2VCWA

Complex structure of prostaglandin d2 synthase at 1.95a.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vcwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vcwA01
1GRXA 2GZZA 4POMA 2RLIA 2YNXA 2QC7A 1XWKA 1V40A 2CQ9A 3IAS2 2IWTA 2DJ0A 3I6AA 1M9AA 1QFNA 5JCGA 3FR6A 1GSEA 2HRAA 2X8GA 3LXZA 1XOAA 5DAKA 5ECQB 1SENA 2P5RA 1EP8A 2CVBA 2JL4A 3UAPA 2VCQA 4IELA 3WD6A 2GGTA 2MBTA 1WMJA 4BWSA 1X9MB 3CMIA 5H5QA 2OKAA 4GTUA 5A4UA 4ECCA 4IW9A 5BMUA 3H93A 2KLXA 2YN1A 4PX1A 2IMKA 3DGQA 4IQ1A 4LA1A 5ECSA 2K18A 3QOUA 3G9BA 1FB6A 1R26A 2B3SA 4LL1B 1BX9A 4N0ZA 6GSTA 2LRTA 3UOMA 3I9V2 2ON7A 5EL8A 5EPFA 3LJRA 4TVEA 4WKWA 4POBA 4D73A 4LMVA 5DJMA 5EVOA 4TW5A 3GX0A 1BAYA 4V2LA 1PRXA 3TKRA 1F2EA 1PGTA 3DWVA 4N30A 2IFQA 4NHWA 3P7XA 1MD3A 2K8SA 2H6XA 4HJMA 3NZNA 2JZRA 4WF4A 1GSUA 2YV7A 4OWYA 4BL7A 4PTSA 5J9CA 1ZMAA 1SK2A 2O87A 3EMPA 3QDNA 3APOA 4ZL9A 4D73B 2H6YA 1EWXA 1TW9A 3F8UA 3GKMA 3HVSA 1MDIA 2VM1A 4OCEA 2PERA 2FWGA 4MF7A 4NPBA 1GTBA 2IFQB 2HRNA 3ZMKA 2DJJA 4WF5A 1TU7A 4K6XA 1VRSD 3ZZXA 3TOTA 4BL7B 4BVXA 2WRTA 2DBCA 3LSZA 3J7Yk 1XOBA 3L9SA 1GUMA 3GTUA 4KW6A 2QGVA 5JCUA 3QAGA 1ERUA 1ZOFA 2FNOA 4ZBBA 4TR4A 2C3QA 3RPPA 4JR6A 3MWHA 5INYA 3VPTA 4RQRA 3WGXA 3HHVA 4JRRA 1XWCA 4MZWA 16GSA 3A2WA 3DD3A 1SL2B 2YANA 4BVXB 3QMXA 3HVXA 1T8EB 3D0ZA 3DVXA 2DMLA 3GTUB 4OMVA 1GSQA 1FVKA 3US3A 2HSYA 5ECOB 4ZB8A 2AJQB 4N10A 2B1KA 1EEMA 1SK1A 1KEBA 3P90A 4AJ7A 1J08A 14GSA 3ME8A 3GKXA 4K8MA 4V1Ag 1V58A 2E0QA 2N5BA 1OC8A 4NXIA 1B9YC 1TKDB 3UL3A 2HE3A 4HJ2A 10GSA 2PU9C 1CQHA 2WZ9A 2YZHA 3CXGA 2H1DA 4N11A 3TKPA 4FO5A 1QXHA 3CRTA 7GSSA 3LXTA 2FWEA 3IPZA 2M46A 4ZBAA 3TJJA 4IHUA 2FGXA 2FY6A 3S9FA 1S3AA 3GA4A 4F9ZA 1IYHA 2DJ3A 2LQOA 4F2IA 2WFCA 4MH3A 4V2MA 5JWQB 3KCMA 1WIKA 4X0XA 3JCML 4Q5NA 4ZILA 2C8UA 3TJKA 2P0GA 5ECKB 2AHEA 4GQFA 4ZBDA 3HXSA 3GIXA 3IOSA 2F8AA 1FAAA 3HZ4A 2YP6A 1FOVA 2A2SA 1X5CA 2VL2C 3LG6A 3RBTA 1F3BA 2C0GA 1UVZA 3HZ8A 2HRKB 4OFMA 2YZUA 4XRAA 1QUWA 2H8LA 2CT6A 2JU5A 1GTUA 1EZKA 4PNFA 1FW1A 2OA7A 1AQVA 4RI6A 2A2RA 2C0FA 3LYKA 1JHBA 3GN3A 3C8EA 1M2AA 2VIMA 4PUAA 4IBPA 3IXRA 4WEYA 3FZAA 5C04A 1M9BA 1OYJA 5IMAA 20GSA 2HSHA 4HDEA 2AAWA 2IMDA 1PMTA 2DJKA 1EOGA 2DC5A 4IS0A 1K0DA 4NMUA 1N8JA 3MAKA 4ECJA 4GQCA 2HI7A 3M9KA 1B4PA 2I81A 3TKSE 2EIRA 2H75A 3PH9A 2H71A 3SBCA 4G0LA 2OBIA 3EURA 3TKSA 4FYUA 2VCVA 2IMEA 3GL5A 2YJ7A 2PUKC 4G19A 2V6OA 3KH9A 4QL9A 2KHPA 2LKUA 1NHYA 2YOIA 4L0WA 4XCSA 2ALBA 4V2NA 1T7PB 1GNWA 1PKWA 1WP0A 1N2AA 2WDUA 4ECIA 5DDLA 3EE2A 4YQUA 2AYTA 2BMXA 1BEDA 1XW9A 2NDOA 1JZWA 1R4WA 4HU9A 3TDGA 1MEKA 3M9JA 5IMDA 3KMOA 3ZMLA 4YAPA 6GSUA 4O32A 5E59A 1XWGA 2QKEA 3NIVA 2LNTA 1BJXA 1XBSA 3DYRA 1AUCA 4MMMA 5H5RA 4IVFA 1A8LA 1QGVA 2XPDA 3DEXA 4KDUA 4EVMA 1EGOA 3E9JB 5ECRB 1NSWA 1TRWA 3FYGA 3CTGA 3QR6A 4K7OA 1V2AA 2PPTA 4IGJA 1X9WB 3LWAA 3KMNA 5ID2A 1SYXA 4GSTA 1A8YA 2DIYA 5IOXA 2LRCA 2ZNMA 1BG5A 1SD8A 1MD4A 2IMIA 1SD9A 4XTSA 3G7IA 5DBQA 5CREA 17GSA 3EYTA 2HZFA 5DJLA 4ZL8A 5IO2A 4WR4A 3QCPA 3Q6OA 1KTEA 5AN1A 3I69A 1U6TA 4EF0A 4CW9A 4GSSA 1F37A 4ID0A 1W4VA 2MMNA 2C80A 2F51A 4HQSA 4IN0A 2H01A 4PGTA 3C71A 4CDOA 4TR1A 3WYWA 1S3DA 2LJAA 2OADA 4O92A 5KEJA 1FHEA 3F3QA 2MMAA 4G0KA 4TR3A 3ZVJD 4FYCA 4POLA 2VAFA 1T3BA 4HEA2 3CSJA 2WB9A 4MF5A 4WXTA 2FA4A 3D22A 3GUSA 1AC1A 1ERTA 4RQXA 2O89A 4WBRD 2ZCTA 1GULA 4KF9A 1SU9A 2K8VA 3GYKA 4X43A 1K0MA 1OC9A 4JU5A 3KP9A 1G6YA 2HNLA 5HR0A 5H5SA 1THXA 5F06A 3LEFA 4XS6A 4TR1B 4NV5A 5LCZA 4KE3A 4HOJA 4F0CA 2WJUA 3F6DA 3UBKA 3O6TA 3DKSA 1ZYQB 2V32A 2N5AA 2E2GA 2MMOA 1SYRA 5CRGA 4NAXA 1M2DA 3CYNA 3KH7A 3KGKA 1PL1A 4USSA 3F3RA 2J9HA 3EU4A 2CAIA 5DQSA 3FY7A 1OC9B 5IMVA 4MH2A 2NTOA 2PVOC 3A2VA 4HQZA 4MK3A 1H75A 2LSTA 2MBSA 2XC2A 3D4TA 5D96A 3HYPA 4EO3A 4IKHA 2OJLA 2PN8A 2NVLA 4L8EA 2H1GA 3Q74A 1J9BA 2FA8A 2FLSA 2HSMA 3LYPA 5IOWA 3KM6A 1SJIA 2AB6A 1PKZA 3HJOA 3KTLA 2LTKA 1GL8A 1WRYA 4QQ7A 2MZCA 4QL7A 3ZITA 2EIOA 4MZBA 1X5DA 1T4YA 1ZL9A 3K8NA 5ECMB 2X8HA 3ISOA 3DRNA 2TRXA 5JWOB 1U87A 4AF2A 3QPMA 1SKSB 1USBA 2B7JA 5LD0A 2F3MA 1TRUA 4PQ1A 3CSIA 2XPEA 5D8IA 5D9VA 3TJFA 5DCHA 2V41A 1ACVA 3HD5A 1TJDA 4MF6A 4XHMA 3BJ5A 1RQMA 2R3XA 4GSNA 2HSMB 1WOUA 3ZVJA 3FW2A 4MJAA 4EDZA 4ZB6A 1GSSA 2GTUA 4LLRA 2XHFA 2O8VB 3PR8A 2DJ2A 3EWLA 2B5YA 3EU3A 1O6JA 3VPQA 1E2YA 3VWVA 3RHBA 1G6WA 1IYIA 1FVJA 2B5EA 5ECLB 2YJHA 2V2GA 1URMA 1GUHA 1M0UA 2DJ1A 2H70A 3TRQA 1X9SB 3QFBC 4OFNA 2FWHA 4BVYA 2GLRA 4EDYA 3C73A 1GSFA 1ZZYA 3FHKA 2VD1A 4ISDA 4AJ8A 2VL3A 2RM6A 3GL3A 2M80A 5ENUA 2WCIA 1YY7A 2VL2A 1W89A 5EY6A 3LGCA 4EE0A 2FD3A 1XCCA 5HR2A 3H79A 1XW5A 2H76A 4POKA 3IK9A 1O8WA 4XS4A 4IJIA 3BCKA 4BVYB 11GSA 1YEPA 2LS5A 1OKTA 4K9ZA 3PGTA 3D21A 4MABA 4DSQA 2VCZA 3HCZA 1K3OA 3RHCA 1TI3A 3MSZA 2L4CA 4O5RA 4MCUA 4G9HA 5ABRA 1HQOA 1O8XA 2LJKA 4K0GA 6GSYA 4L5OA 1JLVA 1AIUA 3AY8A 4XS4B 4LMWA 1XXUA 3TRPA 2L4QA 3UVTA 2O7KA 2G2QA 2GZYA 2HRKA 5GSTA 2GT6A 3DIEA 4OD7A 1JZOA 1ST9A 1O85A 3EC3A 1TI1A 1K0AA 5D9XA 4GXZA 3J7Yb 1JFUA 2YV9A 3L4NA 1H4OA 4FH8A 5D93A 4N0VA 2GT5A 3D6IA 2I3YA 5IIZA 1XVWA 3F6FA 1B8XA 3O76A 5HFGA 5IPHA 2PWJA 4WETA 1T1VA 2G0FA 3R3EA 1GNEA 4IQAA 1Z6NA 1BQ7A 4KUNA 2LRNA 3GSSA 2DIZA 1AAZA 2LEGA 2B5XA 4I2UA 2O85A 3ZLPA 1T00A 2D2ZA 3IRAA 1SKRB 2M72A 5IQYA 2HYXA 1R5PA 3GH9A 3G7YA 1PD21 2DLXA 5D9WA 5A4WA 4YAVA 2P5QA 3L78A 4ULXA 2VLUA 5DVBA 1LU4A 2LUSA 4JZQA 4XIHA 2HT9A 2HZEA 3VWXA 3RDWA 4Z7XA 3VWUA 5IMZA 3TGZA 3IV4A 5LNKe 2H0IA 2ES7A 1VF2A 5ELAA 2KP2A 2H0GA 5AIXA 3SWLA 1M2BA 3IC4A 4OO5A 4I6XA 3TOUA 3GFKA 4DVCA 12GSA 3U5RE 1LBKA 5ELGA 2DSAA 4KA0A 1PQNA 5FT3A 4X1UA 4Q5QA 1HNBA 4GRFA 9GSSA 1ABAA 2H1AA 1LJRA 1HYUA 5KN1A 4ZB9A 2YPMA 2HZEB 5HQPA 4GF0A 1XW6A 2NBSA 3P8WA 2H0HA 2VM2A 2C3TA 1QQ2A 4K2DA 2K6VA 2GQLA 3ZFBA 5G5EA 3W6GA 1V9WA 3M3MA 5D9TA 3HVVA 1PX7A 1GLQA 3P2AA 3F4RA 3N9JA 3QAWA 3W8JA 3KTBA 3C1SA 1OE7A 1RK4A 4MDCA 1GSYA 5ECHB 1OC3A 2NPBA 2GSRA 3GHAA 4OFTA 3F4TA 3VFIA 1DUGA 5HR3A 3FZ5A 1QK8A 2C3NA 2GQKA 1CQGA 4HI7A 6GSVA 1GH2A 4KH7A 1A23A 3A2XA 3DXBA 2JSZA 3A5WA 1X5EA 2H74A 4KGIA 8GSSA 5C00A 4RI7A 1A2MA 3C7MA 1UC7A 3UVHA 1Z5YE 3PINA 5J9BA 2OE0A 1MTCA 4RUVA 3GX8A 5GAPD 2OACA 4BA7A 2CV4A 4PQHA 4KSMA 3W8SA 2H19A 1XZOA 3CRUA 4WR5A 1F9MA 1I5GA 3EINA 1AQXA 3QD9A 2C1YA 1JZRA 3ERWA 4TR0A 2XBIA 4ZIJA 3GSTA 5G2ZA 2OE1A 1XWBA 1ERVA 2CZ3A 2I1UA 2VCTA 1AXDA 1Z6MA 5L71A 3LFLA 2DMMA 5CAXA 1YF0A 4BPYA 2I4AA 5A5KA 2R4VA 2L6DA 4J56E 2EC4A 2JZTA 3O3TA 1PSQA 1U3IA 1WJKA 1HNCA 4PXOA 5IMFA 2L5OA 2AUVA 2F9SA 3QAVA 4JE1A 1YZXA 3ERGA 5B7CA 1BYEA 1T4ZA 4NWYA 2CZ2A 4MLYA 4I8BA 4PURA 3KIJA 1E6BA 2JACA 4TXOA 4HZ4A 3MNGA 2H30A 3FEUA 3VLNA 4MPFA 4WBJA 4KNDA 3M1GA 5KN2A 3M8NA 5ECPB 5COHA 1HNAA 2CAQA 1EEJA 3L9UA 2VOCA 5ECNB 3DMLA 2VUPA 1TP9A 1XWAA 5DQYA 1VF4A 2YCDA 3M0FA 4G10A 1JLWA 3OR5A 3TJGA 1OE8A 4KB3A 1F3AA 2X99A 3BCIA 1XFLA 1K0OA 3BOAA 1NM3A 3WT1A 2I9HA 4YQMA 1WPIA 5HFKA 2FHEA 2ON5A 1QMVA 1FG4A 1I9DA 4TXOB 4JBBA 4KX4A 3HA9A 4IP6A 1FB0A 3GMFA 4L0UA 2UZ8A 2TRCP 3UIWA 3CBUA 4L5LA 3LQ7A 2TIRA 3GURA 1PA3A 2J23A 2REMA 4PUFC 1Z7PA 4KAEA 2PGTA 1OKDA 5DAKB 2H73A 3FRCA 3NOFA 1TXXA 4MJCA 1TK0B 4YH2A 3BD2A 2JSYA 4EKZA 3APSA 3FKFA 1DE2A 1UA5A 3A3TA 5GZZB 1O81A 2K9FA 2L5LA 5CRWA 3HY2A 1FO5A 4MA9A 4G0IA 1GLPA 3DVWA 1TOFA 3IE3A 2KP1A 2RIIA 2E2MA 3TJBA 2HQTA 1NW2A 4I2TA 22GSA 4KCAA 1EP7A 5KN3A 3FZ9A 4HU7A 5J5NA 2V1MA 1Q4JA 2JZSA 1TDIA 3IBHA 2GSTA 1THOA 4EC0A 3GNJA 1SK0A 3VI5A 5B6NA 4P3YB 3KP8A 3IK7A 2B7KA 3VI7A 2BTOT 4BWQA 2IMFA 3H8QA 2Z9SA 2GSQA 4MP4A 1A2JA 3IC8A 1Z9HA 4Q5RA 4DEJA 4KSOA 2FWFA 3IAM2 1GTAA 2BJXA 1DE1A 1GSDA 5IM9A 5AIVA 3KXOA 3RPNA 3UJ1A 4E8EA 5B6MA 3V1WA 1GWCA 2P31A 2FUG2 2HRFA 2IPAA 3KD0A 6GSWA 1B9XC 2AV4A 1YEXA 3H1NA 2H6ZA 18GSA 3VURA 1G0TA 1V57A 2KUCA 3CTFA 4JEDA 3D5JA 2A4VA 3GH6A 3CSHA 4E8HA 3FK8A 1Y6EA 5F0GA 1HD2A 3WGEA 1A0RP 2F8FA 5JCWA 5DALA 3GRXA 5HFIA 2L6CA 4F82A 4TKYA 3C1RA 19GSA 4I5QA 4AJ6A 1G7OA 1VGLA 4J2FA 4K7IA 3ZREA 3UEMA 1OAZA 1PX6A 1SL0B 2GZPA 2GQMA 2LQQA 2V6KA 4Q5FA 3FR3A 1KBNA 1YJ6A 6GSXA 5D73A 2HXKA 1SJZA 1WE0A 5FHIA 5CNWA 2L57A 1MDKA 4MJEA 4DSSA 4HUAA 2X8CA 2R37A 3F63A 4K1FA 4EXJA 3D4MA 2VD0A 3ZRDA 1V98A 3F9UA 2R5GA 3ZL5A 5DALB 1AW9A 5AISA 2IN3A 2H72A 1EV4A 3R2QA 5G5FA 1J0FA 1TRSA 1O7UA 3F0IA 2H66A 5F05A 2E7PA 3H4KA 3E3EA 3VWWA 2VCWA 13GSA 3ZFLA 1EOHA 4DSRA 1Q98A 2LV3A 3FR9A 4MPGA 3GV1A 4XS1A 4DSSB 1A24A 2CX4A 3KZQA 3TRXA 3APQA 2IIYA 2VLVA 1EGRA 3GKKA 4ML1A 1TK5B 3QFAC 3U6VA 3ME7A 2CVDA 4MZCA 2VCXA 5IPGA 1B48A 3MDKA 2PVQA 4OCFA 5G1KA 3IHQA 1EV9A 1XPVA 2B1LA 1KNGA 3Q18A 4LL4B 5E4WA 1U3AA 5CYYA 2L59A 4AGSA 4ECBA 1AQWA 4ZXGA 1A2LA 4TXVA 1Z3EA 1C72A 2C0DA 1VF3A 2WS2A 1GP1A 2QSIA 3UBLA 1K3LA 3N5OA 1B4QA 3ZIJA 3IDVA 3WT2A 4F0BA 4PNGA 4GLTA 1K0CA 5FWGA 2YWIA 3Q19A 2ZUPA 5GSSA 2OE3A 2CVKA 2YWMA 2XBQA 5J3RA 2GS3A 2HSNB 1M7TA 3IR4A 5A4VA 2MYGA 4IJ3A 4ZL7A 3VK9A 1VF1A 5CO3A 4TOPA 5G30A 3I43A 1NHOA 4NV2A 4FIWA 5F07A 5G1LA 3L9VA 3TB2A 1JZDA 4V1Ap 1DSBA 3HDCA 2EIQA 3ZYWA 1YKCA 4KDXA 3ED3A 1G7EA 3EVIA 1TK8B 1YDKA 2JADA 2LNSA 3KEBA 5JWRB 2RUFA 3PPUA 4FYBA 2YWNA 4NHZA 4OO4A 2B6MA 3F4SA 1Z7RA 5F8BA 4ILFA 3TCOA 1UN2A 1XVQA 1ZYEA 1Y25A 4HS1A 1U88A 1XIYA 2GDRA 3HJMA 1K3YA 2C0EA 2R2JA 4TRXA 1MDJA 5G31A 1GUKA 2N5FA 1TRVA 5J4UA 3L0HA 2VLTA 3HJPA 4G2EA 1SL1B 2PMTA 1ZCPA 4K0NA 4TN8A 1SKWB 4O7HA 5J41A 3KJYA 2R6KA 5B8BA 5DCGA 1PN9A 1R5AA 2C4JA 3G7JA 1A0FA 2H1BA 4HZ2A 3RAZA 3IA1A 1YF1A 1GTIA 4IP1A 5GAND 4F03A 4H86A 3E0UA 2CA8A 4GWRA 4XRDA 3UMAA 2WGRA 2YWOA 3WGDA 5CRHA 4JR4A 2IJYA 6GSSA 1F6MC 2VO4A 5B8AA 3FZ4A 4I97A 5AGYA 1ON4A 4FQUA 5ECIB 1K0NA 1YKAA 4J57E 3TUEA 4KCEA 1TU8A 2LJRA 2VL9A 4CHSA 1ILOA 2FCHA 3TKQA 2GVPA 2KOKA 3EMXA 1K0BA 1ERWA 3BBYA 3HKRA 1DBYA 2RM5A 1ZGNA 4MJBA 2MMZA 5KN0A 4KDYA 4PQIA 2HLSA 5CRDA 1RW1A 4YQVA 1X0RA 3ZIVA 2IL3A 1SJ6A 1TTZA 1M99A 3ZTLA 1O73A 5HR1A 3TKSC 3ERFA 5CP1A 4ACSA 2RUEA 5IMCA 5IO0A 2HFDA 1OVNA 3GKNA 4EUYA 1WWJA 2CX3A 2PBJA 1ML6A 2X64A 2OBKA 3LORA 1PL2A 4K7NA 3UARA 1S3CA 5ID2B 4EL1A 4ML6A 2GSSA 4GCIA 1R7HA 2WULA 1YQ1A
