4HZ4A

Crystal structure of glutathione s-transferase b4xh91 (target efi-501787) from actinobacillus pleuropneumoniae
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
215
structure length
215
Chain Sequence
MITLHYLKQSCSHRIVWLLEALGLDYELKIYDRLEGTGFAPEELKAQHPLGKAPVLQDGDLVLAEGNAIIQHLLDRYDTENRFTPAHKTDAYSNYVYWLAISASMFSANLLALVSKKGDLGDFAQYTNAQVGLYFSHVEKSLEGKTWIVGEQLTGADFALSFPLQWGLNYVNKADYPNITRYLEQIETHPAYLKANEKTDGGLDLSRFAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione-S-transferase
publication title Crystal structure of glutathione s-transferase b4xh91 from Actinobacillus pleuropneumoniae
rcsb
source organism Actinobacillus pleuropneumoniae
total genus 87
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4hz4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hz4A01
2P5QA 4IP6A 1B4PA 5CAXA 2R37A 1EOGA 5KN3A 4DVCA 4ISDA 4FQUA 5LD0A 3H4KA 6GSUA 3ERFA 4ZB8A 1VF2A 2F9SA 3QAGA 4BWQA 2H1GA 3EMPA 1NHYA 5D9VA 5ECKB 2H1BA 2Z9SA 2EIOA 1U3IA 4MJEA 3LORA 4K2DA 1UVZA 1YZXA 4D73A 2IN3A 4EC0A 1EV9A 3A2WA 4AF2A 1JLVA 3GHAA 5EPFA 1XW5A 2WRTA 2C0EA 2H1DA 1PKZA 5ID2A 2GQLA 5IMZA 4LMVA 4HEA2 1ACVA 5IMCA 3L9VA 2PGTA 3QPMA 3KGKA 3G7YA 2HSMB 2VIMA 2EIRA 2V2GA 4TR1A 4MABA 5IMDA 3A5WA 3J7Yk 2KHPA 4ZL7A 4RQRA 3FRCA 5HR2A 2QKEA 4WETA 4G0KA 5DDLA 2FA8A 3F4RA 3ZFBA 3ME8A 2WGRA 3HCZA 4EDZA 1QFNA 1MDJA 1FB0A 3UOMA 1V2AA 4L8EA 5A5KA 4JBBA 2FCHA 1EV4A 5G5FA 2WJUA 2B1KA 1K3LA 2H74A 3V1WA 1TRVA 4IHUA 5ECIB 1VF1A 1MD3A 3KZQA 3GKNA 2FD3A 2HSNB 3TKRA 4QL7A 1A24A 3GH9A 1HNBA 3QOUA 3ZYWA 2HRKB 2C0FA 3GX8A 1K0BA 3GNJA 4LA1A 1YQ1A 1TJDA 5IOXA 4RQXA 1GLQA 4EVMA 1A8LA 3APSA 3PR8A 2JADA 4LLRA 3QDNA 2IMEA 4OO4A 3TRPA 1URMA 3FR9A 1FB6A 3F6DA 3GA4A 2KP1A 3F0IA 4CDOA 4EF0A 3MAKA 5A4WA 2LJAA 2HI7A 1SYXA 1X9SB 1S3DA 1F3BA 1YEXA 3DVXA 3L0HA 2AAWA 1B8XA 1MEKA 3KH9A 4F2IA 2R4VA 1T8EB 5EY6A 1JZOA 1SD8A 4N11A 8GSSA 3FZ4A 4MP4A 1O81A 3KIJA 2PVQA 5JCWA 3FK8A 1DE1A 3KTBA 2C8UA 3IC4A 2F8FA 1S3AA 4HJMA 5FT3A 1WPIA 3OR5A 2YV7A 5JWOB 1X5DA 4IBPA 1UN2A 4YQMA 4K7IA 2NBSA 2HFDA 1GNWA 2J23A 1HNAA 2B1LA 4IJ3A 3D0ZA 3GSSA 3KD0A 5DJMA 4PX1A 3BOAA 1C72A 4V1Ag 3LXTA 4LL4B 3PGTA 3F3RA 4G0LA 1A2LA 1GP1A 1GSYA 4MJCA 3TUEA 5ID2B 1ZYEA 2BTOT 1GSEA 2CX3A 2LQOA 12GSA 1EWXA 1M2DA 3HDCA 1IYHA 2VLVA 3DYRA 4BWSA 2KP2A 1O85A 4N0ZA 1U3AA 4HQZA 4TR1B 2HE3A 5IQYA 1SK0A 1XW6A 4IJIA 1HYUA 3FZ5A 1Y25A 3BCIA 3GYKA 2DJ3A 1XWKA 1OC8A 3DMLA 1B48A 4TXVA 2HSHA 2O7KA 1PKWA 2VD0A 2IL3A 4Q5NA 4JEDA 4XRAA 3CRUA 5F0GA 2XC2A 2HZEA 1R4WA 2E0QA 3CSHA 2X8GA 1BEDA 2JZTA 5ECNB 2VL9A 4G10A 1GWCA 3D5JA 4XIHA 2I3YA 2H73A 1BYEA 2NDOA 1XCCA 3BCKA 4WBRD 2C3TA 4WEYA 1SKSB 4LMWA 3KJYA 4TW5A 3H8QA 1X9MB 3CTFA 3TJBA 1ZYQB 4O5RA 1G7OA 5KN1A 1F6MC 4PUFC 2KUCA 4V1Ap 3DRNA 5DALA 4JZQA 4F0BA 3VURA 5IMFA 2GSQA 4MLYA 1BAYA 4ZB9A 2MBTA 2YN1A 5JCGA 1ERUA 3RHBA 1SK2A 4MJAA 1PX6A 2X99A 3G7IA 5G1KA 5GZZB 4J2FA 3MWHA 3VK9A 5CRHA 3IK9A 4V2LA 1SKRB 4ECCA 4K7OA 4POLA 2ZUPA 4X43A 3A2XA 3UJ1A 4FYBA 2GVPA 1XVQA 3I6AA 1TRUA 3N9JA 1TI1A 3GSTA 2GTUA 1A2MA 4ML1A 3LYKA 1SJZA 5C04A 3KM6A 3CTGA 3Q18A 5F07A 2OE0A 4N0VA 1TDIA 4G0IA 1FOVA 7GSSA 2REMA 1NW2A 2YCDA 4KB3A 3FHKA 4JR6A 1ST9A 1TTZA 1T4YA 22GSA 5JCUA 3CRTA 4FIWA 2WS2A 4IELA 4GF0A 3J7Yb 1Q98A 4ZL8A 2YWMA 6GSTA 2MBSA 3MSZA 4NV2A 4WBJA 2NTOA 4PURA 1Z7PA 5GAND 3TKSC 4JR4A 5BMUA 2C3NA 5DAKB 1PQNA 14GSA 4DSSA 4J56E 4TRXA 2LKUA 4Q5RA 4GRFA 2O87A 1V98A 4MZCA 3DIEA 3LWAA 5IO2A 4IS0A 3SWLA 1XWBA 3TKSA 3HZ4A 5H5QA 4V2MA 4K0NA 1YF0A 4ZXGA 2KLXA 2P31A 3U5RE 2LTKA 2XHFA 3UBKA 4DEJA 2PMTA 2HNLA 1T7PB 2K9FA 3VWWA 1FHEA 1QK8A 3GMFA 2MMNA 3TOTA 2DJJA 1A0FA 4ECBA 2J9HA 5DVBA 3ERWA 2R3XA 10GSA 2CQ9A 2RM5A 5CYYA 2HLSA 3F8UA 4IVFA 4MPGA 3KEBA 5AN1A 2K18A 5DQYA 2CVDA 2B5XA 3UMAA 3UVHA 4PNGA 3DXBA 1MDIA 2VLTA 1OAZA 2PWJA 3GKXA 4OO5A 5A4VA 4HJ2A 4DSRA 1O8WA 2H0HA 3GFKA 1G7EA 4IGJA 3ME7A 4GXZA 1AXDA 2P5RA 4K6XA 4MPFA 3GL3A 2DJ2A 3EE2A 5COHA 4KCAA 3EWLA 5CP1A 4H86A 2DIYA 2GQMA 3GTUA 3S9FA 2VCTA 4AJ7A 4WR5A 2VD1A 1FO5A 1GSSA 1V58A 2DC5A 4KX4A 3TGZA 2L6CA 3M0FA 3LEFA 2LQQA 5J5NA 1XFLA 4EKZA 4Q5QA 2CT6A 4GTUA 1M7TA 3KP8A 1DBYA 1CQGA 4NHZA 3ED3A 3IAM2 1EEJA 1M2AA 3F3QA 2F51A 2DJ1A 1XXUA 2VCWA 1TU7A 4O32A 1VGLA 5KN0A 3EC3A 5F8BA 4MZWA 3F6FA 4IW9A 3UARA 1F9MA 3W8SA 5ECHB 3ZMKA 3I9V2 4MMMA 3TDGA 1XPVA 1O6JA 3FEUA 2JZSA 3U6VA 1GSDA 1PD21 1BG5A 4XS1A 2E2MA 1THXA 3D22A 5ECLB 4K9ZA 5INYA 3TJGA 3O6TA 1WMJA 5D96A 3IRAA 3WYWA 4POBA 1ZGNA 5LCZA 1J08A 3EMXA 1M2BA 2A2SA 2M80A 3L4NA 4TXOA 2H75A 3CBUA 3K8NA 2NVLA 3C1RA 3VI5A 1O7UA 1T1VA 5H5SA 5B6NA 3QCPA 3US3A 4TR4A 3L9SA 4GSSA 4NAXA 2O85A 2IFQA 4EUYA 4KDYA 2GDRA 1VF4A 1K0AA 1JZRA 2VCQA 2PERA 1GUKA 1EP8A 1SENA 5D9XA 1HD2A 4RUVA 3RDWA 3TKPA 1WOUA 1JFUA 2LNTA 1J0FA 1TK5B 5FWGA 3HA9A 4IN0A 4OD7A 1FW1A 2YWNA 1HNCA 1GNEA 4XRDA 1XBSA 1QQ2A 1Z3EA 3RBTA 1GTAA 4JE1A 5ELGA 3SBCA 4XCSA 3TJKA 1G0TA 1WIKA 4KDUA 3CSJA 2HRFA 3ZZXA 4L0UA 1EP7A 2X64A 1F37A 2V6OA 1BJXA 1AW9A 1T3BA 2IWTA 3KMNA 1G6YA 1F2EA 3VPTA 4G2EA 2ALBA 3ZFLA 4X1UA 5ECRB 2VCXA 3HY2A 4HQSA 3M8NA 1PA3A 3HZ8A 3APQA 2VM1A 4BPYA 2N5FA 1YEPA 3F63A 4GSTA 1E2YA 3NZNA 1RQMA 1GH2A 3IC8A 3IBHA 2I1UA 3FY7A 1TXXA 3KCMA 2DJ0A 3D4MA 2PN8A 2JSYA 1K0OA 1EOHA 5CNWA 2B7JA 1ERWA 3QMXA 1OYJA 5J4UA 1YJ6A 2ZCTA 4K8MA 1TKDB 2LJRA 2FUG2 2RUEA 3IAS2 4YQVA 2IMKA 2C3QA 4D73B 19GSA 2L59A 2CA8A 4KH7A 1GRXA 1HQOA 1I5GA 3TCOA 2M46A 5L71A 2H1AA 2WCIA 1JZDA 1XWCA 1GL8A 2B5YA 4NMUA 4ECJA 4JU5A 2XPDA 3C8EA 3IOSA 1GSFA 4ECIA 1GTUA 2GQKA 3IR4A 3H1NA 2IMIA 2LSTA 3F9UA 3IDVA 4YAPA 2FWFA 5DBQA 2TRCP 11GSA 2YNXA 2IJYA 1V9WA 4TXOB 5HR0A 17GSA 3MNGA 3D21A 4KF9A 2B7KA 3ZVJD 2D2ZA 2F8AA 3HJPA 3GURA 3VLNA 2TRXA 2GZYA 4ID0A 2CAQA 4CW9A 5AIVA 4MH3A 1OC9A 5F06A 4K1FA 1ILOA 3C73A 1H4OA 5C00A 5LNKe 1R5PA 4MA9A 1K3YA 5ELAA 2GZPA 2LRNA 5FHIA 1CQHA 3HHVA 5DQSA 1WE0A 4XTSA 5KEJA 1ERVA 4E8EA 2JL4A 1KTEA 2VCZA 4KE3A 3C71A 3DEXA 3TJJA 4BL7A 3I69A 3L78A 4HDEA 4G9HA 4NPBA 4OCFA 3R2QA 3NOFA 3WGDA 5J41A 5ECMB 2GT6A 5GAPD 1MTCA 1AUCA 1M99A 5D9TA 2VM2A 4F82A 1K0MA 1X0RA 1PGTA 3DGQA 18GSA 3IXRA 1EEMA 1NM3A 3E9JB 2OBKA 4NXIA 3ZRDA 2LUSA 2PBJA 4ZBDA 3IPZA 4MF7A 4EE0A 2OKAA 1TW9A 5B7CA 2AUVA 3M9KA 3ZREA 2RIIA 3W8JA 4DSQA 3HYPA 5J9BA 3LQ7A 4ZBAA 2ON7A 2HSYA 3QR6A 1O73A 2H76A 3DWVA 2GLRA 2H72A 2E7PA 1TI3A 1X9WB 2H19A 1Q4JA 4OCEA 1QUWA 5G30A 4KUNA 2UZ8A 3GKKA 2CX4A 2WZ9A 1NHOA 1FVJA 4IKHA 4TOPA 1SK1A 3EU4A 4FO5A 4HZ2A 3EURA 2M72A 2I81A 4WF4A 1OE7A 4I5QA 5HQPA 4RI6A 4GLTA 3ZIJA 4GCIA 3TJFA 2L4QA 4USSA 5CREA 2JACA 2GSTA 1YDKA 5ABRA 13GSA 5IO0A 1U88A 4KDXA 4KGIA 4POKA 2LRCA 2FWHA 3WD6A 1SL1B 5IOWA 2O8VB 2IPAA 2B5EA 2HZFA 1OE8A 4IQ1A 3H79A 1ZCPA 2HZEB 2VL2A 2FLSA 1TRWA 1WRYA 1PRXA 2EIQA 2DBCA 1OKTA 2VOCA 3APOA 2C80A 2IMDA 2ON5A 3E3EA 1DE2A 2YWIA 3IE3A 5IM9A 4HI7A 3R3EA 2OE3A 1A2JA 2H70A 2AB6A 4BVYA 1FG4A 3TKQA 2HYXA 2YV9A 3EU3A 4F0CA 3LYPA 2F3MA 1SD9A 3IK7A 2WULA 5DALB 3KH7A 5HFGA 2C0GA 2CZ3A 3QFBC 3GV1A 3LJRA 1ZOFA 2R5GA 2E2GA 2LS5A 4OFTA 1N8JA 3VPQA 1V57A 4GWRA 5E59A 3HJMA 4KNDA 6GSXA 1AQVA 4E8HA 2L5OA 3CSIA 1DSBA 5CRGA 2PPTA 2OE1A 4KA0A 2CV4A 2FA4A 2MMZA 2FGXA 3RPNA 1YKAA 2L57A 2H0GA 1VRSD 1TP9A 4MCUA 1YY7A 2CVBA 4WR4A 5CRWA 2RUFA 2CVKA 2AYTA 3KXOA 2VUPA 1I9DA 5B8AA 1A0RP 5JWRB 1GUHA 1B9YC 3LXZA 3ZMLA 1Y6EA 1BX9A 1Z6NA 5H5RA 5IMAA 2XPEA 1NSWA 2OA7A 2GZZA 3Q6OA 1TK0B 4MZBA 2K6VA 3GUSA 3H93A 1GSUA 4YAVA 1VF3A 4Q5FA 1SYRA 4MF6A 4KW6A 1PN9A 2FWEA 4WXTA 4QL9A 2WFCA 3Q19A 2FWGA 4EL1A 3GH6A 3HD5A 2MZCA 2FNOA 5G2ZA 1EZKA 2R2JA 4I2TA 1M9AA 4EXJA 4DSSB 5J3RA 5ENUA 5AGYA 5GSTA 4XS6A 4PGTA 4F03A 2QGVA 2HT9A 4N10A 2JU5A 4IQAA 1XWAA 3P90A 2LEGA 3LGCA 3AY8A 1QGVA 3IA1A 4HZ4A 2AHEA 2X8CA 1G6WA 5CRDA 3LG6A 1T00A 5IPGA 3HKRA 3GX0A 4BA7A 2VO4A 3LFLA 1K3OA 4TR3A 4O7HA 4EO3A 2PU9C 3KMOA 4HS1A 2H66A 2OADA 1SJIA 3F4SA 4NHWA 1SJ6A 3QAWA 5ECPB 5HR1A 4G19A 4K7NA 4L0WA 5GSSA 1ML6A 4HU7A 3ZL5A 1R5AA 4IP1A 4PNFA 1SL0B 3UIWA 5D8IA 3O3TA 2LRTA 5G5EA 3GL5A 4HOJA 5AIXA 1XWGA 4BVYB 4NWYA 2YWOA 2BMXA 1B4QA 4J57E 2GSSA 6GSSA 4ZL9A 3KTLA 3W6GA 2FY6A 1Z6MA 3LSZA 1ERTA 1E6BA 4XHMA 2FHEA 3HVVA 3FZ9A 1K0CA 3HVSA 4ILFA 3G7JA 1A23A 4FH8A 1KEBA 5DJLA 3UBLA 1Z5YE 4CHSA 3WGXA 1PL1A 2TIRA 3IV4A 3GTUB 2PVOC 1XOAA 2H30A 4I97A 2P0GA 2VLUA 1T4ZA 4F9ZA 2I9HA 2YJ7A 1ZL9A 2A2RA 4EDYA 3CMIA 2DMMA 3GKMA 3E0UA 4NV5A 4FYUA 1OVNA 1AAZA 1X5CA 3VFIA 3N5OA 1XVWA 2DJKA 3NIVA 2QC7A 2XBQA 2LV3A 1U87A 3ERGA 3D4TA 4FYCA 2YANA 3G9BA 3UVTA 4YQUA 3BD2A 4WF5A 2V1MA 2MYGA 2OBIA 2H71A 4TN8A 1RK4A 1XIYA 2GS3A 3RAZA 1K0DA 4TVEA 5IIZA 3EINA 4GQCA 2CAIA 3FR3A 20GSA 1PX7A 4K0GA 5J9CA 4PQHA 4YH2A 2YZUA 4PQIA 3GN3A 3IHQA 1AC1A 1QXHA 1QMVA 3P7XA 1KNGA 1R7HA 3WGEA 3PH9A 4MF5A 5D73A 3VWXA 1YKCA 4PXOA 1MDKA 2MMAA 1USBA 5HFIA 1JLWA 4LL1B 3PINA 1PL2A 4PTSA 2I4AA 3ISOA 1W4VA 3TKSE 2AV4A 1EGOA 1GTBA 3HXSA 3RPPA 2YOIA 3A2VA 3CXGA 3TOUA 4ULXA 1ZMAA 4Z7XA 3VWVA 2K8SA 1IYIA 2YJHA 4JRRA 5DAKA 4OWYA 3EYTA 1MD4A 5DCHA 4GQFA 5EL8A 1GULA 4XS4A 5ECOB 1A8YA 3FW2A 2H01A 4O92A 2IFQB 4QQ7A 2JSZA 1M0UA 3L9UA 5E4WA 4KSMA 4P3YB 2AJQB 1GUMA 2V32A 3M1GA 2CZ2A 2G2QA 3BBYA 3FR6A 2R6KA 1H75A 4BVXA 3HVXA 3F4TA 2IIYA 4KSOA 2ZNMA 3M9JA 1ZZYA 5IPHA 2HQTA 4X0XA 1GLPA 2V6KA 2LNSA 3C1SA 1OKDA 3BJ5A 4N30A 3UAPA 2WDUA 1LBKA 4WKWA 2DLXA 4TR0A 5G1LA 4AJ6A 3ZIVA 3UL3A 4I2UA 2H0IA 3DD3A 5DCGA 5JWQB 2BJXA 2C1YA 2YP6A 3WT2A 2H6XA 4MJBA 1ON4A 2B6MA 1JZWA 4RI7A 1V40A 4ACSA 2N5BA 2GSRA 5KN2A 1M9BA 1SL2B 2VAFA 3PPUA 1UA5A 1TRSA 1LU4A 2LJKA 2QSIA 4AJ8A 4L5OA 5D9WA 1TU8A 4ZILA 2A4VA 3DKSA 1Z7RA 2H6ZA 3QD9A 5A4UA 1XW9A 3HJOA 3EVIA 2NPBA 1WJKA 2XBIA 2KOKA 3P8WA 1RW1A 2RM6A 2C0DA 1THOA 4HUAA 1AQXA 3QFAC 4KCEA 3FZAA 1XOBA 3ZVJA 5CO3A 4PUAA 5G31A 4ML6A 3FYGA 4OFMA 2L6DA 2L4CA 3O76A 2B3SA 3UEMA 1S3CA 4MH2A 2H6YA 4OFNA 2DMLA 2GT5A 1TK8B 5HFKA 1B9XC 1DUGA 2JZRA 4L5LA 4MK3A 2VL2C 6GSYA 1W89A 3ZITA 5ECQB 3ZLPA 3RHCA 1BQ7A 2C4JA 3M3MA 2HXKA 2HSMA 2WB9A 3JCML 2GGTA 2EC4A 4XS4B 4TKYA 1F3AA 1GSQA 1Z9HA 4POMA 1FAAA 3TRQA 5B8BA 2H8LA 5EVOA 2O89A 4KAEA 1OC3A 4ZBBA 2MMOA 1OC9B 3KP9A 2L5LA 1JHBA 2VL3A 4ZB6A 3TB2A 3VI7A 1K0NA 1XZOA 4I8BA 2N5AA 2K8VA 5ECSA 2RLIA 1X5EA 2V41A 5F05A 1UC7A 2OJLA 3D6IA 3DVWA 1O8XA 1LJRA 2G0FA 4BVXB 1ABAA 1WWJA 1AIUA 4BL7B 2IMFA 1PMTA 1AQWA 4V2NA 5AISA 1J9BA 3VWUA 1KBNA 16GSA 1TOFA 1GTIA 1U6TA 9GSSA 4GSNA 2DIZA 2HRNA 3C7MA 2YZHA 3TRXA 2HRKA 1FVKA 2ES7A 4MDCA 2VCVA 3A3TA 3FKFA 4HU9A 5HR3A 5B6MA 4I6XA 2PUKC 3WT1A 6GSVA 3P2AA 4ZIJA 2HRAA 2YPMA 3CYNA 4PQ1A 3ZTLA 5IMVA 1WP0A 3MDKA 1N2AA 3QAVA 2DSAA 3Q74A 1EGRA 5D93A 3GIXA 1R26A 1SKWB 1YF1A 6GSWA 3I43A 4OMVA 3GRXA 1PSQA 1SU9A 2X8HA 4AGSA 2OACA
