3F6FA

Crystal structure of glutathione transferase dmgstd10 from drosophila melanogaster
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGWEENWAGCQEFRKYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CG18548-PA (IP02196p) (IP02193p)
publication title Structural evidence for conformational changes of Delta class glutathione transferases after ligand binding
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 81
structure length 209
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3f6fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f6fA01
2KP2A 1UVZA 2HNLA 5B8AA 3KH9A 2P5RA 1V57A 5IMFA 4ECJA 4G0IA 1KTEA 4EDZA 1K0MA 1X5DA 4F0BA 3KH7A 4ZBBA 1U87A 2VCTA 4POMA 4K7OA 3TOUA 2XPEA 5H5SA 4ECBA 1RW1A 3US3A 5D96A 4FIWA 3TB2A 3H8QA 3P90A 4LMVA 1IYIA 3VPQA 3VFIA 4MCUA 5J9BA 2FA4A 1PX6A 3PPUA 3CTGA 3F4RA 3IBHA 3IK7A 1GTIA 2OE0A 2QKEA 5ECQB 2V6KA 1GSSA 4MF6A 4G0LA 2O85A 5F07A 2NPBA 1TXXA 1X9WB 2FCHA 2JADA 4MA9A 3GX0A 3IE3A 2V41A 4EVMA 1FW1A 1B4QA 1SD8A 3RHCA 2R4VA 4KUNA 2HRKA 4USSA 2C0GA 4IHUA 2MMNA 1M2DA 3EVIA 4KDYA 1EGRA 3GX8A 3L9UA 2M72A 1OAZA 1GUKA 1BQ7A 2HRAA 3FHKA 3GYKA 2H0IA 3GURA 2RIIA 2GSQA 3UMAA 3FR3A 3KXOA 4XTSA 3M0FA 1PL2A 3HKRA 2WRTA 2FGXA 3QR6A 1V9WA 4ZXGA 5IMDA 3GNJA 2JACA 1ML6A 3KCMA 1EP8A 2NVLA 1A0RP 1PQNA 2HYXA 3LEFA 1QUWA 1Z6MA 3EMPA 4IP1A 1MDJA 2YV7A 4O32A 3GKMA 1SL2B 2HI7A 3VWVA 2DBCA 3E3EA 3I9V2 3GKXA 1VF1A 1GTBA 2L4CA 2C0FA 1BAYA 4N10A 3ZIJA 3GL3A 1T1VA 4Q5QA 4GQCA 3D6IA 4AJ6A 5CO3A 4RQXA 13GSA 3C73A 2WGRA 4GWRA 2YV9A 2K18A 5D9TA 3QCPA 4ZBDA 3KD0A 1A8LA 4OCFA 3DEXA 4ZB9A 5ID2B 1ERVA 1QQ2A 4HQZA 3RBTA 3F0IA 3IAM2 4BL7B 3H4KA 2WS2A 4OO5A 3EWLA 3VK9A 3HVXA 3ERWA 12GSA 1A2LA 1X5CA 2C4JA 3HVSA 3L9VA 4K1FA 1YKAA 2YWMA 2FWGA 3KGKA 3G7IA 4NHZA 4XS6A 4J56E 1DE2A 2HT9A 2X8CA 3H93A 2HXKA 2VLTA 2C3NA 4HU7A 1K0DA 3FZ5A 1OE7A 3TKSC 3GN3A 1OKTA 2GLRA 5G31A 3IR4A 2B6MA 4MZCA 3HYPA 4XS4B 1EEMA 5DAKA 4K0GA 2HZFA 1N2AA 4L5OA 3KTBA 4PUFC 2VM1A 5AISA 1ERTA 2KP1A 3GIXA 5H5RA 1NHYA 4KAEA 1K0CA 1TK8B 1TK0B 2B5XA 1ZYQB 2B7JA 3C1SA 4MF7A 2LRNA 5CREA 3ZZXA 1IYHA 3ISOA 2EIRA 3EINA 3FRCA 3TDGA 4Z7XA 4WBJA 4I8BA 2OBIA 4ILFA 5DALB 3UIWA 5CAXA 2YZHA 4AJ8A 4OFNA 2LJRA 2K8SA 3APOA 2VL2C 3KIJA 2LRTA 2I9HA 4QL9A 2IIYA 3MWHA 5J3RA 4ML6A 4GCIA 1YJ6A 2VAFA 4KX4A 4ZIJA 4F2IA 2B3SA 3FZAA 4L5LA 4FO5A 2IN3A 3TCOA 4GRFA 4POBA 2QGVA 3DVWA 2ALBA 2CAIA 3IC4A 2C1YA 3EMXA 4KE3A 5HQPA 5JWRB 3TJFA 4HJMA 4ZBAA 1XVWA 4BA7A 3A2WA 2EIOA 3JCML 1WRYA 6GSYA 1NSWA 1T4ZA 2IFQB 1S3AA 5DQYA 1EP7A 3TKSA 1THXA 2CQ9A 2TIRA 5C00A 3CRTA 1R5AA 3HA9A 1M2AA 3S9FA 2MZCA 3TGZA 4TR0A 5KEJA 4K7IA 3TJJA 4MJEA 1PSQA 1AIUA 4PQIA 1A8YA 4IJIA 1NM3A 4MABA 3RPPA 4N30A 3A2VA 5IMVA 4G9HA 3GH9A 2OACA 3CXGA 4DSQA 3QMXA 4JU5A 1XW6A 20GSA 1GLPA 1Z7PA 3GFKA 2H70A 4EO3A 2P0GA 3EU4A 2LJKA 3RDWA 4YAVA 4ECCA 1ILOA 3WGXA 3TUEA 4YQVA 5GSSA 2M46A 1G6YA 4NWYA 2VCVA 3HY2A 2JZTA 1XWKA 1F9MA 2VL2A 1VF3A 3ZYWA 3ZTLA 5IMAA 5G1KA 3D22A 3GTUB 5CRDA 2H0GA 1WIKA 1RQMA 3NOFA 3D21A 5LD0A 4MZBA 3VURA 1T8EB 2R3XA 5ELGA 2ZCTA 3W8JA 5CP1A 2HSMB 5DVBA 4DSSB 2YNXA 3WYWA 2DJ3A 5KN2A 3IOSA 4BPYA 3HZ4A 2AV4A 3DYRA 2P31A 4TXOB 5IM9A 3F63A 5A4UA 1WE0A 4P3YB 5LCZA 5B6NA 2HSYA 1GLQA 4Q5RA 4F82A 1V40A 14GSA 1LJRA 3QAVA 2F9SA 3APSA 3GKKA 2Z9SA 4RUVA 3UVHA 4TR1A 4Q5FA 2A2SA 4I2TA 3GV1A 4RI7A 2VL3A 2GT6A 1T3BA 1HNCA 5IO0A 2IMFA 5ABRA 5D73A 3BCKA 1LU4A 1OC9A 3O76A 1GSFA 1ZGNA 2XBQA 4WF5A 2IWTA 4EL1A 2OE1A 4J57E 3GH6A 3E9JB 3CSJA 5G30A 1Y25A 5INYA 2V32A 4YAPA 3MSZA 1U3AA 1Z3EA 4I2UA 1EEJA 1E2YA 5HR0A 1OKDA 3DGQA 3RAZA 4WXTA 3C7MA 5F0GA 5JCGA 5DBQA 5A4VA 1PN9A 5AN1A 18GSA 5D9VA 5GAPD 1RK4A 3DVXA 2C3QA 4WR4A 2GQMA 2IL3A 4KW6A 4MJAA 3W8SA 2GZYA 2KHPA 4AGSA 1GP1A 2J9HA 3G7YA 3HXSA 4IBPA 1MDKA 4FH8A 2GZZA 5D8IA 4JE1A 1BYEA 2GQKA 4JR6A 1GSUA 3L78A 3WT2A 3J7Yk 5DJMA 1XOBA 1YF1A 3DXBA 