chains in the Genus database with same CATH superfamily
4E68A 1GRXA 5A34A 2GZZA 4POMA 4PHZC 2RLIA 2YNXA 2QC7A 1XWKA 1V40A 2CQ9A 3IAS2 2IWTA 2DJ0A 3I6AA 1M9AA 1QFNA 5JCGA 3FR6A 1GSEA 2HRAA 2X8GA 3LXZA 1XOAA 5DAKA 5ECQB 1SENA 2P5RA 1EP8A 2CVBA 2JL4A 3UAPA 2VCQA 4IELA 3WD6A 2GGTA 2MBTA 1WMJA 4BWSA 1X9MB 3CMIA 5H5QA 2OKAA 4GTUA 5A4UA 4ECCA 3H93A 4IW9A 5BMUA 2KLXA 2YN1A 4PX1A 2X4AA 2IMKA 3DGQA 4IQ1A 4LA1A 5ECSA 2K18A 3QOUA 3G9BA 1FB6A 1R26A 2B3SA 4LL1B 1BX9A 2A4HA 4N0ZA 6GSTA 2LRTA 3UOMA 2EFDA 3I9V2 2ON7A 5EL8A 4EIQA 5EPFA 3LJRA 4TVEA 4WKWA 4POBA 4D73A 3RFRC 4LMVA 5DJMA 5EVOA 4TW5A 3GX0A 1BAYA 1FOHA 4V2LA 1PRXA 3TKRA 1F2EA 1PGTA 3DWVA 4N30A 2IFQA 4NHWA 3P7XA 1SVOA 1MD3A 2K8SA 2H6XA 4HJMA 3NZNA 2JZRA 4WF4A 1GSUA 2YV7A 2O3EA 4OWYA 4BL7A 4PTSA 5J9CA 1ZMAA 1SK2A 2O87A 3EMPA 3QDNA 3APOA 4ZL9A 4D73B 2H6YA 1EWXA 1TW9A 3F8UA 3GKMA 3HVSA 1MDIA 2VM1A 4OCEA 2PERA 2FWGA 4MF7A 4NPBA 4AI6A 1GTBA 2IFQB 2HRNA 3ZMKA 2DJJA 4WF5A 1TU7A 4K6XA 2EFEA 1VRSD 3ZZXA 3TOTA 5J4YA 4BL7B 4BVXA 2WRTA 2DBCA 3LSZA 3J7Yk 1XOBA 5A1NA 3L9SA 5KOWA 1GUMA 3GTUA 4KW6A 2QGVA 5JCUA 3QAGA 2WW2A 1ERUA 1ZOFA 2FNOA 4ZBBA 4TR4A 2C3QA 3RPPA 4JR6A 3MWHA 5INYA 3VPTA 4RQRA 3WGXA 3HHVA 4JRRA 1XWCA 4MZWA 16GSA 3A2WA 3DD3A 1SL2B 2YANA 4BVXB 4YKGA 3QMXA 5A1NB 3HVXA 1T8EB 3D0ZA 3DVXA 2DMLA 3GTUB 4OMVA 1GSQA 1FVKA 3US3A 2HSYA 5ECOB 4ZB8A 2AJQB 4N10A 2B1KA 1EEMA 1SK1A 1KEBA 3P90A 4AJ7A 1J08A 14GSA 3ME8A 3GKXA 4K8MA 4V1Ag 1V58A 2E0QA 2N5BA 1OC8A 4NXIA 1B9YC 1TKDB 3UL3A 2HE3A 4HJ2A 10GSA 2PU9C 1CQHA 2WZ9A 4BIKA 2WW0A 3CWGA 2YZHA 3CXGA 2H1DA 4N11A 3TKPA 4FO5A 1QXHA 3CRTA 7GSSA 3LXTA 2FWEA 3IPZA 4GDFA 2M46A 4ZBAA 3TJJA 4IHUA 2FGXA 2FY6A 3S9FA 1S3AA 3GA4A 4F9ZA 1IYHA 2DJ3A 2LQOA 4F2IA 2WFCA 4MH3A 4V2MA 5JWQB 3KCMA 1WIKA 4X0XA 3JCML 4Q5NA 4ZILA 2C8UA 3TJKA 2P0GA 5ECKB 2AHEA 4GQFA 4ZBDA 3HXSA 3GIXA 3IOSA 2F8AA 1FAAA 3HZ4A 2YP6A 1FOVA 2A2SA 1X5CA 2VL2C 3LG6A 3RBTA 1F3BA 2C0GA 1UVZA 3HZ8A 2HRKB 2YZUA 4OFMA 1M3IA 4XRAA 1QUWA 2H8LA 2CT6A 2JU5A 1GTUA 1EZKA 4PNFA 1FW1A 2OA7A 1AQVA 4RI6A 2A2RA 2C0FA 3LYKA 1JHBA 3GN3A 3CQFA 3C8EA 1M2AA 2VIMA 4PUAA 4IBPA 3IXRA 4WEYA 1M3JA 3FZAA 5C04A 1M9BA 1OYJA 5IMAA 20GSA 2HSHA 4HDEA 2AAWA 2IMDA 1PMTA 2DJKA 1EOGA 2DC5A 4IS0A 1K0DA 4NMUA 1N8JA 3MAKA 4ECJA 4GQCA 2HI7A 3M9KA 1B4PA 2I81A 3TKSE 2EIRA 2H75A 3PH9A 2H71A 3SBCA 4G0LA 2OBIA 3EURA 3TKSA 4FYUA 2VCVA 2IMEA 3GL5A 2YJ7A 2PUKC 4G19A 2V6OA 3KH9A 4QL9A 2KHPA 2LKUA 1NHYA 2YOIA 4L0WA 4XCSA 2ALBA 4V2NA 1T7PB 1GNWA 1PKWA 2VKZG 1WP0A 1N2AA 2WDUA 4ECIA 5DDLA 3EE2A 4YQUA 2AYTA 2BMXA 1BEDA 1XW9A 2NDOA 1JZWA 1R4WA 4HU9A 3TDGA 1MEKA 3M9JA 5IMDA 3KMOA 3ZMLA 4YAPA 6GSUA 4O32A 5E59A 3FMWA 1XWGA 2QKEA 3NIVA 2LNTA 1BJXA 1XBSA 3DYRA 1AUCA 2QA1A 4MMMA 5H5RA 4IVFA 1A8LA 1QGVA 2XPDA 3DEXA 4KDUA 4EVMA 1EGOA 3E9JB 5ECRB 1NSWA 4ICYA 1TRWA 3FYGA 3CTGA 3QR6A 4K7OA 1V2AA 2PPTA 4IGJA 1X9WB 3LWAA 3KMNA 5ID2A 1SYXA 4GSTA 1A8YA 2DIYA 5IOXA 4CY8A 4CY6A 2LRCA 2ZNMA 1BG5A 1SD8A 1MD4A 2IMIA 1SD9A 4XTSA 3G7IA 5DBQA 5CREA 17GSA 3EYTA 2HZFA 5DJLA 4ZL8A 5IO2A 4WR4A 3QCPA 3Q6OA 1KTEA 5AN1A 3I69A 1PN0A 1U6TA 4EF0A 4CW9A 4GSSA 1F37A 4ID0A 1W4VA 2MMNA 3HVNA 2C80A 2F51A 4EIPA 4HQSA 4IN0A 2H01A 4PGTA 3C71A 4CDOA 4TR1A 3WYWA 1S3DA 2LJAA 2OADA 4O92A 5KEJA 1FHEA 1PFOA 3F3QA 2MMAA 4G0KA 4TR3A 3ZVJD 4FYCA 4POLA 2VAFA 1T3BA 5J47A 4HEA2 3CSJA 2WB9A 4MF5A 4WXTA 2FA4A 3D22A 3GUSA 1AC1A 1ERTA 4RQXA 2O89A 4WBRD 2ZCTA 1GULA 4KF9A 1SU9A 2K8VA 3GYKA 4X43A 4PI0C 1K0MA 1OC9A 4JU5A 3KP9A 1G6YA 2HNLA 5HR0A 5H5SA 1THXA 5F06A 3LEFA 4XS6A 4TR1B 2EFHA 4K5RA 4NV5A 4PI2C 5LCZA 4KE3A 4HOJA 2R0PA 4F0CA 2WJUA 3F6DA 3UBKA 3O6TA 3DKSA 1ZYQB 2V32A 2N5AA 2E2GA 2MMOA 1SYRA 5CRGA 4NAXA 1M2DA 3CYNA 3KH7A 3MIXA 3KGKA 1PL1A 4USSA 3F3RA 2J9HA 3EU4A 2CAIA 5DQSA 3FY7A 1OC9B 5IMVA 4MH2A 2NTOA 2PVOC 3A2VA 4HQZA 4MK3A 2DKIA 1H75A 4Z2UA 2LSTA 2MBSA 2XC2A 3D4TA 5D96A 3HYPA 4EO3A 4IKHA 2OJLA 2PN8A 2NVLA 4L8EA 2H1GA 3Q74A 1J9BA 2FA8A 2FLSA 2HSMA 3LYPA 5IOWA 3KM6A 1SJIA 2AB6A 1PKZA 3HJOA 3KTLA 2LTKA 1GL8A 1WRYA 4QQ7A 2MZCA 4QL7A 3ZITA 2EIOA 4MZBA 1X5DA 1T4YA 1ZL9A 3K8NA 5ECMB 2X8HA 3ISOA 3DRNA 2TRXA 3A5IA 5JWOB 1U87A 4AF2A 3QPMA 1SKSB 1USBA 2B7JA 5LD0A 2F3MA 1TRUA 2WVYA 4PQ1A 3CSIA 2XPEA 5D8IA 5D9VA 3TJFA 5DCHA 2V41A 1ACVA 3HD5A 1TJDA 4MF6A 4XHMA 3BJ5A 1RQMA 2R3XA 4GSNA 2HSMB 1WOUA 3ZVJA 3FW2A 4MJAA 4EDZA 4ZB6A 1GSSA 2GTUA 4LLRA 2XHFA 2O8VB 4MNNA 3PR8A 2DJ2A 3EWLA 2B5YA 3EU3A 1O6JA 3VPQA 1E2YA 3VWVA 3RHBA 1G6WA 1IYIA 1FVJA 1BG1A 2B5EA 5ECLB 2YJHA 2V2GA 1URMA 1GUHA 1M0UA 2DJ1A 2H70A 3TRQA 1X9SB 3QFBC 4OFNA 2FWHA 4BVYA 1YEWC 2GLRA 4EDYA 3C73A 1GSFA 1ZZYA 3FHKA 2VD1A 4ISDA 4AJ8A 2VL3A 2RM6A 3GL3A 2M80A 5ENUA 2WCIA 1YY7A 2VL2A 1W89A 5EY6A 3LGCA 4EE0A 2FD3A 1XCCA 5HR2A 3H79A 1XW5A 2H76A 4POKA 1YVLA 3IK9A 1O8WA 4XS4A 4IJIA 4HSCX 5A5HA 3BCKA 4BVYB 11GSA 1YEPA 2LS5A 1OKTA 3PGTA 3D21A 4K9ZA 4MABA 4DSQA 2VCZA 3HCZA 1K3OA 3RHCA 1TI3A 3MSZA 2L4CA 4O5RA 4MCUA 4G9HA 5ABRA 1HQOA 1O8XA 2LJKA 4K0GA 6GSYA 4L5OA 1JLVA 1AIUA 3AY8A 4XS4B 4LMWA 1XXUA 5A5HB 3TRPA 2L4QA 3UVTA 2O7KA 2G2QA 2GZYA 2HRKA 5GSTA 2GT6A 3DIEA 4OD7A 3LW9A 1JZOA 1ST9A 1O85A 3EC3A 1TI1A 1K0AA 5D9XA 4GXZA 3J7Yb 1JFUA 2YV9A 3L4NA 1H4OA 4FH8A 5D93A 4N0VA 2GT5A 3D6IA 2I3YA 5IIZA 1XVWA 3F6FA 1B8XA 3O76A 5HFGA 5IPHA 2PWJA 4WETA 1T1VA 2G0FA 3R3EA 1GNEA 4IQAA 1Z6NA 1BQ7A 4KUNA 2LRNA 3GSSA 2DIZA 1AAZA 2LEGA 2B5XA 4I2UA 2O85A 3ZLPA 1T00A 2D2ZA 3IRAA 1SKRB 2M72A 5IQYA 2HYXA 1R5PA 3GH9A 3G7YA 1PD21 2DLXA 5D9WA 1ZYPA 5A4WA 4YAVA 2P5QA 3L78A 4ULXA 2VLUA 5DVBA 1LU4A 2LUSA 4JZQA 4XIHA 4QMKA 2HT9A 2HZEA 3VWXA 4K5SA 3RDWA 4Z7XA 3VWUA 5IMZA 3TGZA 5BRTA 3IV4A 5LNKe 2H0IA 2WW3A 2ES7A 1VF2A 5ELAA 2KP2A 2H0GA 5AIXA 3SWLA 1M2BA 3IC4A 4OO5A 4I6XA 3TOUA 3GFKA 2UV8G 4DVCA 12GSA 3U5RE 1LBKA 5ELGA 2DSAA 4KA0A 1PQNA 5FT3A 2X49A 4X1UA 4Q5QA 1HNBA 4GRFA 9GSSA 1ABAA 2H1AA 1LJRA 1HYUA 5KN1A 4ZB9A 2YPMA 2HZEB 5HQPA 4GF0A 1XW6A 2NBSA 3TU3B 3P8WA 2H0HA 2VM2A 2C3TA 1QQ2A 4K2DA 2K6VA 1TXUA 2GQLA 3ZFBA 5G5EA 3W6GA 1V9WA 3M3MA 5D9TA 3HVVA 1PX7A 1GLQA 3P2AA 3F4RA 3N9JA 3QAWA 2WVXA 3W8JA 3KTBA 3C1SA 5J40A 1OE7A 1RK4A 4MDCA 1GSYA 5ECHB 1OC3A 2NPBA 2GSRA 3GHAA 4OFTA 3F4TA 3VFIA 1DUGA 5HR3A 3FZ5A 1QK8A 2C3NA 2GQKA 1CQGA 4HI7A 6GSVA 1GH2A 4KH7A 1A23A 3A2XA 3DXBA 2JSZA 2DKHA 3A5WA 2OT3A 1X5EA 1SVMA 4Z2TA 2H74A 4KGIA 8GSSA 5C00A 4RI7A 1A2MA 3C7MA 1UC7A 2WVXB 3UVHA 1Z5YE 3PINA 5J9BA 2OE0A 1MTCA 4RUVA 3GX8A 5GAPD 2OACA 4BA7A 2CV4A 4PQHA 4KSMA 3W8SA 2H19A 1XZOA 3CRUA 4WR5A 1F9MA 1N25A 1I5GA 3EINA 1AQXA 3QD9A 2C1YA 1JZRA 3ERWA 4TR0A 2XBIA 4ZIJA 3GSTA 5G2ZA 2H1LA 2OE1A 1XWBA 1ERVA 2CZ3A 2I1UA 2VCTA 1AXDA 1Z6MA 5L71A 3LFLA 2DMMA 5CAXA 1YF0A 4BPYA 4K2XA 2I4AA 2R0GA 5A5KA 2R4VA 2L6DA 4J56E 2EC4A 2JZTA 3O3TA 1PSQA 1U3IA 1WJKA 1HNCA 4PXOA 5IMFA 2L5OA 2AUVA 2F9SA 3QAVA 4JE1A 1YZXA 3ERGA 5B7CA 4YKFA 1BYEA 1T4ZA 4NWYA 2CZ2A 4MLYA 4I8BA 4PURA 3KIJA 1E6BA 2JACA 4TXOA 4X4JA 4HZ4A 3MNGA 2H30A 3FEUA 3VLNA 4MPFA 4WBJA 4KNDA 3M1GA 5KN2A 3IHGA 4AKGA 3M8NA 3MYDA 5ECPB 1S3RA 5COHA 1HNAA 2CAQA 1EEJA 3L9UA 2VOCA 5ECNB 3DMLA 2VUPA 1TP9A 1XWAA 4AKIA 5DQYA 1VF4A 2YCDA 3M0FA 4G10A 1JLWA 3OR5A 3TJGA 1OE8A 4KB3A 1F3AA 2X99A 3BCIA 1XFLA 1K0OA 4AKXB 3BOAA 1NM3A 3WT1A 2I9HA 4YQMA 1WPIA 5HFKA 2FHEA 2ON5A 1QMVA 1FG4A 1I9DA 4TXOB 2WZSA 5A34B 4JBBA 4KX4A 3HA9A 4IP6A 1FB0A 3GMFA 4L0UA 2UZ8A 2TRCP 3UIWA 3CBUA 4L5LA 3LQ7A 2WW1A 2TIRA 3GURA 1PA3A 2J23A 3RGBC 2REMA 4PUFC 1Z7PA 4KAEA 2PGTA 1OKDA 5DAKB 2H73A 3FRCA 3NOFA 1TXXA 4MJCA 1TK0B 4YH2A 3BD2A 2JSYA 4EKZA 3APSA 3FKFA 1DE2A 1UA5A 3A3TA 5GZZB 1O81A 2QA2A 2K9FA 2L5LA 5CRWA 3HY2A 5BMUB 4O5QA 1FO5A 4MA9A 4G0IA 1GLPA 3DVWA 1TOFA 2A2PA 3IE3A 2KP1A 2RIIA 2E2MA 3TJBA 2HQTA 1NW2A 4I2TA 22GSA 4KCAA 1EP7A 5KN3A 3FZ9A 4AKHA 4HU7A 5J5NA 2V1MA 1Q4JA 2JZSA 1TDIA 3IBHA 2GSTA 1THOA 4EC0A 3GNJA 1SK0A 3VI5A 5B6NA 4P3YB 3KP8A 3IK7A 2B7KA 3VI7A 2BTOT 4BWQA 2IMFA 3H8QA 2Z9SA 2GSQA 4MP4A 1A2JA 3IC8A 1Z9HA 4Q5RA 4DEJA 4KSOA 2FWFA 3IAM2 1GTAA 2BJXA 1DE1A 5J4VA 1GSDA 5IM9A 5AIVA 3KXOA 3RPNA 3UJ1A 4E8EA 5B6MA 2WVZA 3V1WA 1GWCA 2P31A 2FUG2 2HRFA 2IPAA 3KD0A 6GSWA 1B9XC 2AV4A 1YEXA 3H1NA 2H6ZA 18GSA 3VURA 1G0TA 1V57A 2KUCA 3CTFA 4JEDA 3D5JA 2A4VA 3GH6A 3CSHA 4E8HA 3FK8A 1Y6EA 5F0GA 1HD2A 4ZB7A 3WGEA 1A0RP 2F8FA 5JCWA 4FXYP 5DALA 3GRXA 4W66A 5HFIA 2L6CA 4F82A 4TKYA 3C1RA 19GSA 4I5QA 4AJ6A 4N3ZA 1G7OA 1VGLA 4J2FA 4K7IA 3ZREA 3UEMA 1OAZA 1PX6A 1SL0B 2GZPA 2GQMA 2LQQA 2V6KA 4Q5FA 3FR3A 1KBNA 1YJ6A 6GSXA 5D73A 2HXKA 1SJZA 1WE0A 5FHIA 5CNWA 2L57A 1MDKA 4MJEA 4DSSA 4HUAA 2X8CA 2R37A 3F63A 4K1FA 4EXJA 3D4MA 2VD0A 3ZRDA 1V98A 3F9UA 2R5GA 3ZL5A 5DALB 1AW9A 5AISA 5KOXA 2IN3A 2H72A 1EV4A 3R2QA 5G5FA 1J0FA 1TRSA 1O7UA 3F0IA 2H66A 5F05A 2E7PA 3H4KA 3E3EA 3VWWA 2VCWA 13GSA 3ZFLA 1EOHA 1ZYNA 3CHXC 3EPTA 4DSRA 1Q98A 2LV3A 3FR9A 4MPGA 2R0CA 3GV1A 4XS1A 4DSSB 1A24A 2CX4A 3KZQA 3TRXA 3APQA 2IIYA 4Z2RA 2VLVA 1EGRA 4G01A 3GKKA 4ML1A 1TK5B 3QFAC 3U6VA 3ME7A 2CVDA 4MZCA 2VCXA 5IPGA 1B48A 3MDKA 4O5UA 2PVQA 4OCFA 2HSNA 5G1KA 3IHQA 1EV9A 1XPVA 2B1LA 1KNGA 3Q18A 4LL4B 5E4WA 1S4BP 1U3AA 5CYYA 2L59A 4AGSA 4ECBA 1AQWA 4ZXGA 1A2LA 4TXVA 1Z3EA 1C72A 2C0DA 1SVLA 2O5VA 1VF3A 2WS2A 1GP1A 2QSIA 3UBLA 4A5PA 1K3LA 3N5OA 1B4QA 3ZIJA 3IDVA 3WT2A 4F0BA 4PNGA 4GLTA 1K0CA 5FWGA 2YWIA 3Q19A 2ZUPA 5GSSA 2OE3A 2CVKA 2EFCA 2YWMA 2XBQA 5J3RA 2GS3A 2HSNB 1M7TA 3IR4A 5A4VA 2MYGA 4IJ3A 4ZL7A 3VK9A 1VF1A 5CO3A 4TOPA 5G30A 3I43A 1NHOA 4NV2A 1XG8A 4FIWA 5F07A 3HMJG 1I1IP 5G1LA 3L9VA 3TB2A 1JZDA 4V1Ap 1DSBA 3HDCA 2EIQA 3ZYWA 1YKCA 4KDXA 3ED3A 1G7EA 3EVIA 1TK8B 1YDKA 2JADA 2LNSA 3KEBA 5JWRB 2RUFA 3PPUA 4FYBA 2YWNA 4NHZA 4OO4A 2B6MA 3F4SA 1Z7RA 5F8BA 4ILFA 3TCOA 1UN2A 1XVQA 1ZYEA 1Y25A 1BF5A 1U88A 4HS1A 1XIYA 2GDRA 3HJMA 1K3YA 2C0EA 2R2JA 4TRXA 1MDJA 5G31A 1GUKA 2N5FA 1TRVA 5J4UA 3L0HA 2VLTA 3HJPA 4G2EA 1SL1B 2PMTA 1ZCPA 4K0NA 4TN8A 1SKWB 4O7HA 5J41A 3KJYA 2R6KA 5B8BA 5DCGA 1PN9A 1R5AA 2C4JA 3G7JA 1A0FA 2H1BA 4HZ2A 3RAZA 3IA1A 1YF1A 1GTIA 4IP1A 5GAND 4F03A 2O36A 4H86A 3E0UA 2CA8A 4GWRA 4XRDA 1Y1UA 3UMAA 2WGRA 2YWOA 3WGDA 5CRHA 4JR4A 2IJYA 6GSSA 1F6MC 2VO4A 5B8AA 3FZ4A 4I97A 5AGYA 1ON4A 4FQUA 5ECIB 1K0NA 1YKAA 4J57E 3TUEA 4KCEA 1TU8A 2LJRA 2VL9A 4CHSA 1ILOA 2FCHA 3TKQA 2GVPA 2KOKA 3EMXA 1K0BA 1ERWA 3BBYA 3HKRA 1DBYA 2RM5A 1ZGNA 4MJBA 2MMZA 5KN0A 4KDYA 4PQIA 2HLSA 5CRDA 1RW1A 4YQVA 1X0RA 3ZIVA 2IL3A 1SJ6A 1TTZA 1M99A 3ZTLA 1O73A 5HR1A 3TKSC 3ERFA 5CP1A 4ACSA 2RUEA 5IMCA 5IO0A 2HFDA 1OVNA 3GKNA 4EUYA 1WWJA 2CX3A 2PBJA 1ML6A 2X64A 2OBKA 3LORA 1PL2A 4K7NA 3UARA 1S3CA 5ID2B 4EL1A 4ML6A 2GSSA 4GCIA 1R7HA 2WULA 1YQ1A