chains in the Genus database with same CATH superfamily
2P5QA 4IP6A 1B4PA 5CAXA 2R37A 1EOGA 5KN3A 4DVCA 4ISDA 4FQUA 5LD0A 3H4KA 6GSUA 3RFRC 4ICYA 3ERFA 4ZB8A 1VF2A 2F9SA 3QAGA 4BWQA 2H1GA 3EMPA 2A4HA 1NHYA 5D9VA 5ECKB 2H1BA 2Z9SA 2EIOA 1U3IA 4MJEA 3LORA 4K2DA 1UVZA 1YZXA 4D73A 2IN3A 4EC0A 1EV9A 3A2WA 4AF2A 1JLVA 3GHAA 5EPFA 1XW5A 2WRTA 2C0EA 2H1DA 1PKZA 5ID2A 2GQLA 5IMZA 4LMVA 4HEA2 1ACVA 5IMCA 3L9VA 2PGTA 3QPMA 3KGKA 3G7YA 2HSMB 2VIMA 2EIRA 2V2GA 4TR1A 4MABA 5IMDA 3A5WA 3J7Yk 2KHPA 4ZL7A 4RQRA 3FRCA 5HR2A 2QKEA 4WETA 4G0KA 5DDLA 2FA8A 3F4RA 3ZFBA 3ME8A 4K5RA 2WGRA 3HCZA 4EDZA 1QFNA 1MDJA 1FB0A 3UOMA 1V2AA 4L8EA 1BF5A 5A5KA 4JBBA 2FCHA 1EV4A 5G5FA 2WJUA 2B1KA 5A5HB 1K3LA 2H74A 3V1WA 1TRVA 4IHUA 5ECIB 1VF1A 1MD3A 3KZQA 3GKNA 2FD3A 2HSNB 3TKRA 4QL7A 1A24A 3GH9A 1HNBA 3QOUA 3ZYWA 2HRKB 2C0FA 3GX8A 1K0BA 3GNJA 4LA1A 1YQ1A 1TJDA 5IOXA 4RQXA 1GLQA 4EVMA 1A8LA 3APSA 3PR8A 2JADA 4LLRA 3QDNA 2IMEA 4OO4A 3TRPA 1URMA 3FR9A 1PN0A 1FB6A 3F6DA 3GA4A 2KP1A 3F0IA 4CDOA 4EF0A 3MAKA 5A4WA 2LJAA 2HI7A 1SYXA 1X9SB 1S3DA 1F3BA 1YEXA 3DVXA 4YKGA 3L0HA 2AAWA 1B8XA 1MEKA 3KH9A 4F2IA 2R4VA 1T8EB 5EY6A 1JZOA 1SD8A 4N11A 5BRTA 1BG1A 8GSSA 3FZ4A 4MP4A 1O81A 3KIJA 2PVQA 5JCWA 3FK8A 1DE1A 3KTBA 4EIPA 2C8UA 3IC4A 2F8FA 1S3AA 2WVZA 4HJMA 5FT3A 1WPIA 3OR5A 2YV7A 5JWOB 1X5DA 4IBPA 1UN2A 4YQMA 4K7IA 2NBSA 2HFDA 1GNWA 2J23A 1HNAA 2B1LA 4IJ3A 3D0ZA 3GSSA 3KD0A 5DJMA 1YVLA 4PX1A 3BOAA 1C72A 4V1Ag 3LXTA 1I1IP 4LL4B 3PGTA 3F3RA 4G0LA 1A2LA 1GP1A 1GSYA 4MJCA 3TUEA 5ID2B 1ZYEA 2BTOT 1GSEA 2CX3A 2LQOA 12GSA 1EWXA 1M2DA 3HDCA 1IYHA 2VLVA 3DYRA 4BWSA 2KP2A 1O85A 4N0ZA 1U3AA 2R0GA 4HQZA 4TR1B 2HE3A 5IQYA 1SK0A 1XW6A 4IJIA 1HYUA 3FZ5A 1Y25A 3BCIA 3GYKA 2DJ3A 1XWKA 1OC8A 3DMLA 1B48A 4TXVA 2HSHA 2O7KA 1PKWA 2VD0A 2IL3A 4Q5NA 4JEDA 4XRAA 3CRUA 5F0GA 2XC2A 2HZEA 1R4WA 2E0QA 3CSHA 2X8GA 1BEDA 2JZTA 1SVLA 5ECNB 1S3RA 2VL9A 4G10A 1GWCA 3D5JA 4XIHA 2I3YA 2H73A 1BYEA 2NDOA 1XCCA 4CY8A 3BCKA 4WBRD 2C3TA 4WEYA 1SKSB 4LMWA 3KJYA 4TW5A 3H8QA 1X9MB 3CTFA 3TJBA 1ZYQB 4O5RA 1G7OA 5KN1A 1F6MC 4PUFC 2KUCA 4V1Ap 3DRNA 5DALA 4JZQA 4F0BA 3VURA 5IMFA 2WW2A 2GSQA 4MLYA 1BAYA 4ZB9A 5J4YA 2MBTA 2YN1A 5JCGA 1ERUA 2OT3A 3RHBA 1SK2A 4MJAA 1PX6A 2X99A 3G7IA 5G1KA 5GZZB 4J2FA 3MWHA 3VK9A 5CRHA 3IK9A 4V2LA 1SKRB 4ECCA 4K7OA 4POLA 2ZUPA 4X43A 2DKIA 3A2XA 3UJ1A 4FYBA 2GVPA 1XVQA 3I6AA 1TRUA 3A5IA 3N9JA 1TI1A 5A34A 3GSTA 4W66A 2GTUA 1A2MA 4ML1A 3LYKA 1SJZA 5C04A 3KM6A 3CTGA 3Q18A 5F07A 2OE0A 4N0VA 1TDIA 4G0IA 1FOVA 7GSSA 2REMA 1NW2A 2YCDA 4KB3A 3FHKA 1Y1UA 4JR6A 1ST9A 1TTZA 1T4YA 22GSA 5JCUA 3CRTA 4FIWA 2WS2A 4IELA 4GF0A 3EPTA 3J7Yb 1Q98A 4ZL8A 4YKFA 2YWMA 6GSTA 2MBSA 3MSZA 4NV2A 4WBJA 2NTOA 1SVOA 4PURA 1Z7PA 5GAND 2H1LA 3TKSC 4JR4A 5BMUA 2C3NA 5DAKB 1PQNA 14GSA 4DSSA 3HVNA 4J56E 4TRXA 2LKUA 4Q5RA 4GRFA 2O87A 1V98A 4MZCA 3DIEA 3LWAA 5IO2A 4IS0A 3SWLA 1XWBA 3TKSA 1FOHA 3HZ4A 5H5QA 4V2MA 4K0NA 1YF0A 4ZXGA 2KLXA 2P31A 3U5RE 2LTKA 2XHFA 3UBKA 4DEJA 2PMTA 2HNLA 1T7PB 2K9FA 3VWWA 1FHEA 1QK8A 3GMFA 2MMNA 3TOTA 2DJJA 1A0FA 4ECBA 2J9HA 5DVBA 3ERWA 2R3XA 10GSA 2CQ9A 2RM5A 5CYYA 2HLSA 3F8UA 4IVFA 4MPGA 3KEBA 4O5QA 5AN1A 2K18A 5DQYA 2CVDA 2B5XA 3UMAA 3UVHA 4PNGA 3DXBA 1MDIA 2VLTA 1OAZA 2PWJA 3GKXA 4OO5A 5A4VA 4HJ2A 4DSRA 1O8WA 2H0HA 3GFKA 1G7EA 4IGJA 3ME7A 4GXZA 1AXDA 2P5RA 4K6XA 4MPFA 3GL3A 2DJ2A 3EE2A 5COHA 4KCAA 3EWLA 5CP1A 4H86A 2DIYA 2GQMA 3GTUA 3S9FA 2VCTA 2WVXB 4WR5A 4AJ7A 2VD1A 1FO5A 1GSSA 4CY6A 1V58A 2DC5A 4KX4A 3TGZA 2L6CA 3M0FA 3LEFA 2LQQA 5J5NA 1XFLA 4EKZA 4Q5QA 2CT6A 4GTUA 1M7TA 3KP8A 1DBYA 5A34B 1CQGA 4NHZA 3ED3A 3IAM2 1EEJA 1M2AA 3F3QA 2F51A 2DJ1A 1XXUA 2VCWA 1TU7A 4O32A 1VGLA 5KN0A 3EC3A 4BIKA 5F8BA 4MZWA 3F6FA 4IW9A 3UARA 1F9MA 3W8SA 5ECHB 3ZMKA 2R0PA 2EFEA 3I9V2 4MMMA 3TDGA 1XPVA 1O6JA 3FEUA 2JZSA 3U6VA 1GSDA 1PD21 1BG5A 4XS1A 2E2MA 1THXA 3D22A 4K5SA 5ECLB 4K9ZA 5INYA 2X4AA 3TJGA 3O6TA 1WMJA 5D96A 5BMUB 3IRAA 3WYWA 4POBA 1ZGNA 5LCZA 1M3IA 1J08A 3EMXA 1M2BA 2A2SA 2M80A 3L4NA 4TXOA 2H75A 3CBUA 3K8NA 2NVLA 3C1RA 3VI5A 1O7UA 1T1VA 5H5SA 5B6NA 3QCPA 3US3A 4TR4A 3L9SA 4GSSA 2WW3A 4NAXA 2O85A 2IFQA 4EUYA 4KDYA 2GDRA 1VF4A 1K0AA 1JZRA 2VCQA 2PERA 1GUKA 1EP8A 1SENA 5D9XA 1HD2A 4RUVA 3RDWA 3TKPA 1WOUA 1JFUA 2LNTA 1J0FA 1TK5B 5FWGA 3HA9A 4IN0A 4OD7A 1FW1A 2YWNA 1HNCA 1GNEA 2A2PA 4XRDA 1XBSA 1QQ2A 4N3ZA 1Z3EA 2EFHA 3RBTA 2O5VA 1GTAA 4JE1A 5ELGA 3SBCA 4XCSA 3TJKA 1G0TA 1WIKA 4KDUA 3CSJA 2HRFA 3ZZXA 4L0UA 1EP7A 2X64A 1F37A 2V6OA 1BJXA 1AW9A 1T3BA 2IWTA 3KMNA 1G6YA 1TXUA 1F2EA 2WW1A 3VPTA 4G2EA 2ALBA 3ZFLA 4X1UA 5ECRB 2VCXA 3HY2A 4HQSA 3M8NA 1PA3A 3HZ8A 3APQA 2VM1A 4BPYA 2N5FA 1YEPA 3F63A 4GSTA 1E2YA 3NZNA 1RQMA 1GH2A 3IC8A 3IBHA 2I1UA 3FY7A 1TXXA 3KCMA 2DJ0A 3D4MA 2PN8A 2JSYA 1K0OA 3CHXC 4AKGA 1EOHA 5CNWA 2B7JA 4AI6A 2O3EA 1ERWA 4G01A 3QMXA 1OYJA 5J4UA 1YJ6A 2ZCTA 4K8MA 1TKDB 2LJRA 2FUG2 2RUEA 3IAS2 4YQVA 2IMKA 2C3QA 4D73B 19GSA 2L59A 2CA8A 4KH7A 1GRXA 5J40A 1HQOA 1I5GA 3TCOA 2WVYA 4PI2C 2M46A 5L71A 2H1AA 2WCIA 1JZDA 1XWCA 1GL8A 2B5YA 4NMUA 4ECJA 4JU5A 2XPDA 3C8EA 3IOSA 1GSFA 4ECIA 1GTUA 2GQKA 3IR4A 3H1NA 1ZYPA 2IMIA 2LSTA 3F9UA 3IDVA 4YAPA 2WW0A 2FWFA 5DBQA 2TRCP 11GSA 2YNXA 2IJYA 1V9WA 4TXOB 5HR0A 17GSA 3MNGA 3D21A 4KF9A 2B7KA 3ZVJD 2D2ZA 2F8AA 3HJPA 3GURA 3VLNA 2TRXA 2GZYA 4ID0A 2CAQA 4CW9A 5AIVA 4MH3A 1OC9A 5F06A 4K1FA 1ILOA 3C73A 1H4OA 5C00A 5LNKe 1R5PA 4MA9A 4Z2UA 1K3YA 5ELAA 2GZPA 2LRNA 3RGBC 5FHIA 1CQHA 3HHVA 5DQSA 1WE0A 4XTSA 5KEJA 1ERVA 4E8EA 2JL4A 1KTEA 2VCZA 4KE3A 3C71A 3DEXA 3TJJA 4BL7A 3I69A 3L78A 4HDEA 4G9HA 4NPBA 4OCFA 3R2QA 3NOFA 3WGDA 5J41A 5ECMB 2GT6A 5GAPD 1MTCA 1AUCA 1M99A 5D9TA 2VM2A 4F82A 1K0MA 1X0RA 1PGTA 3DGQA 18GSA 1PFOA 3IXRA 1EEMA 1NM3A 3E9JB 2OBKA 4MNNA 4NXIA 3ZRDA 2LUSA 2PBJA 4ZBDA 4AKIA 3IPZA 4MF7A 4EE0A 2OKAA 1TW9A 5B7CA 2AUVA 3M9KA 3ZREA 2RIIA 3W8JA 4DSQA 3HYPA 5J9BA 3LQ7A 4ZBAA 2ON7A 2HSYA 4E68A 3QR6A 1O73A 2H76A 3DWVA 2GLRA 2H72A 2E7PA 1TI3A 1X9WB 2H19A 1Q4JA 4OCEA 1QUWA 5G30A 4KUNA 2UZ8A 3GKKA 2CX4A 2WZ9A 1NHOA 1FVJA 4IKHA 4TOPA 1SK1A 3EU4A 4FO5A 4HZ2A 3EURA 2M72A 2I81A 4WF4A 1OE7A 4I5QA 4HSCX 5HQPA 4RI6A 4GLTA 3ZIJA 4GCIA 3TJFA 2L4QA 4USSA 5CREA 2JACA 2GSTA 1YDKA 5ABRA 13GSA 5IO0A 1U88A 4KDXA 4KGIA 4POKA 2LRCA 2FWHA 3WD6A 1SL1B 5IOWA 2O8VB 2IPAA 2B5EA 2HZFA 1OE8A 4IQ1A 3H79A 1ZCPA 2HZEB 2VL2A 2FLSA 1TRWA 1WRYA 1PRXA 2EIQA 2DBCA 1OKTA 2VOCA 4K2XA 3APOA 2C80A 2IMDA 2ON5A 3E3EA 1DE2A 2YWIA 3IE3A 5IM9A 4HI7A 3R3EA 2OE3A 1A2JA 2H70A 2AB6A 4BVYA 1FG4A 3TKQA 2HYXA 2YV9A 3EU3A 4F0CA 3LYPA 2F3MA 1SD9A 3IK7A 2WULA 5DALB 3KH7A 5HFGA 2C0GA 2CZ3A 3QFBC 3GV1A 3LJRA 1ZOFA 2R5GA 2E2GA 2LS5A 4OFTA 1N8JA 3VPQA 1V57A 4GWRA 5E59A 3HJMA 4KNDA 6GSXA 4Z2RA 1AQVA 4E8HA 2L5OA 3CSIA 1DSBA 5CRGA 5J47A 2PPTA 2OE1A 4KA0A 2CV4A 2FA4A 2MMZA 4O5UA 2FGXA 3RPNA 1YKAA 2L57A 2H0GA 2QA2A 1VRSD 1TP9A 4MCUA 1YY7A 2CVBA 4WR4A 5J4VA 5CRWA 2RUFA 2CVKA 2AYTA 3KXOA 2VUPA 1I9DA 5B8AA 1A0RP 5JWRB 1GUHA 1B9YC 4X4JA 3LXZA 3ZMLA 1Y6EA 1BX9A 1Z6NA 5H5RA 5IMAA 2XPEA 1NSWA 2OA7A 2GZZA 3Q6OA 1TK0B 4MZBA 2K6VA 3GUSA 3H93A 1GSUA 4YAVA 2EFCA 1VF3A 4Q5FA 1SYRA 4MF6A 4KW6A 1PN9A 4PHZC 2FWEA 4WXTA 5A1NA 4QL9A 2WFCA 3Q19A 2FWGA 4EL1A 3GH6A 3HD5A 2MZCA 2FNOA 4ZB7A 2QA1A 5G2ZA 1EZKA 2R2JA 4I2TA 1M9AA 4EXJA 4DSSB 5J3RA 5ENUA 5AGYA 5GSTA 4XS6A 4PGTA 4F03A 2QGVA 2HT9A 4N10A 2JU5A 4IQAA 1XWAA 3P90A 2LEGA 3LGCA 3AY8A 1QGVA 3IA1A 4HZ4A 2AHEA 2X8CA 1G6WA 5CRDA 3LG6A 1T00A 5IPGA 3HKRA 3GX0A 4BA7A 2VO4A 3LFLA 1K3OA 4TR3A 2R0CA 4O7HA 4EO3A 2PU9C 3KMOA 4HS1A 2H66A 1N25A 2OADA 1SJIA 3F4SA 4NHWA 1SJ6A 3QAWA 5ECPB 5HR1A 4G19A 4K7NA 4L0WA 5GSSA 1ML6A 4HU7A 3ZL5A 1R5AA 4IP1A 4PNFA 1SL0B 3UIWA 5D8IA 3O3TA 2LRTA 5G5EA 3GL5A 4HOJA 5AIXA 1XWGA 4BVYB 4NWYA 2YWOA 2BMXA 1B4QA 4J57E 2GSSA 6GSSA 4ZL9A 3KTLA 3W6GA 2FY6A 1Z6MA 3LSZA 1ERTA 1E6BA 4XHMA 2FHEA 3HVVA 3FZ9A 1K0CA 3HVSA 4ILFA 4GDFA 3G7JA 1A23A 4FH8A 1KEBA 5DJLA 3UBLA 1Z5YE 4CHSA 3WGXA 1PL1A 2TIRA 3IV4A 3GTUB 2PVOC 1XOAA 2H30A 4I97A 2P0GA 2VLUA 1T4ZA 4F9ZA 2I9HA 2YJ7A 1ZL9A 2A2RA 4EDYA 3CMIA 2DMMA 3GKMA 3E0UA 4NV5A 4FYUA 1OVNA 1AAZA 2WZSA 1X5CA 3VFIA 3N5OA 3LW9A 1XVWA 2DJKA 3NIVA 2QC7A 2XBQA 2LV3A 1U87A 3ERGA 3D4TA 4FYCA 2YANA 3G9BA 3UVTA 4YQUA 3BD2A 4WF5A 1M3JA 2V1MA 2MYGA 2OBIA 2H71A 4TN8A 1RK4A 1XIYA 2GS3A 3RAZA 1K0DA 4TVEA 5IIZA 3EINA 4GQCA 2CAIA 3FR3A 20GSA 1PX7A 4K0GA 5J9CA 4PQHA 2UV8G 4YH2A 2YZUA 4PQIA 3GN3A 3IHQA 1AC1A 1QXHA 1QMVA 3P7XA 2VKZG 1KNGA 1R7HA 5A1NB 3WGEA 3PH9A 4MF5A 5D73A 3VWXA 1YKCA 4PXOA 1MDKA 2MMAA 1USBA 5HFIA 1JLWA 4LL1B 3PINA 1ZYNA 1PL2A 4PTSA 2I4AA 3ISOA 1W4VA 1YEWC 3TKSE 2AV4A 1EGOA 1GTBA 3HXSA 3RPPA 2YOIA 2DKHA 3A2VA 3CXGA 3TOUA 4ULXA 1ZMAA 4Z7XA 3VWVA 2K8SA 1IYIA 2YJHA 4JRRA 5DAKA 4OWYA 3EYTA 1MD4A 5DCHA 4GQFA 5EL8A 1GULA 4XS4A 5ECOB 4AKHA 1A8YA 3FW2A 2H01A 4O92A 2IFQB 4QQ7A 2JSZA 5KOXA 