4IJIA

Crystal structure of a glutathione transferase family member from psuedomonas fluorescens pf-5, target efi-900011, with bound s-(propanoic acid)-glutathione
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
204
structure length
204
Chain Sequence
SLTLFHNPASPYVRKVMVLLHETGQLNRVALQASQLSPVAPDAALNQDNPLGKIPALRLDNGQVLYDSRVILDYLDQQHVGNPLIPRDGSARWRRLTLAALADGIMDASVLVRYELALRAPEKHWEQWLDGQRDKIRRALAVLEAEAIAELASHFDIAAISVACALGYLDFRHPDLEWRQDHPQLAAWYFEISQRPSMLATRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase-like protein YibF
publication title Crystal structure of a glutathione transferase family member from Psuedomonas fluorescens Pf-5, target EFI-900011, with bound S-(propanoic acid)-glutathione
rcsb
source organism Pseudomonas protegens
total genus 67
structure length 204
sequence length 204
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ijiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ijiA01
1XWKA 2HRAA 2CV4A 3GURA 3IA1A 4V2LA 1F37A 2V6KA 2YWIA 1ZL9A 1QQ2A 1FOVA 4WXTA 4ZL9A 4MABA 2LV3A 3I69A 2GSTA 3Q19A 2YV9A 3I9V2 1ST9A 2NPBA 4LMWA 1ZYEA 3EINA 3CTGA 3MAKA 3GH6A 1F3AA 4GF0A 2H75A 4OFTA 5ECOB 2H71A 3CTFA 1GTIA 4HZ2A 4PXOA 4YQVA 2OACA 3ERFA 3TKQA 1EP7A 1O8XA 1DSBA 2H1GA 5J41A 1U3IA 2KUCA 1QMVA 5CRDA 1GSUA 4OO4A 1H4OA 2EIRA 5HR2A 3HA9A 4MP4A 3IDVA 3FRCA 4MJAA 1XBSA 1HNAA 3KMNA 1G7OA 3ME7A 1GRXA 5IMZA 1G0TA 5AGYA 2VLVA 4Q5FA 1Z7PA 3E9JB 1K0NA 1NHYA 1PN9A 6GSTA 1GSSA 3UBKA 1K0BA 3IK7A 2IMEA 2OADA 3LJRA 2VCWA 3TRQA 1V58A 3VWXA 4L5LA 1W4VA 2H74A 4H86A 4MZCA 2WFCA 3GKMA 5ELGA 5J4UA 1SENA 1PX6A 4BVYA 4TOPA 3DKSA 2VCZA 4PTSA 4XRDA 3A2VA 4TVEA 1R5PA 5DJMA 2I3YA 3LWAA 2FWFA 5IM9A 1EGRA 1M2DA 3SWLA 3UMAA 2HSYA 1PL2A 3PR8A 3CXGA 5IOWA 3ERGA 4FYBA 2GT5A 2LQQA 4AF2A 3W8JA 1XIYA 1TRUA 2JACA 3FY7A 2IJYA 4KCAA 5IIZA 2R5GA 1M7TA 5ENUA 3GX8A 1V40A 4X1UA 2R4VA 5G5FA 4Q5QA 2O8VB 3EU4A 4AJ6A 2HRKA 5ECQB 2HZEA 1OE8A 1OC9B 5ECMB 3L0HA 1B9YC 1XW5A 3HZ8A 2WJUA 3UARA 2GQMA 5KEJA 2MYGA 3TKRA 4WF5A 1GULA 4FYUA 2WRTA 2MMAA 2XBQA 5IO0A 1VRSD 2ZUPA 2NTOA 2AB6A 1ZOFA 1BAYA 2X8GA 5HFGA 4HJ2A 4XIHA 1AUCA 1SD8A 5DDLA 4RQRA 1XOBA 1J9BA 5G30A 4EXJA 4OWYA 2GSSA 1AAZA 2IMKA 5BMUA 1U3AA 4L0WA 3J7Yk 2O85A 1J0FA 4CDOA 4YAPA 4G10A 3EE2A 2FCHA 3IXRA 2AJQB 1A8LA 1XOAA 3D21A 3GHAA 2H1AA 2YV7A 1M0UA 2GQLA 3I43A 2O7KA 3IPZA 4ZBDA 2C3NA 3KH9A 1XVQA 1FW1A 1AC1A 3ME8A 1O73A 5DCGA 3UJ1A 4HUAA 3G7YA 2DMMA 1OYJA 1XWCA 2H73A 3KIJA 5G1LA 1WPIA 4O32A 4KE3A 2OBKA 3VI5A 3UOMA 4POMA 4MF5A 2JZRA 4PNFA 2V2GA 4IGJA 2JU5A 3Q18A 5H5QA 1XVWA 1SKSB 4XS4A 1W89A 1MTCA 5F8BA 1Z5YE 2VL3A 4EE0A 2LNSA 4OO5A 5DQSA 3KEBA 5IO2A 5IMCA 3BJ5A 5J5NA 2WDUA 1YF0A 3A5WA 2E0QA 2WB9A 4WEYA 2C3TA 2H01A 1O85A 3QAGA 2RM6A 1THOA 3KD0A 2B6MA 2CX4A 4POBA 1M99A 3TJFA 5C04A 3GUSA 1XW6A 3EVIA 1A23A 3APQA 3GA4A 5GAND 3GYKA 3DXBA 2VAFA 4FYCA 2L4QA 4BVXB 1QFNA 2YCDA 4WBRD 3UL3A 4HQZA 1RQMA 1ERTA 1T7PB 3PINA 2HLSA 2DBCA 2RIIA 2MBSA 4GSTA 6GSVA 4CW9A 1GLQA 5D9VA 3G7IA 3TJGA 3ZYWA 2DIZA 4JRRA 4Q5RA 1YKAA 4ML1A 2KHPA 4F9ZA 1I5GA 1RW1A 3NIVA 3C1SA 2JSYA 2CVDA 3KXOA 3L9VA 1WIKA 12GSA 4EUYA 4EVMA 3H79A 2OE1A 3LYPA 6GSYA 3GTUA 3TJKA 3GL5A 5CNWA 4V2MA 2A2SA 1O7UA 4K7OA 1VF4A 1V9WA 2GGTA 3IBHA 4WKWA 1MD4A 4ISDA 2ZCTA 1WJKA 4NPBA 2H72A 2C80A 1TRSA 3QAVA 1KEBA 1UVZA 3LXTA 3FW2A 1MDIA 13GSA 1WMJA 1PKZA 5INYA 3ZIJA 4Q5NA 4LMVA 2EIQA 1TKDB 4NAXA 1K0DA 1Z6NA 3IOSA 20GSA 3NZNA 2FNOA 1WWJA 5JCGA 1TXXA 4WBJA 3TRPA 5B7CA 4ULXA 4AJ8A 5J9CA 1Z7RA 1XZOA 3DIEA 2MMOA 1V2AA 3F4TA 5D9XA 2L6DA 3LYKA 1SKWB 4E8HA 1B8XA 1TK8B 3LGCA 2NVLA 3GRXA 1NM3A 3IHQA 3GMFA 5IMAA 3KJYA 3TCOA 4X43A 2XPDA 3US3A 1URMA 2KP2A 2H6ZA 5IMFA 5LCZA 4XTSA 1TW9A 1EOHA 3M9KA 2OKAA 2AHEA 1FHEA 3D22A 1QXHA 1B48A 3RPPA 3F0IA 2M72A 4KX4A 3U5RE 4F0CA 2X8CA 3G7JA 5ID2B 4MH3A 1YF1A 4XS4B 4KDUA 2FWHA 2D2ZA 4PQIA 2QGVA 2EIOA 4N30A 2WS2A 2P31A 2KP1A 2CQ9A 2VCQA 2K8VA 2K9FA 4K0GA 5CYYA 3GKNA 5JWQB 5AIVA 1FO5A 4J57E 1QUWA 1EGOA 2LEGA 18GSA 1SJZA 3RHBA 4ECJA 1I9DA 6GSWA 3WYWA 2IL3A 1GH2A 2LRNA 5AISA 1O6JA 2XBIA 3O6TA 3TDGA 1TOFA 2G2QA 2C1YA 5DVBA 4ZL8A 4QQ7A 1WE0A 1G6WA 3UVHA 3E0UA 4V2NA 1IYIA 4TXOB 5ECHB 5JWOB 2HSHA 4WETA 2VCTA 2HE3A 2GVPA 1U88A 2V6OA 2BMXA 1UA5A 1EEJA 2ZNMA 3ZIVA 2V32A 3D4TA 2K18A 3DVWA 3G9BA 1VF3A 1E6BA 2DJKA 3TGZA 3ZFBA 3Q74A 5C00A 4KGIA 2FA4A 5JCUA 1F6MC 4KW6A 2LRCA 2TIRA 1AQXA 2IWTA 4EKZA 4WR4A 2R6KA 4TKYA 4I2TA 1AQWA 2E2MA 4GSNA 2IN3A 3H8QA 4NV5A 3D5JA 5B6MA 1MDKA 1Q4JA 3L9SA 4AGSA 1X5DA 3TJJA 4IQAA 4J2FA 1XFLA 3QFAC 1KBNA 16GSA 2H0GA 3GTUB 2B7KA 2IMIA 3VLNA 3DMLA 4N0ZA 4YQMA 3EWLA 1UC7A 3IRAA 3HCZA 1R7HA 4IBPA 2LKUA 5EVOA 3RHCA 3IC8A 2I81A 4JR4A 1PSQA 3FR6A 2C8UA 2VCXA 2VD0A 2XC2A 2YP6A 2LSTA 5DCHA 1RK4A 3CBUA 1YJ6A 1OAZA 1Z6MA 1ZCPA 4I2UA 4HOJA 1CQHA 1ERUA 3M9JA 4FQUA 2RUEA 5EPFA 1IYHA 2ALBA 2NDOA 2F9SA 2HQTA 3ZFLA 4HJMA 3D6IA 4ZILA 4N0VA 5KN2A 4TR1B 8GSSA 1MDJA 4DSQA 2HSMA 1GSYA 2AUVA 3QFBC 4NXIA 3C7MA 1LJRA 3HZ4A 4OFNA 2JZTA 3TKSE 2VL2C 2OE3A 2QC7A 2FY6A 2YNXA 4FH8A 4IELA 3PGTA 1DUGA 2IMFA 4NHZA 3TKSC 1HD2A 2I1UA 3A3TA 4ECIA 5AIXA 19GSA 2X64A 4EO3A 3OR5A 4POLA 2OA7A 4JBBA 5IPGA 1YKCA 3WGDA 3UAPA 1Y6EA 2B1KA 1T00A 1F9MA 5KN0A 1XPVA 1HNBA 2HI7A 2YZHA 1AXDA 2FA8A 1EWXA 3UIWA 4DSRA 2ON5A 2H1BA 4ZBAA 3F3QA 3ZREA 4EC0A 4CHSA 1EP8A 1O81A 1FG4A 1M9AA 1EOGA 5D96A 4MDCA 5IPHA 3UVTA 1GL8A 2YWOA 2JZSA 3MWHA 1SYRA 2YZUA 5J9BA 3KGKA 7GSSA 1E2YA 5COHA 1HQOA 2WCIA 4ACSA 4YQUA 2LTKA 2C0GA 3DYRA 1GWCA 3WGXA 3ZMLA 4NMUA 10GSA 4EL1A 5DAKB 1M9BA 4IP1A 4PNGA 2VCVA 3QMXA 2PVOC 1V57A 4DSSA 1PA3A 4JU5A 1TK0B 1N8JA 2YJHA 4ECBA 1SL1B 5IMDA 4HDEA 4MZWA 2WULA 4KDXA 3IAS2 1YDKA 4P3YB 2L6CA 3TUEA 2L4CA 1FVKA 3CMIA 2REMA 2VUPA 4K1FA 2P5QA 3IV4A 2HSNB 1WRYA 5CRGA 4F0BA 5A4VA 5LD0A 1MEKA 3F6FA 3FZAA 2R2JA 3LQ7A 3KCMA 3ED3A 5E59A 3UEMA 3ZVJA 4G0LA 4KB3A 1WOUA 3DD3A 1TU7A 2YPMA 4BL7A 4MF6A 1Q98A 3WD6A 3MSZA 2GZZA 1R4WA 4GQCA 3WT2A 1X9MB 2HNLA 1DE1A 4GWRA 3KP9A 4LL1B 4G0KA 5ECPB 4O7HA 4PURA 2F8AA 4QL7A 4OCFA 2MMZA 2I9HA 2GDRA 4KH7A 4D73A 2IIYA 1SJ6A 1GSQA 1ZYQB 1HYUA 3R2QA 3V1WA 5DALA 1GSFA 2IFQA 2WGRA 2FWGA 1BX9A 3ZVJD 4IHUA 3UBLA 1YQ1A 4BVYB 1DE2A 3QR6A 3FZ4A 2QKEA 2H76A 4FIWA 2OE0A 5A4WA 1TI1A 2LUSA 2DLXA 5CRWA 4HS1A 5GAPD 1B4PA 1HNCA 4TN8A 3HD5A 2IPAA 4IP6A 1NSWA 2JL4A 5LNKe 5IQYA 3TOTA 4TR3A 3RDWA 5E4WA 3ISOA 2O87A 5B6NA 5ECKB 2H66A 1USBA 5H5SA 2C0FA 2DJ3A 2FLSA 4BWSA 1X9WB 2E2GA 2A2RA 4F03A 1YY7A 4HZ4A 3KTLA 1CQGA 3KTBA 4KSMA 4ZXGA 3VFIA 3ZTLA 2OJLA 1THXA 4QL9A 3DWVA 2PN8A 1NHOA 2HRKB 2HZEB 3F63A 5J3RA 1AQVA 3N5OA 2YWNA 1JFUA 3J7Yb 4JZQA 4PUAA 3C8EA 3EURA 3FR9A 1G7EA 3EU3A 3WGEA 2DIYA 2DJ1A 2M80A 2A4VA 2HRFA 2MZCA 3S9FA 3P90A 3R3EA 1T3BA 5HR1A 1YZXA 2ON7A 4JEDA 4AJ7A 1ZMAA 1TDIA 4TW5A 3TRXA 3HYPA 1QK8A 3D0ZA 2DMLA 5IOXA 1S3CA 2H1DA 3VI7A 3ZMKA 4MMMA 4K7IA 4GTUA 2P0GA 2B7JA 4BPYA 2PWJA 5ECLB 2XHFA 2FWEA 3VWVA 1ML6A 2B5EA 4ZBBA 5G1KA 1AIUA 2H0HA 2PMTA 2Z9SA 2H30A 3F8UA 3DGQA 1GSDA 3EC3A 5D9TA 5FT3A 1KTEA 1XXUA 4KDYA 1BEDA 1XW9A 4O5RA 4TRXA 4TXVA 2CAQA 2H8LA 1JZOA 1TI3A 2CA8A 2LJKA 3HHVA 1GNEA 2TRXA 2VLUA 1PRXA 2N5AA 1K3YA 3VURA 1YEXA 2FGXA 4NWYA 5CRHA 4K6XA 2B1LA 3DVXA 5D9WA 3FK8A 2BTOT 3C1RA 9GSSA 2FD3A 2VLTA 1T8EB 1ABAA 2B3SA 3KMOA 4KA0A 2RLIA 4G2EA 3P7XA 1OC9A 1SK0A 3IK9A 4K0NA 2OBIA 1K0MA 14GSA 2HRNA 4PQ1A 2K8SA 4XRAA 1TRVA 3TB2A 1K3OA 4MJCA 4D73B 1PMTA 3JCML 1EEMA 3A2WA 4F82A 1GTAA 3BOAA 1J08A 4I5QA 2N5BA 4LA1A 2DC5A 3BD2A 1V98A 1PQNA 4PGTA 5HQPA 4N10A 4BA7A 5F0GA 4FO5A 4IJ3A 1PX7A 3BCIA 1X9SB 1FB6A 4PUFC 2I4AA 1BG5A 2GSRA 1T4ZA 3M1GA 5ELAA 4K7NA 3O3TA 1OVNA 3GX0A 1Z9HA 2DJ2A 3SBCA 2H6XA 3LORA 1LBKA 1SU9A 2L57A 1S3AA 1M2BA 1O8WA 4XS1A 1GTBA 2PVQA 1BYEA 1OC3A 3W8SA 3IR4A 4PX1A 2RM5A 4OD7A 1GLPA 3NOFA 2V41A 4K2DA 2DJJA 4G0IA 2CZ3A 4RI6A 4X0XA 3TKPA 3KZQA 1G6YA 3GNJA 5DBQA 4JE1A 4KUNA 3C73A 3LSZA 2RUFA 3APSA 4MCUA 3HJOA 1F2EA 3QOUA 2CZ2A 4IW9A 2JADA 2LJRA 4IVFA 4LLRA 4E8EA 3H93A 3CSHA 5F07A 1K0OA 2V1MA 3ZLPA 1BQ7A 3F9UA 2AV4A 2WZ9A 1X5EA 1ON4A 4ZB6A 3EYTA 2DJ0A 3GN3A 5DQYA 3N9JA 1YEPA 4USSA 4TR4A 3L78A 4ECCA 3PPUA 11GSA 2CVBA 2LRTA 1T1VA 5ECRB 5HR0A 3IC4A 2C0DA 2JSZA 4MZBA 3HJMA 3A2XA 4IJIA 1K0AA 5B8BA 5IMVA 4BVXA 4MJBA 5KN3A 4YH2A 4MA9A 4EDZA 2GS3A 3FKFA 3VWWA 2CX3A 3IE3A 1GUHA 2J9HA 3P2AA 1LU4A 1EZKA 1XWAA 5F06A 2O89A 4JR6A 3C71A 2YWMA 4TR0A 2F8FA 3CSIA 5F05A 4RQXA 4F2IA 1PL1A 3F3RA 1KNGA 1K0CA 3LG6A 1OKTA 3M8NA 4MPFA 1JHBA 2H19A 3CRUA 3HY2A 4OMVA 4NHWA 2P5RA 3M0FA 3HVSA 4YAVA 2B5XA 2HT9A 5HR3A 1ZZYA 2HZFA 5GSTA 3QD9A 2VM2A 3ZITA 1UN2A 5FWGA 2F51A 2QSIA 1A2LA 1Z3EA 2VIMA 2PUKC 3H4KA 3IAM2 2VM1A 3MNGA 5JCWA 2LNTA 4V1Ap 1JZDA 2R37A 4I97A 2GT6A 6GSSA 4XCSA 2UZ8A 4MLYA 2PGTA 3U6VA 1PD21 4OCEA 4DVCA 3QDNA 1X0RA 3D4MA 3BCKA 1EV9A 1SD9A 3GV1A 1TK5B 3FHKA 1R5AA 4G19A 3K8NA 1SK1A 2VL2A 4RI7A 3DRNA 3VPTA 1X5CA 4GXZA 4I8BA 4BWQA 3CYNA 3F4RA 3HVXA 2L5LA 2GZYA 3TKSA 5ABRA 1PKWA 5EL8A 1QGVA 2K6VA 3E3EA 3GSTA 5G31A 1U6TA 4POKA 2R3XA 1C72A 3I6AA 5D93A 5FHIA 6GSXA 2EC4A 3HDCA 2TRCP 3FZ5A 3CRTA 1SL2B 2YN1A 2VO4A 3F4SA 2E7PA 1FAAA 2VD1A 4ZL7A 4ZB8A 1H75A 1JZWA 4OFMA 5KN1A 1DBYA 5ID2A 1S3DA 2M46A 3RAZA 1GUMA 3LEFA 1ERVA 3TOUA 3L9UA 1SK2A 2GLRA 5GSSA 2DSAA 1GTUA 1Y25A 2MMNA 3RBTA 2N5FA 2AYTA 2L59A 1BJXA 3EMXA 4NV2A 3KP8A 2VOCA 3P8WA 4HI7A 1SJIA 3QCPA 3GKKA 5CP1A 5JWRB 2YANA 1NW2A 2HSMB 1M2AA 1R26A 5ECNB 5EY6A 4PQHA 4TXOA 3KM6A 2HFDA 3FEUA 4O92A 1OKDA 1JZRA 1ZGNA 1A24A 1AW9A 2GQKA 2LQOA 2GSQA 1VF1A 5DJLA 4N11A 2PPTA 3QAWA 4J56E 2J23A 5B8AA 2IMDA 5GZZB 3GL3A 1XWGA 4HU7A 4HU9A 4ML6A 3ZL5A 4GSSA 4V1Ag 2ES7A 1TU8A 1PGTA 1A2MA 3FYGA 2PBJA 4HEA2 3FZ9A 2L5OA 4GCIA 1OE7A 1VGLA 4IN0A 1A0RP 4XHMA 17GSA 1SKRB 6GSUA 3O76A 1FB0A 2NBSA 2HYXA 1VF2A 5HFIA 3GKXA 3GFKA 3VPQA 2KOKA 4K8MA 1A0FA 1F3BA 5D73A 2HXKA 1TRWA 1A8YA 2C4JA 1GSEA 2CVKA 2X8HA 3H1NA 5A4UA 1SL0B 5ECIB 3LFLA 4KAEA 1XWBA 3HXSA 4MPGA 4GRFA 3FR3A 1EV4A 1JLWA 5G5EA 4MF7A 4DEJA 2GTUA 2B5YA 3GSSA 2AAWA 1TJDA 4KCEA 1ACVA 4WF4A 4EF0A 5CO3A 4DSSB 3BBYA 3LXZA 2G0FA 2YOIA 3GIXA 4TR1A 2PU9C 4EDYA 2X99A 4ZB9A 1TP9A 2LJAA 3F6DA 4GQFA 3MDKA 3EMPA 3CSJA 4ZIJA 2YJ7A 3ZZXA 2CT6A 3HKRA 4ILFA 1N2AA 5HFKA 3KH7A 2C0EA 3GH9A 4MH2A 4K9ZA 3AY8A 1T4YA 4MJEA 4IQ1A 3VK9A 1TTZA 4WR5A 3HVVA 3L4NA 2H70A 5A5KA 1XCCA 1MD3A 4BL7B 3TJBA 3VWUA 22GSA 3Q6OA 3APOA 4HQSA 2C3QA 2F3MA 2GZPA 2H0IA 5AN1A 2XPEA 1A2JA 1JLVA 3HJPA 4GLTA 4KSOA 4RUVA 2LS5A 5ECSA 1GUKA 5CAXA 5G2ZA 1K3LA 5L71A 4I6XA 1ILOA 4IKHA 4L0UA 2PERA 5H5RA 1B4QA 4KF9A 2H6YA 2CAIA 5DALB 2IFQB 4ID0A 3PH9A 1U87A 2MBTA 4L5OA 4LL4B 1ERWA 5CREA 2VL9A 3M3MA 1WP0A 4XS6A 3WT1A 2BJXA 1B9XC 3ZRDA 1GNWA 3ERWA 3QPMA 2FUG2 3W6GA 4L8EA 4Z7XA 4IS0A 5D8IA 5DAKA 3DEXA 4KNDA 1GP1A 2FHEA 1SYXA 1OC8A 3RPNA 4MK3A 1FVJA 2KLXA 4G9HA