chains in the Genus database with same CATH topology
4E68A 1GRXA 5A34A 2GZZA 4POMA 2RLIA 2YNXA 2QC7A 1XWKA 1V40A 2CQ9A 3IAS2 2IWTA 2DJ0A 3I6AA 1M9AA 1QFNA 5JCGA 3FR6A 1GSEA 2HRAA 2X8GA 3LXZA 1XOAA 5DAKA 5ECQB 1SENA 2P5RA 1EP8A 2CVBA 2JL4A 3UAPA 2VCQA 4IELA 3WD6A 2GGTA 2MBTA 1WMJA 4BWSA 1X9MB 3CMIA 5H5QA 2OKAA 4GTUA 5A4UA 4ECCA 3H93A 4IW9A 5BMUA 2KLXA 2YN1A 4PX1A 2X4AA 2IMKA 3DGQA 4IQ1A 4LA1A 5ECSA 2K18A 3QOUA 3G9BA 1FB6A 1R26A 2B3SA 4LL1B 1BX9A 2A4HA 4N0ZA 6GSTA 2LRTA 3UOMA 2EFDA 3I9V2 2ON7A 5EL8A 4EIQA 5EPFA 3LJRA 4TVEA 4WKWA 4POBA 4D73A 4LMVA 5DJMA 5EVOA 4TW5A 3GX0A 1BAYA 1FOHA 4V2LA 1PRXA 3TKRA 1F2EA 1PGTA 3DWVA 4N30A 2IFQA 4NHWA 3P7XA 1SVOA 1MD3A 2K8SA 2H6XA 4HJMA 3NZNA 2JZRA 4WF4A 1GSUA 2YV7A 4OWYA 4BL7A 4PTSA 5J9CA 1ZMAA 1SK2A 2O87A 3EMPA 3QDNA 3APOA 4ZL9A 4D73B 2H6YA 1EWXA 1TW9A 3F8UA 3GKMA 3HVSA 1MDIA 2VM1A 4OCEA 2PERA 2FWGA 4MF7A 4NPBA 4AI6A 1GTBA 2IFQB 2HRNA 3ZMKA 2DJJA 4WF5A 1TU7A 4K6XA 2EFEA 1VRSD 3ZZXA 3TOTA 5J4YA 4BL7B 4BVXA 2WRTA 2DBCA 3LSZA 3J7Yk 1XOBA 5A1NA 3L9SA 5KOWA 1GUMA 3GTUA 4KW6A 2QGVA 5JCUA 3QAGA 1ERUA 1ZOFA 2FNOA 4ZBBA 4TR4A 2C3QA 3RPPA 4JR6A 3MWHA 5INYA 3VPTA 4RQRA 3WGXA 3HHVA 4JRRA 1XWCA 4MZWA 16GSA 3A2WA 3DD3A 1SL2B 2YANA 4BVXB 4YKGA 3QMXA 5A1NB 3HVXA 1T8EB 3D0ZA 3DVXA 2DMLA 3GTUB 4OMVA 1GSQA 1FVKA 3US3A 2HSYA 5ECOB 4ZB8A 2AJQB 4N10A 2B1KA 1EEMA 1SK1A 1KEBA 3P90A 4AJ7A 1J08A 14GSA 3ME8A 3GKXA 4K8MA 4V1Ag 1V58A 2E0QA 2N5BA 1OC8A 4NXIA 1B9YC 1TKDB 3UL3A 2HE3A 4HJ2A 10GSA 2PU9C 1CQHA 2WZ9A 3CWGA 2YZHA 3CXGA 2H1DA 4N11A 3TKPA 4FO5A 1QXHA 3CRTA 7GSSA 3LXTA 2FWEA 3IPZA 4GDFA 2M46A 4ZBAA 3TJJA 4IHUA 2FGXA 2FY6A 3S9FA 1S3AA 3GA4A 4F9ZA 1IYHA 2DJ3A 2LQOA 4F2IA 2WFCA 4MH3A 4V2MA 5JWQB 3KCMA 1WIKA 4X0XA 3JCML 4Q5NA 4ZILA 2C8UA 3TJKA 2P0GA 5ECKB 2AHEA 4GQFA 4ZBDA 3HXSA 3GIXA 3IOSA 2F8AA 1FAAA 3HZ4A 2YP6A 1FOVA 2A2SA 1X5CA 2VL2C 3LG6A 3RBTA 1F3BA 2C0GA 1UVZA 3HZ8A 2HRKB 4OFMA 2YZUA 4XRAA 1QUWA 2H8LA 2CT6A 2JU5A 1GTUA 1EZKA 4PNFA 1FW1A 2OA7A 1AQVA 4RI6A 2A2RA 2C0FA 3LYKA 1JHBA 3GN3A 3C8EA 1M2AA 2VIMA 4PUAA 4IBPA 3IXRA 4WEYA 3FZAA 5C04A 1M9BA 1OYJA 5IMAA 20GSA 2HSHA 4HDEA 2AAWA 2IMDA 1PMTA 2DJKA 1EOGA 2DC5A 4IS0A 1K0DA 4NMUA 1N8JA 3MAKA 4ECJA 4GQCA 2HI7A 3M9KA 1B4PA 2I81A 3TKSE 2EIRA 2H75A 3PH9A 2H71A 3SBCA 4G0LA 2OBIA 3EURA 3TKSA 4FYUA 2VCVA 2IMEA 3GL5A 2YJ7A 2PUKC 4G19A 2V6OA 3KH9A 4QL9A 2KHPA 2LKUA 1NHYA 2YOIA 4L0WA 4XCSA 2ALBA 4V2NA 1T7PB 1GNWA 1PKWA 2VKZG 1WP0A 1N2AA 2WDUA 4ECIA 5DDLA 3EE2A 4YQUA 2AYTA 2BMXA 1BEDA 1XW9A 2NDOA 1JZWA 1R4WA 4HU9A 3TDGA 1MEKA 3M9JA 5IMDA 3KMOA 3ZMLA 4YAPA 6GSUA 4O32A 5E59A 3FMWA 1XWGA 2QKEA 3NIVA 2LNTA 1BJXA 1XBSA 3DYRA 1AUCA 2QA1A 4MMMA 5H5RA 4IVFA 1A8LA 1QGVA 2XPDA 3DEXA 4KDUA 4EVMA 1EGOA 3E9JB 5ECRB 1NSWA 4ICYA 1TRWA 3FYGA 3CTGA 3QR6A 4K7OA 1V2AA 2PPTA 4IGJA 1X9WB 3LWAA 3KMNA 5ID2A 1SYXA 4GSTA 1A8YA 2DIYA 5IOXA 4CY8A 4CY6A 2LRCA 2ZNMA 1BG5A 1SD8A 1MD4A 2IMIA 1SD9A 4XTSA 3G7IA 5DBQA 5CREA 17GSA 3EYTA 2HZFA 5DJLA 4ZL8A 5IO2A 4WR4A 3QCPA 3Q6OA 1KTEA 5AN1A 3I69A 1PN0A 1U6TA 4EF0A 4CW9A 4GSSA 1F37A 4ID0A 1W4VA 2MMNA 2C80A 2F51A 4EIPA 4HQSA 4IN0A 2H01A 4PGTA 3C71A 4CDOA 4TR1A 3WYWA 1S3DA 2LJAA 2OADA 4O92A 5KEJA 1FHEA 3F3QA 2MMAA 4G0KA 4TR3A 3ZVJD 4FYCA 4POLA 2VAFA 1T3BA 5J47A 4HEA2 3CSJA 2WB9A 4MF5A 4WXTA 2FA4A 3D22A 3GUSA 1AC1A 1ERTA 4RQXA 2O89A 4WBRD 2ZCTA 1GULA 4KF9A 1SU9A 2K8VA 3GYKA 4X43A 1K0MA 1OC9A 4JU5A 3KP9A 1G6YA 2HNLA 5HR0A 5H5SA 1THXA 5F06A 3LEFA 4XS6A 4TR1B 2EFHA 4K5RA 4NV5A 5LCZA 4KE3A 4HOJA 2R0PA 4F0CA 2WJUA 3F6DA 3UBKA 3O6TA 3DKSA 1ZYQB 2V32A 2N5AA 2E2GA 2MMOA 1SYRA 5CRGA 4NAXA 1M2DA 3CYNA 3KH7A 3MIXA 3KGKA 1PL1A 4USSA 3F3RA 2J9HA 3EU4A 2CAIA 5DQSA 3FY7A 1OC9B 5IMVA 4MH2A 2NTOA 2PVOC 3A2VA 4HQZA 4MK3A 2DKIA 1H75A 4Z2UA 2LSTA 2MBSA 2XC2A 3D4TA 5D96A 3HYPA 4EO3A 4IKHA 2OJLA 2PN8A 2NVLA 4L8EA 2H1GA 3Q74A 1J9BA 2FA8A 2FLSA 2HSMA 3LYPA 5IOWA 3KM6A 1SJIA 2AB6A 1PKZA 3HJOA 3KTLA 2LTKA 1GL8A 1WRYA 4QQ7A 2MZCA 4QL7A 3ZITA 2EIOA 4MZBA 1X5DA 1T4YA 1ZL9A 3K8NA 5ECMB 2X8HA 3ISOA 3DRNA 2TRXA 3A5IA 5JWOB 1U87A 4AF2A 3QPMA 1SKSB 1USBA 2B7JA 5LD0A 2F3MA 1TRUA 4PQ1A 3CSIA 2XPEA 5D8IA 5D9VA 3TJFA 5DCHA 2V41A 1ACVA 3HD5A 1TJDA 4MF6A 4XHMA 3BJ5A 1RQMA 2R3XA 4GSNA 2HSMB 1WOUA 3ZVJA 3FW2A 4MJAA 4EDZA 4ZB6A 1GSSA 2GTUA 4LLRA 2XHFA 2O8VB 4MNNA 3PR8A 2DJ2A 3EWLA 2B5YA 3EU3A 1O6JA 3VPQA 1E2YA 3VWVA 3RHBA 1G6WA 1IYIA 1FVJA 1BG1A 2B5EA 5ECLB 2YJHA 2V2GA 1URMA 1GUHA 1M0UA 2DJ1A 2H70A 3TRQA 1X9SB 3QFBC 4OFNA 2FWHA 4BVYA 2GLRA 4EDYA 3C73A 1GSFA 1ZZYA 3FHKA 2VD1A 4ISDA 4AJ8A 2VL3A 2RM6A 3GL3A 2M80A 5ENUA 2WCIA 1YY7A 2VL2A 1W89A 5EY6A 3LGCA 4EE0A 2FD3A 1XCCA 5HR2A 3H79A 1XW5A 2H76A 4POKA 1YVLA 3IK9A 1O8WA 4XS4A 4IJIA 5A5HA 3BCKA 4BVYB 11GSA 1YEPA 2LS5A 1OKTA 3PGTA 3D21A 4K9ZA 4MABA 4DSQA 2VCZA 3HCZA 1K3OA 3RHCA 1TI3A 3MSZA 2L4CA 4O5RA 4MCUA 4G9HA 5ABRA 1HQOA 1O8XA 2LJKA 4K0GA 6GSYA 4L5OA 1JLVA 1AIUA 3AY8A 4XS4B 4LMWA 1XXUA 5A5HB 3TRPA 2L4QA 3UVTA 2O7KA 2G2QA 2GZYA 2HRKA 5GSTA 2GT6A 3DIEA 4OD7A 3LW9A 1JZOA 1ST9A 1O85A 3EC3A 1TI1A 1K0AA 5D9XA 4GXZA 3J7Yb 1JFUA 2YV9A 3L4NA 1H4OA 4FH8A 5D93A 4N0VA 2GT5A 3D6IA 2I3YA 5IIZA 1XVWA 3F6FA 1B8XA 3O76A 5HFGA 5IPHA 2PWJA 4WETA 1T1VA 2G0FA 3R3EA 1GNEA 4IQAA 1Z6NA 1BQ7A 4KUNA 2LRNA 3GSSA 2DIZA 1AAZA 2LEGA 2B5XA 4I2UA 2O85A 3ZLPA 1T00A 2D2ZA 3IRAA 1SKRB 2M72A 5IQYA 2HYXA 1R5PA 3GH9A 3G7YA 1PD21 2DLXA 5D9WA 1ZYPA 5A4WA 4YAVA 2P5QA 3L78A 4ULXA 2VLUA 5DVBA 1LU4A 2LUSA 4JZQA 4XIHA 4QMKA 2HT9A 2HZEA 3VWXA 4K5SA 3RDWA 4Z7XA 3VWUA 5IMZA 3TGZA 5BRTA 3IV4A 5LNKe 2H0IA 2ES7A 1VF2A 5ELAA 2KP2A 2H0GA 5AIXA 3SWLA 1M2BA 3IC4A 4OO5A 4I6XA 3TOUA 3GFKA 2UV8G 4DVCA 12GSA 3U5RE 1LBKA 5ELGA 2DSAA 4KA0A 1PQNA 5FT3A 2X49A 4X1UA 4Q5QA 1HNBA 4GRFA 9GSSA 1ABAA 2H1AA 1LJRA 1HYUA 5KN1A 4ZB9A 2YPMA 2HZEB 5HQPA 4GF0A 1XW6A 2NBSA 3TU3B 3P8WA 2H0HA 2VM2A 2C3TA 1QQ2A 4K2DA 2K6VA 1TXUA 2GQLA 3ZFBA 5G5EA 3W6GA 1V9WA 3M3MA 5D9TA 3HVVA 1PX7A 1GLQA 3P2AA 3F4RA 3N9JA 3QAWA 3W8JA 3KTBA 3C1SA 5J40A 1OE7A 1RK4A 4MDCA 1GSYA 5ECHB 1OC3A 2NPBA 2GSRA 3GHAA 4OFTA 3F4TA 3VFIA 1DUGA 5HR3A 3FZ5A 1QK8A 2C3NA 2GQKA 1CQGA 4HI7A 6GSVA 1GH2A 4KH7A 1A23A 3A2XA 3DXBA 2JSZA 2DKHA 3A5WA 2OT3A 1X5EA 1SVMA 4Z2TA 2H74A 4KGIA 8GSSA 5C00A 4RI7A 1A2MA 3C7MA 1UC7A 3UVHA 1Z5YE 3PINA 5J9BA 2OE0A 1MTCA 4RUVA 3GX8A 5GAPD 2OACA 4BA7A 2CV4A 4PQHA 4KSMA 3W8SA 2H19A 1XZOA 3CRUA 4WR5A 1F9MA 1N25A 1I5GA 3EINA 1AQXA 3QD9A 2C1YA 1JZRA 3ERWA 4TR0A 2XBIA 4ZIJA 3GSTA 5G2ZA 2H1LA 2OE1A 1XWBA 1ERVA 2CZ3A 2I1UA 2VCTA 1AXDA 1Z6MA 5L71A 3LFLA 2DMMA 5CAXA 1YF0A 4BPYA 4K2XA 2I4AA 2R0GA 5A5KA 2R4VA 2L6DA 4J56E 2EC4A 2JZTA 3O3TA 1PSQA 1U3IA 1WJKA 1HNCA 4PXOA 5IMFA 2L5OA 2AUVA 2F9SA 3QAVA 4JE1A 1YZXA 3ERGA 5B7CA 4YKFA 1BYEA 1T4ZA 4NWYA 2CZ2A 4MLYA 4I8BA 4PURA 3KIJA 1E6BA 2JACA 4TXOA 4X4JA 4HZ4A 3MNGA 2H30A 3FEUA 3VLNA 4MPFA 4WBJA 4KNDA 3M1GA 5KN2A 3IHGA 4AKGA 3M8NA 3MYDA 5ECPB 5COHA 1HNAA 2CAQA 1EEJA 3L9UA 2VOCA 5ECNB 3DMLA 2VUPA 1TP9A 1XWAA 4AKIA 5DQYA 1VF4A 2YCDA 3M0FA 4G10A 1JLWA 3OR5A 3TJGA 1OE8A 4KB3A 1F3AA 2X99A 3BCIA 1XFLA 1K0OA 4AKXB 3BOAA 1NM3A 3WT1A 2I9HA 4YQMA 1WPIA 5HFKA 2FHEA 2ON5A 1QMVA 1FG4A 1I9DA 4TXOB 5A34B 4JBBA 4KX4A 3HA9A 4IP6A 1FB0A 3GMFA 4L0UA 2UZ8A 2TRCP 3UIWA 3CBUA 4L5LA 3LQ7A 2TIRA 3GURA 1PA3A 2J23A 2REMA 4PUFC 1Z7PA 4KAEA 2PGTA 1OKDA 5DAKB 2H73A 3FRCA 3NOFA 1TXXA 4MJCA 1TK0B 4YH2A 3BD2A 2JSYA 4EKZA 3APSA 3FKFA 1DE2A 1UA5A 3A3TA 5GZZB 1O81A 2QA2A 2K9FA 2L5LA 5CRWA 3HY2A 5BMUB 4O5QA 1FO5A 4MA9A 4G0IA 1GLPA 3DVWA 1TOFA 2A2PA 3IE3A 2KP1A 2RIIA 2E2MA 3TJBA 2HQTA 1NW2A 4I2TA 22GSA 4KCAA 1EP7A 5KN3A 3FZ9A 4AKHA 4HU7A 5J5NA 2V1MA 1Q4JA 2JZSA 1TDIA 3IBHA 2GSTA 1THOA 4EC0A 3GNJA 1SK0A 3VI5A 5B6NA 4P3YB 3KP8A 3IK7A 2B7KA 3VI7A 2BTOT 4BWQA 2IMFA 3H8QA 2Z9SA 2GSQA 4MP4A 1A2JA 3IC8A 1Z9HA 4Q5RA 4DEJA 4KSOA 2FWFA 3IAM2 1GTAA 2BJXA 1DE1A 5J4VA 1GSDA 5IM9A 5AIVA 3KXOA 3RPNA 3UJ1A 4E8EA 5B6MA 3V1WA 1GWCA 2P31A 2FUG2 2HRFA 2IPAA 3KD0A 6GSWA 1B9XC 2AV4A 1YEXA 3H1NA 2H6ZA 18GSA 3VURA 1G0TA 1V57A 2KUCA 3CTFA 4JEDA 3D5JA 2A4VA 3GH6A 3CSHA 4E8HA 3FK8A 1Y6EA 5F0GA 1HD2A 4ZB7A 3WGEA 1A0RP 2F8FA 5JCWA 5DALA 3GRXA 4W66A 5HFIA 2L6CA 4F82A 4TKYA 3C1RA 19GSA 4I5QA 4AJ6A 4N3ZA 1G7OA 1VGLA 4J2FA 4K7IA 3ZREA 3UEMA 1OAZA 1PX6A 1SL0B 2GZPA 2GQMA 2LQQA 2V6KA 4Q5FA 3FR3A 1KBNA 1YJ6A 6GSXA 5D73A 2HXKA 1SJZA 1WE0A 5FHIA 5CNWA 2L57A 1MDKA 4MJEA 4DSSA 