2VCWA

Complex structure of prostaglandin d2 synthase at 1.95a.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vcwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vcwA01
3ED3A 5ECQB 2DJ0A 4V2MA 5J9BA 2NDOA 5ECHB 1WIKA 3M8NA 2AB6A 5IMCA 4QQ7A 2LRNA 1B4PA 3F4TA 1B8XA 1C72A 3F4RA 1A0FA 3DWVA 1ERUA 4I5QA 1O85A 3IBHA 2EIRA 2I3YA 4I2UA 2YP6A 4LA1A 2TIRA 1TJDA 17GSA 1F9MA 1EZKA 3VK9A 1SD9A 1TU7A 1GL8A 3RPPA 4ID0A 1SJZA 3E9JB 3IA1A 1DBYA 2JZRA 4GSSA 2GVPA 3O3TA 1TDIA 2VL2C 4OWYA 3HVVA 5IM9A 3LEFA 3FR6A 3CRUA 5JWOB 3APQA 1ZGNA 3EMPA 3D4MA 3CSIA 1Q98A 3O76A 3DXBA 2CAQA 3F3RA 1Z6MA 5CAXA 2HSMA 4JRRA 1E2YA 1GSSA 3GRXA 3ZYWA 1LJRA 2EIOA 3TRXA 4J57E 5J9CA 5HFKA 1YZXA 4F2IA 2HZEA 1FW1A 5D9XA 1MEKA 4F0BA 2VD0A 1YEPA 3ZRDA 4JR4A 2FGXA 4GSNA 4JU5A 2WJUA 4LMWA 4OD7A 1M99A 5E4WA 3DGQA 3FKFA 4K9ZA 1Q4JA 1Z7PA 2H0HA 2DBCA 3MSZA 5J3RA 2QC7A 4MJBA 2C8UA 5IMVA 4NV5A 4O92A 3HJOA 4FH8A 1N8JA 3EWLA 2LKUA 3HCZA 1M9BA 1XWAA 1A8YA 3N5OA 5F06A 2RLIA 2F9SA 3CXGA 4TN8A 3FY7A 4IS0A 1ZZYA 1T00A 2RM5A 5B6MA 2R37A 4Z7XA 3C71A 1QXHA 3EE2A 1PL1A 3IAS2 1UC7A 5B8AA 5D9WA 1ZL9A 2VCZA 1SJ6A 2G2QA 2XC2A 2M72A 3FZAA 2GSQA 3GL3A 5ELAA 1NSWA 1F3AA 1EGOA 2B1LA 4XHMA 3FZ9A 3KIJA 3G7JA 1GSEA 3M1GA 2KUCA 5HR0A 2TRCP 4TR1B 3TOUA 5FHIA 5ABRA 4EE0A 5GZZB 3TRQA 4ECIA 2HI7A 3ZMKA 2B5YA 4P3YB 3MAKA 1AUCA 1TRSA 2PVQA 4MP4A 3R3EA 4TKYA 1G6WA 3UARA 4BL7A 1SYXA 2H6YA 3GFKA 2VLTA 3UAPA 3LXTA 3QFAC 2EC4A 3UBLA 3VURA 1YEXA 2LJRA 3BOAA 4K8MA 3WD6A 1QMVA 3TB2A 3KTLA 5IMDA 5E59A 3FEUA 2H73A 2VCTA 3QD9A 2KHPA 4D73A 3TRPA 4I97A 4I8BA 3TJJA 3VFIA 3I69A 1ZMAA 5ECLB 4BVYB 3L0HA 3GMFA 1FO5A 4TOPA 2IL3A 2HZEB 1XWCA 4POLA 1M2DA 2AAWA 1SU9A 2H71A 3GYKA 2YWMA 1PGTA 4O32A 5HFGA 2GSTA 2H1AA 4MZBA 4V2NA 1EOHA 1HYUA 2H1GA 4IBPA 2FCHA 3ZFBA 3ZIVA 3LYPA 5HQPA 3M9KA 3QDNA 2DSAA 3VLNA 1SENA 2R5GA 1FAAA 2PWJA 4HDEA 3LSZA 4PXOA 4USSA 4JE1A 1DE1A 2JSYA 1SL1B 2C1YA 2F3MA 6GSXA 1JLVA 2NVLA 2O89A 1K0MA 1ZYEA 5AIVA 4ULXA 2V1MA 3P8WA 3CTFA 4MZCA 3GH9A 4BA7A 2GLRA 3RAZA 4GQCA 3D5JA 3A2XA 2LRTA 1H75A 3IR4A 5D73A 4CHSA 3ME8A 3IC8A 4JR6A 5CREA 1GTIA 1XVQA 2YWIA 5FT3A 2K8SA 4IP1A 2VLUA 2VCWA 4KCAA 4XS1A 2HT9A 2XPDA 1R26A 5G1KA 2JL4A 1GRXA 4AJ7A 2LV3A 1AQVA 1OC3A 3HYPA 4PUAA 1FG4A 1U87A 4HZ4A 1I9DA 5CO3A 2ON5A 2YANA 3HVXA 2R4VA 1OC9B 1V58A 4RI7A 4HU7A 2C3NA 5KN1A 2IJYA 4XIHA 1OE8A 1XOBA 3GTUB 3H8QA 3P90A 2H6ZA 4IJIA 2GZYA 4EC0A 4DVCA 2LTKA 2L6CA 2C3QA 3E3EA 3K8NA 1J08A 3Q19A 3FRCA 5AGYA 1Z7RA 3KZQA 4GQFA 4KUNA 4PNFA 3BD2A 1SKSB 3IAM2 4NHWA 6GSVA 1M9AA 1Z3EA 2C0GA 3VWUA 2HSHA 1SL0B 3KCMA 1G6YA 1AIUA 1B9YC 4EF0A 2MBSA 4MF7A 1BG5A 4MK3A 3EYTA 4K2DA 4PURA 2JZSA 2K8VA 4EL1A 2R6KA 4WBJA 1GUKA 2XPEA 5CRGA 4G0IA 1YY7A 3FHKA 2OKAA 4ECCA 2V6KA 4ECJA 2V6OA 2REMA 5LCZA 1SKRB 1V9WA 3O6TA 4KCEA 5G31A 3DMLA 2DLXA 5H5QA 3DRNA 1PRXA 2ON7A 4TR4A 1J9BA 4Q5RA 2H1DA 2YV7A 1XCCA 4HZ2A 4ISDA 4I2TA 5B6NA 1NW2A 2ZUPA 1VRSD 3J7Yb 2X64A 1THOA 3HDCA 4KSMA 4IHUA 1TP9A 2O7KA 5C04A 2IMIA 5ELGA 5LD0A 4KB3A 2CVBA 5IPGA 5IOWA 2PPTA 4N11A 2L4CA 4DSSA 1BX9A 2JACA 2OA7A 4BVXB 4GF0A 5KN0A 2FWGA 5DJMA 2H74A 3L9UA 5GAPD 2IMKA 5ECKB 1JZOA 2BMXA 1PMTA 5LNKe 3FK8A 1KNGA 3GA4A 2BJXA 1VGLA 4AJ6A 2DMMA 2OJLA 3L78A 4PUFC 5DVBA 2C4JA 2IFQB 2RIIA 5GSTA 2YNXA 4QL7A 2OE1A 3VI5A 2YN1A 1XXUA 2YZHA 2LEGA 2CVKA 1M2AA 3HZ8A 2CQ9A 4K0NA 4EUYA 4MPGA 1ABAA 5AISA 2QKEA 3UL3A 2YWOA 4FYUA 2RM6A 3E0UA 4DSQA 4HOJA 5G2ZA 1TK8B 2MYGA 3PPUA 4LL4B 4IELA 1KTEA 5D8IA 2HRKA 4OMVA 1GUMA 2XHFA 4EXJA 4G19A 1GTBA 2HQTA 2TRXA 1R5AA 1XIYA 1Z6NA 2VL3A 1PX6A 5G1LA 4F03A 5HR2A 5DQSA 3SBCA 3M3MA 2R2JA 5G5EA 3V1WA 2RUEA 1VF3A 2DJKA 2X8CA 1TK5B 2H01A 1CQGA 4MJAA 2RUFA 2A2SA 1X5CA 3GSSA 1PX7A 12GSA 3F3QA 3GNJA 1S3DA 1PD21 1OYJA 4G0KA 4IP6A 1DSBA 3DIEA 2DIZA 2FA8A 4KE3A 2DJJA 1SL2B 4PGTA 3VWWA 1ILOA 3I9V2 2V32A 4KDYA 3KM6A 4WKWA 3AY8A 4IN0A 5ECNB 4WF4A 3WGXA 1EEJA 1F2EA 3DD3A 1NM3A 3APSA 2P5RA 3H93A 3KEBA 3GKMA 1RK4A 3IHQA 1BAYA 1TI3A 1YF1A 4KDUA 4L0WA 1TOFA 5BMUA 3UIWA 4HQSA 3EU4A 2H75A 2KP1A 1BQ7A 3A3TA 4MA9A 4TXOA 2M46A 5DALA 4ZILA 4ECBA 1XWKA 5DCGA 1O8XA 1QQ2A 2CVDA 3UVHA 2ZNMA 4E8HA 1QFNA 4F82A 4K7IA 1T8EB 4MF6A 1SD8A 5DDLA 4N0ZA 1EOGA 2CV4A 1B4QA 5CRDA 3Q74A 3U6VA 3BCIA 1WP0A 2N5AA 5ECIB 3RDWA 4Q5FA 3HD5A 2FHEA 1TRVA 5JCUA 3CMIA 1ZYQB 5EL8A 1HNCA 3QCPA 2MMOA 1HD2A 3J7Yk 2X8GA 5JWRB 2CX4A 2VL9A 1RQMA 5D9VA 2AUVA 4NWYA 4XS4A 2OBKA 3Q6OA 3GKKA 6GSSA 5EY6A 2C0EA 1TI1A 5AN1A 5KN2A 2L5LA 2CA8A 1GH2A 2IN3A 3OR5A 3VWXA 2YWNA 1Y25A 5DAKA 1EGRA 3D4TA 5H5RA 3TOTA 3P7XA 1XWBA 2VL2A 2OE0A 1I5GA 1G7OA 2VCXA 5CYYA 4HQZA 2IMEA 5ECMB 2HSMB 3KH9A 3N9JA 2HE3A 2QGVA 3UVTA 2CZ3A 3HY2A 2LJKA 1PA3A 4FO5A 2HXKA 5DCHA 1WE0A 2DJ1A 5F8BA 3LWAA 2NBSA 1XW5A 4G2EA 2DJ2A 4JZQA 3F8UA 5CRHA 4G9HA 1GUHA 1GSFA 3QR6A 4AF2A 4MH3A 6GSWA 1URMA 4HU9A 2CZ2A 1A2MA 1X9SB 1WJKA 2WGRA 4MMMA 5INYA 2YCDA 1UVZA 1OKDA 5B8BA 4IQAA 4TXOB 5DALB 5F07A 4AGSA 3US3A 3ZL5A 3F9UA 3HJMA 1JZDA 4Q5NA 5ID2A 1GSDA 1HQOA 1MTCA 4FYBA 4KW6A 4HUAA 5EPFA 3RPNA 4YQVA 1S3AA 2P0GA 2I4AA 1AQXA 4J2FA 3IPZA 4RUVA 2GDRA 10GSA 1O6JA 3LFLA 3L4NA 3TKSC 3KGKA 1MDIA 2PN8A 1YJ6A 4E8EA 2B7JA 4AJ8A 3ERWA 5EVOA 4GRFA 3G7IA 1R7HA 4L5OA 4ACSA 3VI7A 1F6MC 1GP1A 1TXXA 5ECPB 1GLQA 4YAVA 4XS4B 1OAZA 2HFDA 2H19A 1Y6EA 1T7PB 3TGZA 2LUSA 2O8VB 3IV4A 4NV2A 5ECSA 8GSSA 2E2GA 1X5EA 3C1SA 1ON4A 2PVOC 4BL7B 2WCIA 4OO4A 1YKAA 4TVEA 4NMUA 4L0UA 3LORA 4HJ2A 1WMJA 4ZB9A 4N0VA 3GV1A 2Z9SA 4YQUA 4EO3A 2K9FA 2HNLA 3ZREA 2WFCA 3MNGA 1VF2A 4D73B 3S9FA 11GSA 3G7YA 4DEJA 20GSA 1THXA 4IKHA 2GTUA 2V41A 3ZMLA 1GLPA 3EMXA 4ZL7A 3CRTA 1SYRA 2XBQA 4GLTA 1B48A 4MZWA 1XZOA 2H8LA 3F4SA 4JEDA 1GSQA 3CBUA 2FWEA 2YPMA 1MDJA 5HR3A 3PH9A 1UA5A 4OCFA 3TUEA 1QUWA 1GSUA 1PN9A 2IWTA 4YH2A 2AV4A 4LLRA 3UEMA 1XOAA 3LQ7A 14GSA 2GSSA 2HYXA 1T3BA 1IYIA 4TW5A 1WPIA 2AJQB 4V1Ag 2AHEA 3ERFA 3GSTA 2H0GA 3GURA 2X99A 3FYGA 2WS2A 3C8EA 4PNGA 3GX0A 4YAPA 1ERTA 4ZB8A 3HJPA 3PR8A 4HJMA 3ZVJA 2J9HA 2P5QA 1A2LA 5JCWA 2X8HA 3QAWA 1O7UA 1ML6A 2CT6A 4G0LA 2DC5A 3C7MA 2OBIA 4WR4A 1J0FA 1AW9A 3I6AA 1U88A 1F37A 2GQKA 3GKXA 4CW9A 3QFBC 4GXZA 2H76A 2MMAA 5A4VA 2IMFA 4QL9A 5HR1A 3BCKA 3M9JA 1HNBA 1GSYA 4IVFA 2VM2A 3CSJA 5G5FA 4ML1A 2F8AA 5AIXA 3IE3A 3IXRA 2M80A 3KP8A 4MPFA 1KBNA 3PINA 3ME7A 3L9VA 4GCIA 1BJXA 1X5DA 2GT5A 3FR9A 3ZZXA 4XRAA 3GL5A 4POKA 5J5NA 4K1FA 5F0GA 4DSRA 3A5WA 2PBJA 2CX3A 2B1KA 1F3BA 2OACA 3QMXA 2OE3A 1TK0B 1YKCA 4ZB6A 1AQWA 5JWQB 2PERA 4ZL8A 3F63A 1ERWA 1A2JA 4K6XA 3I43A 2IIYA 1WWJA 1GNEA 5A4WA 1O81A 3ZITA 3D21A 4TR0A 3F0IA 4V1Ap 1TKDB 1XWGA 5COHA 3HHVA 4K7OA 3VPTA 2N5BA 2LNSA 4FYCA 5L71A 4J56E 2MMNA 1ZCPA 3C1RA 1Z5YE 2WRTA 3F6DA 6GSTA 2C0DA 4X1UA 2EIQA 1S3CA 4BWSA 4XCSA 3WGDA 2WZ9A 5A4UA 3JCML 3TJBA 5D96A 2VUPA 4PQ1A 2HSNB 2DJ3A 3IC4A 2H6XA 3H1NA 1FOVA 3A2VA 4BWQA 4WEYA 4HI7A 5IMZA 1DE2A 3KJYA 2VAFA 3APOA 3KMNA 4G10A 1NHOA 1V98A 1ST9A 2L4QA 2PU9C 1HNAA 4NHZA 4TR1A 1PKZA 1ZOFA 2O85A 4N10A 4RI6A 2QSIA 2G0FA 3QAVA 2HRNA 5KEJA 4F9ZA 3GHAA 2C80A 4HS1A 4LMVA 3SWLA 1M0UA 2V2GA 3TJKA 2I1UA 5FWGA 3UJ1A 2YJHA 3EC3A 2MBTA 3MWHA 3KH7A 3TDGA 4ZBDA 2H66A 5G30A 2IMDA 1XVWA 2BTOT 2LQQA 3FW2A 4EKZA 3R2QA 1A0RP 1TTZA 5IIZA 1IYHA 2C3TA 3WYWA 2VOCA 4OO5A 4MJCA 2I81A 4KH7A 3HZ4A 4FQUA 2LNTA 2CAIA 3DVWA 1GNWA 4BVYA 4OFNA 4DSSB 2VLVA 3TKSE 2FWHA 3ZVJD 3HVSA 3LGCA 1PL2A 3W6GA 1EP8A 1W89A 4MH2A 4OFMA 1K0BA 3IOSA 2B6MA 4X43A 2H30A 1ERVA 2JSZA 13GSA 2YZUA 4ZL9A 1A23A 2HZFA 1EEMA 1H4OA 4MABA 4HEA2 3IRAA 2E7PA 3W8JA 1JHBA 1UN2A 1K3YA 3P2AA 3GKNA 4MF5A 2L57A 3CYNA 2O87A 3DVXA 5D93A 4ZIJA 2VM1A 4O7HA 1K0CA 3HXSA 2HSYA 1KEBA 2KOKA 4JBBA 2E2MA 3EU3A 1DUGA 19GSA 3TKQA 2GQMA 3U5RE 2HRKB 3C73A 4N30A 1XBSA 1K0DA 2A2RA 2LS5A 3QPMA 4KNDA 4L5LA 1SK1A 2E0QA 2F8FA 5JCGA 5D9TA 4MJEA 2J23A 2L5OA 4GTUA 1U3IA 1XPVA 2FD3A 4XTSA 5IQYA 4KX4A 2FWFA 5ENUA 2VO4A 1VF1A 3CSHA 3ZIJA 5IMAA 3LG6A 4X0XA 4XS6A 2LRCA 1A8LA 1PQNA 3WT2A 4NAXA 2VD1A 1N2AA 3VPQA 2YOIA 1G0TA 1O73A 1K0OA 1OC9A 1B9XC 4OCEA 3CTGA 5DQYA 3LJRA 1R4WA 1E6BA 3FZ4A 3GTUA 3D0ZA 3ERGA 2DIYA 4TXVA 1FVKA 1CQHA 4WXTA 1V2AA 3RHBA 1MD3A 1O8WA 3PGTA 1T1VA 2F51A 1WRYA 3IK9A 1JFUA 3MDKA 4KDXA 4GWRA 5F05A 3DYRA 2ZCTA 4WF5A 1Z9HA 3WT1A 1U3AA 3LYKA 2R3XA 2GS3A 2YJ7A 2FUG2 4FIWA 1MDKA 2DMLA 2FNOA 4KSOA 2GGTA 1SK0A 4MCUA 2GZPA 1USBA 3QOUA 3GUSA 4CDOA 1AAZA 3DKSA 4IW9A 7GSSA 2GSRA 2GT6A 1RW1A 4ZBAA 1EWXA 1T4YA 2JU5A 4L8EA 1W4VA 3KD0A 1G7EA 1FVJA 3W8SA 2FLSA 4KF9A 1QGVA 3IDVA 2WDUA 3QAGA 2VCQA 5DBQA 2MZCA 9GSSA 3L9SA 3UMAA 1EP7A 4KAEA 3NIVA 3G9BA 3HKRA 2YV9A 1GTUA 3A2WA 1T4ZA 1K0NA 2MMZA 4PQIA 2JADA 1EV4A 2B3SA 2L59A 3TJGA 4O5RA 6GSYA 4POBA 2WB9A 2ES7A 4KA0A 1A24A 2VCVA 3F6FA 4V2LA 3H4KA 5IOXA 2AYTA 3EVIA 1K0AA 3HA9A 4GSTA 3D22A 2N5FA 4MLYA 1TW9A 1GWCA 4Q5QA 4OFTA 5CRWA 1XW6A 4RQRA 2B5XA 3RBTA 1OKTA 4WBRD 1PSQA 1X9WB 1TRUA 2IPAA 3KTBA 4BVXA 3NOFA 2FA4A 2ALBA 4EVMA 1K3OA 1U6TA 3TKRA 5DAKB 2H72A 4LL1B 5CP1A 3GH6A 3ZLPA 4EDZA 1FB0A 3UBKA 3KP9A 2B5EA 4PQHA 3ZTLA 5IMFA 2IFQA 3TKPA 2OADA 1QK8A 1TU8A 3EINA 1OE7A 4YQMA 3IK7A 2PGTA 2FY6A 4NPBA 4K0GA 3GIXA 2PMTA 1JZWA 3WGEA 5DJLA 1FHEA 2XBIA 3Q18A 5J41A 4ZXGA 5H5SA 2GZZA 3BJ5A 1AC1A 3DEXA 1PKWA 1EV9A 4ILFA 18GSA 2HRFA 1LBKA 3NZNA 4PTSA 4NXIA 1WOUA 1SK2A 1OC8A 1JLWA 2D2ZA 1XFLA 3M0FA 4H86A 3FR3A 5B7CA 1YF0A 6GSUA 4ZBBA 2P31A 1OVNA 2K18A 2K6VA 2HLSA 1X9MB 2WULA 5IPHA 2KLXA 1LU4A 2H70A 5ID2B 2JZTA 4IGJA 2A4VA 2GQLA 1X0RA 1XW9A 3RHCA 5ECRB 3KMOA 1V40A 3UOMA 1M2BA 3EURA 5CNWA 5ECOB 2NTOA 1AXDA 4BPYA 2B7KA 4XRDA 2I9HA 1GULA 4IQ1A 4I6XA 5HFIA 5GAND 1MD4A 3KXOA 3TKSA 3TCOA 4K7NA 5IO2A 4IJ3A 1SJIA 1YQ1A 4TRXA 1NHYA 3GX8A 4PX1A 2LSTA 4RQXA 4KGIA 1VF4A 1JZRA 2LQOA 4EDYA 2L6DA 1GTAA 4ML6A 2UZ8A 2H0IA 22GSA 4F0CA 3GN3A 5C00A 3FZ5A 1SKWB 1V57A 1YDKA 4WR5A 1BYEA 3TJFA 5GSSA 2H1BA 2LJAA 3H79A 3LXZA 4POMA 3ISOA 1BEDA 1M7TA 1R5PA 1K3LA 2KP2A 5A5KA 2C0FA 2VIMA 5KN3A 2HRAA 3VWVA 16GSA 4MDCA 5J4UA 5IO0A 4WETA 3BBYA 1TRWA 1FB6A 1ACVA 2NPBA 3D6IA 3ZFLA 2PUKC 4TR3A