3MIXA 1M0UA 3L9UA 5E4WA 4KSMA 1XG8A 4P3YB 2AJQB 1GUMA 2V32A 3M1GA 2CZ2A 2G2QA 3BBYA 3FR6A 2R6KA 1H75A 4BVXA 3HVXA 3F4TA 2IIYA 4KSOA 2ZNMA 3M9JA 1ZZYA 5IPHA 2HQTA 4X0XA 1GLPA 2V6KA 2LNSA 3C1SA 1OKDA 3BJ5A 4N30A 3UAPA 2WDUA 1LBKA 4WKWA 1S4BP 2DLXA 4TR0A 5G1LA 4AJ6A 3ZIVA 3UL3A 4I2UA 2H0IA 3DD3A 5DCGA 5JWQB 2BJXA 4Z2TA 2C1YA 2YP6A 3WT2A 2H6XA 2X49A 4MJBA 1ON4A 2B6MA 2O36A 1JZWA 2WVXA 4RI7A 1V40A 3TU3B 4ACSA 2N5BA 4A5PA 2GSRA 5KN2A 1M9BA 1SL2B 2VAFA 3PPUA 1UA5A 1TRSA 1LU4A 2LJKA 2QSIA 4AJ8A 4L5OA 5D9WA 1TU8A 4ZILA 2A4VA 3DKSA 1Z7RA 2H6ZA 3QD9A 3CQFA 5A4UA 1XW9A 3HJOA 3MYDA 3EVIA 2NPBA 1WJKA 2XBIA 2KOKA 3P8WA 1RW1A 2RM6A 2C0DA 1THOA 4HUAA 1AQXA 3QFAC 4KCEA 3FZAA 1XOBA 3ZVJA 5CO3A 4PUAA 5G31A 4ML6A 3FYGA 4OFMA 2L6DA 2L4CA 3O76A 2B3SA 3UEMA 1S3CA 4MH2A 2H6YA 4OFNA 2EFDA 2DMLA 2GT5A 1TK8B 5HFKA 1B9XC 1DUGA 2JZRA 4L5LA 4MK3A 3FMWA 2VL2C 6GSYA 1W89A 3ZITA 5ECQB 3ZLPA 3IHGA 3RHCA 1BQ7A 2C4JA 3M3MA 2HXKA 2HSMA 2WB9A 3JCML 2GGTA 2EC4A 4XS4B 4TKYA 1F3AA 1GSQA 1Z9HA 4POMA 1FAAA 3TRQA 5B8BA 2H8LA 5EVOA 2O89A 4KAEA 1OC3A 4ZBBA 2MMOA 1OC9B 3KP9A 2L5LA 1JHBA 2VL3A 4ZB6A 3TB2A 3VI7A 1K0NA 1XZOA 4I8BA 2N5AA 2K8VA 5ECSA 2RLIA 1X5EA 2V41A 5F05A 1UC7A 2OJLA 3D6IA 3DVWA 1O8XA 1LJRA 2G0FA 4BVXB 1ABAA 4PI0C 1WWJA 1AIUA 5A5HA 4BL7B 2IMFA 1PMTA 1AQWA 4V2NA 5AISA 1J9BA 3VWUA 1KBNA 16GSA 1TOFA 1GTIA 3HMJG 1U6TA 2HSNA 9GSSA 4GSNA 2DIZA 2HRNA 3C7MA 2YZHA 3TRXA 2HRKA 1FVKA 2ES7A 4MDCA 2VCVA 3A3TA 3FKFA 4HU9A 1SVMA 5HR3A 5B6MA 4I6XA 2PUKC 3WT1A 6GSVA 3P2AA 4ZIJA 2HRAA 2YPMA 3CYNA 3CWGA 4EIQA 4PQ1A 3ZTLA 5IMVA 1WP0A 3MDKA 1N2AA 3QAVA 2DSAA 3Q74A 4FXYP 5KOWA 1EGRA 5D93A 3GIXA 4AKXB 1R26A 1SKWB 1YF1A 6GSWA 3I43A 4QMKA 4OMVA 3GRXA 1PSQA 1SU9A 2X8HA 4AGSA 2OACA
chains in the Genus database with same CATH topology
2P5QA 4IP6A 1B4PA 5CAXA 2R37A 1EOGA 5KN3A 4DVCA 4ISDA 4FQUA 5LD0A 3H4KA 6GSUA 4ICYA 3ERFA 4ZB8A 1VF2A 2F9SA 3QAGA 4BWQA 2H1GA 3EMPA 2A4HA 1NHYA 5D9VA 5ECKB 2H1BA 2Z9SA 2EIOA 1U3IA 4MJEA 3LORA 4K2DA 1UVZA 1YZXA 4D73A 2IN3A 4EC0A 1EV9A 3A2WA 4AF2A 1JLVA 3GHAA 5EPFA 1XW5A 2WRTA 2C0EA 2H1DA 1PKZA 5ID2A 2GQLA 5IMZA 4LMVA 4HEA2 1ACVA 5IMCA 3L9VA 2PGTA 3QPMA 3KGKA 3G7YA 2HSMB 2VIMA 2EIRA 2V2GA 4TR1A 4MABA 5IMDA 3A5WA 3J7Yk 2KHPA 4ZL7A 4RQRA 3FRCA 5HR2A 2QKEA 4WETA 4G0KA 5DDLA 2FA8A 3F4RA 3ZFBA 3ME8A 4K5RA 2WGRA 3HCZA 4EDZA 1QFNA 1MDJA 1FB0A 3UOMA 1V2AA 4L8EA 1BF5A 5A5KA 4JBBA 2FCHA 1EV4A 5G5FA 2WJUA 2B1KA 5A5HB 1K3LA 2H74A 3V1WA 1TRVA 4IHUA 5ECIB 1VF1A 1MD3A 3KZQA 3GKNA 2FD3A 2HSNB 3TKRA 4QL7A 1A24A 3GH9A 1HNBA 3QOUA 3ZYWA 2HRKB 2C0FA 3GX8A 1K0BA 3GNJA 4LA1A 1YQ1A 1TJDA 5IOXA 4RQXA 1GLQA 4EVMA 1A8LA 3APSA 3PR8A 2JADA 4LLRA 3QDNA 2IMEA 4OO4A 3TRPA 1URMA 3FR9A 1PN0A 1FB6A 3F6DA 3GA4A 2KP1A 3F0IA 4CDOA 4EF0A 3MAKA 5A4WA 2LJAA 2HI7A 1SYXA 1X9SB 1S3DA 1F3BA 1YEXA 3DVXA 4YKGA 3L0HA 2AAWA 1B8XA 1MEKA 3KH9A 4F2IA 2R4VA 1T8EB 5EY6A 1JZOA 1SD8A 4N11A 5BRTA 1BG1A 8GSSA 3FZ4A 4MP4A 1O81A 3KIJA 2PVQA 5JCWA 3FK8A 1DE1A 3KTBA 4EIPA 2C8UA 3IC4A 2F8FA 1S3AA 4HJMA 5FT3A 1WPIA 3OR5A 2YV7A 5JWOB 1X5DA 4IBPA 1UN2A 4YQMA 4K7IA 2NBSA 2HFDA 1GNWA 2J23A 1HNAA 2B1LA 4IJ3A 3D0ZA 3GSSA 3KD0A 5DJMA 1YVLA 4PX1A 3BOAA 1C72A 4V1Ag 3LXTA 4LL4B 3PGTA 3F3RA 4G0LA 1A2LA 1GP1A 1GSYA 4MJCA 3TUEA 5ID2B 1ZYEA 2BTOT 1GSEA 2CX3A 2LQOA 12GSA 1EWXA 1M2DA 3HDCA 1IYHA 2VLVA 3DYRA 4BWSA 2KP2A 1O85A 4N0ZA 1U3AA 2R0GA 4HQZA 4TR1B 2HE3A 5IQYA 1SK0A 1XW6A 4IJIA 1HYUA 3FZ5A 1Y25A 3BCIA 3GYKA 2DJ3A 1XWKA 1OC8A 3DMLA 1B48A 4TXVA 2HSHA 2O7KA 1PKWA 2VD0A 2IL3A 4Q5NA 4JEDA 4XRAA 3CRUA 5F0GA 2XC2A 2HZEA 1R4WA 2E0QA 3CSHA 2X8GA 1BEDA 2JZTA 1SVLA 5ECNB 2VL9A 4G10A 1GWCA 3D5JA 4XIHA 2I3YA 2H73A 1BYEA 2NDOA 1XCCA 4CY8A 3BCKA 4WBRD 2C3TA 4WEYA 1SKSB 4LMWA 3KJYA 4TW5A 3H8QA 1X9MB 3CTFA 3TJBA 1ZYQB 4O5RA 1G7OA 5KN1A 1F6MC 4PUFC 2KUCA 4V1Ap 3DRNA 5DALA 4JZQA 4F0BA 3VURA 5IMFA 2GSQA 4MLYA 1BAYA 4ZB9A 5J4YA 2MBTA 2YN1A 5JCGA 1ERUA 2OT3A 3RHBA 1SK2A 4MJAA 1PX6A 2X99A 3G7IA 5G1KA 5GZZB 4J2FA 3MWHA 3VK9A 5CRHA 3IK9A 4V2LA 1SKRB 4ECCA 4K7OA 4POLA 2ZUPA 4X43A 2DKIA 3A2XA 3UJ1A 4FYBA 2GVPA 1XVQA 3I6AA 1TRUA 3A5IA 3N9JA 1TI1A 5A34A 3GSTA 4W66A 2GTUA 1A2MA 4ML1A 3LYKA 1SJZA 5C04A 3KM6A 3CTGA 3Q18A 5F07A 2OE0A 4N0VA 1TDIA 4G0IA 1FOVA 7GSSA 2REMA 1NW2A 2YCDA 4KB3A 3FHKA 1Y1UA 4JR6A 1ST9A 1TTZA 1T4YA 22GSA 5JCUA 3CRTA 4FIWA 2WS2A 4IELA 4GF0A 3EPTA 3J7Yb 1Q98A 4ZL8A 4YKFA 2YWMA 6GSTA 2MBSA 3MSZA 4NV2A 4WBJA 2NTOA 1SVOA 4PURA 1Z7PA 5GAND 2H1LA 3TKSC 4JR4A 5BMUA 2C3NA 5DAKB 1PQNA 14GSA 4DSSA 4J56E 4TRXA 2LKUA 4Q5RA 4GRFA 2O87A 1V98A 4MZCA 3DIEA 3LWAA 5IO2A 4IS0A 3SWLA 1XWBA 3TKSA 1FOHA 3HZ4A 5H5QA 4V2MA 4K0NA 1YF0A 4ZXGA 2KLXA 2P31A 3U5RE 2LTKA 2XHFA 3UBKA 4DEJA 2PMTA 2HNLA 1T7PB 2K9FA 3VWWA 1FHEA 1QK8A 3GMFA 2MMNA 3TOTA 2DJJA 1A0FA 4ECBA 2J9HA 5DVBA 3ERWA 2R3XA 10GSA 2CQ9A 2RM5A 5CYYA 2HLSA 3F8UA 4IVFA 4MPGA 3KEBA 4O5QA 5AN1A 2K18A 5DQYA 2CVDA 2B5XA 3UMAA 3UVHA 4PNGA 3DXBA 1MDIA 2VLTA 1OAZA 2PWJA 3GKXA 4OO5A 5A4VA 4HJ2A 4DSRA 1O8WA 2H0HA 3GFKA 1G7EA 4IGJA 3ME7A 4GXZA 1AXDA 2P5RA 4K6XA 4MPFA 3GL3A 2DJ2A 3EE2A 5COHA 4KCAA 3EWLA 5CP1A 4H86A 2DIYA 2GQMA 3GTUA 3S9FA 2VCTA 4AJ7A 4WR5A 2VD1A 1FO5A 1GSSA 4CY6A 1V58A 2DC5A 4KX4A 3TGZA 2L6CA 3M0FA 3LEFA 2LQQA 5J5NA 1XFLA 4EKZA 4Q5QA 2CT6A 4GTUA 1M7TA 3KP8A 1DBYA 5A34B 1CQGA 4NHZA 3ED3A 3IAM2 1EEJA 1M2AA 3F3QA 2F51A 2DJ1A 1XXUA 2VCWA 1TU7A 4O32A 1VGLA 5KN0A 3EC3A 5F8BA 4MZWA 3F6FA 4IW9A 3UARA 1F9MA 3W8SA 5ECHB 3ZMKA 2R0PA 2EFEA 3I9V2 4MMMA 3TDGA 1XPVA 1O6JA 3FEUA 2JZSA 3U6VA 1GSDA 1PD21 1BG5A 4XS1A 2E2MA 1THXA 3D22A 4K5SA 5ECLB 4K9ZA 5INYA 2X4AA 3TJGA 3O6TA 1WMJA 5D96A 5BMUB 3IRAA 3WYWA 4POBA 1ZGNA 5LCZA 1J08A 3EMXA 1M2BA 2A2SA 2M80A 3L4NA 4TXOA 2H75A 3CBUA 3K8NA 2NVLA 3C1RA 3VI5A 1O7UA 1T1VA 5H5SA 5B6NA 3QCPA 3US3A 4TR4A 3L9SA 4GSSA 4NAXA 2O85A 2IFQA 4EUYA 4KDYA 2GDRA 1VF4A 1K0AA 1JZRA 2VCQA 2PERA 1GUKA 1EP8A 1SENA 5D9XA 1HD2A 4RUVA 3RDWA 3TKPA 1WOUA 1JFUA 2LNTA 1J0FA 1TK5B 5FWGA 3HA9A 4IN0A 4OD7A 1FW1A 2YWNA 1HNCA 1GNEA 2A2PA 4XRDA 1XBSA 1QQ2A 4N3ZA 1Z3EA 2EFHA 3RBTA 2O5VA 1GTAA 4JE1A 5ELGA 3SBCA 4XCSA 3TJKA 1G0TA 1WIKA 4KDUA 3CSJA 2HRFA 3ZZXA 4L0UA 1EP7A 2X64A 1F37A 2V6OA 1BJXA 1AW9A 1T3BA 2IWTA 3KMNA 1G6YA 1TXUA 1F2EA 3VPTA 4G2EA 2ALBA 3ZFLA 4X1UA 5ECRB 2VCXA 3HY2A 4HQSA 3M8NA 1PA3A 3HZ8A 3APQA 2VM1A 4BPYA 2N5FA 1YEPA 3F63A 4GSTA 1E2YA 3NZNA 1RQMA 1GH2A 3IC8A 3IBHA 2I1UA 3FY7A 1TXXA 3KCMA 2DJ0A 3D4MA 2PN8A 2JSYA 1K0OA 4AKGA 1EOHA 5CNWA 2B7JA 4AI6A 1ERWA 4G01A 3QMXA 1OYJA 5J4UA 1YJ6A 2ZCTA 4K8MA 1TKDB 2LJRA 2FUG2 2RUEA 3IAS2 4YQVA 2IMKA 2C3QA 4D73B 19GSA 2L59A 2CA8A 4KH7A 1GRXA 5J40A 1HQOA 1I5GA 3TCOA 2M46A 5L71A 2H1AA 2WCIA 1JZDA 1XWCA 1GL8A 2B5YA 4NMUA 4ECJA 4JU5A 2XPDA 3C8EA 3IOSA 1GSFA 4ECIA 1GTUA 2GQKA 3IR4A 3H1NA 1ZYPA 2IMIA 2LSTA 3F9UA 3IDVA 4YAPA 2FWFA 5DBQA 2TRCP 11GSA 2YNXA 2IJYA 1V9WA 4TXOB 5HR0A 17GSA 3MNGA 3D21A 4KF9A 2B7KA 3ZVJD 2D2ZA 2F8AA 3HJPA 3GURA 3VLNA 2TRXA 2GZYA 4ID0A 2CAQA 4CW9A 5AIVA 4MH3A 1OC9A 5F06A 4K1FA 1ILOA 3C73A 1H4OA 5C00A 5LNKe 1R5PA 4MA9A 4Z2UA 1K3YA 5ELAA 2GZPA 2LRNA 5FHIA 1CQHA 3HHVA 5DQSA 1WE0A 4XTSA 5KEJA 1ERVA 4E8EA 2JL4A 1KTEA 2VCZA 4KE3A 3C71A 3DEXA 3TJJA 4BL7A 3I69A 3L78A 4HDEA 4G9HA 4NPBA 4OCFA 3R2QA 3NOFA 3WGDA 5J41A 5ECMB 2GT6A 5GAPD 1MTCA 1AUCA 1M99A 5D9TA 2VM2A 4F82A 1K0MA 1X0RA 1PGTA 3DGQA 18GSA 3IXRA 1EEMA 1NM3A 3E9JB 2OBKA 4MNNA 4NXIA 3ZRDA 2LUSA 2PBJA 4ZBDA 4AKIA 3IPZA 4MF7A 4EE0A 2OKAA 1TW9A 5B7CA 2AUVA 3M9KA 3ZREA 2RIIA 3W8JA 4DSQA 3HYPA 5J9BA 3LQ7A 4ZBAA 2ON7A 2HSYA 4E68A 3QR6A 1O73A 2H76A 3DWVA 2GLRA 2H72A 2E7PA 1TI3A 1X9WB 2H19A 1Q4JA 4OCEA 1QUWA 5G30A 4KUNA 2UZ8A 3GKKA 2CX4A 2WZ9A 1NHOA 1FVJA 4IKHA 4TOPA 1SK1A 3EU4A 4FO5A 4HZ2A 3EURA 2M72A 2I81A 4WF4A 1OE7A 4I5QA 5HQPA 4RI6A 4GLTA 3ZIJA 4GCIA 3TJFA 2L4QA 4USSA 5CREA 2JACA 2GSTA 1YDKA 5ABRA 13GSA 5IO0A 1U88A 4KDXA 4KGIA 4POKA 2LRCA 2FWHA 3WD6A 1SL1B 5IOWA 2O8VB 2IPAA 2B5EA 2HZFA 1OE8A 4IQ1A 3H79A 1ZCPA 2HZEB 2VL2A 2FLSA 1TRWA 1WRYA 1PRXA 2EIQA 2DBCA 1OKTA 2VOCA 4K2XA 3APOA 2C80A 2IMDA 2ON5A 3E3EA 1DE2A 2YWIA 3IE3A 5IM9A 4HI7A 3R3EA 2OE3A 1A2JA 2H70A 2AB6A 4BVYA 1FG4A 3TKQA 2HYXA 2YV9A 3EU3A 4F0CA 3LYPA 2F3MA 1SD9A 3IK7A 2WULA 5DALB 3KH7A 5HFGA 2C0GA 2CZ3A 3QFBC 3GV1A 3LJRA 1ZOFA 2R5GA 2E2GA 2LS5A 4OFTA 1N8JA 3VPQA 1V57A 4GWRA 5E59A 3HJMA 4KNDA 6GSXA 4Z2RA 1AQVA 4E8HA 2L5OA 3CSIA 1DSBA 5CRGA 5J47A 2PPTA 2OE1A 4KA0A 2CV4A 2FA4A 2MMZA 4O5UA 2FGXA 3RPNA 1YKAA 2L57A 2H0GA 2QA2A 1VRSD 1TP9A 4MCUA 1YY7A 2CVBA 4WR4A 5J4VA 5CRWA 2RUFA 2CVKA 2AYTA 3KXOA 2VUPA 1I9DA 5B8AA 1A0RP 5JWRB 1GUHA 1B9YC 4X4JA 3LXZA 3ZMLA 1Y6EA 1BX9A 1Z6NA 5H5RA 5IMAA 2XPEA 1NSWA 2OA7A 2GZZA 3Q6OA 1TK0B 4MZBA 2K6VA 3GUSA 3H93A 1GSUA 4YAVA 2EFCA 1VF3A 4Q5FA 1SYRA 4MF6A 4KW6A 1PN9A 2FWEA 4WXTA 5A1NA 4QL9A 2WFCA 3Q19A 2FWGA 4EL1A 3GH6A 3HD5A 2MZCA 2FNOA 4ZB7A 2QA1A 5G2ZA 1EZKA 2R2JA 4I2TA 1M9AA 4EXJA 4DSSB 5J3RA 5ENUA 5AGYA 5GSTA 4XS6A 4PGTA 4F03A 2QGVA 2HT9A 4N10A 2JU5A 4IQAA 1XWAA 3P90A 2LEGA 3LGCA 3AY8A 1QGVA 3IA1A 4HZ4A 2AHEA 2X8CA 1G6WA 5CRDA 3LG6A 1T00A 5IPGA 3HKRA 3GX0A 4BA7A 2VO4A 3LFLA 1K3OA 4TR3A 2R0CA 4O7HA 4EO3A 2PU9C 3KMOA 4HS1A 2H66A 1N25A 2OADA 1SJIA 3F4SA 4NHWA 1SJ6A 3QAWA 5ECPB 5HR1A 4G19A 4K7NA 4L0WA 5GSSA 1ML6A 4HU7A 3ZL5A 1R5AA 4IP1A 4PNFA 1SL0B 3UIWA 5D8IA 3O3TA 2LRTA 5G5EA 3GL5A 4HOJA 5AIXA 1XWGA 4BVYB 4NWYA 2YWOA 2BMXA 1B4QA 4J57E 2GSSA 6GSSA 4ZL9A 3KTLA 3W6GA 2FY6A 1Z6MA 3LSZA 1ERTA 1E6BA 4XHMA 2FHEA 3HVVA 3FZ9A 1K0CA 3HVSA 4ILFA 4GDFA 3G7JA 1A23A 4FH8A 1KEBA 5DJLA 3UBLA 1Z5YE 4CHSA 3WGXA 1PL1A 2TIRA 3IV4A 3GTUB 2PVOC 1XOAA 2H30A 4I97A 2P0GA 2VLUA 1T4ZA 4F9ZA 2I9HA 2YJ7A 1ZL9A 2A2RA 4EDYA 3CMIA 2DMMA 3GKMA 3E0UA 4NV5A 4FYUA 1OVNA 1AAZA 1X5CA 