4HUAA 2X8CA 2R37A 3F63A 4K1FA 4EXJA 3D4MA 2VD0A 3ZRDA 1V98A 3F9UA 2R5GA 3ZL5A 5DALB 1AW9A 5AISA 5KOXA 2IN3A 2H72A 1EV4A 3R2QA 5G5FA 1J0FA 1TRSA 1O7UA 3F0IA 2H66A 5F05A 2E7PA 3H4KA 3E3EA 3VWWA 2VCWA 13GSA 3ZFLA 1EOHA 1ZYNA 3EPTA 4DSRA 1Q98A 2LV3A 3FR9A 4MPGA 2R0CA 3GV1A 4XS1A 4DSSB 1A24A 2CX4A 3KZQA 3TRXA 3APQA 2IIYA 4Z2RA 2VLVA 1EGRA 4G01A 3GKKA 4ML1A 1TK5B 3QFAC 3U6VA 3ME7A 2CVDA 4MZCA 2VCXA 5IPGA 1B48A 3MDKA 4O5UA 2PVQA 4OCFA 2HSNA 5G1KA 3IHQA 1EV9A 1XPVA 2B1LA 1KNGA 3Q18A 4LL4B 5E4WA 1U3AA 5CYYA 2L59A 4AGSA 4ECBA 1AQWA 4ZXGA 1A2LA 4TXVA 1Z3EA 1C72A 2C0DA 1SVLA 2O5VA 1VF3A 2WS2A 1GP1A 2QSIA 3UBLA 4A5PA 1K3LA 3N5OA 1B4QA 3ZIJA 3IDVA 3WT2A 4F0BA 4PNGA 4GLTA 1K0CA 5FWGA 2YWIA 3Q19A 2ZUPA 5GSSA 2OE3A 2CVKA 2EFCA 2YWMA 2XBQA 5J3RA 2GS3A 2HSNB 1M7TA 3IR4A 5A4VA 2MYGA 4IJ3A 4ZL7A 3VK9A 1VF1A 5CO3A 4TOPA 5G30A 3I43A 1NHOA 4NV2A 4FIWA 5F07A 3HMJG 5G1LA 3L9VA 3TB2A 1JZDA 4V1Ap 1DSBA 3HDCA 2EIQA 3ZYWA 1YKCA 4KDXA 3ED3A 1G7EA 3EVIA 1TK8B 1YDKA 2JADA 2LNSA 3KEBA 5JWRB 2RUFA 3PPUA 4FYBA 2YWNA 4NHZA 4OO4A 2B6MA 3F4SA 1Z7RA 5F8BA 4ILFA 3TCOA 1UN2A 1XVQA 1ZYEA 1Y25A 1BF5A 1U88A 4HS1A 1XIYA 2GDRA 3HJMA 1K3YA 2C0EA 2R2JA 4TRXA 1MDJA 5G31A 1GUKA 2N5FA 1TRVA 5J4UA 3L0HA 2VLTA 3HJPA 4G2EA 1SL1B 2PMTA 1ZCPA 4K0NA 4TN8A 1SKWB 4O7HA 5J41A 3KJYA 2R6KA 5B8BA 5DCGA 1PN9A 1R5AA 2C4JA 3G7JA 1A0FA 2H1BA 4HZ2A 3RAZA 3IA1A 1YF1A 1GTIA 4IP1A 5GAND 4F03A 4H86A 3E0UA 2CA8A 4GWRA 4XRDA 1Y1UA 3UMAA 2WGRA 2YWOA 3WGDA 5CRHA 4JR4A 2IJYA 6GSSA 1F6MC 2VO4A 5B8AA 3FZ4A 4I97A 5AGYA 1ON4A 4FQUA 5ECIB 1K0NA 1YKAA 4J57E 3TUEA 4KCEA 1TU8A 2LJRA 2VL9A 4CHSA 1ILOA 2FCHA 3TKQA 2GVPA 2KOKA 3EMXA 1K0BA 1ERWA 3BBYA 3HKRA 1DBYA 2RM5A 1ZGNA 4MJBA 2MMZA 5KN0A 4KDYA 4PQIA 2HLSA 5CRDA 1RW1A 4YQVA 1X0RA 3ZIVA 2IL3A 1SJ6A 1TTZA 1M99A 3ZTLA 1O73A 5HR1A 3TKSC 3ERFA 5CP1A 4ACSA 2RUEA 5IMCA 5IO0A 2HFDA 1OVNA 3GKNA 4EUYA 1WWJA 2CX3A 2PBJA 1ML6A 2X64A 2OBKA 3LORA 1PL2A 4K7NA 3UARA 1S3CA 5ID2B 4EL1A 4ML6A 2GSSA 4GCIA 1R7HA 2WULA 1YQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GRX A;  2GZZ A;  4POM A;  2RLI A;  2YNX A;  2QC7 A;  1XWK A;  1V40 A;  2CQ9 A;  3IAS 2;  2IWT A;  2DJ0 A;  3I6A A;  1M9A A;  1QFN A;  5JCG A;  3FR6 A;  1GSE A;  2HRA A;  2X8G A;  3LXZ A;  1XOA A;  5DAK A;  5ECQ B;  1SEN A;  2P5R A;  1EP8 A;  2CVB A;  2JL4 A;  3UAP A;  2VCQ A;  4IEL A;  3WD6 A;  2GGT A;  2MBT A;  1WMJ A;  4BWS A;  1X9M B;  3CMI A;  5H5Q A;  2OKA A;  4GTU A;  5A4U A;  4ECC A;  4IW9 A;  5BMU A;  3H93 A;  2KLX A;  2YN1 A;  4PX1 A;  2IMK A;  3DGQ A;  4IQ1 A;  4LA1 A;  5ECS A;  2K18 A;  3QOU A;  3G9B A;  1FB6 A;  1R26 A;  2B3S A;  4LL1 B;  1BX9 A;  4N0Z A;  6GST A;  2LRT A;  3UOM A;  3I9V 2;  2ON7 A;  5EL8 A;  5EPF A;  3LJR A;  4TVE A;  4WKW A;  4POB A;  4D73 A;  4LMV A;  5DJM A;  5EVO A;  4TW5 A;  3GX0 A;  1BAY A;  4V2L A;  1PRX A;  3TKR A;  1F2E A;  1PGT A;  3DWV A;  4N30 A;  2IFQ A;  4NHW A;  3P7X A;  1MD3 A;  2K8S A;  2H6X A;  4HJM A;  3NZN A;  2JZR A;  4WF4 A;  1GSU A;  2YV7 A;  4OWY A;  4BL7 A;  4PTS A;  5J9C A;  1ZMA A;  1SK2 A;  2O87 A;  3EMP A;  3QDN A;  3APO A;  4ZL9 A;  4D73 B;  2H6Y A;  1EWX A;  1TW9 A;  3F8U A;  3GKM A;  3HVS A;  1MDI A;  2VM1 A;  4OCE A;  2PER A;  2FWG A;  4MF7 A;  4NPB A;  1GTB A;  2IFQ B;  2HRN A;  3ZMK A;  2DJJ A;  4WF5 A;  1TU7 A;  4K6X A;  1VRS D;  3ZZX A;  3TOT A;  4BL7 B;  4BVX A;  2WRT A;  2DBC A;  3LSZ A;  3J7Y k;  1XOB A;  3L9S A;  1GUM A;  3GTU A;  4KW6 A;  2QGV A;  5JCU A;  3QAG A;  1ERU A;  1ZOF A;  2FNO A;  4ZBB A;  4TR4 A;  2C3Q A;  3RPP A;  4JR6 A;  3MWH A;  5INY A;  3VPT A;  4RQR A;  3WGX A;  3HHV A;  4JRR A;  1XWC A;  4MZW A;  16GS A;  3A2W A;  3DD3 A;  1SL2 B;  2YAN A;  4BVX B;  3QMX A;  3HVX A;  1T8E B;  3D0Z A;  3DVX A;  2DML A;  3GTU B;  4OMV A;  1GSQ A;  1FVK A;  3US3 A;  2HSY A;  5ECO B;  4ZB8 A;  2AJQ B;  4N10 A;  2B1K A;  1EEM A;  1SK1 A;  1KEB A;  3P90 A;  4AJ7 A;  1J08 A;  14GS A;  3ME8 A;  3GKX A;  4K8M A;  4V1A g;  1V58 A;  2E0Q A;  2N5B A;  1OC8 A;  4NXI A;  1B9Y C;  1TKD B;  3UL3 A;  2HE3 A;  4HJ2 A;  10GS A;  2PU9 C;  1CQH A;  2WZ9 A;  2YZH A;  3CXG A;  2H1D A;  4N11 A;  3TKP A;  4FO5 A;  1QXH A;  3CRT A;  7GSS A;  3LXT A;  2FWE A;  3IPZ A;  2M46 A;  4ZBA A;  3TJJ A;  4IHU A;  2FGX A;  2FY6 A;  3S9F A;  1S3A A;  3GA4 A;  4F9Z A;  1IYH A;  2DJ3 A;  2LQO A;  4F2I A;  2WFC A;  4MH3 A;  4V2M A;  5JWQ B;  3KCM A;  1WIK A;  4X0X A;  3JCM L;  4Q5N A;  4ZIL A;  2C8U A;  3TJK A;  2P0G A;  5ECK B;  2AHE A;  4GQF A;  4ZBD A;  3HXS A;  3GIX A;  3IOS A;  2F8A A;  1FAA A;  3HZ4 A;  2YP6 A;  1FOV A;  2A2S A;  1X5C A;  2VL2 C;  3LG6 A;  3RBT A;  1F3B A;  2C0G A;  1UVZ A;  3HZ8 A;  2HRK B;  4OFM A;  2YZU A;  4XRA A;  1QUW A;  2H8L A;  2CT6 A;  2JU5 A;  1GTU A;  1EZK A;  4PNF A;  1FW1 A;  2OA7 A;  1AQV A;  4RI6 A;  2A2R A;  2C0F A;  3LYK A;  1JHB A;  3GN3 A;  3C8E A;  1M2A A;  2VIM A;  4PUA A;  4IBP A;  3IXR A;  4WEY A;  3FZA A;  5C04 A;  1M9B A;  1OYJ A;  5IMA A;  20GS A;  2HSH A;  4HDE A;  2AAW A;  2IMD A;  1PMT A;  2DJK A;  1EOG A;  2DC5 A;  4IS0 A;  1K0D A;  4NMU A;  1N8J A;  3MAK A;  4ECJ A;  4GQC A;  2HI7 A;  3M9K A;  1B4P A;  2I81 A;  3TKS E;  2EIR A;  2H75 A;  3PH9 A;  2H71 A;  3SBC A;  4G0L A;  2OBI A;  3EUR A;  3TKS A;  4FYU A;  2VCV A;  2IME A;  3GL5 A;  2YJ7 A;  2PUK C;  4G19 A;  2V6O A;  3KH9 A;  4QL9 A;  2KHP A;  2LKU A;  1NHY A;  2YOI A;  4L0W A;  4XCS A;  2ALB A;  4V2N A;  1T7P B;  1GNW A;  1PKW A;  1WP0 A;  1N2A A;  2WDU A;  4ECI A;  5DDL A;  3EE2 A;  4YQU A;  2AYT A;  2BMX A;  1BED A;  1XW9 A;  2NDO A;  1JZW A;  1R4W A;  4HU9 A;  3TDG A;  1MEK A;  3M9J A;  5IMD A;  3KMO A;  3ZML A;  4YAP A;  6GSU A;  4O32 A;  5E59 A;  1XWG A;  2QKE A;  3NIV A;  2LNT A;  1BJX A;  1XBS A;  3DYR A;  1AUC A;  4MMM A;  5H5R A;  4IVF A;  1A8L A;  1QGV A;  2XPD A;  3DEX A;  4KDU A;  4EVM A;  1EGO A;  3E9J B;  5ECR B;  1NSW A;  1TRW A;  3FYG A;  3CTG A;  3QR6 A;  4K7O A;  1V2A A;  2PPT A;  4IGJ A;  1X9W B;  3LWA A;  3KMN A;  5ID2 A;  1SYX A;  4GST A;  1A8Y A;  2DIY A;  5IOX A;  2LRC A;  2ZNM A;  1BG5 A;  1SD8 A;  1MD4 A;  2IMI A;  1SD9 A;  4XTS A;  3G7I A;  5DBQ A;  5CRE A;  17GS A;  3EYT A;  2HZF A;  5DJL A;  4ZL8 A;  5IO2 A;  4WR4 A;  3QCP A;  3Q6O A;  1KTE A;  5AN1 A;  3I69 A;  1U6T A;  4EF0 A;  4CW9 A;  4GSS A;  1F37 A;  4ID0 A;  1W4V A;  2MMN A;  2C80 A;  2F51 A;  4HQS A;  4IN0 A;  2H01 A;  4PGT A;  3C71 A;  4CDO A;  4TR1 A;  3WYW A;  1S3D A;  2LJA A;  2OAD A;  4O92 A;  5KEJ A;  1FHE A;  3F3Q A;  2MMA A;  4G0K A;  4TR3 A;  3ZVJ D;  4FYC A;  4POL A;  2VAF A;  1T3B A;  4HEA 2;  3CSJ A;  2WB9 A;  4MF5 A;  4WXT A;  2FA4 A;  3D22 A;  3GUS A;  1AC1 A;  1ERT A;  4RQX A;  2O89 A;  4WBR D;  2ZCT A;  1GUL A;  4KF9 A;  1SU9 A;  2K8V A;  3GYK A;  4X43 A;  1K0M A;  1OC9 A;  4JU5 A;  3KP9 A;  1G6Y A;  2HNL A;  5HR0 A;  5H5S A;  1THX A;  5F06 A;  3LEF A;  4XS6 A;  4TR1 B;  4NV5 A;  5LCZ A;  4KE3 A;  4HOJ A;  4F0C A;  2WJU A;  3F6D A;  3UBK A;  3O6T A;  3DKS A;  1ZYQ B;  2V32 A;  2N5A A;  2E2G A;  2MMO A;  1SYR A;  5CRG A;  4NAX A;  1M2D A;  3CYN A;  3KH7 A;  3KGK A;  1PL1 A;  4USS A;  3F3R A;  2J9H A;  3EU4 A;  2CAI A;  5DQS A;  3FY7 A;  1OC9 B;  5IMV A;  4MH2 A;  2NTO A;  2PVO C;  3A2V A;  4HQZ A;  4MK3 A;  1H75 A;  2LST A;  2MBS A;  2XC2 A;  3D4T A;  5D96 A;  3HYP A;  4EO3 A;  4IKH A;  2OJL A;  2PN8 A;  2NVL A;  4L8E A;  2H1G A;  3Q74 A;  1J9B A;  2FA8 A;  2FLS A;  2HSM A;  3LYP A;  5IOW A;  3KM6 A;  1SJI A;  2AB6 A;  1PKZ A;  3HJO A;  3KTL A;  2LTK A;  1GL8 A;  1WRY A;  4QQ7 A;  2MZC A;  4QL7 A;  3ZIT A;  2EIO A;  4MZB A;  1X5D A;  1T4Y A;  1ZL9 A;  3K8N A;  5ECM B;  2X8H A;  3ISO A;  3DRN A;  2TRX A;  5JWO B;  1U87 A;  4AF2 A;  3QPM A;  1SKS B;  1USB A;  2B7J A;  5LD0 A;  2F3M A;  1TRU A;  4PQ1 A;  3CSI A;  2XPE A;  5D8I A;  5D9V A;  3TJF A;  5DCH A;  2V41 A;  1ACV A;  3HD5 A;  1TJD A;  4MF6 A;  4XHM A;  3BJ5 A;  1RQM A;  2R3X A;  4GSN A;  2HSM B;  1WOU A;  3ZVJ A;  3FW2 A;  4MJA A;  4EDZ A;  4ZB6 A;  1GSS A;  2GTU A;  4LLR A;  2XHF A;  2O8V B;  3PR8 A;  2DJ2 A;  3EWL A;  2B5Y A;  3EU3 A;  1O6J A;  3VPQ A;  1E2Y A;  3VWV A;  3RHB A;  1G6W A;  1IYI A;  1FVJ A;  2B5E A;  5ECL B;  2YJH A;  2V2G A;  1URM A;  1GUH A;  1M0U A;  2DJ1 A;  2H70 A;  3TRQ A;  1X9S B;  3QFB C;  4OFN A;  2FWH A;  4BVY A;  2GLR A;  4EDY A;  3C73 A;  1GSF A;  1ZZY A;  3FHK A;  2VD1 A;  4ISD A;  4AJ8 A;  2VL3 A;  2RM6 A;  3GL3 A;  2M80 A;  5ENU A;  2WCI A;  1YY7 A;  2VL2 A;  1W89 A;  5EY6 A;  3LGC A;  4EE0 A;  2FD3 A;  1XCC A;  5HR2 A;  3H79 A;  1XW5 A;  2H76 A;  4POK A;  3IK9 A;  1O8W A;  4XS4 A;  4IJI A;  3BCK A;  4BVY B;  11GS A;  1YEP A;  2LS5 A;  1OKT A;  4K9Z A;  3PGT A;  3D21 A;  4MAB A;  4DSQ A;  2VCZ A;  3HCZ A;  1K3O A;  3RHC A;  1TI3 A;  3MSZ A;  2L4C A;  4O5R A;  4MCU A;  4G9H A;  5ABR A;  1HQO A;  1O8X A;  2LJK A;  4K0G A;  6GSY A;  4L5O A;  1JLV A;  1AIU A;  3AY8 A;  4XS4 B;  4LMW A;  1XXU A;  3TRP A;  2L4Q A;  3UVT A;  2O7K A;  2G2Q A;  2GZY A;  2HRK A;  5GST A;  2GT6 A;  3DIE A;  4OD7 A;  1JZO A;  1ST9 A;  1O85 A;  3EC3 A;  1TI1 A;  1K0A A;  5D9X A;  4GXZ A;  3J7Y b;  1JFU A;  2YV9 A;  3L4N A;  1H4O A;  4FH8 A;  5D93 A;  4N0V A;  2GT5 A;  3D6I A;  2I3Y A;  5IIZ A;  1XVW A;  3F6F A;  1B8X A;  3O76 A;  5HFG A;  5IPH A;  2PWJ A;  4WET A;  1T1V A;  2G0F A;  3R3E A;  1GNE A;  4IQA A;  1Z6N A;  1BQ7 A;  4KUN A;  2LRN A;  3GSS A;  2DIZ A;  1AAZ A;  2LEG A;  2B5X A;  4I2U A;  2O85 A;  3ZLP A;  1T00 A;  2D2Z A;  3IRA A;  1SKR B;  2M72 A;  5IQY A;  2HYX