chains in the Genus database with same CATH superfamily
3ED3A 5ECQB 2DJ0A 4V2MA 5J9BA 2NDOA 5ECHB 1WIKA 4K5SA 3M8NA 2AB6A 5IMCA 4QQ7A 2LRNA 1B4PA 3F4TA 1B8XA 1C72A 3F4RA 1A0FA 3DWVA 1ERUA 3FMWA 5J40A 4I5QA 1O85A 3IBHA 2EIRA 2I3YA 2X4AA 4Z2RA 4I2UA 2YP6A 4LA1A 2TIRA 1TJDA 17GSA 1F9MA 1EZKA 3VK9A 1SD9A 1TU7A 1GL8A 3RPPA 4ID0A 1SJZA 4QMKA 3E9JB 3IA1A 1DBYA 2JZRA 4GSSA 2GVPA 3O3TA 1TDIA 2VL2C 4OWYA 3HVVA 5IM9A 3LEFA 3FR6A 3CRUA 5JWOB 3APQA 1ZGNA 3EMPA 3D4MA 5A5HA 3CSIA 1Q98A 3O76A 3DXBA 2CAQA 3F3RA 1Z6MA 5CAXA 2HSMA 4JRRA 1E2YA 1GSSA 3GRXA 3ZYWA 1LJRA 5A34B 2EIOA 3TRXA 4J57E 5J9CA 5HFKA 1YZXA 4F2IA 2HZEA 1FW1A 5D9XA 1MEKA 4F0BA 2VD0A 1YEPA 3ZRDA 4JR4A 2FGXA 4GSNA 4JU5A 2WJUA 4LMWA 4OD7A 1M99A 2VKZG 5E4WA 3DGQA 3FKFA 5J4YA 4K9ZA 1Q4JA 1Z7PA 2H0HA 2DBCA 3MSZA 5J3RA 2QC7A 4MJBA 2C8UA 5IMVA 4NV5A 4O92A 3HJOA 4FH8A 1N8JA 3EWLA 2LKUA 3HCZA 1M9BA 1XWAA 1A8YA 2QA1A 3N5OA 2O3EA 5F06A 2RLIA 2F9SA 3CXGA 4TN8A 3FY7A 4IS0A 1ZZYA 1T00A 2RM5A 5B6MA 2R37A 4Z7XA 3C71A 1QXHA 3EE2A 3HVNA 2WVYA 1PL1A 3IAS2 1UC7A 5B8AA 5D9WA 1ZL9A 2VCZA 1SJ6A 2G2QA 2XC2A 2M72A 3FZAA 2GSQA 4GDFA 3GL3A 5ELAA 1NSWA 1F3AA 1EGOA 2B1LA 4XHMA 3FZ9A 3KIJA 3G7JA 1GSEA 3M1GA 2KUCA 5HR0A 2TRCP 4TR1B 3TOUA 5FHIA 5ABRA 4EE0A 5GZZB 3TRQA 4ECIA 2HI7A 3ZMKA 2B5YA 4P3YB 4AKIA 3MAKA 1AUCA 1TRSA 2PVQA 4MP4A 3R3EA 4TKYA 1G6WA 3UARA 4BL7A 1SYXA 2H6YA 3GFKA 2VLTA 3UAPA 3LXTA 3QFAC 2EC4A 3UBLA 3VURA 1YEXA 2LJRA 3BOAA 4K8MA 3WD6A 1QMVA 3TB2A 3KTLA 5IMDA 5E59A 3FEUA 2H73A 2VCTA 3QD9A 2KHPA 1PN0A 4D73A 3TRPA 4I97A 4I8BA 3TJJA 3VFIA 3I69A 1ZMAA 5ECLB 4BVYB 3L0HA 3GMFA 1FO5A 4TOPA 2IL3A 2HZEB 1XWCA 4POLA 1M2DA 2AAWA 1SU9A 2H71A 3GYKA 2YWMA 1PGTA 4O32A 5HFGA 2GSTA 2H1AA 3RFRC 4MZBA 4V2NA 1EOHA 1HYUA 2H1GA 4IBPA 2FCHA 3ZFBA 3ZIVA 3LYPA 5HQPA 3M9KA 3QDNA 2DSAA 3VLNA 1SENA 2R5GA 1FAAA 2PWJA 4HDEA 3LSZA 4PXOA 4USSA 4JE1A 1DE1A 4W66A 2JSYA 1SL1B 2C1YA 2F3MA 6GSXA 1JLVA 2NVLA 2O89A 1K0MA 1ZYEA 5AIVA 4ULXA 2V1MA 3P8WA 3CTFA 4MZCA 3GH9A 4BA7A 2GLRA 3RAZA 4GQCA 3D5JA 3A2XA 2LRTA 1H75A 3IR4A 5D73A 4CHSA 3ME8A 3IC8A 4JR6A 5CREA 1GTIA 1XVQA 2YWIA 4YKFA 5FT3A 2K8SA 4IP1A 2VLUA 2VCWA 4KCAA 4XS1A 2HT9A 2XPDA 1R26A 5G1KA 2JL4A 1GRXA 4AJ7A 2LV3A 1AQVA 1OC3A 3HYPA 4Z2UA 4PUAA 1FG4A 1U87A 4HZ4A 1I9DA 5CO3A 2ON5A 2YANA 3HVXA 2R4VA 1OC9B 1V58A 4RI7A 4HU7A 2C3NA 5KN1A 2IJYA 4XIHA 5KOXA 1OE8A 1XOBA 3GTUB 3H8QA 3P90A 2H6ZA 4IJIA 2GZYA 4EC0A 4DVCA 3CWGA 2LTKA 2L6CA 2C3QA 3E3EA 4PI0C 3K8NA 1J08A 3Q19A 3FRCA 5AGYA 1Z7RA 3KZQA 4GQFA 4KUNA 4PNFA 3BD2A 1SKSB 3IAM2 4NHWA 6GSVA 1M9AA 4A5PA 1Z3EA 2C0GA 3VWUA 2HSHA 1SL0B 3KCMA 1G6YA 1AIUA 1B9YC 4EF0A 2MBSA 4MF7A 1BG5A 4MK3A 3EYTA 4K2DA 3CQFA 4PURA 2JZSA 2K8VA 4EL1A 2R6KA 4WBJA 1GUKA 2XPEA 2HSNA 2A2PA 5CRGA 4G0IA 1YY7A 3FHKA 2OKAA 4ECCA 2V6KA 4ECJA 2V6OA 2REMA 5LCZA 1SKRB 1V9WA 3O6TA 4KCEA 5G31A 3DMLA 4N3ZA 2DLXA 5H5QA 3DRNA 1PRXA 2ON7A 4TR4A 1J9BA 4Q5RA 2H1DA 2YV7A 2WVXB 1XCCA 4HZ2A 4ISDA 4I2TA 5B6NA 1NW2A 2ZUPA 1VRSD 3J7Yb 2X64A 1THOA 3HDCA 4KSMA 4IHUA 1TP9A 2O7KA 5C04A 2IMIA 5ELGA 4E68A 2O36A 5LD0A 4KB3A 2CVBA 5IPGA 5IOWA 2PPTA 4N11A 2L4CA 4DSSA 1BX9A 2JACA 2OA7A 4BVXB 4GF0A 5KN0A 2FWGA 5DJMA 2H74A 3L9UA 1ZYPA 5GAPD 2IMKA 5ECKB 1JZOA 2BMXA 2UV8G 1PMTA 5LNKe 3FK8A 1KNGA 3GA4A 2BJXA 1VGLA 4ZB7A 4AJ6A 2DMMA 2OJLA 3L78A 4PUFC 1S3RA 5DVBA 2C4JA 2IFQB 2RIIA 5GSTA 2YNXA 4QL7A 2OE1A 2WZSA 3VI5A 2YN1A 1XXUA 2YZHA 2LEGA 3TU3B 2CVKA 1M2AA 3HZ8A 2CQ9A 4K0NA 4EUYA 4MPGA 1ABAA 5AISA 2QKEA 3UL3A 2YWOA 4FYUA 2RM6A 3E0UA 4DSQA 4HOJA 5G2ZA 1TK8B 2MYGA 3PPUA 4LL4B 4IELA 1KTEA 5D8IA 2HRKA 4OMVA 1GUMA 2XHFA 4EXJA 4G19A 1GTBA 1XG8A 2QA2A 2HQTA 2EFDA 2TRXA 1R5AA 1XIYA 1BF5A 1Z6NA 2VL3A 1PX6A 5G1LA 4F03A 5HR2A 5A1NA 1YEWC 5DQSA 3SBCA 3M3MA 2R2JA 1S4BP 5G5EA 3V1WA 2RUEA 1VF3A 2DJKA 2X8CA 4K2XA 1TK5B 2H01A 1CQGA 1I1IP 4MJAA 2RUFA 2A2SA 1X5CA 3GSSA 1PX7A 12GSA 3F3QA 3GNJA 1S3DA 1PD21 1OYJA 4G0KA 4IP6A 1DSBA 3DIEA 2DIZA 2FA8A 4KE3A 2DJJA 1SL2B 4PGTA 3VWWA 1ILOA 3I9V2 2V32A 4KDYA 3KM6A 4WKWA 3AY8A 4IN0A 5ECNB 4WF4A 3WGXA 1EEJA 1F2EA 3DD3A 1NM3A 3APSA 2P5RA 3H93A 3KEBA 3GKMA 1RK4A 3IHQA 1BAYA 1TI3A 1YF1A 4KDUA 4L0WA 1TOFA 5BMUA 3UIWA 4HQSA 3EU4A 2H75A 2KP1A 1BQ7A 3A3TA 2DKHA 4MA9A 4TXOA 2M46A 5DALA 4ZILA 4ECBA 1XWKA 5DCGA 1O8XA 1QQ2A 2EFHA 2CVDA 3UVHA 2ZNMA 4E8HA 1QFNA 4F82A 4K7IA 2DKIA 1T8EB 4MF6A 1SD8A 5DDLA 4N0ZA 1EOGA 4X4JA 2CV4A 1B4QA 5CRDA 3Q74A 3U6VA 3BCIA 1WP0A 2N5AA 5ECIB 3RDWA 4Q5FA 3HD5A 2FHEA 1TRVA 5JCUA 3CMIA 1ZYQB 2WW1A 5EL8A 1HNCA 3QCPA 2MMOA 1HD2A 3J7Yk 2X8GA 5JWRB 2CX4A 2VL9A 1RQMA 5D9VA 5A1NB 2AUVA 4NWYA 4XS4A 2OBKA 3Q6OA 3GKKA 6GSSA 5EY6A 2C0EA 1TI1A 3A5IA 5AN1A 5KN2A 2L5LA 2CA8A 1GH2A 2IN3A 3OR5A 3VWXA 2YWNA 1Y25A 5BRTA 5DAKA 1EGRA 3D4TA 5H5RA 3TOTA 3P7XA 1XWBA 2VL2A 2OE0A 1I5GA 5A5HB 1G7OA 2VCXA 5CYYA 4HQZA 2IMEA 5ECMB 2HSMB 3KH9A 3N9JA 2HE3A 2QGVA 3UVTA 2CZ3A 2A4HA 4HSCX 3HY2A 2LJKA 1PA3A 4FO5A 2HXKA 5DCHA 1WE0A 2DJ1A 5F8BA 3LWAA 2NBSA 1XW5A 4G2EA 2DJ2A 4JZQA 3F8UA 5CRHA 4G9HA 1GUHA 1GSFA 3QR6A 2WW3A 4AF2A 4MH3A 6GSWA 1URMA 4HU9A 2CZ2A 1A2MA 1X9SB 1WJKA 2EFEA 2WGRA 4MMMA 5INYA 4AI6A 2YCDA 1UVZA 1OKDA 5B8BA 4IQAA 4TXOB 5DALB 5F07A 4AGSA 3US3A 3CHXC 4AKGA 3ZL5A 3F9UA 3HJMA 1JZDA 4Q5NA 5ID2A 1GSDA 1HQOA 1MTCA 4FYBA 4KW6A 4HUAA 5EPFA 3RPNA 4YQVA 1S3AA 2P0GA 2I4AA 1AQXA 4J2FA 3IPZA 4RUVA 2GDRA 10GSA 1O6JA 3LFLA 3L4NA 3TKSC 5J4VA 3KGKA 1MDIA 2PN8A 1YJ6A 4E8EA 4Z2TA 2B7JA 4AJ8A 3ERWA 5EVOA 4GRFA 3G7IA 1R7HA 4L5OA 4ACSA 3VI7A 1F6MC 1GP1A 1TXXA 5ECPB 1GLQA 4YAVA 4XS4B 1OAZA 2HFDA 2H19A 1Y6EA 1T7PB 3TGZA 2LUSA 2O8VB 3IV4A 4NV2A 4ICYA 2EFCA 5ECSA 8GSSA 2E2GA 1X5EA 3C1SA 1ON4A 2PVOC 4BL7B 2WCIA 4OO4A 1YKAA 4TVEA 4NMUA 4L0UA 3LORA 4HJ2A 1WMJA 4ZB9A 4N0VA 3GV1A 2Z9SA 4YQUA 4EO3A 2K9FA 2HNLA 3ZREA 2WFCA 3MNGA 1VF2A 4D73B 3S9FA 11GSA 3G7YA 4DEJA 20GSA 1THXA 4IKHA 2GTUA 2V41A 3ZMLA 1GLPA 3EMXA 4ZL7A 3CRTA 1SYRA 2XBQA 4GLTA 1B48A 4MZWA 1XZOA 2H8LA 3F4SA 4O5UA 4JEDA 1GSQA 3CBUA 2FWEA 2YPMA 1MDJA 5HR3A 3PH9A 1UA5A 4OCFA 3TUEA 1QUWA 1GSUA 1PN9A 2IWTA 1N25A 4YH2A 2AV4A 4LLRA 3UEMA 1XOAA 3LQ7A 3EPTA 14GSA 2GSSA 2HYXA 1T3BA 3MYDA 1IYIA 3LW9A 4TW5A 1BG1A 1WPIA 2AJQB 4V1Ag 2WW0A 2AHEA 3ERFA 3GSTA 2H0GA 3GURA 2X99A 3FYGA 2WS2A 3C8EA 4PI2C 4PNGA 3GX0A 4YAPA 1ERTA 4ZB8A 3HJPA 3PR8A 4HJMA 3ZVJA 2J9HA 2P5QA 1A2LA 5JCWA 2X8HA 3QAWA 1O7UA 1ML6A 2CT6A 4G0LA 2DC5A 3C7MA 5A34A 2OBIA 3HMJG 4WR4A 1J0FA 1AW9A 3I6AA 1U88A 1F37A 2GQKA 3GKXA 4CW9A 3QFBC 4GXZA 2H76A 2MMAA 5A4VA 2IMFA 4QL9A 5HR1A 3BCKA 3M9JA 1HNBA 1GSYA 4AKXB 4IVFA 2VM2A 3CSJA 5G5FA 4ML1A 2F8AA 5AIXA 3IE3A 3IXRA 2M80A 3KP8A 4MPFA 1KBNA 3PINA 3ME7A 3L9VA 4GCIA 1BJXA 1X5DA 2GT5A 3FR9A 3ZZXA 4XRAA 3GL5A 4POKA 5J5NA 4K1FA 5F0GA 2O5VA 4DSRA 3A5WA 2PBJA 1M3IA 2B1KA 2CX3A 4O5QA 1F3BA 5J47A 2OACA 3QMXA 2OE3A 1TK0B 1YKCA 4ZB6A 1AQWA 5JWQB 2PERA 4ZL8A 2OT3A 3F63A 1ERWA 1A2JA 4K6XA 2WVZA 3I43A 2IIYA 1WWJA 1GNEA 5A4WA 1O81A 3ZITA 3D21A 4TR0A 3F0IA 4V1Ap 1TKDB 1XWGA 5COHA 3HHVA 4K5RA 4K7OA 3VPTA 2R0CA 2N5BA 2LNSA 4FYCA 5L71A 4J56E 2MMNA 1ZCPA 1PFOA 3C1RA 1Z5YE 2WRTA 3F6DA 6GSTA 2C0DA 4X1UA 2EIQA 1S3CA 1SVMA 4BWSA 4XCSA 3WGDA 2WZ9A 5A4UA 3JCML 3TJBA 5D96A 2VUPA 4PQ1A 2HSNB 2DJ3A 3IC4A 1SVLA 3H1NA 2H6XA 1FOVA 3A2VA 4BWQA 4WEYA 4HI7A 5IMZA 1DE2A 3KJYA 2VAFA 3APOA 3KMNA 4G10A 1NHOA 1V98A 1ST9A 2L4QA 2PU9C 1HNAA 4NHZA 4TR1A 1PKZA 1ZOFA 2O85A 4N10A 4RI6A 2QSIA 2G0FA 3QAVA 2HRNA 5KEJA 4F9ZA 3GHAA 2C80A 4HS1A 4LMVA 3SWLA 1M0UA 2V2GA 3TJKA 2I1UA 5FWGA 3UJ1A 2YJHA 3EC3A 2MBTA 3MWHA 3KH7A 3TDGA 4ZBDA 2H66A 5G30A 2IMDA 1XVWA 2BTOT 2LQQA 3FW2A 4EKZA 3R2QA 1A0RP 1TTZA 5IIZA 5KOWA 1IYHA 2C3TA 3WYWA 2VOCA 4OO5A 4MJCA 2I81A 4KH7A 3HZ4A 4FQUA 2LNTA 2CAIA 3DVWA 1GNWA 4BVYA 4OFNA 4DSSB 2VLVA 3TKSE 2FWHA 2R0GA 3ZVJD 3HVSA 3LGCA 1PL2A 3W6GA 1EP8A 1W89A 2WW2A 4MH2A 4OFMA 1K0BA 3IOSA 2B6MA 4X43A 2H30A 1ERVA 2JSZA 13GSA 2YZUA 4ZL9A 1A23A 2HZFA 1EEMA 1H4OA 4MABA 4HEA2 3IRAA 2E7PA 3W8JA 1JHBA 1UN2A 1K3YA 3P2AA 3GKNA 4MF5A 2L57A 3CYNA 2O87A 3DVXA 5D93A 4ZIJA 2VM1A 4O7HA 1K0CA 3HXSA 2HSYA 1KEBA 1SVOA 2KOKA 4JBBA 2E2MA 3EU3A 1DUGA 19GSA 3TKQA 4EIPA 2GQMA 3U5RE 2HRKB 3C73A 4N30A 1XBSA 1K0DA 2A2RA 2LS5A 3QPMA 4KNDA 4L5LA 1SK1A 2E0QA 2F8FA 5JCGA 5D9TA 4MJEA 2J23A 2L5OA 4GTUA 1U3IA 1XPVA 2FD3A 4XTSA 5IQYA 4KX4A 2FWFA 5ENUA 2VO4A 1VF1A 3CSHA 3ZIJA 5IMAA 3LG6A 4X0XA 4XS6A 2LRCA 4CY8A 1A8LA 1PQNA 3WT2A 4NAXA 2VD1A 1N2AA 3VPQA 2YOIA 1G0TA 1O73A 1K0OA 1OC9A 1B9XC 4OCEA 3CTGA 5DQYA 3LJRA 1R4WA 1E6BA 3FZ4A 3GTUA 3D0ZA 3ERGA 2DIYA 4TXVA 2H1LA 4YKGA 1FVKA 1CQHA 4WXTA 1V2AA 3RHBA 4AKHA 1MD3A 1O8WA 3PGTA 1T1VA 2F51A 1WRYA 3IK9A 1JFUA 3MDKA 4KDXA 4GWRA 5F05A 3DYRA 2ZCTA 4WF5A 1FOHA 1Z9HA 3WT1A 1U3AA 3LYKA 2R3XA 2GS3A 2YJ7A 2FUG2 4FIWA 1MDKA 2DMLA 2FNOA 4KSOA 2GGTA 1SK0A 4MCUA 2GZPA 1USBA 3QOUA 3GUSA 4CDOA 1AAZA 3DKSA 4IW9A 7GSSA 2GSRA 2GT6A 1RW1A 4ZBAA 5BMUB 1EWXA 1T4YA 2JU5A 4L8EA 1W4VA 3KD0A 1G7EA 1FVJA 3W8SA 2FLSA 4KF9A 1QGVA 3IDVA 2WDUA 3QAGA 2VCQA 5DBQA 2MZCA 9GSSA 3L9SA 3UMAA 1EP7A 4KAEA 3NIVA 3G9BA 3HKRA 2YV9A 1GTUA 3A2WA 4CY6A 1T4ZA 1K0NA 2MMZA 4PQIA 2JADA 1EV4A 1TXUA 1M3JA 2B3SA 2L59A 3TJGA 4O5RA 6GSYA 2WVXA 4POBA 2WB9A 2ES7A 4KA0A 1A24A 2VCVA 3F6FA 4V2LA 3H4KA 5IOXA 2AYTA 3EVIA 1K0AA 3HA9A 4GSTA 3D22A 2N5FA 4MLYA 1TW9A 1GWCA 4Q5QA 4OFTA 5CRWA 1XW6A 4RQRA 2B5XA 3RBTA 1OKTA 4WBRD 4G01A 1PSQA 1X9WB 1TRUA 4PHZC 2IPAA 3KTBA 4BVXA 3NOFA 2FA4A 2ALBA 4EVMA 2R0PA 1K3OA 1U6TA 3TKRA 5DAKB 2H72A 4LL1B 5CP1A 3GH6A 3ZLPA 4EDZA 1FB0A 4MNNA 3UBKA 3KP9A 2B5EA 4EIQA 4PQHA 3ZTLA 5IMFA 2IFQA 3TKPA 2OADA 1QK8A 1TU8A 3EINA 1OE7A 4YQMA 3IK7A 2PGTA 2FY6A 4NPBA 4K0GA 3GIXA 2PMTA 1JZWA 3WGEA 5DJLA 1FHEA 2XBIA 3Q18A 5J41A 4ZXGA 3MIXA 5H5SA 2GZZA 3BJ5A 1AC1A 3DEXA 1PKWA 1EV9A 4ILFA 18GSA 2X49A 2HRFA 1LBKA 3NZNA 4PTSA 4NXIA 1WOUA 1SK2A 1OC8A 1JLWA 2D2ZA 1XFLA 3M0FA 4H86A 3FR3A 5B7CA 1YF0A 6GSUA 4ZBBA 2P31A 3RGBC 1OVNA 2K18A 2K6VA 2HLSA 1X9MB 2WULA 5IPHA 2KLXA 1LU4A 2H70A 5ID2B 2JZTA 1YVLA 4IGJA 2A4VA 2GQLA 1X0RA 1XW9A 3RHCA 4FXYP 5ECRB 3KMOA 1V40A 3UOMA 1M2BA 3EURA 5CNWA 5ECOB 2NTOA 1AXDA 4BPYA 2B7KA 4XRDA 2I9HA 1GULA 4IQ1A 4I6XA 5HFIA 5GAND 1MD4A 3KXOA 3TKSA 3TCOA 4K7NA 5IO2A 4IJ3A 1SJIA 1YQ1A 4TRXA 1NHYA 3GX8A 4PX1A 2LSTA 4RQXA 4KGIA 1VF4A 1JZRA 2LQOA 4EDYA 2L6DA 1GTAA 4ML6A 2UZ8A 2H0IA 22GSA 1Y1UA 4F0CA 3GN3A 5C00A 3FZ5A 4BIKA 1SKWB 1V57A 1YDKA 4WR5A 1BYEA 3TJFA 5GSSA 2H1BA 2LJAA 3H79A 3LXZA 3IHGA 4POMA 1ZYNA 3ISOA 1BEDA 1M7TA 1R5PA 1K3LA 2KP2A 5A5KA 2C0FA 2VIMA 5KN3A 2HRAA 3VWVA 16GSA 4MDCA 5J4UA 5IO0A 4WETA 3BBYA 1TRWA 1FB6A 1ACVA 2NPBA 3D6IA 3ZFLA 2PUKC 4TR3A
