4IJIA

Crystal structure of a glutathione transferase family member from psuedomonas fluorescens pf-5, target efi-900011, with bound s-(propanoic acid)-glutathione
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
204
structure length
204
Chain Sequence
SLTLFHNPASPYVRKVMVLLHETGQLNRVALQASQLSPVAPDAALNQDNPLGKIPALRLDNGQVLYDSRVILDYLDQQHVGNPLIPRDGSARWRRLTLAALADGIMDASVLVRYELALRAPEKHWEQWLDGQRDKIRRALAVLEAEAIAELASHFDIAAISVACALGYLDFRHPDLEWRQDHPQLAAWYFEISQRPSMLATRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase-like protein YibF
publication title Crystal structure of a glutathione transferase family member from Psuedomonas fluorescens Pf-5, target EFI-900011, with bound S-(propanoic acid)-glutathione
rcsb
source organism Pseudomonas protegens
molecule tags Transferase
total genus 67
structure length 204
sequence length 204
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ijiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ijiA01
5ECNB 2PWJA 2DJ1A 3F4RA 1R5AA 4TN8A 1TU8A 4WR5A 3FW2A 3TKSC 4F0BA 5IO0A 1NM3A 3GTUA 1ST9A 1VF4A 1XWBA 1G6YA 1OAZA 1UVZA 5EY6A 1E6BA 2HT9A 1W4VA 1A0FA 1BQ7A 1JZWA 5B6MA 2V1MA 6GSSA 4HQZA 18GSA 2P5QA 1WWJA 3Q19A 1XW6A 1XOAA 3IE3A 2PN8A 5G30A 2L6DA 5DALA 1K0NA 4V2MA 1Z3EA 2R5GA 1GSUA 3LJRA 2LRNA 5IMVA 2NDOA 1BYEA 4BVYB 2YN1A 1TRUA 4NMUA 1Y25A 4OD7A 3F4TA 3UAPA 2V6OA 1EZKA 3CSIA 2LJRA 4KGIA 2FGXA 2JADA 3A2XA 3P90A 2VLUA 2QKEA 5ECPB 1GSSA 2HZFA 1HYUA 1F37A 2IL3A 3LSZA 4TR3A 4F9ZA 3W8JA 2LJKA 4JR4A 1PSQA 2H01A 3DVWA 3KXOA 4F82A 4HS1A 5HFKA 2IN3A 4BA7A 4K8MA 3ZYWA 2HRAA 3OR5A 3C1SA 6GSYA 4K9ZA 1FB6A 2AUVA 5KN0A 2VCTA 1YY7A 1X9WB 3UEMA 1TRSA 2GZPA 1NHOA 1X0RA 3GIXA 5DQYA 3G7YA 4V1Ag 1SL1B 5L71A 4WEYA 3RPNA 3P2AA 1YF0A 1BJXA 5A5KA 1H75A 3TJJA 4V1Ap 4O5RA 4GWRA 5AISA 3U5RE 2VL9A 5IM9A 2V2GA 1TK8B 4ZL9A 1XOBA 2UZ8A 1J0FA 2VCQA 1TU7A 4O92A 5ECSA 4HUAA 2VM1A 2LSTA 1FB0A 4LMWA 4RQRA 2OKAA 3MDKA 5COHA 2JZRA 2L5OA 5JCWA 4RQXA 3APSA 3GL3A 5ECLB 1TKDB 5ECHB 20GSA 2VO4A 2VL2A 4GSSA 4MPGA 4N0VA 16GSA 1DBYA 3HXSA 3LEFA 5IMAA 2DJJA 4IW9A 2K6VA 3KH9A 2HSYA 1EWXA 1BX9A 2LNTA 3HCZA 4EKZA 1IYIA 2LEGA 4BVXB 1N2AA 4BWSA 4FH8A 4OFMA 1JLWA 1B9XC 3PH9A 4RI6A 5ENUA 4IP6A 3W6GA 4OFNA 2HFDA 1T1VA 2GSSA 2HLSA 3H8QA 1GNWA 3HZ8A 2FNOA 1OYJA 4OCFA 4LL1B 1YKCA 4IJIA 2FHEA 2H30A 2LS5A 1GRXA 5J41A 1X9SB 1T4ZA 1ZL9A 2BMXA 4I2UA 4USSA 2I4AA 4E8HA 5BMUA 1XWGA 2FWEA 3ZRDA 4O32A 1EGRA 2FD3A 3D21A 2MZCA 2VAFA 4FIWA 3GFKA 2L57A 4NHWA 1GUMA 1HNAA 4KDUA 1XBSA 2R3XA 1A23A 2CQ9A 4G19A 5LCZA 3VLNA 3D6IA 2YCDA 2FLSA 1Q4JA 3HJPA 1BEDA 2YZHA 1PA3A 1XW9A 4DSRA 2HZEA 4KCEA 4PNFA 1N8JA 4KNDA 1R4WA 1BG5A 1V57A 3F3RA 5DQSA 4LA1A 1GP1A 1S3CA 1AQVA 5J4UA 3QOUA 1XFLA 1GTIA 2WFCA 2LKUA 1USBA 5HR0A 3EC3A 4V2LA 3IC8A 4X1UA 4ZB9A 1OC3A 2J9HA 5D9VA 1A2JA 4HZ4A 5DAKA 4XS4A 4PQHA 2N5FA 1TRVA 2LUSA 4YH2A 2DJ2A 2K8VA 3KTBA 1SK1A 1R7HA 2V32A 3TJBA 3VWVA 3KJYA 2PBJA 3RAZA 2HXKA 1UA5A 3V1WA 2TIRA 1YQ1A 1A2LA 2DJ3A 5ECOB 1Z5YE 3LQ7A 4NV2A 1EGOA 2VD0A 1M0UA 6GSVA 4DSSB 3BCKA 3GKNA 1TI1A 5GAND 3GKXA 4BL7A 3RHCA 3DWVA 2HE3A 2KP2A 2WULA 4F2IA 5JWQB 2C80A 5J9CA 3GKKA 4DVCA 5ECKB 2OADA 1ZYQB 2B7JA 1X5EA 2R2JA 1JZRA 4ULXA 2OBIA 2B5XA 2B5EA 3TUEA 2HSHA 4OO4A 1ERWA 4MF5A 4HJ2A 4K7IA 3JCML 2LRCA 3MAKA 3APOA 3DYRA 4X43A 1DUGA 4AJ6A 1TP9A 2F51A 1WRYA 2HRKB 4YAVA 1PL1A 4PUAA 3QDNA 2PERA 3FEUA 4KX4A 2HRNA 4JE1A 4HU9A 2FA4A 2OE3A 4MF6A 3FZ4A 4ZB6A 1E2YA 2PPTA 4POKA 5JCGA 3WD6A 1FVKA 2YOIA 3EURA 5CRGA 1GSQA 2VL2C 5CYYA 2X64A 1ZYEA 4ECIA 5INYA 4PQIA 2IFQA 1UC7A 4MLYA 4KUNA 3C1RA 4PTSA 5FHIA 3BJ5A 3GN3A 4MZBA 1YDKA 3FKFA 3GYKA 4JR6A 4HZ2A 2LJAA 1ZCPA 5C04A 4YQUA 1XVQA 2YANA 3VWUA 2WCIA 1VF2A 4EE0A 2RM5A 12GSA 3O3TA 2TRXA 2I81A 2C0DA 1ACVA 2H6XA 2C8UA 4IBPA 3LYKA 5A4UA 5EL8A 3D4MA 4TR4A 1MDKA 2FWFA 4GRFA 3UMAA 3GH6A 4NHZA 4TKYA 4HI7A 4RI7A 2L4QA 2N5BA 2I9HA 1R26A 4CW9A 5GSTA 1YEXA 4N0ZA 1EP8A 4TXOB 5DJMA 2H0HA 3VPQA 4MH3A 3QCPA 3GKMA 5DBQA 2HYXA 1ERUA 1GTUA 2GZYA 4EF0A 2CT6A 3HD5A 5JWOB 3TDGA 4LMVA 1B48A 4PGTA 3HVSA 1AXDA 4KE3A 3EU4A 2H6ZA 2JU5A 3C8EA 2RUEA 2HSNB 4YQMA 4WXTA 5ABRA 2NVLA 2VL3A 4J2FA 2WB9A 2XBIA 3KEBA 1TJDA 3QAVA 5KN3A 3S9FA 2X8GA 4ZBDA 4WBRD 3TGZA 1JLVA 3UIWA 2H75A 3HZ4A 2YWNA 3RHBA 2YPMA 3HYPA 3F0IA 4AF2A 3L9SA 2FCHA 2P0GA 2ON7A 4EO3A 5KN1A 2H70A 2RIIA 4MMMA 5B8AA 5CAXA 3TJGA 3IA1A 5C00A 3EINA 5ELAA 4I5QA 4BPYA 3CRUA 4JU5A 2D2ZA 3F63A 2K18A 1PMTA 5FT3A 1FO5A 5B8BA 1HQOA 2H74A 1PX7A 3HVXA 2OE0A 2VLVA 2DIYA 2C1YA 3ZVJA 3F6DA 3M1GA 1GWCA 3FZ9A 4TR1A 1DE2A 4HDEA 4OWYA 4G9HA 3IK7A 3KTLA 1B4QA 3M9JA 3A3TA 3KIJA 2NPBA 2A4VA 2YV7A 3VPTA 3UBKA 4JEDA 3U6VA 1O81A 3CTGA 4XTSA 5CNWA 5IPGA 1K0DA 3FZAA 4MZCA 4H86A 2HI7A 2J23A 5CRHA 2OA7A 2GGTA 1Z6NA 5ELGA 3DVXA 5F06A 4GCIA 3H4KA 1V40A 2DSAA 3MNGA 1GSEA 1LU4A 1HD2A 2H1BA 2LQOA 1PQNA 1OE7A 2B3SA 2C3NA 3PR8A 4KA0A 1TI3A 3VI7A 1M2DA 1XVWA 2ZUPA 3TOTA 1TRWA 1NSWA 2VCXA 3TKQA 4K7NA 2VCWA 4TXVA 4MJEA 2YZUA 4WETA 2XPEA 2YJHA 4K1FA 2PUKC 5F0GA 2H1AA 2HSMB 1G0TA 3VFIA 2IPAA 2C3QA 1KTEA 1J08A 2QC7A 4FYCA 2RM6A 2DLXA 4RUVA 5FWGA 3O6TA 4Z7XA 1GNEA 1H4OA 3TOUA 2X8CA 2X8HA 2H19A 1MTCA 5IMFA 1SD8A 1S3DA 5E59A 4IQAA 1XWKA 2C3TA 5DVBA 2AYTA 1NW2A 2H8LA 1WE0A 2GT5A 5F07A 4PQ1A 1DSBA 1Z7PA 2LQQA 1LBKA 4G0LA 1OVNA 3IK9A 2LNSA 4HU7A 1F6MC 1GL8A 5ECQB 2NTOA 2WRTA 4NPBA 2ES7A 1YF1A 2BJXA 4NWYA 4EVMA 3P7XA 3FZ5A 1WPIA 2VOCA 3DEXA 1XZOA 4KDXA 2R37A 3UJ1A 1A2MA 1K0MA 2H6YA 4ZXGA 1EOGA 3TKSE 5ID2B 3HA9A 3ZFBA 1SYRA 1EEJA 1Y6EA 4EDZA 4YQVA 4IHUA 2C4JA 3UARA 2M46A 3D22A 4ECJA 3LYPA 2GQLA 1F2EA 4J57E 1O7UA 4IS0A 3J7Yk 2CVBA 4MJCA 1YJ6A 4ML1A 1GH2A 5G1KA 4WR4A 3CSHA 3ZMKA 3ZREA 1HNCA 4ZL7A 5IPHA 2L59A 1TW9A 3TB2A 4JRRA 1K3YA 1THXA 4IVFA 1ZZYA 1A24A 1FOVA 1ILOA 1FW1A 2JL4A 2K9FA 1SJZA 3CXGA 1I5GA 4L8EA 4AGSA 1OC9B 3F4SA 3M9KA 2LV3A 1M99A 5ECIB 1EV9A 1QUWA 5IO2A 1AQWA 4EUYA 2OBKA 1PD21 4L5OA 4WF4A 2KP1A 3ZTLA 4D73A 2P5RA 3QD9A 4K0GA 3H93A 3FR9A 5CP1A 3Q18A 3GTUB 3DGQA 3F3QA 1K0BA 4TOPA 1O73A 1I9DA 1EV4A 5H5RA 2AJQB 2H66A 2CZ3A 1VRSD 1SL2B 5IMZA 1AUCA 3QFAC 3LXZA 3L9VA 5HFGA 2H71A 5CRWA 1KBNA 3IPZA 4IJ3A 8GSSA 1QK8A 22GSA 2H1GA 5DALB 1GUKA 2KOKA 3ZZXA 3LORA 3QPMA 3VURA 5LD0A 2QGVA 4KSOA 4HEA2 4OCEA 4HOJA 3QAGA 3A2WA 3CMIA 4NAXA 3IDVA 1SKSB 2ZNMA 3GV1A 2O85A 1V9WA 1AAZA 2GLRA 2R4VA 4Q5NA 2L4CA 1M2BA 3RDWA 5J5NA 2XBQA 2EC4A 4TW5A 1OC8A 1M9BA 3I6AA 1GSYA 1M9AA 4MABA 3BBYA 5CRDA 1KNGA 3HJOA 3QR6A 2HNLA 2L5LA 4G10A 3KM6A 3D4TA 2OJLA 5DCHA 4IELA 5G1LA 4O7HA 3IAM2 2H0IA 5IIZA 1F9MA 4MZWA 2B7KA 4KSMA 5J3RA 3NIVA 4IP1A 4I8BA 4N11A 4G2EA 4BVYA 4XS6A 3US3A 2IMEA 3IAS2 4ISDA 2EIQA 2G0FA 4ID0A 1TXXA 2DMMA 2ALBA 1SL0B 2VLTA 3GNJA 4PXOA 4KAEA 1XWAA 3FYGA 3FR3A 2G2QA 3ZIJA 3DRNA 4F03A 2GSQA 2CV4A 2PMTA 5KN2A 4MJAA 2AB6A 2C0GA 3H79A 1XIYA 2AHEA 1RQMA 3A5WA 5IMDA 4PNGA 5G5EA 1MD3A 5IQYA 3I9V2 2IJYA 1XXUA 1ABAA 2V6KA 2YWIA 3EMPA 3UL3A 4OFTA 2B1KA 5EPFA 3GX0A 4XRDA 5G2ZA 3D0ZA 4JBBA 3UVTA 5HR1A 2QSIA 3IHQA 1QQ2A 4AJ8A 2H72A 3EU3A 1AIUA 1XW5A 1TK5B 3IC4A 5GAPD 3VI5A 2KUCA 3IXRA 3PINA 5D96A 2F8FA 3GH9A 4Q5FA 3I43A 3O76A 3IBHA 1OE8A 1B9YC 1T7PB 2VD1A 1XCCA 1SK0A 6GSXA 3E9JB 2AV4A 3R2QA 3M8NA 2H1DA 5HFIA 3WGDA 2K8SA 4QL9A 4GLTA 1F3BA 4EC0A 5IMCA 4MDCA 3L78A 1A8YA 3CTFA 1K3LA 2N5AA 1JFUA 1ZGNA 1U3AA 2TRCP 4GSNA 3IV4A 4PUFC 2FA8A 4ZILA 3GHAA 4BVXA 4MH2A 1WJKA 4IQ1A 3L9UA 5G31A 5A4WA 3W8SA 4IKHA 3IOSA 1TK0B 3KMOA 2X99A 1SU9A 3UVHA 2F9SA 3PGTA 3GA4A 3QAWA 2HZEB 1T3BA 4TVEA 1Z7RA 4DSQA 4PX1A 2DIZA 4LL4B 6GSUA 3ZIVA 2PU9C 1M7TA 1V58A 4IGJA 1NHYA 4ZBBA 1ON4A 4Q5QA 4MPFA 4XS1A 4GQCA 1XWCA 4IN0A 3TJKA 3MWHA 3G7JA 3R3EA 5D73A 1T00A 2KLXA 5DAKB 3ME7A 2I1UA 4XS4B 2REMA 2IIYA 4KW6A 5D93A 1X5CA 3KGKA 3GMFA 2B6MA 1QGVA 3TRQA 3GX8A 1WIKA 4N30A 4OMVA 4TRXA 2B1LA 1CQGA 4BL7B 3LXTA 1ZOFA 1O8XA 1TTZA 2E0QA 3LGCA 2AAWA 3C71A 5H5QA 2A2SA 1J9BA 2MBTA 4XIHA 3E0UA 4L0UA 5F8BA 5JCUA 2HRFA 1ZMAA 3I69A 3KH7A 2WGRA 1GLQA 2V41A 1AW9A 4POBA 4MK3A 1ERVA 3C7MA 3TKRA 3GUSA 2WS2A 1SD9A 3EE2A 4I6XA 3KD0A 2IMDA 4TR0A 4DEJA 2XHFA 1GLPA 3TRPA 5IOXA 4I2TA 2IMFA 1SENA 1X5DA 7GSSA 4DSSA 2CVDA 1Z9HA 1MDJA 1DE1A 2O89A 2GVPA 3NZNA 3FY7A 3HHVA 3LFLA 5D9WA 4EL1A 9GSSA 2IFQB 5DDLA 3CYNA 4FYBA 5ECRB 4WKWA 2O87A 1VF1A 2IMIA 1MD4A 5GSSA 3AY8A 2JSYA 3ME8A 1FAAA 10GSA 1K0OA 3G9BA 3CBUA 4ECCA 1TDIA 1RW1A 1GUHA 1Z6MA 4XRAA 1THOA 1IYHA 3ERWA 1G7EA 3HKRA 1AC1A 2YWMA 1U88A 2BTOT 3N9JA 1QFNA 1TOFA 3KCMA 1A0RP 6GSWA 1T4YA 4OO5A 3E3EA 4L0WA 3A2VA 2CVKA 4QQ7A 4FO5A 2HRKA 3ZLPA 2VUPA 4I97A 3ZITA 3TRXA 13GSA 3RBTA 1PRXA 4KB3A 3F9UA 3FR6A 2FY6A 5B6NA 4EXJA 3VK9A 2VCZA 1T8EB 1QMVA 2GSTA 4Q5RA 1V98A 3NOFA 3FHKA 4G0IA 3ZVJD 1W89A 3KMNA 3DKSA 3WYWA 2VIMA 1VGLA 4J56E 5AIXA 2F8AA 1UN2A 3DXBA 2B5YA 4WBJA 2NBSA 2OE1A 14GSA 1JHBA 4L5LA 5HR2A 4ZIJA 3L4NA 4ILFA 2CAIA 3Q74A 2DMLA 1FG4A 5J9BA 3VWXA 5HR3A 2E7PA 2MMAA 3MSZA 2C0EA 4MA9A 1WP0A 1PKZA 1LJRA 2MBSA 3GL5A 1YKAA 4KDYA 3DD3A 3KP8A 1SK2A 2GT6A 5G5FA 2VCVA 1ML6A 2R6KA 2XC2A 1OKDA 3SBCA 2M72A 5D8IA 4TXOA 3KP9A 1F3AA 3WT1A 4POLA 5AIVA 1G7OA 3APQA 19GSA 4G0KA 3ERGA 4GQFA 3GURA 3TKPA 1K0CA 2GZZA 2RUFA 4X0XA 1G6WA 3WT2A 1XPVA 3BOAA 4TR1B 4WF5A 2RLIA 1V2AA 2CX4A 2GSRA 1WMJA 3K8NA 1U3IA 2IMKA 3EVIA 3N5OA 3C73A 1SJ6A 2JZTA 4BWQA 1EEMA 3ZL5A 3IR4A 2EIOA 1C72A 2KHPA 2MMZA 2ZCTA 1URMA 5IOWA 4K6XA 1HNBA 1JZDA 3CRTA 4MJBA 3QMXA 17GSA 1B4PA 1X9MB 4MF7A 2H76A 4KF9A 4V2NA 4ZBAA 1ERTA 3ED3A 3EWLA 3P8WA 1AQXA 4QL7A 5CREA 1YZXA 4F0CA 4CDOA 5GZZB 3TKSA 1O8WA 1M2AA 4ZB8A 3ZMLA 1FVJA 2GQKA 1GSDA 3ERFA 4PURA 2C0FA 4LLRA 1KEBA 4K7OA 2IWTA 3DMLA 2I3YA 3Q6OA 2YP6A 2PGTA 3M0FA 2YJ7A 5E4WA 1SYXA 2GDRA 5KEJA 3EMXA 1CQHA 5AN1A 5HQPA 1PX6A 3DIEA 3TCOA 2ON5A 2PVOC 3GRXA 3F6FA 1R5PA 3UOMA 4ZL8A 1SKWB 3ZFLA 2FWHA 5ECMB 3TJFA 3J7Yb 2YWOA 1U6TA 1PL2A 3KZQA 3UBLA 1RK4A 2H73A 3HVVA 3WGXA 1MDIA 1QXHA 5B7CA 5EVOA 2JACA 2JSZA 3HDCA 3FK8A 5A4VA 1PN9A 1SKRB 4XHMA 4ML6A 3F8UA 4KCAA 4GSTA 1S3AA 2HSMA 2DBCA 5F05A 1U87A 1BAYA 2L6CA 3FRCA 4XCSA 2OACA 3CSJA 2GS3A 1WOUA 1Q98A 3LG6A 2O7KA 1K3OA 1VF3A 4E8EA 3H1NA 3HY2A 5DJLA 5H5SA 3VWWA 3D5JA 1EOHA 3LWAA 1A8LA 3IRAA 5AGYA 3BD2A 4KH7A 1GSFA 2LTKA 4NV5A 6GSTA 4MP4A 1PGTA 3GSSA 1OKTA 5JWRB 2GTUA 4NXIA 2MYGA 2A2RA 4EDYA 1O6JA 2YNXA 2MMOA 3QFBC 2WJUA 2YV9A 3EYTA 2DJKA 1MEKA 5D9TA 1SJIA 2H0GA 5LNKe 5DCGA 2MMNA 1FHEA 3G7IA 4K0NA 2FUG2 4AJ7A 3GSTA 3WGEA 3RPPA 2F3MA 4HQSA 1B8XA 2GQMA 2CX3A 4MCUA 1K0AA 2LRTA 3SWLA 4HJMA 4CHSA 1YEPA 2P31A 5ID2A 4JZQA 4ECBA 3M3MA 1JZOA 2DJ0A 2Z9SA 1O85A 1GTBA 2VM2A 4GTUA 4D73B 2CA8A 2WDUA 1GULA 4POMA 4GXZA 4ACSA 2CZ2A 11GSA 2XPDA 1EP7A 3PPUA 1PKWA 1GTAA 3L0HA 4N10A 4P3YB 4K2DA 2HQTA 4FYUA 2FWGA 2O8VB 3HJMA 2EIRA 2E2GA 3ISOA 3BCIA 2DC5A 2PVQA 2M80A 4FQUA 2JZSA 2E2MA 1OC9A 2CAQA 5CO3A 5D9XA 4GF0A 2WZ9A 4YAPA