A;  1R5P A;  3GH9 A;  3G7Y A;  1PD2 1;  2DLX A;  5D9W A;  5A4W A;  4YAV A;  2P5Q A;  3L78 A;  4ULX A;  2VLU A;  5DVB A;  1LU4 A;  2LUS A;  4JZQ A;  4XIH A;  2HT9 A;  2HZE A;  3VWX A;  3RDW A;  4Z7X A;  3VWU A;  5IMZ A;  3TGZ A;  3IV4 A;  5LNK e;  2H0I A;  2ES7 A;  1VF2 A;  5ELA A;  2KP2 A;  2H0G A;  5AIX A;  3SWL A;  1M2B A;  3IC4 A;  4OO5 A;  4I6X A;  3TOU A;  3GFK A;  4DVC A;  12GS A;  3U5R E;  1LBK A;  5ELG A;  2DSA A;  4KA0 A;  1PQN A;  5FT3 A;  4X1U A;  4Q5Q A;  1HNB A;  4GRF A;  9GSS A;  1ABA A;  2H1A A;  1LJR A;  1HYU A;  5KN1 A;  4ZB9 A;  2YPM A;  2HZE B;  5HQP A;  4GF0 A;  1XW6 A;  2NBS A;  3P8W A;  2H0H A;  2VM2 A;  2C3T A;  1QQ2 A;  4K2D A;  2K6V A;  2GQL A;  3ZFB A;  5G5E A;  3W6G A;  1V9W A;  3M3M A;  5D9T A;  3HVV A;  1PX7 A;  1GLQ A;  3P2A A;  3F4R A;  3N9J A;  3QAW A;  3W8J A;  3KTB A;  3C1S A;  1OE7 A;  1RK4 A;  4MDC A;  1GSY A;  5ECH B;  1OC3 A;  2NPB A;  2GSR A;  3GHA A;  4OFT A;  3F4T A;  3VFI A;  1DUG A;  5HR3 A;  3FZ5 A;  1QK8 A;  2C3N A;  2GQK A;  1CQG A;  4HI7 A;  6GSV A;  1GH2 A;  4KH7 A;  1A23 A;  3A2X A;  3DXB A;  2JSZ A;  3A5W A;  1X5E A;  2H74 A;  4KGI A;  8GSS A;  5C00 A;  4RI7 A;  1A2M A;  3C7M A;  1UC7 A;  3UVH A;  1Z5Y E;  3PIN A;  5J9B A;  2OE0 A;  1MTC A;  4RUV A;  3GX8 A;  5GAP D;  2OAC A;  4BA7 A;  2CV4 A;  4PQH A;  4KSM A;  3W8S A;  2H19 A;  1XZO A;  3CRU A;  4WR5 A;  1F9M A;  1I5G A;  3EIN A;  1AQX A;  3QD9 A;  2C1Y A;  1JZR A;  3ERW A;  4TR0 A;  2XBI A;  4ZIJ A;  3GST A;  5G2Z A;  2OE1 A;  1XWB A;  1ERV A;  2CZ3 A;  2I1U A;  2VCT A;  1AXD A;  1Z6M A;  5L71 A;  3LFL A;  2DMM A;  5CAX A;  1YF0 A;  4BPY A;  2I4A A;  5A5K A;  2R4V A;  2L6D A;  4J56 E;  2EC4 A;  2JZT A;  3O3T A;  1PSQ A;  1U3I A;  1WJK A;  1HNC A;  4PXO A;  5IMF A;  2L5O A;  2AUV A;  2F9S A;  3QAV A;  4JE1 A;  1YZX A;  3ERG A;  5B7C A;  1BYE A;  1T4Z A;  4NWY A;  2CZ2 A;  4MLY A;  4I8B A;  4PUR A;  3KIJ A;  1E6B A;  2JAC A;  4TXO A;  4HZ4 A;  3MNG A;  2H30 A;  3FEU A;  3VLN A;  4MPF A;  4WBJ A;  4KND A;  3M1G A;  5KN2 A;  3M8N A;  5ECP B;  5COH A;  1HNA A;  2CAQ A;  1EEJ A;  3L9U A;  2VOC A;  5ECN B;  3DML A;  2VUP A;  1TP9 A;  1XWA A;  5DQY A;  1VF4 A;  2YCD A;  3M0F A;  4G10 A;  1JLW A;  3OR5 A;  3TJG A;  1OE8 A;  4KB3 A;  1F3A A;  2X99 A;  3BCI A;  1XFL A;  1K0O A;  3BOA A;  1NM3 A;  3WT1 A;  2I9H A;  4YQM A;  1WPI A;  5HFK A;  2FHE A;  2ON5 A;  1QMV A;  1FG4 A;  1I9D A;  4TXO B;  4JBB A;  4KX4 A;  3HA9 A;  4IP6 A;  1FB0 A;  3GMF A;  4L0U A;  2UZ8 A;  2TRC P;  3UIW A;  3CBU A;  4L5L A;  3LQ7 A;  2TIR A;  3GUR A;  1PA3 A;  2J23 A;  2REM A;  4PUF C;  1Z7P A;  4KAE A;  2PGT A;  1OKD A;  5DAK B;  2H73 A;  3FRC A;  3NOF A;  1TXX A;  4MJC A;  1TK0 B;  4YH2 A;  3BD2 A;  2JSY A;  4EKZ A;  3APS A;  3FKF A;  1DE2 A;  1UA5 A;  3A3T A;  5GZZ B;  1O81 A;  2K9F A;  2L5L A;  5CRW A;  3HY2 A;  1FO5 A;  4MA9 A;  4G0I A;  1GLP A;  3DVW A;  1TOF A;  3IE3 A;  2KP1 A;  2RII A;  2E2M A;  3TJB A;  2HQT A;  1NW2 A;  4I2T A;  22GS A;  4KCA A;  1EP7 A;  5KN3 A;  3FZ9 A;  4HU7 A;  5J5N A;  2V1M A;  1Q4J A;  2JZS A;  1TDI A;  3IBH A;  2GST A;  1THO A;  4EC0 A;  3GNJ A;  1SK0 A;  3VI5 A;  5B6N A;  4P3Y B;  3KP8 A;  3IK7 A;  2B7K A;  3VI7 A;  2BTO T;  4BWQ A;  2IMF A;  3H8Q A;  2Z9S A;  2GSQ A;  4MP4 A;  1A2J A;  3IC8 A;  1Z9H A;  4Q5R A;  4DEJ A;  4KSO A;  2FWF A;  3IAM 2;  1GTA A;  2BJX A;  1DE1 A;  1GSD A;  5IM9 A;  5AIV A;  3KXO A;  3RPN A;  3UJ1 A;  4E8E A;  5B6M A;  3V1W A;  1GWC A;  2P31 A;  2FUG 2;  2HRF A;  2IPA A;  3KD0 A;  6GSW A;  1B9X C;  2AV4 A;  1YEX A;  3H1N A;  2H6Z A;  18GS A;  3VUR A;  1G0T A;  1V57 A;  2KUC A;  3CTF A;  4JED A;  3D5J A;  2A4V A;  3GH6 A;  3CSH A;  4E8H A;  3FK8 A;  1Y6E A;  5F0G A;  1HD2 A;  3WGE A;  1A0R P;  2F8F A;  5JCW A;  5DAL A;  3GRX A;  5HFI A;  2L6C A;  4F82 A;  4TKY A;  3C1R A;  19GS A;  4I5Q A;  4AJ6 A;  1G7O A;  1VGL A;  4J2F A;  4K7I A;  3ZRE A;  3UEM A;  1OAZ A;  1PX6 A;  1SL0 B;  2GZP A;  2GQM A;  2LQQ A;  2V6K A;  4Q5F A;  3FR3 A;  1KBN A;  1YJ6 A;  6GSX A;  5D73 A;  2HXK A;  1SJZ A;  1WE0 A;  5FHI A;  5CNW A;  2L57 A;  1MDK A;  4MJE A;  4DSS A;  4HUA A;  2X8C A;  2R37 A;  3F63 A;  4K1F A;  4EXJ A;  3D4M A;  2VD0 A;  3ZRD A;  1V98 A;  3F9U A;  2R5G A;  3ZL5 A;  5DAL B;  1AW9 A;  5AIS A;  2IN3 A;  2H72 A;  1EV4 A;  3R2Q A;  5G5F A;  1J0F A;  1TRS A;  1O7U A;  3F0I A;  2H66 A;  5F05 A;  2E7P A;  3H4K A;  3E3E A;  3VWW A;  2VCW A;  13GS A;  3ZFL A;  1EOH A;  4DSR A;  1Q98 A;  2LV3 A;  3FR9 A;  4MPG A;  3GV1 A;  4XS1 A;  4DSS B;  1A24 A;  2CX4 A;  3KZQ A;  3TRX A;  3APQ A;  2IIY A;  2VLV A;  1EGR A;  3GKK A;  4ML1 A;  1TK5 B;  3QFA C;  3U6V A;  3ME7 A;  2CVD A;  4MZC A;  2VCX A;  5IPG A;  1B48 A;  3MDK A;  2PVQ A;  4OCF A;  5G1K A;  3IHQ A;  1EV9 A;  1XPV A;  2B1L A;  1KNG A;  3Q18 A;  4LL4 B;  5E4W A;  1U3A A;  5CYY A;  2L59 A;  4AGS A;  4ECB A;  1AQW A;  4ZXG A;  1A2L A;  4TXV A;  1Z3E A;  1C72 A;  2C0D A;  1VF3 A;  2WS2 A;  1GP1 A;  2QSI A;  3UBL A;  1K3L A;  3N5O A;  1B4Q A;  3ZIJ A;  3IDV A;  3WT2 A;  4F0B A;  4PNG A;  4GLT A;  1K0C A;  5FWG A;  2YWI A;  3Q19 A;  2ZUP A;  5GSS A;  2OE3 A;  2CVK A;  2YWM A;  2XBQ A;  5J3R A;  2GS3 A;  2HSN B;  1M7T A;  3IR4 A;  5A4V A;  2MYG A;  4IJ3 A;  4ZL7 A;  3VK9 A;  1VF1 A;  5CO3 A;  4TOP A;  5G30 A;  3I43 A;  1NHO A;  4NV2 A;  4FIW A;  5F07 A;  5G1L A;  3L9V A;  3TB2 A;  1JZD A;  4V1A p;  1DSB A;  3HDC A;  2EIQ A;  3ZYW A;  1YKC A;  4KDX A;  3ED3 A;  1G7E A;  3EVI A;  1TK8 B;  1YDK A;  2JAD A;  2LNS A;  3KEB A;  5JWR B;  2RUF A;  3PPU A;  4FYB A;  2YWN A;  4NHZ A;  4OO4 A;  2B6M A;  3F4S A;  1Z7R A;  5F8B A;  4ILF A;  3TCO A;  1UN2 A;  1XVQ A;  1ZYE A;  1Y25 A;  4HS1 A;  1U88 A;  1XIY A;  2GDR A;  3HJM A;  1K3Y A;  2C0E A;  2R2J A;  4TRX A;  1MDJ A;  5G31 A;  1GUK A;  2N5F A;  1TRV A;  5J4U A;  3L0H A;  2VLT A;  3HJP A;  4G2E A;  1SL1 B;  2PMT A;  1ZCP A;  4K0N A;  4TN8 A;  1SKW B;  4O7H A;  5J41 A;  3KJY A;  2R6K A;  5B8B A;  5DCG A;  1PN9 A;  1R5A A;  2C4J A;  3G7J A;  1A0F A;  2H1B A;  4HZ2 A;  3RAZ A;  3IA1 A;  1YF1 A;  1GTI A;  4IP1 A;  5GAN D;  4F03 A;  4H86 A;  3E0U A;  2CA8 A;  4GWR A;  4XRD A;  3UMA A;  2WGR A;  2YWO A;  3WGD A;  5CRH A;  4JR4 A;  2IJY A;  6GSS A;  1F6M C;  2VO4 A;  5B8A A;  3FZ4 A;  4I97 A;  5AGY A;  1ON4 A;  4FQU A;  5ECI B;  1K0N A;  1YKA A;  4J57 E;  3TUE A;  4KCE A;  1TU8 A;  2LJR A;  2VL9 A;  4CHS A;  1ILO A;  2FCH A;  3TKQ A;  2GVP A;  2KOK A;  3EMX A;  1K0B A;  1ERW A;  3BBY A;  3HKR A;  1DBY A;  2RM5 A;  1ZGN A;  4MJB A;  2MMZ A;  5KN0 A;  4KDY A;  4PQI A;  2HLS A;  5CRD A;  1RW1 A;  4YQV A;  1X0R A;  3ZIV A;  2IL3 A;  1SJ6 A;  1TTZ A;  1M99 A;  3ZTL A;  1O73 A;  5HR1 A;  3TKS C;  3ERF A;  5CP1 A;  4ACS A;  2RUE A;  5IMC A;  5IO0 A;  2HFD A;  1OVN A;  3GKN A;  4EUY A;  1WWJ A;  2CX3 A;  2PBJ A;  1ML6 A;  2X64 A;  2OBK A;  3LOR A;  1PL2 A;  4K7N A;  3UAR A;  1S3C A;  5ID2 B;  4EL1 A;  4ML6 A;  2GSS A;  4GCI A;  1R7H A;  2WUL A;  1YQ1 A; 
#chains in the Genus database with same CATH topology
 4E68 A;  1GRX A;  5A34 A;  2GZZ A;  4POM A;  4PHZ C;  2RLI A;  2YNX A;  2QC7 A;  1XWK A;  1V40 A;  2CQ9 A;  3IAS 2;  2IWT A;  2DJ0 A;  3I6A A;  1M9A A;  1QFN A;  5JCG A;  3FR6 A;  1GSE A;  2HRA A;  2X8G A;  3LXZ A;  1XOA A;  5DAK A;  5ECQ B;  1SEN A;  2P5R A;  1EP8 A;  2CVB A;  2JL4 A;  3UAP A;  2VCQ A;  4IEL A;  3WD6 A;  2GGT A;  2MBT A;  1WMJ A;  4BWS A;  1X9M B;  3CMI A;  5H5Q A;  2OKA A;  4GTU A;  5A4U A;  4ECC A;  3H93 A;  4IW9 A;  5BMU A;  2KLX A;  2YN1 A;  4PX1 A;  2X4A A;  2IMK A;  3DGQ A;  4IQ1 A;  4LA1 A;  5ECS A;  2K18 A;  3QOU A;  3G9B A;  1FB6 A;  1R26 A;  2B3S A;  4LL1 B;  1BX9 A;  2A4H A;  4N0Z A;  6GST A;  2LRT A;  3UOM A;  2EFD A;  3I9V 2;  2ON7 A;  5EL8 A;  4EIQ A;  5EPF A;  3LJR A;  4TVE A;  4WKW A;  4POB A;  4D73 A;  3RFR C;  4LMV A;  5DJM A;  5EVO A;  4TW5 A;  3GX0 A;  1BAY A;  1FOH A;  4V2L A;  1PRX A;  3TKR A;  1F2E A;  1PGT A;  3DWV A;  4N30 A;  2IFQ A;  4NHW A;  3P7X A;  1SVO A;  1MD3 A;  2K8S A;  2H6X A;  4HJM A;  3NZN A;  2JZR A;  4WF4 A;  1GSU A;  2YV7 A;  2O3E A;  4OWY A;  4BL7 A;  4PTS A;  5J9C A;  1ZMA A;  1SK2 A;  2O87 A;  3EMP A;  3QDN A;  3APO A;  4ZL9 A;  4D73 B;  2H6Y A;  1EWX A;  1TW9 A;  3F8U A;  3GKM A;  3HVS A;  1MDI A;  2VM1 A;  4OCE A;  2PER A;  2FWG A;  4MF7 A;  4NPB A;  4AI6 A;  1GTB A;  2IFQ B;  2HRN A;  3ZMK A;  2DJJ A;  4WF5 A;  1TU7 A;  4K6X A;  2EFE A;  1VRS D;  3ZZX A;  3TOT A;  5J4Y A;  4BL7 B;  4BVX A;  2WRT A;  2DBC A;  3LSZ A;  3J7Y k;  1XOB A;  5A1N A;  3L9S A;  5KOW A;  1GUM A;  3GTU A;  4KW6 A;  2QGV A;  5JCU A;  3QAG A;  2WW2 A;  1ERU A;  1ZOF A;  2FNO A;  4ZBB A;  4TR4 A;  2C3Q A;  3RPP A;  4JR6 A;  3MWH A;  5INY A;  3VPT A;  4RQR A;  3WGX A;  3HHV A;  4JRR A;  1XWC A;  4MZW A;  16GS A;  3A2W A;  3DD3 A;  1SL2 B;  2YAN A;  4BVX B;  4YKG A;  3QMX A;  5A1N B;  3HVX A;  1T8E B;  3D0Z A;  3DVX A;  2DML A;  3GTU B;  4OMV A;  1GSQ A;  1FVK A;  3US3 A;  2HSY A;  5ECO B;  4ZB8 A;  2AJQ B;  4N10 A;  2B1K A;  1EEM A;  1SK1 A;  1KEB A;  3P90 A;  4AJ7 A;  1J08 A;  14GS A;  3ME8 A;  3GKX A;  4K8M A;  4V1A g;  1V58 A;  2E0Q A;  2N5B A;  1OC8 A;  4NXI A;  1B9Y C;  1TKD B;  3UL3 A;  2HE3 A;  4HJ2 A;  10GS A;  2PU9 C;  1CQH A;  2WZ9 A;  4BIK A;  2WW0 A;  3CWG A;  2YZH A;  3CXG A;  2H1D A;  4N11 A;  3TKP A;  4FO5 A;  1QXH A;  3CRT A;  7GSS A;  3LXT A;  2FWE A;  3IPZ A;  4GDF A;  2M46 A;  4ZBA A;  3TJJ A;  4IHU A;  2FGX A;  2FY6 A;  3S9F A;  1S3A A;  3GA4 