3VFIA 3N5OA 3LW9A 1XVWA 2DJKA 3NIVA 2QC7A 2XBQA 2LV3A 1U87A 3ERGA 3D4TA 4FYCA 2YANA 3G9BA 3UVTA 4YQUA 3BD2A 4WF5A 2V1MA 2MYGA 2OBIA 2H71A 4TN8A 1RK4A 1XIYA 2GS3A 3RAZA 1K0DA 4TVEA 5IIZA 3EINA 4GQCA 2CAIA 3FR3A 20GSA 1PX7A 4K0GA 5J9CA 4PQHA 2UV8G 4YH2A 2YZUA 4PQIA 3GN3A 3IHQA 1AC1A 1QXHA 1QMVA 3P7XA 2VKZG 1KNGA 1R7HA 5A1NB 3WGEA 3PH9A 4MF5A 5D73A 3VWXA 1YKCA 4PXOA 1MDKA 2MMAA 1USBA 5HFIA 1JLWA 4LL1B 3PINA 1ZYNA 1PL2A 4PTSA 2I4AA 3ISOA 1W4VA 3TKSE 2AV4A 1EGOA 1GTBA 3HXSA 3RPPA 2YOIA 2DKHA 3A2VA 3CXGA 3TOUA 4ULXA 1ZMAA 4Z7XA 3VWVA 2K8SA 1IYIA 2YJHA 4JRRA 5DAKA 4OWYA 3EYTA 1MD4A 5DCHA 4GQFA 5EL8A 1GULA 4XS4A 5ECOB 4AKHA 1A8YA 3FW2A 2H01A 4O92A 2IFQB 4QQ7A 2JSZA 5KOXA 3MIXA 1M0UA 3L9UA 5E4WA 4KSMA 4P3YB 2AJQB 1GUMA 2V32A 3M1GA 2CZ2A 2G2QA 3BBYA 3FR6A 2R6KA 1H75A 4BVXA 3HVXA 3F4TA 2IIYA 4KSOA 2ZNMA 3M9JA 1ZZYA 5IPHA 2HQTA 4X0XA 1GLPA 2V6KA 2LNSA 3C1SA 1OKDA 3BJ5A 4N30A 3UAPA 2WDUA 1LBKA 4WKWA 2DLXA 4TR0A 5G1LA 4AJ6A 3ZIVA 3UL3A 4I2UA 2H0IA 3DD3A 5DCGA 5JWQB 2BJXA 4Z2TA 2C1YA 2YP6A 3WT2A 2H6XA 2X49A 4MJBA 1ON4A 2B6MA 1JZWA 4RI7A 1V40A 3TU3B 4ACSA 2N5BA 4A5PA 2GSRA 5KN2A 1M9BA 1SL2B 2VAFA 3PPUA 1UA5A 1TRSA 1LU4A 2LJKA 2QSIA 4AJ8A 4L5OA 5D9WA 1TU8A 4ZILA 2A4VA 3DKSA 1Z7RA 2H6ZA 3QD9A 5A4UA 1XW9A 3HJOA 3MYDA 3EVIA 2NPBA 1WJKA 2XBIA 2KOKA 3P8WA 1RW1A 2RM6A 2C0DA 1THOA 4HUAA 1AQXA 3QFAC 4KCEA 3FZAA 1XOBA 3ZVJA 5CO3A 4PUAA 5G31A 4ML6A 3FYGA 4OFMA 2L6DA 2L4CA 3O76A 2B3SA 3UEMA 1S3CA 4MH2A 2H6YA 4OFNA 2EFDA 2DMLA 2GT5A 1TK8B 5HFKA 1B9XC 1DUGA 2JZRA 4L5LA 4MK3A 3FMWA 2VL2C 6GSYA 1W89A 3ZITA 5ECQB 3ZLPA 3IHGA 3RHCA 1BQ7A 2C4JA 3M3MA 2HXKA 2HSMA 2WB9A 3JCML 2GGTA 2EC4A 4XS4B 4TKYA 1F3AA 1GSQA 1Z9HA 4POMA 1FAAA 3TRQA 5B8BA 2H8LA 5EVOA 2O89A 4KAEA 1OC3A 4ZBBA 2MMOA 1OC9B 3KP9A 2L5LA 1JHBA 2VL3A 4ZB6A 3TB2A 3VI7A 1K0NA 1XZOA 4I8BA 2N5AA 2K8VA 5ECSA 2RLIA 1X5EA 2V41A 5F05A 1UC7A 2OJLA 3D6IA 3DVWA 1O8XA 1LJRA 2G0FA 4BVXB 1ABAA 1WWJA 1AIUA 5A5HA 4BL7B 2IMFA 1PMTA 1AQWA 4V2NA 5AISA 1J9BA 3VWUA 1KBNA 16GSA 1TOFA 1GTIA 3HMJG 1U6TA 2HSNA 9GSSA 4GSNA 2DIZA 2HRNA 3C7MA 2YZHA 3TRXA 2HRKA 1FVKA 2ES7A 4MDCA 2VCVA 3A3TA 3FKFA 4HU9A 1SVMA 5HR3A 5B6MA 4I6XA 2PUKC 3WT1A 6GSVA 3P2AA 4ZIJA 2HRAA 2YPMA 3CYNA 3CWGA 4EIQA 4PQ1A 3ZTLA 5IMVA 1WP0A 3MDKA 1N2AA 3QAVA 2DSAA 3Q74A 5KOWA 1EGRA 5D93A 3GIXA 4AKXB 1R26A 1SKWB 1YF1A 6GSWA 3I43A 4QMKA 4OMVA 3GRXA 1PSQA 1SU9A 2X8HA 4AGSA 2OACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5Q A;  4IP6 A;  1B4P A;  5CAX A;  2R37 A;  1EOG A;  5KN3 A;  4DVC A;  4ISD A;  4FQU A;  5LD0 A;  3H4K A;  6GSU A;  3ERF A;  4ZB8 A;  1VF2 A;  2F9S A;  3QAG A;  4BWQ A;  2H1G A;  3EMP A;  1NHY A;  5D9V A;  5ECK B;  2H1B A;  2Z9S A;  2EIO A;  1U3I A;  4MJE A;  3LOR A;  4K2D A;  1UVZ A;  1YZX A;  4D73 A;  2IN3 A;  4EC0 A;  1EV9 A;  3A2W A;  4AF2 A;  1JLV A;  3GHA A;  5EPF A;  1XW5 A;  2WRT A;  2C0E A;  2H1D A;  1PKZ A;  5ID2 A;  2GQL A;  5IMZ A;  4LMV A;  4HEA 2;  1ACV A;  5IMC A;  3L9V A;  2PGT A;  3QPM A;  3KGK A;  3G7Y A;  2HSM B;  2VIM A;  2EIR A;  2V2G A;  4TR1 A;  4MAB A;  5IMD A;  3A5W A;  3J7Y k;  2KHP A;  4ZL7 A;  4RQR A;  3FRC A;  5HR2 A;  2QKE A;  4WET A;  4G0K A;  5DDL A;  2FA8 A;  3F4R A;  3ZFB A;  3ME8 A;  2WGR A;  3HCZ A;  4EDZ A;  1QFN A;  1MDJ A;  1FB0 A;  3UOM A;  1V2A A;  4L8E A;  5A5K A;  4JBB A;  2FCH A;  1EV4 A;  5G5F A;  2WJU A;  2B1K A;  1K3L A;  2H74 A;  3V1W A;  1TRV A;  4IHU A;  5ECI B;  1VF1 A;  1MD3 A;  3KZQ A;  3GKN A;  2FD3 A;  2HSN B;  3TKR A;  4QL7 A;  1A24 A;  3GH9 A;  1HNB A;  3QOU A;  3ZYW A;  2HRK B;  2C0F A;  3GX8 A;  1K0B A;  3GNJ A;  4LA1 A;  1YQ1 A;  1TJD A;  5IOX A;  4RQX A;  1GLQ A;  4EVM A;  1A8L A;  3APS A;  3PR8 A;  2JAD A;  4LLR A;  3QDN A;  2IME A;  4OO4 A;  3TRP A;  1URM A;  3FR9 A;  1FB6 A;  3F6D A;  3GA4 A;  2KP1 A;  3F0I A;  4CDO A;  4EF0 A;  3MAK A;  5A4W A;  2LJA A;  2HI7 A;  1SYX A;  1X9S B;  1S3D A;  1F3B A;  1YEX A;  3DVX A;  3L0H A;  2AAW A;  1B8X A;  1MEK A;  3KH9 A;  4F2I A;  2R4V A;  1T8E B;  5EY6 A;  1JZO A;  1SD8 A;  4N11 A;  8GSS A;  3FZ4 A;  4MP4 A;  1O81 A;  3KIJ A;  2PVQ A;  5JCW A;  3FK8 A;  1DE1 A;  3KTB A;  2C8U A;  3IC4 A;  2F8F A;  1S3A A;  4HJM A;  5FT3 A;  1WPI A;  3OR5 A;  2YV7 A;  5JWO B;  1X5D A;  4IBP A;  1UN2 A;  4YQM A;  4K7I A;  2NBS A;  2HFD A;  1GNW A;  2J23 A;  1HNA A;  2B1L A;  4IJ3 A;  3D0Z A;  3GSS A;  3KD0 A;  5DJM A;  4PX1 A;  3BOA A;  1C72 A;  4V1A g;  3LXT A;  4LL4 B;  3PGT A;  3F3R A;  4G0L A;  1A2L A;  1GP1 A;  1GSY A;  4MJC A;  3TUE A;  5ID2 B;  1ZYE A;  2BTO T;  1GSE A;  2CX3 A;  2LQO A;  12GS A;  1EWX A;  1M2D A;  3HDC A;  1IYH A;  2VLV A;  3DYR A;  4BWS A;  2KP2 A;  1O85 A;  4N0Z A;  1U3A A;  4HQZ A;  4TR1 B;  2HE3 A;  5IQY A;  1SK0 A;  1XW6 A;  4IJI A;  1HYU A;  3FZ5 A;  1Y25 A;  3BCI A;  3GYK A;  2DJ3 A;  1XWK A;  1OC8 A;  3DML A;  1B48 A;  4TXV A;  2HSH A;  2O7K A;  1PKW A;  2VD0 A;  2IL3 A;  4Q5N A;  4JED A;  4XRA A;  3CRU A;  5F0G A;  2XC2 A;  2HZE A;  1R4W A;  2E0Q A;  3CSH A;  2X8G A;  1BED A;  2JZT A;  5ECN B;  2VL9 A;  4G10 A;  1GWC A;  3D5J A;  4XIH A;  2I3Y A;  2H73 A;  1BYE A;  2NDO A;  1XCC A;  3BCK A;  4WBR D;  2C3T A;  4WEY A;  1SKS B;  4LMW A;  3KJY A;  4TW5 A;  3H8Q A;  1X9M B;  3CTF A;  3TJB A;  1ZYQ B;  4O5R A;  1G7O A;  5KN1 A;  1F6M C;  4PUF C;  2KUC A;  4V1A p;  3DRN A;  5DAL A;  4JZQ A;  4F0B A;  3VUR A;  5IMF A;  2GSQ A;  4MLY A;  1BAY A;  4ZB9 A;  2MBT A;  2YN1 A;  5JCG A;  1ERU A;  3RHB A;  1SK2 A;  4MJA A;  1PX6 A;  2X99 A;  3G7I A;  5G1K A;  5GZZ B;  4J2F A;  3MWH A;  3VK9 A;  5CRH A;  3IK9 A;  4V2L A;  1SKR B;  4ECC A;  4K7O A;  4POL A;  2ZUP A;  4X43 A;  3A2X A;  3UJ1 A;  4FYB A;  2GVP A;  1XVQ A;  3I6A A;  1TRU A;  3N9J A;  1TI1 A;  3GST A;  2GTU A;  1A2M A;  4ML1 A;  3LYK A;  1SJZ A;  5C04 A;  3KM6 A;  3CTG A;  3Q18 A;  5F07 A;  2OE0 A;  4N0V A;  1TDI A;  4G0I A;  1FOV A;  7GSS A;  2REM A;  1NW2 A;  2YCD A;  4KB3 A;  3FHK A;  4JR6 A;  1ST9 A;  1TTZ A;  1T4Y A;  22GS A;  5JCU A;  3CRT A;  4FIW A;  2WS2 A;  4IEL A;  4GF0 A;  3J7Y b;  1Q98 A;  4ZL8 A;  2YWM A;  6GST A;  2MBS A;  3MSZ A;  4NV2 A;  4WBJ A;  2NTO A;  4PUR A;  1Z7P A;  5GAN D;  3TKS C;  4JR4 A;  5BMU A;  2C3N A;  5DAK B;  1PQN A;  14GS A;  4DSS A;  4J56 E;  4TRX A;  2LKU A;  4Q5R A;  4GRF A;  2O87 A;  1V98 A;  4MZC A;  3DIE A;  3LWA A;  5IO2 A;  4IS0 A;  3SWL A;  1XWB A;  3TKS A;  3HZ4 A;  5H5Q A;  4V2M A;  4K0N A;  1YF0 A;  4ZXG A;  2KLX A;  2P31 A;  3U5R E;  2LTK A;  2XHF A;  3UBK A;  4DEJ A;  2PMT A;  2HNL A;  1T7P B;  2K9F A;  3VWW A;  1FHE A;  1QK8 A;  3GMF A;  2MMN A;  3TOT A;  2DJJ A;  1A0F A;  4ECB A;  2J9H A;  5DVB A;  3ERW A;  2R3X A;  10GS A;  2CQ9 A;  2RM5 A;  5CYY A;  2HLS A;  3F8U A;  4IVF A;  4MPG A;  3KEB A;  5AN1 A;  2K18 A;  5DQY A;  2CVD A;  2B5X A;  3UMA A;  3UVH A;  4PNG A;  3DXB A;  1MDI A;  2VLT A;  1OAZ A;  2PWJ A;  3GKX A;  4OO5 A;  5A4V A;  4HJ2 A;  4DSR A;  1O8W A;  2H0H A;  3GFK A;  1G7E A;  4IGJ A;  3ME7 A;  4GXZ A;  1AXD A;  2P5R A;  4K6X A;  4MPF A;  3GL3 A;  2DJ2 A;  3EE2 A;  5COH A;  4KCA A;  3EWL A;  5CP1 A;  4H86 A;  2DIY A;  2GQM A;  3GTU A;  3S9F A;  2VCT A;  4AJ7 A;  4WR5 A;  2VD1 A;  1FO5 A;  1GSS A;  1V58 A;  2DC5 A;  4KX4 A;  3TGZ A;  2L6C A;  3M0F A;  3LEF A;  2LQQ A;  5J5N A;  1XFL A;  4EKZ A;  4Q5Q A;  2CT6 A;  4GTU A;  1M7T A;  3KP8 A;  1DBY A;  1CQG A;  4NHZ A;  3ED3 A;  3IAM 2;  1EEJ A;  1M2A A;  3F3Q A;  2F51 A;  2DJ1 A;  1XXU A;  2VCW A;  1TU7 A;  4O32 A;  1VGL A;  5KN0 A;  3EC3 A;  5F8B A;  4MZW A;  3F6F A;  4IW9 A;  3UAR A;  1F9M A;  3W8S A;  5ECH B;  3ZMK A;  3I9V 2;  4MMM A;  3TDG A;  1XPV A;  1O6J A;  3FEU A;  2JZS A;  3U6V A;  1GSD A;  1PD2 1;  1BG5 A;  4XS1 A;  2E2M A;  1THX A;  3D22 A;  5ECL B;  4K9Z A;  5INY A;  3TJG A;  3O6T A;  1WMJ A;  5D96 A;  3IRA A;  3WYW A;  4POB A;  1ZGN A;  5LCZ A;  1J08 A;  3EMX A;  1M2B A;  2A2S A;  2M80 A;  3L4N A;  4TXO A;  2H75 A;  3CBU A;  3K8N A;  2NVL A;  3C1R A;  3VI5 A;  1O7U A;  1T1V A;  5H5S A;  5B6N A;  3QCP A;  3US3 A;  4TR4 A;  3L9S A;  4GSS A;  4NAX A;  2O85 A;  2IFQ A;  4EUY A;  4KDY A;  2GDR A;  1VF4 A;  1K0A A;  1JZR A;  2VCQ A;  2PER A;  1GUK A;  1EP8 A;  1SEN A;  5D9X A;  1HD2 A;  4RUV A;  3RDW A;  3TKP A;  1WOU A;  1JFU A;  2LNT A;  1J0F A;  1TK5 B;  5FWG A;  3HA9 A;  4IN0 A;  4OD7 A;  1FW1 A;  2YWN A;  1HNC A;  1GNE A;  4XRD A;  1XBS A;  1QQ2 A;  1Z3E A;  3RBT A;  1GTA A;  4JE1 A;  5ELG A;  3SBC A;  4XCS A;  3TJK A;  1G0T A;  1WIK A;  4KDU A;  3CSJ A;  2HRF A;  3ZZX A;  4L0U A;  1EP7 A;  2X64 A;  1F37 A;  2V6O A;  1BJX A;  1AW9 A;  1T3B A;  2IWT A;  3KMN A;  1G6Y A;  1F2E A;  3VPT A;  4G2E A;  2ALB A;  3ZFL A;  4X1U A;  5ECR B;  2VCX A;  3HY2 A;  4HQS A;  3M8N A;  1PA3 A;  3HZ8 A;  3APQ A;  2VM1 A;  4BPY A;  2N5F A;  1YEP A;  3F63 A;  4GST A;  1E2Y A;  3NZN A;  1RQM A;  1GH2 A;  3IC8 A;  3IBH A;  2I1U A;  3FY7 A;  1TXX A;  3KCM A;  2DJ0 A;  3D4M A;  2PN8 A;  2JSY A;  1K0O A;  1EOH A;  5CNW A;  2B7J A;  1ERW A;  3QMX A;  1OYJ A;  5J4U A;  1YJ6 A;  2ZCT A;  4K8M A;  1TKD B;  2LJR A;  2FUG 2;  2RUE A;  3IAS 2;  4YQV A;  2IMK A;  2C3Q A;  4D73 B;  19GS A;  2L59 A;  2CA8 A;  4KH7 A;  1GRX A;  1HQO A;  1I5G A;  3TCO A;  2M46 A;  5L71 A;  2H1A A;  2WCI A;  1JZD A;  1XWC A;  1GL8 A;  2B5Y A;  4NMU A;  4ECJ A;  4JU5 A;  2XPD A;  3C8E A;  3IOS A;  1GSF A;  4ECI A;  1GTU A;  2GQK A;  3IR4 A;  3H1N A;  2IMI A;  2LST A;  3F9U A;  3IDV A;  4YAP A;  2FWF A;  5DBQ A;  2TRC P;  11GS A;  2YNX A;  2IJY A;  1V9W A;  4TXO B;  5HR0 A;  17GS A;  3MNG A;  3D21 A;  4KF9 A;  2B7K A;  3ZVJ D;  2D2Z A;  2F8A