chains in the Genus database with same CATH topology
3ED3A 5ECQB 2DJ0A 4V2MA 5J9BA 2NDOA 5ECHB 1WIKA 4K5SA 3M8NA 2AB6A 5IMCA 4QQ7A 2LRNA 1B4PA 3F4TA 1B8XA 1C72A 3F4RA 1A0FA 3DWVA 1ERUA 3FMWA 5J40A 4I5QA 1O85A 3IBHA 2EIRA 2I3YA 2X4AA 4Z2RA 4I2UA 2YP6A 4LA1A 2TIRA 1TJDA 17GSA 1F9MA 1EZKA 3VK9A 1SD9A 1TU7A 1GL8A 3RPPA 4ID0A 1SJZA 4QMKA 3E9JB 3IA1A 1DBYA 2JZRA 4GSSA 2GVPA 3O3TA 1TDIA 2VL2C 4OWYA 3HVVA 5IM9A 3LEFA 3FR6A 3CRUA 5JWOB 3APQA 1ZGNA 3EMPA 3D4MA 5A5HA 3CSIA 1Q98A 3O76A 3DXBA 2CAQA 3F3RA 1Z6MA 5CAXA 2HSMA 4JRRA 1E2YA 1GSSA 3GRXA 3ZYWA 1LJRA 5A34B 2EIOA 3TRXA 4J57E 5J9CA 5HFKA 1YZXA 4F2IA 2HZEA 1FW1A 5D9XA 1MEKA 4F0BA 2VD0A 1YEPA 3ZRDA 4JR4A 2FGXA 4GSNA 4JU5A 2WJUA 4LMWA 4OD7A 1M99A 2VKZG 5E4WA 3DGQA 3FKFA 5J4YA 4K9ZA 1Q4JA 1Z7PA 2H0HA 2DBCA 3MSZA 5J3RA 2QC7A 4MJBA 2C8UA 5IMVA 4NV5A 4O92A 3HJOA 4FH8A 1N8JA 3EWLA 2LKUA 3HCZA 1M9BA 1XWAA 1A8YA 2QA1A 3N5OA 5F06A 2RLIA 2F9SA 3CXGA 4TN8A 3FY7A 4IS0A 1ZZYA 1T00A 2RM5A 5B6MA 2R37A 4Z7XA 3C71A 1QXHA 3EE2A 1PL1A 3IAS2 1UC7A 5B8AA 5D9WA 1ZL9A 2VCZA 1SJ6A 2G2QA 2XC2A 2M72A 3FZAA 2GSQA 4GDFA 3GL3A 5ELAA 1NSWA 1F3AA 1EGOA 2B1LA 4XHMA 3FZ9A 3KIJA 3G7JA 1GSEA 3M1GA 2KUCA 5HR0A 2TRCP 4TR1B 3TOUA 5FHIA 5ABRA 4EE0A 5GZZB 3TRQA 4ECIA 2HI7A 3ZMKA 2B5YA 4P3YB 4AKIA 3MAKA 1AUCA 1TRSA 2PVQA 4MP4A 3R3EA 4TKYA 1G6WA 3UARA 4BL7A 1SYXA 2H6YA 3GFKA 2VLTA 3UAPA 3LXTA 3QFAC 2EC4A 3UBLA 3VURA 1YEXA 2LJRA 3BOAA 4K8MA 3WD6A 1QMVA 3TB2A 3KTLA 5IMDA 5E59A 3FEUA 2H73A 2VCTA 3QD9A 2KHPA 1PN0A 4D73A 3TRPA 4I97A 4I8BA 3TJJA 3VFIA 3I69A 1ZMAA 5ECLB 4BVYB 3L0HA 3GMFA 1FO5A 4TOPA 2IL3A 2HZEB 1XWCA 4POLA 1M2DA 2AAWA 1SU9A 2H71A 3GYKA 2YWMA 1PGTA 4O32A 5HFGA 2GSTA 2H1AA 4MZBA 4V2NA 1EOHA 1HYUA 2H1GA 4IBPA 2FCHA 3ZFBA 3ZIVA 3LYPA 5HQPA 3M9KA 3QDNA 2DSAA 3VLNA 1SENA 2R5GA 1FAAA 2PWJA 4HDEA 3LSZA 4PXOA 4USSA 4JE1A 1DE1A 4W66A 2JSYA 1SL1B 2C1YA 2F3MA 6GSXA 1JLVA 2NVLA 2O89A 1K0MA 1ZYEA 5AIVA 4ULXA 2V1MA 3P8WA 3CTFA 4MZCA 3GH9A 4BA7A 2GLRA 3RAZA 4GQCA 3D5JA 3A2XA 2LRTA 1H75A 3IR4A 5D73A 4CHSA 3ME8A 3IC8A 4JR6A 5CREA 1GTIA 1XVQA 2YWIA 4YKFA 5FT3A 2K8SA 4IP1A 2VLUA 2VCWA 4KCAA 4XS1A 2HT9A 2XPDA 1R26A 5G1KA 2JL4A 1GRXA 4AJ7A 2LV3A 1AQVA 1OC3A 3HYPA 4Z2UA 4PUAA 1FG4A 1U87A 4HZ4A 1I9DA 5CO3A 2ON5A 2YANA 3HVXA 2R4VA 1OC9B 1V58A 4RI7A 4HU7A 2C3NA 5KN1A 2IJYA 4XIHA 5KOXA 1OE8A 1XOBA 3GTUB 3H8QA 3P90A 2H6ZA 4IJIA 2GZYA 4EC0A 4DVCA 3CWGA 2LTKA 2L6CA 2C3QA 3E3EA 3K8NA 1J08A 3Q19A 3FRCA 5AGYA 1Z7RA 3KZQA 4GQFA 4KUNA 4PNFA 3BD2A 1SKSB 3IAM2 4NHWA 6GSVA 1M9AA 4A5PA 1Z3EA 2C0GA 3VWUA 2HSHA 1SL0B 3KCMA 1G6YA 1AIUA 1B9YC 4EF0A 2MBSA 4MF7A 1BG5A 4MK3A 3EYTA 4K2DA 4PURA 2JZSA 2K8VA 4EL1A 2R6KA 4WBJA 1GUKA 2XPEA 2HSNA 2A2PA 5CRGA 4G0IA 1YY7A 3FHKA 2OKAA 4ECCA 2V6KA 4ECJA 2V6OA 2REMA 5LCZA 1SKRB 1V9WA 3O6TA 4KCEA 5G31A 3DMLA 4N3ZA 2DLXA 5H5QA 3DRNA 1PRXA 2ON7A 4TR4A 1J9BA 4Q5RA 2H1DA 2YV7A 1XCCA 4HZ2A 4ISDA 4I2TA 5B6NA 1NW2A 2ZUPA 1VRSD 3J7Yb 2X64A 1THOA 3HDCA 4KSMA 4IHUA 1TP9A 2O7KA 5C04A 2IMIA 5ELGA 4E68A 5LD0A 4KB3A 2CVBA 5IPGA 5IOWA 2PPTA 4N11A 2L4CA 4DSSA 1BX9A 2JACA 2OA7A 4BVXB 4GF0A 5KN0A 2FWGA 5DJMA 2H74A 3L9UA 1ZYPA 5GAPD 2IMKA 5ECKB 1JZOA 2BMXA 2UV8G 1PMTA 5LNKe 3FK8A 1KNGA 3GA4A 2BJXA 1VGLA 4ZB7A 4AJ6A 2DMMA 2OJLA 3L78A 4PUFC 5DVBA 2C4JA 2IFQB 2RIIA 5GSTA 2YNXA 4QL7A 2OE1A 3VI5A 2YN1A 1XXUA 2YZHA 2LEGA 3TU3B 2CVKA 1M2AA 3HZ8A 2CQ9A 4K0NA 4EUYA 4MPGA 1ABAA 5AISA 2QKEA 3UL3A 2YWOA 4FYUA 2RM6A 3E0UA 4DSQA 4HOJA 5G2ZA 1TK8B 2MYGA 3PPUA 4LL4B 4IELA 1KTEA 5D8IA 2HRKA 4OMVA 1GUMA 2XHFA 4EXJA 4G19A 1GTBA 2QA2A 2HQTA 2EFDA 2TRXA 1R5AA 1XIYA 1BF5A 1Z6NA 2VL3A 1PX6A 5G1LA 4F03A 5HR2A 5A1NA 5DQSA 3SBCA 3M3MA 2R2JA 5G5EA 3V1WA 2RUEA 1VF3A 2DJKA 2X8CA 4K2XA 1TK5B 2H01A 1CQGA 4MJAA 2RUFA 2A2SA 1X5CA 3GSSA 1PX7A 12GSA 3F3QA 3GNJA 1S3DA 1PD21 1OYJA 4G0KA 4IP6A 1DSBA 3DIEA 2DIZA 2FA8A 4KE3A 2DJJA 1SL2B 4PGTA 3VWWA 1ILOA 3I9V2 2V32A 4KDYA 3KM6A 4WKWA 3AY8A 4IN0A 5ECNB 4WF4A 3WGXA 1EEJA 1F2EA 3DD3A 1NM3A 3APSA 2P5RA 3H93A 3KEBA 3GKMA 1RK4A 3IHQA 1BAYA 1TI3A 1YF1A 4KDUA 4L0WA 1TOFA 5BMUA 3UIWA 4HQSA 3EU4A 2H75A 2KP1A 1BQ7A 3A3TA 2DKHA 4MA9A 4TXOA 2M46A 5DALA 4ZILA 4ECBA 1XWKA 5DCGA 1O8XA 1QQ2A 2EFHA 2CVDA 3UVHA 2ZNMA 4E8HA 1QFNA 4F82A 4K7IA 2DKIA 1T8EB 4MF6A 1SD8A 5DDLA 4N0ZA 1EOGA 4X4JA 2CV4A 1B4QA 5CRDA 3Q74A 3U6VA 3BCIA 1WP0A 2N5AA 5ECIB 3RDWA 4Q5FA 3HD5A 2FHEA 1TRVA 5JCUA 3CMIA 1ZYQB 5EL8A 1HNCA 3QCPA 2MMOA 1HD2A 3J7Yk 2X8GA 5JWRB 2CX4A 2VL9A 1RQMA 5D9VA 5A1NB 2AUVA 4NWYA 4XS4A 2OBKA 3Q6OA 3GKKA 6GSSA 5EY6A 2C0EA 1TI1A 3A5IA 5AN1A 5KN2A 2L5LA 2CA8A 1GH2A 2IN3A 3OR5A 3VWXA 2YWNA 1Y25A 5BRTA 5DAKA 1EGRA 3D4TA 5H5RA 3TOTA 3P7XA 1XWBA 2VL2A 2OE0A 1I5GA 5A5HB 1G7OA 2VCXA 5CYYA 4HQZA 2IMEA 5ECMB 2HSMB 3KH9A 3N9JA 2HE3A 2QGVA 3UVTA 2CZ3A 2A4HA 3HY2A 2LJKA 1PA3A 4FO5A 2HXKA 5DCHA 1WE0A 2DJ1A 5F8BA 3LWAA 2NBSA 1XW5A 4G2EA 2DJ2A 4JZQA 3F8UA 5CRHA 4G9HA 1GUHA 1GSFA 3QR6A 4AF2A 4MH3A 6GSWA 1URMA 4HU9A 2CZ2A 1A2MA 1X9SB 1WJKA 2EFEA 2WGRA 4MMMA 5INYA 4AI6A 2YCDA 1UVZA 1OKDA 5B8BA 4IQAA 4TXOB 5DALB 5F07A 4AGSA 3US3A 4AKGA 3ZL5A 3F9UA 3HJMA 1JZDA 4Q5NA 5ID2A 1GSDA 1HQOA 1MTCA 4FYBA 4KW6A 4HUAA 5EPFA 3RPNA 4YQVA 1S3AA 2P0GA 2I4AA 1AQXA 4J2FA 3IPZA 4RUVA 2GDRA 10GSA 1O6JA 3LFLA 3L4NA 3TKSC 5J4VA 3KGKA 1MDIA 2PN8A 1YJ6A 4E8EA 4Z2TA 2B7JA 4AJ8A 3ERWA 5EVOA 4GRFA 3G7IA 1R7HA 4L5OA 4ACSA 3VI7A 1F6MC 1GP1A 1TXXA 5ECPB 1GLQA 4YAVA 4XS4B 1OAZA 2HFDA 2H19A 1Y6EA 1T7PB 3TGZA 2LUSA 2O8VB 3IV4A 4NV2A 4ICYA 2EFCA 5ECSA 8GSSA 2E2GA 1X5EA 3C1SA 1ON4A 2PVOC 4BL7B 2WCIA 4OO4A 1YKAA 4TVEA 4NMUA 4L0UA 3LORA 4HJ2A 1WMJA 4ZB9A 4N0VA 3GV1A 2Z9SA 4YQUA 4EO3A 2K9FA 2HNLA 3ZREA 2WFCA 3MNGA 1VF2A 4D73B 3S9FA 11GSA 3G7YA 4DEJA 20GSA 1THXA 4IKHA 2GTUA 2V41A 3ZMLA 1GLPA 3EMXA 4ZL7A 3CRTA 1SYRA 2XBQA 4GLTA 1B48A 4MZWA 1XZOA 2H8LA 3F4SA 4O5UA 4JEDA 1GSQA 3CBUA 2FWEA 2YPMA 1MDJA 5HR3A 3PH9A 1UA5A 4OCFA 3TUEA 1QUWA 1GSUA 1PN9A 2IWTA 1N25A 4YH2A 2AV4A 4LLRA 3UEMA 1XOAA 3LQ7A 3EPTA 14GSA 2GSSA 2HYXA 1T3BA 3MYDA 1IYIA 3LW9A 4TW5A 1BG1A 1WPIA 2AJQB 4V1Ag 2AHEA 3ERFA 3GSTA 2H0GA 3GURA 2X99A 3FYGA 2WS2A 3C8EA 4PNGA 3GX0A 4YAPA 1ERTA 4ZB8A 3HJPA 3PR8A 4HJMA 3ZVJA 2J9HA 2P5QA 1A2LA 5JCWA 2X8HA 3QAWA 1O7UA 1ML6A 2CT6A 4G0LA 2DC5A 3C7MA 5A34A 2OBIA 3HMJG 4WR4A 1J0FA 1AW9A 3I6AA 1U88A 1F37A 2GQKA 3GKXA 4CW9A 3QFBC 4GXZA 2H76A 2MMAA 5A4VA 2IMFA 4QL9A 5HR1A 3BCKA 3M9JA 1HNBA 1GSYA 4AKXB 4IVFA 2VM2A 3CSJA 5G5FA 4ML1A 2F8AA 5AIXA 3IE3A 3IXRA 2M80A 3KP8A 4MPFA 1KBNA 3PINA 3ME7A 3L9VA 4GCIA 1BJXA 1X5DA 2GT5A 3FR9A 3ZZXA 4XRAA 3GL5A 4POKA 5J5NA 4K1FA 5F0GA 2O5VA 4DSRA 3A5WA 2PBJA 2CX3A 2B1KA 4O5QA 1F3BA 5J47A 2OACA 3QMXA 2OE3A 1TK0B 1YKCA 4ZB6A 1AQWA 5JWQB 2PERA 4ZL8A 2OT3A 3F63A 1ERWA 1A2JA 4K6XA 3I43A 2IIYA 1WWJA 1GNEA 5A4WA 1O81A 3ZITA 3D21A 4TR0A 3F0IA 4V1Ap 1TKDB 1XWGA 5COHA 3HHVA 4K5RA 4K7OA 3VPTA 2R0CA 2N5BA 2LNSA 4FYCA 5L71A 4J56E 2MMNA 1ZCPA 3C1RA 1Z5YE 2WRTA 3F6DA 6GSTA 2C0DA 4X1UA 2EIQA 1S3CA 1SVMA 4BWSA 4XCSA 3WGDA 2WZ9A 5A4UA 3JCML 3TJBA 5D96A 2VUPA 4PQ1A 2HSNB 2DJ3A 3IC4A 1SVLA 3H1NA 2H6XA 1FOVA 3A2VA 4BWQA 4WEYA 4HI7A 5IMZA 1DE2A 3KJYA 2VAFA 3APOA 3KMNA 4G10A 1NHOA 1V98A 1ST9A 2L4QA 2PU9C 1HNAA 4NHZA 4TR1A 1PKZA 1ZOFA 2O85A 4N10A 4RI6A 2QSIA 2G0FA 3QAVA 2HRNA 5KEJA 4F9ZA 3GHAA 2C80A 4HS1A 4LMVA 3SWLA 1M0UA 2V2GA 3TJKA 2I1UA 5FWGA 3UJ1A 2YJHA 3EC3A 2MBTA 3MWHA 3KH7A 3TDGA 4ZBDA 2H66A 5G30A 2IMDA 1XVWA 2BTOT 2LQQA 3FW2A 4EKZA 3R2QA 1A0RP 1TTZA 5IIZA 5KOWA 1IYHA 2C3TA 3WYWA 2VOCA 4OO5A 4MJCA 2I81A 4KH7A 3HZ4A 4FQUA 2LNTA 2CAIA 3DVWA 1GNWA 4BVYA 4OFNA 4DSSB 2VLVA 3TKSE 2FWHA 2R0GA 3ZVJD 3HVSA 3LGCA 1PL2A 3W6GA 1EP8A 1W89A 4MH2A 4OFMA 1K0BA 3IOSA 2B6MA 4X43A 2H30A 1ERVA 2JSZA 13GSA 2YZUA 4ZL9A 1A23A 2HZFA 1EEMA 1H4OA 4MABA 4HEA2 3IRAA 2E7PA 3W8JA 1JHBA 1UN2A 1K3YA 3P2AA 3GKNA 4MF5A 2L57A 3CYNA 2O87A 3DVXA 5D93A 4ZIJA 2VM1A 4O7HA 1K0CA 3HXSA 2HSYA 1KEBA 1SVOA 2KOKA 4JBBA 2E2MA 3EU3A 1DUGA 19GSA 3TKQA 4EIPA 2GQMA 3U5RE 2HRKB 3C73A 4N30A 1XBSA 1K0DA 2A2RA 2LS5A 3QPMA 4KNDA 4L5LA 1SK1A 2E0QA 2F8FA 5JCGA 5D9TA 4MJEA 2J23A 2L5OA 4GTUA 1U3IA 1XPVA 2FD3A 4XTSA 5IQYA 4KX4A 2FWFA 5ENUA 2VO4A 1VF1A 3CSHA 3ZIJA 5IMAA 3LG6A 4X0XA 4XS6A 2LRCA 4CY8A 1A8LA 1PQNA 3WT2A 4NAXA 2VD1A 1N2AA 3VPQA 2YOIA 1G0TA 1O73A 1K0OA 1OC9A 1B9XC 4OCEA 3CTGA 5DQYA 3LJRA 1R4WA 1E6BA 3FZ4A 3GTUA 3D0ZA 3ERGA 2DIYA 4TXVA 2H1LA 