chains in the Genus database with same CATH superfamily
5ECNB 2PWJA 2DJ1A 3F4RA 1R5AA 4TN8A 1TU8A 2EFHA 4WR5A 3FW2A 3A5IA 3TKSC 4F0BA 5IO0A 1NM3A 3GTUA 1ST9A 1VF4A 4AI6A 1XWBA 1G6YA 1OAZA 1YEWC 1UVZA 5EY6A 1E6BA 2HT9A 1W4VA 1A0FA 1BQ7A 1JZWA 5B6MA 2V1MA 6GSSA 1M3IA 4HQZA 18GSA 2P5QA 1WWJA 3Q19A 1XW6A 1XOAA 2EFEA 3IE3A 2PN8A 5G30A 2L6DA 5DALA 1K0NA 4V2MA 1Z3EA 2R5GA 1GSUA 3LJRA 2LRNA 5IMVA 2NDOA 1BYEA 4BVYB 2YN1A 1TRUA 4NMUA 1Y25A 4OD7A 3F4TA 3UAPA 2V6OA 1EZKA 3CSIA 2LJRA 4KGIA 1S3RA 2FGXA 2JADA 3A2XA 3P90A 2VLUA 2QKEA 5ECPB 1GSSA 2HZFA 1HYUA 1F37A 2IL3A 3LSZA 4TR3A 4F9ZA 3W8JA 2LJKA 4JR4A 1PSQA 2H01A 3DVWA 3KXOA 4AKGA 4F82A 4HS1A 4PI2C 5HFKA 2IN3A 4BA7A 4K8MA 3ZYWA 2HRAA 3OR5A 3C1SA 6GSYA 4K9ZA 1FB6A 2AUVA 5KN0A 2VCTA 1YY7A 2WW0A 4MNNA 1X9WB 3UEMA 1TRSA 2GZPA 1NHOA 1X0RA 3GIXA 5DQYA 3G7YA 4V1Ag 1SL1B 5L71A 4WEYA 3RPNA 3P2AA 5J4YA 1YF0A 1BJXA 5A5KA 1H75A 3TJJA 4V1Ap 4O5RA 4GWRA 5AISA 3U5RE 2VL9A 5IM9A 2V2GA 1TK8B 4ZL9A 1XOBA 2UZ8A 1J0FA 2VCQA 1TU7A 4O92A 5ECSA 4HUAA 2VM1A 2LSTA 1FB0A 3RGBC 4LMWA 4RQRA 2OKAA 3MDKA 5COHA 2JZRA 2L5OA 5JCWA 4RQXA 3APSA 3GL3A 5ECLB 1TKDB 5ECHB 20GSA 2O5VA 2VO4A 5A5HA 2VL2A 4GSSA 4MPGA 4N0VA 16GSA 1DBYA 3HXSA 3LEFA 5IMAA 2DJJA 4IW9A 2K6VA 3KH9A 2HSYA 1EWXA 1BX9A 1FOHA 5KOWA 2LNTA 3HCZA 4EKZA 1IYIA 2LEGA 4BVXB 1N2AA 4BWSA 4FXYP 4FH8A 4OFMA 1JLWA 1B9XC 3PH9A 4RI6A 5ENUA 4IP6A 3W6GA 4OFNA 2HFDA 5A34A 1T1VA 2GSSA 2HLSA 3H8QA 1GNWA 3HZ8A 2FNOA 1OYJA 4OCFA 4LL1B 1YKCA 1XG8A 4IJIA 2FHEA 2H30A 2LS5A 1GRXA 5J41A 1X9SB 1T4ZA 1ZL9A 2BMXA 4I2UA 4USSA 2I4AA 4E8HA 2OT3A 5BMUA 1XWGA 2DKIA 2FWEA 3ZRDA 4O32A 1EGRA 2FD3A 3D21A 2MZCA 2VAFA 4FIWA 2A4HA 3GFKA 2L57A 4NHWA 1GUMA 1HNAA 4KDUA 1XBSA 2R3XA 1A23A 2CQ9A 4G19A 5LCZA 3VLNA 3D6IA 2YCDA 2FLSA 1Q4JA 3HJPA 1BEDA 2YZHA 1PA3A 1XW9A 4DSRA 2HZEA 3FMWA 4KCEA 2WVZA 4PNFA 1N8JA 4KNDA 1R4WA 1BG5A 1V57A 3F3RA 5DQSA 4LA1A 1GP1A 1S3CA 1AQVA 5J4UA 3QOUA 1XFLA 1GTIA 2WFCA 2LKUA 1USBA 5HR0A 4HSCX 2WW3A 3EC3A 4V2LA 3IC8A 2WZSA 4X1UA 4ZB9A 1OC3A 2J9HA 5D9VA 1A2JA 4HZ4A 5DAKA 4XS4A 4PQHA 2N5FA 1TRVA 2LUSA 4YH2A 2DJ2A 2K8VA 3KTBA 1I1IP 1SK1A 1R7HA 2V32A 3TJBA 3VWVA 3KJYA 2PBJA 3RAZA 2HXKA 1UA5A 3V1WA 2TIRA 1YQ1A 1A2LA 2DJ3A 5ECOB 1Z5YE 3LQ7A 4NV2A 1EGOA 2VD0A 1M0UA 6GSVA 4DSSB 3BCKA 3GKNA 1TI1A 5GAND 3GKXA 4BL7A 3RHCA 3DWVA 2HE3A 2KP2A 2WULA 4F2IA 5JWQB 2C80A 5J9CA 3GKKA 4DVCA 5ECKB 2OADA 1ZYQB 3RFRC 2B7JA 1X5EA 2R2JA 1JZRA 4ULXA 2OBIA 2B5XA 2B5EA 3TUEA 2HSHA 4OO4A 1YVLA 1ERWA 4MF5A 4HJ2A 4K7IA 3JCML 2LRCA 3MAKA 3APOA 3DYRA 4X43A 1DUGA 4AJ6A 1TP9A 2F51A 1WRYA 1M3JA 2HRKB 4YAVA 1PL1A 4PUAA 3QDNA 2PERA 3FEUA 4KX4A 2HRNA 4HU9A 4JE1A 2FA4A 2OE3A 4MF6A 3FZ4A 4ZB6A 1E2YA 4YKFA 2PPTA 4POKA 5JCGA 4A5PA 3WD6A 1FVKA 2YOIA 3EURA 5CRGA 1GSQA 2VL2C 5CYYA 2X64A 1ZYEA 4ECIA 5INYA 4PQIA 2IFQA 1UC7A 4MLYA 4KUNA 3C1RA 4PTSA 5FHIA 3BJ5A 3GN3A 4MZBA 1YDKA 3FKFA 3GYKA 3MIXA 4JR6A 4HZ2A 2LJAA 1ZCPA 5C04A 4YQUA 1XVQA 2YANA 3VWUA 2WCIA 1VF2A 4EE0A 2RM5A 12GSA 3O3TA 2TRXA 2I81A 2C0DA 1ACVA 2H6XA 2C8UA 4IBPA 3LYKA 5A4UA 5EL8A 3D4MA 4TR4A 3CWGA 1MDKA 2FWFA 4GRFA 3UMAA 3GH6A 4NHZA 4TKYA 4HI7A 4RI7A 2L4QA 2N5BA 2UV8G 2I9HA 1R26A 4CW9A 5GSTA 1YEXA 2R0GA 1EP8A 4N0ZA 4TXOB 5DJMA 2H0HA 3VPQA 4MH3A 4PI0C 3QCPA 3GKMA 5DBQA 2HYXA 1ERUA 1GTUA 2GZYA 4EF0A 2CT6A 3HD5A 3CQFA 5JWOB 3TDGA 4LMVA 1B48A 4PGTA 3HVSA 1AXDA 4KE3A 1ZYNA 3EU4A 2H6ZA 2JU5A 3C8EA 2RUEA 2HSNB 4YQMA 4WXTA 5ABRA 2NVLA 2VL3A 4J2FA 2WB9A 2XBIA 3KEBA 1TJDA 3QAVA 5KN3A 3S9FA 2X8GA 2H1LA 4W66A 4ZBDA 3IHGA 4WBRD 3TGZA 1JLVA 3UIWA 2H75A 3HZ4A 2YWNA 3RHBA 2YPMA 3HYPA 3F0IA 4AF2A 3L9SA 2FCHA 2P0GA 2ON7A 4EO3A 5KN1A 2H70A 2RIIA 4K5RA 4MMMA 5B8AA 5CAXA 3TJGA 3IA1A 5C00A 3EINA 5ELAA 4I5QA 4BPYA 3CRUA 4JU5A 2D2ZA 3F63A 2K18A 1PMTA 5FT3A 1FO5A 5B8BA 1HQOA 2H74A 1PX7A 3HVXA 2OE0A 2VLVA 2DIYA 2C1YA 3ZVJA 3F6DA 3M1GA 1GWCA 3FZ9A 4TR1A 1DE2A 4HDEA 4OWYA 4G9HA 3IK7A 3KTLA 1Y1UA 1B4QA 3M9JA 3A3TA 3KIJA 2NPBA 2A4VA 2YV7A 3VPTA 3UBKA 4JEDA 3U6VA 1O81A 3CTGA 4XTSA 5CNWA 5IPGA 1K0DA 3FZAA 4MZCA 4H86A 2HI7A 2J23A 5CRHA 2OA7A 2GGTA 1Z6NA 5ELGA 3DVXA 5F06A 4GCIA 3H4KA 1V40A 2DSAA 3MNGA 4GDFA 4O5UA 4BIKA 1GSEA 1LU4A 1HD2A 2H1BA 2LQOA 1PQNA 1OE7A 2B3SA 2C3NA 3PR8A 4KA0A 1TI3A 2WVXB 3VI7A 1M2DA 1XVWA 2ZUPA 3TOTA 1TRWA 1NSWA 2VCXA 3TKQA 4K7NA 2VCWA 4TXVA 4MJEA 2YZUA 4WETA 2XPEA 2YJHA 4K1FA 2PUKC 5F0GA 2H1AA 2HSMB 1G0TA 3VFIA 2IPAA 2C3QA 1KTEA 1J08A 2QC7A 4FYCA 2RM6A 2DLXA 4RUVA 4AKHA 5FWGA 3O6TA 4Z7XA 1GNEA 1H4OA 3TOUA 2X8CA 2X8HA 2H19A 1MTCA 5IMFA 1SD8A 1S3DA 5E59A 4IQAA 1SVMA 1XWKA 2C3TA 5DVBA 2AYTA 1NW2A 2H8LA 1WE0A 2GT5A 5F07A 4PQ1A 4K5SA 1DSBA 1Z7PA 2LQQA 1LBKA 4G0LA 1OVNA 3IK9A 2LNSA 4HU7A 1F6MC 1GL8A 5ECQB 2NTOA 1BG1A 2WRTA 4NPBA 2ES7A 1YF1A 2BJXA 4NWYA 4EVMA 3P7XA 3FZ5A 1WPIA 2VOCA 3DEXA 1XZOA 4KDXA 2R37A 3UJ1A 1A2MA 4G01A 1K0MA 2H6YA 4ZXGA 4ICYA 5J47A 1EOGA 3TKSE 5ID2B 3HA9A 3ZFBA 1SYRA 1EEJA 1S4BP 1Y6EA 4EDZA 4YQVA 4IHUA 2C4JA 3UARA 2M46A 3D22A 4ECJA 3LYPA 2GQLA 1F2EA 4J57E 1O7UA 4IS0A 3J7Yk 2CVBA 4MJCA 1YJ6A 4ML1A 1GH2A 5G1KA 4WR4A 3CSHA 3ZMKA 3ZREA 1HNCA 4ZL7A 5IPHA 2L59A 1TXUA 1TW9A 3TB2A 4JRRA 1K3YA 1THXA 4IVFA 1ZZYA 1A24A 1FOVA 1ILOA 1FW1A 2JL4A 2K9FA 1SJZA 3CXGA 1I5GA 5A1NA 4L8EA 4AGSA 1OC9B 3HVNA 3F4SA 3M9KA 2LV3A 1M99A 5ECIB 1EV9A 2X4AA 1QUWA 5IO2A 5J4VA 1AQWA 4EUYA 2OBKA 1PD21 4L5OA 4WF4A 2KP1A 3ZTLA 4D73A 2P5RA 3QD9A 4K0GA 3H93A 3FR9A 5CP1A 3Q18A 3GTUB 3DGQA 3F3QA 1K0BA 4TOPA 1O73A 1I9DA 1EV4A 5H5RA 2AJQB 2H66A 2CZ3A 1VRSD 1SL2B 5IMZA 1AUCA 3QFAC 3LXZA 3L9VA 5HFGA 2H71A 5CRWA 1KBNA 3IPZA 4IJ3A 8GSSA 1QK8A 22GSA 2H1GA 5DALB 1GUKA 2KOKA 3ZZXA 1BF5A 3LORA 2EFDA 3QPMA 3VURA 5LD0A 2QGVA 4KSOA 4HEA2 4OCEA 4HOJA 3QAGA 3A2WA 3CMIA 4NAXA 3IDVA 1SKSB 2ZNMA 3GV1A 2O85A 1V9WA 2WW1A 1AAZA 2GLRA 2R4VA 4Q5NA 2L4CA 4ZB7A 1M2BA 3RDWA 5J5NA 2XBQA 2EC4A 4TW5A 1OC8A 1M9BA 2VKZG 3I6AA 1GSYA 1M9AA 4MABA 2O36A 3BBYA 5CRDA 1KNGA 4E68A 3HJOA 3QR6A 2HNLA 2L5LA 4G10A 3KM6A 3D4TA 2OJLA 5DCHA 4IELA 5G1LA 4O7HA 3IAM2 2H0IA 5IIZA 1F9MA 4MZWA 2B7KA 4KSMA 5J3RA 3NIVA 4IP1A 4I8BA 4N11A 4G2EA 4BVYA 4XS6A 3US3A 2IMEA 3HMJG 3IAS2 4ISDA 2EIQA 2G0FA 4ID0A 1TXXA 2DMMA 2ALBA 1SL0B 2VLTA 3GNJA 4PXOA 4KAEA 1XWAA 3FYGA 3FR3A 2G2QA 3ZIJA 3DRNA 4F03A 2GSQA 2CV4A 2PMTA 5KN2A 4MJAA 2AB6A 2C0GA 3H79A 2EFCA 1XIYA 2AHEA 1RQMA 3A5WA 5IMDA 4PNGA 5G5EA 1MD3A 5IQYA 3I9V2 2IJYA 1XXUA 1ABAA 2V6KA 2YWIA 5A5HB 3EMPA 3UL3A 4OFTA 2B1KA 5EPFA 3GX0A 2QA1A 4XRDA 5G2ZA 3D0ZA 4JBBA 3UVTA 5HR1A 2QSIA 3IHQA 1QQ2A 4AJ8A 2H72A 3EU3A 1AIUA 1XW5A 1TK5B 3IC4A 5GAPD 3VI5A 2KUCA 3IXRA 3PINA 2R0PA 5D96A 2F8FA 3GH9A 4Q5FA 3I43A 3O76A 4EIPA 3IBHA 1OE8A 1B9YC 1T7PB 2VD1A 1XCCA 1SK0A 6GSXA 3E9JB 5A34B 2AV4A 3R2QA 3M8NA 2H1DA 4Z2RA 5HFIA 3WGDA 2K8SA 4QL9A 4GLTA 1F3BA 4EC0A 5IMCA 4MDCA 3L78A 1A8YA 3CTFA 1K3LA 2N5AA 1JFUA 1ZGNA 1U3AA 5BMUB 2TRCP 4GSNA 3IV4A 4PUFC 2O3EA 2FA8A 4YKGA 4ZILA 3GHAA 4BVXA 4MH2A 1WJKA 4IQ1A 3L9UA 5G31A 5A4WA 3W8SA 4IKHA 3IOSA 1TK0B 3KMOA 2X99A 1SU9A 3UVHA 2F9SA 3PGTA 3GA4A 3QAWA 4Z2TA 2HZEB 1T3BA 4TVEA 4O5QA 1Z7RA 4DSQA 4PX1A 2DIZA 4LL4B 6GSUA 3ZIVA 1ZYPA 2PU9C 1M7TA 1V58A 4IGJA 1NHYA 4ZBBA 1ON4A 4Q5QA 4MPFA 3TU3B 4XS1A 4GQCA 2WVYA 1XWCA 4IN0A 3TJKA 3MWHA 3G7JA 3R3EA 5D73A 1T00A 2KLXA 5DAKB 3ME7A 2I1UA 4XS4B 2REMA 1SVOA 2IIYA 4KW6A 5D93A 5BRTA 1X5CA 3KGKA 3GMFA 2B6MA 1QGVA 3TRQA 3GX8A 5J40A 1WIKA 1N25A 4N30A 4OMVA 4TRXA 2B1LA 1CQGA 4BL7B 3LXTA 1ZOFA 5KOXA 1O8XA 1TTZA 2E0QA 4EIQA 3LGCA 2AAWA 3C71A 5H5QA 2A2SA 1J9BA 2MBTA 1PN0A 4XIHA 3E0UA 4L0UA 5F8BA 5JCUA 2HRFA 1ZMAA 3I69A 3KH7A 1PFOA 2WGRA 1GLQA 2V41A 1AW9A 4POBA 4MK3A 1ERVA 3C7MA 3TKRA 3GUSA 2WS2A 4Z2UA 1SD9A 3EE2A 4I6XA 3KD0A 2IMDA 4TR0A 4DEJA 2XHFA 1GLPA 3TRPA 5IOXA 4I2TA 2IMFA 1SENA 1X5DA 7GSSA 4DSSA 2CVDA 1Z9HA 1MDJA 1DE1A 2O89A 2GVPA 3NZNA 3FY7A 3HHVA 3LFLA 5D9WA 4EL1A 9GSSA 2IFQB 5DDLA 3CYNA 4FYBA 5ECRB 4WKWA 2O87A 4QMKA 1VF1A 2IMIA 1MD4A 5GSSA 3AY8A 2JSYA 3ME8A 1FAAA 10GSA 1K0OA 3G9BA 3CBUA 4ECCA 1TDIA 1RW1A 1GUHA 1Z6MA 4XRAA 1THOA 1IYHA 3ERWA 1G7EA 3HKRA 1AC1A 2YWMA 1U88A 2BTOT 3N9JA 1QFNA 1TOFA 3KCMA 1A0RP 6GSWA 1T4YA 4OO5A 3E3EA 4L0WA 3A2VA 2CVKA 4QQ7A 4FO5A 2HRKA 3ZLPA 2VUPA 4I97A 3ZITA 3TRXA 13GSA 3RBTA 1PRXA 4KB3A 3F9UA 3FR6A 2FY6A 5B6NA 4EXJA 3VK9A 2VCZA 1T8EB 1QMVA 2GSTA 4Q5RA 1V98A 3NOFA 3FHKA 3LW9A 4G0IA 4PHZC 1W89A 3ZVJD 3KMNA 3DKSA 3WYWA 2VIMA 1VGLA 4J56E 5AIXA 2F8AA 1UN2A 3DXBA 2B5YA 4WBJA 2NBSA 2OE1A 14GSA 1JHBA 4L5LA 5HR2A 4ZIJA 3L4NA 4ILFA 2CAIA 3Q74A 2DMLA 2QA2A 1FG4A 5J9BA 3VWXA 5HR3A 2E7PA 2MMAA 3MSZA 2C0EA 4MA9A 1WP0A 1PKZA 1LJRA 2MBSA 3GL5A 1YKAA 4KDYA 3DD3A 3KP8A 1SK2A 2GT6A 5G5FA 2VCVA 1ML6A 2R6KA 2XC2A 1OKDA 3SBCA 2M72A 5D8IA 4TXOA 3KP9A 1F3AA 3WT1A 4POLA 5AIVA 1G7OA 3APQA 19GSA 4G0KA 3ERGA 4GQFA 3GURA 3TKPA 1K0CA 2GZZA 2RUFA 4X0XA 1G6WA 3WT2A 1XPVA 3BOAA 4TR1B 4WF5A 2HSNA 2RLIA 1V2AA 2CX4A 2GSRA 1WMJA 2R0CA 4N3ZA 3K8NA 1U3IA 2IMKA 3EVIA 3N5OA 3C73A 1SJ6A 2WW2A 2JZTA 4BWQA 1EEMA 3ZL5A 3IR4A 2EIOA 1C72A 2KHPA 2MMZA 2ZCTA 1URMA 5IOWA 4K6XA 1HNBA 1JZDA 3CRTA 4MJBA 3QMXA 17GSA 1B4PA 1X9MB 4MF7A 2H76A 4KF9A 4V2NA 4ZBAA 1ERTA 3ED3A 3EWLA 3P8WA 1AQXA 4QL7A 5CREA 1YZXA 4F0CA 4CDOA 5GZZB 3TKSA 1O8WA 1M2AA 4ZB8A 3ZMLA 1FVJA 2GQKA 4CY6A 1GSDA 3ERFA 4PURA 2C0FA 4LLRA 1KEBA 4K7OA 2IWTA 3DMLA 3CHXC 2I3YA 3Q6OA 2YP6A 2PGTA 3M0FA 2YJ7A 5E4WA 4K2XA 1SYXA 2GDRA 5KEJA 3EMXA 1CQHA 5AN1A 5HQPA 1PX6A 3DIEA 3TCOA 2ON5A 2PVOC 3GRXA 3F6FA 1R5PA 3UOMA 4ZL8A 1SKWB 3ZFLA 2FWHA 4CY8A 5ECMB 3TJFA 3J7Yb 3EPTA 2YWOA 1U6TA 1PL2A 4AKXB 3KZQA 3UBLA 1RK4A 2H73A 3HVVA 2A2PA 3WGXA 1MDIA 1QXHA 5B7CA 5EVOA 2WVXA 2JACA 2JSZA 3HDCA 3FK8A 5A4VA 1PN9A 1SKRB 4XHMA 4ML6A 3F8UA 4KCAA 4GSTA 1S3AA 2HSMA 2DBCA 5F05A 1U87A 1BAYA 2L6CA 3FRCA 4XCSA 2OACA 3CSJA 2GS3A 1WOUA 1Q98A 3LG6A 2O7KA 1K3OA 1SVLA 1VF3A 4E8EA 3H1NA 3HY2A 5DJLA 5H5SA 3VWWA 3D5JA 1EOHA 3LWAA 1A8LA 3IRAA 5AGYA 3BD2A 4KH7A 1GSFA 2LTKA 3MYDA 4NV5A 6GSTA 4MP4A 1PGTA 3GSSA 1OKTA 5JWRB 2GTUA 4NXIA 2MYGA 2A2RA 4EDYA 1O6JA 2YNXA 2MMOA 3QFBC 4X4JA 2WJUA 2YV9A 2DKHA 3EYTA 2DJKA 1MEKA 5D9TA 1SJIA 2H0GA 5LNKe 5DCGA 2MMNA 1FHEA 3G7IA 4K0NA 5A1NB 2FUG2 4AJ7A 3GSTA 3WGEA 4AKIA 3RPPA 2F3MA 4HQSA 1B8XA 2GQMA 2CX3A 4MCUA 1K0AA 2LRTA 3SWLA 4HJMA 4CHSA 1YEPA 2P31A 5ID2A 4JZQA 4ECBA 3M3MA 1JZOA 2DJ0A 2Z9SA 1O85A 1GTBA 2VM2A 4GTUA 4D73B 2CA8A 2WDUA 1GULA 4POMA 4GXZA 4ACSA 2CZ2A 11GSA 2XPDA 1EP7A 3PPUA 1PKWA 1GTAA 3L0HA 4N10A 4P3YB 4K2DA 2HQTA 4FYUA 2FWGA 2O8VB 3HJMA 2EIRA 2E2GA 3ISOA 3BCIA 2X49A 2DC5A 2PVQA 2M80A 4FQUA 2JZSA 2E2MA 1OC9A 2CAQA 5CO3A 5D9XA 4GF0A 2WZ9A 4YAPA
chains in the Genus database with same CATH topology
5ECNB 2PWJA 2DJ1A 3F4RA 1R5AA 4TN8A 1TU8A 2EFHA 4WR5A 3FW2A 3A5IA 3TKSC 4F0BA 5IO0A 1NM3A 3GTUA 1ST9A 1VF4A 4AI6A 1XWBA 1G6YA 1OAZA 1UVZA 5EY6A 1E6BA 2HT9A 1W4VA 1A0FA 1BQ7A 1JZWA 5B6MA 2V1MA 6GSSA 4HQZA 18GSA 2P5QA 1WWJA 3Q19A 1XW6A 1XOAA 2EFEA 3IE3A 2PN8A 5G30A 2L6DA 5DALA 1K0NA 4V2MA 1Z3EA 2R5GA 1GSUA 3LJRA 2LRNA 5IMVA 2NDOA 1BYEA 4BVYB 2YN1A 1TRUA 4NMUA 1Y25A 4OD7A 3F4TA 3UAPA 2V6OA 1EZKA 3CSIA 2LJRA 4KGIA 2FGXA 2JADA 3A2XA 3P90A 2VLUA 2QKEA 5ECPB 1GSSA 2HZFA 1HYUA 1F37A 2IL3A 3LSZA 4TR3A 4F9ZA 3W8JA 2LJKA 4JR4A 1PSQA 2H01A 3DVWA 3KXOA 4AKGA 4F82A 4HS1A 5HFKA 2IN3A 4BA7A 4K8MA 3ZYWA 2HRAA 3OR5A 3C1SA 6GSYA 4K9ZA 1FB6A 2AUVA 5KN0A 2VCTA 1YY7A 4MNNA 1X9WB 3UEMA 1TRSA 2GZPA 1NHOA 1X0RA 3GIXA 5DQYA 3G7YA 4V1Ag 1SL1B 5L71A 4WEYA 3RPNA 3P2AA 5J4YA 1YF0A 1BJXA 5A5KA 1H75A 3TJJA 4V1Ap 4O5RA 4GWRA 5AISA 3U5RE 2VL9A 5IM9A 2V2GA 1TK8B 4ZL9A 1XOBA 2UZ8A 1J0FA 2VCQA 1TU7A 4O92A 5ECSA 4HUAA 2VM1A 2LSTA 1FB0A 4LMWA 4RQRA 2OKAA 3MDKA 5COHA 2JZRA 2L5OA 5JCWA 4RQXA 3APSA 3GL3A 5ECLB 1TKDB 5ECHB 20GSA 2O5VA 2VO4A 5A5HA 2VL2A 4GSSA 4MPGA 4N0VA 16GSA 1DBYA 3HXSA 3LEFA 5IMAA 2DJJA 4IW9A 2K6VA 3KH9A 2HSYA 1EWXA 1BX9A 1FOHA 5KOWA 2LNTA 3HCZA 4EKZA 1IYIA 2LEGA 4BVXB 1N2AA 4BWSA 4FH8A 4OFMA 1JLWA 1B9XC 3PH9A 4RI6A 5ENUA 4IP6A 3W6GA 4OFNA 2HFDA 5A34A 1T1VA 2GSSA 2HLSA 3H8QA 1GNWA 3HZ8A 2FNOA 1OYJA 4OCFA 4LL1B 1YKCA 4IJIA 2FHEA 2H30A 2LS5A 1GRXA 5J41A 1X9SB 1T4ZA 1ZL9A 2BMXA 4I2UA 4USSA 2I4AA 4E8HA 2OT3A 5BMUA 1XWGA 2DKIA 2FWEA 3ZRDA 4O32A 1EGRA 2FD3A 3D21A 2MZCA 2VAFA 4FIWA 2A4HA 3GFKA 2L57A 4NHWA 1GUMA 1HNAA 4KDUA 1XBSA 2R3XA 1A23A 2CQ9A 4G19A 5LCZA 3VLNA 3D6IA 2YCDA 2FLSA 1Q4JA 3HJPA 1BEDA 2YZHA 1PA3A 1XW9A 4DSRA 2HZEA 3FMWA 4KCEA 4PNFA 1N8JA 4KNDA 1R4WA 1BG5A 1V57A 3F3RA 5DQSA 4LA1A 1GP1A 1S3CA 1AQVA 5J4UA 3QOUA 1XFLA 1GTIA 2WFCA 2LKUA 1USBA 5HR0A 3EC3A 4V2LA 3IC8A 4X1UA 4ZB9A 1OC3A 2J9HA 5D9VA 1A2JA 4HZ4A 5DAKA 4XS4A 4PQHA 2N5FA 1TRVA 2LUSA 4YH2A 2DJ2A 2K8VA 3KTBA 1SK1A 1R7HA 2V32A 3TJBA 3VWVA 3KJYA 2PBJA 3RAZA 2HXKA 1UA5A 3V1WA 2TIRA 1YQ1A 1A2LA 2DJ3A 5ECOB 1Z5YE 3LQ7A 4NV2A 1EGOA 2VD0A 1M0UA 6GSVA 4DSSB 3BCKA 3GKNA 1TI1A 5GAND 3GKXA 4BL7A 3RHCA 3DWVA 2HE3A 2KP2A 2WULA 4F2IA 5JWQB 2C80A 5J9CA 3GKKA 4DVCA 5ECKB 2OADA 1ZYQB 2B7JA 1X5EA 2R2JA 1JZRA 4ULXA 2OBIA 2B5XA 2B5EA 3TUEA 2HSHA 4OO4A 1YVLA 1ERWA 4MF5A 4HJ2A 4K7IA 3JCML 2LRCA 3MAKA 3APOA 3DYRA 4X43A 1DUGA 4AJ6A 1TP9A 2F51A 1WRYA 2HRKB 4YAVA 1PL1A 4PUAA 3QDNA 2PERA 3FEUA 4KX4A 2HRNA 4HU9A 4JE1A 2FA4A 2OE3A 4MF6A 3FZ4A 4ZB6A 1E2YA 4YKFA 2PPTA 4POKA 5JCGA 4A5PA 3WD6A 1FVKA 2YOIA 3EURA 5CRGA 1GSQA 2VL2C 5CYYA 2X64A 1ZYEA 4ECIA 5INYA 4PQIA 2IFQA 1UC7A 4MLYA 4KUNA 3C1RA 4PTSA 5FHIA 3BJ5A 3GN3A 4MZBA 1YDKA 3FKFA 3GYKA 3MIXA 4JR6A 4HZ2A 2LJAA 1ZCPA 5C04A 4YQUA 1XVQA 2YANA 3VWUA 2WCIA 1VF2A 4EE0A 2RM5A 12GSA 3O3TA 2TRXA 2I81A 2C0DA 1ACVA 2H6XA 2C8UA 4IBPA 3LYKA 5A4UA 5EL8A 3D4MA 4TR4A 3CWGA 1MDKA 2FWFA 4GRFA 3UMAA 3GH6A 4NHZA 4TKYA 4HI7A 4RI7A 2L4QA 2N5BA 2UV8G 2I9HA 1R26A 4CW9A 5GSTA 1YEXA 2R0GA 1EP8A 4N0ZA 4TXOB 5DJMA 2H0HA 3VPQA 4MH3A 3QCPA 3GKMA 5DBQA 2HYXA 1ERUA 1GTUA 2GZYA 4EF0A 2CT6A 3HD5A 5JWOB 3TDGA 4LMVA 1B48A 4PGTA 3HVSA 1AXDA 4KE3A 1ZYNA 3EU4A 2H6ZA 2JU5A 3C8EA 2RUEA 2HSNB 4YQMA 4WXTA 5ABRA 2NVLA 2VL3A 4J2FA 2WB9A 2XBIA 3KEBA 1TJDA 3QAVA 5KN3A 3S9FA 2X8GA 2H1LA 4W66A 4ZBDA 3IHGA 4WBRD 3TGZA 1JLVA 3UIWA 2H75A 3HZ4A 2YWNA 3RHBA 2YPMA 3HYPA 3F0IA 4AF2A 3L9SA 2FCHA 2P0GA 2ON7A 4EO3A 5KN1A 2H70A 2RIIA 4K5RA 4MMMA 5B8AA 5CAXA 3TJGA 3IA1A 5C00A 3EINA 5ELAA 4I5QA 4BPYA 3CRUA 4JU5A 2D2ZA 3F63A 2K18A 1PMTA 5FT3A 1FO5A 5B8BA 1HQOA 2H74A 1PX7A 3HVXA 2OE0A 2VLVA 2DIYA 2C1YA 3ZVJA 3F6DA 3M1GA 1GWCA 3FZ9A 4TR1A 1DE2A 4HDEA 4OWYA 4G9HA 3IK7A 3KTLA 1Y1UA 1B4QA 3M9JA 3A3TA 3KIJA 2NPBA 2A4VA 2YV7A 3VPTA 3UBKA 4JEDA 3U6VA 1O81A 3CTGA 4XTSA 5CNWA 5IPGA 1K0DA 3FZAA 4MZCA 4H86A 2HI7A 2J23A 5CRHA 2OA7A 2GGTA 1Z6NA 5ELGA 3DVXA 5F06A 4GCIA 3H4KA 1V40A 2DSAA 3MNGA 4GDFA 4O5UA 1GSEA 1LU4A 1HD2A 2H1BA 2LQOA 1PQNA 1OE7A 2B3SA 2C3NA 3PR8A 4KA0A 1TI3A 3VI7A 1M2DA 1XVWA 2ZUPA 3TOTA 1TRWA 1NSWA 2VCXA 3TKQA 4K7NA 2VCWA 4TXVA 4MJEA 2YZUA 4WETA 2XPEA 2YJHA 4K1FA 2PUKC 5F0GA 2H1AA 2HSMB 1G0TA 3VFIA 2IPAA 2C3QA 1KTEA 1J08A 2QC7A 4FYCA 2RM6A 2DLXA 4RUVA 4AKHA 5FWGA 3O6TA 4Z7XA 1GNEA 1H4OA 3TOUA 2X8CA 2X8HA 2H19A 1MTCA 5IMFA 1SD8A 1S3DA 5E59A 4IQAA 1SVMA 1XWKA 2C3TA 5DVBA 2AYTA 1NW2A 2H8LA 1WE0A 2GT5A 5F07A 4PQ1A 4K5SA 1DSBA 1Z7PA 2LQQA 1LBKA 4G0LA 1OVNA 3IK9A 2LNSA 4HU7A 1F6MC 1GL8A 5ECQB 2NTOA 1BG1A 2WRTA 4NPBA 2ES7A 1YF1A 2BJXA 4NWYA 4EVMA 3P7XA 3FZ5A 1WPIA 2VOCA 3DEXA 1XZOA 4KDXA 2R37A 3UJ1A 1A2MA 4G01A 1K0MA 2H6YA 4ZXGA 4ICYA 5J47A 1EOGA 3TKSE 5ID2B 3HA9A 3ZFBA 1SYRA 1EEJA 1Y6EA 4EDZA 4YQVA 4IHUA 2C4JA 3UARA 2M46A 3D22A 4ECJA 3LYPA 2GQLA 1F2EA 4J57E 1O7UA 4IS0A 3J7Yk 2CVBA 4MJCA 1YJ6A 4ML1A 1GH2A 5G1KA 4WR4A 3CSHA 3ZMKA 3ZREA 1HNCA 4ZL7A 5IPHA 2L59A 1TXUA 1TW9A 3TB2A 4JRRA 1K3YA 1THXA 4IVFA 1ZZYA 1A24A 1FOVA 1ILOA 1FW1A 2JL4A 2K9FA 1SJZA 3CXGA 1I5GA 5A1NA 4L8EA 4AGSA 1OC9B 3F4SA 3M9KA 2LV3A 1M99A 5ECIB 1EV9A 2X4AA 1QUWA 5IO2A 5J4VA 1AQWA 4EUYA 2OBKA 1PD21 4L5OA 4WF4A 2KP1A 3ZTLA 4D73A 2P5RA 3QD9A 4K0GA 3H93A 3FR9A 5CP1A 3Q18A 3GTUB 3DGQA 3F3QA 1K0BA 4TOPA 1O73A 1I9DA 1EV4A 5H5RA 2AJQB 2H66A 2CZ3A 1VRSD 1SL2B 5IMZA 1AUCA 3QFAC 3LXZA 3L9VA 5HFGA 2H71A 5CRWA 1KBNA 3IPZA 4IJ3A 8GSSA 1QK8A 22GSA 2H1GA 5DALB 1GUKA 2KOKA 3ZZXA 1BF5A 3LORA 2EFDA 3QPMA 3VURA 5LD0A 2QGVA 4KSOA 4HEA2 4OCEA 4HOJA 3QAGA 3A2WA 3CMIA 4NAXA 3IDVA 1SKSB 2ZNMA 3GV1A 2O85A 1V9WA 1AAZA 2GLRA 2R4VA 4Q5NA 2L4CA 4ZB7A 1M2BA 3RDWA 5J5NA 2XBQA 2EC4A 4TW5A 1OC8A 1M9BA 2VKZG 3I6AA 1GSYA 1M9AA 4MABA 3BBYA 5CRDA 1KNGA 4E68A 3HJOA 3QR6A 2HNLA 2L5LA 4G10A 3KM6A 3D4TA 2OJLA 5DCHA 4IELA 5G1LA 4O7HA 3IAM2 2H0IA 5IIZA 1F9MA 4MZWA 2B7KA 4KSMA 5J3RA 3NIVA 4IP1A 4I8BA 4N11A 4G2EA 4BVYA 4XS6A 3US3A 2IMEA 3HMJG 3IAS2 4ISDA 2EIQA 2G0FA 4ID0A 1TXXA 2DMMA 2ALBA 1SL0B 2VLTA 3GNJA 4PXOA 4KAEA 1XWAA 3FYGA 3FR3A 2G2QA 3ZIJA 3DRNA 4F03A 2GSQA 2CV4A 2PMTA 5KN2A 4MJAA 2AB6A 2C0GA 3H79A 2EFCA 1XIYA 2AHEA 1RQMA 3A5WA 5IMDA 4PNGA 5G5EA 1MD3A 5IQYA 3I9V2 2IJYA 1XXUA 1ABAA 2V6KA 2YWIA 5A5HB 3EMPA 3UL3A 4OFTA 2B1KA 5EPFA 3GX0A 2QA1A 4XRDA 5G2ZA 3D0ZA 4JBBA 3UVTA 5HR1A 2QSIA 3IHQA 1QQ2A 4AJ8A 2H72A 3EU3A 1AIUA 1XW5A 1TK5B 3IC4A 5GAPD 3VI5A 2KUCA 3IXRA 3PINA 2R0PA 5D96A 2F8FA 3GH9A 4Q5FA 3I43A 3O76A 4EIPA 3IBHA 1OE8A 1B9YC 1T7PB 2VD1A 1XCCA 1SK0A 6GSXA 3E9JB 5A34B 2AV4A 3R2QA 3M8NA 2H1DA 4Z2RA 5HFIA 3WGDA 2K8SA 4QL9A 4GLTA 1F3BA 4EC0A 5IMCA 4MDCA 3L78A 1A8YA 3CTFA 1K3LA 2N5AA 1JFUA 1ZGNA 1U3AA 5BMUB 2TRCP 4GSNA 3IV4A 4PUFC 2FA8A 4YKGA 4ZILA 3GHAA 4BVXA 4MH2A 1WJKA 4IQ1A 3L9UA 5G31A 5A4WA 3W8SA 4IKHA 3IOSA 1TK0B 3KMOA 2X99A 1SU9A 3UVHA 2F9SA 3PGTA 3GA4A 3QAWA 4Z2TA 2HZEB 1T3BA 4TVEA 4O5QA 1Z7RA 4DSQA 4PX1A 2DIZA 4LL4B 6GSUA 3ZIVA 1ZYPA 2PU9C 1M7TA 1V58A 4IGJA 1NHYA 4ZBBA 1ON4A 4Q5QA 4MPFA 3TU3B 4XS1A 4GQCA 1XWCA 4IN0A 3TJKA 3MWHA 3G7JA 3R3EA 5D73A 1T00A 2KLXA 5DAKB 3ME7A 2I1UA 4XS4B 2REMA 1SVOA 2IIYA 4KW6A 5D93A 5BRTA 1X5CA 3KGKA 3GMFA 2B6MA 1QGVA 3TRQA 3GX8A 5J40A 1WIKA 1N25A 4N30A 4OMVA 4TRXA 2B1LA 1CQGA 4BL7B 3LXTA 1ZOFA 5KOXA 1O8XA 1TTZA 2E0QA 4EIQA 3LGCA 2AAWA 3C71A 5H5QA 2A2SA 1J9BA 2MBTA 1PN0A 4XIHA 3E0UA 4L0UA 5F8BA 5JCUA 2HRFA 1ZMAA 3I69A 3KH7A 2WGRA 1GLQA 2V41A 1AW9A 4POBA 4MK3A 1ERVA 3C7MA 3TKRA 3GUSA 2WS2A 4Z2UA 1SD9A 3EE2A 4I6XA 3KD0A 2IMDA 4TR0A 4DEJA 2XHFA 1GLPA 3TRPA 5IOXA 4I2TA 2IMFA 1SENA 1X5DA 7GSSA 4DSSA 2CVDA 1Z9HA 1MDJA 1DE1A 2O89A 2GVPA 3NZNA 3FY7A 3HHVA 3LFLA 5D9WA 4EL1A 9GSSA 2IFQB 5DDLA 3CYNA 4FYBA 5ECRB 4WKWA 2O87A 4QMKA 1VF1A 2IMIA 1MD4A 5GSSA 3AY8A 2JSYA 3ME8A 1FAAA 10GSA 1K0OA 3G9BA 3CBUA 4ECCA 1TDIA 1RW1A 1GUHA 1Z6MA 4XRAA 1THOA 