A;  3HJP A;  3GUR A;  3VLN A;  2TRX A;  2GZY A;  4ID0 A;  2CAQ A;  4CW9 A;  5AIV A;  4MH3 A;  1OC9 A;  5F06 A;  4K1F A;  1ILO A;  3C73 A;  1H4O A;  5C00 A;  5LNK e;  1R5P A;  4MA9 A;  1K3Y A;  5ELA A;  2GZP A;  2LRN A;  5FHI A;  1CQH A;  3HHV A;  5DQS A;  1WE0 A;  4XTS A;  5KEJ A;  1ERV A;  4E8E A;  2JL4 A;  1KTE A;  2VCZ A;  4KE3 A;  3C71 A;  3DEX A;  3TJJ A;  4BL7 A;  3I69 A;  3L78 A;  4HDE A;  4G9H A;  4NPB A;  4OCF A;  3R2Q A;  3NOF A;  3WGD A;  5J41 A;  5ECM B;  2GT6 A;  5GAP D;  1MTC A;  1AUC A;  1M99 A;  5D9T A;  2VM2 A;  4F82 A;  1K0M A;  1X0R A;  1PGT A;  3DGQ A;  18GS A;  3IXR A;  1EEM A;  1NM3 A;  3E9J B;  2OBK A;  4NXI A;  3ZRD A;  2LUS A;  2PBJ A;  4ZBD A;  3IPZ A;  4MF7 A;  4EE0 A;  2OKA A;  1TW9 A;  5B7C A;  2AUV A;  3M9K A;  3ZRE A;  2RII A;  3W8J A;  4DSQ A;  3HYP A;  5J9B A;  3LQ7 A;  4ZBA A;  2ON7 A;  2HSY A;  3QR6 A;  1O73 A;  2H76 A;  3DWV A;  2GLR A;  2H72 A;  2E7P A;  1TI3 A;  1X9W B;  2H19 A;  1Q4J A;  4OCE A;  1QUW A;  5G30 A;  4KUN A;  2UZ8 A;  3GKK A;  2CX4 A;  2WZ9 A;  1NHO A;  1FVJ A;  4IKH A;  4TOP A;  1SK1 A;  3EU4 A;  4FO5 A;  4HZ2 A;  3EUR A;  2M72 A;  2I81 A;  4WF4 A;  1OE7 A;  4I5Q A;  5HQP A;  4RI6 A;  4GLT A;  3ZIJ A;  4GCI A;  3TJF A;  2L4Q A;  4USS A;  5CRE A;  2JAC A;  2GST A;  1YDK A;  5ABR A;  13GS A;  5IO0 A;  1U88 A;  4KDX A;  4KGI A;  4POK A;  2LRC A;  2FWH A;  3WD6 A;  1SL1 B;  5IOW A;  2O8V B;  2IPA A;  2B5E A;  2HZF A;  1OE8 A;  4IQ1 A;  3H79 A;  1ZCP A;  2HZE B;  2VL2 A;  2FLS A;  1TRW A;  1WRY A;  1PRX A;  2EIQ A;  2DBC A;  1OKT A;  2VOC A;  3APO A;  2C80 A;  2IMD A;  2ON5 A;  3E3E A;  1DE2 A;  2YWI A;  3IE3 A;  5IM9 A;  4HI7 A;  3R3E A;  2OE3 A;  1A2J A;  2H70 A;  2AB6 A;  4BVY A;  1FG4 A;  3TKQ A;  2HYX A;  2YV9 A;  3EU3 A;  4F0C A;  3LYP A;  2F3M A;  1SD9 A;  3IK7 A;  2WUL A;  5DAL B;  3KH7 A;  5HFG A;  2C0G A;  2CZ3 A;  3QFB C;  3GV1 A;  3LJR A;  1ZOF A;  2R5G A;  2E2G A;  2LS5 A;  4OFT A;  1N8J A;  3VPQ A;  1V57 A;  4GWR A;  5E59 A;  3HJM A;  4KND A;  6GSX A;  1AQV A;  4E8H A;  2L5O A;  3CSI A;  1DSB A;  5CRG A;  2PPT A;  2OE1 A;  4KA0 A;  2CV4 A;  2FA4 A;  2MMZ A;  2FGX A;  3RPN A;  1YKA A;  2L57 A;  2H0G A;  1VRS D;  1TP9 A;  4MCU A;  1YY7 A;  2CVB A;  4WR4 A;  5CRW A;  2RUF A;  2CVK A;  2AYT A;  3KXO A;  2VUP A;  1I9D A;  5B8A A;  1A0R P;  5JWR B;  1GUH A;  1B9Y C;  3LXZ A;  3ZML A;  1Y6E A;  1BX9 A;  1Z6N A;  5H5R A;  5IMA A;  2XPE A;  1NSW A;  2OA7 A;  2GZZ A;  3Q6O A;  1TK0 B;  4MZB A;  2K6V A;  3GUS A;  3H93 A;  1GSU A;  4YAV A;  1VF3 A;  4Q5F A;  1SYR A;  4MF6 A;  4KW6 A;  1PN9 A;  2FWE A;  4WXT A;  4QL9 A;  2WFC A;  3Q19 A;  2FWG A;  4EL1 A;  3GH6 A;  3HD5 A;  2MZC A;  2FNO A;  5G2Z A;  1EZK A;  2R2J A;  4I2T A;  1M9A A;  4EXJ A;  4DSS B;  5J3R A;  5ENU A;  5AGY A;  5GST A;  4XS6 A;  4PGT A;  4F03 A;  2QGV A;  2HT9 A;  4N10 A;  2JU5 A;  4IQA A;  1XWA A;  3P90 A;  2LEG A;  3LGC A;  3AY8 A;  1QGV A;  3IA1 A;  4HZ4 A;  2AHE A;  2X8C A;  1G6W A;  5CRD A;  3LG6 A;  1T00 A;  5IPG A;  3HKR A;  3GX0 A;  4BA7 A;  2VO4 A;  3LFL A;  1K3O A;  4TR3 A;  4O7H A;  4EO3 A;  2PU9 C;  3KMO A;  4HS1 A;  2H66 A;  2OAD A;  1SJI A;  3F4S A;  4NHW A;  1SJ6 A;  3QAW A;  5ECP B;  5HR1 A;  4G19 A;  4K7N A;  4L0W A;  5GSS A;  1ML6 A;  4HU7 A;  3ZL5 A;  1R5A A;  4IP1 A;  4PNF A;  1SL0 B;  3UIW A;  5D8I A;  3O3T A;  2LRT A;  5G5E A;  3GL5 A;  4HOJ A;  5AIX A;  1XWG A;  4BVY B;  4NWY A;  2YWO A;  2BMX A;  1B4Q A;  4J57 E;  2GSS A;  6GSS A;  4ZL9 A;  3KTL A;  3W6G A;  2FY6 A;  1Z6M A;  3LSZ A;  1ERT A;  1E6B A;  4XHM A;  2FHE A;  3HVV A;  3FZ9 A;  1K0C A;  3HVS A;  4ILF A;  3G7J A;  1A23 A;  4FH8 A;  1KEB A;  5DJL A;  3UBL A;  1Z5Y E;  4CHS A;  3WGX A;  1PL1 A;  2TIR A;  3IV4 A;  3GTU B;  2PVO C;  1XOA A;  2H30 A;  4I97 A;  2P0G A;  2VLU A;  1T4Z A;  4F9Z A;  2I9H A;  2YJ7 A;  1ZL9 A;  2A2R A;  4EDY A;  3CMI A;  2DMM A;  3GKM A;  3E0U A;  4NV5 A;  4FYU A;  1OVN A;  1AAZ A;  1X5C A;  3VFI A;  3N5O A;  1XVW A;  2DJK A;  3NIV A;  2QC7 A;  2XBQ A;  2LV3 A;  1U87 A;  3ERG A;  3D4T A;  4FYC A;  2YAN A;  3G9B A;  3UVT A;  4YQU A;  3BD2 A;  4WF5 A;  2V1M A;  2MYG A;  2OBI A;  2H71 A;  4TN8 A;  1RK4 A;  1XIY A;  2GS3 A;  3RAZ A;  1K0D A;  4TVE A;  5IIZ A;  3EIN A;  4GQC A;  2CAI A;  3FR3 A;  20GS A;  1PX7 A;  4K0G A;  5J9C A;  4PQH A;  4YH2 A;  2YZU A;  4PQI A;  3GN3 A;  3IHQ A;  1AC1 A;  1QXH A;  1QMV A;  3P7X A;  1KNG A;  1R7H A;  3WGE A;  3PH9 A;  4MF5 A;  5D73 A;  3VWX A;  1YKC A;  4PXO A;  1MDK A;  2MMA A;  1USB A;  5HFI A;  1JLW A;  4LL1 B;  3PIN A;  1PL2 A;  4PTS A;  2I4A A;  3ISO A;  1W4V A;  3TKS E;  2AV4 A;  1EGO A;  1GTB A;  3HXS A;  3RPP A;  2YOI A;  3A2V A;  3CXG A;  3TOU A;  4ULX A;  1ZMA A;  4Z7X A;  3VWV A;  2K8S A;  1IYI A;  2YJH A;  4JRR A;  5DAK A;  4OWY A;  3EYT A;  1MD4 A;  5DCH A;  4GQF A;  5EL8 A;  1GUL A;  4XS4 A;  5ECO B;  1A8Y A;  3FW2 A;  2H01 A;  4O92 A;  2IFQ B;  4QQ7 A;  2JSZ A;  1M0U A;  3L9U A;  5E4W A;  4KSM A;  4P3Y B;  2AJQ B;  1GUM A;  2V32 A;  3M1G A;  2CZ2 A;  2G2Q A;  3BBY A;  3FR6 A;  2R6K A;  1H75 A;  4BVX A;  3HVX A;  3F4T A;  2IIY A;  4KSO A;  2ZNM A;  3M9J A;  1ZZY A;  5IPH A;  2HQT A;  4X0X A;  1GLP A;  2V6K A;  2LNS A;  3C1S A;  1OKD A;  3BJ5 A;  4N30 A;  3UAP A;  2WDU A;  1LBK A;  4WKW A;  2DLX A;  4TR0 A;  5G1L A;  4AJ6 A;  3ZIV A;  3UL3 A;  4I2U A;  2H0I A;  3DD3 A;  5DCG A;  5JWQ B;  2BJX A;  2C1Y A;  2YP6 A;  3WT2 A;  2H6X A;  4MJB A;  1ON4 A;  2B6M A;  1JZW A;  4RI7 A;  1V40 A;  4ACS A;  2N5B A;  2GSR A;  5KN2 A;  1M9B A;  1SL2 B;  2VAF A;  3PPU A;  1UA5 A;  1TRS A;  1LU4 A;  2LJK A;  2QSI A;  4AJ8 A;  4L5O A;  5D9W A;  1TU8 A;  4ZIL A;  2A4V A;  3DKS A;  1Z7R A;  2H6Z A;  3QD9 A;  5A4U A;  1XW9 A;  3HJO A;  3EVI A;  2NPB A;  1WJK A;  2XBI A;  2KOK A;  3P8W A;  1RW1 A;  2RM6 A;  2C0D A;  1THO A;  4HUA A;  1AQX A;  3QFA C;  4KCE A;  3FZA A;  1XOB A;  3ZVJ A;  5CO3 A;  4PUA A;  5G31 A;  4ML6 A;  3FYG A;  4OFM A;  2L6D A;  2L4C A;  3O76 A;  2B3S A;  3UEM A;  1S3C A;  4MH2 A;  2H6Y A;  4OFN A;  2DML A;  2GT5 A;  1TK8 B;  5HFK A;  1B9X C;  1DUG A;  2JZR A;  4L5L A;  4MK3 A;  2VL2 C;  6GSY A;  1W89 A;  3ZIT A;  5ECQ B;  3ZLP A;  3RHC A;  1BQ7 A;  2C4J A;  3M3M A;  2HXK A;  2HSM A;  2WB9 A;  3JCM L;  2GGT A;  2EC4 A;  4XS4 B;  4TKY A;  1F3A A;  1GSQ A;  1Z9H A;  4POM A;  1FAA A;  3TRQ A;  5B8B A;  2H8L A;  5EVO A;  2O89 A;  4KAE A;  1OC3 A;  4ZBB A;  2MMO A;  1OC9 B;  3KP9 A;  2L5L A;  1JHB A;  2VL3 A;  4ZB6 A;  3TB2 A;  3VI7 A;  1K0N A;  1XZO A;  4I8B A;  2N5A A;  2K8V A;  5ECS A;  2RLI A;  1X5E A;  2V41 A;  5F05 A;  1UC7 A;  2OJL A;  3D6I A;  3DVW A;  1O8X A;  1LJR A;  2G0F A;  4BVX B;  1ABA A;  1WWJ A;  1AIU A;  4BL7 B;  2IMF A;  1PMT A;  1AQW A;  4V2N A;  5AIS A;  1J9B A;  3VWU A;  1KBN A;  16GS A;  1TOF A;  1GTI A;  1U6T A;  9GSS A;  4GSN A;  2DIZ A;  2HRN A;  3C7M A;  2YZH A;  3TRX A;  2HRK A;  1FVK A;  2ES7 A;  4MDC A;  2VCV A;  3A3T A;  3FKF A;  4HU9 A;  5HR3 A;  5B6M A;  4I6X A;  2PUK C;  3WT1 A;  6GSV A;  3P2A A;  4ZIJ A;  2HRA A;  2YPM A;  3CYN A;  4PQ1 A;  3ZTL A;  5IMV A;  1WP0 A;  3MDK A;  1N2A A;  3QAV A;  2DSA A;  3Q74 A;  1EGR A;  5D93 A;  3GIX A;  1R26 A;  1SKW B;  1YF1 A;  6GSW A;  3I43 A;  4OMV A;  3GRX A;  1PSQ A;  1SU9 A;  2X8H A;  4AGS A;  2OAC A; 
#chains in the Genus database with same CATH topology
 2P5Q A;  4IP6 A;  1B4P A;  5CAX A;  2R37 A;  1EOG A;  5KN3 A;  4DVC A;  4ISD A;  4FQU A;  5LD0 A;  3H4K A;  6GSU A;  3RFR C;  4ICY A;  3ERF A;  4ZB8 A;  1VF2 A;  2F9S A;  3QAG A;  4BWQ A;  2H1G A;  3EMP A;  2A4H A;  1NHY A;  5D9V A;  5ECK B;  2H1B A;  2Z9S A;  2EIO A;  1U3I A;  4MJE A;  3LOR A;  4K2D A;  1UVZ A;  1YZX A;  4D73 A;  2IN3 A;  4EC0 A;  1EV9 A;  3A2W A;  4AF2 A;  1JLV A;  3GHA A;  5EPF A;  1XW5 A;  2WRT A;  2C0E A;  2H1D A;  1PKZ A;  5ID2 A;  2GQL A;  5IMZ A;  4LMV A;  4HEA 2;  1ACV A;  5IMC A;  3L9V A;  2PGT A;  3QPM A;  3KGK A;  3G7Y A;  2HSM B;  2VIM A;  2EIR A;  2V2G A;  4TR1 A;  4MAB A;  5IMD A;  3A5W A;  3J7Y k;  2KHP A;  4ZL7 A;  4RQR A;  3FRC A;  5HR2 A;  2QKE A;  4WET A;  4G0K A;  5DDL A;  2FA8 A;  3F4R A;  3ZFB A;  3ME8 A;  4K5R A;  2WGR A;  3HCZ A;  4EDZ A;  1QFN A;  1MDJ A;  1FB0 A;  3UOM A;  1V2A A;  4L8E A;  1BF5 A;  5A5K A;  4JBB A;  2FCH A;  1EV4 A;  5G5F A;  2WJU A;  2B1K A;  5A5H B;  1K3L A;  2H74 A;  3V1W A;  1TRV A;  4IHU A;  5ECI B;  1VF1 A;  1MD3 A;  3KZQ A;  3GKN A;  2FD3 A;  2HSN B;  3TKR A;  4QL7 A;  1A24 A;  3GH9 A;  1HNB A;  3QOU A;  3ZYW A;  2HRK B;  2C0F A;  3GX8 A;  1K0B A;  3GNJ A;  4LA1 A;  1YQ1 A;  1TJD A;  5IOX A;  4RQX A;  1GLQ A;  4EVM A;  1A8L A;  3APS A;  3PR8 A;  2JAD A;  4LLR A;  3QDN A;  2IME A;  4OO4 A;  3TRP A;  1URM A;  3FR9 A;  1PN0 A;  1FB6 A;  3F6D A;  3GA4 A;  2KP1 A;  3F0I A;  4CDO A;  4EF0 A;  3MAK A;  5A4W A;  2LJA A;  2HI7 A;  1SYX A;  1X9S B;  1S3D A;  1F3B A;  1YEX A;  3DVX A;  4YKG A;  3L0H A;  2AAW A;  1B8X A;  1MEK A;  3KH9 A;  4F2I A;  2R4V A;  1T8E B;  5EY6 A;  1JZO A;  1SD8 A;  4N11 A;  5BRT A;  1BG1 A;  8GSS A;  3FZ4 A;  4MP4 A;  1O81 A;  3KIJ A;  2PVQ A;  5JCW A;  3FK8 A;  1DE1 A;  3KTB A;  4EIP A;  2C8U A;  3IC4 A;  2F8F A;  1S3A A;  2WVZ A;  4HJM A;  5FT3 A;  1WPI A;  3OR5 A;  2YV7 A;  5JWO B;  1X5D A;  4IBP A;  1UN2 A;  4YQM A;  4K7I A;  2NBS A;  2HFD A;  1GNW A;  2J23 A;  1HNA A;  2B1L A;  4IJ3 A;  3D0Z A;  3GSS A;  3KD0 A;  5DJM A;  1YVL A;  4PX1 A;  3BOA A;  1C72 A;  4V1A g;  3LXT A;  1I1I P;  4LL4 B;  3PGT A;  3F3R A;  4G0L A;  1A2L A;  1GP1 A;  1GSY A;  4MJC A;  3TUE A;  5ID2 B;  1ZYE A;  