chains in the Genus database with same CATH superfamily
1XWKA 2HRAA 2CV4A 3GURA 3IA1A 4V2LA 1F37A 2V6KA 2YWIA 1ZL9A 1QQ2A 1FOVA 4WXTA 4ZL9A 4MABA 2LV3A 3I69A 2GSTA 3Q19A 2YV9A 3I9V2 1ST9A 3IHGA 2NPBA 4LMWA 1ZYEA 3EINA 1BF5A 2HSNA 3CTGA 3MAKA 3GH6A 1F3AA 4GF0A 2H75A 4OFTA 5ECOB 2H71A 3CTFA 1GTIA 4HZ2A 4PXOA 3RFRC 4YQVA 2OACA 3ERFA 3TKQA 1EP7A 1O8XA 1DSBA 2H1GA 5J41A 1U3IA 2KUCA 1QMVA 5A1NA 5CRDA 1GSUA 4OO4A 1H4OA 2EIRA 5HR2A 3HA9A 4MP4A 3IDVA 3FRCA 4MJAA 1XBSA 1HNAA 3KMNA 1G7OA 3ME7A 1GRXA 5IMZA 1G0TA 5AGYA 2VLVA 4Q5FA 1YEWC 1Z7PA 3E9JB 1K0NA 1NHYA 1PN9A 6GSTA 5J4YA 1GSSA 3UBKA 1K0BA 3IK7A 2IMEA 2OADA 3LJRA 2VCWA 3TRQA 1V58A 3VWXA 4L5LA 1W4VA 3HMJG 2H74A 4H86A 4MZCA 2WFCA 3GKMA 5ELGA 3MYDA 5J4UA 1SENA 1PX6A 4BVYA 4TOPA 3DKSA 2VCZA 4PTSA 4XRDA 3A2VA 4TVEA 1R5PA 5DJMA 2I3YA 3LWAA 2FWFA 5IM9A 1EGRA 1M2DA 3SWLA 3UMAA 2HSYA 1PL2A 3PR8A 3CXGA 5IOWA 3ERGA 4FYBA 2GT5A 2LQQA 4A5PA 1SVLA 4AF2A 3W8JA 1XIYA 1TRUA 2JACA 3FY7A 2IJYA 4KCAA 5IIZA 2R5GA 1M7TA 5ENUA 3GX8A 1V40A 4X1UA 2R4VA 5G5FA 4Q5QA 2O8VB 3EU4A 4AJ6A 2HRKA 5ECQB 2HZEA 1OE8A 1OC9B 5ECMB 2DKHA 2O3EA 3L0HA 1B9YC 1XW5A 3HZ8A 2WJUA 2H1LA 3UARA 2GQMA 5KEJA 2MYGA 3TKRA 4WF5A 1GULA 2WRTA 2MMAA 2XBQA 4FYUA 5IO0A 2WVZA 1VRSD 2ZUPA 2NTOA 2AB6A 1ZOFA 1BAYA 2X8GA 5HFGA 4HJ2A 4XIHA 1AUCA 1SD8A 5DDLA 1SVOA 4RQRA 1XOBA 1J9BA 5G30A 4EXJA 4OWYA 2GSSA 1AAZA 2IMKA 5BMUA 1U3AA 4L0WA 3J7Yk 2O85A 1J0FA 4CDOA 4YAPA 4G10A 5A5HB 4Z2UA 3EE2A 2FCHA 3IXRA 2AJQB 1A8LA 1XOAA 3D21A 3GHAA 2H1AA 2YV7A 1M0UA 2GQLA 4GDFA 3I43A 2O7KA 4O5QA 3IPZA 4ZBDA 2C3NA 3KH9A 1XVQA 1FW1A 1AC1A 3ME8A 1O73A 4EIPA 5DCGA 3UJ1A 4HUAA 3G7YA 2DMMA 1OYJA 1XWCA 2H73A 3KIJA 5G1LA 1WPIA 4O32A 4KE3A 2OBKA 3VI5A 3UOMA 4POMA 4MF5A 2JZRA 4PNFA 2V2GA 4AKHA 4IGJA 2JU5A 3Q18A 5H5QA 1XVWA 1SKSB 4XS4A 1W89A 1MTCA 3HVNA 4YKGA 5F8BA 1Z5YE 2VL3A 4EE0A 2LNSA 4OO5A 5DQSA 3KEBA 5IO2A 5IMCA 3BJ5A 5J5NA 2WDUA 1YF0A 3A5WA 2E0QA 2WB9A 4WEYA 2C3TA 2H01A 1O85A 3QAGA 2RM6A 1THOA 3KD0A 2B6MA 2CX4A 4POBA 1M99A 3TJFA 5C04A 3GUSA 1XW6A 3EVIA 1A23A 3APQA 3GA4A 3CHXC 5GAND 3GYKA 3DXBA 2X4AA 2VAFA 4FYCA 2L4QA 4BVXB 1QFNA 2YCDA 4WBRD 3UL3A 4HQZA 4Z2TA 1RQMA 1ERTA 1T7PB 3PINA 5A34A 2HLSA 2DBCA 2RIIA 2MBSA 4GSTA 6GSVA 4CW9A 1GLQA 5D9VA 3G7IA 3TJGA 3ZYWA 2DIZA 4JRRA 4Q5RA 1YKAA 4ML1A 2KHPA 3CQFA 4F9ZA 1I5GA 1RW1A 3NIVA 3C1SA 2JSYA 2CVDA 3KXOA 3L9VA 1WIKA 12GSA 4EUYA 4EVMA 3H79A 2OE1A 3LYPA 6GSYA 3GTUA 3TJKA 3GL5A 5CNWA 4V2MA 2A2SA 1O7UA 4K7OA 1VF4A 1V9WA 2GGTA 3IBHA 4WKWA 1MD4A 4ISDA 2ZCTA 1WJKA 4NPBA 2H72A 2C80A 1TRSA 3QAVA 1KEBA 1UVZA 3LXTA 3FW2A 1MDIA 13GSA 1WMJA 1PKZA 5INYA 3ZIJA 4Q5NA 4LMVA 2EIQA 1TKDB 4NAXA 1K0DA 1Z6NA 3IOSA 20GSA 2R0PA 3NZNA 2FNOA 1WWJA 5JCGA 1TXXA 4WBJA 3TRPA 5B7CA 4ULXA 4AJ8A 5J9CA 1Z7RA 1XZOA 3DIEA 3TU3B 2MMOA 1V2AA 3F4TA 5D9XA 2L6DA 3LYKA 1SKWB 2EFCA 4E8HA 1B8XA 1TK8B 3LGCA 2NVLA 3GRXA 1NM3A 3IHQA 3GMFA 2UV8G 5IMAA 3KJYA 3TCOA 4X43A 2XPDA 3US3A 1URMA 2KP2A 2H6ZA 5IMFA 5LCZA 4XTSA 1TW9A 1EOHA 3M9KA 2OKAA 2AHEA 1FHEA 3D22A 1QXHA 1B48A 3RPPA 3F0IA 2M72A 4KX4A 3U5RE 4F0CA 2X8CA 3G7JA 5ID2B 2WW1A 4MH3A 1YF1A 4XS4B 4KDUA 2FWHA 5KOWA 2WVXA 2D2ZA 4PQIA 2QGVA 2EIOA 4N30A 2WS2A 2P31A 2KP1A 2CQ9A 2VCQA 2K8VA 2K9FA 4K0GA 5CYYA 3GKNA 5JWQB 5AIVA 1FO5A 4J57E 1QUWA 1EGOA 2LEGA 18GSA 1TXUA 1SJZA 3RHBA 4ECJA 1I9DA 6GSWA 3WYWA 2IL3A 1GH2A 2LRNA 5AISA 1O6JA 2XBIA 3O6TA 3TDGA 1TOFA 2G2QA 2C1YA 5DVBA 4ZL8A 4QQ7A 1WE0A 1G6WA 3UVHA 3E0UA 4V2NA 1IYIA 4TXOB 5ECHB 5JWOB 2HSHA 4WETA 2VCTA 3LW9A 3EPTA 2HE3A 2GVPA 1U88A 2V6OA 4ZB7A 2BMXA 1UA5A 1EEJA 2ZNMA 3ZIVA 2V32A 3D4TA 2K18A 3DVWA 3G9BA 4Z2RA 1VF3A 1E6BA 2DJKA 3TGZA 3ZFBA 3Q74A 5C00A 4KGIA 2FA4A 5JCUA 1F6MC 4KW6A 5A34B 2LRCA 2TIRA 1AQXA 2IWTA 4EKZA 4WR4A 2R6KA 4TKYA 4I2TA 1I1IP 1AQWA 2E2MA 4GSNA 2IN3A 3H8QA 4NV5A 3D5JA 5B6MA 1MDKA 1Q4JA 3L9SA 4AGSA 1X5DA 3TJJA 4IQAA 4J2FA 1XFLA 3QFAC 1KBNA 16GSA 4QMKA 2H0GA 3GTUB 2B7KA 2IMIA 3VLNA 3DMLA 4N0ZA 4YQMA 3EWLA 1UC7A 3IRAA 3HCZA 4X4JA 1R7HA 2R0GA 4IBPA 2LKUA 5EVOA 3RHCA 3IC8A 2I81A 4JR4A 1PSQA 3FR6A 2C8UA 2VCXA 2VD0A 2XC2A 2YP6A 2LSTA 5DCHA 1RK4A 3CBUA 1YJ6A 1OAZA 1Z6MA 1ZCPA 4I2UA 4HOJA 1CQHA 1ERUA 3M9JA 4FQUA 2RUEA 5EPFA 1IYHA 2ALBA 2NDOA 2F9SA 2HQTA 3ZFLA 4K5SA 4HJMA 3D6IA 4ZILA 4N0VA 5KN2A 4TR1B 8GSSA 5KOXA 1MDJA 4DSQA 2HSMA 1GSYA 2AUVA 4AKGA 3QFBC 4NXIA 3C7MA 1LJRA 3HZ4A 4OFNA 2JZTA 3TKSE 2VL2C 2OE3A 2QC7A 2FY6A 2YNXA 4FH8A 4IELA 3PGTA 1DUGA 2IMFA 4NHZA 3A5IA 3TKSC 1HD2A 2I1UA 3A3TA 4ECIA 5AIXA 19GSA 2X64A 4EO3A 3OR5A 4POLA 2OA7A 4JBBA 5IPGA 1YKCA 3WGDA 3UAPA 1Y6EA 2B1KA 1T00A 1F9MA 3MIXA 5KN0A 1XPVA 1HNBA 2HI7A 2YZHA 1AXDA 2FA8A 1EWXA 3UIWA 4DSRA 2ON5A 2H1BA 4ZBAA 4K2XA 3F3QA 3ZREA 4EC0A 4CHSA 1EP8A 1O81A 1FG4A 1M9AA 1EOGA 5D96A 4MDCA 5IPHA 3UVTA 1GL8A 4ICYA 2YWOA 2JZSA 3MWHA 1SYRA 5J4VA 2YZUA 5J9BA 3KGKA 7GSSA 1E2YA 5COHA 1HQOA 2WCIA 4ACSA 4YQUA 2LTKA 2C0GA 3DYRA 1GWCA 3WGXA 3ZMLA 4NMUA 10GSA 4EL1A 5DAKB 1M9BA 4IP1A 2EFDA 4PNGA 2VCVA 2WZSA 3QMXA 2PVOC 1V57A 4DSSA 1PA3A 4JU5A 1TK0B 1N8JA 2YJHA 4ECBA 1SL1B 5IMDA 2X49A 4HDEA 4MZWA 2WULA 4KDXA 3IAS2 1YDKA 4FXYP 1PFOA 4P3YB 2L6CA 3TUEA 2L4CA 1FVKA 3CMIA 2REMA 2VUPA 4K1FA 2P5QA 3IV4A 2HSNB 4G01A 1WRYA 2WW3A 5CRGA 4F0BA 5A4VA 5LD0A 1MEKA 3F6FA 3FZAA 2R2JA 3LQ7A 3KCMA 3ED3A 5E59A 3UEMA 3ZVJA 4G0LA 4KB3A 5A1NB 1WOUA 3DD3A 2YPMA 1TU7A 4BL7A 4MF6A 1Q98A 3WD6A 3MSZA 2GZZA 1R4WA 4GQCA 3WT2A 1X9MB 2HNLA 1DE1A 4GWRA 3KP9A 4LL1B 4G0KA 5ECPB 4O7HA 4PURA 2F8AA 4QL7A 4OCFA 2MMZA 2I9HA 2GDRA 4KH7A 4D73A 2IIYA 1S4BP 1GSQA 1SJ6A 1ZYQB 1HYUA 3R2QA 3V1WA 5DALA 1GSFA 2IFQA 2WGRA 4MNNA 2FWGA 1BX9A 3ZVJD 4IHUA 3UBLA 1YQ1A 4BVYB 1DE2A 3QR6A 3FZ4A 2QKEA 2H76A 4FIWA 2OE0A 5A4WA 1TI1A 2LUSA 2DLXA 5CRWA 4HS1A 5GAPD 1B4PA 1HNCA 4TN8A 3HD5A 2IPAA 4IP6A 1NSWA 2JL4A 5LNKe 5IQYA 3TOTA 4TR3A 3RDWA 5E4WA 3ISOA 2O87A 5B6NA 2OT3A 5ECKB 2H66A 1USBA 2QA2A 5H5SA 2C0FA 2DJ3A 2FLSA 4BWSA 1X9WB 2E2GA 2A2RA 5J40A 4F03A 1YY7A 4HZ4A 3KTLA 1CQGA 3KTBA 4KSMA 4ZXGA 3VFIA 3ZTLA 5J47A 1THXA 2OJLA 4QL9A 3DWVA 2PN8A 1NHOA 2QA1A 2HRKB 2HZEB 3F63A 5J3RA 2A2PA 1AQVA 3N5OA 2YWNA 1JFUA 3J7Yb 4JZQA 4PUAA 3C8EA 3EURA 3FR9A 1G7EA 3EU3A 3WGEA 2DIYA 2DJ1A 2M80A 2A4VA 2HRFA 2MZCA 3S9FA 1YVLA 3P90A 3R3EA 1T3BA 5HR1A 1YZXA 2ON7A 4JEDA 4AJ7A 1ZMAA 1N25A 1TDIA 5BMUB 4TW5A 3TRXA 3HYPA 1QK8A 3D0ZA 1M3JA 2DMLA 5IOXA 1S3CA 2H1DA 1M3IA 3VI7A 3ZMKA 4MMMA 4K7IA 4GTUA 2P0GA 2B7JA 4BPYA 2PWJA 5ECLB 2XHFA 1S3RA 2FWEA 3VWVA 1ML6A 2B5EA 4ZBBA 2VKZG 5G1KA 1AIUA 2H0HA 2PMTA 2Z9SA 2H30A 3F8UA 3DGQA 1GSDA 3EC3A 5D9TA 5FT3A 1KTEA 1SVMA 1XXUA 4KDYA 1BEDA 1XW9A 2DKIA 4O5RA 4TRXA 4TXVA 2CAQA 2H8LA 1JZOA 1TI3A 2CA8A 2LJKA 3HHVA 1GNEA 2TRXA 2VLUA 1PRXA 2N5AA 1K3YA 3VURA 1YEXA 2FGXA 4NWYA 5CRHA 4K6XA 2B1LA 3DVXA 5D9WA 3FK8A 2BTOT 3C1RA 9GSSA 2FD3A 2VLTA 1T8EB 1ABAA 2B3SA 3KMOA 4KA0A 2RLIA 4G2EA 3P7XA 1OC9A 1SK0A 3IK9A 4K0NA 2OBIA 1K0MA 14GSA 2HRNA 4PQ1A 2K8SA 4XRAA 1TRVA 3TB2A 1K3OA 4MJCA 1ZYPA 4D73B 1PMTA 3JCML 4AI6A 1EEMA 1FOHA 3A2WA 4F82A 1GTAA 3BOAA 1J08A 4I5QA 2N5BA 4LA1A 2DC5A 3BD2A 1V98A 1PQNA 4PGTA 5HQPA 4N10A 4BA7A 5F0GA 4FO5A 4IJ3A 1PX7A 3BCIA 1X9SB 1FB6A 4PUFC 2I4AA 1BG5A 2GSRA 1T4ZA 3M1GA 5ELAA 4K7NA 3O3TA 1OVNA 3GX0A 1Z9HA 2DJ2A 3SBCA 2H6XA 3LORA 4N3ZA 1LBKA 1SU9A 2L57A 1S3AA 1M2BA 1O8WA 4XS1A 1GTBA 2PVQA 4PHZC 1BYEA 1OC3A 3W8SA 3IR4A 4PX1A 2RM5A 4OD7A 1GLPA 3NOFA 2V41A 4K2DA 2DJJA 4G0IA 2CZ3A 4RI6A 4X0XA 3TKPA 3KZQA 1G6YA 3GNJA 5DBQA 4JE1A 4KUNA 3C73A 3LSZA 2RUFA 3APSA 4MCUA 3HJOA 1F2EA 3QOUA 2CZ2A 4IW9A 2JADA 2LJRA 4IVFA 4LLRA 4E8EA 3H93A 3CSHA 5F07A 1K0OA 2V1MA 3ZLPA 1BQ7A 3F9UA 2AV4A 2WZ9A 1X5EA 1ON4A 4ZB6A 3EYTA 2DJ0A 3GN3A 5DQYA 3N9JA 1YEPA 2EFHA 4USSA 4TR4A 3L78A 4ECCA 3PPUA 11GSA 2CVBA 2LRTA 1T1VA 5ECRB 5HR0A 4EIQA 3IC4A 2C0DA 2JSZA 4MZBA 4W66A 3HJMA 3A2XA 4IJIA 1K0AA 5B8BA 5IMVA 4BVXA 4MJBA 5KN3A 4YH2A 4MA9A 4EDZA 2GS3A 2WVYA 3FKFA 3VWWA 2CX3A 3IE3A 1GUHA 2J9HA 3P2AA 1LU4A 1EZKA 1XWAA 5F06A 2O89A 4JR6A 3C71A 2YWMA 4AKIA 4TR0A 2F8FA 3CSIA 4O5UA 5F05A 4RQXA 4F2IA 1PL1A 1XG8A 3F3RA 1KNGA 1K0CA 3LG6A 1OKTA 3M8NA 4MPFA 1JHBA 2H19A 3CRUA 3HY2A 4OMVA 4NHWA 2P5RA 3M0FA 3HVSA 4YAVA 2WVXB 2B5XA 2HT9A 5HR3A 1ZZYA 2HZFA 5GSTA 3QD9A 2VM2A 3ZITA 1UN2A 5FWGA 2F51A 2QSIA 1A2LA 1Z3EA 3CWGA 2VIMA 2PUKC 3H4KA 3IAM2 2VM1A 3MNGA 5JCWA 2LNTA 4V1Ap 1JZDA 2R37A 4I97A 2GT6A 6GSSA 4XCSA 2UZ8A 4MLYA 4CY8A 2PGTA 3U6VA 1PD21 4OCEA 4DVCA 3QDNA 1X0RA 3D4MA 3BCKA 1EV9A 1SD9A 3GV1A 1TK5B 3FHKA 1R5AA 4G19A 3K8NA 1SK1A 2VL2A 4RI7A 3DRNA 3VPTA 1X5CA 4GXZA 4I8BA 4BWQA 3CYNA 3F4RA 3HVXA 2L5LA 2GZYA 3TKSA 5ABRA 1PKWA 5EL8A 1QGVA 2K6VA 3E3EA 3GSTA 5G31A 1U6TA 4POKA 2R3XA 1C72A 3I6AA 5D93A 5FHIA 6GSXA 2EC4A 3HDCA 2TRCP 3FZ5A 3CRTA 1SL2B 