;  4Z7X A;  1F3B A;  1S3A A;  4MMM A;  3G7J A;  2FCH A;  3IBH A;  4YAV A;  3FKF A;  1MD3 A;  2IPA A;  3GL3 A;  1O8W A;  2CVD A;  5CP1 A;  5ENU A;  2EIQ A;  2V32 A;  3KCM A;  5IOX A;  4DSQ A;  5H5Q A;  1PRX A;  4LLR A;  1WMJ A;  1YKA A;  3UVT A;  4JR4 A;  5EY6 A;  2I4A A;  3DGQ A;  2F3M A;  2YV7 A;  2I3Y A;  1K0A A;  4IN0 A;  3M8N A;  4DSS B;  2VO4 A;  1JLV A;  5F07 A;  2AJQ B;  3HVV A;  2JSY A;  2HZE A;  5J9C A;  2L6C A;  2LJR A;  5HFI A;  1V98 A;  3TJG A;  3WT1 A;  2FGX A;  3ZIV A;  3HY2 A;  5JCG A;  4I8B A;  1M7T A;  3QPM A;  1GSU A;  3GX0 A;  3KJY A;  1T00 A;  4OD7 A;  1J0F A;  1ZZY A;  2LJK A;  5D9W A;  5JWQ B;  2WB9 A;  3SBC A;  4KB3 A;  2OBI A;  2HNL A;  1FAA A;  3CMI A;  1XBS A;  1ZMA A;  3TJK A;  4V2M A;  1GUM A;  1XW6 A;  2MZC A;  4XHM A;  16GS A;  4PNF A;  3C71 A;  2TRC P;  3EYT A;  3RPP A;  4K7N A;  4PQI A;  13GS A;  5B8B A;  3P7X A;  4JBB A;  2IIY A;  4MH2 A;  4TR1 A;  1UVZ A;  1K3Y A;  3PPU A;  5D9V A;  2GST A;  4IKH A;  4K9Z A;  4EKZ A;  1TTZ A;  4QL7 A;  1YY7 A;  2AV4 A;  1RQM A;  1XZO A;  2YWI A;  3ZRD A;  5L71 A;  1FVJ A;  1EP7 A;  2OKA A;  3FHK A;  5E4W A;  1GSD A;  3ERG A;  4GCI A;  1GSF A;  1CQH A;  1TDI A;  2DIZ A;  3ED3 A;  5HR3 A;  1GUH A;  4YQU A;  3RHB A;  3FR9 A;  3D4T A;  2X8C A;  4IP1 A;  2F51 A;  4X1U A;  2WS2 A;  3FR6 A;  1EGR A;  4TRX A;  5CAX A; 
#chains in the Genus database with same CATH topology
 4OCF A;  3FRC A;  3HCZ A;  3HA9 A;  4JE1 A;  2XPE A;  1K0M A;  1F9M A;  3VWX A;  1J08 A;  2EFC A;  2PMT A;  4TOP A;  3GYK A;  1B9Y C;  4IS0 A;  5IMV A;  1V40 A;  2MBT A;  1QMV A;  2IMI A;  4IJI A;  2HE3 A;  1TKD B;  3LJR A;  3LW9 A;  1V9W A;  1A0F A;  2YZH A;  4MH3 A;  1EEJ A;  2WVY A;  3VWW A;  4EDY A;  2XBQ A;  5KN2 A;  2ES7 A;  2LKU A;  22GS A;  4O32 A;  4LMV A;  2FLS A;  2QSI A;  2DC5 A;  3ZVJ A;  2PGT A;  3WYW A;  3UEM A;  2CVK A;  3US3 A;  2K6V A;  1FO5 A;  3DEX A;  5D8I A;  5A34 A;  4ZB7 A;  4WBJ A;  5ECI B;  4MCU A;  1MTC A;  4HUA A;  5LD0 A;  3IA1 A;  3TKS A;  1PX6 A;  3L9V A;  4ICY A;  4JZQ A;  3L4N A;  4KND A;  3RPN A;  1GSE A;  4EF0 A;  1PL2 A;  3ZMK A;  1XW5 A;  3ZLP A;  4ZXG A;  1S3C A;  2HSH A;  3KEB A;  5F06 A;  5D93 A;  4ACS A;  2XBI A;  1EV4 A;  3KH9 A;  1WPI A;  3A5W A;  1V2A A;  2WZ9 A;  3GH9 A;  5BRT A;  3VI5 A;  2A2S A;  3F4T A;  3GFK A;  4OO4 A;  3Q18 A;  1QGV A;  1HYU A;  4N3Z A;  4LL1 B;  2DJ1 A;  2FA8 A;  3KXO A;  1NSW A;  2OAD A;  4K2D A;  1TK5 B;  2KHP A;  1TW9 A;  1SKS B;  2VM2 A;  1XIY A;  1A8Y A;  4V1A g;  4TXV A;  5ECL B;  2V2G A;  1HD2 A;  3VUR A;  1JZD A;  1ON4 A;  5DAK B;  2V41 A;  5JCU A;  1O8X A;  4EDZ A;  1AC1 A;  2EFH A;  4ECB A;  2VCX A;  2C0F A;  4ZL7 A;  1WIK A;  4IHU A;  3WT2 A;  5BMU B;  1AQV A;  2FNO A;  1A0R P;  2CX3 A;  4OFM A;  2JZS A;  5AIV A;  1XFL A;  1PX7 A;  4EUY A;  1Z9H A;  1ILO A;  3L9U A;  4Z2R A;  4XRD A;  1ERW A;  1UN2 A;  2LEG A;  2I9H A;  3GX8 A;  1PD2 1;  2AB6 A;  3ERF A;  9GSS A;  3IPZ A;  4XS6 A;  4WEY A;  2LJA A;  4PGT A;  4KA0 A;  3EMX A;  1G7O A;  3GTU A;  6GSS A;  4KSO A;  4BVY A;  1S4B P;  4PUR A;  2JU5 A;  2FA4 A;  1VF1 A;  1THX A;  2XPD A;  2X4A A;  1XWG A;  2K9F A;  5F0G A;  4TXO A;  5ABR A;  2H19 A;  5LNK e;  1OKT A;  4KUN A;  5IMZ A;  3KIJ A;  4X4J A;  2IMD A;  2L6D A;  3QFB C;  2QA1 A;  2HSY A;  1TK0 B;  2C0D A;  2FY6 A;  2QGV A;  3HXS A;  2FWE A;  3FY7 A;  4KCA A;  1TU7 A;  3M3M A;  3EWL A;  3IAS 2;  4NV2 A;  5ID2 A;  4MF7 A;  1OC8 A;  1TI3 A;  3APQ A;  1KBN A;  1YJ6 A;  5A4U A;  2LQQ A;  4EIP A;  3W8J A;  2VKZ G;  6GSV A;  3WGD A;  3M9J A;  2C4J A;  2FWF A;  2YJ7 A;  2V6K A;  2LS5 A;  4MAB A;  1ACV A;  2X8G A;  4K2X A;  1OVN A;  2I81 A;  3RAZ A;  3KTL A;  1PN0 A;  1UC7 A;  5KOW A;  3GL5 A;  1AQX A;  3FZ9 A;  4JR6 A;  5D9T A;  3WGX A;  4V1A p;  2CVB A;  1B9X C;  3TKS C;  4I6X A;  3HZ8 A;  1I1I P;  5ELA A;  5DQY A;  3IC8 A;  5J4Y A;  1JZO A;  3Q6O A;  2E0Q A;  4NV5 A;  2DJ3 A;  3HHV A;  4ECC A;  1GWC A;  3MNG A;  5D73 A;  1SU9 A;  4RQR A;  4CDO A;  5AN1 A;  2JZT A;  2VLV A;  4MJC A;  