4TRXA 4GLTA 2DJKA 2L57A 1XW5A 1OYJA 4ZB8A 2C3TA 2VLUA 1HYUA 1SJZA 1X9SB 5ECNB 3GA4A 4G19A 2H0HA 2FUG2 4ML1A 2YOIA 4ISDA 3IK9A 1EZKA 1U3IA 2NDOA 4MJCA 5GZZB 4KDUA 1C72A 1YY7A 2WJUA 1F6MC 3HJMA 2PERA 4OFMA 3LGCA 4MH3A 4TVEA 1K0OA 2YN1A 10GSA 3KTLA 1TP9A 3TJKA 4ZILA 2WB9A 4WKWA 1DUGA 2MBSA 1UA5A 1TRVA 4IQAA 4O92A 1J08A 4GF0A 2CX4A 1ZMAA 3VWUA 1JZRA 4KCAA 4QQ7A 3Q19A 2DJ0A 4F0CA 5EL8A 3ZMKA 2LKUA 1I5GA 3UBLA 2CVBA 2H19A 4HQSA 3ZREA 5JCUA 1YF0A 5IOXA 4EC0A 4F03A 2LNSA 2GVPA 3KM6A 2IMKA 3FY7A 2JSZA 1TI1A 3LG6A 3A2XA 4KA0A 1SL1B 2WCIA 4ACSA 4TW5A 2H1GA 4X1UA 1TRUA 2HRNA 3I43A 2WULA 1WP0A 1O7UA 3M9JA 2AUVA 5HR3A 2A2RA 3UBKA 4FYUA 3L4NA 1KEBA 3EE2A 1PRXA 16GSA 3AY8A 4BVXB 5IOWA 1XPVA 5E59A 3DMLA 5GAND 2TRXA 1AW9A 3ZIVA 4MLYA 1XFLA 2C0DA 3L9SA 4WETA 2IMEA 5G5EA 1BG5A 3VI5A 3GKNA 2FA8A 3IRAA 5ID2A 5IMZA 1WMJA 1W4VA 1XBSA 4BL7A 5DQSA 4K6XA 2B1LA 2KLXA 4MP4A 2CT6A 2R37A 2I4AA 1A23A 4TKYA 4MDCA 2CVDA 4HEA2 3FEUA 4PNGA 1WPIA 4LLRA 2QSIA 1TOFA 4LA1A 5ENUA 3N9JA 2O89A 4YQMA 3GUSA 5CYYA 3SBCA 5A5KA 1VRSD 4XS1A 4BWSA 1UC7A 3GL5A 5G2ZA 1R5PA 4GSTA 2YP6A 3KP9A 4D73B 4XS4A 4ECIA 1O8WA 1GSQA 1SK1A 3UOMA 2B1KA 3LSZA 2RM6A 1S3CA 5DCGA 5D9XA 3E0UA 1EGOA 1V98A 1A0FA 2JL4A 1Z9HA 2AYTA 1FAAA 1JLVA 1BX9A 3F8UA 3PINA 4FYBA 4ZL7A 2PU9C 2L5LA 4KGIA 4POLA 5HFGA 3ZVJD 2GTUA 4HZ2A 2QC7A 3HCZA 4OMVA 5DALA 3P8WA 2DIZA 2IMDA 2WFCA 4X43A 1J0FA 4OD7A 3M8NA 4CHSA 4MPFA 2E2GA 3QDNA 2L4QA 3ZFLA 1T00A 2PVQA 5AGYA 2P5QA 5BMUA 22GSA 3F3QA 1GSEA 9GSSA 4FQUA 1WWJA 3LORA 2HRFA 1AQVA 2E7PA 3UL3A 2L6CA 2MYGA 3VWWA 4FYCA 3QD9A 3GSSA 4RI6A 3ERFA 4GTUA 3BOAA 4F9ZA 3M9KA 3M3MA 2LUSA 4HU9A 3CRUA 1TDIA 2IFQA 5LNKe 3UAPA 2VCXA 11GSA 19GSA 2VLVA 3FR9A 1ABAA 2BJXA 3GSTA 4PTSA 6GSVA 2A4VA 1Q4JA 3DIEA 2GT5A 3GRXA 4DSRA 4PQHA 2O8VB 2CZ3A 1AQXA 4LMWA 2VIMA 1OC8A 1ERUA 2YJHA 1PKWA 4IJ3A 4EXJA 5ECRB 1GUMA 1USBA 2RUFA 3RPNA 2C8UA 4G2EA 1J9BA 1T4YA 1TU7A 1FOVA 2V6OA 4HS1A 1ZL9A 3HVVA 4IP6A 2FY6A 4BWQA 3ZITA 4K8MA 2ON7A 4L0WA 4OWYA 1YDKA 3CMIA 5F06A 3U5RE 2VD1A 2X99A 2RLIA 4BVYB 1AC1A 4N0ZA 2AAWA 3D0ZA 3OR5A 2GSRA 3I6AA 4K7NA 1X9MB 3MNGA 3QAWA 1XWBA 2YWIA 2JZRA 4XHMA 2PBJA 2IPAA 4KSMA 2GZPA 4IQ1A 3TJBA 4WBRD 2OKAA 3KP8A 3CYNA 3GTUA 1EV9A 3R2QA 2K9FA 4AJ7A 2PWJA 2DJJA 3O6TA 1WJKA 1BEDA 1EOGA 1QK8A 4EUYA 4EF0A 1K3YA 2HSMA 2YWOA 4CW9A 5B8BA 1F3AA 1O8XA 4DSSA 3N5OA 3BBYA 2H6YA 2HZEB 2H6ZA 3U6VA 3H1NA 3HDCA 4HDEA 5EY6A 1XWCA 4TXOA 1ERWA 3DWVA 3A3TA 3DD3A 1GUHA 3FK8A 2FHEA 4G0KA 2H74A 2E2MA 2JU5A 3RHBA 1NHOA 4N11A 4KH7A 2MMAA 1SJIA 5DJLA 4JZQA 2F3MA 4PNFA 1YKCA 2VL9A 1XOAA 4K9ZA 2NBSA 3TKSE 3ZMLA 3O3TA 2AHEA 4V2NA 2YZUA 1R4WA 2GSSA 1GTUA 6GSSA 2DSAA 4IELA 3TKPA 1KNGA 1SK0A 2H8LA 3IC8A 6GSTA 3EC3A 1AXDA 3ME7A 5J41A 5B7CA 3C71A 1N8JA 4GQFA 1K3LA 2PGTA 3WGEA 1YEXA 1GH2A 1MDIA 2EIQA 1URMA 1PMTA 2N5AA 4PGTA 4PQ1A 5EPFA 5J4UA 4MZWA 2OJLA 2RUEA 4MK3A 2EC4A 3IXRA 2O87A 5J9CA 3WGDA 5ECIB 1B9YC 1AQWA 4XCSA 3WD6A 1XZOA 3BD2A 4QL7A 2FLSA 5HR2A 4X0XA 2WDUA 3G9BA 2X8HA 1A24A 3F4TA 3WT1A 3LJRA 1SL0B 5A4WA 5HFIA 3ZFBA 4NAXA 1SU9A 2TRCP 1W89A 1F2EA 1S3DA 2YWNA 1FO5A 1G7OA 1JLWA 3NZNA 1XXUA 3V1WA 3L0HA 5ECOB 4MPGA 2H71A 2VD0A 2HE3A 3HZ8A 3J7Yb 5CNWA 3LYKA 4N0VA 3IV4A 4JR4A 3DKSA 3C8EA 5H5QA 3LFLA 1EV4A 4YQUA 2LQOA 2J23A 3F3RA 5IQYA 1M0UA 4IKHA 2GSTA 1K0BA 4KNDA 1E6BA 2X8GA 2X64A 4KSOA 1QGVA 1GWCA 1AUCA 1MEKA 1ZYEA 2DMMA 1HD2A 1QXHA 5IPGA 5B6MA 2LEGA 2AJQB 2HLSA 3IAS2 4ZL9A 1YQ1A 2DIYA 3R3EA 4NV5A 3EURA 3F6FA 6GSUA 2YPMA 4KB3A 1R7HA 1VF2A 5FT3A 1ST9A 2JZSA 2PUKC 4LL1B 1A2JA 1TRSA 5ECMB 2LV3A 2RM5A 3TRXA 2VM2A 4TR4A 1U88A 3LXTA 6GSXA 1THOA 1MD3A 1XWGA 3PR8A 1SYXA 1CQHA 3H79A 2PN8A 2F8AA 1FVJA 3UARA 2H72A 2M80A 3TRPA 2OA7A 1K3OA 5JWQB 4OO4A 2CX3A 4BVXA 1TK5B 3D5JA 1GSYA 3G7JA 3KJYA 1YEPA 2GQLA 3UJ1A 2XPDA 1PGTA 2L5OA 1JZWA 5IO2A 5JCWA 2I1UA 1FG4A 1M7TA 2FWEA 1EWXA 1O85A 2YANA 2HRKB 