2BTO T;  1GSE A;  2CX3 A;  2LQO A;  12GS A;  1EWX A;  1M2D A;  3HDC A;  1IYH A;  2VLV A;  3DYR A;  4BWS A;  2KP2 A;  1O85 A;  4N0Z A;  1U3A A;  2R0G A;  4HQZ A;  4TR1 B;  2HE3 A;  5IQY A;  1SK0 A;  1XW6 A;  4IJI A;  1HYU A;  3FZ5 A;  1Y25 A;  3BCI A;  3GYK A;  2DJ3 A;  1XWK A;  1OC8 A;  3DML A;  1B48 A;  4TXV A;  2HSH A;  2O7K A;  1PKW A;  2VD0 A;  2IL3 A;  4Q5N A;  4JED A;  4XRA A;  3CRU A;  5F0G A;  2XC2 A;  2HZE A;  1R4W A;  2E0Q A;  3CSH A;  2X8G A;  1BED A;  2JZT A;  1SVL A;  5ECN B;  1S3R A;  2VL9 A;  4G10 A;  1GWC A;  3D5J A;  4XIH A;  2I3Y A;  2H73 A;  1BYE A;  2NDO A;  1XCC A;  4CY8 A;  3BCK A;  4WBR D;  2C3T A;  4WEY A;  1SKS B;  4LMW A;  3KJY A;  4TW5 A;  3H8Q A;  1X9M B;  3CTF A;  3TJB A;  1ZYQ B;  4O5R A;  1G7O A;  5KN1 A;  1F6M C;  4PUF C;  2KUC A;  4V1A p;  3DRN A;  5DAL A;  4JZQ A;  4F0B A;  3VUR A;  5IMF A;  2WW2 A;  2GSQ A;  4MLY A;  1BAY A;  4ZB9 A;  5J4Y A;  2MBT A;  2YN1 A;  5JCG A;  1ERU A;  2OT3 A;  3RHB A;  1SK2 A;  4MJA A;  1PX6 A;  2X99 A;  3G7I A;  5G1K A;  5GZZ B;  4J2F A;  3MWH A;  3VK9 A;  5CRH A;  3IK9 A;  4V2L A;  1SKR B;  4ECC A;  4K7O A;  4POL A;  2ZUP A;  4X43 A;  2DKI A;  3A2X A;  3UJ1 A;  4FYB A;  2GVP A;  1XVQ A;  3I6A A;  1TRU A;  3A5I A;  3N9J A;  1TI1 A;  5A34 A;  3GST A;  4W66 A;  2GTU A;  1A2M A;  4ML1 A;  3LYK A;  1SJZ A;  5C04 A;  3KM6 A;  3CTG A;  3Q18 A;  5F07 A;  2OE0 A;  4N0V A;  1TDI A;  4G0I A;  1FOV A;  7GSS A;  2REM A;  1NW2 A;  2YCD A;  4KB3 A;  3FHK A;  1Y1U A;  4JR6 A;  1ST9 A;  1TTZ A;  1T4Y A;  22GS A;  5JCU A;  3CRT A;  4FIW A;  2WS2 A;  4IEL A;  4GF0 A;  3EPT A;  3J7Y b;  1Q98 A;  4ZL8 A;  4YKF A;  2YWM A;  6GST A;  2MBS A;  3MSZ A;  4NV2 A;  4WBJ A;  2NTO A;  1SVO A;  4PUR A;  1Z7P A;  5GAN D;  2H1L A;  3TKS C;  4JR4 A;  5BMU A;  2C3N A;  5DAK B;  1PQN A;  14GS A;  4DSS A;  3HVN A;  4J56 E;  4TRX A;  2LKU A;  4Q5R A;  4GRF A;  2O87 A;  1V98 A;  4MZC A;  3DIE A;  3LWA A;  5IO2 A;  4IS0 A;  3SWL A;  1XWB A;  3TKS A;  1FOH A;  3HZ4 A;  5H5Q A;  4V2M A;  4K0N A;  1YF0 A;  4ZXG A;  2KLX A;  2P31 A;  3U5R E;  2LTK A;  2XHF A;  3UBK A;  4DEJ A;  2PMT A;  2HNL A;  1T7P B;  2K9F A;  3VWW A;  1FHE A;  1QK8 A;  3GMF A;  2MMN A;  3TOT A;  2DJJ A;  1A0F A;  4ECB A;  2J9H A;  5DVB A;  3ERW A;  2R3X A;  10GS A;  2CQ9 A;  2RM5 A;  5CYY A;  2HLS A;  3F8U A;  4IVF A;  4MPG A;  3KEB A;  4O5Q A;  5AN1 A;  2K18 A;  5DQY A;  2CVD A;  2B5X A;  3UMA A;  3UVH A;  4PNG A;  3DXB A;  1MDI A;  2VLT A;  1OAZ A;  2PWJ A;  3GKX A;  4OO5 A;  5A4V A;  4HJ2 A;  4DSR A;  1O8W A;  2H0H A;  3GFK A;  1G7E A;  4IGJ A;  3ME7 A;  4GXZ A;  1AXD A;  2P5R A;  4K6X A;  4MPF A;  3GL3 A;  2DJ2 A;  3EE2 A;  5COH A;  4KCA A;  3EWL A;  5CP1 A;  4H86 A;  2DIY A;  2GQM A;  3GTU A;  3S9F A;  2VCT A;  2WVX B;  4WR5 A;  4AJ7 A;  2VD1 A;  1FO5 A;  1GSS A;  4CY6 A;  1V58 A;  2DC5 A;  4KX4 A;  3TGZ A;  2L6C A;  3M0F A;  3LEF A;  2LQQ A;  5J5N A;  1XFL A;  4EKZ A;  4Q5Q A;  2CT6 A;  4GTU A;  1M7T A;  3KP8 A;  1DBY A;  5A34 B;  1CQG A;  4NHZ A;  3ED3 A;  3IAM 2;  1EEJ A;  1M2A A;  3F3Q A;  2F51 A;  2DJ1 A;  1XXU A;  2VCW A;  1TU7 A;  4O32 A;  1VGL A;  5KN0 A;  3EC3 A;  4BIK A;  5F8B A;  4MZW A;  3F6F A;  4IW9 A;  3UAR A;  1F9M A;  3W8S A;  5ECH B;  3ZMK A;  2R0P A;  2EFE A;  3I9V 2;  4MMM A;  3TDG A;  1XPV A;  1O6J A;  3FEU A;  2JZS A;  3U6V A;  1GSD A;  1PD2 1;  1BG5 A;  4XS1 A;  2E2M A;  1THX A;  3D22 A;  4K5S A;  5ECL B;  4K9Z A;  5INY A;  2X4A A;  3TJG A;  3O6T A;  1WMJ A;  5D96 A;  5BMU B;  3IRA A;  3WYW A;  4POB A;  1ZGN A;  5LCZ A;  1M3I A;  1J08 A;  3EMX A;  1M2B A;  2A2S A;  2M80 A;  3L4N A;  4TXO A;  2H75 A;  3CBU A;  3K8N A;  2NVL A;  3C1R A;  3VI5 A;  1O7U A;  1T1V A;  5H5S A;  5B6N A;  3QCP A;  3US3 A;  4TR4 A;  3L9S A;  4GSS A;  2WW3 A;  4NAX A;  2O85 A;  2IFQ A;  4EUY A;  4KDY A;  2GDR A;  1VF4 A;  1K0A A;  1JZR A;  2VCQ A;  2PER A;  1GUK A;  1EP8 A;  1SEN A;  5D9X A;  1HD2 A;  4RUV A;  3RDW A;  3TKP A;  1WOU A;  1JFU A;  2LNT A;  1J0F A;  1TK5 B;  5FWG A;  3HA9 A;  4IN0 A;  4OD7 A;  1FW1 A;  2YWN A;  1HNC A;  1GNE A;  2A2P A;  4XRD A;  1XBS A;  1QQ2 A;  4N3Z A;  1Z3E A;  2EFH A;  3RBT A;  2O5V A;  1GTA A;  4JE1 A;  5ELG A;  3SBC A;  4XCS A;  3TJK A;  1G0T A;  1WIK A;  4KDU A;  3CSJ A;  2HRF A;  3ZZX A;  4L0U A;  1EP7 A;  2X64 A;  1F37 A;  2V6O A;  1BJX A;  1AW9 A;  1T3B A;  2IWT A;  3KMN A;  1G6Y A;  1TXU A;  1F2E A;  2WW1 A;  3VPT A;  4G2E A;  2ALB A;  3ZFL A;  4X1U A;  5ECR B;  2VCX A;  3HY2 A;  4HQS A;  3M8N A;  1PA3 A;  3HZ8 A;  3APQ A;  2VM1 A;  4BPY A;  2N5F A;  1YEP A;  3F63 A;  4GST A;  1E2Y A;  3NZN A;  1RQM A;  1GH2 A;  3IC8 A;  3IBH A;  2I1U A;  3FY7 A;  1TXX A;  3KCM A;  2DJ0 A;  3D4M A;  2PN8 A;  2JSY A;  1K0O A;  3CHX C;  4AKG A;  1EOH A;  5CNW A;  2B7J A;  4AI6 A;  2O3E A;  1ERW A;  4G01 A;  3QMX A;  1OYJ A;  5J4U A;  1YJ6 A;  2ZCT A;  4K8M A;  1TKD B;  2LJR A;  2FUG 2;  2RUE A;  3IAS 2;  4YQV A;  2IMK A;  2C3Q A;  4D73 B;  19GS A;  2L59 A;  2CA8 A;  4KH7 A;  1GRX A;  5J40 A;  1HQO A;  1I5G A;  3TCO A;  2WVY A;  4PI2 C;  2M46 A;  5L71 A;  2H1A A;  2WCI A;  1JZD A;  1XWC A;  1GL8 A;  2B5Y A;  4NMU A;  4ECJ A;  4JU5 A;  2XPD A;  3C8E A;  3IOS A;  1GSF A;  4ECI A;  1GTU A;  2GQK A;  3IR4 A;  3H1N A;  1ZYP A;  2IMI A;  2LST A;  3F9U A;  3IDV A;  4YAP A;  2WW0 A;  2FWF A;  5DBQ A;  2TRC P;  11GS A;  2YNX A;  2IJY A;  1V9W A;  4TXO B;  5HR0 A;  17GS A;  3MNG A;  3D21 A;  4KF9 A;  2B7K A;  3ZVJ D;  2D2Z A;  2F8A A;  3HJP A;  3GUR A;  3VLN A;  2TRX A;  2GZY A;  4ID0 A;  2CAQ A;  4CW9 A;  5AIV A;  4MH3 A;  1OC9 A;  5F06 A;  4K1F A;  1ILO A;  3C73 A;  1H4O A;  5C00 A;  5LNK e;  1R5P A;  4MA9 A;  4Z2U A;  1K3Y A;  5ELA A;  2GZP A;  2LRN A;  3RGB C;  5FHI A;  1CQH A;  3HHV A;  5DQS A;  1WE0 A;  4XTS A;  5KEJ A;  1ERV A;  4E8E A;  2JL4 A;  1KTE A;  2VCZ A;  4KE3 A;  3C71 A;  3DEX A;  3TJJ A;  4BL7 A;  3I69 A;  3L78 A;  4HDE A;  4G9H A;  4NPB A;  4OCF A;  3R2Q A;  3NOF A;  3WGD A;  5J41 A;  5ECM B;  2GT6 A;  5GAP D;  1MTC A;  1AUC A;  1M99 A;  5D9T A;  2VM2 A;  4F82 A;  1K0M A;  1X0R A;  1PGT A;  3DGQ A;  18GS A;  1PFO A;  3IXR A;  1EEM A;  1NM3 A;  3E9J B;  2OBK A;  4MNN A;  4NXI A;  3ZRD A;  2LUS A;  2PBJ A;  4ZBD A;  4AKI A;  3IPZ A;  4MF7 A;  4EE0 A;  2OKA A;  1TW9 A;  5B7C A;  2AUV A;  3M9K A;  3ZRE A;  2RII A;  3W8J A;  4DSQ A;  3HYP A;  5J9B A;  3LQ7 A;  4ZBA A;  2ON7 A;  2HSY A;  4E68 A;  3QR6 A;  1O73 A;  2H76 A;  3DWV A;  2GLR A;  2H72 A;  2E7P A;  1TI3 A;  1X9W B;  2H19 A;  1Q4J A;  4OCE A;  1QUW A;  5G30 A;  4KUN A;  2UZ8 A;  3GKK A;  2CX4 A;  2WZ9 A;  1NHO A;  1FVJ A;  4IKH A;  4TOP A;  1SK1 A;  3EU4 A;  4FO5 A;  4HZ2 A;  3EUR A;  2M72 A;  2I81 A;  4WF4 A;  1OE7 A;  4I5Q A;  4HSC X;  5HQP A;  4RI6 A;  4GLT A;  3ZIJ A;  4GCI A;  3TJF A;  2L4Q A;  4USS A;  5CRE A;  2JAC A;  2GST A;  1YDK A;  5ABR A;  13GS A;  5IO0 A;  1U88 A;  4KDX A;  4KGI A;  4POK A;  2LRC A;  2FWH A;  3WD6 A;  1SL1 B;  5IOW A;  2O8V B;  2IPA A;  2B5E A;  2HZF A;  1OE8 A;  4IQ1 A;  3H79 A;  1ZCP A;  2HZE B;  2VL2 A;  2FLS A;  1TRW A;  1WRY A;  1PRX A;  2EIQ A;  2DBC A;  1OKT A;  2VOC A;  4K2X A;  3APO A;  2C80 A;  2IMD A;  2ON5 A;  3E3E A;  1DE2 A;  2YWI A;  3IE3 A;  5IM9 A;  4HI7 A;  3R3E A;  2OE3 A;  1A2J A;  2H70 A;  2AB6 A;  4BVY A;  1FG4 A;  3TKQ A;  2HYX A;  2YV9 A;  3EU3 A;  4F0C A;  3LYP A;  2F3M A;  1SD9 A;  3IK7 A;  2WUL A;  5DAL B;  3KH7 A;  5HFG A;  2C0G A;  2CZ3 A;  3QFB C;  3GV1 A;  3LJR A;  1ZOF A;  2R5G A;  2E2G A;  2LS5 A;  4OFT A;  1N8J A;  3VPQ A;  1V57 A;  4GWR A;  5E59 A;  3HJM A;  4KND A;  6GSX A;  4Z2R A;  1AQV A;  4E8H A;  2L5O A;  3CSI A;  1DSB A;  5CRG A;  5J47 A;  2PPT A;  2OE1 A;  4KA0 A;  2CV4 A;  2FA4 A;  2MMZ A;  4O5U A;  2FGX A;  3RPN A;  1YKA A;  2L57 A;  2H0G A;  2QA2 A;  1VRS D;  1TP9 A;  4MCU A;  1YY7 A;  2CVB A;  4WR4 A;  5J4V A;  5CRW A;  2RUF A;  2CVK A;  2AYT A;  3KXO A;  2VUP A;  1I9D A;  5B8A A;  1A0R P;  5JWR B;  1GUH A;  1B9Y C;  4X4J A;  3LXZ A;  3ZML A;  1Y6E A;  1BX9 A;  1Z6N A;  5H5R A;  5IMA A;  2XPE A;  1NSW A;  2OA7 A;  2GZZ A;  3Q6O A;  1TK0 B;  4MZB A;  2K6V A;  3GUS A;  3H93 A;  1GSU A;  4YAV A;  2EFC A;  1VF3 A;  4Q5F A;  1SYR A;  4MF6 A;  4KW6 A;  1PN9 A;  4PHZ C;  2FWE A;  4WXT A;  5A1N A;  4QL9 A;  2WFC A;  3Q19 A;  2FWG A;  4EL1 A;  3GH6 A;  3HD5 A;  2MZC A;  2FNO A;  4ZB7 A;  2QA1 A;  5G2Z A;  1EZK A;  2R2J A;  4I2T A;  1M9A A;  4EXJ A;  4DSS B;  5J3R A;  5ENU A;  5AGY A;  5GST A;  4XS6 A;  4PGT A;  4F03 A;  2QGV A;  2HT9 A;  4N10 A;  2JU5 A;  4IQA A;  1XWA A;  3P90 A;  2LEG A;  3LGC A;  3AY8 A;  1QGV A;  3IA1 A;  4HZ4 A;  2AHE A;  2X8C A;  1G6W A;  5CRD A;  3LG6 A;  1T00 A;  5IPG A;  3HKR A;  3GX0 A;  4BA7 A;  2VO4 A;  3LFL A;  1K3O A;  4TR3 A;  2R0C A;  4O7H A;  4EO3 A;  2PU9 C;  3KMO A;  4HS1 A;  2H66 A;  1N25 A;  2OAD A;  1SJI A;  3F4S A;  4NHW A;  1SJ6 A;  3QAW A;  5ECP B;  5HR1 A;  4G19 A;  4K7N A;  4L0W A;  5GSS A;  1ML6 A;  4HU7 A;  3ZL5 A;  1R5A A;  4IP1 A;  4PNF A;  1SL0 B;  3UIW A;  5D8I A;  3O3T A;  2LRT A;  5G5E A;  3GL5 A;  4HOJ A;  5AIX A;  1XWG A;  4BVY B;  4NWY A;  2YWO A;  2BMX A;  1B4Q A;  4J57 E;  2GSS A;  6GSS A;  4ZL9 A;  3KTL A;  3W6G A;  2FY6 A;  1Z6M A;  3LSZ A;  1ERT A;  1E6B A;  4XHM A;  2FHE A;  3HVV A;  3FZ9 A;  1K0C A;  3HVS A;  4ILF A;  4GDF A;  3G7J A;  1A23 A;  4FH8 A;  1KEB A;  5DJL A;  3UBL A;  1Z5Y E;  4CHS A;  3WGX A;  1PL1 A;  2TIR A;  3IV4 A;  3GTU B;  2PVO C;  1XOA A;  2H30 A;  4I97 A;  2P0G A;  2VLU A;  1T4Z A;  4F9Z A;  2I9H A;  2YJ7 A;  1ZL9 A;  2A2R A;  4EDY