4YKGA 1FVKA 1CQHA 4WXTA 1V2AA 3RHBA 4AKHA 1MD3A 1O8WA 3PGTA 1T1VA 2F51A 1WRYA 3IK9A 1JFUA 3MDKA 4KDXA 4GWRA 5F05A 3DYRA 2ZCTA 4WF5A 1FOHA 1Z9HA 3WT1A 1U3AA 3LYKA 2R3XA 2GS3A 2YJ7A 2FUG2 4FIWA 1MDKA 2DMLA 2FNOA 4KSOA 2GGTA 1SK0A 4MCUA 2GZPA 1USBA 3QOUA 3GUSA 4CDOA 1AAZA 3DKSA 4IW9A 7GSSA 2GSRA 2GT6A 1RW1A 4ZBAA 5BMUB 1EWXA 1T4YA 2JU5A 4L8EA 1W4VA 3KD0A 1G7EA 1FVJA 3W8SA 2FLSA 4KF9A 1QGVA 3IDVA 2WDUA 3QAGA 2VCQA 5DBQA 2MZCA 9GSSA 3L9SA 3UMAA 1EP7A 4KAEA 3NIVA 3G9BA 3HKRA 2YV9A 1GTUA 3A2WA 4CY6A 1T4ZA 1K0NA 2MMZA 4PQIA 2JADA 1EV4A 1TXUA 2B3SA 2L59A 3TJGA 4O5RA 6GSYA 4POBA 2WB9A 2ES7A 4KA0A 1A24A 2VCVA 3F6FA 4V2LA 3H4KA 5IOXA 2AYTA 3EVIA 1K0AA 3HA9A 4GSTA 3D22A 2N5FA 4MLYA 1TW9A 1GWCA 4Q5QA 4OFTA 5CRWA 1XW6A 4RQRA 2B5XA 3RBTA 1OKTA 4WBRD 4G01A 1PSQA 1X9WB 1TRUA 2IPAA 3KTBA 4BVXA 3NOFA 2FA4A 2ALBA 4EVMA 2R0PA 1K3OA 1U6TA 3TKRA 5DAKB 2H72A 4LL1B 5CP1A 3GH6A 3ZLPA 4EDZA 1FB0A 4MNNA 3UBKA 3KP9A 2B5EA 4EIQA 4PQHA 3ZTLA 5IMFA 2IFQA 3TKPA 2OADA 1QK8A 1TU8A 3EINA 1OE7A 4YQMA 3IK7A 2PGTA 2FY6A 4NPBA 4K0GA 3GIXA 2PMTA 1JZWA 3WGEA 5DJLA 1FHEA 2XBIA 3Q18A 5J41A 4ZXGA 3MIXA 5H5SA 2GZZA 3BJ5A 1AC1A 3DEXA 1PKWA 1EV9A 4ILFA 18GSA 2X49A 2HRFA 1LBKA 3NZNA 4PTSA 4NXIA 1WOUA 1SK2A 1OC8A 1JLWA 2D2ZA 1XFLA 3M0FA 4H86A 3FR3A 5B7CA 1YF0A 6GSUA 4ZBBA 2P31A 1OVNA 2K18A 2K6VA 2HLSA 1X9MB 2WULA 5IPHA 2KLXA 1LU4A 2H70A 5ID2B 2JZTA 1YVLA 4IGJA 2A4VA 2GQLA 1X0RA 1XW9A 3RHCA 5ECRB 3KMOA 1V40A 3UOMA 1M2BA 3EURA 5CNWA 5ECOB 2NTOA 1AXDA 4BPYA 2B7KA 4XRDA 2I9HA 1GULA 4IQ1A 4I6XA 5HFIA 5GAND 1MD4A 3KXOA 3TKSA 3TCOA 4K7NA 5IO2A 4IJ3A 1SJIA 1YQ1A 4TRXA 1NHYA 3GX8A 4PX1A 2LSTA 4RQXA 4KGIA 1VF4A 1JZRA 2LQOA 4EDYA 2L6DA 1GTAA 4ML6A 2UZ8A 2H0IA 22GSA 1Y1UA 4F0CA 3GN3A 5C00A 3FZ5A 1SKWB 1V57A 1YDKA 4WR5A 1BYEA 3TJFA 5GSSA 2H1BA 2LJAA 3H79A 3LXZA 3IHGA 4POMA 1ZYNA 3ISOA 1BEDA 1M7TA 1R5PA 1K3LA 2KP2A 5A5KA 2C0FA 2VIMA 5KN3A 2HRAA 3VWVA 16GSA 4MDCA 5J4UA 5IO0A 4WETA 3BBYA 1TRWA 1FB6A 1ACVA 2NPBA 3D6IA 3ZFLA 2PUKC 4TR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ED3 A;  5ECQ B;  2DJ0 A;  4V2M A;  5J9B A;  2NDO A;  5ECH B;  1WIK A;  3M8N A;  2AB6 A;  5IMC A;  4QQ7 A;  2LRN A;  1B4P A;  3F4T A;  1B8X A;  1C72 A;  3F4R A;  1A0F A;  3DWV A;  1ERU A;  4I5Q A;  1O85 A;  3IBH A;  2EIR A;  2I3Y A;  4I2U A;  2YP6 A;  4LA1 A;  2TIR A;  1TJD A;  17GS A;  1F9M A;  1EZK A;  3VK9 A;  1SD9 A;  1TU7 A;  1GL8 A;  3RPP A;  4ID0 A;  1SJZ A;  3E9J B;  3IA1 A;  1DBY A;  2JZR A;  4GSS A;  2GVP A;  3O3T A;  1TDI A;  2VL2 C;  4OWY A;  3HVV A;  5IM9 A;  3LEF A;  3FR6 A;  3CRU A;  5JWO B;  3APQ A;  1ZGN A;  3EMP A;  3D4M A;  3CSI A;  1Q98 A;  3O76 A;  3DXB A;  2CAQ A;  3F3R A;  1Z6M A;  5CAX A;  2HSM A;  4JRR A;  1E2Y A;  1GSS A;  3GRX A;  3ZYW A;  1LJR A;  2EIO A;  3TRX A;  4J57 E;  5J9C A;  5HFK A;  1YZX A;  4F2I A;  2HZE A;  1FW1 A;  5D9X A;  1MEK A;  4F0B A;  2VD0 A;  1YEP A;  3ZRD A;  4JR4 A;  2FGX A;  4GSN A;  4JU5 A;  2WJU A;  4LMW A;  4OD7 A;  1M99 A;  5E4W A;  3DGQ A;  3FKF A;  4K9Z A;  1Q4J A;  1Z7P A;  2H0H A;  2DBC A;  3MSZ A;  5J3R A;  2QC7 A;  4MJB A;  2C8U A;  5IMV A;  4NV5 A;  4O92 A;  3HJO A;  4FH8 A;  1N8J A;  3EWL A;  2LKU A;  3HCZ A;  1M9B A;  1XWA A;  1A8Y A;  3N5O A;  5F06 A;  2RLI A;  2F9S A;  3CXG A;  4TN8 A;  3FY7 A;  4IS0 A;  1ZZY A;  1T00 A;  2RM5 A;  5B6M A;  2R37 A;  4Z7X A;  3C71 A;  1QXH A;  3EE2 A;  1PL1 A;  3IAS 2;  1UC7 A;  5B8A A;  5D9W A;  1ZL9 A;  2VCZ A;  1SJ6 A;  2G2Q A;  2XC2 A;  2M72 A;  3FZA A;  2GSQ A;  3GL3 A;  5ELA A;  1NSW A;  1F3A A;  1EGO A;  2B1L A;  4XHM A;  3FZ9 A;  3KIJ A;  3G7J A;  1GSE A;  3M1G A;  2KUC A;  5HR0 A;  2TRC P;  4TR1 B;  3TOU A;  5FHI A;  5ABR A;  4EE0 A;  5GZZ B;  3TRQ A;  4ECI A;  2HI7 A;  3ZMK A;  2B5Y A;  4P3Y B;  3MAK A;  1AUC A;  1TRS A;  2PVQ A;  4MP4 A;  3R3E A;  4TKY A;  1G6W A;  3UAR A;  4BL7 A;  1SYX A;  2H6Y A;  3GFK A;  2VLT A;  3UAP A;  3LXT A;  3QFA C;  2EC4 A;  3UBL A;  3VUR A;  1YEX A;  2LJR A;  3BOA A;  4K8M A;  3WD6 A;  1QMV A;  3TB2 A;  3KTL A;  5IMD A;  5E59 A;  3FEU A;  2H73 A;  2VCT A;  3QD9 A;  2KHP A;  4D73 A;  3TRP A;  4I97 A;  4I8B A;  3TJJ A;  3VFI A;  3I69 A;  1ZMA A;  5ECL B;  4BVY B;  3L0H A;  3GMF A;  1FO5 A;  4TOP A;  2IL3 A;  2HZE B;  1XWC A;  4POL A;  1M2D A;  2AAW A;  1SU9 A;  2H71 A;  3GYK A;  2YWM A;  1PGT A;  4O32 A;  5HFG A;  2GST A;  2H1A A;  4MZB A;  4V2N A;  1EOH A;  1HYU A;  2H1G A;  4IBP A;  2FCH A;  3ZFB A;  3ZIV A;  3LYP A;  5HQP A;  3M9K A;  3QDN A;  2DSA A;  3VLN A;  1SEN A;  2R5G A;  1FAA A;  2PWJ A;  4HDE A;  3LSZ A;  4PXO A;  4USS A;  4JE1 A;  1DE1 A;  2JSY A;  1SL1 B;  2C1Y A;  2F3M A;  6GSX A;  1JLV A;  2NVL A;  2O89 A;  1K0M A;  1ZYE A;  5AIV A;  4ULX A;  2V1M A;  3P8W A;  3CTF A;  4MZC A;  3GH9 A;  4BA7 A;  2GLR A;  3RAZ A;  4GQC A;  3D5J A;  3A2X A;  2LRT A;  1H75 A;  3IR4 A;  5D73 A;  4CHS A;  3ME8 A;  3IC8 A;  4JR6 A;  5CRE A;  1GTI A;  1XVQ A;  2YWI A;  5FT3 A;  2K8S A;  4IP1 A;  2VLU A;  2VCW A;  4KCA A;  4XS1 A;  2HT9 A;  2XPD A;  1R26 A;  5G1K A;  2JL4 A;  1GRX A;  4AJ7 A;  2LV3 A;  1AQV A;  1OC3 A;  3HYP A;  4PUA A;  1FG4 A;  1U87 A;  4HZ4 A;  1I9D A;  5CO3 A;  2ON5 A;  2YAN A;  3HVX A;  2R4V A;  1OC9 B;  1V58 A;  4RI7 A;  4HU7 A;  2C3N A;  5KN1 A;  2IJY A;  4XIH A;  1OE8 A;  1XOB A;  3GTU B;  3H8Q A;  3P90 A;  2H6Z A;  4IJI A;  2GZY A;  4EC0 A;  4DVC A;  2LTK A;  2L6C A;  2C3Q A;  3E3E A;  3K8N A;  1J08 A;  3Q19 A;  3FRC A;  5AGY A;  1Z7R A;  3KZQ A;  4GQF A;  4KUN A;  4PNF A;  3BD2 A;  1SKS B;  3IAM 2;  4NHW A;  6GSV A;  1M9A A;  1Z3E A;  2C0G A;  3VWU A;  2HSH A;  1SL0 B;  3KCM A;  1G6Y A;  1AIU A;  1B9Y C;  4EF0 A;  2MBS A;  4MF7 A;  1BG5 A;  4MK3 A;  3EYT A;  4K2D A;  4PUR A;  2JZS A;  2K8V A;  4EL1 A;  2R6K A;  4WBJ A;  1GUK A;  2XPE A;  5CRG A;  4G0I A;  1YY7 A;  3FHK A;  2OKA A;  4ECC A;  2V6K A;  4ECJ A;  2V6O A;  2REM A;  5LCZ A;  1SKR B;  1V9W A;  3O6T A;  4KCE A;  5G31 A;  3DML A;  2DLX A;  5H5Q A;  3DRN A;  1PRX A;  2ON7 A;  4TR4 A;  1J9B A;  4Q5R A;  2H1D A;  2YV7 A;  1XCC A;  4HZ2 A;  4ISD A;  4I2T A;  5B6N A;  1NW2 A;  2ZUP A;  1VRS D;  3J7Y b;  2X64 A;  1THO A;  3HDC A;  4KSM A;  4IHU A;  1TP9 A;  2O7K A;  5C04 A;  2IMI A;  5ELG A;  5LD0 A;  4KB3 A;  2CVB A;  5IPG A;  5IOW A;  2PPT A;  4N11 A;  2L4C A;  4DSS A;  1BX9 A;  2JAC A;  2OA7 A;  4BVX B;  4GF0 A;  5KN0 A;  2FWG A;  5DJM A;  2H74 A;  3L9U A;  5GAP D;  2IMK A;  5ECK B;  1JZO A;  2BMX A;  1PMT A;  5LNK e;  3FK8 A;  1KNG A;  3GA4 A;  2BJX A;  1VGL A;  4AJ6 A;  2DMM A;  2OJL A;  3L78 A;  4PUF C;  5DVB A;  2C4J A;  2IFQ B;  2RII A;  5GST A;  2YNX A;  4QL7 A;  2OE1 A;  3VI5 A;  2YN1 A;  1XXU A;  2YZH A;  2LEG A;  2CVK A;  1M2A A;  3HZ8 A;  2CQ9 A;  4K0N A;  4EUY A;  4MPG A;  1ABA A;  5AIS A;  2QKE A;  3UL3 A;  2YWO A;  4FYU A;  2RM6 A;  3E0U A;  4DSQ A;  4HOJ A;  5G2Z A;  1TK8 B;  2MYG A;  3PPU A;  4LL4 B;  4IEL A;  1KTE A;  5D8I A;  2HRK A;  4OMV A;  1GUM A;  2XHF A;  4EXJ A;  4G19 A;  1GTB A;  2HQT A;  2TRX A;  1R5A A;  1XIY A;  1Z6N A;  2VL3 A;  1PX6 A;  5G1L A;  4F03 A;  5HR2 A;  5DQS A;  3SBC A;  3M3M A;  2R2J A;  5G5E A;  3V1W A;  2RUE A;  1VF3 A;  2DJK A;  2X8C A;  1TK5 B;  2H01 A;  1CQG A;  4MJA A;  2RUF A;  2A2S A;  1X5C A;  3GSS A;  1PX7 A;  12GS A;  3F3Q A;  3GNJ A;  1S3D A;  1PD2 1;  1OYJ A;  4G0K A;  4IP6 A;  1DSB A;  3DIE A;  2DIZ A;  2FA8 A;  4KE3 A;  2DJJ A;  1SL2 B;  4PGT A;  3VWW A;  1ILO A;  3I9V 2;  2V32 A;  4KDY A;  3KM6 A;  4WKW A;  3AY8 A;  4IN0 A;  5ECN B;  4WF4 A;  3WGX A;  1EEJ A;  1F2E A;  3DD3 A;  1NM3 A;  3APS A;  2P5R A;  3H93 A;  3KEB A;  3GKM A;  1RK4 A;  3IHQ A;  1BAY A;  1TI3 A;  1YF1 A;  4KDU A;  4L0W A;  1TOF A;  5BMU A;  3UIW A;  4HQS A;  3EU4 A;  2H75 A;  2KP1 A;  1BQ7 A;  3A3T A;  4MA9 A;  4TXO A;  2M46 A;  5DAL A;  4ZIL A;  4ECB A;  1XWK A;  5DCG A;  1O8X A;  1QQ2 A;  2CVD A;  3UVH A;  2ZNM A;  4E8H A;  1QFN A;  4F82 A;  4K7I A;  1T8E B;  4MF6 A;  1SD8 A;  5DDL A;  4N0Z A;  1EOG A;  2CV4 A;  1B4Q A;  5CRD A;  3Q74 A;  3U6V A;  3BCI A;  1WP0 A;  2N5A A;  5ECI B;  3RDW A;  4Q5F A;  3HD5 A;  2FHE A;  1TRV A;  5JCU A;  3CMI A;  1ZYQ B;  5EL8 A;  1HNC A;  3QCP A;  2MMO A;  1HD2 A;  3J7Y k;  2X8G A;  5JWR B;  2CX4 A;  2VL9 A;  1RQM A;  5D9V A;  2AUV A;  4NWY A;  4XS4 A;  2OBK A;  3Q6O A;  3GKK A;  6GSS A;  5EY6 A;  2C0E A;  1TI1 A;  5AN1 A;  5KN2 A;  2L5L A;  2CA8 A;  1GH2 A;  2IN3 A;  3OR5 A;  3VWX A;  2YWN A;  1Y25 A;  5DAK A;  1EGR A;  3D4T A;  5H5R A;  3TOT A;  3P7X A;  1XWB A;  2VL2 A;  2OE0 A;  1I5G A;  1G7O A;  2VCX A;  5CYY A;  4HQZ A;  2IME A;  5ECM B;  2HSM B;  3KH9 A;  3N9J A;  2HE3 A;  2QGV A;  3UVT A;  2CZ3 A;  3HY2 A;  2LJK A;  1PA3 A;  4FO5 A;  2HXK A;  5DCH A;  1WE0 A;  2DJ1 A;  5F8B A;  3LWA A;  2NBS A;  1XW5 A;  4G2E A;  2DJ2 A;  4JZQ A;  3F8U A;  5CRH A;  4G9H A;  1GUH A;  1GSF A;  3QR6 A;  4AF2 A;  4MH3 A;  6GSW A;  1URM A;  4HU9 A;  2CZ2 A;  1A2M A;  1X9S B;  1WJK A;  2WGR A;  4MMM A;  5INY A;  2YCD A;  1UVZ A;  1OKD A;  5B8B A;  4IQA A;  4TXO B;  5DAL B;  5F07 A;  4AGS A;  3US3 A;  3ZL5 A;  3F9U A;  3HJM A;  1JZD A;  4Q5N A;  5ID2 A;  1GSD A;  1HQO A;  1MTC A;  4FYB A;  4KW6 A;  4HUA A;  5EPF A;  3RPN A;  4YQV A;  1S3A A;  2P0G A;  2I4A A;  1AQX A;  4J2F A;  3IPZ A;  4RUV A;  2GDR A;  10GS A;  1O6J A;  3LFL A;  3L4N A;  3TKS C;  3KGK A;  1MDI A;  2PN8 A;  1YJ6 A;  4E8E A;  2B7J A;  4AJ8 A;  3ERW A;  5EVO A;  4GRF A;  3G7I A;  1R7H A;  4L5O A;  4ACS A;  3VI7 A;  1F6M C;  1GP1 A;  1TXX A;  5ECP B;  1GLQ A;  4YAV A;  4XS4 B;  1OAZ A;  2HFD A;  2H19 A;  1Y6E A;  1T7P B;  3TGZ A;  2LUS A;  2O8V B;  3IV4 A;  4NV2 A;  5ECS A;  8GSS A;  2E2G A;  1X5E A;  3C1S A;  1ON4 A;  2PVO C;  4BL7 B;  2WCI A;  4OO4 A;  1YKA A;  4TVE A;  4NMU A;  4L0U A;  3LOR A;  4HJ2 A;  1WMJ A;  4ZB9 A;  4N0V A;  3GV1 A;  2Z9S A;  4YQU A;  4EO3 A;  2K9F A;  2HNL A;  3ZRE A;  2WFC A;  3MNG A;  1VF2 A;  4D73 B;  3S9F A;  11GS A;  3G7Y A;  4DEJ A;  20GS A;  1THX A;  4IKH A;  2GTU A;  2V41 A;  3ZML A;  1GLP A;  3EMX A;  4ZL7 A;  3CRT A;  1SYR A;  2XBQ A;  4GLT A;  1B48 A;  4MZW A;  1XZO A;  2H8L A;  3F4S A;  4JED A;  1GSQ A;  3CBU A;  2FWE A;  2YPM A;  1MDJ A;  5HR3 A;  3PH9 A;  1UA5 A;  4OCF A;  3TUE A;  1QUW A;  1GSU A;  1PN9 A;  2IWT A;  4YH2 A;  2AV4 A;  4LLR A;  3UEM A;  1XOA A;  3LQ7 A;  14GS A;  2GSS A;  2HYX A;  1T3B A;  1IYI A;  4TW5 A;  1WPI A;  2AJQ B;  4V1A g;  2AHE A;  3ERF A;  3GST A;  2H0G A;  3GUR A;  2X99 A;  3FYG A;  2WS2 A;  3C8E A;  4PNG A;  3GX0 A;  4YAP A;  1ERT A;  4ZB8 A;  3HJP A;  3PR8 A;  4HJM A;  3ZVJ A;  2J9H A;  2P5Q A;  1A2L A;  5JCW A;  2X8H A;  3QAW A;  1O7U A;  1ML6 A;  2CT6 A;  4G0L A;  2DC5 A;  3C7M A;  2OBI A;  4WR4 A;  1J0F A;  1AW9 A;  3I6A A;  1U88 A;  1F37 A;  2GQK A;  3GKX A;  4CW9 A;  3QFB C;  4GXZ A;  2H76 A;  2MMA A;  5A4V A;  2IMF A;  4QL9 A;  5HR1 A;  3BCK A;  3M9J A;  1HNB A;  1GSY A;  4IVF A;  2VM2 A;  3CSJ A;  5G5F A;  4ML1 A;  2F8A A;  5AIX A;  3IE3 A;  3IXR A;  2M80 A;  3KP8 A;  4MPF A;  1KBN A;  3PIN A;  3ME7 A;  3L9V A;  4GCI A;  1BJX A;  1X5D A;  2GT5 A;  3FR9 A;  3ZZX A;  4XRA A;  3GL5 A;  4POK A;  5J5N A;  4K1F A;  5F0G A;  4DSR A;  3A5W A;  2PBJ A;  2CX3 A;  2B1K A;  1F3B A;  2OAC A;  3QMX A;  2OE3 A;  1TK0 B;  1YKC A;  4ZB6 A;  1AQW A;  5JWQ B;  2PER A;  4ZL8 A;  3F63 A;  1ERW A;  1A2J A;  4K6X A;  3I43 A;  2IIY A;  1WWJ A;  1GNE A;  5A4W A;  1O81 A;  3ZIT A;  3D21 A;  4TR0 A;  3F0I A;  4V1A p;  1TKD B;  1XWG A;  5COH A;  3HHV A;  4K7O A;  3VPT A;  2N5B A;  2LNS A;  4FYC A;  5L71 A;  4J56 E;  2MMN A;  1ZCP A;  3C1R A;  1Z5Y E;  2WRT A;  3F6D A;  6GST A;  2C0D A;  4X1U A;  2EIQ A;  1S3C A;  4BWS A;  4XCS A;  3WGD A;  2WZ9 A;  5A4U A;  3JCM L;  3TJB A;  5D96 A;  2VUP A;  4PQ1 A;  2HSN B;  2DJ3 A;  3IC4 A;  2H6X A;  3H1N A;  1FOV A;  3A2V A;  4BWQ A;  4WEY A;  4HI7 A;  5IMZ A;  1DE2 A;  3KJY A;  2VAF A;  3APO A;  3KMN A;  4G10 A;  1NHO A;  1V98 A;  1ST9 A;  2L4Q A;  2PU9 C;  1HNA A;  4NHZ A;  4TR1 A;  1PKZ A;  1ZOF A;  2O85 A;  4N10 A;  4RI6 A;  2QSI A;  2G0F A;  3QAV A;  2HRN A;  5KEJ A;  4F9Z A;  3GHA A;  2C80 A;  4HS1 A;  4LMV A;  3SWL A;  1M0U A;  2V2G A;  3TJK A;  2I1U A;  5FWG A;  3UJ1 A;  2YJH A;  3EC3 A;  2MBT A;  3MWH A;  3KH7 A;  3TDG A;  4ZBD A;  2H66 A;  5G30 A;  2IMD A;  1XVW A;  2BTO T;  2LQQ A;  3FW2 A;  4EKZ A;  3R2Q A;  1A0R P;  1TTZ A;  5IIZ A;  1IYH A;  2C3T A;  3WYW A;  2VOC A;  4OO5 A;  4MJC A;  2I81 A;  4KH7 A;  3HZ4 A;  4FQU A;  2LNT A;  2CAI A;  3DVW A;  1GNW A;  4BVY A;  4OFN A;  4DSS B;  2VLV A;  3TKS E;  2FWH A;  3ZVJ D;  3HVS A;  3LGC A;  1PL2 A;  3W6G A;  1EP8 A;  1W89 A;  4MH2 A;  4OFM A;  1K0B A;  3IOS A;  2B6M A;  4X43 A;  2H30 A;  1ERV A;  2JSZ A;  13GS A;  2YZU A;  4ZL9 A;  1A23 A;  2HZF A;  1EEM A;  1H4O A;  4MAB A;  4HEA 2;  3IRA A;  2E7P A;  3W8J A;  1JHB A;  1UN2 A;  1K3Y A;  3P2A A;  3GKN A;  4MF5 A;  2L57 A;  3CYN A;  2O87 A;  3DVX A;  5D93 A;  4ZIJ A;  2VM1 A;  4O7H A;  1K0C A;  3HXS A;  2HSY A;  1KEB A;  2KOK A;  4JBB A;  2E2M A;  3EU3 A;  1DUG A;  19GS A;  3TKQ A;  2GQM A;  3U5R E;  2HRK B;  3C73 A;  4N30 A;  1XBS A;  1K0D A;  2A2R A;  2LS5 A;  3QPM A;  4KND A;  4L5L A;  1SK1 A;  2E0Q A;  2F8F A;  5JCG A;  5D9T A;  4MJE A;  2J23 A;  2L5O A;  4GTU A;  1U3I A;  1XPV A;  2FD3 A;  4XTS A;  5IQY A;  4KX4 A;  2FWF A;  5ENU A;  2VO4 A;  1VF1 A;  3CSH A;  3ZIJ A;  5IMA A;  3LG6 A;  4X0X A;  4XS6 A;  2LRC A;  1A8L A;  1PQN A;  3WT2 A;  4NAX A;  2VD1 A;  1N2A A;  3VPQ A;  2YOI A;  1G0T A;  1O73 A;  1K0O A;  1OC9 A;  1B9X C;  4OCE A;  3CTG A;  5DQY A;  3LJR A;  1R4W A;  1E6B A;  3FZ4 A;  3GTU A;  3D0Z A;  3ERG A;  2DIY A;  4TXV A;  1FVK A;  1CQH A;  4WXT A;  1V2A A;  3RHB A;  1MD3 A;  1O8W A;  3PGT A;  1T1V A;  2F51 A;  1WRY A;  3IK9 A;  1JFU A;  3MDK A;  4KDX A;  4GWR A;  5F05 A;  3DYR A;  2ZCT A;  4WF5 A;  1Z9H A;  3WT1 A;  1U3A A;  3LYK A;  2R3X A;  2GS3 A;  2YJ7 A;  2FUG 2;  4FIW A;  1MDK A;  2DML A;  2FNO A;  4KSO A;  2GGT A;  1SK0 A;  4MCU A;  2GZP A;  1USB A;  3QOU A;  3GUS A;  4CDO A;  1AAZ A;  3DKS A;  4IW9 A;  7GSS A;  2GSR A;  2GT6 A;  1RW1 A;  4ZBA A;  1EWX A;  1T4Y A;  2JU5 A;  4L8E A;  1W4V A;  3KD0 A;  1G7E A;  1FVJ A;  3W8S A;  2FLS A;  4KF9 A;  1QGV A;  3IDV A;  2WDU A;  3QAG A;  2VCQ A;  5DBQ A;  2MZC A;  9GSS A;  3L9S A;  3UMA A;  1EP7 A;  4KAE A;  3NIV A;  3G9B A;  3HKR A;  2YV9 A;  1GTU A;  3A2W A;  1T4Z A;  1K0N A;  2MMZ A;  4PQI A;  2JAD A;  1EV4 A;  2B3S A;  2L59 A;  3TJG A;  4O5R A;  6GSY A;  4POB A;  2WB9 A;  2ES7 A;  4KA0 A;  1A24 A;  2VCV A;  3F6F A;  4V2L A;  3H4K A;  5IOX A;  2AYT A;  3EVI A;  1K0A A;  3HA9 A;  4GST A;  3D22 A;  2N5F A;  4MLY A;  1TW9 A;  1GWC A;  4Q5Q A;  4OFT A;  5CRW A;  1XW6 A;  4RQR A;  2B5X A;  3RBT A;  1OKT A;  4WBR D;  1PSQ A;  1X9W B;  1TRU A;  2IPA A;  3KTB A;  4BVX A;  3NOF A;  2FA4 A;  2ALB A;  4EVM A;  1K3O A;  1U6T A;  3TKR A;  5DAK B;  2H72 A;  4LL1 B;  5CP1 A;  3GH6 A;  3ZLP A;  4EDZ A;  1FB0 A;  3UBK A;  3KP9 A;  2B5E A;  4PQH A;  3ZTL A;  5IMF A;  2IFQ A;  3TKP A;  2OAD A;  1QK8 A;  1TU8 A;  3EIN A;  1OE7 A;  4YQM A;  3IK7 A;  2PGT A;  2FY6 A;  4NPB A;  4K0G A;  3GIX A;  2PMT A;  1JZW A;  3WGE A;  5DJL A;  1FHE A;  2XBI A;  3Q18 A;  5J41 A;  4ZXG A;  5H5S A;  2GZZ A;  3BJ5 A;  1AC1 A;  3DEX A;  1PKW A;  1EV9 A;  4ILF A;  18GS A;  2HRF A;  1LBK A;  3NZN A;  4PTS A;  4NXI A;  1WOU A;  1SK2 A;  1OC8 A;  1JLW A;  2D2Z A;  1XFL A;  3M0F A;  4H86 A;  3FR3 A;  5B7C A;  1YF0 A;  6GSU A;  4ZBB A;  2P31 A;  1OVN A;  2K18 A;  2K6V A;  2HLS A;  1X9M B;  2WUL A;  5IPH A;  2KLX A;  1LU4 A;  2H70 A;  5ID2 B;  2JZT A;  4IGJ A;  2A4V A;  2GQL A;  1X0R A;  1XW9 A;  3RHC A;  5ECR B;  3KMO A;  1V40 A;  3UOM A;  1M2B A;  3EUR A;  5CNW A;  5ECO B;  2NTO A;  1AXD A;  4BPY A;  2B7K A;  4XRD A;  2I9H A;  1GUL A;  4IQ1 A;  4I6X A;  5HFI A;  5GAN D;  1MD4 A;  3KXO A;  3TKS A;  3TCO A;  4K7N A;  5IO2 A;  4IJ3 A;  1SJI A;  1YQ1 A;  4TRX A;  1NHY A;  3GX8 A;  4PX1 A;  2LST A;  4RQX A;  4KGI A;  1VF4 A;  1JZR A;  2LQO A;  4EDY A;  2L6D A;  1GTA A;  4ML6 A;  2UZ8 A;  2H0I A;  22GS A;  4F0C A;  3GN3 A;  5C00 A;  3FZ5 A;  1SKW B;  1V57 A;  1YDK A;  4WR5 A;  1BYE A;  3TJF A;  5GSS A;  2H1B A;  2LJA A;  3H79 A;  3LXZ A;  4POM A;  3ISO A;  1BED A;  1M7T A;  1R5P A;  1K3L A;  2KP2 A;  5A5K A;  2C0F A;  2VIM A;  5KN3 A;  2HRA A;  3VWV A;  16GS A;  4MDC A;  5J4U A;  5IO0 A;  4WET A;  3BBY A;  1TRW A;  1FB6 A;  1ACV A;  2NPB A;  3D6I A;  3ZFL A;  2PUK C;  4TR3 A; 
#chains in the Genus database with same CATH topology
 3ED3 A;  5ECQ B;  2DJ0 A;  4V2M A;  5J9B A;  2NDO A;  5ECH B;  1WIK A;  4K5S A;  3M8N A;  2AB6 A;  5IMC A;  4QQ7 A;  2LRN A;  1B4P A;  3F4T A;  1B8X A;  1C72 A;  3F4R A;  1A0F A;  3DWV A;  1ERU A;  3FMW A;  5J40 A;  4I5Q A;  1O85 A;  3IBH A;  2EIR A;  2I3Y A;  2X4A A;  4Z2R A;  4I2U A;  2YP6 A;  4LA1 A;  2TIR A;  1TJD A;  17GS A;  1F9M A;  1EZK A;  3VK9 A;  1SD9 A;  1TU7 A;  1GL8 A;  3RPP A;  4ID0 A;  1SJZ A;  4QMK A;  3E9J B;  3IA1 A;  1DBY A;  2JZR A;  4GSS A;  2GVP A;  3O3T A;  1TDI A;  2VL2 C;  4OWY A;  3HVV A;  5IM9 A;  3LEF A;  3FR6 A;  3CRU A;  5JWO B;  3APQ A;  1ZGN A;  3EMP A;  3D4M A;  5A5H A;  3CSI A;  1Q98 A;  3O76 A;  3DXB A;  2CAQ A;  3F3R A;  1Z6M A;  5CAX A;  2HSM A;  4JRR A;  1E2Y A;  1GSS A;  3GRX A;  3ZYW A;  1LJR A;  5A34 B;  2EIO A;  3TRX A;  4J57 E;  5J9C A;  5HFK A;  1YZX A;  4F2I A;  2HZE A;  1FW1 A;  5D9X A;  1MEK A;  4F0B A;  2VD0 A;  1YEP A;  3ZRD A;  4JR4 A;  2FGX A;  4GSN A;  4JU5 A;  2WJU A;  4LMW A;  4OD7 A;  1M99 A;  2VKZ G;  5E4W A;  3DGQ A;  3FKF A;  5J4Y A;  4K9Z A;  1Q4J A;  1Z7P A;  2H0H A;  2DBC A;  3MSZ A;  5J3R A;  2QC7 A;  4MJB A;  2C8U A;  5IMV A;  4NV5 A;  4O92 A;  3HJO A;  4FH8 A;  1N8J A;  3EWL A;  2LKU A;  3HCZ A;  1M9B A;  1XWA A;  1A8Y A;  2QA1 A;  3N5O A;  2O3E A;  5F06 A;  2RLI A;  2F9S A;  3CXG A;  4TN8 A;  3FY7 A;  4IS0 A;  1ZZY A;  1T00 A;  2RM5 A;  5B6M A;  2R37 A;  4Z7X A;  3C71 A;  1QXH A;  3EE2 A;  3HVN A;  2WVY A;  1PL1 A;  3IAS 2;  1UC7 A;  5B8A A;  5D9W A;  1ZL9 A;  2VCZ A;  1SJ6 A;  2G2Q A;  2XC2 A;  2M72 A;  3FZA A;  2GSQ A;  4GDF A;  3GL3 A;  5ELA A;  1NSW A;  1F3A A;  1EGO A;  2B1L A;  4XHM A;  3FZ9 A;  3KIJ A;  3G7J A;  1GSE A;  3M1G A;  2KUC A;  5HR0 A;  2TRC P;  4TR1 B;  3TOU A;  5FHI A;  5ABR A;  4EE0 A;  5GZZ B;  3TRQ A;  4ECI A;  2HI7 A;  3ZMK A;  2B5Y A;  4P3Y B;  4AKI A;  3MAK A;  1AUC A;  1TRS A;  2PVQ A;  4MP4 A;  3R3E A;  4TKY A;  1G6W A;  3UAR A;  4BL7 A;  1SYX A;  2H6Y A;  3GFK A;  2VLT A;  3UAP A;  3LXT A;  3QFA C;  2EC4 A;  3UBL A;  3VUR A;  1YEX A;  2LJR A;  3BOA A;  4K8M A;  3WD6 A;  1QMV A;  3TB2 A;  3KTL A;  5IMD A;  5E59 A;  3FEU A;  2H73 A;  2VCT A;  3QD9 A;  2KHP A;  1PN0 A;  4D73 A;  3TRP A;  4I97 A;  4I8B A;  3TJJ A;  3VFI A;  3I69 A;  1ZMA A;  5ECL B;  4BVY B;  3L0H A;  3GMF A;  1FO5 A;  4TOP A;  2IL3 A;  2HZE B;  1XWC A;  4POL A;  1M2D A;  2AAW A;  1SU9 A;  2H71 A;  3GYK A;  2YWM A;  1PGT A;  4O32 A;  5HFG