2HSN A;  3A2V A;  2M80 A;  1SEN A;  1TRS A;  4KGI A;  3TGZ A;  2VM1 A;  1X9M B;  3P8W A;  4PXO A;  1R7H A;  2WCI A;  1U3A A;  2JAC A;  4D73 A;  2QA2 A;  2G2Q A;  2NBS A;  2OA7 A;  3FW2 A;  1GLP A;  3TUE A;  1TXU A;  4N10 A;  5COH A;  2FWG A;  1PKZ A;  3APS A;  1Y1U A;  5J5N A;  1K0B A;  1KNG A;  3D5J A;  3DVW A;  3H8Q A;  1PSQ A;  4ZL9 A;  3EC3 A;  1YEW C;  1VRS D;  2B3S A;  3ZZX A;  1FVK A;  1A8L A;  2D2Z A;  1M3I A;  1XPV A;  5KOX A;  1ERV A;  4MA9 A;  5HFK A;  3DML A;  2RUE A;  1GNE A;  1ZYQ B;  2C0E A;  1XWB A;  2MYG A;  4MF6 A;  1CQG A;  1F2E A;  5A5H B;  1R26 A;  5ECR B;  4HQS A;  4X43 A;  2YV9 A;  3GH6 A;  1B4Q A;  4AJ7 A;  1T4Z A;  7GSS A;  2DBC A;  3F8U A;  2H6X A;  4IP6 A;  1Z7R A;  3Q74 A;  4OO5 A;  3O6T A;  3W6G A;  1YQ1 A;  4I97 A;  1GTB A;  3CRT A;  2L5L A;  2A2P A;  3CTG A;  3UBL A;  3EUR A;  4HU9 A;  4ZB6 A;  2TRX A;  4I2U A;  5DVB A;  2RM5 A;  1LJR A;  3P90 A;  4DSS A;  3C8E A;  3LYK A;  1N2A A;  3HZ4 A;  1T3B A;  1WRY A;  4N11 A;  1F37 A;  4BVX B;  1QK8 A;  3FK8 A;  2ZUP A;  4ISD A;  2L5O A;  2ZCT A;  3CSI A;  2IJY A;  2Z9S A;  2VL2 A;  3CTF A;  4F0B A;  4XIH A;  4TR4 A;  1U3I A;  4K0N A;  1ML6 A;  2H30 A;  2H72 A;  3HMJ G;  3I6A A;  3C1S A;  3NIV A;  2X8H A;  5D9X A;  3UMA A;  1SYR A;  3OR5 A;  4K5R A;  4WXT A;  4F9Z A;  5DJM A;  3CYN A;  2OE1 A;  2IME A;  3VWU A;  5J40 A;  2IFQ A;  1H4O A;  2VUP A;  5G5F A;  5CRW A;  1N25 A;  2J9H A;  3CBU A;  1Q4J A;  1SJ6 A;  3W8S A;  4TR3 A;  4MZW A;  2OT3 A;  1ST9 A;  4NMU A;  3TB2 A;  3PR8 A;  2CV4 A;  3CSJ A;  1M2A A;  3ZYW A;  4GF0 A;  4J57 E;  3TU3 B;  2LUS A;  4I5Q A;  3M1G A;  3ERW A;  4K1F A;  1EOG A;  5ECK B;  4ZB8 A;  5J47 A;  1WE0 A;  2H70 A;  4YQV A;  5J4U A;  3QFA C;  4L5L A;  1GP1 A;  2YWN A;  4ECI A;  11GS A;  1EEM A;  1OYJ A;  5CRE A;  2DML A;  5CO3 A;  2VOC A;  3ZFB A;  4A5P A;  4K6X A;  4NWY A;  1G7E A;  4N30 A;  1R4W A;  3KM6 A;  4ML6 A;  5GST A;  5ECS A;  4PUF C;  1E6B A;  3H1N A;  2YWO A;  4RQX A;  2GT5 A;  1Z7P A;  2F8A A;  4HJM A;  1URM A;  4H86 A;  1Q98 A;  2P31 A;  3IXR A;  5DAL B;  1JHB A;  1V58 A;  2R0C A;  4ZL8 A;  14GS A;  1J9B A;  2YCD A;  2VLU A;  2HZE B;  1BG5 A;  2HRK B;  1EGO A;  2GLR A;  1XOA A;  5A5K A;  1S3D A;  5HQP A;  4XS4 A;  4N0V A;  5ECP B;  1QXH A;  1M2D A;  3NOF A;  1LBK A;  4MP4 A;  1U88 A;  2NPB A;  1T4Y A;  5CRH A;  17GS A;  4KDX A;  5J3R A;  3LWA A;  1THO A;  1WWJ A;  2EIR A;  2LNS A;  2LRT A;  3LGC A;  2E7P A;  3UAR A;  4L0W A;  1SVL A;  3TJJ A;  4G19 A;  3PGT A;  1BJX A;  1IYI A;  5ECO B;  2KLX A;  4E68 A;  1FB6 A;  1EP8 A;  4PHZ C;  3ME7 A;  2C8U A;  4HDE A;  2HRN A;  1K3L A;  5A4W A;  4TVE A;  3GKN A;  1K0N A;  1AIU A;  2ZNM A;  3GNJ A;  4KE3 A;  3SWL A;  1S3R A;  1JZR A;  4ID0 A;  1F3A A;  2RUF A;  4KW6 A;  4WR5 A;  3FR3 A;  4POM A;  1N8J A;  4HI7 A;  1A2J A;  3G7Y A;  3H93 A;  2O5V A;  2WW3 A;  3GST A;  4PI0 C;  3L78 A;  4Z2T A;  5JWR B;  2VL2 C;  4NAX A;  2HSM A;  1JZW A;  4FXY P;  4GQF A;  4KH7 A;  2NVL A;  3FEU A;  2LV3 A;  3TKQ A;  1X9W B;  4GDF A;  3EU4 A;  1FG4 A;  2JL4 A;  2HI7 A;  2R37 A;  4AJ6 A;  2H71 A;  5G5E A;  1KEB A;  4XCS A;  1SVO A;  2O3E A;  3C73 A;  12GS A;  3EPT A;  3GN3 A;  2JZR A;  3V1W A;  1XVW A;  3KH7 A;  1G6Y A;  4IGJ A;  3R2Q A;  3R3E A;  2N5F A;  1YVL A;  2GS3 A;  2YAN A;  3UOM A;  2A4V A;  3BCI A;  4GQC A;  1EWX A;  3P2A A;  4MLY A;  5DAK A;  3F3Q A;  1UA5 A;  2VLT A;  4NHZ A;  4JU5 A;  4MZB A;  1G6W A;  1BAY A;  4ECJ A;  3GHA A;  4L8E A;  2P5Q A;  2X99 A;  2LST A;  3RGB C;  5IQY A;  3TKP A;  4HSC X;  2CX4 A;  3LYP A;  2F8F A;  2CZ2 A;  4G0K A;  2DKH A;  2H1B A;  2EC4 A;  3GKK A;  4O5R A;  3QMX A;  4RI7 A;  2GVP A;  3D21 A;  4RI6 A;  3HJO A;  4HQZ A;  4O7H A;  1SKW B;  1K0D A;  2KP2 A;  2HT9 A;  1OE8 A;  4MK3 A;  4XTS A;  2NDO A;  1BQ7 A;  5IMC A;  1T7P B;  3NZN A;  5AIX A;  2HXK A;  5FWG A;  2O36 A;  4AJ8 A;  4DSR A;  3O3T A;  4PTS A;  2MMN A;  2M46 A;  3HJM A;  2VD1 A;  4EE0 A;  2C0G A;  1F6M C;  5EVO A;  1YZX A;  4EO3 A;  1A24 A;  1TP9 A;  1FHE