A;  3CMI A;  2DMM A;  3GKM A;  3E0U A;  4NV5 A;  4FYU A;  1OVN A;  1AAZ A;  2WZS A;  1X5C A;  3VFI A;  3N5O A;  3LW9 A;  1XVW A;  2DJK A;  3NIV A;  2QC7 A;  2XBQ A;  2LV3 A;  1U87 A;  3ERG A;  3D4T A;  4FYC A;  2YAN A;  3G9B A;  3UVT A;  4YQU A;  3BD2 A;  4WF5 A;  1M3J A;  2V1M A;  2MYG A;  2OBI A;  2H71 A;  4TN8 A;  1RK4 A;  1XIY A;  2GS3 A;  3RAZ A;  1K0D A;  4TVE A;  5IIZ A;  3EIN A;  4GQC A;  2CAI A;  3FR3 A;  20GS A;  1PX7 A;  4K0G A;  5J9C A;  4PQH A;  2UV8 G;  4YH2 A;  2YZU A;  4PQI A;  3GN3 A;  3IHQ A;  1AC1 A;  1QXH A;  1QMV A;  3P7X A;  2VKZ G;  1KNG A;  1R7H A;  5A1N B;  3WGE A;  3PH9 A;  4MF5 A;  5D73 A;  3VWX A;  1YKC A;  4PXO A;  1MDK A;  2MMA A;  1USB A;  5HFI A;  1JLW A;  4LL1 B;  3PIN A;  1ZYN A;  1PL2 A;  4PTS A;  2I4A A;  3ISO A;  1W4V A;  1YEW C;  3TKS E;  2AV4 A;  1EGO A;  1GTB A;  3HXS A;  3RPP A;  2YOI A;  2DKH A;  3A2V A;  3CXG A;  3TOU A;  4ULX A;  1ZMA A;  4Z7X A;  3VWV A;  2K8S A;  1IYI A;  2YJH A;  4JRR A;  5DAK A;  4OWY A;  3EYT A;  1MD4 A;  5DCH A;  4GQF A;  5EL8 A;  1GUL A;  4XS4 A;  5ECO B;  4AKH A;  1A8Y A;  3FW2 A;  2H01 A;  4O92 A;  2IFQ B;  4QQ7 A;  2JSZ A;  5KOX A;  3MIX A;  1M0U A;  3L9U A;  5E4W A;  4KSM A;  1XG8 A;  4P3Y B;  2AJQ B;  1GUM A;  2V32 A;  3M1G A;  2CZ2 A;  2G2Q A;  3BBY A;  3FR6 A;  2R6K A;  1H75 A;  4BVX A;  3HVX A;  3F4T A;  2IIY A;  4KSO A;  2ZNM A;  3M9J A;  1ZZY A;  5IPH A;  2HQT A;  4X0X A;  1GLP A;  2V6K A;  2LNS A;  3C1S A;  1OKD A;  3BJ5 A;  4N30 A;  3UAP A;  2WDU A;  1LBK A;  4WKW A;  1S4B P;  2DLX A;  4TR0 A;  5G1L A;  4AJ6 A;  3ZIV A;  3UL3 A;  4I2U A;  2H0I A;  3DD3 A;  5DCG A;  5JWQ B;  2BJX A;  4Z2T A;  2C1Y A;  2YP6 A;  3WT2 A;  2H6X A;  2X49 A;  4MJB A;  1ON4 A;  2B6M A;  2O36 A;  1JZW A;  2WVX A;  4RI7 A;  1V40 A;  3TU3 B;  4ACS A;  2N5B A;  4A5P A;  2GSR A;  5KN2 A;  1M9B A;  1SL2 B;  2VAF A;  3PPU A;  1UA5 A;  1TRS A;  1LU4 A;  2LJK A;  2QSI A;  4AJ8 A;  4L5O A;  5D9W A;  1TU8 A;  4ZIL A;  2A4V A;  3DKS A;  1Z7R A;  2H6Z A;  3QD9 A;  3CQF A;  5A4U A;  1XW9 A;  3HJO A;  3MYD A;  3EVI A;  2NPB A;  1WJK A;  2XBI A;  2KOK A;  3P8W A;  1RW1 A;  2RM6 A;  2C0D A;  1THO A;  4HUA A;  1AQX A;  3QFA C;  4KCE A;  3FZA A;  1XOB A;  3ZVJ A;  5CO3 A;  4PUA A;  5G31 A;  4ML6 A;  3FYG A;  4OFM A;  2L6D A;  2L4C A;  3O76 A;  2B3S A;  3UEM A;  1S3C A;  4MH2 A;  2H6Y A;  4OFN A;  2EFD A;  2DML A;  2GT5 A;  1TK8 B;  5HFK A;  1B9X C;  1DUG A;  2JZR A;  4L5L A;  4MK3 A;  3FMW A;  2VL2 C;  6GSY A;  1W89 A;  3ZIT A;  5ECQ B;  3ZLP A;  3IHG A;  3RHC A;  1BQ7 A;  2C4J A;  3M3M A;  2HXK A;  2HSM A;  2WB9 A;  3JCM L;  2GGT A;  2EC4 A;  4XS4 B;  4TKY A;  1F3A A;  1GSQ A;  1Z9H A;  4POM A;  1FAA A;  3TRQ A;  5B8B A;  2H8L A;  5EVO A;  2O89 A;  4KAE A;  1OC3 A;  4ZBB A;  2MMO A;  1OC9 B;  3KP9 A;  2L5L A;  1JHB A;  2VL3 A;  4ZB6 A;  3TB2 A;  3VI7 A;  1K0N A;  1XZO A;  4I8B A;  2N5A A;  2K8V A;  5ECS A;  2RLI A;  1X5E A;  2V41 A;  5F05 A;  1UC7 A;  2OJL A;  3D6I A;  3DVW A;  1O8X A;  1LJR A;  2G0F A;  4BVX B;  1ABA A;  4PI0 C;  1WWJ A;  1AIU A;  5A5H A;  4BL7 B;  2IMF A;  1PMT A;  1AQW A;  4V2N A;  5AIS A;  1J9B A;  3VWU A;  1KBN A;  16GS A;  1TOF A;  1GTI A;  3HMJ G;  1U6T A;  2HSN A;  9GSS A;  4GSN A;  2DIZ A;  2HRN A;  3C7M A;  2YZH A;  3TRX A;  2HRK A;  1FVK A;  2ES7 A;  4MDC A;  2VCV A;  3A3T A;  3FKF A;  4HU9 A;  1SVM A;  5HR3 A;  5B6M A;  4I6X A;  2PUK C;  3WT1 A;  6GSV A;  3P2A A;  4ZIJ A;  2HRA A;  2YPM A;  3CYN A;  3CWG A;  4EIQ A;  4PQ1 A;  3ZTL A;  5IMV A;  1WP0 A;  3MDK A;  1N2A A;  3QAV A;  2DSA A;  3Q74 A;  4FXY P;  5KOW A;  1EGR A;  5D93 A;  3GIX A;  4AKX B;  1R26 A;  1SKW B;  1YF1 A;  6GSW A;  3I43 A;  4QMK A;  4OMV A;  3GRX A;  1PSQ A;  1SU9 A;  2X8H A;  4AGS A;  2OAC A; 
#chains in the Genus database with same CATH homology
 2P5Q A;  4IP6 A;  1B4P A;  5CAX A;  2R37 A;  1EOG A;  5KN3 A;  4DVC A;  4ISD A;  4FQU A;  5LD0 A;  3H4K A;  6GSU A;  4ICY A;  3ERF A;  4ZB8 A;  1VF2 A;  2F9S A;  3QAG A;  4BWQ A;  2H1G A;  3EMP A;  2A4H A;  1NHY A;  5D9V A;  5ECK B;  2H1B A;  2Z9S A;  2EIO A;  1U3I A;  4MJE A;  3LOR A;  4K2D A;  1UVZ A;  1YZX A;  4D73 A;  2IN3 A;  4EC0 A;  1EV9 A;  3A2W A;  4AF2 A;  1JLV A;  3GHA A;  5EPF A;  1XW5 A;  2WRT A;  2C0E A;  2H1D A;  1PKZ A;  5ID2 A;  2GQL A;  5IMZ A;  4LMV A;  4HEA 2;  1ACV A;  5IMC A;  3L9V A;  2PGT A;  3QPM A;  3KGK A;  3G7Y A;  2HSM B;  2VIM A;  2EIR A;  2V2G A;  4TR1 A;  4MAB A;  5IMD A;  3A5W A;  3J7Y k;  2KHP A;  4ZL7 A;  4RQR A;  3FRC A;  5HR2 A;  2QKE A;  4WET A;  4G0K A;  5DDL A;  2FA8 A;  3F4R A;  3ZFB A;  3ME8 A;  4K5R A;  2WGR A;  3HCZ A;  4EDZ A;  1QFN A;  1MDJ A;  1FB0 A;  3UOM A;  1V2A A;  4L8E A;  1BF5 A;  5A5K A;  4JBB A;  2FCH A;  1EV4 A;  5G5F A;  2WJU A;  2B1K A;  5A5H B;  1K3L A;  2H74 A;  3V1W A;  1TRV A;  4IHU A;  5ECI B;  1VF1 A;  1MD3 A;  3KZQ A;  3GKN A;  2FD3 A;  2HSN B;  3TKR A;  4QL7 A;  1A24 A;  3GH9 A;  1HNB A;  3QOU A;  3ZYW A;  2HRK B;  2C0F A;  3GX8 A;  1K0B A;  3GNJ A;  4LA1 A;  1YQ1 A;  1TJD A;  5IOX A;  4RQX A;  1GLQ A;  4EVM A;  1A8L A;  3APS A;  3PR8 A;  2JAD A;  4LLR A;  3QDN A;  2IME A;  4OO4 A;  3TRP A;  1URM A;  3FR9 A;  1PN0 A;  1FB6 A;  3F6D A;  3GA4 A;  2KP1 A;  3F0I A;  4CDO A;  4EF0 A;  3MAK A;  5A4W A;  2LJA A;  2HI7 A;  1SYX A;  1X9S B;  1S3D A;  1F3B A;  1YEX A;  3DVX A;  4YKG A;  3L0H A;  2AAW A;  1B8X A;  1MEK A;  3KH9 A;  4F2I A;  2R4V A;  1T8E B;  5EY6 A;  1JZO A;  1SD8 A;  4N11 A;  5BRT A;  1BG1 A;  8GSS A;  3FZ4 A;  4MP4 A;  1O81 A;  3KIJ A;  2PVQ A;  5JCW A;  3FK8 A;  1DE1 A;  3KTB A;  4EIP A;  2C8U A;  3IC4 A;  2F8F A;  1S3A A;  4HJM A;  5FT3 A;  1WPI A;  3OR5 A;  2YV7 A;  5JWO B;  1X5D A;  4IBP A;  1UN2 A;  4YQM A;  4K7I A;  2NBS A;  2HFD A;  1GNW A;  2J23 A;  1HNA A;  2B1L A;  4IJ3 A;  3D0Z A;  3GSS A;  3KD0 A;  5DJM A;  1YVL A;  4PX1 A;  3BOA A;  1C72 A;  4V1A g;  3LXT A;  4LL4 B;  3PGT A;  3F3R A;  4G0L A;  1A2L A;  1GP1 A;  1GSY A;  4MJC A;  3TUE A;  5ID2 B;  1ZYE A;  2BTO T;  1GSE A;  2CX3 A;  2LQO A;  12GS A;  1EWX A;  1M2D A;  3HDC A;  1IYH A;  2VLV A;  3DYR A;  4BWS A;  2KP2 A;  1O85 A;  4N0Z A;  1U3A A;  2R0G A;  4HQZ A;  4TR1 B;  2HE3 A;  5IQY A;  1SK0 A;  1XW6 A;  4IJI A;  1HYU A;  3FZ5 A;  1Y25 A;  3BCI A;  3GYK A;  2DJ3 A;  1XWK A;  1OC8 A;  3DML A;  1B48 A;  4TXV A;  2HSH A;  2O7K A;  1PKW A;  2VD0 A;  2IL3 A;  4Q5N A;  4JED A;  4XRA A;  3CRU A;  5F0G A;  2XC2 A;  2HZE A;  1R4W A;  2E0Q A;  3CSH A;  2X8G A;  1BED A;  2JZT A;  1SVL A;  5ECN B;  2VL9 A;  4G10 A;  1GWC A;  3D5J A;  4XIH A;  2I3Y A;  2H73 A;  1BYE A;  2NDO A;  1XCC A;  4CY8 A;  3BCK A;  4WBR D;  2C3T A;  4WEY A;  1SKS B;  4LMW A;  3KJY A;  4TW5 A;  3H8Q A;  1X9M B;  3CTF A;  3TJB A;  1ZYQ B;  4O5R A;  1G7O A;  5KN1 A;  1F6M C;  4PUF C;  2KUC A;  4V1A p;  3DRN A;  5DAL A;  4JZQ A;  4F0B A;  3VUR A;  5IMF A;  2GSQ A;  4MLY A;  1BAY A;  4ZB9 A;  5J4Y A;  2MBT A;  2YN1 A;  5JCG A;  1ERU A;  2OT3 A;  3RHB A;  1SK2 A;  4MJA A;  1PX6 A;  2X99 A;  3G7I A;  5G1K A;  5GZZ B;  4J2F A;  3MWH A;  3VK9 A;  5CRH A;  3IK9 A;  4V2L A;  1SKR B;  4ECC A;  4K7O A;  4POL A;  2ZUP A;  4X43 A;  2DKI A;  3A2X A;  3UJ1 A;  4FYB A;  2GVP A;  1XVQ A;  3I6A A;  1TRU A;  3A5I A;  3N9J A;  1TI1 A;  5A34 A;  3GST A;  4W66 A;  2GTU A;  1A2M A;  4ML1 A;  3LYK A;  1SJZ A;  5C04 A;  3KM6 A;  3CTG A;  3Q18 A;  5F07 A;  2OE0 A;  4N0V A;  1TDI A;  4G0I A;  1FOV A;  7GSS A;  2REM A;  1NW2 A;  2YCD A;  4KB3 A;  3FHK A;  1Y1U A;  4JR6 A;  1ST9 A;  1TTZ A;  1T4Y A;  22GS A;  5JCU A;  3CRT A;  4FIW A;  2WS2 A;  4IEL A;  4GF0 A;  3EPT A;  3J7Y b;  1Q98 A;  4ZL8 A;  4YKF A;  2YWM A;  6GST A;  2MBS A;  3MSZ A;  4NV2 A;  4WBJ A;  2NTO A;  1SVO A;  4PUR A;  1Z7P A;  5GAN D;  2H1L A;  3TKS C;  4JR4 A;  5BMU A;  2C3N A;  5DAK B;  1PQN A;  14GS A;  4DSS A;  4J56 E;  4TRX A;  2LKU A;  4Q5R A;  4GRF A;  2O87 A;  1V98 A;  4MZC A;  3DIE A;  3LWA A;  5IO2 A;  4IS0 A;  3SWL A;  1XWB A;  3TKS A;  1FOH A;  3HZ4 A;  5H5Q A;  4V2M A;  4K0N A;  1YF0 A;  4ZXG A;  2KLX A;  2P31 A;  3U5R E;  2LTK A;  2XHF A;  3UBK A;  4DEJ A;  2PMT A;  2HNL A;  1T7P B;  2K9F A;  3VWW A;  1FHE A;  1QK8 A;  3GMF A;  2MMN A;  3TOT A;  2DJJ A;  1A0F A;  4ECB A;  2J9H A;  5DVB A;  3ERW A;  2R3X A;  10GS A;  2CQ9 A;  2RM5 A;  5CYY A;  2HLS A;  3F8U A;  4IVF A;  4MPG A;  3KEB A;  4O5Q A;  5AN1 A;  2K18 A;  5DQY A;  2CVD A;  2B5X A;  3UMA A;  3UVH A;  4PNG A;  3DXB A;  1MDI A;  2VLT A;  1OAZ A;  2PWJ A;  3GKX A;  4OO5 A;  5A4V A;  4HJ2 A;  4DSR A;  1O8W A;  2H0H A;  3GFK A;  1G7E A;  4IGJ A;  3ME7 A;  4GXZ A;  1AXD A;  2P5R A;  4K6X A;  4MPF A;  3GL3 A;  2DJ2 A;  3EE2 A;  5COH A;  4KCA A;  3EWL A;  5CP1 A;  4H86 A;  2DIY A;  2GQM A;  3GTU A;  3S9F A;  2VCT A;  4AJ7 A;  4WR5 A;  2VD1 A;  1FO5 A;  1GSS A;  4CY6 A;  1V58 A;  2DC5 A;  4KX4 A;  3TGZ A;  2L6C A;  3M0F A;  3LEF A;  2LQQ A;  5J5N A;  1XFL A;  4EKZ A;  4Q5Q A;  2CT6 A;  4GTU A;  1M7T A;  3KP8 A;  1DBY A;  5A34 B;  1CQG A;  4NHZ A;  3ED3 A;  3IAM 2;  1EEJ A;  1M2A A;  3F3Q A;  2F51 A;  2DJ1 A;  1XXU A;  2VCW A;  1TU7 A;  4O32 A;  1VGL A;  5KN0 A;  3EC3 A;  5F8B A;  4MZW A;  3F6F A;  4IW9 A;  3UAR A;  1F9M A;  3W8S A;  5ECH B;  3ZMK A;  2R0P A;  2EFE A;  3I9V 2;  4MMM A;  3TDG A;  1XPV A;  1O6J A;  3FEU A;  2JZS A;  3U6V A;  1GSD A;  1PD2 1;  1BG5 A;  4XS1 A;  2E2M A;  1THX A;  3D22 A;  4K5S A;  5ECL B;  4K9Z A;  5INY A;  2X4A A;  3TJG A;  3O6T A;  1WMJ A;  5D96 A;  5BMU B;  3IRA A;  3WYW A;  4POB A;  1ZGN A;  5LCZ A;  1J08 A;  3EMX A;  1M2B A;  2A2S A;  2M80 A;  