A;  2GST A;  2H1A A;  3RFR C;  4MZB A;  4V2N A;  1EOH A;  1HYU A;  2H1G A;  4IBP A;  2FCH A;  3ZFB A;  3ZIV A;  3LYP A;  5HQP A;  3M9K A;  3QDN A;  2DSA A;  3VLN A;  1SEN A;  2R5G A;  1FAA A;  2PWJ A;  4HDE A;  3LSZ A;  4PXO A;  4USS A;  4JE1 A;  1DE1 A;  4W66 A;  2JSY A;  1SL1 B;  2C1Y A;  2F3M A;  6GSX A;  1JLV A;  2NVL A;  2O89 A;  1K0M A;  1ZYE A;  5AIV A;  4ULX A;  2V1M A;  3P8W A;  3CTF A;  4MZC A;  3GH9 A;  4BA7 A;  2GLR A;  3RAZ A;  4GQC A;  3D5J A;  3A2X A;  2LRT A;  1H75 A;  3IR4 A;  5D73 A;  4CHS A;  3ME8 A;  3IC8 A;  4JR6 A;  5CRE A;  1GTI A;  1XVQ A;  2YWI A;  4YKF A;  5FT3 A;  2K8S A;  4IP1 A;  2VLU A;  2VCW A;  4KCA A;  4XS1 A;  2HT9 A;  2XPD A;  1R26 A;  5G1K A;  2JL4 A;  1GRX A;  4AJ7 A;  2LV3 A;  1AQV A;  1OC3 A;  3HYP A;  4Z2U A;  4PUA A;  1FG4 A;  1U87 A;  4HZ4 A;  1I9D A;  5CO3 A;  2ON5 A;  2YAN A;  3HVX A;  2R4V A;  1OC9 B;  1V58 A;  4RI7 A;  4HU7 A;  2C3N A;  5KN1 A;  2IJY A;  4XIH A;  5KOX A;  1OE8 A;  1XOB A;  3GTU B;  3H8Q A;  3P90 A;  2H6Z A;  4IJI A;  2GZY A;  4EC0 A;  4DVC A;  3CWG A;  2LTK A;  2L6C A;  2C3Q A;  3E3E A;  4PI0 C;  3K8N A;  1J08 A;  3Q19 A;  3FRC A;  5AGY A;  1Z7R A;  3KZQ A;  4GQF A;  4KUN A;  4PNF A;  3BD2 A;  1SKS B;  3IAM 2;  4NHW A;  6GSV A;  1M9A A;  4A5P A;  1Z3E A;  2C0G A;  3VWU A;  2HSH A;  1SL0 B;  3KCM A;  1G6Y A;  1AIU A;  1B9Y C;  4EF0 A;  2MBS A;  4MF7 A;  1BG5 A;  4MK3 A;  3EYT A;  4K2D A;  3CQF A;  4PUR A;  2JZS A;  2K8V A;  4EL1 A;  2R6K A;  4WBJ A;  1GUK A;  2XPE A;  2HSN A;  2A2P A;  5CRG A;  4G0I A;  1YY7 A;  3FHK A;  2OKA A;  4ECC A;  2V6K A;  4ECJ A;  2V6O A;  2REM A;  5LCZ A;  1SKR B;  1V9W A;  3O6T A;  4KCE A;  5G31 A;  3DML A;  4N3Z A;  2DLX A;  5H5Q A;  3DRN A;  1PRX A;  2ON7 A;  4TR4 A;  1J9B A;  4Q5R A;  2H1D A;  2YV7 A;  2WVX B;  1XCC A;  4HZ2 A;  4ISD A;  4I2T A;  5B6N A;  1NW2 A;  2ZUP A;  1VRS D;  3J7Y b;  2X64 A;  1THO A;  3HDC A;  4KSM A;  4IHU A;  1TP9 A;  2O7K A;  5C04 A;  2IMI A;  5ELG A;  4E68 A;  2O36 A;  5LD0 A;  4KB3 A;  2CVB A;  5IPG A;  5IOW A;  2PPT A;  4N11 A;  2L4C A;  4DSS A;  1BX9 A;  2JAC A;  2OA7 A;  4BVX B;  4GF0 A;  5KN0 A;  2FWG A;  5DJM A;  2H74 A;  3L9U A;  1ZYP A;  5GAP D;  2IMK A;  5ECK B;  1JZO A;  2BMX A;  2UV8 G;  1PMT A;  5LNK e;  3FK8 A;  1KNG A;  3GA4 A;  2BJX A;  1VGL A;  4ZB7 A;  4AJ6 A;  2DMM A;  2OJL A;  3L78 A;  4PUF C;  1S3R A;  5DVB A;  2C4J A;  2IFQ B;  2RII A;  5GST A;  2YNX A;  4QL7 A;  2OE1 A;  2WZS A;  3VI5 A;  2YN1 A;  1XXU A;  2YZH A;  2LEG A;  3TU3 B;  2CVK A;  1M2A A;  3HZ8 A;  2CQ9 A;  4K0N A;  4EUY A;  4MPG A;  1ABA A;  5AIS A;  2QKE A;  3UL3 A;  2YWO A;  4FYU A;  2RM6 A;  3E0U A;  4DSQ A;  4HOJ A;  5G2Z A;  1TK8 B;  2MYG A;  3PPU A;  4LL4 B;  4IEL A;  1KTE A;  5D8I A;  2HRK A;  4OMV A;  1GUM A;  2XHF A;  4EXJ A;  4G19 A;  1GTB A;  1XG8 A;  2QA2 A;  2HQT A;  2EFD A;  2TRX A;  1R5A A;  1XIY A;  1BF5 A;  1Z6N A;  2VL3 A;  1PX6 A;  5G1L A;  4F03 A;  5HR2 A;  5A1N A;  1YEW C;  5DQS A;  3SBC A;  3M3M A;  2R2J A;  1S4B P;  5G5E A;  3V1W A;  2RUE A;  1VF3 A;  2DJK A;  2X8C A;  4K2X A;  1TK5 B;  2H01 A;  1CQG A;  1I1I P;  4MJA A;  2RUF A;  2A2S A;  1X5C A;  3GSS A;  1PX7 A;  12GS A;  3F3Q A;  3GNJ A;  1S3D A;  1PD2 1;  1OYJ A;  4G0K A;  4IP6 A;  1DSB A;  3DIE A;  2DIZ A;  2FA8 A;  4KE3 A;  2DJJ A;  1SL2 B;  4PGT A;  3VWW A;  1ILO A;  3I9V 2;  2V32 A;  4KDY A;  3KM6 A;  4WKW A;  3AY8 A;  4IN0 A;  5ECN B;  4WF4 A;  3WGX A;  1EEJ A;  1F2E A;  3DD3 A;  1NM3 A;  3APS A;  2P5R A;  3H93 A;  3KEB A;  3GKM A;  1RK4 A;  3IHQ A;  1BAY A;  1TI3 A;  1YF1 A;  4KDU A;  4L0W A;  1TOF A;  5BMU A;  3UIW A;  4HQS A;  3EU4 A;  2H75 A;  2KP1 A;  1BQ7 A;  3A3T A;  2DKH A;  4MA9 A;  4TXO A;  2M46 A;  5DAL A;  4ZIL A;  4ECB A;  1XWK A;  5DCG A;  1O8X A;  1QQ2 A;  2EFH A;  2CVD A;  3UVH A;  2ZNM A;  4E8H A;  1QFN A;  4F82 A;  4K7I A;  2DKI A;  1T8E B;  4MF6 A;  1SD8 A;  5DDL A;  4N0Z A;  1EOG A;  4X4J A;  2CV4 A;  1B4Q A;  5CRD A;  3Q74 A;  3U6V A;  3BCI A;  1WP0 A;  2N5A A;  5ECI B;  3RDW A;  4Q5F A;  3HD5 A;  2FHE A;  1TRV A;  5JCU A;  3CMI A;  1ZYQ B;  2WW1 A;  5EL8 A;  1HNC A;  3QCP A;  2MMO A;  1HD2 A;  3J7Y k;  2X8G A;  5JWR B;  2CX4 A;  2VL9 A;  1RQM A;  5D9V A;  5A1N B;  2AUV A;  4NWY A;  4XS4 A;  2OBK A;  3Q6O A;  3GKK A;  6GSS A;  5EY6 A;  2C0E A;  1TI1 A;  3A5I A;  5AN1 A;  5KN2 A;  2L5L A;  2CA8 A;  1GH2 A;  2IN3 A;  3OR5 A;  3VWX A;  2YWN A;  1Y25 A;  5BRT A;  5DAK A;  1EGR A;  3D4T A;  5H5R A;  3TOT A;  3P7X A;  1XWB A;  2VL2 A;  2OE0 A;  1I5G A;  5A5H B;  1G7O A;  2VCX A;  5CYY A;  4HQZ A;  2IME A;  5ECM B;  2HSM B;  3KH9 A;  3N9J A;  2HE3 A;  2QGV A;  3UVT A;  2CZ3 A;  2A4H A;  4HSC X;  3HY2 A;  2LJK A;  1PA3 A;  4FO5 A;  2HXK A;  5DCH A;  1WE0 A;  2DJ1 A;  5F8B A;  3LWA A;  2NBS A;  1XW5 A;  4G2E A;  2DJ2 A;  4JZQ A;  3F8U A;  5CRH A;  4G9H A;  1GUH A;  1GSF A;  3QR6 A;  2WW3 A;  4AF2 A;  4MH3 A;  6GSW A;  1URM A;  4HU9 A;  2CZ2 A;  1A2M A;  1X9S B;  1WJK A;  2EFE A;  2WGR A;  4MMM A;  5INY A;  4AI6 A;  2YCD A;  1UVZ A;  1OKD A;  5B8B A;  4IQA A;  4TXO B;  5DAL B;  5F07 A;  4AGS A;  3US3 A;  3CHX C;  4AKG A;  3ZL5 A;  3F9U A;  3HJM A;  1JZD A;  4Q5N A;  5ID2 A;  1GSD A;  1HQO A;  1MTC A;  4FYB A;  4KW6 A;  4HUA A;  5EPF A;  3RPN A;  4YQV A;  1S3A A;  2P0G A;  2I4A A;  1AQX A;  4J2F A;  3IPZ A;  4RUV A;  2GDR A;  10GS A;  1O6J A;  3LFL A;  3L4N A;  3TKS C;  5J4V A;  3KGK A;  1MDI A;  2PN8 A;  1YJ6 A;  4E8E A;  4Z2T A;  2B7J A;  4AJ8 A;  3ERW A;  5EVO A;  4GRF A;  3G7I A;  1R7H A;  4L5O A;  4ACS A;  3VI7 A;  1F6M C;  1GP1 A;  1TXX A;  5ECP B;  1GLQ A;  4YAV A;  4XS4 B;  1OAZ A;  2HFD A;  2H19 A;  1Y6E A;  1T7P B;  3TGZ A;  2LUS A;  2O8V B;  3IV4 A;  4NV2 A;  4ICY A;  2EFC A;  5ECS A;  8GSS A;  2E2G A;  1X5E A;  3C1S A;  1ON4 A;  2PVO C;  4BL7 B;  2WCI A;  4OO4 A;  1YKA A;  4TVE A;  4NMU A;  4L0U A;  3LOR A;  4HJ2 A;  1WMJ A;  4ZB9 A;  4N0V A;  3GV1 A;  2Z9S A;  4YQU A;  4EO3 A;  2K9F A;  2HNL A;  3ZRE A;  2WFC A;  3MNG A;  1VF2 A;  4D73 B;  3S9F A;  11GS A;  3G7Y A;  4DEJ A;  20GS A;  1THX A;  4IKH A;  2GTU A;  2V41 A;  3ZML A;  1GLP A;  3EMX A;  4ZL7 A;  3CRT A;  1SYR A;  2XBQ A;  4GLT A;  1B48 A;  4MZW A;  1XZO A;  2H8L A;  3F4S A;  4O5U A;  4JED A;  1GSQ A;  3CBU A;  2FWE A;  2YPM A;  1MDJ A;  5HR3 A;  3PH9 A;  1UA5 A;  4OCF A;  3TUE A;  1QUW A;  1GSU A;  1PN9 A;  2IWT A;  1N25 A;  4YH2 A;  2AV4 A;  4LLR A;  3UEM A;  1XOA A;  3LQ7 A;  3EPT A;  14GS A;  2GSS A;  2HYX A;  1T3B A;  3MYD A;  1IYI A;  3LW9 A;  4TW5 A;  1BG1 A;  1WPI A;  2AJQ B;  4V1A g;  2WW0 A;  2AHE A;  3ERF A;  3GST A;  2H0G A;  3GUR A;  2X99 A;  3FYG A;  2WS2 A;  3C8E A;  4PI2 C;  4PNG A;  3GX0 A;  4YAP A;  1ERT A;  4ZB8 A;  3HJP A;  3PR8 A;  4HJM A;  3ZVJ A;  2J9H A;  2P5Q A;  1A2L A;  5JCW A;  2X8H A;  3QAW A;  1O7U A;  1ML6 A;  2CT6 A;  4G0L A;  2DC5 A;  3C7M A;  5A34 A;  2OBI A;  3HMJ G;  4WR4 A;  1J0F A;  1AW9 A;  3I6A A;  1U88 A;  1F37 A;  2GQK A;  3GKX A;  4CW9 A;  3QFB C;  4GXZ A;  2H76 A;  2MMA A;  5A4V A;  2IMF A;  4QL9 A;  5HR1 A;  3BCK A;  3M9J A;  1HNB A;  1GSY A;  4AKX B;  4IVF A;  2VM2 A;  3CSJ A;  5G5F A;  4ML1 A;  2F8A A;  5AIX A;  3IE3 A;  3IXR A;  2M80 A;  3KP8 A;  4MPF A;  1KBN A;  3PIN A;  3ME7 A;  3L9V A;  4GCI A;  1BJX A;  1X5D A;  2GT5 A;  3FR9 A;  3ZZX A;  4XRA A;  3GL5 A;  4POK A;  5J5N A;  4K1F A;  5F0G A;  2O5V A;  4DSR A;  3A5W A;  2PBJ A;  1M3I A;  2B1K A;  2CX3 A;  4O5Q A;  1F3B A;  5J47 A;  2OAC A;  3QMX A;  2OE3 A;  1TK0 B;  1YKC A;  4ZB6 A;  1AQW A;  5JWQ B;  2PER A;  4ZL8 A;  2OT3 A;  3F63 A;  1ERW A;  1A2J A;  4K6X A;  2WVZ A;  3I43 A;  2IIY A;  1WWJ A;  1GNE A;  5A4W A;  1O81 A;  3ZIT A;  3D21 A;  4TR0 A;  3F0I A;  4V1A p;  1TKD B;  1XWG A;  5COH A;  3HHV A;  4K5R A;  4K7O A;  3VPT A;  2R0C A;  2N5B A;  2LNS A;  4FYC A;  5L71 A;  4J56 E;  2MMN A;  1ZCP A;  1PFO A;  3C1R A;  1Z5Y E;  2WRT A;  3F6D A;  6GST A;  2C0D A;  4X1U A;  2EIQ A;  1S3C A;  1SVM A;  4BWS A;  4XCS A;  3WGD A;  2WZ9 A;  5A4U A;  3JCM L;  3TJB A;  5D96 A;  2VUP A;  4PQ1 A;  2HSN B;  2DJ3 A;  3IC4 A;  1SVL A;  3H1N A;  2H6X A;  1FOV A;  3A2V A;  4BWQ A;  4WEY A;  4HI7 A;  5IMZ A;  1DE2 A;  3KJY A;  2VAF A;  3APO A;  3KMN A;  4G10 A;  1NHO A;  1V98 A;  1ST9 A;  2L4Q A;  2PU9 C;  1HNA A;  4NHZ A;  4TR1 A;  1PKZ A;  1ZOF A;  2O85 A;  4N10 A;  4RI6 A;  2QSI A;  2G0F A;  3QAV A;  2HRN A;  5KEJ A;  4F9Z A;  3GHA A;  2C80 A;  4HS1 A;  4LMV A;  3SWL A;  1M0U A;  2V2G A;  3TJK A;  2I1U A;  5FWG A;  3UJ1 A;  2YJH A;  3EC3 A;  2MBT A;  3MWH A;  3KH7 A;  3TDG A;  4ZBD A;  2H66 A;  5G30 A;  2IMD A;  1XVW A;  2BTO T;  2LQQ A;  3FW2 A;  4EKZ A;  3R2Q A;  1A0R P;  1TTZ A;  5IIZ A;  5KOW A;  1IYH A;  2C3T A;  3WYW A;  2VOC A;  4OO5 A;  4MJC A;  2I81 A;  4KH7 A;  3HZ4 A;  4FQU A;  2LNT A;  2CAI A;  3DVW A;  1GNW A;  4BVY A;  4OFN A;  4DSS B;  2VLV A;  3TKS E;  2FWH A;  2R0G A;  3ZVJ D;  3HVS A;  3LGC A;  1PL2 A;  3W6G A;  1EP8 A;  1W89 A;  2WW2 A;  4MH2 A;  4OFM A;  1K0B A;  3IOS A;  2B6M A;  4X43 A;  2H30 A;  1ERV A;  2JSZ A;  13GS A;  2YZU A;  4ZL9 A;  1A23 A;  2HZF A;  1EEM A;  1H4O A;  4MAB A;  4HEA 2;  3IRA A;  2E7P A;  3W8J A;  1JHB A;  1UN2 A;  1K3Y A;  3P2A A;  3GKN A;  4MF5 A;  2L57 A;  3CYN A;  2O87 A;  3DVX A;  5D93 A;  4ZIJ A;  2VM1 A;  4O7H A;  1K0C A;  3HXS A;  2HSY A;  1KEB A;  1SVO A;  2KOK A;  4JBB A;  2E2M A;  3EU3 A;  1DUG A;  19GS A;  3TKQ A;  4EIP A;  2GQM A;  3U5R E;  2HRK B;  3C73 A;  4N30 A;  1XBS