A;  2P5R A;  3I9V 2;  4Q5R A;  4BA7 A;  2B5X A;  4CHS A;  4G0I A;  3KGK A;  2CZ3 A;  2H0G A;  3E3E A;  3CXG A;  2H66 A;  2PN8 A;  1GUK A;  4EVM A;  5IMD A;  4F2I A;  2H0H A;  4GLT A;  5KN1 A;  1M9B A;  5GSS A;  1EV9 A;  4MPG A;  4HS1 A;  2KUC A;  1R5A A;  2YWM A;  3UJ1 A;  2A4H A;  4DVC A;  1H75 A;  3GIX A;  3A2W A;  3EIN A;  4TW5 A;  5IIZ A;  1V57 A;  2B7K A;  5IO0 A;  2C1Y A;  4MZC A;  1O85 A;  4KCE A;  1SD9 A;  3BCK A;  3K8N A;  4NHW A;  4MJB A;  3MYD A;  2GZY A;  3L9S A;  3ZTL A;  4E8E A;  2H74 A;  3GUR A;  2AYT A;  4GSN A;  2JAD A;  3BJ5 A;  3KMO A;  3N9J A;  4K7O A;  1T1V A;  4AKH A;  1EOH A;  3VI7 A;  2O8V B;  4ILF A;  4KF9 A;  1YF1 A;  4K7I A;  4EL1 A;  1RW1 A;  4ZBD A;  1XOB A;  3GTU B;  1MDJ A;  4WET A;  3VK9 A;  4BVY B;  2B6M A;  4QMK A;  3EMP A;  1OC9 A;  2L57 A;  4DEJ A;  2L4Q A;  2L59 A;  1OAZ A;  1X5C A;  3RHC A;  2WFC A;  5IPG A;  4MF5 A;  5GAP D;  1O6J A;  4BL7 A;  4QQ7 A;  3ZRE A;  4J2F A;  3M0F A;  3FYG A;  5INY A;  1XWA A;  1O73 A;  3KP9 A;  1NHY A;  1SK1 A;  4AI6 A;  4F82 A;  3HVS A;  1ZYP A;  2ON7 A;  3L0H A;  1AUC A;  2UZ8 A;  1DE2 A;  2RLI A;  3TRX A;  3APO A;  3BOA A;  2DSA A;  2PPT A;  5FHI A;  3VLN A;  1HQO A;  5IPH A;  3F3R A;  3TCO A;  1ERT A;  3FZ4 A;  2E2G A;  4AF2 A;  3PIN A;  1BYE A;  3DKS A;  1SL0 B;  20GS A;  2YJH A;  3EVI A;  3EE2 A;  3DD3 A;  4PUA A;  5ECN B;  1GRX A;  4RUV A;  1W89 A;  4POK A;  4Q5Q A;  5ECH B;  3IAM 2;  8GSS A;  4E8H A;  2DIY A;  4BVX A;  1PGT A;  1XW9 A;  1QQ2 A;  1XCC A;  2LRN A;  1K0C A;  1SL1 B;  5FT3 A;  5G1K A;  3AY8 A;  4G10 A;  2C3T A;  1GNW A;  1GUL A;  1IYH A;  1JLW A;  3CSH A;  4Q5N A;  1ZCP A;  1AXD A;  2BTO T;  2FD3 A;  3F63 A;  4K0G A;  5HR0 A;  5H5R A;  2HRF A;  2H0I A;  2VIM A;  1SVM A;  3LEF A;  1X0R A;  3LXT A;  3DXB A;  3G7I A;  2DJ0 A;  3KMN A;  1A23 A;  1M2B A;  2HSN B;  4LMW A;  2NTO A;  4O92 A;  5F05 A;  4IEL A;  4ZIJ A;  4KSM A;  2VL3 A;  4D73 B;  4IVF A;  3IK9 A;  4BIK A;  1GTA A;  3F9U A;  5KN3 A;  1PKW A;  3GV1 A;  3I69 A;  2EFE A;  2LTK A;  1ZYN A;  2R0G A;  4ZBA A;  2GQM A;  3A5I A;  6GST A;  2CQ9 A;  2R3X A;  2VCZ A;  1ZGN A;  1OKD A;  2CT6 A;  4JED A;  5H5S A;  2X49 A;  4WBR D;  1SD8 A;  2V6O A;  2IMK A;  3D22 A;  2H1G A;  4TKY A;  4ZBB A;  3KD0 A;  1M9A A;  3KTB A;  2KP1 A;  1Y6E A;  2OE3 A;  1MEK A;  5DCH A;  1HNC A;  4V2N A;  3UAP A;  5IO2 A;  1DBY A;  2K8S A;  2IWT A;  4CY6 A;  4J56 E;  4I2T A;  2GSS A;  3I43 A;  1MDI A;  2BMX A;  3LG6 A;  4K8M A;  4IQ1 A;  4WF5 A;  4FYU A;  2CAI A;  3BD2 A;  3RDW A;  2J23 A;  1TJD A;  1X5D A;  3E0U A;  2OBK A;  2H6Z A;  4CW9 A;  5G2Z A;  5DAL A;  5HR2 A;  4YH2 A;  2XHF A;  1YEP A;  1PQN A;  1O7U A;  2CAQ A;  3GMF A;  2HRK A;  3MIX A;  3QD9 A;  4TR0 A;  3G9B A;  1K0O A;  2WZS A;  3HVX A;  4MJA A;  4X0X A;  2WUL A;  3QDN A;  3QOU A;  4WKW A;  3GA4 A;  3PH9 A;  1Y25 A;  4F0C A;  1SK0 A;  1X9S B;  1A2M A;  4KAE A;  2R2J A;  3QAV A;  1K3O A;  3IRA A;  3BBY A;  3IK7 A;  3DRN A;  4GST A;  1AW9 A;  1FOV A;  5A1N A;  4G9H A;  6GSY A;  2WW1 A;  2MMO A;  2IFQ B;  5B6N A;  5KEJ A;  1ZOF A;  2H73 A;  4GRF A;  2LRC A;  1HNB A;  3QAG A;  2H1A A;  2VCQ A;  2DJ2 A;  3FZA A;  3D6I A;  3DIE A;  1GTI A;  4POL A;  2E2M A;  4GSS A;  5C00 A;  3EU3 A;  4P3Y B;  3VWV A;  1MDK A;  3ME8 A;  5IMA A;  4XS1 A;  3MDK A;  1ERU A;  1VF3 A;  3HD5 A;  2OAC A;  2AUV A;  1TXX A;  1AAZ A;  1PA3 A;  2REM A;  1TK8 B;  2K18 A;  3IHQ A;  5JWO B;  2GSQ A;  3CRU A;  6GSW A;  2YZU A;  1TRV A;  4MPF A;  3GKX A;  5B8A A;  2L4C A;  4MNN A;  4OCE A;  1HNA A;  2O89 A;  2F9S A;  2O7K A;  4AKG A;  2DKI A;  3VFI A;  19GS A;  3GRX A;  2FUG 2;  4HOJ A;  6GSU A;  4TN8 A;  2R4V A;  2HZF A;  3TJB A;  4TR1 B;  3HDC A;  4PQH A;  1TU8 A;  2XC2 A;  2H1D A;  3LXZ A;  1I5G A;  2RII A;  5B6M A;  3TOU A;  5CNW A;  4POB A;  1NW2 A;  3ISO A;  3UL3 A;  1BF5 A;  2GQK A;  2CA8 A;  3D4M A;  4KX4 A;  4PNG A;  2O85 A;  2R6K A;  1VF2 A;  5IOW A;  1NM3 A;  1XXU A;  4XS4 B;  3U5R E;  4GTU A;  3GSS A;  3U6V A;  2PUK C;  4N0Z A;  2EFD A;  