1PL1A 5D9WA 2UZ8A 2V2GA 4PXOA 1M9BA 5JWOB 2H75A 3HJOA 4EE0A 3FW2A 5ECKB 4WF4A 2OADA 1T7PB 1SENA 2CA8A 3UEMA 4NHWA 3LYPA 4H86A 2MMOA 2XBIA 4XRDA 4KCEA 2DMLA 1XVQA 1HNBA 4IGJA 1TRWA 1HNAA 2H1AA 1ACVA 3HJPA 1M99A 4PURA 1NW2A 4IS0A 5D93A 1Z7RA 1JHBA 3Q6OA 2LSTA 2PPTA 4E8EA 2R5GA 3QFAC 1SKWB 1TW9A 4D73A 5F8BA 2GS3A 3MDKA 1UN2A 1GNWA 5L71A 2G2QA 3QAGA 3CSIA 3FYGA 3KEBA 4MJBA 2VUPA 1I9DA 1QMVA 1ZZYA 3Q74A 3KZQA 2FWHA 3TRQA 2DC5A 5KN1A 2B7KA 2XC2A 2YCDA 5ELAA 3QFBC 5KN3A 1O6JA 1FVKA 3FZ9A 2PMTA 3LWAA 2VOCA 3ED3A 3C1RA 2C80A 5GSTA 1G6WA 4ULXA 2ZNMA 4TOPA 3CTFA 1Z5YE 2HSHA 3TKRA 2V1MA 1VGLA 3LXZA 4O7HA 1V2AA 1TTZA 1GULA 1TJDA 2FWFA 3CSHA 4HOJA 2H76A 4EKZA 1LBKA 3HHVA 1ON4A 4MMMA 3FR6A 4V2MA 4G10A 3KMOA 1KBNA 1Q98A 3FKFA 5HFKA 1SKRB 2YJ7A 3K8NA 5ECPB 2G0FA 2MBTA 2K6VA 3EYTA 2D2ZA 5HR1A 4TN8A 1Y6EA 4JRRA 2ZUPA 2LNTA 2GGTA 4XIHA 1XIYA 1ZOFA 3BCIA 3D4TA 2H30A 5DAKB 1XCCA 2L6DA 3IHQA 4MH2A 4TXVA 5CRGA 4WEYA 3TOTA 1SK2A 3SWLA 3GMFA 4IN0A 2HSNB 3NIVA 2ON5A 3CBUA 6GSWA 5C04A 3UVTA 1B9XC 1PA3A 3IDVA 4V1Ap 3F4SA 1SYRA 1H4OA 2B5YA 4J2FA 5IPHA 1O81A 4IVFA 2JSYA 2N5FA 5CRHA 4TR3A 3ZLPA 1G0TA 3ZRDA 4RQRA 1X5EA 2F51A 4IW9A 3F9UA 2L59A 4NPBA 3GHAA 2VCWA 2CAQA 3LQ7A 4ID0A 3P2AA 2CV4A 2IMIA 2F8FA 4HZ4A 2IJYA 4DVCA 2O7KA 3ZVJA 2R6KA 1F37A 1DBYA 4V2LA 2FNOA 4BVYA 1YZXA 4O5RA 4KF9A 5J5NA 1TI3A 2BTOT 1QFNA 2K8VA 1WOUA 1X0RA 4K2DA 4WR5A 1R26A 4NMUA 3PGTA 2REMA 1JZOA 4L8EA 2HFDA 1Z6NA 2BMXA 4PX1A 3IPZA 4YH2A 3TKQA 5IIZA 2B5EA 1GL8A 8GSSA 3FZ4A 4I5QA 2XHFA 2H1BA 2HZEA 1B48A 1EOHA 3QPMA 1OC3A 2H66A 5AIVA 4PUAA 1DSBA 1M2BA 4AF2A 2VCQA 2H6XA 2CVKA 3W6GA 5FWGA 5G5FA 1SJ6A 3P7XA 2H01A 2OE3A 2ES7A 1XWAA 3VI7A 1CQGA 3A5WA 1ZCPA 1U6TA 1AAZA 4JBBA 5ECSA 2LQQA 4POKA 4I6XA 3QOUA 4HJ2A 2VCZA 1DE1A 2CZ2A 3DRNA 3I69A 2GDRA 3MAKA 2LTKA 4XRAA 1G7EA 2C0EA 4NXIA 1A2MA 17GSA 4CDOA 5IMCA 1SKSB 3IA1A 3ERGA 4DEJA 3EU3A 3D4MA 2H1DA 4KDXA 2DJ2A 1PD21 2FD3A 2I81A 2N5BA 1M9AA 1F3BA 5FHIA 1FHEA 1SD9A 1GSDA 1TU8A 7GSSA 2PVOC 3ME8A 5DDLA 5F05A 4GXZA 4HI7A 2KUCA 2R2JA 4I97A 2DJ1A 2WZ9A 3ZL5A 1XW9A 5EVOA 4ZL8A 5ECHB 4K0NA 4JEDA 4EDYA 1H75A 5E4WA 4Q5NA 3BJ5A 5CRWA 1K0NA 1JZDA 3KMNA 3HD5A 1PX7A 1OVNA 5DCHA 3M1GA 4TR1B 2I3YA 1JFUA 2LRCA 3F6DA 1TKDB 1MTCA 2DLXA 2MMZA 3VLNA 4GSNA 1HQOA 4V1Ag 4ZB6A 4OFTA 1GNEA 3TJGA 1OC9B 3Q18A 4HUAA 2E0QA 1PKZA 2OBKA 3VWXA 2LJAA 4LL4B 5AIXA 1B8XA 1MD4A 3VPTA 4NV2A 4MF5A 5G1LA 1GRXA 4GSSA 5COHA 5KN0A 1FB6A 1O73A 1OE8A 2HQTA 5ECLB 1K0AA 1VF4A 2KOKA 1GTAA 3APQA 4L0UA 2NTOA 2VO4A 4E8HA 1BJXA 2AB6A 2LS5A 1B4PA 1V58A 4OCEA 1FB0A 3PH9A 2H73A
chains in the Genus database with same CATH superfamily
2KP2A 1UVZA 2HNLA 3LW9A 5B8AA 3KH9A 2P5RA 1V57A 5IMFA 4ECJA 4G0IA 1KTEA 4EDZA 1K0MA 1X5DA 4F0BA 4EIQA 3KH7A 4ZBBA 1U87A 5J40A 2VCTA 4POMA 4K7OA 3TOUA 2XPEA 5H5SA 4ECBA 1RW1A 3US3A 5D96A 4FIWA 3TB2A 3H8QA 3P90A 2WW3A 4LMVA 1IYIA 3VPQA 3VFIA 4MCUA 2OT3A 5J9BA 2FA4A 1PX6A 3PPUA 3CTGA 1SVOA 3F4RA 3IBHA 3IK7A 1GTIA 4Z2TA 2OE0A 2QKEA 5ECQB 2V6KA 1GSSA 4MF6A 4G0LA 2O85A 5F07A 2NPBA 1TXXA 1X9WB 2FCHA 2JADA 4MA9A 3GX0A 3RGBC 3IE3A 2V41A 4EVMA 1FW1A 1B4QA 1SD8A 3RHCA 5BRTA 2R4VA 4KUNA 2HRKA 2WW0A 4USSA 2C0GA 4IHUA 2MMNA 1M2DA 3EVIA 4KDYA 1EGRA 3GX8A 3L9UA 2M72A 1OAZA 1GUKA 1BQ7A 2HRAA 3FHKA 3GYKA 4AI6A 2H0IA 3GURA 2RIIA 2GSQA 3UMAA 3FR3A 3KXOA 4XTSA 3M0FA 1PL2A 3HKRA 1ZYPA 2WRTA 2FGXA 3QR6A 1V9WA 4ZXGA 5IMDA 3GNJA 2JACA 1ML6A 3KCMA 1EP8A 2NVLA 1A0RP 1PQNA 2HYXA 3LEFA 1QUWA 1Z6MA 3EMPA 4IP1A 1MDJA 2YV7A 4O32A 3GKMA 4K5SA 1SL2B 2HI7A 3VWVA 2DBCA 3E3EA 3I9V2 3GKXA 1VF1A 1GTBA 2L4CA 2C0FA 1BAYA 4N10A 3ZIJA 3GL3A 1T1VA 4Q5QA 4GQCA 3D6IA 4AJ6A 5CO3A 4RQXA 13GSA 3C73A 2WGRA 4AKGA 4GWRA 2YV9A 2K18A 5D9TA 3QCPA 4ZBDA 3KD0A 1A8LA 4OCFA 3DEXA 4ZB9A 5ID2B 1ERVA 1QQ2A 4HQZA 3RBTA 3F0IA 3IAM2 4BL7B 3H4KA 2WS2A 4OO5A 3EWLA 3VK9A 3HVXA 3ERWA 12GSA 1A2LA 1X5CA 