2YN1A 2VO4A 3F4SA 2E7PA 1FAAA 2VD1A 4ZL7A 4ZB8A 1H75A 1JZWA 4OFMA 5KN1A 1DBYA 2WW2A 5ID2A 1S3DA 2M46A 3RAZA 1GUMA 2EFEA 3LEFA 1ERVA 3TOUA 3L9UA 1SK2A 2GLRA 4PI0C 5GSSA 2DSAA 1GTUA 1Y25A 2MMNA 3RBTA 2N5FA 2AYTA 2L59A 1BJXA 3EMXA 4NV2A 3KP8A 2R0CA 2O36A 2VOCA 3P8WA 4HI7A 1SJIA 3QCPA 3GKKA 5CP1A 5JWRB 2YANA 1NW2A 2HSMB 1M2AA 1R26A 5ECNB 5EY6A 4PQHA 1PN0A 4TXOA 3KM6A 2HFDA 3FEUA 4O92A 1OKDA 1JZRA 4PI2C 1ZGNA 1A24A 1AW9A 2GQKA 2LQOA 2GSQA 1VF1A 5DJLA 4N11A 2PPTA 3QAWA 4J56E 2J23A 5B8AA 2IMDA 5GZZB 3GL3A 1XWGA 4HU7A 4HU9A 4ML6A 3ZL5A 4GSSA 4K5RA 4V1Ag 2ES7A 1TU8A 1PGTA 1A2MA 3FYGA 2PBJA 4HEA2 3FZ9A 2L5OA 4GCIA 1OE7A 1VGLA 1A0RP 4IN0A 4XHMA 17GSA 1SKRB 6GSUA 3O76A 1FB0A 2NBSA 2HYXA 4AKXB 1VF2A 5HFIA 3GKXA 3GFKA 3VPQA 2KOKA 4K8MA 1A0FA 1F3BA 5D73A 2HXKA 1TRWA 4YKFA 1A8YA 2C4JA 1GSEA 2A4HA 2CVKA 3FMWA 2X8HA 3H1NA 5A4UA 1SL0B 5ECIB 3LFLA 4KAEA 4E68A 1XWBA 3HXSA 4MPGA 4GRFA 1BG1A 3FR3A 1EV4A 1JLWA 5G5EA 4MF7A 4DEJA 4BIKA 2GTUA 2B5YA 3GSSA 2AAWA 1TJDA 4KCEA 1ACVA 4WF4A 4EF0A 5CO3A 4DSSB 3BBYA 3LXZA 2G0FA 2YOIA 3GIXA 4TR1A 2WW0A 2PU9C 4EDYA 2X99A 4ZB9A 1TP9A 2LJAA 3F6DA 4GQFA 3MDKA 4HSCX 3EMPA 3CSJA 4ZIJA 2YJ7A 3ZZXA 2CT6A 3HKRA 4ILFA 1N2AA 5HFKA 3KH7A 2C0EA 3GH9A 4MH2A 4K9ZA 3AY8A 1T4YA 1Y1UA 4MJEA 4IQ1A 3VK9A 1TTZA 4WR5A 3HVVA 3L4NA 2H70A 5A5KA 5BRTA 1XCCA 1MD3A 4BL7B 3TJBA 3VWUA 22GSA 3Q6OA 3APOA 4HQSA 2C3QA 2F3MA 2O5VA 2GZPA 2H0IA 5AN1A 2XPEA 1A2JA 4CY6A 1JLVA 3HJPA 4GLTA 4KSOA 4RUVA 2LS5A 3RGBC 1ZYNA 5ECSA 1GUKA 5CAXA 5G2ZA 1K3LA 5L71A 4I6XA 1ILOA 4IKHA 4L0UA 2PERA 5H5RA 1B4QA 4KF9A 2H6YA 2CAIA 5DALB 2IFQB 4ID0A 3PH9A 1U87A 2MBTA 4L5OA 4LL4B 1ERWA 5CREA 2VL9A 3M3MA 1WP0A 4XS6A 3WT1A 2BJXA 1B9XC 3ZRDA 1GNWA 3ERWA 3QPMA 2FUG2 3W6GA 4L8EA 4Z7XA 4IS0A 5D8IA 5DAKA 3DEXA 4KNDA 1GP1A 2FHEA 5A5HA 1SYXA 1OC8A 3RPNA 4MK3A 1FVJA 2KLXA 4G9HA
chains in the Genus database with same CATH topology
1XWKA 2HRAA 2CV4A 3GURA 3IA1A 4V2LA 1F37A 2V6KA 2YWIA 1ZL9A 1QQ2A 1FOVA 4WXTA 4ZL9A 4MABA 2LV3A 3I69A 2GSTA 3Q19A 2YV9A 3I9V2 1ST9A 3IHGA 2NPBA 4LMWA 1ZYEA 3EINA 1BF5A 2HSNA 3CTGA 3MAKA 3GH6A 1F3AA 4GF0A 2H75A 4OFTA 5ECOB 2H71A 3CTFA 1GTIA 4HZ2A 4PXOA 4YQVA 2OACA 3ERFA 3TKQA 1EP7A 1O8XA 1DSBA 2H1GA 5J41A 1U3IA 2KUCA 1QMVA 5A1NA 5CRDA 1GSUA 4OO4A 1H4OA 2EIRA 5HR2A 3HA9A 4MP4A 3IDVA 3FRCA 4MJAA 1XBSA 1HNAA 3KMNA 1G7OA 3ME7A 1GRXA 5IMZA 1G0TA 5AGYA 2VLVA 4Q5FA 1Z7PA 3E9JB 1K0NA 1NHYA 1PN9A 6GSTA 5J4YA 1GSSA 3UBKA 1K0BA 3IK7A 2IMEA 2OADA 3LJRA 2VCWA 3TRQA 1V58A 3VWXA 4L5LA 1W4VA 3HMJG 2H74A 4H86A 4MZCA 2WFCA 3GKMA 5ELGA 3MYDA 5J4UA 1SENA 1PX6A 4BVYA 4TOPA 3DKSA 2VCZA 4PTSA 4XRDA 3A2VA 4TVEA 1R5PA 5DJMA 2I3YA 3LWAA 2FWFA 5IM9A 1EGRA 1M2DA 3SWLA 3UMAA 2HSYA 1PL2A 3PR8A 3CXGA 5IOWA 3ERGA 4FYBA 2GT5A 2LQQA 4A5PA 1SVLA 4AF2A 3W8JA 1XIYA 1TRUA 2JACA 3FY7A 2IJYA 4KCAA 5IIZA 2R5GA 1M7TA 5ENUA 3GX8A 1V40A 4X1UA 2R4VA 5G5FA 4Q5QA 2O8VB 3EU4A 4AJ6A 2HRKA 5ECQB 2HZEA 1OE8A 1OC9B 5ECMB 2DKHA 3L0HA 1B9YC 1XW5A 3HZ8A 2WJUA 2H1LA 3UARA 2GQMA 5KEJA 2MYGA 3TKRA 4WF5A 1GULA 2WRTA 2MMAA 2XBQA 4FYUA 5IO0A 1VRSD 2ZUPA 2NTOA 2AB6A 1ZOFA 1BAYA 2X8GA 5HFGA 4HJ2A 4XIHA 1AUCA 1SD8A 5DDLA 1SVOA 4RQRA 1XOBA 1J9BA 5G30A 4EXJA 4OWYA 2GSSA 1AAZA 2IMKA 5BMUA 1U3AA 4L0WA 3J7Yk 2O85A 1J0FA 4CDOA 4YAPA 4G10A 5A5HB 4Z2UA 3EE2A 2FCHA 3IXRA 2AJQB 1A8LA 1XOAA 3D21A 3GHAA 2H1AA 2YV7A 1M0UA 2GQLA 4GDFA 3I43A 2O7KA 4O5QA 3IPZA 4ZBDA 3KH9A 2C3NA 1XVQA 1FW1A 1AC1A 3ME8A 1O73A 4EIPA 5DCGA 3UJ1A 4HUAA 3G7YA 2DMMA 1OYJA 1XWCA 2H73A 3KIJA 5G1LA 1WPIA 4O32A 4KE3A 2OBKA 3VI5A 3UOMA 4POMA 4MF5A 2JZRA 4PNFA 2V2GA 4AKHA 4IGJA 2JU5A 3Q18A 5H5QA 1XVWA 1SKSB 4XS4A 1W89A 1MTCA 4YKGA 5F8BA 1Z5YE 2VL3A 4EE0A 2LNSA 4OO5A 5DQSA 3KEBA 5IO2A 5IMCA 3BJ5A 5J5NA 2WDUA 1YF0A 3A5WA 2E0QA 2WB9A 4WEYA 2C3TA 2H01A 1O85A 3QAGA 2RM6A 1THOA 3KD0A 2B6MA 2CX4A 4POBA 1M99A 3TJFA 5C04A 3GUSA 1XW6A 3EVIA 1A23A 3APQA 3GA4A 5GAND 3GYKA 3DXBA 2X4AA 2VAFA 4FYCA 2L4QA 4BVXB 1QFNA 2YCDA 4WBRD 3UL3A 4HQZA 4Z2TA 1RQMA 1ERTA 1T7PB 3PINA 5A34A 2HLSA 2DBCA 2RIIA 2MBSA 4GSTA 6GSVA 4CW9A 1GLQA 5D9VA 3G7IA 3TJGA 3ZYWA 2DIZA 4JRRA 4Q5RA 1YKAA 4ML1A 2KHPA 4F9ZA 1I5GA 1RW1A 3NIVA 3C1SA 2JSYA 2CVDA 3KXOA 3L9VA 1WIKA 12GSA 4EUYA 4EVMA 3H79A 2OE1A 3LYPA 6GSYA 3GTUA 3TJKA 3GL5A 5CNWA 4V2MA 2A2SA 1O7UA 4K7OA 1VF4A 1V9WA 2GGTA 3IBHA 4WKWA 1MD4A 4ISDA 2ZCTA 1WJKA 4NPBA 2H72A 2C80A 1TRSA 3QAVA 1KEBA 1UVZA 3LXTA 3FW2A 1MDIA 13GSA 1WMJA 1PKZA 5INYA 3ZIJA 4Q5NA 4LMVA 2EIQA 1TKDB 4NAXA 1K0DA 1Z6NA 3IOSA 20GSA 2R0PA 3NZNA 2FNOA 1WWJA 5JCGA 1TXXA 4WBJA 3TRPA 5B7CA 4ULXA 4AJ8A 5J9CA 1Z7RA 1XZOA 3DIEA 3TU3B 2MMOA 1V2AA 3F4TA 5D9XA 2L6DA 3LYKA 1SKWB 2EFCA 4E8HA 1B8XA 1TK8B 3LGCA 2NVLA 3GRXA 1NM3A 3IHQA 3GMFA 2UV8G 5IMAA 3KJYA 3TCOA 4X43A 2XPDA 3US3A 1URMA 2KP2A 2H6ZA 5IMFA 5LCZA 4XTSA 1TW9A 1EOHA 3M9KA 2OKAA 2AHEA 1FHEA 3D22A 1QXHA 1B48A 3RPPA 3F0IA 2M72A 4KX4A 3U5RE 4F0CA 2X8CA 3G7JA 5ID2B 4MH3A 1YF1A 4XS4B 4KDUA 2FWHA 5KOWA 2D2ZA 4PQIA 2QGVA 2EIOA 4N30A 2WS2A 2P31A 2KP1A 2CQ9A 2VCQA 2K8VA 2K9FA 4K0GA 5CYYA 3GKNA 5JWQB 5AIVA 1FO5A 4J57E 1QUWA 1EGOA 2LEGA 18GSA 1TXUA 1SJZA 3RHBA 4ECJA 1I9DA 6GSWA 3WYWA 2IL3A 1GH2A 2LRNA 5AISA 1O6JA 2XBIA 3O6TA 3TDGA 1TOFA 2G2QA 2C1YA 5DVBA 4ZL8A 4QQ7A 1WE0A 1G6WA 3UVHA 3E0UA 4V2NA 1IYIA 4TXOB 5ECHB 5JWOB 2HSHA 4WETA 2VCTA 3LW9A 3EPTA 2HE3A 2GVPA 1U88A 2V6OA 4ZB7A 2BMXA 1UA5A 1EEJA 2ZNMA 3ZIVA 2V32A 3D4TA 2K18A 3DVWA 3G9BA 4Z2RA 1VF3A 1E6BA 2DJKA 3TGZA 3ZFBA 3Q74A 5C00A 4KGIA 2FA4A 5JCUA 1F6MC 4KW6A 5A34B 2LRCA 2TIRA 1AQXA 2IWTA 4EKZA 4WR4A 2R6KA 4TKYA 4I2TA 1AQWA 2E2MA 4GSNA 2IN3A 3H8QA 4NV5A 3D5JA 5B6MA 1MDKA 1Q4JA 3L9SA 4AGSA 1X5DA 3TJJA 4IQAA 4J2FA 1XFLA 3QFAC 1KBNA 16GSA 4QMKA 2H0GA 3GTUB 2B7KA 2IMIA 3VLNA 3DMLA 4N0ZA 4YQMA 3EWLA 1UC7A 3IRAA 3HCZA 4X4JA 1R7HA 2R0GA 4IBPA 2LKUA 5EVOA 3RHCA 3IC8A 2I81A 4JR4A 1PSQA 3FR6A 2C8UA 2VCXA 2VD0A 2XC2A 2YP6A 2LSTA 5DCHA 1RK4A 3CBUA 1YJ6A 1OAZA 1Z6MA 1ZCPA 4I2UA 4HOJA 1CQHA 1ERUA 3M9JA 4FQUA 2RUEA 5EPFA 1IYHA 2ALBA 2NDOA 2F9SA 2HQTA 3ZFLA 4K5SA 4HJMA 3D6IA 4ZILA 4N0VA 5KN2A 4TR1B 8GSSA 5KOXA 1MDJA 4DSQA 2HSMA 1GSYA 2AUVA 4AKGA 3QFBC 4NXIA 3C7MA 1LJRA 3HZ4A 4OFNA 2JZTA 3TKSE 2VL2C 2OE3A 2QC7A 2FY6A 2YNXA 4FH8A 4IELA 3PGTA 1DUGA 2IMFA 4NHZA 3A5IA 3TKSC 1HD2A 2I1UA 3A3TA 4ECIA 5AIXA 19GSA 2X64A 4EO3A 3OR5A 4POLA 2OA7A 4JBBA 5IPGA 1YKCA 3WGDA 3UAPA 1Y6EA 2B1KA 1T00A 1F9MA 3MIXA 5KN0A 1XPVA 1HNBA 2HI7A 2YZHA 1AXDA 2FA8A 1EWXA 3UIWA 4DSRA 2ON5A 2H1BA 4ZBAA 4K2XA 3F3QA 3ZREA 4EC0A 4CHSA 1EP8A 1O81A 1FG4A 1M9AA 1EOGA 5D96A 4MDCA 5IPHA 3UVTA 1GL8A 4ICYA 2YWOA 2JZSA 3MWHA 1SYRA 5J4VA 2YZUA 5J9BA 3KGKA 7GSSA 1E2YA 5COHA 1HQOA 2WCIA 4ACSA 4YQUA 2LTKA 2C0GA 3DYRA 1GWCA 3WGXA 3ZMLA 4NMUA 10GSA 4EL1A 5DAKB 1M9BA 4IP1A 2EFDA 4PNGA 2VCVA 3QMXA 2PVOC 1V57A 4DSSA 1PA3A 4JU5A 1TK0B 1N8JA 2YJHA 4ECBA 1SL1B 5IMDA 2X49A 4HDEA 4MZWA 2WULA 4KDXA 3IAS2 1YDKA 4P3YB 2L6CA 3TUEA 2L4CA 1FVKA 3CMIA 2REMA 2VUPA 4K1FA 2P5QA 3IV4A 2HSNB 4G01A 1WRYA 5CRGA 4F0BA 5A4VA 5LD0A 1MEKA 3F6FA 3FZAA 2R2JA 3LQ7A 3KCMA 3ED3A 5E59A 3UEMA 3ZVJA 4G0LA 4KB3A 5A1NB 1WOUA 3DD3A 1TU7A 2YPMA 4BL7A 4MF6A 1Q98A 3WD6A 3MSZA 2GZZA 1R4WA 4GQCA 3WT2A 1X9MB 2HNLA 1DE1A 4GWRA 3KP9A 4LL1B 4G0KA 5ECPB 4O7HA 4PURA 2F8AA 4QL7A 4OCFA 2MMZA 2I9HA 2GDRA 4KH7A 4D73A 2IIYA 1SJ6A 1GSQA 1ZYQB 1HYUA 3R2QA 3V1WA 5DALA 1GSFA 2IFQA 2WGRA 4MNNA 2FWGA 1BX9A 3ZVJD 4IHUA 3UBLA 1YQ1A 4BVYB 1DE2A 3QR6A 3FZ4A 2QKEA 2H76A 4FIWA 2OE0A 5A4WA 1TI1A 2LUSA 2DLXA 5CRWA 4HS1A 5GAPD 1B4PA 1HNCA 4TN8A 3HD5A 2IPAA 4IP6A 1NSWA 2JL4A 5LNKe 5IQYA 3TOTA 4TR3A 3RDWA 5E4WA 3ISOA 2O87A 5B6NA 2OT3A 5ECKB 2H66A 1USBA 2QA2A 5H5SA 2C0FA 2DJ3A 2FLSA 4BWSA 1X9WB 2E2GA 2A2RA 5J40A 4F03A 1YY7A 4HZ4A 3KTLA 1CQGA 3KTBA 4KSMA 4ZXGA 3VFIA 3ZTLA 5J47A 1THXA 2OJLA 4QL9A 3DWVA 2PN8A 1NHOA 2QA1A 2HRKB 2HZEB 3F63A 5J3RA 2A2PA 1AQVA 3N5OA 2YWNA 1JFUA 3J7Yb 4JZQA 4PUAA 3C8EA 3EURA 3FR9A 1G7EA 3EU3A 3WGEA 2DIYA 2DJ1A 2M80A 2A4VA 2HRFA 2MZCA 3S9FA 1YVLA 3P90A 3R3EA 1T3BA 5HR1A 1YZXA 2ON7A 4JEDA 4AJ7A 1ZMAA 1N25A 1TDIA 5BMUB 4TW5A 3TRXA 3HYPA 1QK8A 3D0ZA 2DMLA 5IOXA 1S3CA 2H1DA 3VI7A 3ZMKA 4MMMA 4K7IA 4GTUA 2P0GA 2B7JA 4BPYA 2PWJA 5ECLB 2XHFA 2FWEA 3VWVA 1ML6A 2B5EA 4ZBBA 2VKZG 5G1KA 1AIUA 2H0HA 2PMTA 2Z9SA 2H30A 3F8UA 3DGQA 1GSDA 3EC3A 5D9TA 5FT3A 1KTEA 1SVMA 1XXUA 4KDYA 1BEDA 1XW9A 2DKIA 4O5RA 4TRXA 4TXVA 2CAQA 2H8LA 1JZOA 1TI3A 2CA8A 2LJKA 3HHVA 1GNEA 2TRXA 2VLUA 1PRXA 2N5AA 1K3YA 3VURA 1YEXA 2FGXA 4NWYA 5CRHA 4K6XA 2B1LA 3DVXA 5D9WA 3FK8A 2BTOT 3C1RA 9GSSA 2FD3A 2VLTA 1T8EB 1ABAA 2B3SA 3KMOA 4KA0A 2RLIA 4G2EA 3P7XA 1OC9A 1SK0A 3IK9A 4K0NA 2OBIA 1K0MA 14GSA 2HRNA 4PQ1A 2K8SA 4XRAA 1TRVA 3TB2A 1K3OA 4MJCA 1ZYPA 4D73B 1PMTA 3JCML 4AI6A 1EEMA 1FOHA 3A2WA 4F82A 1GTAA 3BOAA 1J08A 4I5QA 2N5BA 4LA1A 2DC5A 3BD2A 1V98A 1PQNA 4PGTA 5HQPA 4N10A 4BA7A 5F0GA 4FO5A 4IJ3A 1PX7A 3BCIA 1X9SB 1FB6A 4PUFC 2I4AA 1BG5A 2GSRA 1T4ZA 3M1GA 5ELAA 4K7NA 3O3TA 1OVNA 3GX0A 1Z9HA 2DJ2A 3SBCA 2H6XA 3LORA 4N3ZA 1LBKA 1SU9A 2L57A 1S3AA 1M2BA 1O8WA 4XS1A 1GTBA 2PVQA 1BYEA 1OC3A 3W8SA 3IR4A 4PX1A 2RM5A 4OD7A 1GLPA 3NOFA 2V41A 4K2DA 2DJJA 4G0IA 2CZ3A 4RI6A 4X0XA 3TKPA 3KZQA 1G6YA 3GNJA 5DBQA 4JE1A 4KUNA 3C73A 3LSZA 2RUFA 3APSA 4MCUA 3HJOA 1F2EA 3QOUA 2CZ2A 4IW9A 2JADA 2LJRA 4IVFA 4LLRA 4E8EA 3H93A 3CSHA 5F07A 1K0OA 2V1MA 3ZLPA 1BQ7A 3F9UA 2AV4A 2WZ9A 1X5EA 1ON4A 4ZB6A 3EYTA 2DJ0A 3GN3A 5DQYA 3N9JA 1YEPA 2EFHA 4USSA 4TR4A 3L78A 4ECCA 3PPUA 11GSA 2CVBA 2LRTA 1T1VA 5ECRB 5HR0A 4EIQA 3IC4A 2C0DA 2JSZA 4MZBA 4W66A 3HJMA 3A2XA 4IJIA 1K0AA 5B8BA 5IMVA 4BVXA 4MJBA 5KN3A 4YH2A 4MA9A 4EDZA 2GS3A 3FKFA 3VWWA 2CX3A 3IE3A 1GUHA 2J9HA 3P2AA 1LU4A 1EZKA 1XWAA 5F06A 2O89A 4JR6A 3C71A 2YWMA 4AKIA 4TR0A 2F8FA 3CSIA 