1IYHA 3ERWA 1G7EA 3HKRA 1AC1A 2YWMA 1U88A 2BTOT 3N9JA 1QFNA 1TOFA 3KCMA 1A0RP 6GSWA 1T4YA 4OO5A 3E3EA 4L0WA 3A2VA 2CVKA 4QQ7A 4FO5A 2HRKA 3ZLPA 2VUPA 4I97A 3ZITA 3TRXA 13GSA 3RBTA 1PRXA 4KB3A 3F9UA 3FR6A 2FY6A 5B6NA 4EXJA 3VK9A 2VCZA 1T8EB 1QMVA 2GSTA 4Q5RA 1V98A 3NOFA 3FHKA 3LW9A 4G0IA 3ZVJD 1W89A 3KMNA 3DKSA 3WYWA 2VIMA 1VGLA 4J56E 5AIXA 2F8AA 1UN2A 3DXBA 2B5YA 4WBJA 2NBSA 2OE1A 14GSA 1JHBA 4L5LA 5HR2A 4ZIJA 3L4NA 4ILFA 2CAIA 3Q74A 2DMLA 2QA2A 1FG4A 5J9BA 3VWXA 5HR3A 2E7PA 2MMAA 3MSZA 2C0EA 4MA9A 1WP0A 1PKZA 1LJRA 2MBSA 3GL5A 1YKAA 4KDYA 3DD3A 3KP8A 1SK2A 2GT6A 5G5FA 2VCVA 1ML6A 2R6KA 2XC2A 1OKDA 3SBCA 2M72A 5D8IA 4TXOA 3KP9A 1F3AA 3WT1A 4POLA 5AIVA 1G7OA 3APQA 19GSA 4G0KA 3ERGA 4GQFA 3GURA 3TKPA 1K0CA 2GZZA 2RUFA 4X0XA 1G6WA 3WT2A 1XPVA 3BOAA 4TR1B 4WF5A 2HSNA 2RLIA 1V2AA 2CX4A 2GSRA 1WMJA 2R0CA 4N3ZA 3K8NA 1U3IA 2IMKA 3EVIA 3N5OA 3C73A 1SJ6A 2JZTA 4BWQA 1EEMA 3ZL5A 3IR4A 2EIOA 1C72A 2KHPA 2MMZA 2ZCTA 1URMA 5IOWA 4K6XA 1HNBA 1JZDA 3CRTA 4MJBA 3QMXA 17GSA 1B4PA 1X9MB 4MF7A 2H76A 4KF9A 4V2NA 4ZBAA 1ERTA 3ED3A 3EWLA 3P8WA 1AQXA 4QL7A 5CREA 1YZXA 4F0CA 4CDOA 5GZZB 3TKSA 1O8WA 1M2AA 4ZB8A 3ZMLA 1FVJA 2GQKA 4CY6A 1GSDA 3ERFA 4PURA 2C0FA 4LLRA 1KEBA 4K7OA 2IWTA 3DMLA 2I3YA 3Q6OA 2YP6A 2PGTA 3M0FA 2YJ7A 5E4WA 4K2XA 1SYXA 2GDRA 5KEJA 3EMXA 1CQHA 5AN1A 5HQPA 1PX6A 3DIEA 3TCOA 2ON5A 2PVOC 3GRXA 3F6FA 1R5PA 3UOMA 4ZL8A 1SKWB 3ZFLA 2FWHA 4CY8A 5ECMB 3TJFA 3J7Yb 3EPTA 2YWOA 1U6TA 1PL2A 4AKXB 3KZQA 3UBLA 1RK4A 2H73A 3HVVA 2A2PA 3WGXA 1MDIA 1QXHA 5B7CA 5EVOA 2JACA 2JSZA 3HDCA 3FK8A 5A4VA 1PN9A 1SKRB 4XHMA 4ML6A 3F8UA 4KCAA 4GSTA 1S3AA 2HSMA 2DBCA 5F05A 1U87A 1BAYA 2L6CA 3FRCA 4XCSA 2OACA 3CSJA 2GS3A 1WOUA 1Q98A 3LG6A 2O7KA 1K3OA 1SVLA 1VF3A 4E8EA 3H1NA 3HY2A 5DJLA 5H5SA 3VWWA 3D5JA 1EOHA 3LWAA 1A8LA 3IRAA 5AGYA 3BD2A 4KH7A 1GSFA 2LTKA 3MYDA 4NV5A 6GSTA 4MP4A 1PGTA 3GSSA 1OKTA 5JWRB 2GTUA 4NXIA 2MYGA 2A2RA 4EDYA 1O6JA 2YNXA 2MMOA 3QFBC 4X4JA 2WJUA 2YV9A 2DKHA 3EYTA 2DJKA 1MEKA 5D9TA 1SJIA 2H0GA 5LNKe 5DCGA 2MMNA 1FHEA 3G7IA 4K0NA 5A1NB 2FUG2 4AJ7A 3GSTA 3WGEA 4AKIA 3RPPA 2F3MA 4HQSA 1B8XA 2GQMA 2CX3A 4MCUA 1K0AA 2LRTA 3SWLA 4HJMA 4CHSA 1YEPA 2P31A 5ID2A 4JZQA 4ECBA 3M3MA 1JZOA 2DJ0A 2Z9SA 1O85A 1GTBA 2VM2A 4GTUA 4D73B 2CA8A 2WDUA 1GULA 4POMA 4GXZA 4ACSA 2CZ2A 11GSA 2XPDA 1EP7A 3PPUA 1PKWA 1GTAA 3L0HA 4N10A 4P3YB 4K2DA 2HQTA 4FYUA 2FWGA 2O8VB 3HJMA 2EIRA 2E2GA 3ISOA 3BCIA 2X49A 2DC5A 2PVQA 2M80A 4FQUA 2JZSA 2E2MA 1OC9A 2CAQA 5CO3A 5D9XA 4GF0A 2WZ9A 4YAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECN B;  2PWJ A;  2DJ1 A;  3F4R A;  1R5A A;  4TN8 A;  1TU8 A;  4WR5 A;  3FW2 A;  3TKS C;  4F0B A;  5IO0 A;  1NM3 A;  3GTU A;  1ST9 A;  1VF4 A;  1XWB A;  1G6Y A;  1OAZ A;  1UVZ A;  5EY6 A;  1E6B A;  2HT9 A;  1W4V A;  1A0F A;  1BQ7 A;  1JZW A;  5B6M A;  2V1M A;  6GSS A;  4HQZ A;  18GS A;  2P5Q A;  1WWJ A;  3Q19 A;  1XW6 A;  1XOA A;  3IE3 A;  2PN8 A;  5G30 A;  2L6D A;  5DAL A;  1K0N A;  4V2M A;  1Z3E A;  2R5G A;  1GSU A;  3LJR A;  2LRN A;  5IMV A;  2NDO A;  1BYE A;  4BVY B;  2YN1 A;  1TRU A;  4NMU A;  1Y25 A;  4OD7 A;  3F4T A;  3UAP A;  2V6O A;  1EZK A;  3CSI A;  2LJR A;  4KGI A;  2FGX A;  2JAD A;  3A2X A;  3P90 A;  2VLU A;  2QKE A;  5ECP B;  1GSS A;  2HZF A;  1HYU A;  1F37 A;  2IL3 A;  3LSZ A;  4TR3 A;  4F9Z A;  3W8J A;  2LJK A;  4JR4 A;  1PSQ A;  2H01 A;  3DVW A;  3KXO A;  4F82 A;  4HS1 A;  5HFK A;  2IN3 A;  4BA7 A;  4K8M A;  3ZYW A;  2HRA A;  3OR5 A;  3C1S A;  6GSY A;  4K9Z A;  1FB6 A;  2AUV A;  5KN0 A;  2VCT A;  1YY7 A;  1X9W B;  3UEM A;  1TRS A;  2GZP A;  1NHO A;  1X0R A;  3GIX A;  5DQY A;  3G7Y A;  4V1A g;  1SL1 B;  5L71 A;  4WEY A;  3RPN A;  3P2A A;  1YF0 A;  1BJX A;  5A5K A;  1H75 A;  3TJJ A;  4V1A p;  4O5R A;  4GWR A;  5AIS A;  3U5R E;  2VL9 A;  5IM9 A;  2V2G A;  1TK8 B;  4ZL9 A;  1XOB A;  2UZ8 A;  1J0F A;  2VCQ A;  1TU7 A;  4O92 A;  5ECS A;  4HUA A;  2VM1 A;  2LST A;  1FB0 A;  4LMW A;  4RQR A;  2OKA A;  3MDK A;  5COH A;  2JZR A;  2L5O A;  5JCW A;  4RQX A;  3APS A;  3GL3 A;  5ECL B;  1TKD B;  5ECH B;  20GS A;  2VO4 A;  2VL2 A;  4GSS A;  4MPG A;  4N0V A;  16GS A;  1DBY A;  3HXS A;  3LEF A;  5IMA A;  2DJJ A;  4IW9 A;  2K6V A;  3KH9 A;  2HSY A;  1EWX A;  1BX9 A;  2LNT A;  3HCZ A;  4EKZ A;  1IYI A;  2LEG A;  4BVX B;  1N2A A;  4BWS A;  4FH8 A;  4OFM A;  1JLW A;  1B9X C;  3PH9 A;  4RI6 A;  5ENU A;  4IP6 A;  3W6G A;  4OFN A;  2HFD A;  1T1V A;  2GSS A;  2HLS A;  3H8Q A;  1GNW A;  3HZ8 A;  2FNO A;  1OYJ A;  4OCF A;  4LL1 B;  1YKC A;  4IJI A;  2FHE A;  2H30 A;  2LS5 A;  1GRX A;  5J41 A;  1X9S B;  1T4Z A;  1ZL9 A;  2BMX A;  4I2U A;  4USS A;  2I4A A;  4E8H A;  5BMU A;  1XWG A;  2FWE A;  3ZRD A;  4O32 A;  1EGR A;  2FD3 A;  3D21 A;  2MZC A;  2VAF A;  4FIW A;  3GFK A;  2L57 A;  4NHW A;  1GUM A;  1HNA A;  4KDU A;  1XBS A;  2R3X A;  1A23 A;  2CQ9 A;  4G19 A;  5LCZ A;  3VLN A;  3D6I A;  2YCD A;  2FLS A;  1Q4J A;  3HJP A;  1BED A;  2YZH A;  1PA3 A;  1XW9 A;  4DSR A;  2HZE A;  4KCE A;  4PNF A;  1N8J A;  4KND A;  1R4W A;  1BG5 A;  1V57 A;  3F3R A;  5DQS A;  4LA1 A;  1GP1 A;  1S3C A;  1AQV A;  5J4U A;  3QOU A;  1XFL A;  1GTI A;  2WFC A;  2LKU A;  1USB A;  5HR0 A;  3EC3 A;  4V2L A;  3IC8 A;  4X1U A;  4ZB9 A;  1OC3 A;  2J9H A;  5D9V A;  1A2J A;  4HZ4 A;  5DAK A;  4XS4 A;  4PQH A;  2N5F A;  1TRV A;  2LUS A;  4YH2 A;  2DJ2 A;  2K8V A;  3KTB A;  1SK1 A;  1R7H A;  2V32 A;  3TJB A;  3VWV A;  3KJY A;  2PBJ A;  3RAZ A;  2HXK A;  1UA5 A;  3V1W A;  2TIR A;  1YQ1 A;  1A2L A;  2DJ3 A;  5ECO B;  1Z5Y E;  3LQ7 A;  4NV2 A;  1EGO A;  2VD0 A;  1M0U A;  6GSV A;  4DSS B;  3BCK A;  3GKN A;  1TI1 A;  5GAN D;  3GKX A;  4BL7 A;  3RHC A;  3DWV A;  2HE3 A;  2KP2 A;  2WUL A;  4F2I A;  5JWQ B;  2C80 A;  5J9C A;  3GKK A;  4DVC A;  5ECK B;  2OAD A;  1ZYQ B;  2B7J A;  1X5E A;  2R2J A;  1JZR A;  4ULX A;  2OBI A;  2B5X A;  2B5E A;  3TUE A;  2HSH A;  4OO4 A;  1ERW A;  4MF5 A;  4HJ2 A;  4K7I A;  3JCM L;  2LRC A;  3MAK A;  3APO A;  3DYR A;  4X43 A;  1DUG A;  4AJ6 A;  1TP9 A;  2F51 A;  1WRY A;  2HRK B;  4YAV A;  1PL1 A;  4PUA A;  3QDN A;  2PER A;  3FEU A;  4KX4 A;  2HRN A;  4JE1 A;  4HU9 A;  2FA4 A;  2OE3 A;  4MF6 A;  3FZ4 A;  4ZB6 A;  1E2Y A;  2PPT A;  4POK A;  5JCG A;  3WD6 A;  1FVK A;  2YOI A;  3EUR A;  5CRG A;  1GSQ A;  2VL2 C;  5CYY A;  2X64 A;  1ZYE A;  4ECI A;  5INY A;  4PQI A;  2IFQ A;  1UC7 A;  4MLY A;  4KUN A;  3C1R A;  4PTS A;  5FHI A;  3BJ5 A;  3GN3 A;  4MZB A;  1YDK A;  3FKF A;  3GYK A;  4JR6 A;  4HZ2 A;  2LJA A;  1ZCP A;  5C04 A;  4YQU A;  1XVQ A;  2YAN A;  3VWU A;  2WCI A;  1VF2 A;  4EE0 A;  2RM5 A;  12GS A;  3O3T A;  2TRX A;  2I81 A;  2C0D A;  1ACV A;  2H6X A;  2C8U A;  4IBP A;  3LYK A;  5A4U A;  5EL8 A;  3D4M A;  4TR4 A;  1MDK A;  2FWF A;  4GRF A;  3UMA A;  3GH6 A;  4NHZ A;  4TKY A;  4HI7 A;  4RI7 A;  2L4Q A;  2N5B A;  2I9H A;  1R26 A;  4CW9 A;  5GST A;  1YEX A;  4N0Z A;  1EP8 A;  4TXO B;  5DJM A;  2H0H A;  3VPQ A;  4MH3 A;  3QCP A;  3GKM A;  5DBQ A;  2HYX A;  1ERU A;  1GTU A;  2GZY A;  4EF0 A;  2CT6 A;  3HD5 A;  5JWO B;  3TDG A;  4LMV A;  1B48 A;  4PGT A;  3HVS A;  1AXD A;  4KE3 A;  3EU4 A;  2H6Z A;  2JU5 A;  3C8E A;  2RUE A;  2HSN B;  4YQM A;  4WXT A;  5ABR A;  2NVL A;  2VL3 A;  4J2F A;  2WB9 A;  2XBI A;  3KEB A;  1TJD A;  3QAV A;  5KN3 A;  3S9F A;  2X8G A;  4ZBD A;  4WBR D;  3TGZ A;  1JLV A;  3UIW A;  2H75 A;  3HZ4 A;  2YWN A;  3RHB A;  2YPM A;  3HYP A;  3F0I A;  4AF2 A;  3L9S A;  2FCH A;  2P0G A;  2ON7 A;  4EO3 A;  5KN1 A;  2H70 A;  2RII A;  4MMM A;  5B8A A;  5CAX A;  3TJG A;  3IA1 A;  5C00 A;  3EIN A;  5ELA A;  4I5Q A;  4BPY A;  3CRU A;  4JU5 A;  2D2Z A;  3F63 A;  2K18 A;  1PMT A;  5FT3 A;  1FO5 A;  5B8B A;  1HQO A;  2H74 A;  1PX7 A;  3HVX A;  2OE0 A;  2VLV A;  2DIY A;  2C1Y A;  3ZVJ A;  3F6D A;  3M1G A;  1GWC A;  3FZ9 A;  4TR1 A;  1DE2 A;  4HDE A;  4OWY A;  4G9H A;  3IK7 A;  3KTL A;  1B4Q A;  3M9J A;  3A3T A;  3KIJ A;  2NPB A;  2A4V A;  2YV7 A;  3VPT A;  3UBK A;  4JED A;  3U6V A;  1O81 A;  3CTG A;  4XTS A;  5CNW A;  5IPG A;  1K0D A;  3FZA A;  4MZC A;  4H86 A;  2HI7 A;  2J23 A;  5CRH A;  2OA7 A;  2GGT A;  1Z6N A;  5ELG A;  3DVX A;  5F06 A;  4GCI A;  3H4K A;  1V40 A;  2DSA A;  3MNG A;  1GSE A;  1LU4 A;  1HD2 A;  2H1B A;  2LQO A;  1PQN A;  1OE7 A;  2B3S A;  2C3N A;  3PR8 A;  4KA0 A;  1TI3 A;  3VI7 A;  1M2D A;  1XVW A;  2ZUP A;  3TOT A;  1TRW A;  1NSW A;  2VCX A;  3TKQ A;  4K7N A;  2VCW A;  4TXV A;  4MJE A;  2YZU A;  4WET A;  2XPE A;  2YJH A;  4K1F A;  2PUK C;  5F0G A;  2H1A A;  2HSM B;  1G0T A;  3VFI A;  2IPA A;  2C3Q A;  1KTE A;  1J08 A;  2QC7 A;  4FYC A;  2RM6 A;  2DLX A;  4RUV A;  5FWG A;  3O6T A;  4Z7X A;  1GNE A;  1H4O A;  3TOU A;  2X8C A;  2X8H A;  2H19 A;  1MTC A;  5IMF A;  1SD8 A;  1S3D A;  5E59 A;  4IQA A;  1XWK A;  2C3T A;  5DVB A;  2AYT A;  1NW2 A;  2H8L A;  1WE0 A;  2GT5 A;  5F07 A;  4PQ1 A;  1DSB A;  1Z7P A;  2LQQ A;  1LBK A;  4G0L A;  1OVN A;  3IK9 A;  2LNS A;  4HU7 A;  1F6M C;  1GL8 A;  5ECQ B;  2NTO A;  2WRT A;  4NPB A;  2ES7 A;  1YF1 A;  2BJX A;  4NWY A;  4EVM A;  3P7X A;  3FZ5 A;  1WPI A;  2VOC A;  3DEX A;  1XZO A;  4KDX A;  2R37 A;  3UJ1 A;  1A2M A;  1K0M A;  2H6Y A;  4ZXG A;  1EOG A;  3TKS E;  5ID2 B;  3HA9 A;  3ZFB A;  1SYR A;  1EEJ A;  1Y6E A;  4EDZ A;  4YQV A;  4IHU A;  2C4J A;  3UAR A;  2M46 A;  3D22 A;  4ECJ A;  3LYP A;  2GQL A;  1F2E A;  4J57 E;  1O7U A;  4IS0 A;  3J7Y k;  2CVB A;  4MJC A;  1YJ6 A;  4ML1 A;  1GH2 A;  5G1K A;  4WR4 A;  3CSH A;  3ZMK A;  3ZRE A;  1HNC A;  4ZL7 A;  5IPH A;  2L59 A;  1TW9 A;  3TB2 A;  4JRR A;  1K3Y A;  1THX A;  4IVF A;  1ZZY A;  1A24 A;  1FOV A;  1ILO A;  1FW1 A;  2JL4 