4O5UA 2C4JA 3HVSA 3L9VA 4K1FA 1YKAA 2YWMA 2FWGA 3KGKA 3G7IA 4NHZA 4XS6A 4J56E 2A2PA 3HVNA 1DE2A 2HT9A 2X8CA 3H93A 2HXKA 2VLTA 2C3NA 4HU7A 1K0DA 3FZ5A 1OE7A 3TKSC 3GN3A 1OKTA 2GLRA 5G31A 3IR4A 2B6MA 4MZCA 3HYPA 4XS4B 1EEMA 5DAKA 4K0GA 2HZFA 1N2AA 4L5OA 3KTBA 4PUFC 2VM1A 5AISA 1ERTA 2HSNA 2KP1A 3GIXA 5H5RA 1NHYA 4KAEA 1K0CA 1TK8B 1TK0B 2B5XA 1ZYQB 2B7JA 3C1SA 4MF7A 2LRNA 5CREA 3ZZXA 1IYHA 3ISOA 2EIRA 3EINA 3FRCA 3TDGA 4Z7XA 4WBJA 4I8BA 2OBIA 4ILFA 5DALB 3UIWA 5CAXA 2YZHA 4AJ8A 4OFNA 2LJRA 2K8SA 3APOA 2VL2C 3KIJA 2LRTA 2I9HA 4QL9A 2IIYA 3MWHA 5J3RA 4ML6A 4GCIA 1YJ6A 2VAFA 4KX4A 3MIXA 4ZIJA 4F2IA 2B3SA 3FZAA 4L5LA 4K2XA 5BMUB 4EIPA 4FO5A 2IN3A 3TCOA 4GRFA 4POBA 2QGVA 4CY8A 3DVWA 2ALBA 2CAIA 3IC4A 2C1YA 3EMXA 4KE3A 5HQPA 5JWRB 3TJFA 4HJMA 4ZBAA 1XVWA 4BA7A 3A2WA 2EIOA 3JCML 1WRYA 6GSYA 1NSWA 1T4ZA 2IFQB 1S3AA 5DQYA 1EP7A 3TKSA 1THXA 2CQ9A 2TIRA 5C00A 3CRTA 1R5AA 3HA9A 1M2AA 3S9FA 1PFOA 2MZCA 3TGZA 4TR0A 5KEJA 4K7IA 3TJJA 4MJEA 1PSQA 1AIUA 4PQIA 1A8YA 4IJIA 1NM3A 4MABA 3RPPA 4N30A 3A2VA 5IMVA 4G9HA 3GH9A 2OACA 3CXGA 4DSQA 3QMXA 4JU5A 1XW6A 20GSA 1GLPA 1Z7PA 3GFKA 2H70A 4EO3A 2P0GA 3EU4A 2LJKA 3RDWA 4YAVA 4ECCA 1ILOA 3WGXA 3TUEA 4YQVA 5GSSA 1M3IA 2M46A 1G6YA 4NWYA 2VCVA 3HY2A 2JZTA 2R0CA 1XWKA 1F9MA 2VL2A 1VF3A 3ZYWA 3ZTLA 5IMAA 5G1KA 3D22A 3GTUB 5CRDA 2UV8G 2H0GA 1WIKA 1RQMA 3NOFA 3D21A 5LD0A 4MZBA 3VURA 1T8EB 2R3XA 5ELGA 2ZCTA 3W8JA 5CP1A 2HSMB 5DVBA 1TXUA 4DSSB 2YNXA 3WYWA 2DJ3A 5KN2A 3IOSA 4BPYA 3HZ4A 2AV4A 3DYRA 2P31A 4TXOB 5IM9A 3F63A 5A4UA 1WE0A 4P3YB 5LCZA 5B6NA 4AKIA 2HSYA 1GLQA 5A1NB 4Q5RA 4F82A 1V40A 14GSA 1LJRA 3QAVA 2F9SA 3APSA 3GKKA 2Z9SA 4RUVA 3UVHA 4TR1A 4Q5FA 2A2SA 4I2TA 3GV1A 1YVLA 4RI7A 2VL3A 3TU3B 2GT6A 1T3BA 1HNCA 5IO0A 2IMFA 5ABRA 5D73A 3BCKA 1LU4A 1OC9A 2O3EA 1GSFA 3O76A 1ZGNA 2XBQA 4WF5A 2IWTA 4EL1A 2OE1A 4J57E 3GH6A 3E9JB 3CSJA 1YEWC 5G30A 1Y25A 1Y1UA 5INYA 2V32A 4YAPA 3MSZA 1U3AA 1Z3EA 4I2UA 1EEJA 1E2YA 5HR0A 1OKDA 3DGQA 3RAZA 4WXTA 3C7MA 5F0GA 5JCGA 5DBQA 5A4VA 1PN9A 5AN1A 18GSA 5D9VA 5GAPD 1RK4A 3DVXA 2C3QA 4WR4A 1N25A 2GQMA 2IL3A 4KW6A 4MJAA 3W8SA 2GZYA 2KHPA 4AGSA 1GP1A 2J9HA 3G7YA 3HXSA 4IBPA 1MDKA 4HSCX 4FH8A 2GZZA 5D8IA 2WZSA 4JE1A 2WVYA 1BYEA 2GQKA 4JR6A 1GSUA 3L78A 3WT2A 3J7Yk 5DJMA 1XOBA 1YF1A 3DXBA 1FOHA 4TRXA 4GLTA 2DJKA 2L57A 1XW5A 1OYJA 4ZB8A 2C3TA 2VLUA 1HYUA 1SJZA 1X9SB 5ECNB 3GA4A 4G19A 2X4AA 2H0HA 2FUG2 4ML1A 2YOIA 4ISDA 3IK9A 1EZKA 1U3IA 2NDOA 4MJCA 5GZZB 4KDUA 1C72A 1YY7A 2WJUA 1F6MC 3HJMA 2PERA 4MNNA 4OFMA 3LGCA 4MH3A 4TVEA 1K0OA 4BIKA 2YN1A 10GSA 3KTLA 1TP9A 3TJKA 3IHGA 4ZILA 2WB9A 1ZYNA 4WKWA 1DUGA 2MBSA 1UA5A 1TRVA 4IQAA 4O92A 1J08A 4GF0A 2CX4A 1ZMAA 3VWUA 1JZRA 4KCAA 4QQ7A 3Q19A 2DJ0A 4F0CA 5EL8A 3ZMKA 2LKUA 1I5GA 3UBLA 2CVBA 2H19A 4HQSA 3ZREA 5JCUA 1YF0A 5IOXA 4EC0A 4F03A 2LNSA 2GVPA 3KM6A 2IMKA 3FY7A 2JSZA 1TI1A 3LG6A 3A2XA 4KA0A 1SL1B 2WCIA 4ACSA 4TW5A 2H1GA 4X1UA 1TRUA 2HRNA 3I43A 2WULA 1WP0A 4QMKA 1O7UA 3M9JA 2AUVA 5HR3A 2A2RA 3UBKA 4FYUA 4YKGA 3L4NA 1KEBA 3EE2A 1PRXA 16GSA 3AY8A 4BVXB 5IOWA 1XPVA 5E59A 3DMLA 5GAND 2TRXA 1AW9A 3ZIVA 4MLYA 1XFLA 2C0DA 3L9SA 4WETA 2IMEA 5G5EA 4ZB7A 1BG5A 3VI5A 3GKNA 2FA8A 3IRAA 5ID2A 5IMZA 1WMJA 1W4VA 1XBSA 2EFEA 4A5PA 4BL7A 5DQSA 4K6XA 2B1LA 2KLXA 4MP4A 2CT6A 2R37A 2I4AA 1A23A 4TKYA 4MDCA 2CVDA 4HEA2 3FEUA 4PNGA 1WPIA 4LLRA 4FXYP 2QSIA 1TOFA 4LA1A 5ENUA 3N9JA 2O89A 4YQMA 3GUSA 5CYYA 3SBCA 5A5KA 1VRSD 4XS1A 4BWSA 1UC7A 3GL5A 5G2ZA 1R5PA 4GSTA 2YP6A 3KP9A 4D73B 4XS4A 4ECIA 1O8WA 1GSQA 1SK1A 3UOMA 2B1KA 3LSZA 2RM6A 1S3CA 5DCGA 5D9XA 3E0UA 1EGOA 1V98A 1A0FA 2JL4A 1Z9HA 2AYTA 1FAAA 1JLVA 1BX9A 3F8UA 3PINA 4FYBA 4ZL7A 1S3RA 2PU9C 2L5LA 4KGIA 4POLA 5HFGA 3ZVJD 2GTUA 4HZ2A 2QC7A 3HCZA 4OMVA 5DALA 4N3ZA 3P8WA 2DIZA 1SVLA 2IMDA 2WFCA 4X43A 1J0FA 3CHXC 4OD7A 3M8NA 4CHSA 4MPFA 2E2GA 3QDNA 2L4QA 3ZFLA 1T00A 2PVQA 