1BED A;  1TRW A;  1RK4 A;  1TRU A;  2GGT A;  5B7C A;  1VF4 A;  2GDR A;  4FH8 A;  4ML1 A;  1TI1 A;  4OFT A;  1NHO A;  3IR4 A;  2MMZ A;  5JCW A;  4G0L A;  3MWH A;  1B48 A;  1GSS A;  2WVX B;  2YN1 A;  2YNX A;  2DJK A;  1EZK A;  3FMW A;  1YDK A;  4FYB A;  2OJL A;  2K8V A;  4IQA A;  1ABA A;  1MD4 A;  1G0T A;  3KZQ A;  3WGE A;  3TJF A;  2P0G A;  1Z6M A;  2HFD A;  5F8B A;  1GSQ A;  3TKR A;  1YF0 A;  1XWC A;  5BMU A;  2DJJ A;  1FW1 A;  3H79 A;  3ZIT A;  2H75 A;  1Z6N A;  2M72 A;  2VCT A;  3F4S A;  1M0U A;  2H76 A;  2HSM B;  4IJ3 A;  3E9J B;  2HLS A;  4BWQ A;  4BPY A;  3C1R A;  5D96 A;  2GZZ A;  3VPT A;  1SKR B;  4ZIL A;  3VPQ A;  3GUS A;  1WP0 A;  3RBT A;  1B4P A;  2PBJ A;  5AGY A;  1ZYE A;  5E59 A;  2TIR A;  1DUG A;  5A34 B;  5CRG A;  3S9F A;  2HQT A;  1OE7 A;  2WW0 A;  2DLX A;  1O81 A;  1W4V A;  3MSZ A;  3IE3 A;  2VCW A;  3JCM L;  2WRT A;  3WD6 A;  1SJI A;  2EIO A;  3HYP A;  5DQS A;  2VD0 A;  1YEX A;  3Q19 A;  5CYY A;  3O76 A;  4NPB A;  4WF4 A;  1JFU A;  4K5S A;  5KN0 A;  3LFL A;  5DCG A;  3IC4 A;  5A4V A;  2B5E A;  2KOK A;  2PU9 C;  4YAP A;  3CWG A;  5AIS A;  5DBQ A;  1FB0 A;  2GT6 A;  3IOS A;  2DMM A;  1FOH A;  2X64 A;  2LNT A;  1DE1 A;  3QCP A;  1R5P A;  2MMA A;  1Z3E A;  1SJZ A;  2O87 A;  3C7M A;  3F4R A;  4QL9 A;  2H01 A;  1YKC A;  5IMF A;  2QKE A;  1WOU A;  1X5E A;  3M9K A;  2N5B A;  1A2L A;  4PQ1 A;  1DSB A;  3A3T A;  2WJU A;  2OE0 A;  1OC3 A;  4MDC A;  2R5G A;  2GQL A;  1BX9 A;  1Z5Y E;  1PN9 A;  1M99 A;  4KDU A;  2IMF A;  1TOF A;  3DVX A;  2C80 A;  1VGL A;  1GL8 A;  2IL3 A;  1GTU A;  1GSY A;  4AGS A;  2MBS A;  2A2R A;  2V1M A;  4LL4 B;  4XRA A;  1KTE A;  4CY8 A;  4V2L A;  4FQU A;  2GTU A;  4MJE A;  3TRQ A;  3ZVJ D;  2IN3 A;  2YPM A;  6GSX A;  3H4K A;  4OWY A;  5DJL A;  5EL8 A;  2VAF A;  4FO5 A;  3QR6 A;  2H6Y A;  4HZ2 A;  4YQM A;  2RM6 A;  2FHE A;  4NXI A;  2R0P A;  3GKM A;  4G2E A;  2YOI A;  3ZL5 A;  1LU4 A;  3IV4 A;  3QAW A;  4WR4 A;  2GZP A;  18GS A;  3CQF A;  3F6D A;  3ZIJ A;  2B5Y A;  1SYX A;  4TXO B;  2C3Q A;  3TKS E;  5LCZ A;  3HJP A;  4JRR A;  5G30 A;  2PVQ A;  3KP8 A;  5IM9 A;  1BG1 A;  4G01 A;  4F03 A;  2C3N A;  4IW9 A;  3HKR A;  4BWS A;  4IBP A;  3IDV A;  2B7J A;  5A5H A;  5J9B A;  2B1K A;  2LQO A;  1E2Y A;  2ON5 A;  2AHE A;  1T8E B;  3CHX C;  5ID2 B;  4EXJ A;  1QUW A;  1XWK A;  3N5O A;  5G31 A;  5J41 A;  3MAK A;  5CRD A;  4L0U A;  2H1L A;  2WGR A;  1AQW A;  2B1L A;  4ULX A;  5DDL A;  5ELG A;  2HRA A;  1GLQ A;  3DYR A;  3LQ7 A;  4FYC A;  3HVN A;  1U87 A;  3LOR A;  2PWJ A;  2I1U A;  3D0Z A;  1PFO A;  4OFN A;  3J7Y k;  1OC9 B;  2VL9 A;  3DWV A;  4Q5F A;  4FIW A;  4OMV A;  2JSZ A;  4YKF A;  4L5O A;  2YP6 A;  2PVO C;  2G0F A;  5GZZ B;  4HJ2 A;  1ZL9 A;  4GWR A;  3LSZ A;  3ZML A;  4LA1 A;  1QFN A;  3TDG A;  5HR1 A;  4BL7 B;  2BJX A;  2VCV A;  2WW2 A;  1PMT A;  4ZB9 A;  5ECQ B;  1U6T A;  3F6F A;  1SK2 A;  4W66 A;  4PX1 A;  1WJK A;  3TRP A;  5G1L A;  5GAN D;  5C04 A;  1XG8 A;  2FWH A;  1I9D A;  2N5A A;  2PER A;  4HU7 A;  2HYX A;  3F0I A;  5ECM B;  3UBK A;  4EC0 A;  1PL1 A;  5EPF A;  10GS A;  4EIQ A;  3J7Y b;  2AAW A;  5HFG A;  4GXZ A;  1B8X A;  3ZFL A;  2GSR A;  4KDY A;  1C72 A;  4HZ4 A;  4HEA 2;  4USS A;  3FZ5 A;  2H8L A;  3UIW A;  1XVQ A;  1SL2 B;  3UVH A;  3A2X A;  1USB A;  3TOT A;  2QC7 A;  2WDU A;  1GH2 A;  2ALB A;  2UV8 G;  4Z7X A;  1F3B A;  1S3A A;  4MMM A;  3G7J A;  2FCH A;  3IBH A;  4YAV A;  3FKF A;  1MD3 A;  2IPA A;  3RFR C;  3GL3 A;  1O8W A;  2CVD A;  5CP1 A;  5ENU A;  2EIQ A;  2V32 A;  3KCM A;  5IOX A;  4DSQ A;  5H5Q A;  1PRX A;  4LLR A;  1WMJ A;  1YKA A;  3UVT A;  4JR4 A;  2WVZ A;  5EY6 A;  2I4A A;  3DGQ A;  2F3M A;  2YV7 A;  2I3Y A;  1K0A A;  4IN0 A;  3M8N A;  4DSS B;  2VO4 A;  1JLV A;  5F07 A;  2AJQ B;  3HVV A;  2JSY A;  4O5U A;  2HZE A;  5J9C A;  2L6C A;  2LJR A;  4PI2 C;  5HFI A;  1V98 A;  4O5Q A;  4AKX B;  3TJG A;  3WT1 A;  2FGX A;  3ZIV A;  3HY2 A;  5JCG A;  4I8B A;  1M7T A;  1GSU A;  3GX0 A;  3KJY A;  3QPM A;  1T00 A;  4OD7 A;  1J0F A;  1ZZY A;  2LJK A;  5D9W