A;  2K9F A;  1SJZ A;  3CXG A;  1I5G A;  4L8E A;  4AGS A;  1OC9 B;  3F4S A;  3M9K A;  2LV3 A;  1M99 A;  5ECI B;  1EV9 A;  1QUW A;  5IO2 A;  1AQW A;  4EUY A;  2OBK A;  1PD2 1;  4L5O A;  4WF4 A;  2KP1 A;  3ZTL A;  4D73 A;  2P5R A;  3QD9 A;  4K0G A;  3H93 A;  3FR9 A;  5CP1 A;  3Q18 A;  3GTU B;  3DGQ A;  3F3Q A;  1K0B A;  4TOP A;  1O73 A;  1I9D A;  1EV4 A;  5H5R A;  2AJQ B;  2H66 A;  2CZ3 A;  1VRS D;  1SL2 B;  5IMZ A;  1AUC A;  3QFA C;  3LXZ A;  3L9V A;  5HFG A;  2H71 A;  5CRW A;  1KBN A;  3IPZ A;  4IJ3 A;  8GSS A;  1QK8 A;  22GS A;  2H1G A;  5DAL B;  1GUK A;  2KOK A;  3ZZX A;  3LOR A;  3QPM A;  3VUR A;  5LD0 A;  2QGV A;  4KSO A;  4HEA 2;  4OCE A;  4HOJ A;  3QAG A;  3A2W A;  3CMI A;  4NAX A;  3IDV A;  1SKS B;  2ZNM A;  3GV1 A;  2O85 A;  1V9W A;  1AAZ A;  2GLR A;  2R4V A;  4Q5N A;  2L4C A;  1M2B A;  3RDW A;  5J5N A;  2XBQ A;  2EC4 A;  4TW5 A;  1OC8 A;  1M9B A;  3I6A A;  1GSY A;  1M9A A;  4MAB A;  3BBY A;  5CRD A;  1KNG A;  3HJO A;  3QR6 A;  2HNL A;  2L5L A;  4G10 A;  3KM6 A;  3D4T A;  2OJL A;  5DCH A;  4IEL A;  5G1L A;  4O7H A;  3IAM 2;  2H0I A;  5IIZ A;  1F9M A;  4MZW A;  2B7K A;  4KSM A;  5J3R A;  3NIV A;  4IP1 A;  4I8B A;  4N11 A;  4G2E A;  4BVY A;  4XS6 A;  3US3 A;  2IME A;  3IAS 2;  4ISD A;  2EIQ A;  2G0F A;  4ID0 A;  1TXX A;  2DMM A;  2ALB A;  1SL0 B;  2VLT A;  3GNJ A;  4PXO A;  4KAE A;  1XWA A;  3FYG A;  3FR3 A;  2G2Q A;  3ZIJ A;  3DRN A;  4F03 A;  2GSQ A;  2CV4 A;  2PMT A;  5KN2 A;  4MJA A;  2AB6 A;  2C0G A;  3H79 A;  1XIY A;  2AHE A;  1RQM A;  3A5W A;  5IMD A;  4PNG A;  5G5E A;  1MD3 A;  5IQY A;  3I9V 2;  2IJY A;  1XXU A;  1ABA A;  2V6K A;  2YWI A;  3EMP A;  3UL3 A;  4OFT A;  2B1K A;  5EPF A;  3GX0 A;  4XRD A;  5G2Z A;  3D0Z A;  4JBB A;  3UVT A;  5HR1 A;  2QSI A;  3IHQ A;  1QQ2 A;  4AJ8 A;  2H72 A;  3EU3 A;  1AIU A;  1XW5 A;  1TK5 B;  3IC4 A;  5GAP D;  3VI5 A;  2KUC A;  3IXR A;  3PIN A;  5D96 A;  2F8F A;  3GH9 A;  4Q5F A;  3I43 A;  3O76 A;  3IBH A;  1OE8 A;  1B9Y C;  1T7P B;  2VD1 A;  1XCC A;  1SK0 A;  6GSX A;  3E9J B;  2AV4 A;  3R2Q A;  3M8N A;  2H1D A;  5HFI A;  3WGD A;  2K8S A;  4QL9 A;  4GLT A;  1F3B A;  4EC0 A;  5IMC A;  4MDC A;  3L78 A;  1A8Y A;  3CTF A;  1K3L A;  2N5A A;  1JFU A;  1ZGN A;  1U3A A;  2TRC P;  4GSN A;  3IV4 A;  4PUF C;  2FA8 A;  4ZIL A;  3GHA A;  4BVX A;  4MH2 A;  1WJK A;  4IQ1 A;  3L9U A;  5G31 A;  5A4W A;  3W8S A;  4IKH A;  3IOS A;  1TK0 B;  3KMO A;  2X99 A;  1SU9 A;  3UVH A;  2F9S A;  3PGT A;  3GA4 A;  3QAW A;  2HZE B;  1T3B A;  4TVE A;  1Z7R A;  4DSQ A;  4PX1 A;  2DIZ A;  4LL4 B;  6GSU A;  3ZIV A;  2PU9 C;  1M7T A;  1V58 A;  4IGJ A;  1NHY A;  4ZBB A;  1ON4 A;  4Q5Q A;  4MPF A;  4XS1 A;  4GQC A;  1XWC A;  4IN0 A;  3TJK A;  3MWH A;  3G7J A;  3R3E A;  5D73 A;  1T00 A;  2KLX A;  5DAK B;  3ME7 A;  2I1U A;  4XS4 B;  2REM A;  2IIY A;  4KW6 A;  5D93 A;  1X5C A;  3KGK A;  3GMF A;  2B6M A;  1QGV A;  3TRQ A;  3GX8 A;  1WIK A;  4N30 A;  4OMV A;  4TRX A;  2B1L A;  1CQG A;  4BL7 B;  3LXT A;  1ZOF A;  1O8X A;  1TTZ A;  2E0Q A;  3LGC A;  2AAW A;  3C71 A;  5H5Q A;  2A2S A;  1J9B A;  2MBT A;  4XIH A;  3E0U A;  4L0U A;  5F8B A;  5JCU A;  2HRF A;  1ZMA A;  3I69 A;  3KH7 A;  2WGR A;  1GLQ A;  2V41 A;  1AW9 A;  4POB A;  4MK3 A;  1ERV A;  3C7M A;  3TKR A;  3GUS A;  2WS2 A;  1SD9 A;  3EE2 A;  4I6X A;  3KD0 A;  2IMD A;  4TR0 A;  4DEJ A;  2XHF A;  1GLP A;  3TRP A;  5IOX A;  4I2T A;  2IMF A;  1SEN A;  1X5D A;  7GSS A;  4DSS A;  2CVD A;  1Z9H A;  1MDJ A;  1DE1 A;  2O89 A;  2GVP A;  3NZN A;  3FY7 A;  3HHV A;  3LFL A;  5D9W A;  4EL1 A;  9GSS A;  2IFQ B;  5DDL A;  3CYN A;  4FYB A;  5ECR B;  4WKW A;  2O87 A;  1VF1 A;  2IMI A;  1MD4 A;  5GSS A;  3AY8 A;  2JSY A;  3ME8 A;  1FAA A;  10GS A;  1K0O A;  3G9B A;  3CBU A;  4ECC A;  1TDI A;  1RW1 A;  1GUH A;  1Z6M A;  4XRA A;  1THO A;  1IYH A;  3ERW A;  1G7E A;  3HKR A;  1AC1 A;  2YWM A;  1U88 A;  2BTO T;  3N9J A;  1QFN A;  1TOF A;  3KCM A;  1A0R P;  6GSW A;  1T4Y A;  4OO5 A;  3E3E A;  4L0W A;  3A2V A;  2CVK A;  4QQ7 A;  4FO5 A;  2HRK A;  3ZLP A;  2VUP A;  4I97 A;  3ZIT A;  3TRX A;  13GS A;  3RBT A;  1PRX A;  4KB3 A;  3F9U A;  3FR6 A;  2FY6 A;  5B6N A;  4EXJ A;  3VK9 A;  2VCZ A;  1T8E B;  1QMV A;  2GST A;  4Q5R A;  1V98 A;  3NOF A;  3FHK A;  4G0I A;  3ZVJ D;  1W89 A;  3KMN A;  3DKS A;  3WYW A;  2VIM A;  1VGL A;  4J56 E;  5AIX A;  2F8A A;  1UN2 A;  3DXB A;  2B5Y A;  4WBJ A;  2NBS A;  2OE1 A;  14GS A;  1JHB A;  4L5L A;  5HR2 A;  4ZIJ A;  3L4N A;  4ILF A;  2CAI A;  3Q74 A;  2DML A;  1FG4 A;  5J9B A;  3VWX A;  5HR3 A;  2E7P A;  2MMA A;  3MSZ A;  2C0E A;  4MA9 A;  1WP0 A;  1PKZ A;  1LJR A;  2MBS A;  3GL5 A;  1YKA A;  4KDY A;  3DD3 A;  3KP8 A;  1SK2 A;  2GT6 A;  5G5F A;  2VCV A;  1ML6 A;  2R6K A;  2XC2 A;  1OKD A;  3SBC A;  2M72 A;  5D8I A;  4TXO A;  3KP9 A;  1F3A A;  3WT1 A;  4POL A;  5AIV A;  1G7O A;  3APQ A;  19GS A;  4G0K A;  3ERG A;  4GQF A;  3GUR A;  3TKP A;  1K0C A;  2GZZ A;  2RUF A;  4X0X A;  1G6W A;  3WT2 A;  1XPV A;  3BOA A;  4TR1 B;  4WF5 A;  2RLI A;  1V2A A;  2CX4 A;  2GSR A;  1WMJ A;  3K8N A;  1U3I A;  2IMK A;  3EVI A;  3N5O A;  3C73 A;  1SJ6 A;  2JZT A;  4BWQ A;  1EEM A;  3ZL5 A;  3IR4 A;  2EIO A;  1C72 A;  2KHP A;  2MMZ A;  2ZCT A;  1URM A;  5IOW A;  4K6X A;  1HNB A;  1JZD A;  3CRT A;  4MJB A;  3QMX A;  17GS A;  1B4P A;  1X9M B;  4MF7 A;  2H76 A;  4KF9 A;  4V2N A;  4ZBA A;  1ERT A;  3ED3 A;  3EWL A;  3P8W A;  1AQX A;  4QL7 A;  5CRE A;  1YZX A;  4F0C A;  4CDO A;  5GZZ B;  3TKS A;  1O8W A;  1M2A A;  4ZB8 A;  3ZML A;  1FVJ A;  2GQK A;  1GSD A;  3ERF A;  4PUR A;  2C0F A;  4LLR A;  1KEB A;  4K7O A;  2IWT A;  3DML A;  2I3Y A;  3Q6O A;  2YP6 A;  2PGT A;  3M0F A;  2YJ7 A;  5E4W A;  1SYX A;  2GDR A;  5KEJ A;  3EMX A;  1CQH A;  5AN1 A;  5HQP A;  1PX6 A;  3DIE A;  3TCO A;  2ON5 A;  2PVO C;  3GRX A;  3F6F A;  1R5P A;  3UOM A;  4ZL8 A;  1SKW B;  3ZFL A;  2FWH A;  5ECM B;  3TJF A;  3J7Y b;  2YWO A;  1U6T A;  1PL2 A;  3KZQ A;  3UBL A;  1RK4 A;  2H73 A;  3HVV A;  3WGX A;  1MDI A;  1QXH A;  5B7C A;  5EVO A;  2JAC A;  2JSZ A;  3HDC A;  3FK8 A;  5A4V A;  1PN9 A;  1SKR B;  4XHM A;  4ML6 A;  3F8U A;  4KCA A;  4GST A;  1S3A A;  2HSM A;  2DBC A;  5F05 A;  1U87 A;  1BAY A;  2L6C A;  3FRC A;  4XCS A;  2OAC A;  3CSJ A;  2GS3 A;  1WOU A;  1Q98 A;  3LG6 A;  2O7K A;  1K3O A;  1VF3 A;  4E8E A;  3H1N A;  3HY2 A;  5DJL A;  5H5S A;  3VWW A;  3D5J A;  1EOH A;  3LWA A;  1A8L A;  3IRA A;  5AGY A;  3BD2 A;  4KH7 A;  1GSF A;  2LTK A;  4NV5 A;  6GST A;  4MP4 A;  1PGT A;  3GSS A;  1OKT A;  5JWR B;  2GTU A;  4NXI A;  2MYG A;  2A2R A;  4EDY A;  1O6J A;  2YNX A;  2MMO A;  3QFB C;  2WJU A;  2YV9 A;  3EYT A;  2DJK A;  1MEK A;  5D9T A;  1SJI A;  2H0G A;  5LNK e;  5DCG A;  2MMN A;  1FHE A;  3G7I A;  4K0N A;  2FUG 2;  4AJ7 A;  3GST A;  3WGE A;  3RPP A;  2F3M A;  4HQS A;  1B8X A;  2GQM A;  2CX3 A;  4MCU A;  1K0A A;  2LRT A;  3SWL A;  4HJM A;  4CHS A;  1YEP A;  2P31 A;  5ID2 A;  4JZQ A;  4ECB A;  3M3M A;  1JZO A;  2DJ0 A;  2Z9S A;  1O85 A;  1GTB A;  2VM2 A;  4GTU A;  4D73 B;  2CA8 A;  2WDU A;  1GUL A;  4POM A;  4GXZ A;  4ACS A;  2CZ2 A;  11GS A;  2XPD A;  1EP7 A;  3PPU A;  1PKW A;  1GTA A;  3L0H A;  4N10 A;  4P3Y B;  4K2D A;  2HQT A;  4FYU A;  2FWG A;  2O8V B;  3HJM A;  2EIR A;  2E2G A;  3ISO A;  3BCI A;  2DC5 A;  2PVQ A;  2M80 A;  4FQU A;  2JZS A;  2E2M A;  1OC9 A;  2CAQ A;  5CO3 A;  5D9X A;  4GF0 A;  2WZ9 A;  4YAP A; 
#chains in the Genus database with same CATH topology
 5ECN B;  2PWJ A;  2DJ1 A;  3F4R A;  1R5A A;  4TN8 A;  1TU8 A;  2EFH A;  4WR5 A;  3FW2 A;  3A5I A;  3TKS C;  4F0B A;  5IO0 A;  1NM3 A;  3GTU A;  1ST9 A;  1VF4 A;  4AI6 A;  1XWB A;  1G6Y A;  1OAZ A;  1YEW C;  1UVZ A;  5EY6 A;  1E6B A;  2HT9 A;  1W4V A;  1A0F A;  1BQ7 A;  1JZW A;  5B6M A;  2V1M A;  6GSS A;  1M3I A;  4HQZ A;  18GS A;  2P5Q A;  1WWJ A;  3Q19 A;  1XW6 A;  1XOA A;  2EFE A;  3IE3 A;  2PN8 A;  5G30 A;  2L6D A;  5DAL A;  1K0N A;  4V2M A;  1Z3E A;  2R5G A;  1GSU A;  3LJR A;  2LRN A;  5IMV A;  2NDO A;  1BYE A;  4BVY B;  2YN1 A;  1TRU A;  4NMU A;  1Y25 A;  4OD7 A;  3F4T A;  3UAP A;  2V6O A;  1EZK A;  3CSI A;  2LJR A;  4KGI A;  1S3R A;  2FGX A;  2JAD A;  3A2X A;  3P90 A;  2VLU A;  2QKE A;  5ECP B;  1GSS A;  2HZF A;  1HYU A;  1F37 A;  2IL3 A;  3LSZ A;  4TR3 A;  4F9Z A;  3W8J A;  2LJK A;  4JR4 A;  1PSQ A;  2H01 A;  3DVW A;  3KXO A;  4AKG A;  4F82 A;  4HS1 A;  4PI2 C;  5HFK A;  2IN3 A;  4BA7 A;  4K8M A;  3ZYW A;  2HRA A;  3OR5 A;  3C1S A;  6GSY A;  4K9Z A;  1FB6 A;  2AUV A;  5KN0 A;  2VCT A;  1YY7 A;  2WW0 A;  4MNN A;  1X9W B;  3UEM A;  1TRS A;  2GZP A;  1NHO A;  1X0R A;  3GIX A;  5DQY A;  3G7Y A;  4V1A g;  1SL1 B;  5L71 A;  4WEY A;  3RPN A;  3P2A A;  5J4Y A;  1YF0 A;  1BJX A;  5A5K A;  1H75 A;  3TJJ A;  4V1A p;  4O5R A;  4GWR A;  5AIS A;  3U5R E;  2VL9 A;  5IM9 A;  2V2G A;  1TK8 B;  4ZL9 A;  1XOB A;  2UZ8 A;  1J0F A;  2VCQ A;  1TU7 A;  4O92 A;  5ECS A;  4HUA A;  2VM1 A;  2LST A;  1FB0 A;  3RGB C;  4LMW A;  4RQR A;  2OKA A;  3MDK A;  5COH A;  2JZR A;  2L5O A;  5JCW A;  4RQX A;  3APS A;  3GL3 A;  5ECL B;  1TKD B;  5ECH B;  20GS A;  2O5V A;  2VO4 A;  5A5H A;  2VL2 A;  4GSS A;  4MPG A;  4N0V A;  16GS A;  1DBY A;  3HXS A;  3LEF A;  5IMA A;  2DJJ A;  4IW9 A;  2K6V A;  3KH9 A;  2HSY A;  1EWX A;  1BX9 A;  1FOH A;  5KOW A;  2LNT A;  3HCZ A;  4EKZ A;  1IYI A;  2LEG A;  4BVX B;  1N2A A;  4BWS A;  4FXY P;  4FH8 A;  4OFM A;  1JLW A;  1B9X C;  3PH9 A;  4RI6 A;  5ENU A;  4IP6 A;  3W6G A;  4OFN A;  2HFD A;  5A34 A;  1T1V A;  2GSS A;  2HLS A;  3H8Q A;  1GNW A;  3HZ8 A;  2FNO A;  1OYJ A;  4OCF A;  4LL1 B;  1YKC A;  1XG8 A;  4IJI