A;  1K0D A;  2A2R A;  2LS5 A;  3QPM A;  4KND A;  4L5L A;  1SK1 A;  2E0Q A;  2F8F A;  5JCG A;  5D9T A;  4MJE A;  2J23 A;  2L5O A;  4GTU A;  1U3I A;  1XPV A;  2FD3 A;  4XTS A;  5IQY A;  4KX4 A;  2FWF A;  5ENU A;  2VO4 A;  1VF1 A;  3CSH A;  3ZIJ A;  5IMA A;  3LG6 A;  4X0X A;  4XS6 A;  2LRC A;  4CY8 A;  1A8L A;  1PQN A;  3WT2 A;  4NAX A;  2VD1 A;  1N2A A;  3VPQ A;  2YOI A;  1G0T A;  1O73 A;  1K0O A;  1OC9 A;  1B9X C;  4OCE A;  3CTG A;  5DQY A;  3LJR A;  1R4W A;  1E6B A;  3FZ4 A;  3GTU A;  3D0Z A;  3ERG A;  2DIY A;  4TXV A;  2H1L A;  4YKG A;  1FVK A;  1CQH A;  4WXT A;  1V2A A;  3RHB A;  4AKH A;  1MD3 A;  1O8W A;  3PGT A;  1T1V A;  2F51 A;  1WRY A;  3IK9 A;  1JFU A;  3MDK A;  4KDX A;  4GWR A;  5F05 A;  3DYR A;  2ZCT A;  4WF5 A;  1FOH A;  1Z9H A;  3WT1 A;  1U3A A;  3LYK A;  2R3X A;  2GS3 A;  2YJ7 A;  2FUG 2;  4FIW A;  1MDK A;  2DML A;  2FNO A;  4KSO A;  2GGT A;  1SK0 A;  4MCU A;  2GZP A;  1USB A;  3QOU A;  3GUS A;  4CDO A;  1AAZ A;  3DKS A;  4IW9 A;  7GSS A;  2GSR A;  2GT6 A;  1RW1 A;  4ZBA A;  5BMU B;  1EWX A;  1T4Y A;  2JU5 A;  4L8E A;  1W4V A;  3KD0 A;  1G7E A;  1FVJ A;  3W8S A;  2FLS A;  4KF9 A;  1QGV A;  3IDV A;  2WDU A;  3QAG A;  2VCQ A;  5DBQ A;  2MZC A;  9GSS A;  3L9S A;  3UMA A;  1EP7 A;  4KAE A;  3NIV A;  3G9B A;  3HKR A;  2YV9 A;  1GTU A;  3A2W A;  4CY6 A;  1T4Z A;  1K0N A;  2MMZ A;  4PQI A;  2JAD A;  1EV4 A;  1TXU A;  1M3J A;  2B3S A;  2L59 A;  3TJG A;  4O5R A;  6GSY A;  2WVX A;  4POB A;  2WB9 A;  2ES7 A;  4KA0 A;  1A24 A;  2VCV A;  3F6F A;  4V2L A;  3H4K A;  5IOX A;  2AYT A;  3EVI A;  1K0A A;  3HA9 A;  4GST A;  3D22 A;  2N5F A;  4MLY A;  1TW9 A;  1GWC A;  4Q5Q A;  4OFT A;  5CRW A;  1XW6 A;  4RQR A;  2B5X A;  3RBT A;  1OKT A;  4WBR D;  4G01 A;  1PSQ A;  1X9W B;  1TRU A;  4PHZ C;  2IPA A;  3KTB A;  4BVX A;  3NOF A;  2FA4 A;  2ALB A;  4EVM A;  2R0P A;  1K3O A;  1U6T A;  3TKR A;  5DAK B;  2H72 A;  4LL1 B;  5CP1 A;  3GH6 A;  3ZLP A;  4EDZ A;  1FB0 A;  4MNN A;  3UBK A;  3KP9 A;  2B5E A;  4EIQ A;  4PQH A;  3ZTL A;  5IMF A;  2IFQ A;  3TKP A;  2OAD A;  1QK8 A;  1TU8 A;  3EIN A;  1OE7 A;  4YQM A;  3IK7 A;  2PGT A;  2FY6 A;  4NPB A;  4K0G A;  3GIX A;  2PMT A;  1JZW A;  3WGE A;  5DJL A;  1FHE A;  2XBI A;  3Q18 A;  5J41 A;  4ZXG A;  3MIX A;  5H5S A;  2GZZ A;  3BJ5 A;  1AC1 A;  3DEX A;  1PKW A;  1EV9 A;  4ILF A;  18GS A;  2X49 A;  2HRF A;  1LBK A;  3NZN A;  4PTS A;  4NXI A;  1WOU A;  1SK2 A;  1OC8 A;  1JLW A;  2D2Z A;  1XFL A;  3M0F A;  4H86 A;  3FR3 A;  5B7C A;  1YF0 A;  6GSU A;  4ZBB A;  2P31 A;  3RGB C;  1OVN A;  2K18 A;  2K6V A;  2HLS A;  1X9M B;  2WUL A;  5IPH A;  2KLX A;  1LU4 A;  2H70 A;  5ID2 B;  2JZT A;  1YVL A;  4IGJ A;  2A4V A;  2GQL A;  1X0R A;  1XW9 A;  3RHC A;  4FXY P;  5ECR B;  3KMO A;  1V40 A;  3UOM A;  1M2B A;  3EUR A;  5CNW A;  5ECO B;  2NTO A;  1AXD A;  4BPY A;  2B7K A;  4XRD A;  2I9H A;  1GUL A;  4IQ1 A;  4I6X A;  5HFI A;  5GAN D;  1MD4 A;  3KXO A;  3TKS A;  3TCO A;  4K7N A;  5IO2 A;  4IJ3 A;  1SJI A;  1YQ1 A;  4TRX A;  1NHY A;  3GX8 A;  4PX1 A;  2LST A;  4RQX A;  4KGI A;  1VF4 A;  1JZR A;  2LQO A;  4EDY A;  2L6D A;  1GTA A;  4ML6 A;  2UZ8 A;  2H0I A;  22GS A;  1Y1U A;  4F0C A;  3GN3 A;  5C00 A;  3FZ5 A;  4BIK A;  1SKW B;  1V57 A;  1YDK A;  4WR5 A;  1BYE A;  3TJF A;  5GSS A;  2H1B A;  2LJA A;  3H79 A;  3LXZ A;  3IHG A;  4POM A;  1ZYN A;  3ISO A;  1BED A;  1M7T A;  1R5P A;  1K3L A;  2KP2 A;  5A5K A;  2C0F A;  2VIM A;  5KN3 A;  2HRA A;  3VWV A;  16GS A;  4MDC A;  5J4U A;  5IO0 A;  4WET A;  3BBY A;  1TRW A;  1FB6 A;  1ACV A;  2NPB A;  3D6I A;  3ZFL A;  2PUK C;  4TR3 A; 
#chains in the Genus database with same CATH homology
 3ED3 A;  5ECQ B;  2DJ0 A;  4V2M A;  5J9B A;  2NDO A;  5ECH B;  1WIK A;  4K5S A;  3M8N A;  2AB6 A;  5IMC A;  4QQ7 A;  2LRN A;  1B4P A;  3F4T A;  1B8X A;  1C72 A;  3F4R A;  1A0F A;  3DWV A;  1ERU A;  3FMW A;  5J40 A;  4I5Q A;  1O85 A;  3IBH A;  2EIR A;  2I3Y A;  2X4A A;  4Z2R A;  4I2U A;  2YP6 A;  4LA1 A;  2TIR A;  1TJD A;  17GS A;  1F9M A;  1EZK A;  3VK9 A;  1SD9 A;  1TU7 A;  1GL8 A;  3RPP A;  4ID0 A;  1SJZ A;  4QMK A;  3E9J B;  3IA1 A;  1DBY A;  2JZR A;  4GSS A;  2GVP A;  3O3T A;  1TDI A;  2VL2 C;  4OWY A;  3HVV A;  5IM9 A;  3LEF A;  3FR6 A;  3CRU A;  5JWO B;  3APQ A;  1ZGN A;  3EMP A;  3D4M A;  5A5H A;  3CSI A;  1Q98 A;  3O76 A;  3DXB A;  2CAQ A;  3F3R A;  1Z6M A;  5CAX A;  2HSM A;  4JRR A;  1E2Y A;  1GSS A;  3GRX A;  3ZYW A;  1LJR A;  5A34 B;  2EIO A;  3TRX A;  4J57 E;  5J9C A;  5HFK A;  1YZX A;  4F2I A;  2HZE A;  1FW1 A;  5D9X A;  1MEK A;  4F0B A;  2VD0 A;  1YEP A;  3ZRD A;  4JR4 A;  2FGX A;  4GSN A;  4JU5 A;  2WJU A;  4LMW A;  4OD7 A;  1M99 A;  2VKZ G;  5E4W A;  3DGQ A;  3FKF A;  5J4Y A;  4K9Z A;  1Q4J A;  1Z7P A;  2H0H A;  2DBC A;  3MSZ A;  5J3R A;  2QC7 A;  4MJB A;  2C8U A;  5IMV A;  4NV5 A;  4O92 A;  3HJO A;  4FH8 A;  1N8J A;  3EWL A;  2LKU A;  3HCZ A;  1M9B A;  1XWA A;  1A8Y A;  2QA1 A;  3N5O A;  5F06 A;  2RLI A;  2F9S A;  3CXG A;  4TN8 A;  3FY7 A;  4IS0 A;  1ZZY A;  1T00 A;  2RM5 A;  5B6M A;  2R37 A;  4Z7X A;  3C71 A;  1QXH A;  3EE2 A;  1PL1 A;  3IAS 2;  1UC7 A;  5B8A A;  5D9W A;  1ZL9 A;  2VCZ A;  1SJ6 A;  2G2Q A;  2XC2 A;  2M72 A;  3FZA A;  2GSQ A;  4GDF A;  3GL3 A;  5ELA A;  1NSW A;  1F3A A;  1EGO A;  2B1L A;  4XHM A;  3FZ9 A;  3KIJ A;  3G7J A;  1GSE A;  3M1G A;  2KUC A;  5HR0 A;  2TRC P;  4TR1 B;  3TOU A;  5FHI A;  5ABR A;  4EE0 A;  5GZZ B;  3TRQ A;  4ECI A;  2HI7 A;  3ZMK A;  2B5Y A;  4P3Y B;  4AKI A;  3MAK A;  1AUC A;  1TRS A;  2PVQ A;  4MP4 A;  3R3E A;  4TKY A;  1G6W A;  3UAR A;  4BL7 A;  1SYX A;  2H6Y A;  3GFK A;  2VLT A;  3UAP A;  3LXT A;  3QFA C;  2EC4 A;  3UBL A;  3VUR A;  1YEX A;  2LJR A;  3BOA A;  4K8M A;  3WD6 A;  1QMV A;  3TB2 A;  3KTL A;  5IMD A;  5E59 A;  3FEU A;  2H73 A;  2VCT A;  3QD9 A;  2KHP A;  1PN0 A;  4D73 A;  3TRP A;  4I97 A;  4I8B A;  3TJJ A;  3VFI A;  3I69 A;  1ZMA A;  5ECL B;  4BVY B;  3L0H A;  3GMF A;  1FO5 A;  4TOP A;  2IL3 A;  2HZE B;  1XWC A;  4POL A;  1M2D A;  2AAW A;  1SU9 A;  2H71 A;  3GYK A;  2YWM A;  1PGT A;  4O32 A;  5HFG A;  2GST A;  2H1A A;  4MZB A;  4V2N A;  1EOH A;  1HYU A;  2H1G A;  4IBP A;  2FCH A;  3ZFB A;  3ZIV A;  3LYP A;  5HQP A;  3M9K A;  3QDN A;  2DSA A;  3VLN A;  1SEN A;  2R5G A;  1FAA A;  2PWJ A;  4HDE A;  3LSZ A;  4PXO A;  4USS A;  4JE1 A;  1DE1 A;  4W66 A;  2JSY A;  1SL1 B;  2C1Y A;  2F3M A;  6GSX A;  1JLV A;  2NVL A;  2O89 A;  1K0M A;  1ZYE A;  5AIV A;  4ULX A;  2V1M A;  3P8W A;  3CTF A;  4MZC A;  3GH9 A;  4BA7 A;  2GLR A;  3RAZ A;  4GQC A;  3D5J A;  3A2X A;  2LRT A;  1H75 A;  3IR4 A;  5D73 A;  4CHS A;  3ME8 A;  3IC8 A;  4JR6 A;  5CRE A;  1GTI A;  1XVQ A;  2YWI A;  4YKF A;  5FT3 A;  2K8S A;  4IP1 A;  2VLU A;  2VCW A;  4KCA A;  4XS1 A;  2HT9 A;  2XPD A;  1R26 A;  5G1K A;  2JL4 A;  1GRX A;  4AJ7 A;  2LV3 A;  1AQV A;  1OC3 A;  3HYP A;  4Z2U A;  4PUA A;  1FG4 A;  1U87 A;  4HZ4 A;  1I9D A;  5CO3 A;  2ON5 A;  2YAN A;  3HVX A;  2R4V A;  1OC9 B;  1V58 A;  4RI7 A;  4HU7 A;  2C3N A;  5KN1 A;  2IJY A;  4XIH A;  5KOX A;  1OE8 A;  1XOB A;  3GTU B;  3H8Q A;  3P90 A;  2H6Z A;  4IJI A;  2GZY A;  4EC0 A;  4DVC A;  3CWG A;  2LTK A;  2L6C A;  2C3Q A;  3E3E A;  3K8N A;  1J08 A;  3Q19 A;  3FRC A;  5AGY A;  1Z7R A;  3KZQ A;  4GQF A;  4KUN A;  4PNF A;  3BD2 A;  1SKS B;  3IAM 2;  4NHW A;  6GSV A;  1M9A A;  4A5P A;  1Z3E A;  2C0G A;  3VWU A;  2HSH A;  1SL0 B;  3KCM A;  1G6Y A;  1AIU A;  1B9Y C;  4EF0 A;  2MBS A;  4MF7 A;  1BG5 A;  4MK3 A;  3EYT A;  4K2D A;  4PUR A;  2JZS A;  2K8V A;  4EL1 A;  2R6K A;  4WBJ A;  1GUK A;  2XPE A;  2HSN A;  2A2P A;  5CRG A;  4G0I A;  1YY7 A;  3FHK A;  2OKA A;  4ECC A;  2V6K A;  4ECJ A;  2V6O A;  2REM A;  5LCZ A;  1SKR B;  1V9W A;  3O6T A;  4KCE A;  5G31 A;  3DML A;  4N3Z A;  2DLX A;  5H5Q A;  3DRN A;  1PRX A;  2ON7 A;  4TR4 A;  1J9B A;  4Q5R A;  2H1D A;  2YV7 A;  1XCC A;  4HZ2 A;  4ISD A;  4I2T A;  5B6N A;  1NW2 A;  2ZUP A;  1VRS D;  3J7Y b;  2X64 A;  1THO A;  3HDC A;  4KSM A;  4IHU A;  1TP9 A;  2O7K A;  5C04 A;  2IMI A;  5ELG A;  4E68 A;  5LD0 A;  4KB3 A;  2CVB A;  5IPG A;  5IOW A;  2PPT A;  4N11 A;  2L4C A;  4DSS A;  1BX9 A;  2JAC A;  2OA7 A;  4BVX B;  4GF0 A;  5KN0 A;  2FWG A;  5DJM A;  2H74 A;  3L9U A;  1ZYP A;  5GAP D;  2IMK A;  5ECK B;  1JZO A;  2BMX A;  2UV8 G;  1PMT A;  5LNK e;  3FK8 A;  1KNG A;  3GA4 A;  2BJX A;  1VGL A;  4ZB7 A;  4AJ6 A;  2DMM A;  2OJL A;  3L78 A;  4PUF C;  5DVB A;  2C4J A;  2IFQ B;  2RII A;  5GST A;  2YNX A;  4QL7 A;  2OE1 A;  3VI5 A;  2YN1 A;  1XXU A;  2YZH A;  2LEG A;  3TU3 B;  2CVK A;  1M2A A;  3HZ8 A;  2CQ9 A;  4K0N A;  4EUY A;  4MPG A;  1ABA A;  5AIS A;  2QKE A;  3UL3 A;  2YWO A;  4FYU A;  2RM6 A;  3E0U A;  4DSQ A;  4HOJ A;  5G2Z A;  1TK8 B;  2MYG A;  3PPU A;  4LL4 B;  4IEL A;  1KTE A;  5D8I A;  2HRK A;  4OMV A;  1GUM A;  2XHF A;  4EXJ A;  4G19 A;  1GTB A;  2QA2 A;  2HQT A;  2EFD A;  2TRX A;  1R5A A;  1XIY A;  1BF5 A;  1Z6N A;  2VL3 A;  1PX6 A;  5G1L A;  4F03 A;  5HR2 A;  5A1N A;  5DQS A;  3SBC A;  3M3M A;  2R2J A;  5G5E A;  3V1W A;  2RUE A;  1VF3 A;  2DJK A;  2X8C A;  4K2X A;  1TK5 B;  2H01 A;  1CQG A;  4MJA A;  2RUF A;  2A2S A;  1X5C A;  3GSS A;  1PX7 A;  12GS A;  3F3Q A;  3GNJ A;  1S3D A;  1PD2 1;  1OYJ A;  4G0K A;  4IP6 A;  1DSB A;  3DIE A;  2DIZ A;  2FA8 A;  4KE3 A;  2DJJ A;  1SL2 B;  4PGT A;  3VWW A;  1ILO A;  3I9V 2;  2V32 A;  4KDY A;  3KM6 A;  4WKW A;  3AY8 A;  4IN0 A;  5ECN B;  4WF4 A;  3WGX A;  1EEJ A;  1F2E A;  3DD3 A;  1NM3 A;  3APS A;  2P5R