A;  4F9Z A;  1IYH A;  2DJ3 A;  2LQO A;  4F2I A;  2WFC A;  4MH3 A;  4V2M A;  5JWQ B;  3KCM A;  1WIK A;  4X0X A;  3JCM L;  4Q5N A;  4ZIL A;  2C8U A;  3TJK A;  2P0G A;  5ECK B;  2AHE A;  4GQF A;  4ZBD A;  3HXS A;  3GIX A;  3IOS A;  2F8A A;  1FAA A;  3HZ4 A;  2YP6 A;  1FOV A;  2A2S A;  1X5C A;  2VL2 C;  3LG6 A;  3RBT A;  1F3B A;  2C0G A;  1UVZ A;  3HZ8 A;  2HRK B;  2YZU A;  4OFM A;  1M3I A;  4XRA A;  1QUW A;  2H8L A;  2CT6 A;  2JU5 A;  1GTU A;  1EZK A;  4PNF A;  1FW1 A;  2OA7 A;  1AQV A;  4RI6 A;  2A2R A;  2C0F A;  3LYK A;  1JHB A;  3GN3 A;  3CQF A;  3C8E A;  1M2A A;  2VIM A;  4PUA A;  4IBP A;  3IXR A;  4WEY A;  1M3J A;  3FZA A;  5C04 A;  1M9B A;  1OYJ A;  5IMA A;  20GS A;  2HSH A;  4HDE A;  2AAW A;  2IMD A;  1PMT A;  2DJK A;  1EOG A;  2DC5 A;  4IS0 A;  1K0D A;  4NMU A;  1N8J A;  3MAK A;  4ECJ A;  4GQC A;  2HI7 A;  3M9K A;  1B4P A;  2I81 A;  3TKS E;  2EIR A;  2H75 A;  3PH9 A;  2H71 A;  3SBC A;  4G0L A;  2OBI A;  3EUR A;  3TKS A;  4FYU A;  2VCV A;  2IME A;  3GL5 A;  2YJ7 A;  2PUK C;  4G19 A;  2V6O A;  3KH9 A;  4QL9 A;  2KHP A;  2LKU A;  1NHY A;  2YOI A;  4L0W A;  4XCS A;  2ALB A;  4V2N A;  1T7P B;  1GNW A;  1PKW A;  2VKZ G;  1WP0 A;  1N2A A;  2WDU A;  4ECI A;  5DDL A;  3EE2 A;  4YQU A;  2AYT A;  2BMX A;  1BED A;  1XW9 A;  2NDO A;  1JZW A;  1R4W A;  4HU9 A;  3TDG A;  1MEK A;  3M9J A;  5IMD A;  3KMO A;  3ZML A;  4YAP A;  6GSU A;  4O32 A;  5E59 A;  3FMW A;  1XWG A;  2QKE A;  3NIV A;  2LNT A;  1BJX A;  1XBS A;  3DYR A;  1AUC A;  2QA1 A;  4MMM A;  5H5R A;  4IVF A;  1A8L A;  1QGV A;  2XPD A;  3DEX A;  4KDU A;  4EVM A;  1EGO A;  3E9J B;  5ECR B;  1NSW A;  4ICY A;  1TRW A;  3FYG A;  3CTG A;  3QR6 A;  4K7O A;  1V2A A;  2PPT A;  4IGJ A;  1X9W B;  3LWA A;  3KMN A;  5ID2 A;  1SYX A;  4GST A;  1A8Y A;  2DIY A;  5IOX A;  4CY8 A;  4CY6 A;  2LRC A;  2ZNM A;  1BG5 A;  1SD8 A;  1MD4 A;  2IMI A;  1SD9 A;  4XTS A;  3G7I A;  5DBQ A;  5CRE A;  17GS A;  3EYT A;  2HZF A;  5DJL A;  4ZL8 A;  5IO2 A;  4WR4 A;  3QCP A;  3Q6O A;  1KTE A;  5AN1 A;  3I69 A;  1PN0 A;  1U6T A;  4EF0 A;  4CW9 A;  4GSS A;  1F37 A;  4ID0 A;  1W4V A;  2MMN A;  3HVN A;  2C80 A;  2F51 A;  4EIP A;  4HQS A;  4IN0 A;  2H01 A;  4PGT A;  3C71 A;  4CDO A;  4TR1 A;  3WYW A;  1S3D A;  2LJA A;  2OAD A;  4O92 A;  5KEJ A;  1FHE A;  1PFO A;  3F3Q A;  2MMA A;  4G0K A;  4TR3 A;  3ZVJ D;  4FYC A;  4POL A;  2VAF A;  1T3B A;  5J47 A;  4HEA 2;  3CSJ A;  2WB9 A;  4MF5 A;  4WXT A;  2FA4 A;  3D22 A;  3GUS A;  1AC1 A;  1ERT A;  4RQX A;  2O89 A;  4WBR D;  2ZCT A;  1GUL A;  4KF9 A;  1SU9 A;  2K8V A;  3GYK A;  4X43 A;  4PI0 C;  1K0M A;  1OC9 A;  4JU5 A;  3KP9 A;  1G6Y A;  2HNL A;  5HR0 A;  5H5S A;  1THX A;  5F06 A;  3LEF A;  4XS6 A;  4TR1 B;  2EFH A;  4K5R A;  4NV5 A;  4PI2 C;  5LCZ A;  4KE3 A;  4HOJ A;  2R0P A;  4F0C A;  2WJU A;  3F6D A;  3UBK A;  3O6T A;  3DKS A;  1ZYQ B;  2V32 A;  2N5A A;  2E2G A;  2MMO A;  1SYR A;  5CRG A;  4NAX A;  1M2D A;  3CYN A;  3KH7 A;  3MIX A;  3KGK A;  1PL1 A;  4USS A;  3F3R A;  2J9H A;  3EU4 A;  2CAI A;  5DQS A;  3FY7 A;  1OC9 B;  5IMV A;  4MH2 A;  2NTO A;  2PVO C;  3A2V A;  4HQZ A;  4MK3 A;  2DKI A;  1H75 A;  4Z2U A;  2LST A;  2MBS A;  2XC2 A;  3D4T A;  5D96 A;  3HYP A;  4EO3 A;  4IKH A;  2OJL A;  2PN8 A;  2NVL A;  4L8E A;  2H1G A;  3Q74 A;  1J9B A;  2FA8 A;  2FLS A;  2HSM A;  3LYP A;  5IOW A;  3KM6 A;  1SJI A;  2AB6 A;  1PKZ A;  3HJO A;  3KTL A;  2LTK A;  1GL8 A;  1WRY A;  4QQ7 A;  2MZC A;  4QL7 A;  3ZIT A;  2EIO A;  4MZB A;  1X5D A;  1T4Y A;  1ZL9 A;  3K8N A;  5ECM B;  2X8H A;  3ISO A;  3DRN A;  2TRX A;  3A5I A;  5JWO B;  1U87 A;  4AF2 A;  3QPM A;  1SKS B;  1USB A;  2B7J A;  5LD0 A;  2F3M A;  1TRU A;  2WVY A;  4PQ1 A;  3CSI A;  2XPE A;  5D8I A;  5D9V A;  3TJF A;  5DCH A;  2V41 A;  1ACV A;  3HD5 A;  1TJD A;  4MF6 A;  4XHM A;  3BJ5 A;  1RQM A;  2R3X A;  4GSN A;  2HSM B;  1WOU A;  3ZVJ A;  3FW2 A;  4MJA A;  4EDZ A;  4ZB6 A;  1GSS A;  2GTU A;  4LLR A;  2XHF A;  2O8V B;  4MNN A;  3PR8 A;  2DJ2 A;  3EWL A;  2B5Y A;  3EU3 A;  1O6J A;  3VPQ A;  1E2Y A;  3VWV A;  3RHB A;  1G6W A;  1IYI A;  1FVJ A;  1BG1 A;  2B5E A;  5ECL B;  2YJH A;  2V2G A;  1URM A;  1GUH A;  1M0U A;  2DJ1 A;  2H70 A;  3TRQ A;  1X9S B;  3QFB C;  4OFN A;  2FWH A;  4BVY A;  1YEW C;  2GLR A;  4EDY A;  3C73 A;  1GSF A;  1ZZY A;  3FHK A;  2VD1 A;  4ISD A;  4AJ8 A;  2VL3 A;  2RM6 A;  3GL3 A;  2M80 A;  5ENU A;  2WCI A;  1YY7 A;  2VL2 A;  1W89 A;  5EY6 A;  3LGC A;  4EE0 A;  2FD3 A;  1XCC A;  5HR2 A;  3H79 A;  1XW5 A;  2H76 A;  4POK A;  1YVL A;  3IK9 A;  1O8W A;  4XS4 A;  4IJI A;  4HSC X;  5A5H A;  3BCK A;  4BVY B;  11GS A;  1YEP A;  2LS5 A;  1OKT A;  3PGT A;  3D21 A;  4K9Z A;  4MAB A;  4DSQ A;  2VCZ A;  3HCZ A;  1K3O A;  3RHC A;  1TI3 A;  3MSZ A;  2L4C A;  4O5R A;  4MCU A;  4G9H A;  5ABR A;  1HQO A;  1O8X A;  2LJK A;  4K0G A;  6GSY A;  4L5O A;  1JLV A;  1AIU A;  3AY8 A;  4XS4 B;  4LMW A;  1XXU A;  5A5H B;  3TRP A;  2L4Q A;  3UVT A;  2O7K A;  2G2Q A;  2GZY A;  2HRK A;  5GST A;  2GT6 A;  3DIE A;  4OD7 A;  3LW9 A;  1JZO A;  1ST9 A;  1O85 A;  3EC3 A;  1TI1 A;  1K0A A;  5D9X A;  4GXZ A;  3J7Y b;  1JFU A;  2YV9 A;  3L4N A;  1H4O A;  4FH8 A;  5D93 A;  4N0V A;  2GT5 A;  3D6I A;  2I3Y A;  5IIZ A;  1XVW A;  3F6F A;  1B8X A;  3O76 A;  5HFG A;  5IPH A;  2PWJ A;  4WET A;  1T1V A;  2G0F A;  3R3E A;  1GNE A;  4IQA A;  1Z6N A;  1BQ7 A;  4KUN A;  2LRN A;  3GSS A;  2DIZ A;  1AAZ A;  2LEG A;  2B5X A;  4I2U A;  2O85 A;  3ZLP A;  1T00 A;  2D2Z A;  3IRA A;  1SKR B;  2M72 A;  5IQY A;  2HYX A;  1R5P A;  3GH9 A;  3G7Y A;  1PD2 1;  2DLX A;  5D9W A;  1ZYP A;  5A4W A;  4YAV A;  2P5Q A;  3L78 A;  4ULX A;  2VLU A;  5DVB A;  1LU4 A;  2LUS A;  4JZQ A;  4XIH A;  4QMK A;  2HT9 A;  2HZE A;  3VWX A;  4K5S A;  3RDW A;  4Z7X A;  3VWU A;  5IMZ A;  3TGZ A;  5BRT A;  3IV4 A;  5LNK e;  2H0I A;  2WW3 A;  2ES7 A;  1VF2 A;  5ELA A;  2KP2 A;  2H0G A;  5AIX A;  3SWL A;  1M2B A;  3IC4 A;  4OO5 A;  4I6X A;  3TOU A;  3GFK A;  2UV8 G;  4DVC A;  12GS A;  3U5R E;  1LBK A;  5ELG A;  2DSA A;  4KA0 A;  1PQN A;  5FT3 A;  2X49 A;  4X1U A;  4Q5Q A;  1HNB A;  4GRF A;  9GSS A;  1ABA A;  2H1A A;  1LJR A;  1HYU A;  5KN1 A;  4ZB9 A;  2YPM A;  2HZE B;  5HQP A;  4GF0 A;  1XW6 A;  2NBS A;  3TU3 B;  3P8W A;  2H0H A;  2VM2 A;  2C3T A;  1QQ2 A;  4K2D A;  2K6V A;  1TXU A;  2GQL A;  3ZFB A;  5G5E A;  3W6G A;  1V9W A;  3M3M A;  5D9T A;  3HVV A;  1PX7 A;  1GLQ A;  3P2A A;  3F4R A;  3N9J A;  3QAW A;  2WVX A;  3W8J A;  3KTB A;  3C1S A;  5J40 A;  1OE7 A;  1RK4 A;  4MDC A;  1GSY A;  5ECH B;  1OC3 A;  2NPB A;  2GSR A;  3GHA A;  4OFT A;  3F4T A;  3VFI A;  1DUG A;  5HR3 A;  3FZ5 A;  1QK8 A;  2C3N A;  2GQK A;  1CQG A;  4HI7 A;  6GSV A;  1GH2 A;  4KH7 A;  1A23 A;  3A2X A;  3DXB A;  2JSZ A;  2DKH A;  3A5W A;  2OT3 A;  1X5E A;  1SVM A;  4Z2T A;  2H74 A;  4KGI A;  8GSS A;  5C00 A;  4RI7 A;  1A2M A;  3C7M A;  1UC7 A;  2WVX B;  3UVH A;  1Z5Y E;  3PIN A;  5J9B A;  2OE0 A;  1MTC A;  4RUV A;  3GX8 A;  5GAP D;  2OAC A;  4BA7 A;  2CV4 A;  4PQH A;  4KSM A;  3W8S A;  2H19 A;  1XZO A;  3CRU A;  4WR5 A;  1F9M A;  1N25 A;  1I5G A;  3EIN A;  1AQX A;  3QD9 A;  2C1Y A;  1JZR A;  3ERW A;  4TR0 A;  2XBI A;  4ZIJ A;  3GST A;  5G2Z A;  2H1L A;  2OE1 A;  1XWB A;  1ERV A;  2CZ3 A;  2I1U A;  2VCT A;  1AXD A;  1Z6M A;  5L71 A;  3LFL A;  2DMM A;  5CAX A;  1YF0 A;  4BPY A;  4K2X A;  2I4A A;  2R0G A;  5A5K A;  2R4V A;  2L6D A;  4J56 E;  2EC4 A;  2JZT A;  3O3T A;  1PSQ A;  1U3I A;  1WJK A;  1HNC A;  4PXO A;  5IMF A;  2L5O A;  2AUV A;  2F9S A;  3QAV A;  4JE1 A;  1YZX A;  3ERG A;  5B7C A;  4YKF A;  1BYE A;  1T4Z A;  4NWY A;  2CZ2 A;  4MLY A;  4I8B A;  4PUR A;  3KIJ A;  1E6B A;  2JAC A;  4TXO A;  4X4J A;  4HZ4 A;  3MNG A;  2H30 A;  3FEU A;  3VLN A;  4MPF A;  4WBJ A;  4KND A;  3M1G A;  5KN2 A;  3IHG A;  4AKG A;  3M8N A;  3MYD A;  5ECP B;  1S3R A;  5COH A;  1HNA A;  2CAQ A;  1EEJ A;  3L9U A;  2VOC A;  5ECN B;  3DML A;  2VUP A;  1TP9 A;  1XWA A;  4AKI A;  5DQY A;  1VF4 A;  2YCD A;  3M0F A;  4G10 A;  1JLW A;  3OR5 A;  3TJG A;  1OE8 A;  4KB3 A;  1F3A A;  2X99 A;  3BCI A;  1XFL A;  1K0O A;  4AKX B;  3BOA A;  1NM3 A;  3WT1 A;  2I9H A;  4YQM A;  1WPI A;  5HFK A;  2FHE A;  2ON5 A;  1QMV A;  1FG4 A;  1I9D A;  4TXO B;  2WZS A;  5A34 B;  4JBB A;  4KX4 A;  3HA9 A;  4IP6 A;  1FB0 A;  3GMF A;  4L0U A;  2UZ8 A;  2TRC P;  3UIW A;  3CBU A;  4L5L A;  3LQ7 A;  2WW1 A;  2TIR A;  3GUR A;  1PA3 A;  2J23 A;  3RGB C;  2REM A;  4PUF C;  1Z7P A;  4KAE A;  2PGT A;  1OKD A;  5DAK B;  2H73 A;  3FRC A;  3NOF A;  1TXX A;  4MJC A;  1TK0 B;  4YH2 A;  3BD2 A;  2JSY A;  4EKZ A;  3APS A;  3FKF A;  1DE2 A;  1UA5 A;  3A3T A;  5GZZ B;  1O81 A;  2QA2 A;  2K9F A;  2L5L A;  5CRW A;  3HY2 A;  5BMU B;  4O5Q A;  1FO5 A;  4MA9 A;  4G0I A;  1GLP A;  3DVW A;  1TOF A;  2A2P A;  3IE3 A;  2KP1 A;  2RII A;  2E2M A;  3TJB A;  2HQT A;  1NW2 A;  4I2T A;  22GS A;  4KCA A;  1EP7 A;  5KN3 A;  3FZ9 A;  4AKH A;  4HU7 A;  5J5N A;  2V1M A;  1Q4J A;  2JZS A;  1TDI A;  3IBH A;  2GST A;  1THO A;  4EC0 A;  3GNJ A;  1SK0 A;  3VI5 A;  5B6N A;  4P3Y B;  3KP8 A;  3IK7 A;  2B7K A;  3VI7 A;  2BTO T;  4BWQ A;  2IMF A;  3H8Q A;  2Z9S A;  2GSQ A;  4MP4 A;  1A2J A;  3IC8 A;  1Z9H A;  4Q5R A;  4DEJ A;  4KSO A;  2FWF A;  3IAM 2;  1GTA A;  2BJX A;  1DE1 A;  5J4V A;  1GSD A;  5IM9 A;  5AIV A;  3KXO A;  3RPN A;  3UJ1 A;  4E8E A;  5B6M A;  2WVZ A;  3V1W A;  1GWC A;  2P31 A;  2FUG 2;  2HRF A;  2IPA A;  3KD0 A;  6GSW A;  1B9X C;  2AV4 A;  1YEX A;  3H1N A;  2H6Z A;  18GS A;  3VUR