A;  2FHE A;  2H30 A;  2LS5 A;  1GRX A;  5J41 A;  1X9S B;  1T4Z A;  1ZL9 A;  2BMX A;  4I2U A;  4USS A;  2I4A A;  4E8H A;  2OT3 A;  5BMU A;  1XWG A;  2DKI A;  2FWE A;  3ZRD A;  4O32 A;  1EGR A;  2FD3 A;  3D21 A;  2MZC A;  2VAF A;  4FIW A;  2A4H A;  3GFK A;  2L57 A;  4NHW A;  1GUM A;  1HNA A;  4KDU A;  1XBS A;  2R3X A;  1A23 A;  2CQ9 A;  4G19 A;  5LCZ A;  3VLN A;  3D6I A;  2YCD A;  2FLS A;  1Q4J A;  3HJP A;  1BED A;  2YZH A;  1PA3 A;  1XW9 A;  4DSR A;  2HZE A;  3FMW A;  4KCE A;  2WVZ A;  4PNF A;  1N8J A;  4KND A;  1R4W A;  1BG5 A;  1V57 A;  3F3R A;  5DQS A;  4LA1 A;  1GP1 A;  1S3C A;  1AQV A;  5J4U A;  3QOU A;  1XFL A;  1GTI A;  2WFC A;  2LKU A;  1USB A;  5HR0 A;  4HSC X;  2WW3 A;  3EC3 A;  4V2L A;  3IC8 A;  2WZS A;  4X1U A;  4ZB9 A;  1OC3 A;  2J9H A;  5D9V A;  1A2J A;  4HZ4 A;  5DAK A;  4XS4 A;  4PQH A;  2N5F A;  1TRV A;  2LUS A;  4YH2 A;  2DJ2 A;  2K8V A;  3KTB A;  1I1I P;  1SK1 A;  1R7H A;  2V32 A;  3TJB A;  3VWV A;  3KJY A;  2PBJ A;  3RAZ A;  2HXK A;  1UA5 A;  3V1W A;  2TIR A;  1YQ1 A;  1A2L A;  2DJ3 A;  5ECO B;  1Z5Y E;  3LQ7 A;  4NV2 A;  1EGO A;  2VD0 A;  1M0U A;  6GSV A;  4DSS B;  3BCK A;  3GKN A;  1TI1 A;  5GAN D;  3GKX A;  4BL7 A;  3RHC A;  3DWV A;  2HE3 A;  2KP2 A;  2WUL A;  4F2I A;  5JWQ B;  2C80 A;  5J9C A;  3GKK A;  4DVC A;  5ECK B;  2OAD A;  1ZYQ B;  3RFR C;  2B7J A;  1X5E A;  2R2J A;  1JZR A;  4ULX A;  2OBI A;  2B5X A;  2B5E A;  3TUE A;  2HSH A;  4OO4 A;  1YVL A;  1ERW A;  4MF5 A;  4HJ2 A;  4K7I A;  3JCM L;  2LRC A;  3MAK A;  3APO A;  3DYR A;  4X43 A;  1DUG A;  4AJ6 A;  1TP9 A;  2F51 A;  1WRY A;  1M3J A;  2HRK B;  4YAV A;  1PL1 A;  4PUA A;  3QDN A;  2PER A;  3FEU A;  4KX4 A;  2HRN A;  4HU9 A;  4JE1 A;  2FA4 A;  2OE3 A;  4MF6 A;  3FZ4 A;  4ZB6 A;  1E2Y A;  4YKF A;  2PPT A;  4POK A;  5JCG A;  4A5P A;  3WD6 A;  1FVK A;  2YOI A;  3EUR A;  5CRG A;  1GSQ A;  2VL2 C;  5CYY A;  2X64 A;  1ZYE A;  4ECI A;  5INY A;  4PQI A;  2IFQ A;  1UC7 A;  4MLY A;  4KUN A;  3C1R A;  4PTS A;  5FHI A;  3BJ5 A;  3GN3 A;  4MZB A;  1YDK A;  3FKF A;  3GYK A;  3MIX A;  4JR6 A;  4HZ2 A;  2LJA A;  1ZCP A;  5C04 A;  4YQU A;  1XVQ A;  2YAN A;  3VWU A;  2WCI A;  1VF2 A;  4EE0 A;  2RM5 A;  12GS A;  3O3T A;  2TRX A;  2I81 A;  2C0D A;  1ACV A;  2H6X A;  2C8U A;  4IBP A;  3LYK A;  5A4U A;  5EL8 A;  3D4M A;  4TR4 A;  3CWG A;  1MDK A;  2FWF A;  4GRF A;  3UMA A;  3GH6 A;  4NHZ A;  4TKY A;  4HI7 A;  4RI7 A;  2L4Q A;  2N5B A;  2UV8 G;  2I9H A;  1R26 A;  4CW9 A;  5GST A;  1YEX A;  2R0G A;  1EP8 A;  4N0Z A;  4TXO B;  5DJM A;  2H0H A;  3VPQ A;  4MH3 A;  4PI0 C;  3QCP A;  3GKM A;  5DBQ A;  2HYX A;  1ERU A;  1GTU A;  2GZY A;  4EF0 A;  2CT6 A;  3HD5 A;  3CQF A;  5JWO B;  3TDG A;  4LMV A;  1B48 A;  4PGT A;  3HVS A;  1AXD A;  4KE3 A;  1ZYN A;  3EU4 A;  2H6Z A;  2JU5 A;  3C8E A;  2RUE A;  2HSN B;  4YQM A;  4WXT A;  5ABR A;  2NVL A;  2VL3 A;  4J2F A;  2WB9 A;  2XBI A;  3KEB A;  1TJD A;  3QAV A;  5KN3 A;  3S9F A;  2X8G A;  2H1L A;  4W66 A;  4ZBD A;  3IHG A;  4WBR D;  3TGZ A;  1JLV A;  3UIW A;  2H75 A;  3HZ4 A;  2YWN A;  3RHB A;  2YPM A;  3HYP A;  3F0I A;  4AF2 A;  3L9S A;  2FCH A;  2P0G A;  2ON7 A;  4EO3 A;  5KN1 A;  2H70 A;  2RII A;  4K5R A;  4MMM A;  5B8A A;  5CAX A;  3TJG A;  3IA1 A;  5C00 A;  3EIN A;  5ELA A;  4I5Q A;  4BPY A;  3CRU A;  4JU5 A;  2D2Z A;  3F63 A;  2K18 A;  1PMT A;  5FT3 A;  1FO5 A;  5B8B A;  1HQO A;  2H74 A;  1PX7 A;  3HVX A;  2OE0 A;  2VLV A;  2DIY A;  2C1Y A;  3ZVJ A;  3F6D A;  3M1G A;  1GWC A;  3FZ9 A;  4TR1 A;  1DE2 A;  4HDE A;  4OWY A;  4G9H A;  3IK7 A;  3KTL A;  1Y1U A;  1B4Q A;  3M9J A;  3A3T A;  3KIJ A;  2NPB A;  2A4V A;  2YV7 A;  3VPT A;  3UBK A;  4JED A;  3U6V A;  1O81 A;  3CTG A;  4XTS A;  5CNW A;  5IPG A;  1K0D A;  3FZA A;  4MZC A;  4H86 A;  2HI7 A;  2J23 A;  5CRH A;  2OA7 A;  2GGT A;  1Z6N A;  5ELG A;  3DVX A;  5F06 A;  4GCI A;  3H4K A;  1V40 A;  2DSA A;  3MNG A;  4GDF A;  4O5U A;  4BIK A;  1GSE A;  1LU4 A;  1HD2 A;  2H1B A;  2LQO A;  1PQN A;  1OE7 A;  2B3S A;  2C3N A;  3PR8 A;  4KA0 A;  1TI3 A;  2WVX B;  3VI7 A;  1M2D A;  1XVW A;  2ZUP A;  3TOT A;  1TRW A;  1NSW A;  2VCX A;  3TKQ A;  4K7N A;  2VCW A;  4TXV A;  4MJE A;  2YZU A;  4WET A;  2XPE A;  2YJH A;  4K1F A;  2PUK C;  5F0G A;  2H1A A;  2HSM B;  1G0T A;  3VFI A;  2IPA A;  2C3Q A;  1KTE A;  1J08 A;  2QC7 A;  4FYC A;  2RM6 A;  2DLX A;  4RUV A;  4AKH A;  5FWG A;  3O6T A;  4Z7X A;  1GNE A;  1H4O A;  3TOU A;  2X8C A;  2X8H A;  2H19 A;  1MTC A;  5IMF A;  1SD8 A;  1S3D A;  5E59 A;  4IQA A;  1SVM A;  1XWK A;  2C3T A;  5DVB A;  2AYT A;  1NW2 A;  2H8L A;  1WE0 A;  2GT5 A;  5F07 A;  4PQ1 A;  4K5S A;  1DSB A;  1Z7P A;  2LQQ A;  1LBK A;  4G0L A;  1OVN A;  3IK9 A;  2LNS A;  4HU7 A;  1F6M C;  1GL8 A;  5ECQ B;  2NTO A;  1BG1 A;  2WRT A;  4NPB A;  2ES7 A;  1YF1 A;  2BJX A;  4NWY A;  4EVM A;  3P7X A;  3FZ5 A;  1WPI A;  2VOC A;  3DEX A;  1XZO A;  4KDX A;  2R37 A;  3UJ1 A;  1A2M A;  4G01 A;  1K0M A;  2H6Y A;  4ZXG A;  4ICY A;  5J47 A;  1EOG A;  3TKS E;  5ID2 B;  3HA9 A;  3ZFB A;  1SYR A;  1EEJ A;  1S4B P;  1Y6E A;  4EDZ A;  4YQV A;  4IHU A;  2C4J A;  3UAR A;  2M46 A;  3D22 A;  4ECJ A;  3LYP A;  2GQL A;  1F2E A;  4J57 E;  1O7U A;  4IS0 A;  3J7Y k;  2CVB A;  4MJC A;  1YJ6 A;  4ML1 A;  1GH2 A;  5G1K A;  4WR4 A;  3CSH A;  3ZMK A;  3ZRE A;  1HNC A;  4ZL7 A;  5IPH A;  2L59 A;  1TXU A;  1TW9 A;  3TB2 A;  4JRR A;  1K3Y A;  1THX A;  4IVF A;  1ZZY A;  1A24 A;  1FOV A;  1ILO A;  1FW1 A;  2JL4 A;  2K9F A;  1SJZ A;  3CXG A;  1I5G A;  5A1N A;  4L8E A;  4AGS A;  1OC9 B;  3HVN A;  3F4S A;  3M9K A;  2LV3 A;  1M99 A;  5ECI B;  1EV9 A;  2X4A A;  1QUW A;  5IO2 A;  5J4V A;  1AQW A;  4EUY A;  2OBK A;  1PD2 1;  4L5O A;  4WF4 A;  2KP1 A;  3ZTL A;  4D73 A;  2P5R A;  3QD9 A;  4K0G A;  3H93 A;  3FR9 A;  5CP1 A;  3Q18 A;  3GTU B;  3DGQ A;  3F3Q A;  1K0B A;  4TOP A;  1O73 A;  1I9D A;  1EV4 A;  5H5R A;  2AJQ B;  2H66 A;  2CZ3 A;  1VRS D;  1SL2 B;  5IMZ A;  1AUC A;  3QFA C;  3LXZ A;  3L9V A;  5HFG A;  2H71 A;  5CRW A;  1KBN A;  3IPZ A;  4IJ3 A;  8GSS A;  1QK8 A;  22GS A;  2H1G A;  5DAL B;  1GUK A;  2KOK A;  3ZZX A;  1BF5 A;  3LOR A;  2EFD A;  3QPM A;  3VUR A;  5LD0 A;  2QGV A;  4KSO A;  4HEA 2;  4OCE A;  4HOJ A;  3QAG A;  3A2W A;  3CMI A;  4NAX A;  3IDV A;  1SKS B;  2ZNM A;  3GV1 A;  2O85 A;  1V9W A;  2WW1 A;  1AAZ A;  2GLR A;  2R4V A;  4Q5N A;  2L4C A;  4ZB7 A;  1M2B A;  3RDW A;  5J5N A;  2XBQ A;  2EC4 A;  4TW5 A;  1OC8 A;  1M9B A;  2VKZ G;  3I6A A;  1GSY A;  1M9A A;  4MAB A;  2O36 A;  3BBY A;  5CRD A;  1KNG A;  4E68 A;  3HJO A;  3QR6 A;  2HNL A;  2L5L A;  4G10 A;  3KM6 A;  3D4T A;  2OJL A;  5DCH A;  4IEL A;  5G1L A;  4O7H A;  3IAM 2;  2H0I A;  5IIZ A;  1F9M A;  4MZW A;  2B7K A;  4KSM A;  5J3R A;  3NIV A;  4IP1 A;  4I8B A;  4N11 A;  4G2E A;  4BVY A;  4XS6 A;  3US3 A;  2IME A;  3HMJ G;  3IAS 2;  4ISD A;  2EIQ A;  2G0F A;  4ID0 A;  1TXX A;  2DMM A;  2ALB A;  1SL0 B;  2VLT A;  3GNJ A;  4PXO A;  4KAE A;  1XWA A;  3FYG A;  3FR3 A;  2G2Q A;  3ZIJ A;  3DRN A;  4F03 A;  2GSQ A;  2CV4 A;  2PMT A;  5KN2 A;  4MJA A;  2AB6 A;  2C0G A;  3H79 A;  2EFC A;  1XIY A;  2AHE A;  1RQM A;  3A5W A;  5IMD A;  4PNG A;  5G5E A;  1MD3 A;  5IQY A;  3I9V 2;  2IJY A;  1XXU A;  1ABA A;  2V6K A;  2YWI A;  5A5H B;  3EMP A;  3UL3 A;  4OFT A;  2B1K A;  5EPF A;  3GX0 A;  2QA1 A;  4XRD A;  5G2Z A;  3D0Z A;  4JBB A;  3UVT A;  5HR1 A;  2QSI A;  3IHQ A;  1QQ2 A;  4AJ8 A;  2H72 A;  3EU3 A;  1AIU A;  1XW5 A;  1TK5 B;  3IC4 A;  5GAP D;  3VI5 A;  2KUC A;  3IXR A;  3PIN A;  2R0P A;  5D96 A;  2F8F A;  3GH9 A;  4Q5F A;  3I43 A;  3O76 A;  4EIP A;  3IBH A;  1OE8 A;  1B9Y C;  1T7P B;  2VD1 A;  1XCC A;  1SK0 A;  6GSX A;  3E9J B;  5A34 B;  2AV4 A;  3R2Q A;  3M8N A;  2H1D A;  4Z2R A;  5HFI A;  3WGD A;  2K8S A;  4QL9 A;  4GLT A;  1F3B A;  4EC0 A;  5IMC A;  4MDC A;  3L78 A;  1A8Y A;  3CTF A;  1K3L A;  2N5A A;  1JFU A;  1ZGN A;  1U3A A;  5BMU B;  2TRC P;  4GSN A;  3IV4 A;  4PUF C;  2O3E A;  2FA8 A;  4YKG A;  4ZIL A;  3GHA A;  4BVX A;  4MH2 A;  1WJK A;  4IQ1 A;  3L9U A;  5G31 A;  5A4W A;  3W8S A;  4IKH A;  3IOS A;  1TK0 B;  3KMO A;  2X99 A;  1SU9 A;  3UVH A;  2F9S A;  3PGT A;  3GA4 A;  3QAW A;  4Z2T A;  2HZE B;  1T3B A;  4TVE A;  4O5Q A;  1Z7R A;  4DSQ A;  4PX1 A;  2DIZ A;  4LL4 B;  6GSU A;  3ZIV A;  1ZYP A;  2PU9 C;  1M7T A;  1V58 A;  4IGJ A;  1NHY A;  4ZBB A;  1ON4 A;  4Q5Q A;  4MPF A;  3TU3 B;  4XS1 A;  4GQC A;  2WVY A;  1XWC A;  4IN0 A;  3TJK A;  3MWH A;  3G7J A;  3R3E A;  5D73 A;  1T00 A;  2KLX A;  5DAK B;  3ME7 A;  2I1U A;  4XS4 B;  2REM A;  1SVO A;  2IIY A;  4KW6 A;  5D93 A;  5BRT A;  1X5C A;  3KGK A;  3GMF A;  2B6M A;  1QGV A;  3TRQ A;  3GX8 A;  5J40 A;  1WIK A;  1N25 A;  4N30 A;  4OMV A;  4TRX A;  2B1L A;  1CQG A;  4BL7 B;  3LXT A;  1ZOF A;  5KOX A;  1O8X A;  1TTZ A;  2E0Q A;  4EIQ A;  3LGC A;  2AAW A;  3C71 A;  5H5Q A;  2A2S A;  1J9B A;  2MBT A;  1PN0 A;  4XIH A;  3E0U A;  4L0U A;  5F8B A;  5JCU A;  2HRF A;  1ZMA A;  3I69 A;  3KH7 A;  1PFO A;  2WGR A;  1GLQ A;  2V41 A;  1AW9 A;  4POB A;  4MK3 A;  1ERV A;  3C7M A;  3TKR A;  3GUS A;  2WS2 A;  4Z2U A;  1SD9 A;  3EE2 A;  4I6X A;  3KD0 A;  2IMD A;  4TR0 A;  4DEJ A;  2XHF A;  1GLP A;  3TRP A;  5IOX A;  4I2T A;  2IMF A;  1SEN A;  1X5D A;  7GSS A;  4DSS A;  2CVD A;  1Z9H A;  1MDJ A;  1DE1 A;  2O89 A;  2GVP A;  3NZN A;  3FY7 A;  3HHV A;  3LFL A;  5D9W A;  4EL1 A;  9GSS A;  2IFQ B;  5DDL A;  3CYN A;  4FYB A;  5ECR B;  4WKW A;  2O87 A;  4QMK A;  1VF1 A;  2IMI A;  1MD4 A;  5GSS A;  3AY8 A;  2JSY A;  3ME8 A;  1FAA A;  10GS A;  1K0O A;  3G9B A;  3CBU A;  4ECC A;  1TDI A;  1RW1 A;  1GUH A;  