A;  5JWQ B;  2WB9 A;  3SBC A;  4KB3 A;  2OBI A;  4YKG A;  2HNL A;  1FAA A;  3CMI A;  1XBS A;  1M3J A;  1ZMA A;  3TJK A;  4V2M A;  1GUM A;  1XW6 A;  2MZC A;  4XHM A;  4AKI A;  16GS A;  4PNF A;  3C71 A;  2TRC P;  3EYT A;  3RPP A;  4K7N A;  4PQI A;  4Z2U A;  3IHG A;  13GS A;  5B8B A;  3P7X A;  4JBB A;  2IIY A;  4MH2 A;  4TR1 A;  1UVZ A;  1K3Y A;  3PPU A;  5D9V A;  2GST A;  4IKH A;  4K9Z A;  4EKZ A;  1TTZ A;  4QL7 A;  1YY7 A;  2AV4 A;  5J4V A;  1RQM A;  1XZO A;  2YWI A;  3ZRD A;  5L71 A;  1FVJ A;  1EP7 A;  2OKA A;  3FHK A;  5E4W A;  1GSD A;  3ERG A;  4GCI A;  1GSF A;  1CQH A;  1TDI A;  2DIZ A;  3ED3 A;  5HR3 A;  1GUH A;  4YQU A;  3RHB A;  3FR9 A;  3D4T A;  2X8C A;  4IP1 A;  2F51 A;  5A1N B;  4X1U A;  2WS2 A;  3FR6 A;  1EGR A;  2WVX A;  4TRX A;  5CAX A; 
#chains in the Genus database with same CATH homology
 4OCF A;  3FRC A;  3HCZ A;  3HA9 A;  4JE1 A;  2XPE A;  1K0M A;  1F9M A;  3VWX A;  1J08 A;  2EFC A;  2PMT A;  4TOP A;  3GYK A;  1B9Y C;  4IS0 A;  5IMV A;  1V40 A;  2MBT A;  1QMV A;  2IMI A;  4IJI A;  2HE3 A;  1TKD B;  3LJR A;  3LW9 A;  1V9W A;  1A0F A;  2YZH A;  4MH3 A;  1EEJ A;  3VWW A;  4EDY A;  2XBQ A;  5KN2 A;  2ES7 A;  2LKU A;  22GS A;  4O32 A;  4LMV A;  2FLS A;  2QSI A;  2DC5 A;  3ZVJ A;  2PGT A;  3WYW A;  3UEM A;  2CVK A;  3US3 A;  2K6V A;  1FO5 A;  3DEX A;  5D8I A;  5A34 A;  4ZB7 A;  4WBJ A;  5ECI B;  4MCU A;  1MTC A;  4HUA A;  5LD0 A;  3IA1 A;  3TKS A;  1PX6 A;  3L9V A;  4ICY A;  4JZQ A;  3L4N A;  4KND A;  3RPN A;  1GSE A;  4EF0 A;  1PL2 A;  3ZMK A;  1XW5 A;  3ZLP A;  4ZXG A;  1S3C A;  2HSH A;  3KEB A;  5F06 A;  5D93 A;  4ACS A;  2XBI A;  1EV4 A;  3KH9 A;  1WPI A;  3A5W A;  1V2A A;  2WZ9 A;  3GH9 A;  5BRT A;  3VI5 A;  2A2S A;  3F4T A;  3GFK A;  4OO4 A;  3Q18 A;  1QGV A;  1HYU A;  4N3Z A;  4LL1 B;  2DJ1 A;  2FA8 A;  3KXO A;  1NSW A;  2OAD A;  4K2D A;  1TK5 B;  2KHP A;  1TW9 A;  1SKS B;  2VM2 A;  1XIY A;  1A8Y A;  4V1A g;  4TXV A;  5ECL B;  2V2G A;  1HD2 A;  3VUR A;  1JZD A;  1ON4 A;  5DAK B;  2V41 A;  5JCU A;  1O8X A;  4EDZ A;  1AC1 A;  2EFH A;  4ECB A;  2VCX A;  2C0F A;  4ZL7 A;  1WIK A;  4IHU A;  3WT2 A;  5BMU B;  1AQV A;  2FNO A;  1A0R P;  2CX3 A;  4OFM A;  2JZS A;  5AIV A;  1XFL A;  1PX7 A;  4EUY A;  1Z9H A;  1ILO A;  3L9U A;  4Z2R A;  4XRD A;  1ERW A;  1UN2 A;  2LEG A;  2I9H A;  3GX8 A;  1PD2 1;  2AB6 A;  3ERF A;  9GSS A;  3IPZ A;  4XS6 A;  4WEY A;  2LJA A;  4PGT A;  4KA0 A;  3EMX A;  1G7O A;  3GTU A;  6GSS A;  4KSO A;  4BVY A;  4PUR A;  2JU5 A;  2FA4 A;  1VF1 A;  1THX A;  2XPD A;  2X4A A;  1XWG A;  2K9F A;  5F0G A;  4TXO A;  5ABR A;  2H19 A;  5LNK e;  1OKT A;  4KUN A;  5IMZ A;  3KIJ A;  4X4J A;  2IMD A;  2L6D A;  3QFB C;  2QA1 A;  2HSY A;  1TK0 B;  2C0D A;  2FY6 A;  2QGV A;  3HXS A;  2FWE A;  3FY7 A;  4KCA A;  1TU7 A;  3M3M A;  3EWL A;  3IAS 2;  4NV2 A;  5ID2 A;  4MF7 A;  1OC8 A;  1TI3 A;  3APQ A;  1KBN A;  1YJ6 A;  5A4U A;  2LQQ A;  4EIP A;  3W8J A;  2VKZ G;  6GSV A;  3WGD A;  3M9J A;  2C4J A;  2FWF A;  2YJ7 A;  2V6K A;  2LS5 A;  4MAB A;  1ACV A;  2X8G A;  4K2X A;  1OVN A;  2I81 A;  3RAZ A;  3KTL A;  1PN0 A;  1UC7 A;  5KOW A;  3GL5 A;  1AQX A;  3FZ9 A;  4JR6 A;  5D9T A;  3WGX A;  4V1A p;  2CVB A;  1B9X C;  3TKS C;  4I6X A;  3HZ8 A;  5ELA A;  5DQY A;  3IC8 A;  5J4Y A;  1JZO A;  3Q6O A;  2E0Q A;  4NV5 A;  2DJ3 A;  3HHV A;  4ECC A;  1GWC A;  3MNG A;  5D73 A;  1SU9 A;  4RQR A;  4CDO A;  5AN1 A;  2JZT A;  2VLV A;  4MJC A;  2HSN A;  3A2V A;  2M80 A;  1SEN A;  1TRS A;  4KGI A;  3TGZ A;  2VM1 A;  1X9M B;  3P8W A;  4PXO A;  1R7H A;  2WCI A;  1U3A A;  2JAC A;  4D73 A;  2QA2 A;  2G2Q A;  2NBS A;  2OA7 A;  3FW2 A;  1GLP A;  3TUE A;  1TXU A;  4N10 A;  5COH A;  2FWG A;  1PKZ A;  3APS A;  1Y1U A;  5J5N A;  1K0B A;  1KNG A;  3D5J A;  3DVW A;  3H8Q A;  1PSQ A;  4ZL9 A;  3EC3 A;  1VRS D;  2B3S A;  3ZZX A;  1FVK A;  1A8L A;  2D2Z A;  1XPV A;  5KOX A;  1ERV A;  4MA9 A;  5HFK A;  3DML A;  2RUE A;  1GNE A;  1ZYQ B;  2C0E A;  1XWB A;  2MYG A;  4MF6 A;  1CQG A;  1F2E A;  5A5H B;  1R26 A;  5ECR B;  