3L4N A;  4TXO A;  2H75 A;  3CBU A;  3K8N A;  2NVL A;  3C1R A;  3VI5 A;  1O7U A;  1T1V A;  5H5S A;  5B6N A;  3QCP A;  3US3 A;  4TR4 A;  3L9S A;  4GSS A;  4NAX A;  2O85 A;  2IFQ A;  4EUY A;  4KDY A;  2GDR A;  1VF4 A;  1K0A A;  1JZR A;  2VCQ A;  2PER A;  1GUK A;  1EP8 A;  1SEN A;  5D9X A;  1HD2 A;  4RUV A;  3RDW A;  3TKP A;  1WOU A;  1JFU A;  2LNT A;  1J0F A;  1TK5 B;  5FWG A;  3HA9 A;  4IN0 A;  4OD7 A;  1FW1 A;  2YWN A;  1HNC A;  1GNE A;  2A2P A;  4XRD A;  1XBS A;  1QQ2 A;  4N3Z A;  1Z3E A;  2EFH A;  3RBT A;  2O5V A;  1GTA A;  4JE1 A;  5ELG A;  3SBC A;  4XCS A;  3TJK A;  1G0T A;  1WIK A;  4KDU A;  3CSJ A;  2HRF A;  3ZZX A;  4L0U A;  1EP7 A;  2X64 A;  1F37 A;  2V6O A;  1BJX A;  1AW9 A;  1T3B A;  2IWT A;  3KMN A;  1G6Y A;  1TXU A;  1F2E A;  3VPT A;  4G2E A;  2ALB A;  3ZFL A;  4X1U A;  5ECR B;  2VCX A;  3HY2 A;  4HQS A;  3M8N A;  1PA3 A;  3HZ8 A;  3APQ A;  2VM1 A;  4BPY A;  2N5F A;  1YEP A;  3F63 A;  4GST A;  1E2Y A;  3NZN A;  1RQM A;  1GH2 A;  3IC8 A;  3IBH A;  2I1U A;  3FY7 A;  1TXX A;  3KCM A;  2DJ0 A;  3D4M A;  2PN8 A;  2JSY A;  1K0O A;  4AKG A;  1EOH A;  5CNW A;  2B7J A;  4AI6 A;  1ERW A;  4G01 A;  3QMX A;  1OYJ A;  5J4U A;  1YJ6 A;  2ZCT A;  4K8M A;  1TKD B;  2LJR A;  2FUG 2;  2RUE A;  3IAS 2;  4YQV A;  2IMK A;  2C3Q A;  4D73 B;  19GS A;  2L59 A;  2CA8 A;  4KH7 A;  1GRX A;  5J40 A;  1HQO A;  1I5G A;  3TCO A;  2M46 A;  5L71 A;  2H1A A;  2WCI A;  1JZD A;  1XWC A;  1GL8 A;  2B5Y A;  4NMU A;  4ECJ A;  4JU5 A;  2XPD A;  3C8E A;  3IOS A;  1GSF A;  4ECI A;  1GTU A;  2GQK A;  3IR4 A;  3H1N A;  1ZYP A;  2IMI A;  2LST A;  3F9U A;  3IDV A;  4YAP A;  2FWF A;  5DBQ A;  2TRC P;  11GS A;  2YNX A;  2IJY A;  1V9W A;  4TXO B;  5HR0 A;  17GS A;  3MNG A;  3D21 A;  4KF9 A;  2B7K A;  3ZVJ D;  2D2Z A;  2F8A A;  3HJP A;  3GUR A;  3VLN A;  2TRX A;  2GZY A;  4ID0 A;  2CAQ A;  4CW9 A;  5AIV A;  4MH3 A;  1OC9 A;  5F06 A;  4K1F A;  1ILO A;  3C73 A;  1H4O A;  5C00 A;  5LNK e;  1R5P A;  4MA9 A;  4Z2U A;  1K3Y A;  5ELA A;  2GZP A;  2LRN A;  5FHI A;  1CQH A;  3HHV A;  5DQS A;  1WE0 A;  4XTS A;  5KEJ A;  1ERV A;  4E8E A;  2JL4 A;  1KTE A;  2VCZ A;  4KE3 A;  3C71 A;  3DEX A;  3TJJ A;  4BL7 A;  3I69 A;  3L78 A;  4HDE A;  4G9H A;  4NPB A;  4OCF A;  3R2Q A;  3NOF A;  3WGD A;  5J41 A;  5ECM B;  2GT6 A;  5GAP D;  1MTC A;  1AUC A;  1M99 A;  5D9T A;  2VM2 A;  4F82 A;  1K0M A;  1X0R A;  1PGT A;  3DGQ A;  18GS A;  3IXR A;  1EEM A;  1NM3 A;  3E9J B;  2OBK A;  4MNN A;  4NXI A;  3ZRD A;  2LUS A;  2PBJ A;  4ZBD A;  4AKI A;  3IPZ A;  4MF7 A;  4EE0 A;  2OKA A;  1TW9 A;  5B7C A;  2AUV A;  3M9K A;  3ZRE A;  2RII A;  3W8J A;  4DSQ A;  3HYP A;  5J9B A;  3LQ7 A;  4ZBA A;  2ON7 A;  2HSY A;  4E68 A;  3QR6 A;  1O73 A;  2H76 A;  3DWV A;  2GLR A;  2H72 A;  2E7P A;  1TI3 A;  1X9W B;  2H19 A;  1Q4J A;  4OCE A;  1QUW A;  5G30 A;  4KUN A;  2UZ8 A;  3GKK A;  2CX4 A;  2WZ9 A;  1NHO A;  1FVJ A;  4IKH A;  4TOP A;  1SK1 A;  3EU4 A;  4FO5 A;  4HZ2 A;  3EUR A;  2M72 A;  2I81 A;  4WF4 A;  1OE7 A;  4I5Q A;  5HQP A;  4RI6 A;  4GLT A;  3ZIJ A;  4GCI A;  3TJF A;  2L4Q A;  4USS A;  5CRE A;  2JAC A;  2GST A;  1YDK A;  5ABR A;  13GS A;  5IO0 A;  1U88 A;  4KDX A;  4KGI A;  4POK A;  2LRC A;  2FWH A;  3WD6 A;  1SL1 B;  5IOW A;  2O8V B;  2IPA A;  2B5E A;  2HZF A;  1OE8 A;  4IQ1 A;  3H79 A;  1ZCP A;  2HZE B;  2VL2 A;  2FLS A;  1TRW A;  1WRY A;  1PRX A;  2EIQ A;  2DBC A;  1OKT A;  2VOC A;  4K2X A;  3APO A;  2C80 A;  2IMD A;  2ON5 A;  3E3E A;  1DE2 A;  2YWI A;  3IE3 A;  5IM9 A;  4HI7 A;  3R3E A;  2OE3 A;  1A2J A;  2H70 A;  2AB6 A;  4BVY A;  1FG4 A;  3TKQ A;  2HYX A;  2YV9 A;  3EU3 A;  4F0C A;  3LYP A;  2F3M A;  1SD9 A;  3IK7 A;  2WUL A;  5DAL B;  3KH7 A;  5HFG A;  2C0G A;  2CZ3 A;  3QFB C;  3GV1 A;  3LJR A;  1ZOF A;  2R5G A;  2E2G A;  2LS5 A;  4OFT A;  1N8J A;  3VPQ A;  1V57 A;  4GWR A;  5E59 A;  3HJM A;  4KND A;  6GSX A;  4Z2R A;  1AQV A;  4E8H A;  2L5O A;  3CSI A;  1DSB A;  5CRG A;  5J47 A;  2PPT A;  2OE1 A;  4KA0 A;  2CV4 A;  2FA4 A;  2MMZ A;  4O5U A;  2FGX A;  3RPN A;  1YKA A;  2L57 A;  2H0G A;  2QA2 A;  1VRS D;  1TP9 A;  4MCU A;  1YY7 A;  2CVB A;  4WR4 A;  5J4V A;  5CRW A;  2RUF A;  2CVK A;  2AYT A;  3KXO A;  2VUP A;  1I9D A;  5B8A A;  1A0R P;  5JWR B;  1GUH A;  1B9Y C;  4X4J A;  3LXZ A;  3ZML A;  1Y6E A;  1BX9 A;  1Z6N A;  5H5R A;  5IMA A;  2XPE A;  1NSW A;  2OA7 A;  2GZZ A;  3Q6O A;  1TK0 B;  4MZB A;  2K6V A;  3GUS A;  3H93 A;  1GSU A;  4YAV A;  2EFC A;  1VF3 A;  4Q5F A;  1SYR A;  4MF6 A;  4KW6 A;  1PN9 A;  2FWE A;  4WXT A;  5A1N A;  4QL9 A;  2WFC A;  3Q19 A;  2FWG A;  4EL1 A;  3GH6 A;  3HD5 A;  2MZC A;  2FNO A;  4ZB7 A;  2QA1 A;  5G2Z A;  1EZK A;  2R2J A;  4I2T A;  1M9A A;  4EXJ A;  4DSS B;  5J3R A;  5ENU A;  5AGY A;  5GST A;  4XS6 A;  4PGT A;  4F03 A;  2QGV A;  2HT9 A;  4N10 A;  2JU5 A;  4IQA A;  1XWA A;  3P90 A;  2LEG A;  3LGC A;  3AY8 A;  1QGV A;  3IA1 A;  4HZ4 A;  2AHE A;  2X8C A;  1G6W A;  5CRD A;  3LG6 A;  1T00 A;  5IPG A;  3HKR A;  3GX0 A;  4BA7 A;  2VO4 A;  3LFL A;  1K3O A;  4TR3 A;  2R0C A;  4O7H A;  4EO3 A;  2PU9 C;  3KMO A;  4HS1 A;  2H66 A;  1N25 A;  2OAD A;  1SJI A;  3F4S A;  4NHW A;  1SJ6 A;  3QAW A;  5ECP B;  5HR1 A;  4G19 A;  4K7N A;  4L0W A;  5GSS A;  1ML6 A;  4HU7 A;  3ZL5 A;  1R5A A;  4IP1 A;  4PNF A;  1SL0 B;  3UIW A;  5D8I A;  3O3T A;  2LRT A;  5G5E A;  3GL5 A;  4HOJ A;  5AIX A;  1XWG A;  4BVY B;  4NWY A;  2YWO A;  2BMX A;  1B4Q A;  4J57 E;  2GSS A;  6GSS A;  4ZL9 A;  3KTL A;  3W6G A;  2FY6 A;  1Z6M A;  3LSZ A;  1ERT A;  1E6B A;  4XHM A;  2FHE A;  3HVV A;  3FZ9 A;  1K0C A;  3HVS A;  4ILF A;  4GDF A;  3G7J A;  1A23 A;  4FH8 A;  1KEB A;  5DJL A;  3UBL A;  1Z5Y E;  4CHS A;  3WGX A;  1PL1 A;  2TIR A;  3IV4 A;  3GTU B;  2PVO C;  1XOA A;  2H30 A;  4I97 A;  2P0G A;  2VLU A;  1T4Z A;  4F9Z A;  2I9H A;  2YJ7 A;  1ZL9 A;  2A2R A;  4EDY A;  3CMI A;  2DMM A;  3GKM A;  3E0U A;  4NV5 A;  4FYU A;  1OVN A;  1AAZ A;  1X5C A;  3VFI A;  3N5O A;  3LW9 A;  1XVW A;  2DJK A;  3NIV A;  2QC7 A;  2XBQ A;  2LV3 A;  1U87 A;  3ERG A;  3D4T A;  4FYC A;  2YAN A;  3G9B A;  3UVT A;  4YQU A;  3BD2 A;  4WF5 A;  2V1M A;  2MYG A;  2OBI A;  2H71 A;  4TN8 A;  1RK4 A;  1XIY A;  2GS3 A;  3RAZ A;  1K0D A;  4TVE A;  5IIZ A;  3EIN A;  4GQC A;  2CAI A;  3FR3 A;  20GS A;  1PX7 A;  4K0G A;  5J9C A;  4PQH A;  2UV8 G;  4YH2 A;  2YZU A;  4PQI A;  3GN3 A;  3IHQ A;  1AC1 A;  1QXH A;  1QMV A;  3P7X A;  2VKZ G;  1KNG A;  1R7H A;  5A1N B;  3WGE A;  3PH9 A;  4MF5 A;  5D73 A;  3VWX A;  1YKC A;  4PXO A;  1MDK A;  2MMA A;  1USB A;  5HFI A;  1JLW A;  4LL1 B;  3PIN A;  1ZYN A;  1PL2 A;  4PTS A;  2I4A A;  3ISO A;  1W4V A;  3TKS E;  2AV4 A;  1EGO A;  1GTB A;  3HXS A;  3RPP A;  2YOI A;  2DKH A;  3A2V A;  3CXG A;  3TOU A;  4ULX A;  1ZMA A;  4Z7X A;  3VWV A;  2K8S A;  1IYI A;  2YJH A;  4JRR A;  5DAK A;  4OWY A;  3EYT A;  1MD4 A;  5DCH A;  4GQF A;  5EL8 A;  1GUL A;  4XS4 A;  5ECO B;  4AKH A;  1A8Y A;  3FW2 A;  2H01 A;  4O92 A;  2IFQ B;  4QQ7 A;  2JSZ A;  5KOX A;  3MIX A;  1M0U A;  3L9U A;  5E4W A;  4KSM A;  4P3Y B;  2AJQ B;  1GUM A;  2V32 A;  3M1G A;  2CZ2 A;  2G2Q A;  3BBY A;  3FR6 A;  2R6K A;  1H75 A;  4BVX A;  3HVX A;  3F4T A;  2IIY A;  4KSO A;  2ZNM A;  3M9J A;  1ZZY A;  5IPH A;  2HQT A;  4X0X A;  1GLP A;  2V6K A;  2LNS A;  3C1S A;  1OKD A;  3BJ5 A;  4N30 A;  3UAP A;  2WDU A;  1LBK A;  4WKW A;  2DLX A;  4TR0 A;  5G1L A;  4AJ6 A;  3ZIV A;  3UL3 A;  4I2U A;  2H0I A;  3DD3 A;  5DCG A;  5JWQ B;  2BJX A;  4Z2T A;  2C1Y A;  2YP6 A;  3WT2 A;  2H6X A;  2X49 A;  4MJB A;  1ON4 A;  2B6M A;  1JZW A;  4RI7 A;  1V40 A;  3TU3 B;  4ACS A;  2N5B A;  4A5P A;  2GSR A;  5KN2 A;  1M9B A;  1SL2 B;  2VAF A;  3PPU A;  1UA5 A;  1TRS A;  1LU4 A;  2LJK A;  2QSI A;  4AJ8 A;  4L5O A;  5D9W A;  1TU8 A;  4ZIL A;  2A4V A;  3DKS A;  1Z7R A;  2H6Z A;  3QD9 A;  5A4U A;  1XW9 A;  3HJO A;  3MYD A;  3EVI A;  2NPB A;  1WJK A;  2XBI A;  2KOK A;  3P8W A;  1RW1 A;  2RM6 A;  2C0D A;  1THO A;  4HUA A;  1AQX A;  3QFA C;  4KCE A;  3FZA A;  1XOB A;  3ZVJ A;  5CO3 A;  4PUA A;  5G31 A;  4ML6 A;  3FYG A;  4OFM A;  2L6D A;  2L4C A;  3O76 A;  2B3S A;  3UEM A;  1S3C A;  4MH2 A;  2H6Y A;  4OFN A;  2EFD A;  2DML A;  2GT5 A;  1TK8 B;  5HFK A;  1B9X C;  1DUG A;  2JZR A;  4L5L A;  4MK3 A;  3FMW A;  2VL2 C;  6GSY A;  1W89 A;  3ZIT A;  5ECQ B;  3ZLP A;  3IHG A;  3RHC A;  1BQ7 A;  2C4J A;  3M3M A;  2HXK A;  2HSM A;  2WB9 A;  3JCM L;  2GGT A;  2EC4 A;  4XS4 B;  4TKY A;  1F3A A;  1GSQ A;  1Z9H A;  4POM A;  1FAA A;  3TRQ A;  5B8B A;  2H8L A;  5EVO A;  2O89 A;  4KAE A;  1OC3 A;  4ZBB A;  2MMO A;  1OC9 B;  3KP9 A;  2L5L A;  1JHB A;  2VL3 A;  4ZB6 A;  3TB2 A;  3VI7 A;  1K0N A;  1XZO A;  4I8B A;  2N5A A;  2K8V A;  5ECS A;  2RLI A;  1X5E A;  2V41 A;  5F05 A;  1UC7 A;  2OJL A;  3D6I A;  3DVW A;  1O8X A;  1LJR A;  2G0F A;  4BVX B;  1ABA A;  1WWJ A;  1AIU A;  5A5H A;  4BL7 B;  2IMF A;  1PMT A;  1AQW A;  4V2N A;  5AIS A;  1J9B A;  3VWU A;  1KBN A;  16GS A;  1TOF A;  1GTI A;  3HMJ G;  1U6T A;  2HSN A;  9GSS A;  4GSN A;  2DIZ A;  2HRN A;  3C7M A;  2YZH A;  3TRX A;  2HRK A;  1FVK A;  2ES7 A;  4MDC A;  2VCV A;  3A3T A;  3FKF A;  4HU9 A;  1SVM A;  5HR3 A;  5B6M A;  4I6X A;  2PUK C;  3WT1 A;  6GSV A;  3P2A A;  4ZIJ A;  2HRA A;  2YPM A;  3CYN A;  3CWG A;  4EIQ A;  4PQ1 A;  3ZTL A;  5IMV A;  1WP0 A;  3MDK A;  1N2A A;  3QAV A;  2DSA A;  3Q74 A;  5KOW A;  1EGR A;  5D93 A;  3GIX A;  4AKX B;  1R26 A;  1SKW B;  1YF1 A;  6GSW A;  3I43 A;  4QMK A;  4OMV A;  3GRX A;  1PSQ A;  1SU9 A;  2X8H A;  4AGS A;  2OAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...