4O5UA 5F05A 4RQXA 4F2IA 1PL1A 3F3RA 1KNGA 1K0CA 3LG6A 1OKTA 3M8NA 4MPFA 1JHBA 2H19A 3CRUA 3HY2A 4OMVA 4NHWA 2P5RA 3M0FA 3HVSA 4YAVA 2B5XA 2HT9A 5HR3A 1ZZYA 2HZFA 5GSTA 3QD9A 2VM2A 3ZITA 1UN2A 5FWGA 2F51A 2QSIA 1A2LA 1Z3EA 3CWGA 2VIMA 2PUKC 3H4KA 3IAM2 2VM1A 3MNGA 5JCWA 2LNTA 4V1Ap 1JZDA 2R37A 4I97A 2GT6A 6GSSA 4XCSA 2UZ8A 4MLYA 4CY8A 2PGTA 3U6VA 1PD21 4OCEA 4DVCA 3QDNA 1X0RA 3D4MA 3BCKA 1EV9A 1SD9A 3GV1A 1TK5B 3FHKA 1R5AA 4G19A 3K8NA 1SK1A 2VL2A 4RI7A 3DRNA 3VPTA 1X5CA 4GXZA 4I8BA 4BWQA 3CYNA 3F4RA 3HVXA 2L5LA 2GZYA 3TKSA 5ABRA 1PKWA 5EL8A 1QGVA 2K6VA 3E3EA 3GSTA 5G31A 1U6TA 4POKA 2R3XA 1C72A 3I6AA 5D93A 5FHIA 6GSXA 2EC4A 3HDCA 2TRCP 3FZ5A 3CRTA 1SL2B 2YN1A 2VO4A 3F4SA 2E7PA 1FAAA 2VD1A 4ZL7A 4ZB8A 1H75A 1JZWA 4OFMA 5KN1A 1DBYA 5ID2A 1S3DA 2M46A 3RAZA 1GUMA 2EFEA 3LEFA 1ERVA 3TOUA 3L9UA 1SK2A 2GLRA 5GSSA 2DSAA 1GTUA 1Y25A 2MMNA 3RBTA 2N5FA 2AYTA 2L59A 1BJXA 3EMXA 4NV2A 3KP8A 2R0CA 2VOCA 3P8WA 4HI7A 1SJIA 3QCPA 3GKKA 5CP1A 5JWRB 2YANA 1NW2A 2HSMB 1M2AA 1R26A 5ECNB 5EY6A 4PQHA 1PN0A 4TXOA 3KM6A 2HFDA 3FEUA 4O92A 1OKDA 1JZRA 1ZGNA 1A24A 1AW9A 2GQKA 2LQOA 2GSQA 1VF1A 5DJLA 4N11A 2PPTA 3QAWA 4J56E 2J23A 5B8AA 2IMDA 5GZZB 3GL3A 1XWGA 4HU7A 4HU9A 4ML6A 3ZL5A 4GSSA 4K5RA 4V1Ag 2ES7A 1TU8A 1PGTA 1A2MA 3FYGA 2PBJA 4HEA2 3FZ9A 2L5OA 4GCIA 1OE7A 1VGLA 1A0RP 4IN0A 4XHMA 17GSA 1SKRB 6GSUA 3O76A 1FB0A 2NBSA 2HYXA 4AKXB 1VF2A 5HFIA 3GKXA 3GFKA 3VPQA 2KOKA 4K8MA 1A0FA 1F3BA 5D73A 2HXKA 1TRWA 4YKFA 1A8YA 2C4JA 1GSEA 2A4HA 2CVKA 3FMWA 2X8HA 3H1NA 5A4UA 1SL0B 5ECIB 3LFLA 4KAEA 4E68A 1XWBA 3HXSA 4MPGA 4GRFA 1BG1A 3FR3A 1EV4A 1JLWA 5G5EA 4MF7A 4DEJA 2GTUA 2B5YA 3GSSA 2AAWA 1TJDA 4KCEA 1ACVA 4WF4A 4EF0A 5CO3A 4DSSB 3BBYA 3LXZA 2G0FA 2YOIA 3GIXA 4TR1A 2PU9C 4EDYA 2X99A 4ZB9A 1TP9A 2LJAA 3F6DA 4GQFA 3MDKA 3EMPA 3CSJA 4ZIJA 2YJ7A 3ZZXA 2CT6A 3HKRA 4ILFA 1N2AA 5HFKA 3KH7A 2C0EA 3GH9A 4MH2A 4K9ZA 3AY8A 1T4YA 1Y1UA 4MJEA 4IQ1A 3VK9A 1TTZA 4WR5A 3HVVA 3L4NA 2H70A 5A5KA 5BRTA 1XCCA 1MD3A 4BL7B 3TJBA 3VWUA 22GSA 3Q6OA 3APOA 4HQSA 2C3QA 2F3MA 2O5VA 2GZPA 2H0IA 5AN1A 2XPEA 1A2JA 4CY6A 1JLVA 3HJPA 4GLTA 4KSOA 4RUVA 2LS5A 1ZYNA 5ECSA 1GUKA 5CAXA 5G2ZA 1K3LA 5L71A 4I6XA 1ILOA 4IKHA 4L0UA 2PERA 5H5RA 1B4QA 4KF9A 2H6YA 2CAIA 5DALB 2IFQB 4ID0A 3PH9A 1U87A 2MBTA 4L5OA 4LL4B 1ERWA 5CREA 2VL9A 3M3MA 1WP0A 4XS6A 3WT1A 2BJXA 1B9XC 3ZRDA 1GNWA 3ERWA 3QPMA 2FUG2 3W6GA 4L8EA 4Z7XA 4IS0A 5D8IA 5DAKA 3DEXA 4KNDA 1GP1A 2FHEA 5A5HA 1SYXA 1OC8A 3RPNA 4MK3A 1FVJA 2KLXA 4G9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWK A;  2HRA A;  2CV4 A;  3GUR A;  3IA1 A;  4V2L A;  1F37 A;  2V6K A;  2YWI A;  1ZL9 A;  1QQ2 A;  1FOV A;  4WXT A;  4ZL9 A;  4MAB A;  2LV3 A;  3I69 A;  2GST A;  3Q19 A;  2YV9 A;  3I9V 2;  1ST9 A;  2NPB A;  4LMW A;  1ZYE A;  3EIN A;  3CTG A;  3MAK A;  3GH6 A;  1F3A A;  4GF0 A;  2H75 A;  4OFT A;  5ECO B;  2H71 A;  3CTF A;  1GTI A;  4HZ2 A;  4PXO A;  4YQV A;  2OAC A;  3ERF A;  3TKQ A;  1EP7 A;  1O8X A;  1DSB A;  2H1G A;  5J41 A;  1U3I A;  2KUC A;  1QMV A;  5CRD A;  1GSU A;  4OO4 A;  1H4O A;  2EIR A;  5HR2 A;  3HA9 A;  4MP4 A;  3IDV A;  3FRC A;  4MJA A;  1XBS A;  1HNA A;  3KMN A;  1G7O A;  3ME7 A;  1GRX A;  5IMZ A;  1G0T A;  5AGY A;  2VLV A;  4Q5F A;  1Z7P A;  3E9J B;  1K0N A;  1NHY A;  1PN9 A;  6GST A;  1GSS A;  3UBK A;  1K0B A;  3IK7 A;  2IME A;  2OAD A;  3LJR A;  2VCW A;  3TRQ A;  1V58 A;  3VWX A;  4L5L A;  1W4V A;  2H74 A;  4H86 A;  4MZC A;  2WFC A;  3GKM A;  5ELG A;  5J4U A;  1SEN A;  1PX6 A;  4BVY A;  4TOP A;  3DKS A;  2VCZ A;  4PTS A;  4XRD A;  3A2V A;  4TVE A;  1R5P A;  5DJM A;  2I3Y A;  3LWA A;  2FWF A;  5IM9 A;  1EGR A;  1M2D A;  3SWL A;  3UMA A;  2HSY A;  1PL2 A;  3PR8 A;  3CXG A;  5IOW A;  3ERG A;  4FYB A;  2GT5 A;  2LQQ A;  4AF2 A;  3W8J A;  1XIY A;  1TRU A;  2JAC A;  3FY7 A;  2IJY A;  4KCA A;  5IIZ A;  2R5G A;  1M7T A;  5ENU A;  3GX8 A;  1V40 A;  4X1U A;  2R4V A;  5G5F A;  4Q5Q A;  2O8V B;  3EU4 A;  4AJ6 A;  2HRK A;  5ECQ B;  2HZE A;  1OE8 A;  1OC9 B;  5ECM B;  3L0H A;  1B9Y C;  1XW5 A;  3HZ8 A;  2WJU A;  3UAR A;  2GQM A;  5KEJ A;  2MYG A;  3TKR A;  4WF5 A;  1GUL A;  4FYU A;  2WRT A;  2MMA A;  2XBQ A;  5IO0 A;  1VRS D;  2ZUP A;  2NTO A;  2AB6 A;  1ZOF A;  1BAY A;  2X8G A;  5HFG A;  4HJ2 A;  4XIH A;  1AUC A;  1SD8 A;  5DDL A;  4RQR A;  1XOB A;  1J9B A;  5G30 A;  4EXJ A;  4OWY A;  2GSS A;  1AAZ A;  2IMK A;  5BMU A;  1U3A A;  4L0W A;  3J7Y k;  2O85 A;  1J0F A;  4CDO A;  4YAP A;  4G10 A;  3EE2 A;  2FCH A;  3IXR A;  2AJQ B;  1A8L A;  1XOA A;  3D21 A;  3GHA A;  2H1A A;  2YV7 A;  1M0U A;  2GQL A;  3I43 A;  2O7K A;  3IPZ A;  4ZBD A;  2C3N A;  3KH9 A;  1XVQ A;  1FW1 A;  1AC1 A;  3ME8 A;  1O73 A;  5DCG A;  3UJ1 A;  4HUA A;  3G7Y A;  2DMM A;  1OYJ A;  1XWC A;  2H73 A;  3KIJ A;  5G1L A;  1WPI A;  4O32 A;  4KE3 A;  2OBK A;  3VI5 A;  3UOM A;  4POM A;  4MF5 A;  2JZR A;  4PNF A;  2V2G A;  4IGJ A;  2JU5 A;  3Q18 A;  5H5Q A;  1XVW A;  1SKS B;  4XS4 A;  1W89 A;  1MTC A;  5F8B A;  1Z5Y E;  2VL3 A;  4EE0 A;  2LNS A;  4OO5 A;  5DQS A;  3KEB A;  5IO2 A;  5IMC A;  3BJ5 A;  5J5N A;  2WDU A;  1YF0 A;  3A5W A;  2E0Q A;  2WB9 A;  4WEY A;  2C3T A;  2H01 A;  1O85 A;  3QAG A;  2RM6 A;  1THO A;  3KD0 A;  2B6M A;  2CX4 A;  4POB A;  1M99 A;  3TJF A;  5C04 A;  3GUS A;  1XW6 A;  3EVI A;  1A23 A;  3APQ A;  3GA4 A;  5GAN D;  3GYK A;  3DXB A;  2VAF A;  4FYC A;  2L4Q A;  4BVX B;  1QFN A;  2YCD A;  4WBR D;  3UL3 A;  4HQZ A;  1RQM A;  1ERT A;  1T7P B;  3PIN A;  2HLS A;  2DBC A;  2RII A;  2MBS A;  4GST A;  6GSV A;  4CW9 A;  1GLQ A;  5D9V A;  3G7I A;  3TJG A;  3ZYW A;  2DIZ A;  4JRR A;  4Q5R A;  1YKA A;  4ML1 A;  2KHP A;  4F9Z A;  1I5G A;  1RW1 A;  3NIV A;  3C1S A;  2JSY A;  2CVD A;  3KXO A;  3L9V A;  1WIK A;  12GS A;  4EUY A;  4EVM A;  3H79 A;  2OE1 A;  3LYP A;  6GSY A;  3GTU A;  3TJK A;  3GL5 A;  5CNW A;  4V2M A;  2A2S A;  1O7U A;  4K7O A;  1VF4 A;  1V9W A;  2GGT A;  3IBH A;  4WKW A;  1MD4 A;  4ISD A;  2ZCT A;  1WJK A;  4NPB A;  2H72 A;  2C80 A;  1TRS A;  3QAV A;  1KEB A;  1UVZ A;  3LXT A;  3FW2 A;  1MDI A;  13GS A;  1WMJ A;  1PKZ A;  5INY A;  3ZIJ A;  4Q5N A;  4LMV A;  2EIQ A;  1TKD B;  4NAX A;  1K0D A;  1Z6N A;  3IOS A;  20GS A;  3NZN A;  2FNO A;  1WWJ A;  5JCG A;  1TXX A;  4WBJ A;  3TRP A;  5B7C A;  4ULX A;  4AJ8 A;  5J9C A;  1Z7R A;  1XZO A;  3DIE A;  2MMO A;  1V2A A;  3F4T A;  5D9X A;  2L6D A;  3LYK A;  1SKW B;  4E8H A;  1B8X A;  1TK8 B;  3LGC A;  2NVL A;  3GRX A;  1NM3 A;  3IHQ A;  3GMF A;  5IMA A;  3KJY A;  3TCO A;  4X43 A;  2XPD A;  3US3 A;  1URM A;  2KP2 A;  2H6Z A;  5IMF A;  5LCZ A;  4XTS A;  1TW9 A;  1EOH A;  3M9K A;  2OKA A;  2AHE A;  1FHE A;  3D22 A;  1QXH A;  1B48 A;  3RPP A;  3F0I A;  2M72 A;  4KX4 A;  3U5R E;  4F0C A;  2X8C A;  3G7J A;  5ID2 B;  4MH3 A;  1YF1 A;  4XS4 B;  4KDU A;  2FWH A;  2D2Z A;  4PQI A;  2QGV A;  2EIO A;  4N30 A;  2WS2 A;  2P31 A;  2KP1 A;  2CQ9 A;  2VCQ A;  2K8V A;  2K9F A;  4K0G A;  5CYY A;  3GKN A;  5JWQ B;  5AIV A;  1FO5 A;  4J57 E;  1QUW A;  1EGO A;  2LEG A;  18GS A;  1SJZ A;  3RHB A;  4ECJ A;  1I9D A;  6GSW A;  3WYW A;  2IL3 A;  1GH2 A;  2LRN A;  5AIS A;  1O6J A;  2XBI A;  3O6T A;  3TDG A;  1TOF A;  2G2Q A;  2C1Y A;  5DVB A;  4ZL8 A;  4QQ7 A;  1WE0 A;  1G6W A;  3UVH A;  3E0U A;  4V2N A;  1IYI A;  4TXO B;  5ECH B;  5JWO B;  2HSH A;  4WET A;  2VCT A;  2HE3 A;  2GVP A;  1U88 A;  2V6O A;  2BMX A;  1UA5 A;  1EEJ A;  2ZNM A;  3ZIV A;  2V32 A;  3D4T A;  2K18 A;  3DVW A;  3G9B A;  1VF3 A;  1E6B A;  2DJK A;  3TGZ A;  3ZFB A;  3Q74 A;  5C00 A;  4KGI A;  2FA4 A;  5JCU A;  1F6M C;  4KW6 A;  2LRC A;  2TIR A;  1AQX A;  2IWT A;  4EKZ A;  4WR4 A;  2R6K A;  4TKY A;  4I2T A;  1AQW A;  2E2M A;  4GSN A;  2IN3 A;  3H8Q A;  4NV5 A;  3D5J A;  5B6M A;  1MDK A;  1Q4J A;  3L9S A;  4AGS A;  1X5D A;  3TJJ A;  4IQA A;  4J2F A;  1XFL A;  3QFA C;  1KBN A;  16GS A;  2H0G A;  3GTU B;  2B7K A;  2IMI A;  3VLN A;  3DML A;  4N0Z A;  4YQM A;  3EWL A;  1UC7 A;  3IRA A;  3HCZ A;  1R7H A;  4IBP A;  2LKU A;  5EVO A;  3RHC A;  3IC8 A;  2I81 A;  4JR4 A;  1PSQ A;  3FR6 A;  2C8U A;  2VCX A;  2VD0 A;  2XC2 A;  2YP6 A;  2LST A;  5DCH A;  1RK4 A;  3CBU A;  1YJ6 A;  1OAZ A;  1Z6M A;  1ZCP A;  4I2U A;  4HOJ A;  1CQH A;  1ERU A;  3M9J A;  4FQU A;  2RUE A;  5EPF A;  1IYH A;  2ALB A;  2NDO A;  2F9S A;  2HQT A;  3ZFL A;  4HJM A;  3D6I A;  4ZIL A;  4N0V A;  5KN2 A;  4TR1 B;  8GSS A;  1MDJ A;  4DSQ A;  2HSM A;  1GSY A;  2AUV A;  3QFB C;  4NXI A;  3C7M A;  1LJR A;  3HZ4 A;  4OFN A;  2JZT A;  3TKS E;  2VL2 C;  2OE3 A;  2QC7 A;  2FY6 A;  2YNX A;  4FH8 A;  4IEL A;  3PGT A;  1DUG A;  2IMF A;  4NHZ A;  3TKS C;  1HD2 A;  2I1U A;  3A3T A;  4ECI A;  5AIX A;  19GS A;  2X64 A;  4EO3 A;  3OR5 A;  4POL A;  2OA7 A;  4JBB A;  5IPG A;  1YKC A;  3WGD A;  3UAP A;  1Y6E A;  2B1K A;  1T00 A;  1F9M A;  5KN0 A;  1XPV A;  1HNB A;  2HI7 A;  2YZH A;  1AXD A;  2FA8 A;  1EWX A;  3UIW A;  4DSR A;  2ON5 A;  2H1B A;  4ZBA A;  3F3Q A;  3ZRE A;  4EC0 A;  4CHS A;  1EP8 A;  1O81 A;  1FG4 A;  1M9A A;  1EOG A;  5D96 A;  4MDC A;  5IPH A;  3UVT A;  1GL8 A;  2YWO A;  2JZS A;  3MWH A;  1SYR A;  2YZU A;  5J9B A;  3KGK A;  7GSS A;  1E2Y A;  5COH A;  1HQO A;  2WCI A;  4ACS A;  4YQU A;  2LTK A;  2C0G A;  3DYR A;  1GWC A;  3WGX A;  3ZML A;  4NMU A;  10GS A;  4EL1 A;  5DAK B;  1M9B A;  4IP1 A;  4PNG A;  2VCV A;  3QMX A;  2PVO C;  1V57 A;  4DSS A;  1PA3 A;  4JU5 A;  1TK0 B;  1N8J A;  2YJH A;  4ECB A;  1SL1 B;  5IMD A;  4HDE A;  4MZW A;  2WUL A;  4KDX A;  3IAS 2;  1YDK A;  4P3Y B;  2L6C A;  3TUE A;  2L4C A;  1FVK A;  3CMI A;  2REM A;  2VUP A;  4K1F A;  2P5Q A;  3IV4 A;  2HSN B;  1WRY A;  5CRG A;  