4HQS A;  4X43 A;  2YV9 A;  3GH6 A;  1B4Q A;  4AJ7 A;  1T4Z A;  7GSS A;  2DBC A;  3F8U A;  2H6X A;  4IP6 A;  1Z7R A;  3Q74 A;  4OO5 A;  3O6T A;  3W6G A;  1YQ1 A;  4I97 A;  1GTB A;  3CRT A;  2L5L A;  2A2P A;  3CTG A;  3UBL A;  3EUR A;  4HU9 A;  4ZB6 A;  2TRX A;  4I2U A;  5DVB A;  2RM5 A;  1LJR A;  3P90 A;  4DSS A;  3C8E A;  3LYK A;  1N2A A;  3HZ4 A;  1T3B A;  1WRY A;  4N11 A;  1F37 A;  4BVX B;  1QK8 A;  3FK8 A;  2ZUP A;  4ISD A;  2L5O A;  2ZCT A;  3CSI A;  2IJY A;  2Z9S A;  2VL2 A;  3CTF A;  4F0B A;  4XIH A;  4TR4 A;  1U3I A;  4K0N A;  1ML6 A;  2H30 A;  2H72 A;  3HMJ G;  3I6A A;  3C1S A;  3NIV A;  2X8H A;  5D9X A;  3UMA A;  1SYR A;  3OR5 A;  4K5R A;  4WXT A;  4F9Z A;  5DJM A;  3CYN A;  2OE1 A;  2IME A;  3VWU A;  5J40 A;  2IFQ A;  1H4O A;  2VUP A;  5G5F A;  5CRW A;  1N25 A;  2J9H A;  3CBU A;  1Q4J A;  1SJ6 A;  3W8S A;  4TR3 A;  4MZW A;  2OT3 A;  1ST9 A;  4NMU A;  3TB2 A;  3PR8 A;  2CV4 A;  3CSJ A;  1M2A A;  3ZYW A;  4GF0 A;  4J57 E;  3TU3 B;  2LUS A;  4I5Q A;  3M1G A;  3ERW A;  4K1F A;  1EOG A;  5ECK B;  4ZB8 A;  5J47 A;  1WE0 A;  2H70 A;  4YQV A;  5J4U A;  3QFA C;  4L5L A;  1GP1 A;  2YWN A;  4ECI A;  11GS A;  1EEM A;  1OYJ A;  5CRE A;  2DML A;  5CO3 A;  2VOC A;  3ZFB A;  4A5P A;  4K6X A;  4NWY A;  1G7E A;  4N30 A;  1R4W A;  3KM6 A;  4ML6 A;  5GST A;  5ECS A;  4PUF C;  1E6B A;  3H1N A;  2YWO A;  4RQX A;  2GT5 A;  1Z7P A;  2F8A A;  4HJM A;  1URM A;  4H86 A;  1Q98 A;  2P31 A;  3IXR A;  5DAL B;  1JHB A;  1V58 A;  2R0C A;  4ZL8 A;  14GS A;  1J9B A;  2YCD A;  2VLU A;  2HZE B;  1BG5 A;  2HRK B;  1EGO A;  2GLR A;  1XOA A;  5A5K A;  1S3D A;  5HQP A;  4XS4 A;  4N0V A;  5ECP B;  1QXH A;  1M2D A;  3NOF A;  1LBK A;  4MP4 A;  1U88 A;  2NPB A;  1T4Y A;  5CRH A;  17GS A;  4KDX A;  5J3R A;  3LWA A;  1THO A;  1WWJ A;  2EIR A;  2LNS A;  2LRT A;  3LGC A;  2E7P A;  3UAR A;  4L0W A;  1SVL A;  3TJJ A;  4G19 A;  3PGT A;  1BJX A;  1IYI A;  5ECO B;  2KLX A;  4E68 A;  1FB6 A;  1EP8 A;  3ME7 A;  2C8U A;  4HDE A;  2HRN A;  1K3L A;  5A4W A;  4TVE A;  3GKN A;  1K0N A;  1AIU A;  2ZNM A;  3GNJ A;  4KE3 A;  3SWL A;  1JZR A;  4ID0 A;  1F3A A;  2RUF A;  4KW6 A;  4WR5 A;  3FR3 A;  4POM A;  1N8J A;  4HI7 A;  1A2J A;  3G7Y A;  3H93 A;  2O5V A;  3GST A;  3L78 A;  4Z2T A;  5JWR B;  2VL2 C;  4NAX A;  2HSM A;  1JZW A;  4GQF A;  4KH7 A;  2NVL A;  3FEU A;  2LV3 A;  3TKQ A;  1X9W B;  4GDF A;  3EU4 A;  1FG4 A;  2JL4 A;  2HI7 A;  2R37 A;  4AJ6 A;  2H71 A;  5G5E A;  1KEB A;  4XCS A;  1SVO A;  3C73 A;  12GS A;  3EPT A;  3GN3 A;  2JZR A;  3V1W A;  1XVW A;  3KH7 A;  1G6Y A;  4IGJ A;  3R2Q A;  3R3E A;  2N5F A;  1YVL A;  2GS3 A;  2YAN A;  3UOM A;  2A4V A;  3BCI A;  4GQC A;  1EWX A;  3P2A A;  4MLY A;  5DAK A;  3F3Q A;  1UA5 A;  2VLT A;  4NHZ A;  4JU5 A;  4MZB A;  1G6W A;  1BAY A;  4ECJ A;  3GHA A;  4L8E A;  2P5Q A;  2X99 A;  2LST A;  5IQY A;  3TKP A;  2CX4 A;  3LYP A;  2F8F A;  2CZ2 A;  4G0K A;  2DKH A;  2H1B A;  2EC4 A;  3GKK A;  4O5R A;  3QMX A;  4RI7 A;  2GVP A;  3D21 A;  4RI6 A;  3HJO A;  4HQZ A;  4O7H A;  1SKW B;  1K0D A;  2KP2 A;  2HT9 A;  1OE8 A;  4MK3 A;  4XTS A;  2NDO A;  1BQ7 A;  5IMC A;  1T7P B;  3NZN A;  5AIX A;  2HXK A;  5FWG A;  4AJ8 A;  4DSR A;  3O3T A;  4PTS A;  2MMN A;  2M46 A;  3HJM A;  2VD1 A;  4EE0 A;  2C0G A;  1F6M C;  5EVO A;  1YZX A;  4EO3 A;  1A24 A;  1TP9 A;  1FHE A;  2P5R A;  3I9V 2;  4Q5R A;  4BA7 A;  2B5X A;  4CHS A;  4G0I A;  3KGK A;  2CZ3 A;  2H0G A;  3E3E A;  3CXG A;  2H66 A;  2PN8 A;  1GUK A;  4EVM A;  5IMD A;  4F2I A;  2H0H A;  4GLT A;  5KN1 A;  1M9B A;  5GSS A;  1EV9 A;  4MPG A;  4HS1 A;  2KUC A;  1R5A A;  2YWM A;  3UJ1 A;  2A4H A;  4DVC A;  1H75 A;  3GIX A;  3A2W A;  3EIN A;  4TW5 A;  5IIZ A;  1V57 A;  2B7K A;  5IO0 A;  2C1Y A;  4MZC A;  1O85 A;  4KCE A;  1SD9 A;  3BCK A;  3K8N A;  4NHW A;  4MJB A;  3MYD A;  2GZY A;  3L9S A;  3ZTL A;  4E8E A;  2H74 A;  3GUR A;  2AYT A;  4GSN A;  2JAD A;  3BJ5 A;  3KMO A;  3N9J A;  4K7O A;  1T1V A;  4AKH A;  1EOH A;  3VI7 A;  2O8V B;  4ILF A;  4KF9 A;  1YF1 A;  4K7I A;  4EL1 