1Z6M A;  4XRA A;  1THO A;  1IYH A;  3ERW A;  1G7E A;  3HKR A;  1AC1 A;  2YWM A;  1U88 A;  2BTO T;  3N9J A;  1QFN A;  1TOF A;  3KCM A;  1A0R P;  6GSW A;  1T4Y A;  4OO5 A;  3E3E A;  4L0W A;  3A2V A;  2CVK A;  4QQ7 A;  4FO5 A;  2HRK A;  3ZLP A;  2VUP A;  4I97 A;  3ZIT A;  3TRX A;  13GS A;  3RBT A;  1PRX A;  4KB3 A;  3F9U A;  3FR6 A;  2FY6 A;  5B6N A;  4EXJ A;  3VK9 A;  2VCZ A;  1T8E B;  1QMV A;  2GST A;  4Q5R A;  1V98 A;  3NOF A;  3FHK A;  3LW9 A;  4G0I A;  4PHZ C;  1W89 A;  3ZVJ D;  3KMN A;  3DKS A;  3WYW A;  2VIM A;  1VGL A;  4J56 E;  5AIX A;  2F8A A;  1UN2 A;  3DXB A;  2B5Y A;  4WBJ A;  2NBS A;  2OE1 A;  14GS A;  1JHB A;  4L5L A;  5HR2 A;  4ZIJ A;  3L4N A;  4ILF A;  2CAI A;  3Q74 A;  2DML A;  2QA2 A;  1FG4 A;  5J9B A;  3VWX A;  5HR3 A;  2E7P A;  2MMA A;  3MSZ A;  2C0E A;  4MA9 A;  1WP0 A;  1PKZ A;  1LJR A;  2MBS A;  3GL5 A;  1YKA A;  4KDY A;  3DD3 A;  3KP8 A;  1SK2 A;  2GT6 A;  5G5F A;  2VCV A;  1ML6 A;  2R6K A;  2XC2 A;  1OKD A;  3SBC A;  2M72 A;  5D8I A;  4TXO A;  3KP9 A;  1F3A A;  3WT1 A;  4POL A;  5AIV A;  1G7O A;  3APQ A;  19GS A;  4G0K A;  3ERG A;  4GQF A;  3GUR A;  3TKP A;  1K0C A;  2GZZ A;  2RUF A;  4X0X A;  1G6W A;  3WT2 A;  1XPV A;  3BOA A;  4TR1 B;  4WF5 A;  2HSN A;  2RLI A;  1V2A A;  2CX4 A;  2GSR A;  1WMJ A;  2R0C A;  4N3Z A;  3K8N A;  1U3I A;  2IMK A;  3EVI A;  3N5O A;  3C73 A;  1SJ6 A;  2WW2 A;  2JZT A;  4BWQ A;  1EEM A;  3ZL5 A;  3IR4 A;  2EIO A;  1C72 A;  2KHP A;  2MMZ A;  2ZCT A;  1URM A;  5IOW A;  4K6X A;  1HNB A;  1JZD A;  3CRT A;  4MJB A;  3QMX A;  17GS A;  1B4P A;  1X9M B;  4MF7 A;  2H76 A;  4KF9 A;  4V2N A;  4ZBA A;  1ERT A;  3ED3 A;  3EWL A;  3P8W A;  1AQX A;  4QL7 A;  5CRE A;  1YZX A;  4F0C A;  4CDO A;  5GZZ B;  3TKS A;  1O8W A;  1M2A A;  4ZB8 A;  3ZML A;  1FVJ A;  2GQK A;  4CY6 A;  1GSD A;  3ERF A;  4PUR A;  2C0F A;  4LLR A;  1KEB A;  4K7O A;  2IWT A;  3DML A;  3CHX C;  2I3Y A;  3Q6O A;  2YP6 A;  2PGT A;  3M0F A;  2YJ7 A;  5E4W A;  4K2X A;  1SYX A;  2GDR A;  5KEJ A;  3EMX A;  1CQH A;  5AN1 A;  5HQP A;  1PX6 A;  3DIE A;  3TCO A;  2ON5 A;  2PVO C;  3GRX A;  3F6F A;  1R5P A;  3UOM A;  4ZL8 A;  1SKW B;  3ZFL A;  2FWH A;  4CY8 A;  5ECM B;  3TJF A;  3J7Y b;  3EPT A;  2YWO A;  1U6T A;  1PL2 A;  4AKX B;  3KZQ A;  3UBL A;  1RK4 A;  2H73 A;  3HVV A;  2A2P A;  3WGX A;  1MDI A;  1QXH A;  5B7C A;  5EVO A;  2WVX A;  2JAC A;  2JSZ A;  3HDC A;  3FK8 A;  5A4V A;  1PN9 A;  1SKR B;  4XHM A;  4ML6 A;  3F8U A;  4KCA A;  4GST A;  1S3A A;  2HSM A;  2DBC A;  5F05 A;  1U87 A;  1BAY A;  2L6C A;  3FRC A;  4XCS A;  2OAC A;  3CSJ A;  2GS3 A;  1WOU A;  1Q98 A;  3LG6 A;  2O7K A;  1K3O A;  1SVL A;  1VF3 A;  4E8E A;  3H1N A;  3HY2 A;  5DJL A;  5H5S A;  3VWW A;  3D5J A;  1EOH A;  3LWA A;  1A8L A;  3IRA A;  5AGY A;  3BD2 A;  4KH7 A;  1GSF A;  2LTK A;  3MYD A;  4NV5 A;  6GST A;  4MP4 A;  1PGT A;  3GSS A;  1OKT A;  5JWR B;  2GTU A;  4NXI A;  2MYG A;  2A2R A;  4EDY A;  1O6J A;  2YNX A;  2MMO A;  3QFB C;  4X4J A;  2WJU A;  2YV9 A;  2DKH A;  3EYT A;  2DJK A;  1MEK A;  5D9T A;  1SJI A;  2H0G A;  5LNK e;  5DCG A;  2MMN A;  1FHE A;  3G7I A;  4K0N A;  5A1N B;  2FUG 2;  4AJ7 A;  3GST A;  3WGE A;  4AKI A;  3RPP A;  2F3M A;  4HQS A;  1B8X A;  2GQM A;  2CX3 A;  4MCU A;  1K0A A;  2LRT A;  3SWL A;  4HJM A;  4CHS A;  1YEP A;  2P31 A;  5ID2 A;  4JZQ A;  4ECB A;  3M3M A;  1JZO A;  2DJ0 A;  2Z9S A;  1O85 A;  1GTB A;  2VM2 A;  4GTU A;  4D73 B;  2CA8 A;  2WDU A;  1GUL A;  4POM A;  4GXZ A;  4ACS A;  2CZ2 A;  11GS A;  2XPD A;  1EP7 A;  3PPU A;  1PKW A;  1GTA A;  3L0H A;  4N10 A;  4P3Y B;  4K2D A;  2HQT A;  4FYU A;  2FWG A;  2O8V B;  3HJM A;  2EIR A;  2E2G A;  3ISO A;  3BCI A;  2X49 A;  2DC5 A;  2PVQ A;  2M80 A;  4FQU A;  2JZS A;  2E2M A;  1OC9 A;  2CAQ A;  5CO3 A;  5D9X A;  4GF0 A;  2WZ9 A;  4YAP A; 
#chains in the Genus database with same CATH homology
 5ECN B;  2PWJ A;  2DJ1 A;  3F4R A;  1R5A A;  4TN8 A;  1TU8 A;  2EFH A;  4WR5 A;  3FW2 A;  3A5I A;  3TKS C;  4F0B A;  5IO0 A;  1NM3 A;  3GTU A;  1ST9 A;  1VF4 A;  4AI6 A;  1XWB A;  1G6Y A;  1OAZ A;  1UVZ A;  5EY6 A;  1E6B A;  2HT9 A;  1W4V A;  1A0F A;  1BQ7 A;  1JZW A;  5B6M A;  2V1M A;  6GSS A;  4HQZ A;  18GS A;  2P5Q A;  1WWJ A;  3Q19 A;  1XW6 A;  1XOA A;  2EFE A;  3IE3 A;  2PN8 A;  5G30 A;  2L6D A;  5DAL A;  1K0N A;  4V2M A;  1Z3E A;  2R5G A;  1GSU A;  3LJR A;  2LRN A;  5IMV A;  2NDO A;  1BYE A;  4BVY B;  2YN1 A;  1TRU A;  4NMU A;  1Y25 A;  4OD7 A;  3F4T A;  3UAP A;  2V6O A;  1EZK A;  3CSI A;  2LJR A;  4KGI A;  2FGX A;  2JAD A;  3A2X A;  3P90 A;  2VLU A;  2QKE A;  5ECP B;  1GSS A;  2HZF A;  1HYU A;  1F37 A;  2IL3 A;  3LSZ A;  4TR3 A;  4F9Z A;  3W8J A;  2LJK A;  4JR4 A;  1PSQ A;  2H01 A;  3DVW A;  3KXO A;  4AKG A;  4F82 A;  4HS1 A;  5HFK A;  2IN3 A;  4BA7 A;  4K8M A;  3ZYW A;  2HRA A;  3OR5 A;  3C1S A;  6GSY A;  4K9Z A;  1FB6 A;  2AUV A;  5KN0 A;  2VCT A;  1YY7 A;  4MNN A;  1X9W B;  3UEM A;  1TRS A;  2GZP A;  1NHO A;  1X0R A;  3GIX A;  5DQY A;  3G7Y A;  4V1A g;  1SL1 B;  5L71 A;  4WEY A;  3RPN A;  3P2A A;  5J4Y A;  1YF0 A;  1BJX A;  5A5K A;  1H75 A;  3TJJ A;  4V1A p;  4O5R A;  4GWR A;  5AIS A;  3U5R E;  2VL9 A;  5IM9 A;  2V2G A;  1TK8 B;  4ZL9 A;  1XOB A;  2UZ8 A;  1J0F A;  2VCQ A;  1TU7 A;  4O92 A;  5ECS A;  4HUA A;  2VM1 A;  2LST A;  1FB0 A;  4LMW A;  4RQR A;  2OKA A;  3MDK A;  5COH A;  2JZR A;  2L5O A;  5JCW A;  4RQX A;  3APS A;  3GL3 A;  5ECL B;  1TKD B;  5ECH B;  20GS A;  2O5V A;  2VO4 A;  5A5H A;  2VL2 A;  4GSS A;  4MPG A;  4N0V A;  16GS A;  1DBY A;  3HXS A;  3LEF A;  5IMA A;  2DJJ A;  4IW9 A;  2K6V A;  3KH9 A;  2HSY A;  1EWX A;  1BX9 A;  1FOH A;  5KOW A;  2LNT A;  3HCZ A;  4EKZ A;  1IYI A;  2LEG A;  4BVX B;  1N2A A;  4BWS A;  4FH8 A;  4OFM A;  1JLW A;  1B9X C;  3PH9 A;  4RI6 A;  5ENU A;  4IP6 A;  3W6G A;  4OFN A;  2HFD A;  5A34 A;  1T1V A;  2GSS A;  2HLS A;  3H8Q A;  1GNW A;  3HZ8 A;  2FNO A;  1OYJ A;  4OCF A;  4LL1 B;  1YKC A;  4IJI A;  2FHE A;  2H30 A;  2LS5 A;  1GRX A;  5J41 A;  1X9S B;  1T4Z A;  1ZL9 A;  2BMX A;  4I2U A;  4USS A;  2I4A A;  4E8H A;  2OT3 A;  5BMU A;  1XWG A;  2DKI A;  2FWE A;  3ZRD A;  4O32 A;  1EGR A;  2FD3 A;  3D21 A;  2MZC A;  2VAF A;  4FIW A;  2A4H A;  3GFK A;  2L57 A;  4NHW A;  1GUM A;  1HNA A;  4KDU A;  1XBS A;  2R3X A;  1A23 A;  2CQ9 A;  4G19 A;  5LCZ A;  3VLN A;  3D6I A;  2YCD A;  2FLS A;  1Q4J A;  3HJP A;  1BED A;  2YZH A;  1PA3 A;  1XW9 A;  4DSR A;  2HZE A;  3FMW A;  4KCE A;  4PNF A;  1N8J A;  4KND A;  1R4W A;  1BG5 A;  1V57 A;  3F3R A;  5DQS A;  4LA1 A;  1GP1 A;  1S3C A;  1AQV A;  5J4U A;  3QOU A;  1XFL A;  1GTI A;  2WFC A;  2LKU A;  1USB A;  5HR0 A;  3EC3 A;  4V2L A;  3IC8 A;  4X1U A;  4ZB9 A;  1OC3 A;  2J9H A;  5D9V A;  1A2J A;  4HZ4 A;  5DAK A;  4XS4 A;  4PQH A;  2N5F A;  1TRV A;  2LUS A;  4YH2 A;  2DJ2 A;  2K8V A;  3KTB A;  1SK1 A;  1R7H A;  2V32 A;  3TJB A;  3VWV A;  3KJY A;  2PBJ A;  3RAZ A;  2HXK A;  1UA5 A;  3V1W A;  2TIR A;  1YQ1 A;  1A2L A;  2DJ3 A;  5ECO B;  1Z5Y E;  3LQ7 A;  4NV2 A;  1EGO A;  2VD0 A;  1M0U A;  6GSV A;  4DSS B;  3BCK A;  3GKN A;  1TI1 A;  5GAN D;  3GKX A;  4BL7 A;  3RHC A;  3DWV A;  2HE3 A;  2KP2 A;  2WUL A;  4F2I A;  5JWQ B;  2C80 A;  5J9C A;  3GKK A;  4DVC A;  5ECK B;  2OAD A;  1ZYQ B;  2B7J A;  1X5E A;  2R2J A;  1JZR A;  4ULX A;  2OBI A;  2B5X A;  2B5E A;  3TUE A;  2HSH A;  4OO4 A;  1YVL A;  1ERW A;  4MF5 A;  4HJ2 A;  4K7I A;  3JCM L;  2LRC A;  3MAK A;  3APO A;  3DYR A;  4X43 A;  1DUG A;  4AJ6 A;  1TP9 A;  2F51 A;  1WRY A;  2HRK B;  4YAV A;  1PL1 A;  4PUA A;  3QDN A;  2PER A;  3FEU A;  4KX4 A;  2HRN A;  4HU9 A;  4JE1 A;  2FA4 A;  2OE3 A;  4MF6 A;  3FZ4 A;  4ZB6 A;  1E2Y A;  4YKF A;  2PPT A;  4POK A;  5JCG A;  4A5P A;  3WD6 A;  1FVK A;  2YOI A;  3EUR A;  5CRG A;  1GSQ A;  2VL2 C;  5CYY A;  2X64 A;  1ZYE A;  4ECI A;  5INY A;  4PQI A;  2IFQ A;  1UC7 A;  4MLY A;  4KUN A;  3C1R A;  4PTS A;  5FHI A;  3BJ5 A;  3GN3 A;  4MZB A;  1YDK A;  3FKF A;  3GYK A;  3MIX A;  4JR6 A;  4HZ2 A;  2LJA A;  1ZCP A;  5C04 A;  4YQU A;  1XVQ A;  2YAN A;  3VWU A;  2WCI A;  1VF2 A;  4EE0 A;  2RM5 A;  12GS A;  3O3T A;  2TRX A;  2I81 A;  2C0D A;  1ACV A;  2H6X A;  2C8U A;  4IBP A;  3LYK A;  5A4U A;  5EL8 A;  3D4M A;  4TR4 A;  3CWG A;  1MDK A;  2FWF A;  4GRF A;  3UMA A;  3GH6 A;  4NHZ A;  4TKY A;  4HI7 A;  4RI7 A;  2L4Q A;  2N5B A;  2UV8 G;  2I9H A;  1R26 A;  4CW9 A;  5GST A;  1YEX A;  2R0G A;  1EP8 A;  4N0Z A;  4TXO B;  5DJM A;  2H0H A;  3VPQ A;  4MH3 A;  3QCP A;  3GKM A;  5DBQ A;  2HYX A;  1ERU A;  1GTU A;  2GZY A;  4EF0 A;  2CT6 A;  3HD5 A;  5JWO B;  3TDG A;  4LMV A;  1B48 A;  4PGT A;  3HVS A;  1AXD A;  4KE3 A;  1ZYN A;  3EU4 A;  2H6Z A;  2JU5 A;  3C8E A;  2RUE A;  2HSN B;  4YQM A;  4WXT A;  5ABR A;  2NVL A;  2VL3 A;  4J2F A;  2WB9 A;  2XBI A;  3KEB A;  1TJD A;  3QAV A;  5KN3 A;  3S9F A;  2X8G A;  2H1L A;  4W66 A;  4ZBD A;  3IHG A;  4WBR D;  3TGZ A;  1JLV A;  3UIW A;  2H75 A;  3HZ4 A;  2YWN A;  3RHB A;  2YPM A;  3HYP A;  3F0I A;  4AF2 A;  3L9S A;  2FCH A;  2P0G A;  2ON7 A;  4EO3 A;  5KN1 A;  2H70 A;  2RII A;  4K5R A;  4MMM A;  5B8A A;  5CAX A;  3TJG A;  3IA1 A;  5C00 A;  3EIN A;  5ELA A;  4I5Q A;  4BPY A;  3CRU A;  4JU5 A;  2D2Z A;  3F63 A;  2K18 A;  1PMT A;  5FT3 A;  1FO5 A;  5B8B A;  1HQO A;  2H74 A;  1PX7 A;  3HVX A;  2OE0 A;  2VLV A;  2DIY A;  2C1Y A;  3ZVJ A;  3F6D A;  3M1G A;  1GWC A;  3FZ9 A;  4TR1 A;  1DE2 A;  4HDE A;  4OWY A;  4G9H A;  3IK7 A;  3KTL A;  1Y1U A;  1B4Q A;  3M9J A;  3A3T A;  3KIJ A;  2NPB A;  2A4V A;  2YV7 A;  3VPT A;  3UBK A;  4JED A;  3U6V A;  1O81 A;  3CTG A;  4XTS A;  5CNW A;  5IPG A;  1K0D