5AGYA 2P5QA 5BMUA 22GSA 3F3QA 1GSEA 2R0GA 9GSSA 4FQUA 1WWJA 3LORA 2HRFA 1AQVA 2E7PA 3UL3A 2L6CA 2MYGA 3VWWA 4FYCA 3QD9A 3GSSA 4RI6A 3ERFA 4GTUA 2O36A 3BOAA 4F9ZA 3M9KA 3M3MA 2LUSA 4HU9A 3CRUA 1TDIA 2IFQA 5LNKe 3UAPA 2VCXA 11GSA 19GSA 2VLVA 3FR9A 4PI0C 1ABAA 4AKXB 2BJXA 3GSTA 4PTSA 6GSVA 2A4VA 4AKHA 1Q4JA 5A5HB 3DIEA 2GT5A 3GRXA 4DSRA 4PQHA 2O8VB 2CZ3A 1AQXA 4LMWA 2VIMA 1OC8A 1ERUA 2YJHA 1PKWA 4IJ3A 4EXJA 5ECRB 1GUMA 1USBA 2RUFA 3RPNA 2C8UA 4G2EA 2WW1A 1J9BA 1T4YA 1TU7A 1FOVA 2V6OA 4O5QA 4HS1A 1ZL9A 3HVVA 4IP6A 2FY6A 4BWQA 3ZITA 4K8MA 2ON7A 4L0WA 4OWYA 1YDKA 3CMIA 5F06A 3U5RE 2VD1A 2X99A 2RLIA 4BVYB 1AC1A 4N0ZA 2AAWA 3D0ZA 3OR5A 2GSRA 4Z2UA 3I6AA 4K7NA 1X9MB 3MNGA 3QAWA 1XWBA 2YWIA 2JZRA 4XHMA 2PBJA 2IPAA 4KSMA 2GZPA 4IQ1A 3TJBA 4WBRD 2OKAA 3KP8A 3CYNA 3GTUA 1EV9A 3R2QA 2K9FA 4AJ7A 2PWJA 2DJJA 3O6TA 1WJKA 1BEDA 1EOGA 1QK8A 4EUYA 4EF0A 1K3YA 2HSMA 2YWOA 4CW9A 5B8BA 1F3AA 1O8XA 4DSSA 3N5OA 3BBYA 2H6YA 2HZEB 2H6ZA 3U6VA 4PI2C 3H1NA 3HDCA 4HDEA 5EY6A 1XWCA 4TXOA 1ERWA 3DWVA 3A3TA 3DD3A 1GUHA 3FK8A 5KOWA 2FHEA 4G0KA 2H74A 2E2MA 2JU5A 3RHBA 5A1NA 1NHOA 4N11A 4KH7A 2MMAA 1SJIA 5DJLA 1BF5A 4JZQA 2F3MA 4PNFA 1YKCA 2VL9A 3RFRC 1XOAA 4K9ZA 2NBSA 3TKSE 2VKZG 3ZMLA 3O3TA 2AHEA 4V2NA 2YZUA 1R4WA 2GSSA 1GTUA 6GSSA 2DSAA 4IELA 3TKPA 1KNGA 1SK0A 2H8LA 3IC8A 6GSTA 3EC3A 1AXDA 3ME7A 5A34B 5J41A 5B7CA 3C71A 1N8JA 4GQFA 1K3LA 2PGTA 2WVXB 3WGEA 1YEXA 1GH2A 1MDIA 2EIQA 1URMA 1PMTA 2N5AA 1M3JA 4PGTA 4PQ1A 5EPFA 5J4YA 5J4UA 4MZWA 2OJLA 2RUEA 4MK3A 2EC4A 3IXRA 2O87A 5J9CA 3WGDA 5ECIB 1B9YC 1AQWA 4XCSA 3WD6A 1XZOA 3BD2A 4QL7A 2FLSA 5HR2A 4X0XA 2WDUA 3G9BA 2X8HA 1A24A 3F4TA 3EPTA 3WT1A 3LJRA 1SL0B 5A4WA 5HFIA 3ZFBA 4NAXA 1SU9A 2TRCP 1W89A 1PN0A 1F2EA 1S3DA 2YWNA 1FO5A 1G7OA 1JLWA 3NZNA 1XXUA 3V1WA 3L0HA 5ECOB 4MPGA 2X49A 2H71A 2VD0A 2HE3A 3HZ8A 3J7Yb 5CNWA 3LYKA 4N0VA 3IV4A 4JR4A 3DKSA 3C8EA 5H5QA 3LFLA 1EV4A 4YQUA 2LQOA 2J23A 3F3RA 5IQYA 2DKHA 1M0UA 4IKHA 2GSTA 1K0BA 2QA2A 4KNDA 3CWGA 1E6BA 2X8GA 2X64A 4KSOA 1QGVA 1GWCA 1AUCA 1MEKA 1ZYEA 2DMMA 1HD2A 1QXHA 5IPGA 5B6MA 2LEGA 2AJQB 2HLSA 3IAS2 5J4VA 4ZL9A 1YQ1A 2DIYA 3R3EA 3FMWA 4NV5A 3EURA 3F6FA 6GSUA 2YPMA 4KB3A 1R7HA 2A4HA 1VF2A 5FT3A 1ST9A 2JZSA 2PUKC 4LL1B 1A2JA 1BG1A 1TRSA 5ECMB 2WVZA 2LV3A 2RM5A 3TRXA 2VM2A 4TR4A 5KOXA 1U88A 3LXTA 6GSXA 1THOA 1MD3A 1XWGA 3PR8A 1SYXA 3HMJG 1CQHA 3H79A 2PN8A 2F8AA 1FVJA 2R0PA 3UARA 2H72A 2M80A 3TRPA 2OA7A 1K3OA 5JWQB 4X4JA 4OO4A 2CX3A 4BVXA 1TK5B 3D5JA 1GSYA 3G7JA 3KJYA 1YEPA 2GQLA 3UJ1A 2XPDA 1PGTA 2L5OA 1JZWA 5IO2A 5JCWA 2I1UA 1FG4A 1M7TA 2FWEA 1EWXA 1O85A 2YANA 2HRKB 1PL1A 5D9WA 2UZ8A 2V2GA 4PXOA 1M9BA 5JWOB 2H75A 3HJOA 4EE0A 3FW2A 5ECKB 4WF4A 2OADA 1T7PB 1SENA 2CA8A 3UEMA 4NHWA 3LYPA 4H86A 2MMOA 2XBIA 4XRDA 4KCEA 2DMLA 1XVQA 1HNBA 4IGJA 1TRWA 1HNAA 2H1AA 1ACVA 3HJPA 1M99A 4PURA 1NW2A 4IS0A 5D93A 1Z7RA 1JHBA 3Q6OA 2LSTA 2PPTA 4E8EA 2R5GA 1XG8A 3QFAC 1SKWB 1TW9A 4D73A 5F8BA 4W66A 2GS3A 3MDKA 2H1LA 1UN2A 1GNWA 5L71A 2G2QA 3QAGA 3CSIA 3FYGA 3KEBA 4MJBA 2VUPA 1I9DA 1QMVA 1ZZYA 3Q74A 3KZQA 2FWHA 3TRQA 2DC5A 5KN1A 2B7KA 2XC2A 2YCDA 5ELAA 3QFBC 5KN3A 1O6JA 1FVKA 3FZ9A 2PMTA 3LWAA 2VOCA 3ED3A 3C1RA 2C80A 5GSTA 1G6WA 4ULXA 2ZNMA 4TOPA 2QA1A 3CTFA 1Z5YE 2HSHA 3TKRA 2V1MA 1VGLA 3LXZA 4O7HA 1V2AA 1I1IP 1TTZA 1GULA 1TJDA 2FWFA 3CSHA 4HOJA 2H76A 4EKZA 1LBKA 3HHVA 1ON4A 4YKFA 4MMMA 3FR6A 4V2MA 4G10A 3KMOA 1KBNA 1Q98A 3FKFA 5HFKA 1SKRB 2YJ7A 3K8NA 5ECPB 2G0FA 2MBTA 2K6VA 3EYTA 2D2ZA 4GDFA 4TN8A 5HR1A 5J47A 1Y6EA 4JRRA 2ZUPA 2LNTA 2GGTA 4XIHA 1XIYA 1ZOFA 3BCIA 3D4TA 2H30A 5DAKB 1XCCA 2L6DA 3IHQA 4MH2A 4TXVA 5CRGA 4WEYA 3TOTA 1SK2A 3SWLA 3GMFA 4IN0A 2HSNB 3NIVA 2ON5A 3CBUA 6GSWA 5C04A 3UVTA 1B9XC 5A5HA 1PA3A 3IDVA 4V1Ap 3F4SA 1SYRA 1H4OA 2B5YA 4J2FA 5IPHA 1O81A 4IVFA 2JSYA 2N5FA 5CRHA 4TR3A 3ZLPA 1G0TA 3ZRDA 4RQRA 4E68A 1X5EA 2F51A 4IW9A 