4F0B A;  5A4V A;  5LD0 A;  1MEK A;  3F6F A;  3FZA A;  2R2J A;  3LQ7 A;  3KCM A;  3ED3 A;  5E59 A;  3UEM A;  3ZVJ A;  4G0L A;  4KB3 A;  1WOU A;  3DD3 A;  1TU7 A;  2YPM A;  4BL7 A;  4MF6 A;  1Q98 A;  3WD6 A;  3MSZ A;  2GZZ A;  1R4W A;  4GQC A;  3WT2 A;  1X9M B;  2HNL A;  1DE1 A;  4GWR A;  3KP9 A;  4LL1 B;  4G0K A;  5ECP B;  4O7H A;  4PUR A;  2F8A A;  4QL7 A;  4OCF A;  2MMZ A;  2I9H A;  2GDR A;  4KH7 A;  4D73 A;  2IIY A;  1SJ6 A;  1GSQ A;  1ZYQ B;  1HYU A;  3R2Q A;  3V1W A;  5DAL A;  1GSF A;  2IFQ A;  2WGR A;  2FWG A;  1BX9 A;  3ZVJ D;  4IHU A;  3UBL A;  1YQ1 A;  4BVY B;  1DE2 A;  3QR6 A;  3FZ4 A;  2QKE A;  2H76 A;  4FIW A;  2OE0 A;  5A4W A;  1TI1 A;  2LUS A;  2DLX A;  5CRW A;  4HS1 A;  5GAP D;  1B4P A;  1HNC A;  4TN8 A;  3HD5 A;  2IPA A;  4IP6 A;  1NSW A;  2JL4 A;  5LNK e;  5IQY A;  3TOT A;  4TR3 A;  3RDW A;  5E4W A;  3ISO A;  2O87 A;  5B6N A;  5ECK B;  2H66 A;  1USB A;  5H5S A;  2C0F A;  2DJ3 A;  2FLS A;  4BWS A;  1X9W B;  2E2G A;  2A2R A;  4F03 A;  1YY7 A;  4HZ4 A;  3KTL A;  1CQG A;  3KTB A;  4KSM A;  4ZXG A;  3VFI A;  3ZTL A;  2OJL A;  1THX A;  4QL9 A;  3DWV A;  2PN8 A;  1NHO A;  2HRK B;  2HZE B;  3F63 A;  5J3R A;  1AQV A;  3N5O A;  2YWN A;  1JFU A;  3J7Y b;  4JZQ A;  4PUA A;  3C8E A;  3EUR A;  3FR9 A;  1G7E A;  3EU3 A;  3WGE A;  2DIY A;  2DJ1 A;  2M80 A;  2A4V A;  2HRF A;  2MZC A;  3S9F A;  3P90 A;  3R3E A;  1T3B A;  5HR1 A;  1YZX A;  2ON7 A;  4JED A;  4AJ7 A;  1ZMA A;  1TDI A;  4TW5 A;  3TRX A;  3HYP A;  1QK8 A;  3D0Z A;  2DML A;  5IOX A;  1S3C A;  2H1D A;  3VI7 A;  3ZMK A;  4MMM A;  4K7I A;  4GTU A;  2P0G A;  2B7J A;  4BPY A;  2PWJ A;  5ECL B;  2XHF A;  2FWE A;  3VWV A;  1ML6 A;  2B5E A;  4ZBB A;  5G1K A;  1AIU A;  2H0H A;  2PMT A;  2Z9S A;  2H30 A;  3F8U A;  3DGQ A;  1GSD A;  3EC3 A;  5D9T A;  5FT3 A;  1KTE A;  1XXU A;  4KDY A;  1BED A;  1XW9 A;  4O5R A;  4TRX A;  4TXV A;  2CAQ A;  2H8L A;  1JZO A;  1TI3 A;  2CA8 A;  2LJK A;  3HHV A;  1GNE A;  2TRX A;  2VLU A;  1PRX A;  2N5A A;  1K3Y A;  3VUR A;  1YEX A;  2FGX A;  4NWY A;  5CRH A;  4K6X A;  2B1L A;  3DVX A;  5D9W A;  3FK8 A;  2BTO T;  3C1R A;  9GSS A;  2FD3 A;  2VLT A;  1T8E B;  1ABA A;  2B3S A;  3KMO A;  4KA0 A;  2RLI A;  4G2E A;  3P7X A;  1OC9 A;  1SK0 A;  3IK9 A;  4K0N A;  2OBI A;  1K0M A;  14GS A;  2HRN A;  4PQ1 A;  2K8S A;  4XRA A;  1TRV A;  3TB2 A;  1K3O A;  4MJC A;  4D73 B;  1PMT A;  3JCM L;  1EEM A;  3A2W A;  4F82 A;  1GTA A;  3BOA A;  1J08 A;  4I5Q A;  2N5B A;  4LA1 A;  2DC5 A;  3BD2 A;  1V98 A;  1PQN A;  4PGT A;  5HQP A;  4N10 A;  4BA7 A;  5F0G A;  4FO5 A;  4IJ3 A;  1PX7 A;  3BCI A;  1X9S B;  1FB6 A;  4PUF C;  2I4A A;  1BG5 A;  2GSR A;  1T4Z A;  3M1G A;  5ELA A;  4K7N A;  3O3T A;  1OVN A;  3GX0 A;  1Z9H A;  2DJ2 A;  3SBC A;  2H6X A;  3LOR A;  1LBK A;  1SU9 A;  2L57 A;  1S3A A;  1M2B A;  1O8W A;  4XS1 A;  1GTB A;  2PVQ A;  1BYE A;  1OC3 A;  3W8S A;  3IR4 A;  4PX1 A;  2RM5 A;  4OD7 A;  1GLP A;  3NOF A;  2V41 A;  4K2D A;  2DJJ A;  4G0I A;  2CZ3 A;  4RI6 A;  4X0X A;  3TKP A;  3KZQ A;  1G6Y A;  3GNJ A;  5DBQ A;  4JE1 A;  4KUN A;  3C73 A;  3LSZ A;  2RUF A;  3APS A;  4MCU A;  3HJO A;  1F2E A;  3QOU A;  2CZ2 A;  4IW9 A;  2JAD A;  2LJR A;  4IVF A;  4LLR A;  4E8E A;  3H93 A;  3CSH A;  5F07 A;  1K0O A;  2V1M A;  3ZLP A;  1BQ7 A;  3F9U A;  2AV4 A;  2WZ9 A;  1X5E A;  1ON4 A;  4ZB6 A;  3EYT A;  2DJ0 A;  3GN3 A;  5DQY A;  3N9J A;  1YEP A;  4USS A;  4TR4 A;  3L78 A;  4ECC A;  3PPU A;  11GS A;  2CVB A;  2LRT A;  1T1V A;  5ECR B;  5HR0 A;  3IC4 A;  2C0D A;  2JSZ A;  4MZB A;  3HJM A;  3A2X A;  4IJI A;  1K0A A;  5B8B A;  5IMV A;  4BVX A;  4MJB A;  5KN3 A;  4YH2 A;  4MA9 A;  4EDZ A;  2GS3 A;  3FKF A;  3VWW A;  2CX3 A;  3IE3 A;  1GUH A;  2J9H A;  3P2A A;  1LU4 A;  1EZK A;  1XWA A;  5F06 A;  2O89 A;  4JR6 A;  3C71 A;  2YWM A;  4TR0 A;  2F8F A;  3CSI A;  5F05 A;  4RQX A;  4F2I A;  1PL1 A;  3F3R A;  1KNG A;  1K0C A;  3LG6 A;  1OKT A;  3M8N A;  4MPF A;  1JHB A;  2H19 A;  3CRU A;  3HY2 A;  4OMV A;  4NHW A;  2P5R A;  3M0F A;  3HVS A;  4YAV A;  2B5X A;  2HT9 A;  5HR3 A;  1ZZY A;  2HZF A;  5GST A;  3QD9 A;  2VM2 A;  3ZIT A;  1UN2 A;  5FWG A;  2F51 A;  2QSI A;  1A2L A;  1Z3E A;  2VIM A;  2PUK C;  3H4K A;  3IAM 2;  2VM1 A;  3MNG A;  5JCW A;  2LNT A;  4V1A p;  1JZD A;  2R37 A;  4I97 A;  2GT6 A;  6GSS A;  4XCS A;  2UZ8 A;  4MLY A;  2PGT A;  3U6V A;  1PD2 1;  4OCE A;  4DVC A;  3QDN A;  1X0R A;  3D4M A;  3BCK A;  1EV9 A;  1SD9 A;  3GV1 A;  1TK5 B;  3FHK A;  1R5A A;  4G19 A;  3K8N A;  1SK1 A;  2VL2 A;  4RI7 A;  3DRN A;  3VPT A;  1X5C A;  4GXZ A;  4I8B A;  4BWQ A;  3CYN A;  3F4R A;  3HVX A;  2L5L A;  2GZY A;  3TKS A;  5ABR A;  1PKW A;  5EL8 A;  1QGV A;  2K6V A;  3E3E A;  3GST A;  5G31 A;  1U6T A;  4POK A;  2R3X A;  1C72 A;  3I6A A;  5D93 A;  5FHI A;  6GSX A;  2EC4 A;  3HDC A;  2TRC P;  3FZ5 A;  3CRT A;  1SL2 B;  2YN1 A;  2VO4 A;  3F4S A;  2E7P A;  1FAA A;  2VD1 A;  4ZL7 A;  4ZB8 A;  1H75 A;  1JZW A;  4OFM A;  5KN1 A;  1DBY A;  5ID2 A;  1S3D A;  2M46 A;  3RAZ A;  1GUM A;  3LEF A;  1ERV A;  3TOU A;  3L9U A;  1SK2 A;  2GLR A;  5GSS A;  2DSA A;  1GTU A;  1Y25 A;  2MMN A;  3RBT A;  2N5F A;  2AYT A;  2L59 A;  1BJX A;  3EMX A;  4NV2 A;  3KP8 A;  2VOC A;  3P8W A;  4HI7 A;  1SJI A;  3QCP A;  3GKK A;  5CP1 A;  5JWR B;  2YAN A;  1NW2 A;  2HSM B;  1M2A A;  1R26 A;  5ECN B;  5EY6 A;  4PQH A;  4TXO A;  3KM6 A;  2HFD A;  3FEU A;  4O92 A;  1OKD A;  1JZR A;  1ZGN A;  1A24 A;  1AW9 A;  2GQK A;  2LQO A;  2GSQ A;  1VF1 A;  5DJL A;  4N11 A;  2PPT A;  3QAW A;  4J56 E;  2J23 A;  5B8A A;  2IMD A;  5GZZ B;  3GL3 A;  1XWG A;  4HU7 A;  4HU9 A;  4ML6 A;  3ZL5 A;  4GSS A;  4V1A g;  2ES7 A;  1TU8 A;  1PGT A;  1A2M A;  3FYG A;  2PBJ A;  4HEA 2;  3FZ9 A;  2L5O A;  4GCI A;  1OE7 A;  1VGL A;  4IN0 A;  1A0R P;  4XHM A;  17GS A;  1SKR B;  6GSU A;  3O76 A;  1FB0 A;  2NBS A;  2HYX A;  1VF2 A;  5HFI A;  3GKX A;  3GFK A;  3VPQ A;  2KOK A;  4K8M A;  1A0F A;  1F3B A;  5D73 A;  2HXK A;  1TRW A;  1A8Y A;  2C4J A;  1GSE A;  2CVK A;  2X8H A;  3H1N A;  5A4U A;  1SL0 B;  5ECI B;  3LFL A;  4KAE A;  1XWB A;  3HXS A;  4MPG A;  4GRF A;  3FR3 A;  1EV4 A;  1JLW A;  5G5E A;  4MF7 A;  4DEJ A;  2GTU A;  2B5Y A;  3GSS A;  2AAW A;  1TJD A;  4KCE A;  1ACV A;  4WF4 A;  4EF0 A;  5CO3 A;  4DSS B;  3BBY A;  3LXZ A;  2G0F A;  2YOI A;  3GIX A;  4TR1 A;  2PU9 C;  4EDY A;  2X99 A;  4ZB9 A;  1TP9 A;  2LJA A;  3F6D A;  4GQF A;  3MDK A;  3EMP A;  3CSJ A;  4ZIJ A;  2YJ7 A;  3ZZX A;  2CT6 A;  3HKR A;  4ILF A;  1N2A A;  5HFK A;  3KH7 A;  2C0E A;  3GH9 A;  4MH2 A;  4K9Z A;  3AY8 A;  1T4Y A;  4MJE A;  4IQ1 A;  3VK9 A;  1TTZ A;  4WR5 A;  3HVV A;  3L4N A;  2H70 A;  5A5K A;  1XCC A;  1MD3 A;  4BL7 B;  3TJB A;  3VWU A;  22GS A;  3Q6O A;  3APO A;  4HQS A;  2C3Q A;  2F3M A;  2GZP A;  2H0I A;  5AN1 A;  2XPE A;  1A2J A;  1JLV A;  3HJP A;  4GLT A;  4KSO A;  4RUV A;  2LS5 A;  5ECS A;  1GUK A;  5CAX A;  5G2Z A;  1K3L A;  5L71 A;  4I6X A;  1ILO A;  4IKH A;  4L0U A;  2PER A;  5H5R A;  1B4Q A;  4KF9 A;  2H6Y A;  2CAI A;  5DAL B;  2IFQ B;  4ID0 A;  3PH9 A;  1U87 A;  2MBT A;  4L5O A;  4LL4 B;  1ERW A;  5CRE A;  2VL9 A;  3M3M A;  1WP0 A;  4XS6 A;  3WT1 A;  2BJX A;  1B9X C;  3ZRD A;  1GNW A;  3ERW A;  3QPM A;  2FUG 2;  3W6G A;  4L8E A;  4Z7X A;  4IS0 A;  5D8I A;  5DAK A;  3DEX A;  4KND A;  1GP1 A;  2FHE A;  1SYX A;  1OC8 A;  3RPN A;  4MK3 A;  1FVJ A;  2KLX A;  4G9H A; 
#chains in the Genus database with same CATH topology
 1XWK A;  2HRA A;  2CV4 A;  3GUR A;  3IA1 A;  4V2L A;  1F37 A;  2V6K A;  2YWI A;  1ZL9 A;  1QQ2 A;  1FOV A;  4WXT A;  4ZL9 A;  4MAB A;  2LV3 A;  3I69 A;  2GST A;  3Q19 A;  2YV9 A;  3I9V 2;  1ST9 A;  3IHG A;  2NPB A;  4LMW A;  1ZYE A;  3EIN A;  1BF5 A;  2HSN A;  3CTG A;  3MAK A;  3GH6 A;  1F3A A;  4GF0 A;  2H75 A;  4OFT A;  5ECO B;  2H71 A;  3CTF A;  1GTI A;  4HZ2 A;  4PXO A;  3RFR C;  4YQV A;  2OAC A;  3ERF A;  3TKQ A;  1EP7 A;  1O8X A;  1DSB A;  2H1G A;  5J41 A;  1U3I A;  2KUC A;  1QMV A;  5A1N A;  5CRD A;  1GSU A;  4OO4 A;  1H4O A;  2EIR A;  5HR2 A;  3HA9 A;  4MP4 A;  3IDV A;  3FRC A;  4MJA A;  1XBS A;  1HNA A;  3KMN A;  1G7O A;  3ME7 A;  1GRX A;  5IMZ A;  1G0T A;  5AGY A;  2VLV A;  4Q5F A;  1YEW C;  1Z7P A;  3E9J B;  1K0N A;  1NHY A;  1PN9 A;  6GST A;  5J4Y A;  1GSS A;  3UBK A;  1K0B A;  3IK7 A;  2IME A;  2OAD A;  3LJR A;  2VCW A;  3TRQ A;  1V58 A;  3VWX A;  4L5L A;  1W4V A;  3HMJ G;  2H74 A;  4H86 A;  4MZC A;  2WFC A;  3GKM A;  5ELG A;  3MYD A;  5J4U A;  1SEN A;  1PX6 A;  4BVY A;  4TOP A;  3DKS A;  2VCZ A;  4PTS A;  4XRD A;  3A2V A;  4TVE A;  1R5P A;  5DJM A;  2I3Y A;  3LWA A;  2FWF A;  5IM9 A;  1EGR A;  1M2D A;  3SWL A;  3UMA A;  2HSY A;  1PL2 A;  3PR8 A;  3CXG A;  5IOW A;  3ERG A;  4FYB A;  2GT5 A;  2LQQ A;  4A5P A;  1SVL A;  4AF2 A;  3W8J A;  1XIY A;  1TRU A;  2JAC A;  3FY7 A;  2IJY A;  4KCA A;  5IIZ A;  2R5G A;  1M7T A;  5ENU A;  3GX8 A;  1V40 A;  4X1U A;  2R4V A;  5G5F A;  4Q5Q A;  2O8V B;  3EU4 A;  4AJ6 A;  2HRK A;  5ECQ B;  2HZE A;  1OE8 A;  1OC9 B;  5ECM B;  2DKH A;  2O3E A;  3L0H A;  1B9Y C;  1XW5 A;  3HZ8 A;  2WJU A;  2H1L A;  3UAR A;  2GQM A;  5KEJ A;  2MYG A;  3TKR A;  4WF5 A;  1GUL A;  2WRT A;  2MMA A;  2XBQ A;  4FYU A;  5IO0 A;  2WVZ A;  1VRS D;  2ZUP A;  2NTO A;  2AB6 A;  1ZOF A;  1BAY A;  2X8G A;  5HFG A;  4HJ2 A;  4XIH A;  1AUC A;  1SD8 A;  5DDL A;  1SVO A;  4RQR A;  1XOB A;  1J9B A;  5G30 A;  4EXJ A;  4OWY A;  2GSS A;  1AAZ A;  2IMK A;  5BMU A;  1U3A A;  4L0W A;  3J7Y k;  2O85 A;  1J0F A;  4CDO A;  4YAP A;  4G10 A;  5A5H B;  4Z2U A;  3EE2 A;  2FCH A;  3IXR A;  2AJQ B;  1A8L A;  1XOA A;  3D21 A;  3GHA