A;  1G0T A;  1V57 A;  2KUC A;  3CTF A;  4JED A;  3D5J A;  2A4V A;  3GH6 A;  3CSH A;  4E8H A;  3FK8 A;  1Y6E A;  5F0G A;  1HD2 A;  4ZB7 A;  3WGE A;  1A0R P;  2F8F A;  5JCW A;  4FXY P;  5DAL A;  3GRX A;  4W66 A;  5HFI A;  2L6C A;  4F82 A;  4TKY A;  3C1R A;  19GS A;  4I5Q A;  4AJ6 A;  4N3Z A;  1G7O A;  1VGL A;  4J2F A;  4K7I A;  3ZRE A;  3UEM A;  1OAZ A;  1PX6 A;  1SL0 B;  2GZP A;  2GQM A;  2LQQ A;  2V6K A;  4Q5F A;  3FR3 A;  1KBN A;  1YJ6 A;  6GSX A;  5D73 A;  2HXK A;  1SJZ A;  1WE0 A;  5FHI A;  5CNW A;  2L57 A;  1MDK A;  4MJE A;  4DSS A;  4HUA A;  2X8C A;  2R37 A;  3F63 A;  4K1F A;  4EXJ A;  3D4M A;  2VD0 A;  3ZRD A;  1V98 A;  3F9U A;  2R5G A;  3ZL5 A;  5DAL B;  1AW9 A;  5AIS A;  5KOX A;  2IN3 A;  2H72 A;  1EV4 A;  3R2Q A;  5G5F A;  1J0F A;  1TRS A;  1O7U A;  3F0I A;  2H66 A;  5F05 A;  2E7P A;  3H4K A;  3E3E A;  3VWW A;  2VCW A;  13GS A;  3ZFL A;  1EOH A;  1ZYN A;  3CHX C;  3EPT A;  4DSR A;  1Q98 A;  2LV3 A;  3FR9 A;  4MPG A;  2R0C A;  3GV1 A;  4XS1 A;  4DSS B;  1A24 A;  2CX4 A;  3KZQ A;  3TRX A;  3APQ A;  2IIY A;  4Z2R A;  2VLV A;  1EGR A;  4G01 A;  3GKK A;  4ML1 A;  1TK5 B;  3QFA C;  3U6V A;  3ME7 A;  2CVD A;  4MZC A;  2VCX A;  5IPG A;  1B48 A;  3MDK A;  4O5U A;  2PVQ A;  4OCF A;  2HSN A;  5G1K A;  3IHQ A;  1EV9 A;  1XPV A;  2B1L A;  1KNG A;  3Q18 A;  4LL4 B;  5E4W A;  1S4B P;  1U3A A;  5CYY A;  2L59 A;  4AGS A;  4ECB A;  1AQW A;  4ZXG A;  1A2L A;  4TXV A;  1Z3E A;  1C72 A;  2C0D A;  1SVL A;  2O5V A;  1VF3 A;  2WS2 A;  1GP1 A;  2QSI A;  3UBL A;  4A5P A;  1K3L A;  3N5O A;  1B4Q A;  3ZIJ A;  3IDV A;  3WT2 A;  4F0B A;  4PNG A;  4GLT A;  1K0C A;  5FWG A;  2YWI A;  3Q19 A;  2ZUP A;  5GSS A;  2OE3 A;  2CVK A;  2EFC A;  2YWM A;  2XBQ A;  5J3R A;  2GS3 A;  2HSN B;  1M7T A;  3IR4 A;  5A4V A;  2MYG A;  4IJ3 A;  4ZL7 A;  3VK9 A;  1VF1 A;  5CO3 A;  4TOP A;  5G30 A;  3I43 A;  1NHO A;  4NV2 A;  1XG8 A;  4FIW A;  5F07 A;  3HMJ G;  1I1I P;  5G1L A;  3L9V A;  3TB2 A;  1JZD A;  4V1A p;  1DSB A;  3HDC A;  2EIQ A;  3ZYW A;  1YKC A;  4KDX A;  3ED3 A;  1G7E A;  3EVI A;  1TK8 B;  1YDK A;  2JAD A;  2LNS A;  3KEB A;  5JWR B;  2RUF A;  3PPU A;  4FYB A;  2YWN A;  4NHZ A;  4OO4 A;  2B6M A;  3F4S A;  1Z7R A;  5F8B A;  4ILF A;  3TCO A;  1UN2 A;  1XVQ A;  1ZYE A;  1Y25 A;  1BF5 A;  1U88 A;  4HS1 A;  1XIY A;  2GDR A;  3HJM A;  1K3Y A;  2C0E A;  2R2J A;  4TRX A;  1MDJ A;  5G31 A;  1GUK A;  2N5F A;  1TRV A;  5J4U A;  3L0H A;  2VLT A;  3HJP A;  4G2E A;  1SL1 B;  2PMT A;  1ZCP A;  4K0N A;  4TN8 A;  1SKW B;  4O7H A;  5J41 A;  3KJY A;  2R6K A;  5B8B A;  5DCG A;  1PN9 A;  1R5A A;  2C4J A;  3G7J A;  1A0F A;  2H1B A;  4HZ2 A;  3RAZ A;  3IA1 A;  1YF1 A;  1GTI A;  4IP1 A;  5GAN D;  4F03 A;  2O36 A;  4H86 A;  3E0U A;  2CA8 A;  4GWR A;  4XRD A;  1Y1U A;  3UMA A;  2WGR A;  2YWO A;  3WGD A;  5CRH A;  4JR4 A;  2IJY A;  6GSS A;  1F6M C;  2VO4 A;  5B8A A;  3FZ4 A;  4I97 A;  5AGY A;  1ON4 A;  4FQU A;  5ECI B;  1K0N A;  1YKA A;  4J57 E;  3TUE A;  4KCE A;  1TU8 A;  2LJR A;  2VL9 A;  4CHS A;  1ILO A;  2FCH A;  3TKQ A;  2GVP A;  2KOK A;  3EMX A;  1K0B A;  1ERW A;  3BBY A;  3HKR A;  1DBY A;  2RM5 A;  1ZGN A;  4MJB A;  2MMZ A;  5KN0 A;  4KDY A;  4PQI A;  2HLS A;  5CRD A;  1RW1 A;  4YQV A;  1X0R A;  3ZIV A;  2IL3 A;  1SJ6 A;  1TTZ A;  1M99 A;  3ZTL A;  1O73 A;  5HR1 A;  3TKS C;  3ERF A;  5CP1 A;  4ACS A;  2RUE A;  5IMC A;  5IO0 A;  2HFD A;  1OVN A;  3GKN A;  4EUY A;  1WWJ A;  2CX3 A;  2PBJ A;  1ML6 A;  2X64 A;  2OBK A;  3LOR A;  1PL2 A;  4K7N A;  3UAR A;  1S3C A;  5ID2 B;  4EL1 A;  4ML6 A;  2GSS A;  4GCI A;  1R7H A;  2WUL A;  1YQ1 A; 
#chains in the Genus database with same CATH homology
 4E68 A;  1GRX A;  5A34 A;  2GZZ A;  4POM A;  2RLI A;  2YNX A;  2QC7 A;  1XWK A;  1V40 A;  2CQ9 A;  3IAS 2;  2IWT A;  2DJ0 A;  3I6A A;  1M9A A;  1QFN A;  5JCG A;  3FR6 A;  1GSE A;  2HRA A;  2X8G A;  3LXZ A;  1XOA A;  5DAK A;  5ECQ B;  1SEN A;  2P5R A;  1EP8 A;  2CVB A;  2JL4 A;  3UAP A;  2VCQ A;  4IEL A;  3WD6 A;  2GGT A;  2MBT A;  1WMJ A;  4BWS A;  1X9M B;  3CMI A;  5H5Q A;  2OKA A;  4GTU A;  5A4U A;  4ECC A;  3H93 A;  4IW9 A;  5BMU A;  2KLX A;  2YN1 A;  4PX1 A;  2X4A A;  2IMK A;  3DGQ A;  4IQ1 A;  4LA1 A;  5ECS A;  2K18 A;  3QOU A;  3G9B A;  1FB6 A;  1R26 A;  2B3S A;  4LL1 B;  1BX9 A;  2A4H A;  4N0Z A;  6GST A;  2LRT A;  3UOM A;  2EFD A;  3I9V 2;  2ON7 A;  5EL8 A;  4EIQ A;  5EPF A;  3LJR A;  4TVE A;  4WKW A;  4POB A;  4D73 A;  4LMV A;  5DJM A;  5EVO A;  4TW5 A;  3GX0 A;  1BAY A;  1FOH A;  4V2L A;  1PRX A;  3TKR A;  1F2E A;  1PGT A;  3DWV A;  4N30 A;  2IFQ A;  4NHW A;  3P7X A;  1SVO A;  1MD3 A;  2K8S A;  2H6X A;  4HJM A;  3NZN A;  2JZR A;  4WF4 A;  1GSU A;  2YV7 A;  4OWY A;  4BL7 A;  4PTS A;  5J9C A;  1ZMA A;  1SK2 A;  2O87 A;  3EMP A;  3QDN A;  3APO A;  4ZL9 A;  4D73 B;  2H6Y A;  1EWX A;  1TW9 A;  3F8U A;  3GKM A;  3HVS A;  1MDI A;  2VM1 A;  4OCE A;  2PER A;  2FWG A;  4MF7 A;  4NPB A;  4AI6 A;  1GTB A;  2IFQ B;  2HRN A;  3ZMK A;  2DJJ A;  4WF5 A;  1TU7 A;  4K6X A;  2EFE A;  1VRS D;  3ZZX A;  3TOT A;  5J4Y A;  4BL7 B;  4BVX A;  2WRT A;  2DBC A;  3LSZ A;  3J7Y k;  1XOB A;  5A1N A;  3L9S A;  5KOW A;  1GUM A;  3GTU A;  4KW6 A;  2QGV A;  5JCU A;  3QAG A;  1ERU A;  1ZOF A;  2FNO A;  4ZBB A;  4TR4 A;  2C3Q A;  3RPP A;  4JR6 A;  3MWH A;  5INY A;  3VPT A;  4RQR A;  3WGX A;  3HHV A;  4JRR A;  1XWC A;  4MZW A;  16GS A;  3A2W A;  3DD3 A;  1SL2 B;  2YAN A;  4BVX B;  4YKG A;  3QMX A;  5A1N B;  3HVX A;  1T8E B;  3D0Z A;  3DVX A;  2DML A;  3GTU B;  4OMV A;  1GSQ A;  1FVK A;  3US3 A;  2HSY A;  5ECO B;  4ZB8 A;  2AJQ B;  4N10 A;  2B1K A;  1EEM A;  1SK1 A;  1KEB A;  3P90 A;  4AJ7 A;  1J08 A;  14GS A;  3ME8 A;  3GKX A;  4K8M A;  4V1A g;  1V58 A;  2E0Q A;  2N5B A;  1OC8 A;  4NXI A;  1B9Y C;  1TKD B;  3UL3 A;  2HE3 A;  4HJ2 A;  10GS A;  2PU9 C;  1CQH A;  2WZ9 A;  3CWG A;  2YZH A;  3CXG A;  2H1D A;  4N11 A;  3TKP A;  4FO5 A;  1QXH A;  3CRT A;  7GSS A;  3LXT A;  2FWE A;  3IPZ A;  4GDF A;  2M46 A;  4ZBA A;  3TJJ A;  4IHU A;  2FGX A;  2FY6 A;  3S9F A;  1S3A A;  3GA4 A;  4F9Z A;  1IYH A;  2DJ3 A;  2LQO A;  4F2I A;  2WFC A;  4MH3 A;  4V2M A;  5JWQ B;  3KCM A;  1WIK A;  4X0X A;  3JCM L;  4Q5N A;  4ZIL A;  2C8U A;  3TJK A;  2P0G A;  5ECK B;  2AHE A;  4GQF A;  4ZBD A;  3HXS A;  3GIX A;  3IOS A;  2F8A A;  1FAA A;  3HZ4 A;  2YP6 A;  1FOV A;  2A2S A;  1X5C A;  2VL2 C;  3LG6 A;  3RBT A;  1F3B A;  2C0G A;  1UVZ A;  3HZ8 A;  2HRK B;  4OFM A;  2YZU A;  4XRA A;  1QUW A;  2H8L A;  2CT6 A;  2JU5 A;  1GTU A;  1EZK A;  4PNF A;  1FW1 A;  2OA7 A;  1AQV A;  4RI6 A;  2A2R A;  2C0F A;  3LYK A;  1JHB A;  3GN3 A;  3C8E A;  1M2A A;  2VIM A;  4PUA A;  4IBP A;  3IXR A;  4WEY A;  3FZA A;  5C04 A;  1M9B A;  1OYJ A;  5IMA A;  20GS A;  2HSH A;  4HDE A;  2AAW A;  2IMD A;  1PMT A;  2DJK A;  1EOG A;  2DC5 A;  4IS0 A;  1K0D A;  4NMU A;  1N8J A;  3MAK A;  4ECJ A;  4GQC A;  2HI7 A;  3M9K A;  1B4P A;  2I81 A;  3TKS E;  2EIR A;  2H75 A;  3PH9 A;  2H71 A;  3SBC A;  4G0L A;  2OBI A;  3EUR A;  3TKS A;  4FYU A;  2VCV A;  2IME A;  3GL5 A;  2YJ7 A;  2PUK C;  4G19 A;  2V6O A;  3KH9 A;  4QL9 A;  2KHP A;  2LKU A;  1NHY A;  2YOI A;  4L0W A;  4XCS A;  2ALB A;  4V2N A;  1T7P B;  1GNW A;  1PKW A;  2VKZ G;  1WP0 A;  1N2A A;  2WDU A;  4ECI A;  5DDL A;  3EE2 A;  4YQU A;  2AYT A;  2BMX A;  1BED A;  1XW9 A;  2NDO A;  1JZW A;  1R4W A;  4HU9 A;  3TDG A;  1MEK A;  3M9J A;  5IMD A;  3KMO A;  3ZML A;  4YAP A;  6GSU A;  4O32 A;  5E59 A;  3FMW A;  1XWG A;  2QKE A;  3NIV A;  2LNT A;  1BJX A;  1XBS A;  3DYR A;  1AUC A;  2QA1 A;  4MMM A;  5H5R A;  4IVF A;  1A8L A;  1QGV A;  2XPD A;  3DEX A;  4KDU A;  4EVM A;  1EGO A;  3E9J B;  5ECR B;  1NSW A;  4ICY A;  1TRW A;  3FYG A;  3CTG A;  3QR6 A;  4K7O A;  1V2A A;  2PPT A;  4IGJ A;  1X9W B;  3LWA A;  3KMN A;  5ID2 A;  1SYX A;  4GST A;  1A8Y A;  2DIY A;  5IOX A;  4CY8 A;  4CY6 A;  2LRC A;  2ZNM A;  1BG5 A;  1SD8 A;  1MD4 A;  2IMI A;  1SD9 A;  4XTS A;  3G7I A;  5DBQ A;  5CRE A;  17GS A;  3EYT A;  2HZF A;  5DJL A;  4ZL8 A;  5IO2 A;  4WR4 A;  3QCP A;  3Q6O A;  1KTE A;  5AN1 A;  3I69 A;  1PN0 A;  1U6T A;  4EF0 A;  4CW9 A;  4GSS A;  1F37 A;  4ID0 A;  1W4V A;  2MMN A;  2C80 A;  2F51 A;  4EIP A;  4HQS A;  4IN0 A;  2H01 A;  4PGT A;  3C71 A;  4CDO A;  4TR1 A;  3WYW A;  1S3D A;  2LJA A;  2OAD A;  4O92 A;  5KEJ A;  1FHE A;  3F3Q A;  2MMA A;  4G0K A;  4TR3 A;  3ZVJ D;  4FYC A;  4POL A;  2VAF A;  1T3B A;  5J47 A;  4HEA 2;  3CSJ A;  2WB9 A;  4MF5 A;  4WXT A;  2FA4 A;  3D22 A;  3GUS A;  1AC1 A;  1ERT A;  4RQX A;  2O89 A;  4WBR D;  2ZCT A;  1GUL A;  4KF9 A;  1SU9 A;  2K8V A;  3GYK A;  4X43 A;  1K0M A;  1OC9 A;  4JU5 A;  3KP9 A;  1G6Y A;  2HNL A;  5HR0 A;  5H5S A;  1THX A;  5F06 A;  3LEF A;  4XS6 A;  4TR1 B;  2EFH A;  4K5R A;  4NV5 A;  5LCZ A;  4KE3 A;  4HOJ A;  2R0P A;  4F0C A;  2WJU A;  3F6D A;  3UBK A;  3O6T A;  3DKS A;  1ZYQ B;  2V32 A;  2N5A A;  2E2G A;  2MMO A;  1SYR A;  5CRG A;  4NAX A;  1M2D A;  3CYN A;  3KH7 A;  3MIX A;  3KGK A;  1PL1 A;  4USS A;  3F3R A;  2J9H A;  3EU4 A;  2CAI A;  5DQS A;  3FY7 A;  1OC9 B;  5IMV A;  4MH2 A;  2NTO A;  2PVO C;  3A2V A;  4HQZ A;  4MK3 A;  2DKI A;  1H75 A;  4Z2U A;  2LST A;  2MBS A;  2XC2 A;  3D4T A;  5D96 A;  3HYP A;  4EO3 A;  4IKH A;  2OJL A;  2PN8 A;  2NVL A;  4L8E A;  2H1G A;  3Q74 A;  1J9B A;  2FA8 A;  2FLS A;  2HSM A;  3LYP A;  5IOW A;  3KM6 A;  1SJI A;  2AB6 A;  1PKZ A;  3HJO A;  3KTL A;  2LTK A;  1GL8 A;  1WRY A;  4QQ7 A;  2MZC A;  4QL7 A;  3ZIT A;  2EIO A;  4MZB A;  1X5D