3F9UA 2L59A 4NPBA 3GHAA 2VCWA 2CAQA 3LQ7A 4ID0A 3P2AA 2CV4A 2IMIA 2F8FA 4HZ4A 4G01A 2IJYA 4DVCA 2O7KA 3ZVJA 4ICYA 2R6KA 1F37A 1DBYA 1S4BP 4V2LA 2FNOA 4BVYA 1YZXA 4O5RA 4KF9A 5J5NA 1TI3A 2BTOT 1QFNA 2K8VA 1WOUA 1X0RA 4K2DA 4WR5A 1R26A 4NMUA 3PGTA 2REMA 1JZOA 4L8EA 2HFDA 4Z2RA 1Z6NA 2BMXA 4PX1A 3IPZA 4YH2A 3TKQA 5IIZA 2B5EA 1GL8A 8GSSA 3FZ4A 4I5QA 2XHFA 2H1BA 2HZEA 1B48A 1EOHA 3QPMA 1OC3A 2H66A 5AIVA 4PUAA 1DSBA 1M2BA 4AF2A 2O5VA 2VCQA 2H6XA 2CVKA 3W6GA 5FWGA 5G5FA 1SJ6A 3P7XA 4PHZC 2H01A 2OE3A 2WW2A 2ES7A 1XWAA 3VI7A 1CQGA 3A5WA 1ZCPA 1U6TA 1AAZA 2DKIA 4JBBA 5ECSA 2LQQA 4POKA 4I6XA 3QOUA 2EFCA 4HJ2A 2VCZA 1DE1A 2CZ2A 3DRNA 3I69A 2GDRA 3MAKA 2LTKA 4XRAA 1G7EA 2C0EA 4NXIA 1A2MA 4CY6A 17GSA 4CDOA 5IMCA 1SKSB 3A5IA 3IA1A 3ERGA 4DEJA 3EU3A 3D4MA 2H1DA 5A34A 4KDXA 2DJ2A 1PD21 2FD3A 1SVMA 2I81A 2N5BA 1M9AA 1F3BA 2WVXA 5FHIA 1FHEA 1SD9A 3CQFA 1GSDA 1TU8A 7GSSA 3MYDA 2PVOC 3ME8A 5DDLA 5F05A 4GXZA 4HI7A 2KUCA 2R2JA 4I97A 2DJ1A 2WZ9A 3ZL5A 1XW9A 5EVOA 4ZL8A 4K5RA 5ECHB 4K0NA 4JEDA 2EFDA 4EDYA 1H75A 5E4WA 4Q5NA 3BJ5A 5CRWA 1K0NA 1JZDA 3KMNA 3HD5A 1PX7A 1OVNA 5DCHA 3M1GA 4TR1B 2I3YA 1JFUA 2LRCA 3F6DA 1TKDB 1MTCA 2DLXA 2MMZA 3VLNA 4GSNA 1HQOA 4V1Ag 4ZB6A 4OFTA 1GNEA 3TJGA 1OC9B 3Q18A 4HUAA 2E0QA 1PKZA 2OBKA 3VWXA 2LJAA 4LL4B 5AIXA 1B8XA 1MD4A 3VPTA 4NV2A 4MF5A 5G1LA 1GRXA 4GSSA 5COHA 5KN0A 1FB6A 1O73A 1OE8A 2HQTA 5ECLB 1K0AA 1VF4A 2KOKA 1GTAA 3APQA 2EFHA 4L0UA 2NTOA 2VO4A 4E8HA 1BJXA 2AB6A 2LS5A 1B4PA 1V58A 4OCEA 1FB0A 3PH9A 2H73A
chains in the Genus database with same CATH topology
2KP2A 1UVZA 2HNLA 3LW9A 5B8AA 3KH9A 2P5RA 1V57A 5IMFA 4ECJA 4G0IA 1KTEA 4EDZA 1K0MA 1X5DA 4F0BA 4EIQA 3KH7A 4ZBBA 1U87A 5J40A 2VCTA 4POMA 4K7OA 3TOUA 2XPEA 5H5SA 4ECBA 1RW1A 3US3A 5D96A 4FIWA 3TB2A 3H8QA 3P90A 4LMVA 1IYIA 3VPQA 3VFIA 4MCUA 2OT3A 5J9BA 2FA4A 1PX6A 3PPUA 3CTGA 1SVOA 3F4RA 3IBHA 3IK7A 1GTIA 4Z2TA 2OE0A 2QKEA 5ECQB 2V6KA 1GSSA 4MF6A 4G0LA 2O85A 5F07A 2NPBA 1TXXA 1X9WB 2FCHA 2JADA 4MA9A 3GX0A 3IE3A 2V41A 4EVMA 1FW1A 1B4QA 1SD8A 3RHCA 5BRTA 2R4VA 4KUNA 2HRKA 4USSA 2C0GA 4IHUA 2MMNA 1M2DA 3EVIA 4KDYA 1EGRA 3GX8A 3L9UA 2M72A 1OAZA 1GUKA 1BQ7A 2HRAA 3FHKA 3GYKA 4AI6A 2H0IA 3GURA 2RIIA 2GSQA 3UMAA 3FR3A 3KXOA 4XTSA 3M0FA 1PL2A 3HKRA 1ZYPA 2WRTA 2FGXA 3QR6A 1V9WA 4ZXGA 5IMDA 3GNJA 2JACA 1ML6A 3KCMA 1EP8A 2NVLA 1A0RP 1PQNA 2HYXA 3LEFA 1QUWA 1Z6MA 3EMPA 4IP1A 1MDJA 2YV7A 4O32A 3GKMA 4K5SA 1SL2B 2HI7A 3VWVA 2DBCA 3E3EA 3I9V2 3GKXA 1VF1A 1GTBA 2L4CA 2C0FA 1BAYA 4N10A 3ZIJA 3GL3A 1T1VA 4Q5QA 4GQCA 3D6IA 4AJ6A 5CO3A 4RQXA 13GSA 3C73A 2WGRA 4AKGA 4GWRA 2YV9A 2K18A 5D9TA 3QCPA 4ZBDA 3KD0A 1A8LA 4OCFA 3DEXA 4ZB9A 5ID2B 1ERVA 1QQ2A 4HQZA 3RBTA 3F0IA 3IAM2 4BL7B 3H4KA 2WS2A 4OO5A 3EWLA 3VK9A 3HVXA 3ERWA 12GSA 1A2LA 1X5CA 4O5UA 2C4JA 3HVSA 3L9VA 4K1FA 1YKAA 2YWMA 2FWGA 3KGKA 3G7IA 4NHZA 4XS6A 4J56E 2A2PA 1DE2A 2HT9A 2X8CA 3H93A 2HXKA 2VLTA 2C3NA 4HU7A 1K0DA 3FZ5A 1OE7A 3TKSC 3GN3A 1OKTA 2GLRA 5G31A 3IR4A 2B6MA 4MZCA 3HYPA 4XS4B 1EEMA 5DAKA 4K0GA 2HZFA 1N2AA 4L5OA 3KTBA 4PUFC 2VM1A 5AISA 1ERTA 2HSNA 2KP1A 3GIXA 5H5RA 1NHYA 4KAEA 1K0CA 1TK8B 1TK0B 2B5XA 1ZYQB 2B7JA 3C1SA 4MF7A 2LRNA 5CREA 3ZZXA 1IYHA 3ISOA 2EIRA 3EINA 3FRCA 3TDGA 4Z7XA 4WBJA 4I8BA 2OBIA 4ILFA 5DALB 3UIWA 5CAXA 2YZHA 4AJ8A 4OFNA 2LJRA 2K8SA 3APOA 2VL2C 3KIJA 2LRTA 2I9HA 4QL9A 2IIYA 3MWHA 5J3RA 4ML6A 4GCIA 1YJ6A 2VAFA 4KX4A 3MIXA 4ZIJA 4F2IA 2B3SA 3FZAA 4L5LA 4K2XA 5BMUB 4EIPA 4FO5A 2IN3A 3TCOA 4GRFA 4POBA 2QGVA 4CY8A 3DVWA 2ALBA 2CAIA 3IC4A 2C1YA 3EMXA 4KE3A 5HQPA 5JWRB 3TJFA 4HJMA 4ZBAA 1XVWA 4BA7A 3A2WA 2EIOA 3JCML 1WRYA 6GSYA 1NSWA 1T4ZA 2IFQB 1S3AA 5DQYA 1EP7A 3TKSA 1THXA 2CQ9A 2TIRA 5C00A 3CRTA 1R5AA 3HA9A 1M2AA 3S9FA 2MZCA 3TGZA 4TR0A 5KEJA 4K7IA 3TJJA 4MJEA 1PSQA 1AIUA 4PQIA 1A8YA 4IJIA 1NM3A 4MABA 3RPPA 4N30A 3A2VA 5IMVA 4G9HA 3GH9A 2OACA 3CXGA 4DSQA 3QMXA 