A;  1RW1 A;  4ZBD A;  1XOB A;  3GTU B;  1MDJ A;  4WET A;  3VK9 A;  4BVY B;  2B6M A;  4QMK A;  3EMP A;  1OC9 A;  2L57 A;  4DEJ A;  2L4Q A;  2L59 A;  1OAZ A;  1X5C A;  3RHC A;  2WFC A;  5IPG A;  4MF5 A;  5GAP D;  1O6J A;  4BL7 A;  4QQ7 A;  3ZRE A;  4J2F A;  3M0F A;  3FYG A;  5INY A;  1XWA A;  3KP9 A;  1O73 A;  1NHY A;  1SK1 A;  4AI6 A;  4F82 A;  3HVS A;  1ZYP A;  2ON7 A;  3L0H A;  1AUC A;  2UZ8 A;  1DE2 A;  2RLI A;  3TRX A;  3APO A;  3BOA A;  2DSA A;  2PPT A;  5FHI A;  3VLN A;  1HQO A;  5IPH A;  3F3R A;  3TCO A;  1ERT A;  3FZ4 A;  2E2G A;  4AF2 A;  3PIN A;  1BYE A;  3DKS A;  1SL0 B;  20GS A;  2YJH A;  3EVI A;  3EE2 A;  3DD3 A;  4PUA A;  5ECN B;  1GRX A;  4RUV A;  1W89 A;  4POK A;  4Q5Q A;  5ECH B;  3IAM 2;  8GSS A;  4E8H A;  2DIY A;  4BVX A;  1PGT A;  1XW9 A;  1QQ2 A;  1XCC A;  2LRN A;  1K0C A;  1SL1 B;  5FT3 A;  5G1K A;  3AY8 A;  4G10 A;  2C3T A;  1GNW A;  1GUL A;  1IYH A;  1JLW A;  3CSH A;  4Q5N A;  1ZCP A;  1AXD A;  2BTO T;  2FD3 A;  3F63 A;  4K0G A;  5HR0 A;  5H5R A;  2HRF A;  2H0I A;  2VIM A;  1SVM A;  3LEF A;  1X0R A;  3LXT A;  3DXB A;  3G7I A;  2DJ0 A;  3KMN A;  1A23 A;  1M2B A;  2HSN B;  4LMW A;  2NTO A;  4O92 A;  5F05 A;  4IEL A;  4ZIJ A;  4KSM A;  2VL3 A;  4D73 B;  4IVF A;  3IK9 A;  1GTA A;  3F9U A;  5KN3 A;  1PKW A;  3GV1 A;  3I69 A;  2EFE A;  2LTK A;  1ZYN A;  2R0G A;  4ZBA A;  2GQM A;  3A5I A;  6GST A;  2CQ9 A;  2R3X A;  2VCZ A;  1ZGN A;  1OKD A;  2CT6 A;  4JED A;  5H5S A;  2X49 A;  4WBR D;  1SD8 A;  2V6O A;  2IMK A;  3D22 A;  2H1G A;  4TKY A;  4ZBB A;  3KD0 A;  1M9A A;  3KTB A;  2KP1 A;  1Y6E A;  2OE3 A;  1MEK A;  5DCH A;  1HNC A;  4V2N A;  3UAP A;  5IO2 A;  1DBY A;  2K8S A;  2IWT A;  4CY6 A;  4J56 E;  4I2T A;  2GSS A;  3I43 A;  1MDI A;  2BMX A;  3LG6 A;  4K8M A;  4IQ1 A;  4WF5 A;  4FYU A;  2CAI A;  3BD2 A;  3RDW A;  2J23 A;  1TJD A;  1X5D A;  3E0U A;  2OBK A;  2H6Z A;  4CW9 A;  5G2Z A;  5DAL A;  5HR2 A;  4YH2 A;  2XHF A;  1YEP A;  1PQN A;  1O7U A;  2CAQ A;  3GMF A;  2HRK A;  3MIX A;  3QD9 A;  4TR0 A;  3G9B A;  1K0O A;  4MJA A;  3HVX A;  4X0X A;  2WUL A;  3QDN A;  3QOU A;  4WKW A;  3GA4 A;  3PH9 A;  1Y25 A;  4F0C A;  1SK0 A;  1X9S B;  1A2M A;  4KAE A;  2R2J A;  3QAV A;  1K3O A;  3IRA A;  3BBY A;  3IK7 A;  3DRN A;  4GST A;  1AW9 A;  1FOV A;  5A1N A;  4G9H A;  6GSY A;  2MMO A;  2IFQ B;  5B6N A;  5KEJ A;  1ZOF A;  2H73 A;  4GRF A;  2LRC A;  1HNB A;  3QAG A;  2H1A A;  2VCQ A;  2DJ2 A;  3FZA A;  3D6I A;  3DIE A;  1GTI A;  4POL A;  2E2M A;  4GSS A;  5C00 A;  3EU3 A;  4P3Y B;  3VWV A;  1MDK A;  3ME8 A;  5IMA A;  4XS1 A;  3MDK A;  1ERU A;  1VF3 A;  3HD5 A;  2OAC A;  2AUV A;  1TXX A;  1AAZ A;  1PA3 A;  2REM A;  1TK8 B;  2K18 A;  3IHQ A;  5JWO B;  2GSQ A;  3CRU A;  6GSW A;  2YZU A;  1TRV A;  4MPF A;  3GKX A;  5B8A A;  2L4C A;  4MNN A;  4OCE A;  1HNA A;  2O89 A;  2F9S A;  2O7K A;  4AKG A;  2DKI A;  3VFI A;  19GS A;  3GRX A;  2FUG 2;  4HOJ A;  6GSU A;  4TN8 A;  2R4V A;  2HZF A;  3TJB A;  4TR1 B;  3HDC A;  4PQH A;  1TU8 A;  2XC2 A;  2H1D A;  3LXZ A;  1I5G A;  2RII A;  5B6M A;  3TOU A;  5CNW A;  4POB A;  1NW2 A;  3ISO A;  3UL3 A;  1BF5 A;  2GQK A;  2CA8 A;  3D4M A;  4KX4 A;  4PNG A;  2O85 A;  2R6K A;  1VF2 A;  5IOW A;  1NM3 A;  1XXU A;  4XS4 B;  3U5R E;  4GTU A;  3GSS A;  3U6V A;  2PUK C;  4N0Z A;  2EFD A;  1BED A;  1TRW A;  1RK4 A;  1TRU A;  2GGT A;  5B7C A;  1VF4 A;  2GDR A;  4FH8 A;  4ML1 A;  1TI1 A;  4OFT A;  1NHO A;  3IR4 A;  2MMZ A;  5JCW A;  4G0L A;  3MWH A;  1B48 A;  1GSS A;  2YN1 A;  2YNX A;  2DJK A;  1EZK A;  3FMW A;  1YDK A;  4FYB A;  2OJL A;  2K8V A;  4IQA A;  1ABA A;  1MD4 A;  1G0T A;  3KZQ A;  3WGE A;  3TJF A;  2P0G A;  1Z6M A;  2HFD A;  5F8B A;  1GSQ A;  3TKR A;  1YF0 A;  1XWC A;  5BMU A;  2DJJ A;  1FW1 A;  3H79 A;  3ZIT A;  2H75 A;  1Z6N A;  2M72 A;  2VCT A;  3F4S A;  1M0U A;  2H76 A;  2HSM B;  4IJ3 A;  3E9J B;  2HLS A;  4BWQ A;  4BPY A;  3C1R A;  5D96 A;  2GZZ A;  3VPT A;  1SKR B;  4ZIL A;  3VPQ A;  3GUS A;  1WP0 A;  3RBT A;  1B4P A;  2PBJ A;  5AGY A;  1ZYE A;  5E59 A;  