A;  2H1A A;  2YV7 A;  1M0U A;  2GQL A;  4GDF A;  3I43 A;  2O7K A;  4O5Q A;  3IPZ A;  4ZBD A;  2C3N A;  3KH9 A;  1XVQ A;  1FW1 A;  1AC1 A;  3ME8 A;  1O73 A;  4EIP A;  5DCG A;  3UJ1 A;  4HUA A;  3G7Y A;  2DMM A;  1OYJ A;  1XWC A;  2H73 A;  3KIJ A;  5G1L A;  1WPI A;  4O32 A;  4KE3 A;  2OBK A;  3VI5 A;  3UOM A;  4POM A;  4MF5 A;  2JZR A;  4PNF A;  2V2G A;  4AKH A;  4IGJ A;  2JU5 A;  3Q18 A;  5H5Q A;  1XVW A;  1SKS B;  4XS4 A;  1W89 A;  1MTC A;  3HVN A;  4YKG A;  5F8B A;  1Z5Y E;  2VL3 A;  4EE0 A;  2LNS A;  4OO5 A;  5DQS A;  3KEB A;  5IO2 A;  5IMC A;  3BJ5 A;  5J5N A;  2WDU A;  1YF0 A;  3A5W A;  2E0Q A;  2WB9 A;  4WEY A;  2C3T A;  2H01 A;  1O85 A;  3QAG A;  2RM6 A;  1THO A;  3KD0 A;  2B6M A;  2CX4 A;  4POB A;  1M99 A;  3TJF A;  5C04 A;  3GUS A;  1XW6 A;  3EVI A;  1A23 A;  3APQ A;  3GA4 A;  3CHX C;  5GAN D;  3GYK A;  3DXB A;  2X4A A;  2VAF A;  4FYC A;  2L4Q A;  4BVX B;  1QFN A;  2YCD A;  4WBR D;  3UL3 A;  4HQZ A;  4Z2T A;  1RQM A;  1ERT A;  1T7P B;  3PIN A;  5A34 A;  2HLS A;  2DBC A;  2RII A;  2MBS A;  4GST A;  6GSV A;  4CW9 A;  1GLQ A;  5D9V A;  3G7I A;  3TJG A;  3ZYW A;  2DIZ A;  4JRR A;  4Q5R A;  1YKA A;  4ML1 A;  2KHP A;  3CQF A;  4F9Z A;  1I5G A;  1RW1 A;  3NIV A;  3C1S A;  2JSY A;  2CVD A;  3KXO A;  3L9V A;  1WIK A;  12GS A;  4EUY A;  4EVM A;  3H79 A;  2OE1 A;  3LYP A;  6GSY A;  3GTU A;  3TJK A;  3GL5 A;  5CNW A;  4V2M A;  2A2S A;  1O7U A;  4K7O A;  1VF4 A;  1V9W A;  2GGT A;  3IBH A;  4WKW A;  1MD4 A;  4ISD A;  2ZCT A;  1WJK A;  4NPB A;  2H72 A;  2C80 A;  1TRS A;  3QAV A;  1KEB A;  1UVZ A;  3LXT A;  3FW2 A;  1MDI A;  13GS A;  1WMJ A;  1PKZ A;  5INY A;  3ZIJ A;  4Q5N A;  4LMV A;  2EIQ A;  1TKD B;  4NAX A;  1K0D A;  1Z6N A;  3IOS A;  20GS A;  2R0P A;  3NZN A;  2FNO A;  1WWJ A;  5JCG A;  1TXX A;  4WBJ A;  3TRP A;  5B7C A;  4ULX A;  4AJ8 A;  5J9C A;  1Z7R A;  1XZO A;  3DIE A;  3TU3 B;  2MMO A;  1V2A A;  3F4T A;  5D9X A;  2L6D A;  3LYK A;  1SKW B;  2EFC A;  4E8H A;  1B8X A;  1TK8 B;  3LGC A;  2NVL A;  3GRX A;  1NM3 A;  3IHQ A;  3GMF A;  2UV8 G;  5IMA A;  3KJY A;  3TCO A;  4X43 A;  2XPD A;  3US3 A;  1URM A;  2KP2 A;  2H6Z A;  5IMF A;  5LCZ A;  4XTS A;  1TW9 A;  1EOH A;  3M9K A;  2OKA A;  2AHE A;  1FHE A;  3D22 A;  1QXH A;  1B48 A;  3RPP A;  3F0I A;  2M72 A;  4KX4 A;  3U5R E;  4F0C A;  2X8C A;  3G7J A;  5ID2 B;  2WW1 A;  4MH3 A;  1YF1 A;  4XS4 B;  4KDU A;  2FWH A;  5KOW A;  2WVX A;  2D2Z A;  4PQI A;  2QGV A;  2EIO A;  4N30 A;  2WS2 A;  2P31 A;  2KP1 A;  2CQ9 A;  2VCQ A;  2K8V A;  2K9F A;  4K0G A;  5CYY A;  3GKN A;  5JWQ B;  5AIV A;  1FO5 A;  4J57 E;  1QUW A;  1EGO A;  2LEG A;  18GS A;  1TXU A;  1SJZ A;  3RHB A;  4ECJ A;  1I9D A;  6GSW A;  3WYW A;  2IL3 A;  1GH2 A;  2LRN A;  5AIS A;  1O6J A;  2XBI A;  3O6T A;  3TDG A;  1TOF A;  2G2Q A;  2C1Y A;  5DVB A;  4ZL8 A;  4QQ7 A;  1WE0 A;  1G6W A;  3UVH A;  3E0U A;  4V2N A;  1IYI A;  4TXO B;  5ECH B;  5JWO B;  2HSH A;  4WET A;  2VCT A;  3LW9 A;  3EPT A;  2HE3 A;  2GVP A;  1U88 A;  2V6O A;  4ZB7 A;  2BMX A;  1UA5 A;  1EEJ A;  2ZNM A;  3ZIV A;  2V32 A;  3D4T A;  2K18 A;  3DVW A;  3G9B A;  4Z2R A;  1VF3 A;  1E6B A;  2DJK A;  3TGZ A;  3ZFB A;  3Q74 A;  5C00 A;  4KGI A;  2FA4 A;  5JCU A;  1F6M C;  4KW6 A;  5A34 B;  2LRC A;  2TIR A;  1AQX A;  2IWT A;  4EKZ A;  4WR4 A;  2R6K A;  4TKY A;  4I2T A;  1I1I P;  1AQW A;  2E2M A;  4GSN A;  2IN3 A;  3H8Q A;  4NV5 A;  3D5J A;  5B6M A;  1MDK A;  1Q4J A;  3L9S A;  4AGS A;  1X5D A;  3TJJ A;  4IQA A;  4J2F A;  1XFL A;  3QFA C;  1KBN A;  16GS A;  4QMK A;  2H0G A;  3GTU B;  2B7K A;  2IMI A;  3VLN A;  3DML A;  4N0Z A;  4YQM A;  3EWL A;  1UC7 A;  3IRA A;  3HCZ A;  4X4J A;  1R7H A;  2R0G A;  4IBP A;  2LKU A;  5EVO A;  3RHC A;  3IC8 A;  2I81 A;  4JR4 A;  1PSQ A;  3FR6 A;  2C8U A;  2VCX A;  2VD0 A;  2XC2 A;  2YP6 A;  2LST A;  5DCH A;  1RK4 A;  3CBU A;  1YJ6 A;  1OAZ A;  1Z6M A;  1ZCP A;  4I2U A;  4HOJ A;  1CQH A;  1ERU A;  3M9J A;  4FQU A;  2RUE A;  5EPF A;  1IYH A;  2ALB A;  2NDO A;  2F9S A;  2HQT A;  3ZFL A;  4K5S A;  4HJM A;  3D6I A;  4ZIL A;  4N0V A;  5KN2 A;  4TR1 B;  8GSS A;  5KOX A;  1MDJ A;  4DSQ A;  2HSM A;  1GSY A;  2AUV A;  4AKG A;  3QFB C;  4NXI A;  3C7M A;  1LJR A;  3HZ4 A;  4OFN A;  2JZT A;  3TKS E;  2VL2 C;  2OE3 A;  2QC7 A;  2FY6 A;  2YNX A;  4FH8 A;  4IEL A;  3PGT A;  1DUG A;  2IMF A;  4NHZ A;  3A5I A;  3TKS C;  1HD2 A;  2I1U A;  3A3T A;  4ECI A;  5AIX A;  19GS A;  2X64 A;  4EO3 A;  3OR5 A;  4POL A;  2OA7 A;  4JBB A;  5IPG A;  1YKC A;  3WGD A;  3UAP A;  1Y6E A;  2B1K A;  1T00 A;  1F9M A;  3MIX A;  5KN0 A;  1XPV A;  1HNB A;  2HI7 A;  2YZH A;  1AXD A;  2FA8 A;  1EWX A;  3UIW A;  4DSR A;  2ON5 A;  2H1B A;  4ZBA A;  4K2X A;  3F3Q A;  3ZRE A;  4EC0 A;  4CHS A;  1EP8 A;  1O81 A;  1FG4 A;  1M9A A;  1EOG A;  5D96 A;  4MDC A;  5IPH A;  3UVT A;  1GL8 A;  4ICY A;  2YWO A;  2JZS A;  3MWH A;  1SYR A;  5J4V A;  2YZU A;  5J9B A;  3KGK A;  7GSS A;  1E2Y A;  5COH A;  1HQO A;  2WCI A;  4ACS A;  4YQU A;  2LTK A;  2C0G A;  3DYR A;  1GWC A;  3WGX A;  3ZML A;  4NMU A;  10GS A;  4EL1 A;  5DAK B;  1M9B A;  4IP1 A;  2EFD A;  4PNG A;  2VCV A;  2WZS A;  3QMX A;  2PVO C;  1V57 A;  4DSS A;  1PA3 A;  4JU5 A;  1TK0 B;  1N8J A;  2YJH A;  4ECB A;  1SL1 B;  5IMD A;  2X49 A;  4HDE A;  4MZW A;  2WUL A;  4KDX A;  3IAS 2;  1YDK A;  4FXY P;  1PFO A;  4P3Y B;  2L6C A;  3TUE A;  2L4C A;  1FVK A;  3CMI A;  2REM A;  2VUP A;  4K1F A;  2P5Q A;  3IV4 A;  2HSN B;  4G01 A;  1WRY A;  2WW3 A;  5CRG A;  4F0B A;  5A4V A;  5LD0 A;  1MEK A;  3F6F A;  3FZA A;  2R2J A;  3LQ7 A;  3KCM A;  3ED3 A;  5E59 A;  3UEM A;  3ZVJ A;  4G0L A;  4KB3 A;  5A1N B;  1WOU A;  3DD3 A;  2YPM A;  1TU7 A;  4BL7 A;  4MF6 A;  1Q98 A;  3WD6 A;  3MSZ A;  2GZZ A;  1R4W A;  4GQC A;  3WT2 A;  1X9M B;  2HNL A;  1DE1 A;  4GWR A;  3KP9 A;  4LL1 B;  4G0K A;  5ECP B;  4O7H A;  4PUR A;  2F8A A;  4QL7 A;  4OCF A;  2MMZ A;  2I9H A;  2GDR A;  4KH7 A;  4D73 A;  2IIY A;  1S4B P;  1GSQ A;  1SJ6 A;  1ZYQ B;  1HYU A;  3R2Q A;  3V1W A;  5DAL A;  1GSF A;  2IFQ A;  2WGR A;  4MNN A;  2FWG A;  1BX9 A;  3ZVJ D;  4IHU A;  3UBL A;  1YQ1 A;  4BVY B;  1DE2 A;  3QR6 A;  3FZ4 A;  2QKE A;  2H76 A;  4FIW A;  2OE0 A;  5A4W A;  1TI1 A;  2LUS A;  2DLX A;  5CRW A;  4HS1 A;  5GAP D;  1B4P A;  1HNC A;  4TN8 A;  3HD5 A;  2IPA A;  4IP6 A;  1NSW A;  2JL4 A;  5LNK e;  5IQY A;  3TOT A;  4TR3 A;  3RDW A;  5E4W A;  3ISO A;  2O87 A;  5B6N A;  2OT3 A;  5ECK B;  2H66 A;  1USB A;  2QA2 A;  5H5S A;  2C0F A;  2DJ3 A;  2FLS A;  4BWS A;  1X9W B;  2E2G A;  2A2R A;  5J40 A;  4F03 A;  1YY7 A;  4HZ4 A;  3KTL A;  1CQG A;  3KTB A;  4KSM A;  4ZXG A;  3VFI A;  3ZTL A;  5J47 A;  1THX A;  2OJL A;  4QL9 A;  3DWV A;  2PN8 A;  1NHO A;  2QA1 A;  2HRK B;  2HZE B;  3F63 A;  5J3R A;  2A2P A;  1AQV A;  3N5O A;  2YWN A;  1JFU A;  3J7Y b;  4JZQ A;  4PUA A;  3C8E A;  3EUR A;  3FR9 A;  1G7E A;  3EU3 A;  3WGE A;  2DIY A;  2DJ1 A;  2M80 A;  2A4V A;  2HRF A;  2MZC A;  3S9F A;  1YVL A;  3P90 A;  3R3E A;  1T3B A;  5HR1 A;  1YZX A;  2ON7 A;  4JED A;  4AJ7 A;  1ZMA A;  1N25 A;  1TDI A;  5BMU B;  4TW5 A;  3TRX A;  3HYP A;  1QK8 A;  3D0Z A;  1M3J A;  2DML A;  5IOX A;  1S3C A;  2H1D A;  1M3I A;  3VI7 A;  3ZMK A;  4MMM A;  4K7I A;  4GTU A;  2P0G A;  2B7J A;  4BPY A;  2PWJ A;  5ECL B;  2XHF A;  1S3R A;  2FWE A;  3VWV A;  1ML6 A;  2B5E A;  4ZBB A;  2VKZ G;  5G1K A;  1AIU A;  2H0H A;  2PMT A;  2Z9S A;  2H30 A;  3F8U A;  3DGQ A;  1GSD A;  3EC3 A;  5D9T A;  5FT3 A;  1KTE A;  1SVM A;  1XXU A;  4KDY A;  1BED A;  1XW9 A;  2DKI A;  4O5R A;  4TRX A;  4TXV A;  2CAQ A;  2H8L A;  1JZO A;  1TI3 A;  2CA8 A;  2LJK A;  3HHV A;  1GNE A;  2TRX A;  2VLU A;  1PRX A;  2N5A A;  1K3Y A;  3VUR A;  1YEX A;  2FGX A;  4NWY A;  5CRH A;  4K6X A;  2B1L A;  3DVX A;  5D9W A;  3FK8 A;  2BTO T;  3C1R A;  9GSS A;  2FD3 A;  2VLT A;  1T8E B;  1ABA A;  2B3S A;  3KMO A;  4KA0 A;  2RLI A;  4G2E A;  3P7X A;  1OC9 A;  1SK0 A;  3IK9 A;  4K0N A;  2OBI A;  1K0M A;  14GS A;  2HRN A;  4PQ1 A;  2K8S A;  4XRA A;  1TRV A;  3TB2 A;  1K3O A;  4MJC A;  1ZYP A;  4D73 B;  1PMT A;  3JCM L;  4AI6 A;  1EEM A;  1FOH A;  3A2W A;  4F82 A;  1GTA A;  3BOA A;  1J08 A;  4I5Q A;  2N5B A;  4LA1 A;  2DC5 A;  3BD2 A;  1V98 A;  1PQN A;  4PGT A;  5HQP A;  4N10 A;  4BA7 A;  5F0G A;  4FO5 A;  4IJ3 A;  1PX7 A;  3BCI A;  1X9S B;  1FB6 A;  4PUF C;  2I4A A;  1BG5 A;  2GSR A;  1T4Z A;  3M1G A;  5ELA A;  4K7N A;  3O3T A;  1OVN A;  3GX0 A;  1Z9H A;  2DJ2 A;  3SBC A;  2H6X A;  3LOR A;  4N3Z A;  1LBK A;  1SU9 A;  2L57 A;  1S3A A;  1M2B A;  1O8W A;  4XS1 A;  1GTB A;  2PVQ A;  4PHZ C;  1BYE A;  1OC3 A;  3W8S A;  3IR4 A;  4PX1 A;  2RM5 A;  4OD7 A;  1GLP A;  3NOF A;  2V41 A;  4K2D A;  2DJJ A;  4G0I A;  2CZ3 A;  4RI6 A;  4X0X A;  3TKP A;  3KZQ A;  1G6Y A;  3GNJ A;  5DBQ A;  4JE1 A;  4KUN A;  3C73 A;  3LSZ A;  2RUF A;  3APS A;  4MCU A;  3HJO A;  1F2E A;  3QOU A;  2CZ2 A;  4IW9 A;  2JAD A;  2LJR A;  4IVF A;  4LLR A;  4E8E A;  3H93 A;  3CSH A;  5F07 A;  1K0O A;  2V1M A;  3ZLP A;  1BQ7 A;  3F9U A;  2AV4 A;  2WZ9 A;  1X5E A;  1ON4 A;  4ZB6 A;  3EYT A;  2DJ0 A;  3GN3 A;  5DQY A;  3N9J A;  1YEP A;  2EFH A;  4USS A;  4TR4 A;  3L78 A;  4ECC A;  3PPU A;  11GS A;  2CVB A;  2LRT A;  1T1V A;  5ECR B;  5HR0 A;  4EIQ A;  3IC4 A;  2C0D A;  2JSZ A;  4MZB A;  4W66 A;  3HJM A;  3A2X A;  4IJI A;  1K0A A;  5B8B A;  5IMV A;  4BVX A;  4MJB A;  5KN3 A;  4YH2 A;  4MA9 A;  4EDZ A;  2GS3 A;  2WVY A;  3FKF A;  3VWW A;  2CX3 A;  3IE3 A;  1GUH A;  2J9H A;  3P2A A;  1LU4 A;  1EZK A;  1XWA A;  5F06 A;  2O89 A;  4JR6 A;  3C71 A;  2YWM A;  4AKI A;  4TR0 A;  2F8F A;  3CSI A;  4O5U A;  