4JU5A 1XW6A 20GSA 1GLPA 1Z7PA 3GFKA 2H70A 4EO3A 2P0GA 3EU4A 2LJKA 3RDWA 4YAVA 4ECCA 1ILOA 3WGXA 3TUEA 4YQVA 5GSSA 2M46A 1G6YA 4NWYA 2VCVA 3HY2A 2JZTA 2R0CA 1XWKA 1F9MA 2VL2A 1VF3A 3ZYWA 3ZTLA 5IMAA 5G1KA 3D22A 3GTUB 5CRDA 2UV8G 2H0GA 1WIKA 1RQMA 3NOFA 3D21A 5LD0A 4MZBA 3VURA 1T8EB 2R3XA 5ELGA 2ZCTA 3W8JA 5CP1A 2HSMB 5DVBA 1TXUA 4DSSB 2YNXA 3WYWA 2DJ3A 5KN2A 3IOSA 4BPYA 3HZ4A 2AV4A 3DYRA 2P31A 4TXOB 5IM9A 3F63A 5A4UA 1WE0A 4P3YB 5LCZA 5B6NA 4AKIA 2HSYA 1GLQA 5A1NB 4Q5RA 4F82A 1V40A 14GSA 1LJRA 3QAVA 2F9SA 3APSA 3GKKA 2Z9SA 4RUVA 3UVHA 4TR1A 4Q5FA 2A2SA 4I2TA 3GV1A 1YVLA 4RI7A 2VL3A 3TU3B 2GT6A 1T3BA 1HNCA 5IO0A 2IMFA 5ABRA 5D73A 3BCKA 1LU4A 1OC9A 1GSFA 3O76A 1ZGNA 2XBQA 4WF5A 2IWTA 4EL1A 2OE1A 4J57E 3GH6A 3E9JB 3CSJA 5G30A 1Y25A 1Y1UA 5INYA 2V32A 4YAPA 3MSZA 1U3AA 1Z3EA 4I2UA 1EEJA 1E2YA 5HR0A 1OKDA 3DGQA 3RAZA 4WXTA 3C7MA 5F0GA 5JCGA 5DBQA 5A4VA 1PN9A 5AN1A 18GSA 5D9VA 5GAPD 1RK4A 3DVXA 2C3QA 4WR4A 1N25A 2GQMA 2IL3A 4KW6A 4MJAA 3W8SA 2GZYA 2KHPA 4AGSA 1GP1A 2J9HA 3G7YA 3HXSA 4IBPA 1MDKA 4FH8A 2GZZA 5D8IA 4JE1A 1BYEA 2GQKA 4JR6A 1GSUA 3L78A 3WT2A 3J7Yk 5DJMA 1XOBA 1YF1A 3DXBA 1FOHA 4TRXA 4GLTA 2DJKA 2L57A 1XW5A 1OYJA 4ZB8A 2C3TA 2VLUA 1HYUA 1SJZA 1X9SB 5ECNB 3GA4A 4G19A 2X4AA 2H0HA 2FUG2 4ML1A 2YOIA 4ISDA 3IK9A 1EZKA 1U3IA 2NDOA 4MJCA 5GZZB 4KDUA 1C72A 1YY7A 2WJUA 1F6MC 3HJMA 2PERA 4MNNA 4OFMA 3LGCA 4MH3A 4TVEA 1K0OA 2YN1A 10GSA 3KTLA 1TP9A 3TJKA 3IHGA 4ZILA 2WB9A 1ZYNA 4WKWA 1DUGA 2MBSA 1UA5A 1TRVA 4IQAA 4O92A 1J08A 4GF0A 2CX4A 1ZMAA 3VWUA 1JZRA 4KCAA 4QQ7A 3Q19A 2DJ0A 4F0CA 5EL8A 3ZMKA 2LKUA 1I5GA 3UBLA 2CVBA 2H19A 4HQSA 3ZREA 5JCUA 1YF0A 5IOXA 4EC0A 4F03A 2LNSA 2GVPA 3KM6A 2IMKA 3FY7A 2JSZA 1TI1A 3LG6A 3A2XA 4KA0A 1SL1B 2WCIA 4ACSA 4TW5A 2H1GA 4X1UA 1TRUA 2HRNA 3I43A 2WULA 1WP0A 4QMKA 1O7UA 3M9JA 2AUVA 5HR3A 2A2RA 3UBKA 4FYUA 4YKGA 3L4NA 1KEBA 3EE2A 1PRXA 16GSA 3AY8A 4BVXB 5IOWA 1XPVA 5E59A 3DMLA 5GAND 2TRXA 1AW9A 3ZIVA 4MLYA 1XFLA 2C0DA 3L9SA 4WETA 2IMEA 5G5EA 4ZB7A 1BG5A 3VI5A 3GKNA 2FA8A 3IRAA 5ID2A 5IMZA 1WMJA 1W4VA 1XBSA 2EFEA 4A5PA 4BL7A 5DQSA 4K6XA 2B1LA 2KLXA 4MP4A 2CT6A 2R37A 2I4AA 1A23A 4TKYA 4MDCA 2CVDA 4HEA2 3FEUA 4PNGA 1WPIA 4LLRA 2QSIA 1TOFA 4LA1A 5ENUA 3N9JA 2O89A 4YQMA 3GUSA 5CYYA 3SBCA 5A5KA 1VRSD 4XS1A 4BWSA 1UC7A 3GL5A 5G2ZA 1R5PA 4GSTA 2YP6A 3KP9A 4D73B 4XS4A 4ECIA 1O8WA 1GSQA 1SK1A 3UOMA 2B1KA 3LSZA 2RM6A 1S3CA 5DCGA 5D9XA 3E0UA 1EGOA 1V98A 1A0FA 2JL4A 1Z9HA 2AYTA 1FAAA 1JLVA 1BX9A 3F8UA 3PINA 4FYBA 4ZL7A 2PU9C 2L5LA 4KGIA 4POLA 5HFGA 3ZVJD 2GTUA 4HZ2A 2QC7A 3HCZA 4OMVA 5DALA 4N3ZA 3P8WA 2DIZA 1SVLA 2IMDA 2WFCA 4X43A 1J0FA 4OD7A 3M8NA 4CHSA 4MPFA 2E2GA 3QDNA 2L4QA 3ZFLA 1T00A 2PVQA 5AGYA 2P5QA 5BMUA 22GSA 3F3QA 1GSEA 2R0GA 9GSSA 4FQUA 1WWJA 3LORA 2HRFA 1AQVA 2E7PA 3UL3A 2L6CA 2MYGA 3VWWA 4FYCA 3QD9A 3GSSA 4RI6A 3ERFA 4GTUA 3BOAA 4F9ZA 3M9KA 3M3MA 2LUSA 4HU9A 3CRUA 1TDIA 2IFQA 5LNKe 3UAPA 2VCXA 11GSA 19GSA 2VLVA 3FR9A 1ABAA 4AKXB 2BJXA 3GSTA 4PTSA 6GSVA 2A4VA 4AKHA 1Q4JA 5A5HB 3DIEA 2GT5A 3GRXA 4DSRA 4PQHA 2O8VB 2CZ3A 1AQXA 4LMWA 2VIMA 1OC8A 1ERUA 2YJHA 1PKWA 4IJ3A 4EXJA 5ECRB 1GUMA 1USBA 2RUFA 3RPNA 2C8UA 4G2EA 1J9BA 1T4YA 1TU7A 1FOVA 2V6OA 4O5QA 4HS1A 1ZL9A 3HVVA 4IP6A 2FY6A 4BWQA 3ZITA 4K8MA 2ON7A 4L0WA 4OWYA 1YDKA 3CMIA 5F06A 3U5RE 2VD1A 2X99A 2RLIA 4BVYB 1AC1A 4N0ZA 2AAWA 3D0ZA 3OR5A 2GSRA 4Z2UA 3I6AA 4K7NA 1X9MB 3MNGA 3QAWA 1XWBA 2YWIA 2JZRA 4XHMA 2PBJA 2IPAA 4KSMA 2GZPA 4IQ1A 3TJBA 4WBRD 2OKAA 3KP8A 3CYNA 3GTUA 1EV9A 3R2QA 2K9FA 4AJ7A 2PWJA 2DJJA 3O6TA 1WJKA 1BEDA 1EOGA 1QK8A 4EUYA 4EF0A 1K3YA 2HSMA 2YWOA 4CW9A 5B8BA 1F3AA 1O8XA 4DSSA 3N5OA 3BBYA 2H6YA 2HZEB 2H6ZA 3U6VA 3H1NA 3HDCA 4HDEA 5EY6A 1XWCA 4TXOA 1ERWA 3DWVA 3A3TA 3DD3A 1GUHA 3FK8A 5KOWA 2FHEA 4G0KA 2H74A 2E2MA 2JU5A 3RHBA 5A1NA 1NHOA 4N11A 4KH7A 2MMAA 1SJIA 5DJLA 1BF5A 4JZQA 2F3MA 4PNFA 1YKCA 