A;  1T4Y A;  1ZL9 A;  3K8N A;  5ECM B;  2X8H A;  3ISO A;  3DRN A;  2TRX A;  3A5I A;  5JWO B;  1U87 A;  4AF2 A;  3QPM A;  1SKS B;  1USB A;  2B7J A;  5LD0 A;  2F3M A;  1TRU A;  4PQ1 A;  3CSI A;  2XPE A;  5D8I A;  5D9V A;  3TJF A;  5DCH A;  2V41 A;  1ACV A;  3HD5 A;  1TJD A;  4MF6 A;  4XHM A;  3BJ5 A;  1RQM A;  2R3X A;  4GSN A;  2HSM B;  1WOU A;  3ZVJ A;  3FW2 A;  4MJA A;  4EDZ A;  4ZB6 A;  1GSS A;  2GTU A;  4LLR A;  2XHF A;  2O8V B;  4MNN A;  3PR8 A;  2DJ2 A;  3EWL A;  2B5Y A;  3EU3 A;  1O6J A;  3VPQ A;  1E2Y A;  3VWV A;  3RHB A;  1G6W A;  1IYI A;  1FVJ A;  1BG1 A;  2B5E A;  5ECL B;  2YJH A;  2V2G A;  1URM A;  1GUH A;  1M0U A;  2DJ1 A;  2H70 A;  3TRQ A;  1X9S B;  3QFB C;  4OFN A;  2FWH A;  4BVY A;  2GLR A;  4EDY A;  3C73 A;  1GSF A;  1ZZY A;  3FHK A;  2VD1 A;  4ISD A;  4AJ8 A;  2VL3 A;  2RM6 A;  3GL3 A;  2M80 A;  5ENU A;  2WCI A;  1YY7 A;  2VL2 A;  1W89 A;  5EY6 A;  3LGC A;  4EE0 A;  2FD3 A;  1XCC A;  5HR2 A;  3H79 A;  1XW5 A;  2H76 A;  4POK A;  1YVL A;  3IK9 A;  1O8W A;  4XS4 A;  4IJI A;  5A5H A;  3BCK A;  4BVY B;  11GS A;  1YEP A;  2LS5 A;  1OKT A;  3PGT A;  3D21 A;  4K9Z A;  4MAB A;  4DSQ A;  2VCZ A;  3HCZ A;  1K3O A;  3RHC A;  1TI3 A;  3MSZ A;  2L4C A;  4O5R A;  4MCU A;  4G9H A;  5ABR A;  1HQO A;  1O8X A;  2LJK A;  4K0G A;  6GSY A;  4L5O A;  1JLV A;  1AIU A;  3AY8 A;  4XS4 B;  4LMW A;  1XXU A;  5A5H B;  3TRP A;  2L4Q A;  3UVT A;  2O7K A;  2G2Q A;  2GZY A;  2HRK A;  5GST A;  2GT6 A;  3DIE A;  4OD7 A;  3LW9 A;  1JZO A;  1ST9 A;  1O85 A;  3EC3 A;  1TI1 A;  1K0A A;  5D9X A;  4GXZ A;  3J7Y b;  1JFU A;  2YV9 A;  3L4N A;  1H4O A;  4FH8 A;  5D93 A;  4N0V A;  2GT5 A;  3D6I A;  2I3Y A;  5IIZ A;  1XVW A;  3F6F A;  1B8X A;  3O76 A;  5HFG A;  5IPH A;  2PWJ A;  4WET A;  1T1V A;  2G0F A;  3R3E A;  1GNE A;  4IQA A;  1Z6N A;  1BQ7 A;  4KUN A;  2LRN A;  3GSS A;  2DIZ A;  1AAZ A;  2LEG A;  2B5X A;  4I2U A;  2O85 A;  3ZLP A;  1T00 A;  2D2Z A;  3IRA A;  1SKR B;  2M72 A;  5IQY A;  2HYX A;  1R5P A;  3GH9 A;  3G7Y A;  1PD2 1;  2DLX A;  5D9W A;  1ZYP A;  5A4W A;  4YAV A;  2P5Q A;  3L78 A;  4ULX A;  2VLU A;  5DVB A;  1LU4 A;  2LUS A;  4JZQ A;  4XIH A;  4QMK A;  2HT9 A;  2HZE A;  3VWX A;  4K5S A;  3RDW A;  4Z7X A;  3VWU A;  5IMZ A;  3TGZ A;  5BRT A;  3IV4 A;  5LNK e;  2H0I A;  2ES7 A;  1VF2 A;  5ELA A;  2KP2 A;  2H0G A;  5AIX A;  3SWL A;  1M2B A;  3IC4 A;  4OO5 A;  4I6X A;  3TOU A;  3GFK A;  2UV8 G;  4DVC A;  12GS A;  3U5R E;  1LBK A;  5ELG A;  2DSA A;  4KA0 A;  1PQN A;  5FT3 A;  2X49 A;  4X1U A;  4Q5Q A;  1HNB A;  4GRF A;  9GSS A;  1ABA A;  2H1A A;  1LJR A;  1HYU A;  5KN1 A;  4ZB9 A;  2YPM A;  2HZE B;  5HQP A;  4GF0 A;  1XW6 A;  2NBS A;  3TU3 B;  3P8W A;  2H0H A;  2VM2 A;  2C3T A;  1QQ2 A;  4K2D A;  2K6V A;  1TXU A;  2GQL A;  3ZFB A;  5G5E A;  3W6G A;  1V9W A;  3M3M A;  5D9T A;  3HVV A;  1PX7 A;  1GLQ A;  3P2A A;  3F4R A;  3N9J A;  3QAW A;  3W8J A;  3KTB A;  3C1S A;  5J40 A;  1OE7 A;  1RK4 A;  4MDC A;  1GSY A;  5ECH B;  1OC3 A;  2NPB A;  2GSR A;  3GHA A;  4OFT A;  3F4T A;  3VFI A;  1DUG A;  5HR3 A;  3FZ5 A;  1QK8 A;  2C3N A;  2GQK A;  1CQG A;  4HI7 A;  6GSV A;  1GH2 A;  4KH7 A;  1A23 A;  3A2X A;  3DXB A;  2JSZ A;  2DKH A;  3A5W A;  2OT3 A;  1X5E A;  1SVM A;  4Z2T A;  2H74 A;  4KGI A;  8GSS A;  5C00 A;  4RI7 A;  1A2M A;  3C7M A;  1UC7 A;  3UVH A;  1Z5Y E;  3PIN A;  5J9B A;  2OE0 A;  1MTC A;  4RUV A;  3GX8 A;  5GAP D;  2OAC A;  4BA7 A;  2CV4 A;  4PQH A;  4KSM A;  3W8S A;  2H19 A;  1XZO A;  3CRU A;  4WR5 A;  1F9M A;  1N25 A;  1I5G A;  3EIN A;  1AQX A;  3QD9 A;  2C1Y A;  1JZR A;  3ERW A;  4TR0 A;  2XBI A;  4ZIJ A;  3GST A;  5G2Z A;  2H1L A;  2OE1 A;  1XWB A;  1ERV A;  2CZ3 A;  2I1U A;  2VCT A;  1AXD A;  1Z6M A;  5L71 A;  3LFL A;  2DMM A;  5CAX A;  1YF0 A;  4BPY A;  4K2X A;  2I4A A;  2R0G A;  5A5K A;  2R4V A;  2L6D A;  4J56 E;  2EC4 A;  2JZT A;  3O3T A;  1PSQ A;  1U3I A;  1WJK A;  1HNC A;  4PXO A;  5IMF A;  2L5O A;  2AUV A;  2F9S A;  3QAV A;  4JE1 A;  1YZX A;  3ERG A;  5B7C A;  4YKF A;  1BYE A;  1T4Z A;  4NWY A;  2CZ2 A;  4MLY A;  4I8B A;  4PUR A;  3KIJ A;  1E6B A;  2JAC A;  4TXO A;  4X4J A;  4HZ4 A;  3MNG A;  2H30 A;  3FEU A;  3VLN A;  4MPF A;  4WBJ A;  4KND A;  3M1G A;  5KN2 A;  3IHG A;  4AKG A;  3M8N A;  3MYD A;  5ECP B;  5COH A;  1HNA A;  2CAQ A;  1EEJ A;  3L9U A;  2VOC A;  5ECN B;  3DML A;  2VUP A;  1TP9 A;  1XWA A;  4AKI A;  5DQY A;  1VF4 A;  2YCD A;  3M0F A;  4G10 A;  1JLW A;  3OR5 A;  3TJG A;  1OE8 A;  4KB3 A;  1F3A A;  2X99 A;  3BCI A;  1XFL A;  1K0O A;  4AKX B;  3BOA A;  1NM3 A;  3WT1 A;  2I9H A;  4YQM A;  1WPI A;  5HFK A;  2FHE A;  2ON5 A;  1QMV A;  1FG4 A;  1I9D A;  4TXO B;  5A34 B;  4JBB A;  4KX4 A;  3HA9 A;  4IP6 A;  1FB0 A;  3GMF A;  4L0U A;  2UZ8 A;  2TRC P;  3UIW A;  3CBU A;  4L5L A;  3LQ7 A;  2TIR A;  3GUR A;  1PA3 A;  2J23 A;  2REM A;  4PUF C;  1Z7P A;  4KAE A;  2PGT A;  1OKD A;  5DAK B;  2H73 A;  3FRC A;  3NOF A;  1TXX A;  4MJC A;  1TK0 B;  4YH2 A;  3BD2 A;  2JSY A;  4EKZ A;  3APS A;  3FKF A;  1DE2 A;  1UA5 A;  3A3T A;  5GZZ B;  1O81 A;  2QA2 A;  2K9F A;  2L5L A;  5CRW A;  3HY2 A;  5BMU B;  4O5Q A;  1FO5 A;  4MA9 A;  4G0I A;  1GLP A;  3DVW A;  1TOF A;  2A2P A;  3IE3 A;  2KP1 A;  2RII A;  2E2M A;  3TJB A;  2HQT A;  1NW2 A;  4I2T A;  22GS A;  4KCA A;  1EP7 A;  5KN3 A;  3FZ9 A;  4AKH A;  4HU7 A;  5J5N A;  2V1M A;  1Q4J A;  2JZS A;  1TDI A;  3IBH A;  2GST A;  1THO A;  4EC0 A;  3GNJ A;  1SK0 A;  3VI5 A;  5B6N A;  4P3Y B;  3KP8 A;  3IK7 A;  2B7K A;  3VI7 A;  2BTO T;  4BWQ A;  2IMF A;  3H8Q A;  2Z9S A;  2GSQ A;  4MP4 A;  1A2J A;  3IC8 A;  1Z9H A;  4Q5R A;  4DEJ A;  4KSO A;  2FWF A;  3IAM 2;  1GTA A;  2BJX A;  1DE1 A;  5J4V A;  1GSD A;  5IM9 A;  5AIV A;  3KXO A;  3RPN A;  3UJ1 A;  4E8E A;  5B6M A;  3V1W A;  1GWC A;  2P31 A;  2FUG 2;  2HRF A;  2IPA A;  3KD0 A;  6GSW A;  1B9X C;  2AV4 A;  1YEX A;  3H1N A;  2H6Z A;  18GS A;  3VUR A;  1G0T A;  1V57 A;  2KUC A;  3CTF A;  4JED A;  3D5J A;  2A4V A;  3GH6 A;  3CSH A;  4E8H A;  3FK8 A;  1Y6E A;  5F0G A;  1HD2 A;  4ZB7 A;  3WGE A;  1A0R P;  2F8F A;  5JCW A;  5DAL A;  3GRX A;  4W66 A;  5HFI A;  2L6C A;  4F82 A;  4TKY A;  3C1R A;  19GS A;  4I5Q A;  4AJ6 A;  4N3Z A;  1G7O A;  1VGL A;  4J2F A;  4K7I A;  3ZRE A;  3UEM A;  1OAZ A;  1PX6 A;  1SL0 B;  2GZP A;  2GQM A;  2LQQ A;  2V6K A;  4Q5F A;  3FR3 A;  1KBN A;  1YJ6 A;  6GSX A;  5D73 A;  2HXK A;  1SJZ A;  1WE0 A;  5FHI A;  5CNW A;  2L57 A;  1MDK A;  4MJE A;  4DSS A;  4HUA A;  2X8C A;  2R37 A;  3F63 A;  4K1F A;  4EXJ A;  3D4M A;  2VD0 A;  3ZRD A;  1V98 A;  3F9U A;  2R5G A;  3ZL5 A;  5DAL B;  1AW9 A;  5AIS A;  5KOX A;  2IN3 A;  2H72 A;  1EV4 A;  3R2Q A;  5G5F A;  1J0F A;  1TRS A;  1O7U A;  3F0I A;  2H66 A;  5F05 A;  2E7P A;  3H4K A;  3E3E A;  3VWW A;  2VCW A;  13GS A;  3ZFL A;  1EOH A;  1ZYN A;  3EPT A;  4DSR A;  1Q98 A;  2LV3 A;  3FR9 A;  4MPG A;  2R0C A;  3GV1 A;  4XS1 A;  4DSS B;  1A24 A;  2CX4 A;  3KZQ A;  3TRX A;  3APQ A;  2IIY A;  4Z2R A;  2VLV A;  1EGR A;  4G01 A;  3GKK A;  4ML1 A;  1TK5 B;  3QFA C;  3U6V A;  3ME7 A;  2CVD A;  4MZC A;  2VCX A;  5IPG A;  1B48 A;  3MDK A;  4O5U A;  2PVQ A;  4OCF A;  2HSN A;  5G1K A;  3IHQ A;  1EV9 A;  1XPV A;  2B1L A;  1KNG A;  3Q18 A;  4LL4 B;  5E4W A;  1U3A A;  5CYY A;  2L59 A;  4AGS A;  4ECB A;  1AQW A;  4ZXG A;  1A2L A;  4TXV A;  1Z3E A;  1C72 A;  2C0D A;  1SVL A;  2O5V A;  1VF3 A;  2WS2 A;  1GP1 A;  2QSI A;  3UBL A;  4A5P A;  1K3L A;  3N5O A;  1B4Q A;  3ZIJ A;  3IDV A;  3WT2 A;  4F0B A;  4PNG A;  4GLT A;  1K0C A;  5FWG A;  2YWI A;  3Q19 A;  2ZUP A;  5GSS A;  2OE3 A;  2CVK A;  2EFC A;  2YWM A;  2XBQ A;  5J3R A;  2GS3 A;  2HSN B;  1M7T A;  3IR4 A;  5A4V A;  2MYG A;  4IJ3 A;  4ZL7 A;  3VK9 A;  1VF1 A;  5CO3 A;  4TOP A;  5G30 A;  3I43 A;  1NHO A;  4NV2 A;  4FIW A;  5F07 A;  3HMJ G;  5G1L A;  3L9V A;  3TB2 A;  1JZD A;  4V1A p;  1DSB A;  3HDC A;  2EIQ A;  3ZYW A;  1YKC A;  4KDX A;  3ED3 A;  1G7E A;  3EVI A;  1TK8 B;  1YDK A;  2JAD A;  2LNS A;  3KEB A;  5JWR B;  2RUF A;  3PPU A;  4FYB A;  2YWN A;  4NHZ A;  4OO4 A;  2B6M A;  3F4S A;  1Z7R A;  5F8B A;  4ILF A;  3TCO A;  1UN2 A;  1XVQ A;  1ZYE A;  1Y25 A;  1BF5 A;  1U88 A;  4HS1 A;  1XIY A;  2GDR A;  3HJM A;  1K3Y A;  2C0E A;  2R2J A;  4TRX A;  1MDJ A;  5G31 A;  1GUK A;  2N5F A;  1TRV A;  5J4U A;  3L0H A;  2VLT A;  3HJP A;  4G2E A;  1SL1 B;  2PMT A;  1ZCP A;  4K0N A;  4TN8 A;  1SKW B;  4O7H A;  5J41 A;  3KJY A;  2R6K A;  5B8B A;  5DCG A;  1PN9 A;  1R5A A;  2C4J A;  3G7J A;  1A0F A;  2H1B A;  4HZ2 A;  3RAZ A;  3IA1 A;  1YF1 A;  1GTI A;  4IP1 A;  5GAN D;  4F03 A;  4H86 A;  3E0U A;  2CA8 A;  4GWR A;  4XRD A;  1Y1U A;  3UMA A;  2WGR A;  2YWO A;  3WGD A;  5CRH A;  4JR4 A;  2IJY A;  6GSS A;  1F6M C;  2VO4 A;  5B8A A;  3FZ4 A;  4I97 A;  5AGY A;  1ON4 A;  4FQU A;  5ECI B;  1K0N A;  1YKA A;  4J57 E;  3TUE A;  4KCE A;  1TU8 A;  2LJR A;  2VL9 A;  4CHS A;  1ILO A;  2FCH A;  3TKQ A;  2GVP A;  2KOK A;  3EMX A;  1K0B A;  1ERW A;  3BBY A;  3HKR A;  1DBY A;  2RM5 A;  1ZGN A;  4MJB A;  2MMZ A;  5KN0 A;  4KDY A;  4PQI A;  2HLS A;  5CRD A;  1RW1 A;  4YQV A;  1X0R A;  3ZIV A;  2IL3 A;  1SJ6 A;  1TTZ A;  1M99 A;  3ZTL A;  1O73 A;  5HR1 A;  3TKS C;  3ERF A;  5CP1 A;  4ACS A;  2RUE A;  5IMC A;  5IO0 A;  2HFD A;  1OVN A;  3GKN A;  4EUY A;  1WWJ A;  2CX3 A;  2PBJ A;  1ML6 A;  2X64 A;  2OBK A;  3LOR A;  1PL2 A;  4K7N A;  3UAR A;  1S3C A;  5ID2 B;  4EL1 A;  4ML6 A;  2GSS A;  4GCI A;  1R7H A;  2WUL A;  1YQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...