A;  3H93 A;  3KEB A;  3GKM A;  1RK4 A;  3IHQ A;  1BAY A;  1TI3 A;  1YF1 A;  4KDU A;  4L0W A;  1TOF A;  5BMU A;  3UIW A;  4HQS A;  3EU4 A;  2H75 A;  2KP1 A;  1BQ7 A;  3A3T A;  2DKH A;  4MA9 A;  4TXO A;  2M46 A;  5DAL A;  4ZIL A;  4ECB A;  1XWK A;  5DCG A;  1O8X A;  1QQ2 A;  2EFH A;  2CVD A;  3UVH A;  2ZNM A;  4E8H A;  1QFN A;  4F82 A;  4K7I A;  2DKI A;  1T8E B;  4MF6 A;  1SD8 A;  5DDL A;  4N0Z A;  1EOG A;  4X4J A;  2CV4 A;  1B4Q A;  5CRD A;  3Q74 A;  3U6V A;  3BCI A;  1WP0 A;  2N5A A;  5ECI B;  3RDW A;  4Q5F A;  3HD5 A;  2FHE A;  1TRV A;  5JCU A;  3CMI A;  1ZYQ B;  5EL8 A;  1HNC A;  3QCP A;  2MMO A;  1HD2 A;  3J7Y k;  2X8G A;  5JWR B;  2CX4 A;  2VL9 A;  1RQM A;  5D9V A;  5A1N B;  2AUV A;  4NWY A;  4XS4 A;  2OBK A;  3Q6O A;  3GKK A;  6GSS A;  5EY6 A;  2C0E A;  1TI1 A;  3A5I A;  5AN1 A;  5KN2 A;  2L5L A;  2CA8 A;  1GH2 A;  2IN3 A;  3OR5 A;  3VWX A;  2YWN A;  1Y25 A;  5BRT A;  5DAK A;  1EGR A;  3D4T A;  5H5R A;  3TOT A;  3P7X A;  1XWB A;  2VL2 A;  2OE0 A;  1I5G A;  5A5H B;  1G7O A;  2VCX A;  5CYY A;  4HQZ A;  2IME A;  5ECM B;  2HSM B;  3KH9 A;  3N9J A;  2HE3 A;  2QGV A;  3UVT A;  2CZ3 A;  2A4H A;  3HY2 A;  2LJK A;  1PA3 A;  4FO5 A;  2HXK A;  5DCH A;  1WE0 A;  2DJ1 A;  5F8B A;  3LWA A;  2NBS A;  1XW5 A;  4G2E A;  2DJ2 A;  4JZQ A;  3F8U A;  5CRH A;  4G9H A;  1GUH A;  1GSF A;  3QR6 A;  4AF2 A;  4MH3 A;  6GSW A;  1URM A;  4HU9 A;  2CZ2 A;  1A2M A;  1X9S B;  1WJK A;  2EFE A;  2WGR A;  4MMM A;  5INY A;  4AI6 A;  2YCD A;  1UVZ A;  1OKD A;  5B8B A;  4IQA A;  4TXO B;  5DAL B;  5F07 A;  4AGS A;  3US3 A;  4AKG A;  3ZL5 A;  3F9U A;  3HJM A;  1JZD A;  4Q5N A;  5ID2 A;  1GSD A;  1HQO A;  1MTC A;  4FYB A;  4KW6 A;  4HUA A;  5EPF A;  3RPN A;  4YQV A;  1S3A A;  2P0G A;  2I4A A;  1AQX A;  4J2F A;  3IPZ A;  4RUV A;  2GDR A;  10GS A;  1O6J A;  3LFL A;  3L4N A;  3TKS C;  5J4V A;  3KGK A;  1MDI A;  2PN8 A;  1YJ6 A;  4E8E A;  4Z2T A;  2B7J A;  4AJ8 A;  3ERW A;  5EVO A;  4GRF A;  3G7I A;  1R7H A;  4L5O A;  4ACS A;  3VI7 A;  1F6M C;  1GP1 A;  1TXX A;  5ECP B;  1GLQ A;  4YAV A;  4XS4 B;  1OAZ A;  2HFD A;  2H19 A;  1Y6E A;  1T7P B;  3TGZ A;  2LUS A;  2O8V B;  3IV4 A;  4NV2 A;  4ICY A;  2EFC A;  5ECS A;  8GSS A;  2E2G A;  1X5E A;  3C1S A;  1ON4 A;  2PVO C;  4BL7 B;  2WCI A;  4OO4 A;  1YKA A;  4TVE A;  4NMU A;  4L0U A;  3LOR A;  4HJ2 A;  1WMJ A;  4ZB9 A;  4N0V A;  3GV1 A;  2Z9S A;  4YQU A;  4EO3 A;  2K9F A;  2HNL A;  3ZRE A;  2WFC A;  3MNG A;  1VF2 A;  4D73 B;  3S9F A;  11GS A;  3G7Y A;  4DEJ A;  20GS A;  1THX A;  4IKH A;  2GTU A;  2V41 A;  3ZML A;  1GLP A;  3EMX A;  4ZL7 A;  3CRT A;  1SYR A;  2XBQ A;  4GLT A;  1B48 A;  4MZW A;  1XZO A;  2H8L A;  3F4S A;  4O5U A;  4JED A;  1GSQ A;  3CBU A;  2FWE A;  2YPM A;  1MDJ A;  5HR3 A;  3PH9 A;  1UA5 A;  4OCF A;  3TUE A;  1QUW A;  1GSU A;  1PN9 A;  2IWT A;  1N25 A;  4YH2 A;  2AV4 A;  4LLR A;  3UEM A;  1XOA A;  3LQ7 A;  3EPT A;  14GS A;  2GSS A;  2HYX A;  1T3B A;  3MYD A;  1IYI A;  3LW9 A;  4TW5 A;  1BG1 A;  1WPI A;  2AJQ B;  4V1A g;  2AHE A;  3ERF A;  3GST A;  2H0G A;  3GUR A;  2X99 A;  3FYG A;  2WS2 A;  3C8E A;  4PNG A;  3GX0 A;  4YAP A;  1ERT A;  4ZB8 A;  3HJP A;  3PR8 A;  4HJM A;  3ZVJ A;  2J9H A;  2P5Q A;  1A2L A;  5JCW A;  2X8H A;  3QAW A;  1O7U A;  1ML6 A;  2CT6 A;  4G0L A;  2DC5 A;  3C7M A;  5A34 A;  2OBI A;  3HMJ G;  4WR4 A;  1J0F A;  1AW9 A;  3I6A A;  1U88 A;  1F37 A;  2GQK A;  3GKX A;  4CW9 A;  3QFB C;  4GXZ A;  2H76 A;  2MMA A;  5A4V A;  2IMF A;  4QL9 A;  5HR1 A;  3BCK A;  3M9J A;  1HNB A;  1GSY A;  4AKX B;  4IVF A;  2VM2 A;  3CSJ A;  5G5F A;  4ML1 A;  2F8A A;  5AIX A;  3IE3 A;  3IXR A;  2M80 A;  3KP8 A;  4MPF A;  1KBN A;  3PIN A;  3ME7 A;  3L9V A;  4GCI A;  1BJX A;  1X5D A;  2GT5 A;  3FR9 A;  3ZZX A;  4XRA A;  3GL5 A;  4POK A;  5J5N A;  4K1F A;  5F0G A;  2O5V A;  4DSR A;  3A5W A;  2PBJ A;  2CX3 A;  2B1K A;  4O5Q A;  1F3B A;  5J47 A;  2OAC A;  3QMX A;  2OE3 A;  1TK0 B;  1YKC A;  4ZB6 A;  1AQW A;  5JWQ B;  2PER A;  4ZL8 A;  2OT3 A;  3F63 A;  1ERW A;  1A2J A;  4K6X A;  3I43 A;  2IIY A;  1WWJ A;  1GNE A;  5A4W A;  1O81 A;  3ZIT A;  3D21 A;  4TR0 A;  3F0I A;  4V1A p;  1TKD B;  1XWG A;  5COH A;  3HHV A;  4K5R A;  4K7O A;  3VPT A;  2R0C A;  2N5B A;  2LNS A;  4FYC A;  5L71 A;  4J56 E;  2MMN A;  1ZCP A;  3C1R A;  1Z5Y E;  2WRT A;  3F6D A;  6GST A;  2C0D A;  4X1U A;  2EIQ A;  1S3C A;  1SVM A;  4BWS A;  4XCS A;  3WGD A;  2WZ9 A;  5A4U A;  3JCM L;  3TJB A;  5D96 A;  2VUP A;  4PQ1 A;  2HSN B;  2DJ3 A;  3IC4 A;  1SVL A;  3H1N A;  2H6X A;  1FOV A;  3A2V A;  4BWQ A;  4WEY A;  4HI7 A;  5IMZ A;  1DE2 A;  3KJY A;  2VAF A;  3APO A;  3KMN A;  4G10 A;  1NHO A;  1V98 A;  1ST9 A;  2L4Q A;  2PU9 C;  1HNA A;  4NHZ A;  4TR1 A;  1PKZ A;  1ZOF A;  2O85 A;  4N10 A;  4RI6 A;  2QSI A;  2G0F A;  3QAV A;  2HRN A;  5KEJ A;  4F9Z A;  3GHA A;  2C80 A;  4HS1 A;  4LMV A;  3SWL A;  1M0U A;  2V2G A;  3TJK A;  2I1U A;  5FWG A;  3UJ1 A;  2YJH A;  3EC3 A;  2MBT A;  3MWH A;  3KH7 A;  3TDG A;  4ZBD A;  2H66 A;  5G30 A;  2IMD A;  1XVW A;  2BTO T;  2LQQ A;  3FW2 A;  4EKZ A;  3R2Q A;  1A0R P;  1TTZ A;  5IIZ A;  5KOW A;  1IYH A;  2C3T A;  3WYW A;  2VOC A;  4OO5 A;  4MJC A;  2I81 A;  4KH7 A;  3HZ4 A;  4FQU A;  2LNT A;  2CAI A;  3DVW A;  1GNW A;  4BVY A;  4OFN A;  4DSS B;  2VLV A;  3TKS E;  2FWH A;  2R0G A;  3ZVJ D;  3HVS A;  3LGC A;  1PL2 A;  3W6G A;  1EP8 A;  1W89 A;  4MH2 A;  4OFM A;  1K0B A;  3IOS A;  2B6M A;  4X43 A;  2H30 A;  1ERV A;  2JSZ A;  13GS A;  2YZU A;  4ZL9 A;  1A23 A;  2HZF A;  1EEM A;  1H4O A;  4MAB A;  4HEA 2;  3IRA A;  2E7P A;  3W8J A;  1JHB A;  1UN2 A;  1K3Y A;  3P2A A;  3GKN A;  4MF5 A;  2L57 A;  3CYN A;  2O87 A;  3DVX A;  5D93 A;  4ZIJ A;  2VM1 A;  4O7H A;  1K0C A;  3HXS A;  2HSY A;  1KEB A;  1SVO A;  2KOK A;  4JBB A;  2E2M A;  3EU3 A;  1DUG A;  19GS A;  3TKQ A;  4EIP A;  2GQM A;  3U5R E;  2HRK B;  3C73 A;  4N30 A;  1XBS A;  1K0D A;  2A2R A;  2LS5 A;  3QPM A;  4KND A;  4L5L A;  1SK1 A;  2E0Q A;  2F8F A;  5JCG A;  5D9T A;  4MJE A;  2J23 A;  2L5O A;  4GTU A;  1U3I A;  1XPV A;  2FD3 A;  4XTS A;  5IQY A;  4KX4 A;  2FWF A;  5ENU A;  2VO4 A;  1VF1 A;  3CSH A;  3ZIJ A;  5IMA A;  3LG6 A;  4X0X A;  4XS6 A;  2LRC A;  4CY8 A;  1A8L A;  1PQN A;  3WT2 A;  4NAX A;  2VD1 A;  1N2A A;  3VPQ A;  2YOI A;  1G0T A;  1O73 A;  1K0O A;  1OC9 A;  1B9X C;  4OCE A;  3CTG A;  5DQY A;  3LJR A;  1R4W A;  1E6B A;  3FZ4 A;  3GTU A;  3D0Z A;  3ERG A;  2DIY A;  4TXV A;  2H1L A;  4YKG A;  1FVK A;  1CQH A;  4WXT A;  1V2A A;  3RHB A;  4AKH A;  1MD3 A;  1O8W A;  3PGT A;  1T1V A;  2F51 A;  1WRY A;  3IK9 A;  1JFU A;  3MDK A;  4KDX A;  4GWR A;  5F05 A;  3DYR A;  2ZCT A;  4WF5 A;  1FOH A;  1Z9H A;  3WT1 A;  1U3A A;  3LYK A;  2R3X A;  2GS3 A;  2YJ7 A;  2FUG 2;  4FIW A;  1MDK A;  2DML A;  2FNO A;  4KSO A;  2GGT A;  1SK0 A;  4MCU A;  2GZP A;  1USB A;  3QOU A;  3GUS A;  4CDO A;  1AAZ A;  3DKS A;  4IW9 A;  7GSS A;  2GSR A;  2GT6 A;  1RW1 A;  4ZBA A;  5BMU B;  1EWX A;  1T4Y A;  2JU5 A;  4L8E A;  1W4V A;  3KD0 A;  1G7E A;  1FVJ A;  3W8S A;  2FLS A;  4KF9 A;  1QGV A;  3IDV A;  2WDU A;  3QAG A;  2VCQ A;  5DBQ A;  2MZC A;  9GSS A;  3L9S A;  3UMA A;  1EP7 A;  4KAE A;  3NIV A;  3G9B A;  3HKR A;  2YV9 A;  1GTU A;  3A2W A;  4CY6 A;  1T4Z A;  1K0N A;  2MMZ A;  4PQI A;  2JAD A;  1EV4 A;  1TXU A;  2B3S A;  2L59 A;  3TJG A;  4O5R A;  6GSY A;  4POB A;  2WB9 A;  2ES7 A;  4KA0 A;  1A24 A;  2VCV A;  3F6F A;  4V2L A;  3H4K A;  5IOX A;  2AYT A;  3EVI A;  1K0A A;  3HA9 A;  4GST A;  3D22 A;  2N5F A;  4MLY A;  1TW9 A;  1GWC A;  4Q5Q A;  4OFT A;  5CRW A;  1XW6 A;  4RQR A;  2B5X A;  3RBT A;  1OKT A;  4WBR D;  4G01 A;  1PSQ A;  1X9W B;  1TRU A;  2IPA A;  3KTB A;  4BVX A;  3NOF A;  2FA4 A;  2ALB A;  4EVM A;  2R0P A;  1K3O A;  1U6T A;  3TKR A;  5DAK B;  2H72 A;  4LL1 B;  5CP1 A;  3GH6 A;  3ZLP A;  4EDZ A;  1FB0 A;  4MNN A;  3UBK A;  3KP9 A;  2B5E A;  4EIQ A;  4PQH A;  3ZTL A;  5IMF A;  2IFQ A;  3TKP A;  2OAD A;  1QK8 A;  1TU8 A;  3EIN A;  1OE7 A;  4YQM A;  3IK7 A;  2PGT A;  2FY6 A;  4NPB A;  4K0G A;  3GIX A;  2PMT A;  1JZW A;  3WGE A;  5DJL A;  1FHE A;  2XBI A;  3Q18 A;  5J41 A;  4ZXG A;  3MIX A;  5H5S A;  2GZZ A;  3BJ5 A;  1AC1 A;  3DEX A;  1PKW A;  1EV9 A;  4ILF A;  18GS A;  2X49 A;  2HRF A;  1LBK A;  3NZN A;  4PTS A;  4NXI A;  1WOU A;  1SK2 A;  1OC8 A;  1JLW A;  2D2Z A;  1XFL A;  3M0F A;  4H86 A;  3FR3 A;  5B7C A;  1YF0 A;  6GSU A;  4ZBB A;  2P31 A;  1OVN A;  2K18 A;  2K6V A;  2HLS A;  1X9M B;  2WUL A;  5IPH A;  2KLX A;  1LU4 A;  2H70 A;  5ID2 B;  2JZT A;  1YVL A;  4IGJ A;  2A4V A;  2GQL A;  1X0R A;  1XW9 A;  3RHC A;  5ECR B;  3KMO A;  1V40 A;  3UOM A;  1M2B A;  3EUR A;  5CNW A;  5ECO B;  2NTO A;  1AXD A;  4BPY A;  2B7K A;  4XRD A;  2I9H A;  1GUL A;  4IQ1 A;  4I6X A;  5HFI A;  5GAN D;  1MD4 A;  3KXO A;  3TKS A;  3TCO A;  4K7N A;  5IO2 A;  4IJ3 A;  1SJI A;  1YQ1 A;  4TRX A;  1NHY A;  3GX8 A;  4PX1 A;  2LST A;  4RQX A;  4KGI A;  1VF4 A;  1JZR A;  2LQO A;  4EDY A;  2L6D A;  1GTA A;  4ML6 A;  2UZ8 A;  2H0I A;  22GS A;  1Y1U A;  4F0C A;  3GN3 A;  5C00 A;  3FZ5 A;  1SKW B;  1V57 A;  1YDK A;  4WR5 A;  1BYE A;  3TJF A;  5GSS A;  2H1B A;  2LJA A;  3H79 A;  3LXZ A;  3IHG A;  4POM A;  1ZYN A;  3ISO A;  1BED A;  1M7T A;  1R5P A;  1K3L A;  2KP2 A;  5A5K A;  2C0F A;  2VIM A;  5KN3 A;  2HRA A;  3VWV A;  16GS A;  4MDC A;  5J4U A;  5IO0 A;  4WET A;  3BBY A;  1TRW A;  1FB6 A;  1ACV A;  2NPB A;  3D6I A;  3ZFL A;  2PUK C;  4TR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...