5F05 A;  4RQX A;  4F2I A;  1PL1 A;  1XG8 A;  3F3R A;  1KNG A;  1K0C A;  3LG6 A;  1OKT A;  3M8N A;  4MPF A;  1JHB A;  2H19 A;  3CRU A;  3HY2 A;  4OMV A;  4NHW A;  2P5R A;  3M0F A;  3HVS A;  4YAV A;  2WVX B;  2B5X A;  2HT9 A;  5HR3 A;  1ZZY A;  2HZF A;  5GST A;  3QD9 A;  2VM2 A;  3ZIT A;  1UN2 A;  5FWG A;  2F51 A;  2QSI A;  1A2L A;  1Z3E A;  3CWG A;  2VIM A;  2PUK C;  3H4K A;  3IAM 2;  2VM1 A;  3MNG A;  5JCW A;  2LNT A;  4V1A p;  1JZD A;  2R37 A;  4I97 A;  2GT6 A;  6GSS A;  4XCS A;  2UZ8 A;  4MLY A;  4CY8 A;  2PGT A;  3U6V A;  1PD2 1;  4OCE A;  4DVC A;  3QDN A;  1X0R A;  3D4M A;  3BCK A;  1EV9 A;  1SD9 A;  3GV1 A;  1TK5 B;  3FHK A;  1R5A A;  4G19 A;  3K8N A;  1SK1 A;  2VL2 A;  4RI7 A;  3DRN A;  3VPT A;  1X5C A;  4GXZ A;  4I8B A;  4BWQ A;  3CYN A;  3F4R A;  3HVX A;  2L5L A;  2GZY A;  3TKS A;  5ABR A;  1PKW A;  5EL8 A;  1QGV A;  2K6V A;  3E3E A;  3GST A;  5G31 A;  1U6T A;  4POK A;  2R3X A;  1C72 A;  3I6A A;  5D93 A;  5FHI A;  6GSX A;  2EC4 A;  3HDC A;  2TRC P;  3FZ5 A;  3CRT A;  1SL2 B;  2YN1 A;  2VO4 A;  3F4S A;  2E7P A;  1FAA A;  2VD1 A;  4ZL7 A;  4ZB8 A;  1H75 A;  1JZW A;  4OFM A;  5KN1 A;  1DBY A;  2WW2 A;  5ID2 A;  1S3D A;  2M46 A;  3RAZ A;  1GUM A;  2EFE A;  3LEF A;  1ERV A;  3TOU A;  3L9U A;  1SK2 A;  2GLR A;  4PI0 C;  5GSS A;  2DSA A;  1GTU A;  1Y25 A;  2MMN A;  3RBT A;  2N5F A;  2AYT A;  2L59 A;  1BJX A;  3EMX A;  4NV2 A;  3KP8 A;  2R0C A;  2O36 A;  2VOC A;  3P8W A;  4HI7 A;  1SJI A;  3QCP A;  3GKK A;  5CP1 A;  5JWR B;  2YAN A;  1NW2 A;  2HSM B;  1M2A A;  1R26 A;  5ECN B;  5EY6 A;  4PQH A;  1PN0 A;  4TXO A;  3KM6 A;  2HFD A;  3FEU A;  4O92 A;  1OKD A;  1JZR A;  4PI2 C;  1ZGN A;  1A24 A;  1AW9 A;  2GQK A;  2LQO A;  2GSQ A;  1VF1 A;  5DJL A;  4N11 A;  2PPT A;  3QAW A;  4J56 E;  2J23 A;  5B8A A;  2IMD A;  5GZZ B;  3GL3 A;  1XWG A;  4HU7 A;  4HU9 A;  4ML6 A;  3ZL5 A;  4GSS A;  4K5R A;  4V1A g;  2ES7 A;  1TU8 A;  1PGT A;  1A2M A;  3FYG A;  2PBJ A;  4HEA 2;  3FZ9 A;  2L5O A;  4GCI A;  1OE7 A;  1VGL A;  1A0R P;  4IN0 A;  4XHM A;  17GS A;  1SKR B;  6GSU A;  3O76 A;  1FB0 A;  2NBS A;  2HYX A;  4AKX B;  1VF2 A;  5HFI A;  3GKX A;  3GFK A;  3VPQ A;  2KOK A;  4K8M A;  1A0F A;  1F3B A;  5D73 A;  2HXK A;  1TRW A;  4YKF A;  1A8Y A;  2C4J A;  1GSE A;  2A4H A;  2CVK A;  3FMW A;  2X8H A;  3H1N A;  5A4U A;  1SL0 B;  5ECI B;  3LFL A;  4KAE A;  4E68 A;  1XWB A;  3HXS A;  4MPG A;  4GRF A;  1BG1 A;  3FR3 A;  1EV4 A;  1JLW A;  5G5E A;  4MF7 A;  4DEJ A;  4BIK A;  2GTU A;  2B5Y A;  3GSS A;  2AAW A;  1TJD A;  4KCE A;  1ACV A;  4WF4 A;  4EF0 A;  5CO3 A;  4DSS B;  3BBY A;  3LXZ A;  2G0F A;  2YOI A;  3GIX A;  4TR1 A;  2WW0 A;  2PU9 C;  4EDY A;  2X99 A;  4ZB9 A;  1TP9 A;  2LJA A;  3F6D A;  4GQF A;  3MDK A;  4HSC X;  3EMP A;  3CSJ A;  4ZIJ A;  2YJ7 A;  3ZZX A;  2CT6 A;  3HKR A;  4ILF A;  1N2A A;  5HFK A;  3KH7 A;  2C0E A;  3GH9 A;  4MH2 A;  4K9Z A;  3AY8 A;  1T4Y A;  1Y1U A;  4MJE A;  4IQ1 A;  3VK9 A;  1TTZ A;  4WR5 A;  3HVV A;  3L4N A;  2H70 A;  5A5K A;  5BRT A;  1XCC A;  1MD3 A;  4BL7 B;  3TJB A;  3VWU A;  22GS A;  3Q6O A;  3APO A;  4HQS A;  2C3Q A;  2F3M A;  2O5V A;  2GZP A;  2H0I A;  5AN1 A;  2XPE A;  1A2J A;  4CY6 A;  1JLV A;  3HJP A;  4GLT A;  4KSO A;  4RUV A;  2LS5 A;  3RGB C;  1ZYN A;  5ECS A;  1GUK A;  5CAX A;  5G2Z A;  1K3L A;  5L71 A;  4I6X A;  1ILO A;  4IKH A;  4L0U A;  2PER A;  5H5R A;  1B4Q A;  4KF9 A;  2H6Y A;  2CAI A;  5DAL B;  2IFQ B;  4ID0 A;  3PH9 A;  1U87 A;  2MBT A;  4L5O A;  4LL4 B;  1ERW A;  5CRE A;  2VL9 A;  3M3M A;  1WP0 A;  4XS6 A;  3WT1 A;  2BJX A;  1B9X C;  3ZRD A;  1GNW A;  3ERW A;  3QPM A;  2FUG 2;  3W6G A;  4L8E A;  4Z7X A;  4IS0 A;  5D8I A;  5DAK A;  3DEX A;  4KND A;  1GP1 A;  2FHE A;  5A5H A;  1SYX A;  1OC8 A;  3RPN A;  4MK3 A;  1FVJ A;  2KLX A;  4G9H A; 
#chains in the Genus database with same CATH homology
 1XWK A;  2HRA A;  2CV4 A;  3GUR A;  3IA1 A;  4V2L A;  1F37 A;  2V6K A;  2YWI A;  1ZL9 A;  1QQ2 A;  1FOV A;  4WXT A;  4ZL9 A;  4MAB A;  2LV3 A;  3I69 A;  2GST A;  3Q19 A;  2YV9 A;  3I9V 2;  1ST9 A;  3IHG A;  2NPB A;  4LMW A;  1ZYE A;  3EIN A;  1BF5 A;  2HSN A;  3CTG A;  3MAK A;  3GH6 A;  1F3A A;  4GF0 A;  2H75 A;  4OFT A;  5ECO B;  2H71 A;  3CTF A;  1GTI A;  4HZ2 A;  4PXO A;  4YQV A;  2OAC A;  3ERF A;  3TKQ A;  1EP7 A;  1O8X A;  1DSB A;  2H1G A;  5J41 A;  1U3I A;  2KUC A;  1QMV A;  5A1N A;  5CRD A;  1GSU A;  4OO4 A;  1H4O A;  2EIR A;  5HR2 A;  3HA9 A;  4MP4 A;  3IDV A;  3FRC A;  4MJA A;  1XBS A;  1HNA A;  3KMN A;  1G7O A;  3ME7 A;  1GRX A;  5IMZ A;  1G0T A;  5AGY A;  2VLV A;  4Q5F A;  1Z7P A;  3E9J B;  1K0N A;  1NHY A;  1PN9 A;  6GST A;  5J4Y A;  1GSS A;  3UBK A;  1K0B A;  3IK7 A;  2IME A;  2OAD A;  3LJR A;  2VCW A;  3TRQ A;  1V58 A;  3VWX A;  4L5L A;  1W4V A;  3HMJ G;  2H74 A;  4H86 A;  4MZC A;  2WFC A;  3GKM A;  5ELG A;  3MYD A;  5J4U A;  1SEN A;  1PX6 A;  4BVY A;  4TOP A;  3DKS A;  2VCZ A;  4PTS A;  4XRD A;  3A2V A;  4TVE A;  1R5P A;  5DJM A;  2I3Y A;  3LWA A;  2FWF A;  5IM9 A;  1EGR A;  1M2D A;  3SWL A;  3UMA A;  2HSY A;  1PL2 A;  3PR8 A;  3CXG A;  5IOW A;  3ERG A;  4FYB A;  2GT5 A;  2LQQ A;  4A5P A;  1SVL A;  4AF2 A;  3W8J A;  1XIY A;  1TRU A;  2JAC A;  3FY7 A;  2IJY A;  4KCA A;  5IIZ A;  2R5G A;  1M7T A;  5ENU A;  3GX8 A;  1V40 A;  4X1U A;  2R4V A;  5G5F A;  4Q5Q A;  2O8V B;  3EU4 A;  4AJ6 A;  2HRK A;  5ECQ B;  2HZE A;  1OE8 A;  1OC9 B;  5ECM B;  2DKH A;  3L0H A;  1B9Y C;  1XW5 A;  3HZ8 A;  2WJU A;  2H1L A;  3UAR A;  2GQM A;  5KEJ A;  2MYG A;  3TKR A;  4WF5 A;  1GUL A;  2WRT A;  2MMA A;  2XBQ A;  4FYU A;  5IO0 A;  1VRS D;  2ZUP A;  2NTO A;  2AB6 A;  1ZOF A;  1BAY A;  2X8G A;  5HFG A;  4HJ2 A;  4XIH A;  1AUC A;  1SD8 A;  5DDL A;  1SVO A;  4RQR A;  1XOB A;  1J9B A;  5G30 A;  4EXJ A;  4OWY A;  2GSS A;  1AAZ A;  2IMK A;  5BMU A;  1U3A A;  4L0W A;  3J7Y k;  2O85 A;  1J0F A;  4CDO A;  4YAP A;  4G10 A;  5A5H B;  4Z2U A;  3EE2 A;  2FCH A;  3IXR A;  2AJQ B;  1A8L A;  1XOA A;  3D21 A;  3GHA A;  2H1A A;  2YV7 A;  1M0U A;  2GQL A;  4GDF A;  3I43 A;  2O7K A;  4O5Q A;  3IPZ A;  4ZBD A;  3KH9 A;  2C3N A;  1XVQ A;  1FW1 A;  1AC1 A;  3ME8 A;  1O73 A;  4EIP A;  5DCG A;  3UJ1 A;  4HUA A;  3G7Y A;  2DMM A;  1OYJ A;  1XWC A;  2H73 A;  3KIJ A;  5G1L A;  1WPI A;  4O32 A;  4KE3 A;  2OBK A;  3VI5 A;  3UOM A;  4POM A;  4MF5 A;  2JZR A;  4PNF A;  2V2G A;  4AKH A;  4IGJ A;  2JU5 A;  3Q18 A;  5H5Q A;  1XVW A;  1SKS B;  4XS4 A;  1W89 A;  1MTC A;  4YKG A;  5F8B A;  1Z5Y E;  2VL3 A;  4EE0 A;  2LNS A;  4OO5 A;  5DQS A;  3KEB A;  5IO2 A;  5IMC A;  3BJ5 A;  5J5N A;  2WDU A;  1YF0 A;  3A5W A;  2E0Q A;  2WB9 A;  4WEY A;  2C3T A;  2H01 A;  1O85 A;  3QAG A;  2RM6 A;  1THO A;  3KD0 A;  2B6M A;  2CX4 A;  4POB A;  1M99 A;  3TJF A;  5C04 A;  3GUS A;  1XW6 A;  3EVI A;  1A23 A;  3APQ A;  3GA4 A;  5GAN D;  3GYK A;  3DXB A;  2X4A A;  2VAF A;  4FYC A;  2L4Q A;  4BVX B;  1QFN A;  2YCD A;  4WBR D;  3UL3 A;  4HQZ A;  4Z2T A;  1RQM A;  1ERT A;  1T7P B;  3PIN A;  5A34 A;  2HLS A;  2DBC A;  2RII A;  2MBS A;  4GST A;  6GSV A;  4CW9 A;  1GLQ A;  5D9V A;  3G7I A;  3TJG A;  3ZYW A;  2DIZ A;  4JRR A;  4Q5R A;  1YKA A;  4ML1 A;  2KHP A;  4F9Z A;  1I5G A;  1RW1 A;  3NIV A;  3C1S A;  2JSY A;  2CVD A;  3KXO A;  3L9V A;  1WIK A;  12GS A;  4EUY A;  4EVM A;  3H79 A;  2OE1 A;  3LYP A;  6GSY A;  3GTU A;  3TJK A;  3GL5 A;  5CNW A;  4V2M A;  2A2S A;  1O7U A;  4K7O A;  1VF4 A;  1V9W A;  2GGT A;  3IBH A;  4WKW A;  1MD4 A;  4ISD A;  2ZCT A;  1WJK A;  4NPB A;  2H72 A;  2C80 A;  1TRS A;  3QAV A;  1KEB A;  1UVZ A;  3LXT A;  3FW2 A;  1MDI A;  13GS A;  1WMJ A;  1PKZ A;  5INY A;  3ZIJ A;  4Q5N A;  4LMV A;  2EIQ A;  1TKD B;  4NAX A;  1K0D A;  1Z6N A;  3IOS A;  20GS A;  2R0P A;  3NZN A;  2FNO A;  1WWJ A;  5JCG A;  1TXX A;  4WBJ A;  3TRP A;  5B7C A;  4ULX A;  4AJ8 A;  5J9C A;  1Z7R A;  1XZO A;  3DIE A;  3TU3 B;  2MMO A;  1V2A A;  3F4T A;  5D9X A;  2L6D A;  3LYK A;  1SKW B;  2EFC A;  4E8H A;  1B8X A;  1TK8 B;  3LGC A;  2NVL A;  3GRX A;  1NM3 A;  3IHQ A;  3GMF A;  2UV8 G;  5IMA A;  3KJY A;  3TCO A;  4X43 A;  2XPD A;  3US3 A;  1URM A;  2KP2 A;  2H6Z A;  5IMF A;  5LCZ A;  4XTS A;  1TW9 A;  1EOH A;  3M9K A;  2OKA A;  2AHE A;  1FHE A;  3D22 A;  1QXH A;  1B48 A;  3RPP A;  3F0I A;  2M72 A;  4KX4 A;  3U5R E;  4F0C A;  2X8C A;  3G7J A;  5ID2 B;  4MH3 A;  1YF1 A;  4XS4 B;  4KDU A;  2FWH A;  5KOW A;  2D2Z A;  4PQI A;  2QGV A;  2EIO A;  4N30 A;  2WS2 A;  2P31 A;  2KP1 A;  2CQ9 A;  2VCQ A;  2K8V A;  2K9F A;  4K0G A;  5CYY A;  3GKN A;  5JWQ B;  5AIV A;  1FO5 A;  4J57 E;  1QUW A;  1EGO A;  2LEG A;  18GS A;  1TXU A;  1SJZ A;  3RHB A;  4ECJ A;  1I9D A;  6GSW A;  3WYW A;  2IL3 A;  1GH2 A;  2LRN A;  5AIS A;  1O6J A;  2XBI A;  3O6T A;  3TDG A;  1TOF A;  2G2Q A;  2C1Y A;  5DVB A;  4ZL8 A;  4QQ7 A;  1WE0 A;  1G6W A;  3UVH A;  3E0U A;  4V2N A;  1IYI A;  4TXO B;  5ECH B;  5JWO B;  2HSH A;  4WET A;  2VCT A;  3LW9 A;  3EPT A;  2HE3 A;  2GVP A;  1U88 A;  2V6O A;  4ZB7 A;  2BMX A;  1UA5 A;  1EEJ A;  2ZNM A;  3ZIV A;  2V32 A;  3D4T A;  2K18 A;  3DVW A;  3G9B A;  4Z2R A;  1VF3 A;  1E6B A;  2DJK A;  3TGZ A;  3ZFB A;  3Q74 A;  5C00 A;  4KGI A;  2FA4 A;  5JCU A;  1F6M C;  4KW6 A;  5A34 B;  2LRC A;  2TIR A;  1AQX A;  2IWT A;  4EKZ A;  4WR4 A;  2R6K A;  4TKY A;  4I2T A;  1AQW A;  2E2M A;  4GSN A;  2IN3 A;  3H8Q A;  4NV5 A;  3D5J A;  5B6M A;  1MDK A;  1Q4J A;  3L9S A;  4AGS A;  1X5D A;  3TJJ A;  4IQA A;  4J2F A;  1XFL A;  3QFA C;  1KBN A;  16GS A;  4QMK A;  2H0G A;  3GTU B;  2B7K A;  2IMI A;  3VLN A;  3DML A;  4N0Z A;  4YQM A;  3EWL A;  1UC7 A;  3IRA A;  3HCZ A;  4X4J A;  