2TIR A;  1DUG A;  5A34 B;  5CRG A;  3S9F A;  2HQT A;  1OE7 A;  2DLX A;  1O81 A;  1W4V A;  3MSZ A;  3IE3 A;  2VCW A;  3JCM L;  2WRT A;  3WD6 A;  1SJI A;  2EIO A;  3HYP A;  5DQS A;  2VD0 A;  1YEX A;  3Q19 A;  5CYY A;  3O76 A;  4NPB A;  4WF4 A;  1JFU A;  4K5S A;  5KN0 A;  3LFL A;  5DCG A;  3IC4 A;  5A4V A;  2B5E A;  2KOK A;  2PU9 C;  4YAP A;  3CWG A;  5AIS A;  5DBQ A;  1FB0 A;  2GT6 A;  3IOS A;  2DMM A;  1FOH A;  2X64 A;  2LNT A;  1DE1 A;  3QCP A;  1R5P A;  2MMA A;  1Z3E A;  1SJZ A;  2O87 A;  3C7M A;  3F4R A;  4QL9 A;  2H01 A;  1YKC A;  5IMF A;  2QKE A;  1WOU A;  1X5E A;  3M9K A;  2N5B A;  1A2L A;  4PQ1 A;  1DSB A;  3A3T A;  2WJU A;  2OE0 A;  1OC3 A;  4MDC A;  2R5G A;  2GQL A;  1BX9 A;  1Z5Y E;  1PN9 A;  1M99 A;  4KDU A;  2IMF A;  1TOF A;  3DVX A;  2C80 A;  1VGL A;  1GL8 A;  2IL3 A;  1GTU A;  1GSY A;  4AGS A;  2MBS A;  2A2R A;  2V1M A;  4LL4 B;  4XRA A;  1KTE A;  4CY8 A;  4V2L A;  4FQU A;  2GTU A;  4MJE A;  3TRQ A;  3ZVJ D;  2IN3 A;  2YPM A;  6GSX A;  3H4K A;  4OWY A;  5DJL A;  5EL8 A;  2VAF A;  4FO5 A;  3QR6 A;  2H6Y A;  4HZ2 A;  4YQM A;  2RM6 A;  2FHE A;  4NXI A;  2R0P A;  3GKM A;  4G2E A;  2YOI A;  3ZL5 A;  1LU4 A;  3IV4 A;  3QAW A;  4WR4 A;  2GZP A;  18GS A;  3F6D A;  3ZIJ A;  2B5Y A;  1SYX A;  4TXO B;  2C3Q A;  3TKS E;  5LCZ A;  3HJP A;  4JRR A;  5G30 A;  2PVQ A;  3KP8 A;  5IM9 A;  1BG1 A;  4G01 A;  4F03 A;  2C3N A;  4IW9 A;  3HKR A;  4BWS A;  4IBP A;  3IDV A;  2B7J A;  5A5H A;  5J9B A;  2B1K A;  2LQO A;  1E2Y A;  2ON5 A;  2AHE A;  1T8E B;  5ID2 B;  4EXJ A;  1QUW A;  1XWK A;  3N5O A;  5G31 A;  5J41 A;  3MAK A;  5CRD A;  4L0U A;  2H1L A;  2WGR A;  1AQW A;  2B1L A;  4ULX A;  5DDL A;  5ELG A;  2HRA A;  1GLQ A;  3DYR A;  3LQ7 A;  4FYC A;  1U87 A;  3LOR A;  2PWJ A;  2I1U A;  3D0Z A;  4OFN A;  3J7Y k;  1OC9 B;  2VL9 A;  3DWV A;  4Q5F A;  4FIW A;  4OMV A;  2JSZ A;  4YKF A;  4L5O A;  2YP6 A;  2PVO C;  2G0F A;  5GZZ B;  4HJ2 A;  1ZL9 A;  4GWR A;  3LSZ A;  3ZML A;  4LA1 A;  1QFN A;  3TDG A;  5HR1 A;  4BL7 B;  2BJX A;  2VCV A;  1PMT A;  4ZB9 A;  5ECQ B;  1U6T A;  3F6F A;  1SK2 A;  4W66 A;  4PX1 A;  1WJK A;  3TRP A;  5G1L A;  5GAN D;  5C04 A;  2FWH A;  1I9D A;  2N5A A;  2PER A;  4HU7 A;  2HYX A;  3F0I A;  5ECM B;  3UBK A;  4EC0 A;  1PL1 A;  5EPF A;  10GS A;  4EIQ A;  3J7Y b;  2AAW A;  5HFG A;  4GXZ A;  1B8X A;  3ZFL A;  2GSR A;  4KDY A;  1C72 A;  4HZ4 A;  4HEA 2;  4USS A;  3FZ5 A;  2H8L A;  3UIW A;  1XVQ A;  1SL2 B;  3UVH A;  3A2X A;  1USB A;  3TOT A;  2QC7 A;  2WDU A;  1GH2 A;  2ALB A;  2UV8 G;  4Z7X A;  1F3B A;  1S3A A;  4MMM A;  3G7J A;  2FCH A;  3IBH A;  4YAV A;  3FKF A;  1MD3 A;  2IPA A;  3GL3 A;  1O8W A;  2CVD A;  5CP1 A;  5ENU A;  2EIQ A;  2V32 A;  3KCM A;  5IOX A;  4DSQ A;  5H5Q A;  1PRX A;  4LLR A;  1WMJ A;  1YKA A;  3UVT A;  4JR4 A;  5EY6 A;  2I4A A;  3DGQ A;  2F3M A;  2YV7 A;  2I3Y A;  1K0A A;  4IN0 A;  3M8N A;  4DSS B;  2VO4 A;  1JLV A;  5F07 A;  2AJQ B;  3HVV A;  2JSY A;  4O5U A;  2HZE A;  5J9C A;  2L6C A;  2LJR A;  5HFI A;  1V98 A;  4O5Q A;  4AKX B;  3TJG A;  3WT1 A;  2FGX A;  3ZIV A;  3HY2 A;  5JCG A;  4I8B A;  1M7T A;  1GSU A;  3GX0 A;  3KJY A;  3QPM A;  1T00 A;  4OD7 A;  1J0F A;  1ZZY A;  2LJK A;  5D9W A;  5JWQ B;  2WB9 A;  3SBC A;  4KB3 A;  2OBI A;  4YKG A;  2HNL A;  1FAA A;  3CMI A;  1XBS A;  1ZMA A;  3TJK A;  4V2M A;  1GUM A;  1XW6 A;  2MZC A;  4XHM A;  4AKI A;  16GS A;  4PNF A;  3C71 A;  2TRC P;  3EYT A;  3RPP A;  4K7N A;  4PQI A;  4Z2U A;  3IHG A;  13GS A;  5B8B A;  3P7X A;  4JBB A;  2IIY A;  4MH2 A;  4TR1 A;  1UVZ A;  1K3Y A;  3PPU A;  5D9V A;  2GST A;  4IKH A;  4K9Z A;  4EKZ A;  1TTZ A;  4QL7 A;  1YY7 A;  2AV4 A;  5J4V A;  1RQM A;  1XZO A;  2YWI A;  3ZRD A;  5L71 A;  1FVJ A;  1EP7 A;  2OKA A;  3FHK A;  5E4W A;  1GSD A;  3ERG A;  4GCI A;  1GSF A;  1CQH A;  1TDI A;  2DIZ A;  3ED3 A;  5HR3 A;  1GUH A;  4YQU A;  3RHB A;  3FR9 A;  3D4T A;  2X8C A;  4IP1 A;  2F51 A;  5A1N B;  4X1U A;  2WS2 A;  3FR6 A;  1EGR A;  4TRX A;  5CAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...