A;  3FZA A;  4MZC A;  4H86 A;  2HI7 A;  2J23 A;  5CRH A;  2OA7 A;  2GGT A;  1Z6N A;  5ELG A;  3DVX A;  5F06 A;  4GCI A;  3H4K A;  1V40 A;  2DSA A;  3MNG A;  4GDF A;  4O5U A;  1GSE A;  1LU4 A;  1HD2 A;  2H1B A;  2LQO A;  1PQN A;  1OE7 A;  2B3S A;  2C3N A;  3PR8 A;  4KA0 A;  1TI3 A;  3VI7 A;  1M2D A;  1XVW A;  2ZUP A;  3TOT A;  1TRW A;  1NSW A;  2VCX A;  3TKQ A;  4K7N A;  2VCW A;  4TXV A;  4MJE A;  2YZU A;  4WET A;  2XPE A;  2YJH A;  4K1F A;  2PUK C;  5F0G A;  2H1A A;  2HSM B;  1G0T A;  3VFI A;  2IPA A;  2C3Q A;  1KTE A;  1J08 A;  2QC7 A;  4FYC A;  2RM6 A;  2DLX A;  4RUV A;  4AKH A;  5FWG A;  3O6T A;  4Z7X A;  1GNE A;  1H4O A;  3TOU A;  2X8C A;  2X8H A;  2H19 A;  1MTC A;  5IMF A;  1SD8 A;  1S3D A;  5E59 A;  4IQA A;  1SVM A;  1XWK A;  2C3T A;  5DVB A;  2AYT A;  1NW2 A;  2H8L A;  1WE0 A;  2GT5 A;  5F07 A;  4PQ1 A;  4K5S A;  1DSB A;  1Z7P A;  2LQQ A;  1LBK A;  4G0L A;  1OVN A;  3IK9 A;  2LNS A;  4HU7 A;  1F6M C;  1GL8 A;  5ECQ B;  2NTO A;  1BG1 A;  2WRT A;  4NPB A;  2ES7 A;  1YF1 A;  2BJX A;  4NWY A;  4EVM A;  3P7X A;  3FZ5 A;  1WPI A;  2VOC A;  3DEX A;  1XZO A;  4KDX A;  2R37 A;  3UJ1 A;  1A2M A;  4G01 A;  1K0M A;  2H6Y A;  4ZXG A;  4ICY A;  5J47 A;  1EOG A;  3TKS E;  5ID2 B;  3HA9 A;  3ZFB A;  1SYR A;  1EEJ A;  1Y6E A;  4EDZ A;  4YQV A;  4IHU A;  2C4J A;  3UAR A;  2M46 A;  3D22 A;  4ECJ A;  3LYP A;  2GQL A;  1F2E A;  4J57 E;  1O7U A;  4IS0 A;  3J7Y k;  2CVB A;  4MJC A;  1YJ6 A;  4ML1 A;  1GH2 A;  5G1K A;  4WR4 A;  3CSH A;  3ZMK A;  3ZRE A;  1HNC A;  4ZL7 A;  5IPH A;  2L59 A;  1TXU A;  1TW9 A;  3TB2 A;  4JRR A;  1K3Y A;  1THX A;  4IVF A;  1ZZY A;  1A24 A;  1FOV A;  1ILO A;  1FW1 A;  2JL4 A;  2K9F A;  1SJZ A;  3CXG A;  1I5G A;  5A1N A;  4L8E A;  4AGS A;  1OC9 B;  3F4S A;  3M9K A;  2LV3 A;  1M99 A;  5ECI B;  1EV9 A;  2X4A A;  1QUW A;  5IO2 A;  5J4V A;  1AQW A;  4EUY A;  2OBK A;  1PD2 1;  4L5O A;  4WF4 A;  2KP1 A;  3ZTL A;  4D73 A;  2P5R A;  3QD9 A;  4K0G A;  3H93 A;  3FR9 A;  5CP1 A;  3Q18 A;  3GTU B;  3DGQ A;  3F3Q A;  1K0B A;  4TOP A;  1O73 A;  1I9D A;  1EV4 A;  5H5R A;  2AJQ B;  2H66 A;  2CZ3 A;  1VRS D;  1SL2 B;  5IMZ A;  1AUC A;  3QFA C;  3LXZ A;  3L9V A;  5HFG A;  2H71 A;  5CRW A;  1KBN A;  3IPZ A;  4IJ3 A;  8GSS A;  1QK8 A;  22GS A;  2H1G A;  5DAL B;  1GUK A;  2KOK A;  3ZZX A;  1BF5 A;  3LOR A;  2EFD A;  3QPM A;  3VUR A;  5LD0 A;  2QGV A;  4KSO A;  4HEA 2;  4OCE A;  4HOJ A;  3QAG A;  3A2W A;  3CMI A;  4NAX A;  3IDV A;  1SKS B;  2ZNM A;  3GV1 A;  2O85 A;  1V9W A;  1AAZ A;  2GLR A;  2R4V A;  4Q5N A;  2L4C A;  4ZB7 A;  1M2B A;  3RDW A;  5J5N A;  2XBQ A;  2EC4 A;  4TW5 A;  1OC8 A;  1M9B A;  2VKZ G;  3I6A A;  1GSY A;  1M9A A;  4MAB A;  3BBY A;  5CRD A;  1KNG A;  4E68 A;  3HJO A;  3QR6 A;  2HNL A;  2L5L A;  4G10 A;  3KM6 A;  3D4T A;  2OJL A;  5DCH A;  4IEL A;  5G1L A;  4O7H A;  3IAM 2;  2H0I A;  5IIZ A;  1F9M A;  4MZW A;  2B7K A;  4KSM A;  5J3R A;  3NIV A;  4IP1 A;  4I8B A;  4N11 A;  4G2E A;  4BVY A;  4XS6 A;  3US3 A;  2IME A;  3HMJ G;  3IAS 2;  4ISD A;  2EIQ A;  2G0F A;  4ID0 A;  1TXX A;  2DMM A;  2ALB A;  1SL0 B;  2VLT A;  3GNJ A;  4PXO A;  4KAE A;  1XWA A;  3FYG A;  3FR3 A;  2G2Q A;  3ZIJ A;  3DRN A;  4F03 A;  2GSQ A;  2CV4 A;  2PMT A;  5KN2 A;  4MJA A;  2AB6 A;  2C0G A;  3H79 A;  2EFC A;  1XIY A;  2AHE A;  1RQM A;  3A5W A;  5IMD A;  4PNG A;  5G5E A;  1MD3 A;  5IQY A;  3I9V 2;  2IJY A;  1XXU A;  1ABA A;  2V6K A;  2YWI A;  5A5H B;  3EMP A;  3UL3 A;  4OFT A;  2B1K A;  5EPF A;  3GX0 A;  2QA1 A;  4XRD A;  5G2Z A;  3D0Z A;  4JBB A;  3UVT A;  5HR1 A;  2QSI A;  3IHQ A;  1QQ2 A;  4AJ8 A;  2H72 A;  3EU3 A;  1AIU A;  1XW5 A;  1TK5 B;  3IC4 A;  5GAP D;  3VI5 A;  2KUC A;  3IXR A;  3PIN A;  2R0P A;  5D96 A;  2F8F A;  3GH9 A;  4Q5F A;  3I43 A;  3O76 A;  4EIP A;  3IBH A;  1OE8 A;  1B9Y C;  1T7P B;  2VD1 A;  1XCC A;  1SK0 A;  6GSX A;  3E9J B;  5A34 B;  2AV4 A;  3R2Q A;  3M8N A;  2H1D A;  4Z2R A;  5HFI A;  3WGD A;  2K8S A;  4QL9 A;  4GLT A;  1F3B A;  4EC0 A;  5IMC A;  4MDC A;  3L78 A;  1A8Y A;  3CTF A;  1K3L A;  2N5A A;  1JFU A;  1ZGN A;  1U3A A;  5BMU B;  2TRC P;  4GSN A;  3IV4 A;  4PUF C;  2FA8 A;  4YKG A;  4ZIL A;  3GHA A;  4BVX A;  4MH2 A;  1WJK A;  4IQ1 A;  3L9U A;  5G31 A;  5A4W A;  3W8S A;  4IKH A;  3IOS A;  1TK0 B;  3KMO A;  2X99 A;  1SU9 A;  3UVH A;  2F9S A;  3PGT A;  3GA4 A;  3QAW A;  4Z2T A;  2HZE B;  1T3B A;  4TVE A;  4O5Q A;  1Z7R A;  4DSQ A;  4PX1 A;  2DIZ A;  4LL4 B;  6GSU A;  3ZIV A;  1ZYP A;  2PU9 C;  1M7T A;  1V58 A;  4IGJ A;  1NHY A;  4ZBB A;  1ON4 A;  4Q5Q A;  4MPF A;  3TU3 B;  4XS1 A;  4GQC A;  1XWC A;  4IN0 A;  3TJK A;  3MWH A;  3G7J A;  3R3E A;  5D73 A;  1T00 A;  2KLX A;  5DAK B;  3ME7 A;  2I1U A;  4XS4 B;  2REM A;  1SVO A;  2IIY A;  4KW6 A;  5D93 A;  5BRT A;  1X5C A;  3KGK A;  3GMF A;  2B6M A;  1QGV A;  3TRQ A;  3GX8 A;  5J40 A;  1WIK A;  1N25 A;  4N30 A;  4OMV A;  4TRX A;  2B1L A;  1CQG A;  4BL7 B;  3LXT A;  1ZOF A;  5KOX A;  1O8X A;  1TTZ A;  2E0Q A;  4EIQ A;  3LGC A;  2AAW A;  3C71 A;  5H5Q A;  2A2S A;  1J9B A;  2MBT A;  1PN0 A;  4XIH A;  3E0U A;  4L0U A;  5F8B A;  5JCU A;  2HRF A;  1ZMA A;  3I69 A;  3KH7 A;  2WGR A;  1GLQ A;  2V41 A;  1AW9 A;  4POB A;  4MK3 A;  1ERV A;  3C7M A;  3TKR A;  3GUS A;  2WS2 A;  4Z2U A;  1SD9 A;  3EE2 A;  4I6X A;  3KD0 A;  2IMD A;  4TR0 A;  4DEJ A;  2XHF A;  1GLP A;  3TRP A;  5IOX A;  4I2T A;  2IMF A;  1SEN A;  1X5D A;  7GSS A;  4DSS A;  2CVD A;  1Z9H A;  1MDJ A;  1DE1 A;  2O89 A;  2GVP A;  3NZN A;  3FY7 A;  3HHV A;  3LFL A;  5D9W A;  4EL1 A;  9GSS A;  2IFQ B;  5DDL A;  3CYN A;  4FYB A;  5ECR B;  4WKW A;  2O87 A;  4QMK A;  1VF1 A;  2IMI A;  1MD4 A;  5GSS A;  3AY8 A;  2JSY A;  3ME8 A;  1FAA A;  10GS A;  1K0O A;  3G9B A;  3CBU A;  4ECC A;  1TDI A;  1RW1 A;  1GUH A;  1Z6M A;  4XRA A;  1THO A;  1IYH A;  3ERW A;  1G7E A;  3HKR A;  1AC1 A;  2YWM A;  1U88 A;  2BTO T;  3N9J A;  1QFN A;  1TOF A;  3KCM A;  1A0R P;  6GSW A;  1T4Y A;  4OO5 A;  3E3E A;  4L0W A;  3A2V A;  2CVK A;  4QQ7 A;  4FO5 A;  2HRK A;  3ZLP A;  2VUP A;  4I97 A;  3ZIT A;  3TRX A;  13GS A;  3RBT A;  1PRX A;  4KB3 A;  3F9U A;  3FR6 A;  2FY6 A;  5B6N A;  4EXJ A;  3VK9 A;  2VCZ A;  1T8E B;  1QMV A;  2GST A;  4Q5R A;  1V98 A;  3NOF A;  3FHK A;  3LW9 A;  4G0I A;  3ZVJ D;  1W89 A;  3KMN A;  3DKS A;  3WYW A;  2VIM A;  1VGL A;  4J56 E;  5AIX A;  2F8A A;  1UN2 A;  3DXB A;  2B5Y A;  4WBJ A;  2NBS A;  2OE1 A;  14GS A;  1JHB A;  4L5L A;  5HR2 A;  4ZIJ A;  3L4N A;  4ILF A;  2CAI A;  3Q74 A;  2DML A;  2QA2 A;  1FG4 A;  5J9B A;  3VWX A;  5HR3 A;  2E7P A;  2MMA A;  3MSZ A;  2C0E A;  4MA9 A;  1WP0 A;  1PKZ A;  1LJR A;  2MBS A;  3GL5 A;  1YKA A;  4KDY A;  3DD3 A;  3KP8 A;  1SK2 A;  2GT6 A;  5G5F A;  2VCV A;  1ML6 A;  2R6K A;  2XC2 A;  1OKD A;  3SBC A;  2M72 A;  5D8I A;  4TXO A;  3KP9 A;  1F3A A;  3WT1 A;  4POL A;  5AIV A;  1G7O A;  3APQ A;  19GS A;  4G0K A;  3ERG A;  4GQF A;  3GUR A;  3TKP A;  1K0C A;  2GZZ A;  2RUF A;  4X0X A;  1G6W A;  3WT2 A;  1XPV A;  3BOA A;  4TR1 B;  4WF5 A;  2HSN A;  2RLI A;  1V2A A;  2CX4 A;  2GSR A;  1WMJ A;  2R0C A;  4N3Z A;  3K8N A;  1U3I A;  2IMK A;  3EVI A;  3N5O A;  3C73 A;  1SJ6 A;  2JZT A;  4BWQ A;  1EEM A;  3ZL5 A;  3IR4 A;  2EIO A;  1C72 A;  2KHP A;  2MMZ A;  2ZCT A;  1URM A;  5IOW A;  4K6X A;  1HNB A;  1JZD A;  3CRT A;  4MJB A;  3QMX A;  17GS A;  1B4P A;  1X9M B;  4MF7 A;  2H76 A;  4KF9 A;  4V2N A;  4ZBA A;  1ERT A;  3ED3 A;  3EWL A;  3P8W A;  1AQX A;  4QL7 A;  5CRE A;  1YZX A;  4F0C A;  4CDO A;  5GZZ B;  3TKS A;  1O8W A;  1M2A A;  4ZB8 A;  3ZML A;  1FVJ A;  2GQK A;  4CY6 A;  1GSD A;  3ERF A;  4PUR A;  2C0F A;  4LLR A;  1KEB A;  4K7O A;  2IWT A;  3DML A;  2I3Y A;  3Q6O A;  2YP6 A;  2PGT A;  3M0F A;  2YJ7 A;  5E4W A;  4K2X A;  1SYX A;  2GDR A;  5KEJ A;  3EMX A;  1CQH A;  5AN1 A;  5HQP A;  1PX6 A;  3DIE A;  3TCO A;  2ON5 A;  2PVO C;  3GRX A;  3F6F A;  1R5P A;  3UOM A;  4ZL8 A;  1SKW B;  3ZFL A;  2FWH A;  4CY8 A;  5ECM B;  3TJF A;  3J7Y b;  3EPT A;  2YWO A;  1U6T A;  1PL2 A;  4AKX B;  3KZQ A;  3UBL A;  1RK4 A;  2H73 A;  3HVV A;  2A2P A;  3WGX A;  1MDI A;  1QXH A;  5B7C A;  5EVO A;  2JAC A;  2JSZ A;  3HDC A;  3FK8 A;  5A4V A;  1PN9 A;  1SKR B;  4XHM A;  4ML6 A;  3F8U A;  4KCA A;  4GST A;  1S3A A;  2HSM A;  2DBC A;  5F05 A;  1U87 A;  1BAY A;  2L6C A;  3FRC A;  4XCS A;  2OAC A;  3CSJ A;  2GS3 A;  1WOU A;  1Q98 A;  3LG6 A;  2O7K A;  1K3O A;  1SVL A;  1VF3 A;  4E8E A;  3H1N A;  3HY2 A;  5DJL A;  5H5S A;  3VWW A;  3D5J A;  1EOH A;  3LWA A;  1A8L A;  3IRA A;  5AGY A;  3BD2 A;  4KH7 A;  1GSF A;  2LTK A;  3MYD A;  4NV5 A;  6GST A;  4MP4 A;  1PGT A;  3GSS A;  1OKT A;  5JWR B;  2GTU A;  4NXI A;  2MYG A;  2A2R A;  4EDY A;  1O6J A;  2YNX A;  2MMO A;  3QFB C;  4X4J A;  2WJU A;  2YV9 A;  2DKH A;  3EYT A;  2DJK A;  1MEK A;  5D9T A;  1SJI A;  2H0G A;  5LNK e;  5DCG A;  2MMN A;  1FHE A;  3G7I A;  4K0N A;  5A1N B;  2FUG 2;  4AJ7 A;  3GST A;  3WGE A;  4AKI A;  3RPP A;  2F3M A;  4HQS A;  1B8X A;  2GQM A;  2CX3 A;  4MCU A;  1K0A A;  2LRT A;  3SWL A;  4HJM A;  4CHS A;  1YEP A;  2P31 A;  5ID2 A;  4JZQ A;  4ECB A;  3M3M A;  1JZO A;  2DJ0 A;  2Z9S A;  1O85 A;  1GTB A;  2VM2 A;  4GTU A;  4D73 B;  2CA8 A;  2WDU A;  1GUL A;  4POM A;  4GXZ A;  4ACS A;  2CZ2 A;  11GS A;  2XPD A;  1EP7 A;  3PPU A;  1PKW A;  1GTA A;  3L0H A;  4N10 A;  4P3Y B;  4K2D A;  2HQT A;  4FYU A;  2FWG A;  2O8V B;  3HJM A;  2EIR A;  2E2G A;  3ISO A;  3BCI A;  2X49 A;  2DC5 A;  2PVQ A;  2M80 A;  4FQU A;  2JZS A;  2E2M A;  1OC9 A;  2CAQ A;  5CO3 A;  5D9X A;  4GF0 A;  2WZ9 A;  4YAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...