1R7H A;  2R0G A;  4IBP A;  2LKU A;  5EVO A;  3RHC A;  3IC8 A;  2I81 A;  4JR4 A;  1PSQ A;  3FR6 A;  2C8U A;  2VCX A;  2VD0 A;  2XC2 A;  2YP6 A;  2LST A;  5DCH A;  1RK4 A;  3CBU A;  1YJ6 A;  1OAZ A;  1Z6M A;  1ZCP A;  4I2U A;  4HOJ A;  1CQH A;  1ERU A;  3M9J A;  4FQU A;  2RUE A;  5EPF A;  1IYH A;  2ALB A;  2NDO A;  2F9S A;  2HQT A;  3ZFL A;  4K5S A;  4HJM A;  3D6I A;  4ZIL A;  4N0V A;  5KN2 A;  4TR1 B;  8GSS A;  5KOX A;  1MDJ A;  4DSQ A;  2HSM A;  1GSY A;  2AUV A;  4AKG A;  3QFB C;  4NXI A;  3C7M A;  1LJR A;  3HZ4 A;  4OFN A;  2JZT A;  3TKS E;  2VL2 C;  2OE3 A;  2QC7 A;  2FY6 A;  2YNX A;  4FH8 A;  4IEL A;  3PGT A;  1DUG A;  2IMF A;  4NHZ A;  3A5I A;  3TKS C;  1HD2 A;  2I1U A;  3A3T A;  4ECI A;  5AIX A;  19GS A;  2X64 A;  4EO3 A;  3OR5 A;  4POL A;  2OA7 A;  4JBB A;  5IPG A;  1YKC A;  3WGD A;  3UAP A;  1Y6E A;  2B1K A;  1T00 A;  1F9M A;  3MIX A;  5KN0 A;  1XPV A;  1HNB A;  2HI7 A;  2YZH A;  1AXD A;  2FA8 A;  1EWX A;  3UIW A;  4DSR A;  2ON5 A;  2H1B A;  4ZBA A;  4K2X A;  3F3Q A;  3ZRE A;  4EC0 A;  4CHS A;  1EP8 A;  1O81 A;  1FG4 A;  1M9A A;  1EOG A;  5D96 A;  4MDC A;  5IPH A;  3UVT A;  1GL8 A;  4ICY A;  2YWO A;  2JZS A;  3MWH A;  1SYR A;  5J4V A;  2YZU A;  5J9B A;  3KGK A;  7GSS A;  1E2Y A;  5COH A;  1HQO A;  2WCI A;  4ACS A;  4YQU A;  2LTK A;  2C0G A;  3DYR A;  1GWC A;  3WGX A;  3ZML A;  4NMU A;  10GS A;  4EL1 A;  5DAK B;  1M9B A;  4IP1 A;  2EFD A;  4PNG A;  2VCV A;  3QMX A;  2PVO C;  1V57 A;  4DSS A;  1PA3 A;  4JU5 A;  1TK0 B;  1N8J A;  2YJH A;  4ECB A;  1SL1 B;  5IMD A;  2X49 A;  4HDE A;  4MZW A;  2WUL A;  4KDX A;  3IAS 2;  1YDK A;  4P3Y B;  2L6C A;  3TUE A;  2L4C A;  1FVK A;  3CMI A;  2REM A;  2VUP A;  4K1F A;  2P5Q A;  3IV4 A;  2HSN B;  4G01 A;  1WRY A;  5CRG A;  4F0B A;  5A4V A;  5LD0 A;  1MEK A;  3F6F A;  3FZA A;  2R2J A;  3LQ7 A;  3KCM A;  3ED3 A;  5E59 A;  3UEM A;  3ZVJ A;  4G0L A;  4KB3 A;  5A1N B;  1WOU A;  3DD3 A;  1TU7 A;  2YPM A;  4BL7 A;  4MF6 A;  1Q98 A;  3WD6 A;  3MSZ A;  2GZZ A;  1R4W A;  4GQC A;  3WT2 A;  1X9M B;  2HNL A;  1DE1 A;  4GWR A;  3KP9 A;  4LL1 B;  4G0K A;  5ECP B;  4O7H A;  4PUR A;  2F8A A;  4QL7 A;  4OCF A;  2MMZ A;  2I9H A;  2GDR A;  4KH7 A;  4D73 A;  2IIY A;  1SJ6 A;  1GSQ A;  1ZYQ B;  1HYU A;  3R2Q A;  3V1W A;  5DAL A;  1GSF A;  2IFQ A;  2WGR A;  4MNN A;  2FWG A;  1BX9 A;  3ZVJ D;  4IHU A;  3UBL A;  1YQ1 A;  4BVY B;  1DE2 A;  3QR6 A;  3FZ4 A;  2QKE A;  2H76 A;  4FIW A;  2OE0 A;  5A4W A;  1TI1 A;  2LUS A;  2DLX A;  5CRW A;  4HS1 A;  5GAP D;  1B4P A;  1HNC A;  4TN8 A;  3HD5 A;  2IPA A;  4IP6 A;  1NSW A;  2JL4 A;  5LNK e;  5IQY A;  3TOT A;  4TR3 A;  3RDW A;  5E4W A;  3ISO A;  2O87 A;  5B6N A;  2OT3 A;  5ECK B;  2H66 A;  1USB A;  2QA2 A;  5H5S A;  2C0F A;  2DJ3 A;  2FLS A;  4BWS A;  1X9W B;  2E2G A;  2A2R A;  5J40 A;  4F03 A;  1YY7 A;  4HZ4 A;  3KTL A;  1CQG A;  3KTB A;  4KSM A;  4ZXG A;  3VFI A;  3ZTL A;  5J47 A;  1THX A;  2OJL A;  4QL9 A;  3DWV A;  2PN8 A;  1NHO A;  2QA1 A;  2HRK B;  2HZE B;  3F63 A;  5J3R A;  2A2P A;  1AQV A;  3N5O A;  2YWN A;  1JFU A;  3J7Y b;  4JZQ A;  4PUA A;  3C8E A;  3EUR A;  3FR9 A;  1G7E A;  3EU3 A;  3WGE A;  2DIY A;  2DJ1 A;  2M80 A;  2A4V A;  2HRF A;  2MZC A;  3S9F A;  1YVL A;  3P90 A;  3R3E A;  1T3B A;  5HR1 A;  1YZX A;  2ON7 A;  4JED A;  4AJ7 A;  1ZMA A;  1N25 A;  1TDI A;  5BMU B;  4TW5 A;  3TRX A;  3HYP A;  1QK8 A;  3D0Z A;  2DML A;  5IOX A;  1S3C A;  2H1D A;  3VI7 A;  3ZMK A;  4MMM A;  4K7I A;  4GTU A;  2P0G A;  2B7J A;  4BPY A;  2PWJ A;  5ECL B;  2XHF A;  2FWE A;  3VWV A;  1ML6 A;  2B5E A;  4ZBB A;  2VKZ G;  5G1K A;  1AIU A;  2H0H A;  2PMT A;  2Z9S A;  2H30 A;  3F8U A;  3DGQ A;  1GSD A;  3EC3 A;  5D9T A;  5FT3 A;  1KTE A;  1SVM A;  1XXU A;  4KDY A;  1BED A;  1XW9 A;  2DKI A;  4O5R A;  4TRX A;  4TXV A;  2CAQ A;  2H8L A;  1JZO A;  1TI3 A;  2CA8 A;  2LJK A;  3HHV A;  1GNE A;  2TRX A;  2VLU A;  1PRX A;  2N5A A;  1K3Y A;  3VUR A;  1YEX A;  2FGX A;  4NWY A;  5CRH A;  4K6X A;  2B1L A;  3DVX A;  5D9W A;  3FK8 A;  2BTO T;  3C1R A;  9GSS A;  2FD3 A;  2VLT A;  1T8E B;  1ABA A;  2B3S A;  3KMO A;  4KA0 A;  2RLI A;  4G2E A;  3P7X A;  1OC9 A;  1SK0 A;  3IK9 A;  4K0N A;  2OBI A;  1K0M A;  14GS A;  2HRN A;  4PQ1 A;  2K8S A;  4XRA A;  1TRV A;  3TB2 A;  1K3O A;  4MJC A;  1ZYP A;  4D73 B;  1PMT A;  3JCM L;  4AI6 A;  1EEM A;  1FOH A;  3A2W A;  4F82 A;  1GTA A;  3BOA A;  1J08 A;  4I5Q A;  2N5B A;  4LA1 A;  2DC5 A;  3BD2 A;  1V98 A;  1PQN A;  4PGT A;  5HQP A;  4N10 A;  4BA7 A;  5F0G A;  4FO5 A;  4IJ3 A;  1PX7 A;  3BCI A;  1X9S B;  1FB6 A;  4PUF C;  2I4A A;  1BG5 A;  2GSR A;  1T4Z A;  3M1G A;  5ELA A;  4K7N A;  3O3T A;  1OVN A;  3GX0 A;  1Z9H A;  2DJ2 A;  3SBC A;  2H6X A;  3LOR A;  4N3Z A;  1LBK A;  1SU9 A;  2L57 A;  1S3A A;  1M2B A;  1O8W A;  4XS1 A;  1GTB A;  2PVQ A;  1BYE A;  1OC3 A;  3W8S A;  3IR4 A;  4PX1 A;  2RM5 A;  4OD7 A;  1GLP A;  3NOF A;  2V41 A;  4K2D A;  2DJJ A;  4G0I A;  2CZ3 A;  4RI6 A;  4X0X A;  3TKP A;  3KZQ A;  1G6Y A;  3GNJ A;  5DBQ A;  4JE1 A;  4KUN A;  3C73 A;  3LSZ A;  2RUF A;  3APS A;  4MCU A;  3HJO A;  1F2E A;  3QOU A;  2CZ2 A;  4IW9 A;  2JAD A;  2LJR A;  4IVF A;  4LLR A;  4E8E A;  3H93 A;  3CSH A;  5F07 A;  1K0O A;  2V1M A;  3ZLP A;  1BQ7 A;  3F9U A;  2AV4 A;  2WZ9 A;  1X5E A;  1ON4 A;  4ZB6 A;  3EYT A;  2DJ0 A;  3GN3 A;  5DQY A;  3N9J A;  1YEP A;  2EFH A;  4USS A;  4TR4 A;  3L78 A;  4ECC A;  3PPU A;  11GS A;  2CVB A;  2LRT A;  1T1V A;  5ECR B;  5HR0 A;  4EIQ A;  3IC4 A;  2C0D A;  2JSZ A;  4MZB A;  4W66 A;  3HJM A;  3A2X A;  4IJI A;  1K0A A;  5B8B A;  5IMV A;  4BVX A;  4MJB A;  5KN3 A;  4YH2 A;  4MA9 A;  4EDZ A;  2GS3 A;  3FKF A;  3VWW A;  2CX3 A;  3IE3 A;  1GUH A;  2J9H A;  3P2A A;  1LU4 A;  1EZK A;  1XWA A;  5F06 A;  2O89 A;  4JR6 A;  3C71 A;  2YWM A;  4AKI A;  4TR0 A;  2F8F A;  3CSI A;  4O5U A;  5F05 A;  4RQX A;  4F2I A;  1PL1 A;  3F3R A;  1KNG A;  1K0C A;  3LG6 A;  1OKT A;  3M8N A;  4MPF A;  1JHB A;  2H19 A;  3CRU A;  3HY2 A;  4OMV A;  4NHW A;  2P5R A;  3M0F A;  3HVS A;  4YAV A;  2B5X A;  2HT9 A;  5HR3 A;  1ZZY A;  2HZF A;  5GST A;  3QD9 A;  2VM2 A;  3ZIT A;  1UN2 A;  5FWG A;  2F51 A;  2QSI A;  1A2L A;  1Z3E A;  3CWG A;  2VIM A;  2PUK C;  3H4K A;  3IAM 2;  2VM1 A;  3MNG A;  5JCW A;  2LNT A;  4V1A p;  1JZD A;  2R37 A;  4I97 A;  2GT6 A;  6GSS A;  4XCS A;  2UZ8 A;  4MLY A;  4CY8 A;  2PGT A;  3U6V A;  1PD2 1;  4OCE A;  4DVC A;  3QDN A;  1X0R A;  3D4M A;  3BCK A;  1EV9 A;  1SD9 A;  3GV1 A;  1TK5 B;  3FHK A;  1R5A A;  4G19 A;  3K8N A;  1SK1 A;  2VL2 A;  4RI7 A;  3DRN A;  3VPT A;  1X5C A;  4GXZ A;  4I8B A;  4BWQ A;  3CYN A;  3F4R A;  3HVX A;  2L5L A;  2GZY A;  3TKS A;  5ABR A;  1PKW A;  5EL8 A;  1QGV A;  2K6V A;  3E3E A;  3GST A;  5G31 A;  1U6T A;  4POK A;  2R3X A;  1C72 A;  3I6A A;  5D93 A;  5FHI A;  6GSX A;  2EC4 A;  3HDC A;  2TRC P;  3FZ5 A;  3CRT A;  1SL2 B;  2YN1 A;  2VO4 A;  3F4S A;  2E7P A;  1FAA A;  2VD1 A;  4ZL7 A;  4ZB8 A;  1H75 A;  1JZW A;  4OFM A;  5KN1 A;  1DBY A;  5ID2 A;  1S3D A;  2M46 A;  3RAZ A;  1GUM A;  2EFE A;  3LEF A;  1ERV A;  3TOU A;  3L9U A;  1SK2 A;  2GLR A;  5GSS A;  2DSA A;  1GTU A;  1Y25 A;  2MMN A;  3RBT A;  2N5F A;  2AYT A;  2L59 A;  1BJX A;  3EMX A;  4NV2 A;  3KP8 A;  2R0C A;  2VOC A;  3P8W A;  4HI7 A;  1SJI A;  3QCP A;  3GKK A;  5CP1 A;  5JWR B;  2YAN A;  1NW2 A;  2HSM B;  1M2A A;  1R26 A;  5ECN B;  5EY6 A;  4PQH A;  1PN0 A;  4TXO A;  3KM6 A;  2HFD A;  3FEU A;  4O92 A;  1OKD A;  1JZR A;  1ZGN A;  1A24 A;  1AW9 A;  2GQK A;  2LQO A;  2GSQ A;  1VF1 A;  5DJL A;  4N11 A;  2PPT A;  3QAW A;  4J56 E;  2J23 A;  5B8A A;  2IMD A;  5GZZ B;  3GL3 A;  1XWG A;  4HU7 A;  4HU9 A;  4ML6 A;  3ZL5 A;  4GSS A;  4K5R A;  4V1A g;  2ES7 A;  1TU8 A;  1PGT A;  1A2M A;  3FYG A;  2PBJ A;  4HEA 2;  3FZ9 A;  2L5O A;  4GCI A;  1OE7 A;  1VGL A;  1A0R P;  4IN0 A;  4XHM A;  17GS A;  1SKR B;  6GSU A;  3O76 A;  1FB0 A;  2NBS A;  2HYX A;  4AKX B;  1VF2 A;  5HFI A;  3GKX A;  3GFK A;  3VPQ A;  2KOK A;  4K8M A;  1A0F A;  1F3B A;  5D73 A;  2HXK A;  1TRW A;  4YKF A;  1A8Y A;  2C4J A;  1GSE A;  2A4H A;  2CVK A;  3FMW A;  2X8H A;  3H1N A;  5A4U A;  1SL0 B;  5ECI B;  3LFL A;  4KAE A;  4E68 A;  1XWB A;  3HXS A;  4MPG A;  4GRF A;  1BG1 A;  3FR3 A;  1EV4 A;  1JLW A;  5G5E A;  4MF7 A;  4DEJ A;  2GTU A;  2B5Y A;  3GSS A;  2AAW A;  1TJD A;  4KCE A;  1ACV A;  4WF4 A;  4EF0 A;  5CO3 A;  4DSS B;  3BBY A;  3LXZ A;  2G0F A;  2YOI A;  3GIX A;  4TR1 A;  2PU9 C;  4EDY A;  2X99 A;  4ZB9 A;  1TP9 A;  2LJA A;  3F6D A;  4GQF A;  3MDK A;  3EMP A;  3CSJ A;  4ZIJ A;  2YJ7 A;  3ZZX A;  2CT6 A;  3HKR A;  4ILF A;  1N2A A;  5HFK A;  3KH7 A;  2C0E A;  3GH9 A;  4MH2 A;  4K9Z A;  3AY8 A;  1T4Y A;  1Y1U A;  4MJE A;  4IQ1 A;  3VK9 A;  1TTZ A;  4WR5 A;  3HVV A;  3L4N A;  2H70 A;  5A5K A;  5BRT A;  1XCC A;  1MD3 A;  4BL7 B;  3TJB A;  3VWU A;  22GS A;  3Q6O A;  3APO A;  4HQS A;  2C3Q A;  2F3M A;  2O5V A;  2GZP A;  2H0I A;  5AN1 A;  2XPE A;  1A2J A;  4CY6 A;  1JLV A;  3HJP A;  4GLT A;  4KSO A;  4RUV A;  2LS5 A;  1ZYN A;  5ECS A;  1GUK A;  5CAX A;  5G2Z A;  1K3L A;  5L71 A;  4I6X A;  1ILO A;  4IKH A;  4L0U A;  2PER A;  5H5R A;  1B4Q A;  4KF9 A;  2H6Y A;  2CAI A;  5DAL B;  2IFQ B;  4ID0 A;  3PH9 A;  1U87 A;  2MBT A;  4L5O A;  4LL4 B;  1ERW A;  5CRE A;  2VL9 A;  3M3M A;  1WP0 A;  4XS6 A;  3WT1 A;  2BJX A;  1B9X C;  3ZRD A;  1GNW A;  3ERW A;  3QPM A;  2FUG 2;  3W6G A;  4L8E A;  4Z7X A;  4IS0 A;  5D8I A;  5DAK A;  3DEX A;  4KND A;  1GP1 A;  2FHE A;  5A5H A;  1SYX A;  1OC8 A;  3RPN A;  4MK3 A;  1FVJ A;  2KLX A;  4G9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...