2VL9A 1XOAA 4K9ZA 2NBSA 3TKSE 2VKZG 3ZMLA 3O3TA 2AHEA 4V2NA 2YZUA 1R4WA 2GSSA 1GTUA 6GSSA 2DSAA 4IELA 3TKPA 1KNGA 1SK0A 2H8LA 3IC8A 6GSTA 3EC3A 1AXDA 3ME7A 5A34B 5J41A 5B7CA 3C71A 1N8JA 4GQFA 1K3LA 2PGTA 3WGEA 1YEXA 1GH2A 1MDIA 2EIQA 1URMA 1PMTA 2N5AA 4PGTA 4PQ1A 5EPFA 5J4YA 5J4UA 4MZWA 2OJLA 2RUEA 4MK3A 2EC4A 3IXRA 2O87A 5J9CA 3WGDA 5ECIB 1B9YC 1AQWA 4XCSA 3WD6A 1XZOA 3BD2A 4QL7A 2FLSA 5HR2A 4X0XA 2WDUA 3G9BA 2X8HA 1A24A 3F4TA 3EPTA 3WT1A 3LJRA 1SL0B 5A4WA 5HFIA 3ZFBA 4NAXA 1SU9A 2TRCP 1W89A 1PN0A 1F2EA 1S3DA 2YWNA 1FO5A 1G7OA 1JLWA 3NZNA 1XXUA 3V1WA 3L0HA 5ECOB 4MPGA 2X49A 2H71A 2VD0A 2HE3A 3HZ8A 3J7Yb 5CNWA 3LYKA 4N0VA 3IV4A 4JR4A 3DKSA 3C8EA 5H5QA 3LFLA 1EV4A 4YQUA 2LQOA 2J23A 3F3RA 5IQYA 2DKHA 1M0UA 4IKHA 2GSTA 1K0BA 2QA2A 4KNDA 3CWGA 1E6BA 2X8GA 2X64A 4KSOA 1QGVA 1GWCA 1AUCA 1MEKA 1ZYEA 2DMMA 1HD2A 1QXHA 5IPGA 5B6MA 2LEGA 2AJQB 2HLSA 3IAS2 5J4VA 4ZL9A 1YQ1A 2DIYA 3R3EA 3FMWA 4NV5A 3EURA 3F6FA 6GSUA 2YPMA 4KB3A 1R7HA 2A4HA 1VF2A 5FT3A 1ST9A 2JZSA 2PUKC 4LL1B 1A2JA 1BG1A 1TRSA 5ECMB 2LV3A 2RM5A 3TRXA 2VM2A 4TR4A 5KOXA 1U88A 3LXTA 6GSXA 1THOA 1MD3A 1XWGA 3PR8A 1SYXA 3HMJG 1CQHA 3H79A 2PN8A 2F8AA 1FVJA 2R0PA 3UARA 2H72A 2M80A 3TRPA 2OA7A 1K3OA 5JWQB 4X4JA 4OO4A 2CX3A 4BVXA 1TK5B 3D5JA 1GSYA 3G7JA 3KJYA 1YEPA 2GQLA 3UJ1A 2XPDA 1PGTA 2L5OA 1JZWA 5IO2A 5JCWA 2I1UA 1FG4A 1M7TA 2FWEA 1EWXA 1O85A 2YANA 2HRKB 1PL1A 5D9WA 2UZ8A 2V2GA 4PXOA 1M9BA 5JWOB 2H75A 3HJOA 4EE0A 3FW2A 5ECKB 4WF4A 2OADA 1T7PB 1SENA 2CA8A 3UEMA 4NHWA 3LYPA 4H86A 2MMOA 2XBIA 4XRDA 4KCEA 2DMLA 1XVQA 1HNBA 4IGJA 1TRWA 1HNAA 2H1AA 1ACVA 3HJPA 1M99A 4PURA 1NW2A 4IS0A 5D93A 1Z7RA 1JHBA 3Q6OA 2LSTA 2PPTA 4E8EA 2R5GA 3QFAC 1SKWB 1TW9A 4D73A 5F8BA 4W66A 2GS3A 3MDKA 2H1LA 1UN2A 1GNWA 5L71A 2G2QA 3QAGA 3CSIA 3FYGA 3KEBA 4MJBA 2VUPA 1I9DA 1QMVA 1ZZYA 3Q74A 3KZQA 2FWHA 3TRQA 2DC5A 5KN1A 2B7KA 2XC2A 2YCDA 5ELAA 3QFBC 5KN3A 1O6JA 1FVKA 3FZ9A 2PMTA 3LWAA 2VOCA 3ED3A 3C1RA 2C80A 5GSTA 1G6WA 4ULXA 2ZNMA 4TOPA 2QA1A 3CTFA 1Z5YE 2HSHA 3TKRA 2V1MA 1VGLA 3LXZA 4O7HA 1V2AA 1TTZA 1GULA 1TJDA 2FWFA 3CSHA 4HOJA 2H76A 4EKZA 1LBKA 3HHVA 1ON4A 4YKFA 4MMMA 3FR6A 4V2MA 4G10A 3KMOA 1KBNA 1Q98A 3FKFA 5HFKA 1SKRB 2YJ7A 3K8NA 5ECPB 2G0FA 2MBTA 2K6VA 3EYTA 2D2ZA 4GDFA 4TN8A 5HR1A 5J47A 1Y6EA 4JRRA 2ZUPA 2LNTA 2GGTA 4XIHA 1XIYA 1ZOFA 3BCIA 3D4TA 2H30A 5DAKB 1XCCA 2L6DA 3IHQA 4MH2A 4TXVA 5CRGA 4WEYA 3TOTA 1SK2A 3SWLA 3GMFA 4IN0A 2HSNB 3NIVA 2ON5A 3CBUA 6GSWA 5C04A 3UVTA 1B9XC 5A5HA 1PA3A 3IDVA 4V1Ap 3F4SA 1SYRA 1H4OA 2B5YA 4J2FA 5IPHA 1O81A 4IVFA 2JSYA 2N5FA 5CRHA 4TR3A 3ZLPA 1G0TA 3ZRDA 4RQRA 4E68A 1X5EA 2F51A 4IW9A 3F9UA 2L59A 4NPBA 3GHAA 2VCWA 2CAQA 3LQ7A 4ID0A 3P2AA 2CV4A 2IMIA 2F8FA 4HZ4A 4G01A 2IJYA 4DVCA 2O7KA 3ZVJA 4ICYA 2R6KA 1F37A 1DBYA 4V2LA 2FNOA 4BVYA 1YZXA 4O5RA 4KF9A 5J5NA 1TI3A 2BTOT 1QFNA 2K8VA 1WOUA 1X0RA 4K2DA 4WR5A 1R26A 4NMUA 3PGTA 2REMA 1JZOA 4L8EA 2HFDA 4Z2RA 1Z6NA 2BMXA 4PX1A 3IPZA 4YH2A 3TKQA 5IIZA 2B5EA 1GL8A 8GSSA 3FZ4A 4I5QA 2XHFA 2H1BA 2HZEA 1B48A 1EOHA 3QPMA 1OC3A 2H66A 5AIVA 4PUAA 1DSBA 1M2BA 4AF2A 2O5VA 2VCQA 2H6XA 2CVKA 3W6GA 5FWGA 5G5FA 1SJ6A 3P7XA 2H01A 2OE3A 2ES7A 1XWAA 3VI7A 1CQGA 3A5WA 1ZCPA 1U6TA 1AAZA 2DKIA 4JBBA 5ECSA 2LQQA 4POKA 4I6XA 3QOUA 2EFCA 4HJ2A 2VCZA 1DE1A 2CZ2A 3DRNA 3I69A 2GDRA 3MAKA 2LTKA 4XRAA 1G7EA 2C0EA 4NXIA 1A2MA 4CY6A 17GSA 4CDOA 5IMCA 1SKSB 3A5IA 3IA1A 3ERGA 4DEJA 3EU3A 3D4MA 2H1DA 5A34A 4KDXA 2DJ2A 1PD21 2FD3A 1SVMA 2I81A 2N5BA 1M9AA 1F3BA 5FHIA 1FHEA 1SD9A 1GSDA 1TU8A 7GSSA 3MYDA 2PVOC 3ME8A 5DDLA 5F05A 4GXZA 4HI7A 2KUCA 2R2JA 4I97A 2DJ1A 2WZ9A 3ZL5A 1XW9A 5EVOA 4ZL8A 4K5RA 5ECHB 4K0NA 4JEDA 2EFDA 4EDYA 1H75A 5E4WA 4Q5NA 3BJ5A 5CRWA 1K0NA 1JZDA 3KMNA 3HD5A 1PX7A 1OVNA 5DCHA 3M1GA 4TR1B 2I3YA 1JFUA 2LRCA 3F6DA 1TKDB 1MTCA 2DLXA 2MMZA 3VLNA 4GSNA 1HQOA 4V1Ag 4ZB6A 4OFTA 1GNEA 3TJGA 1OC9B 3Q18A 4HUAA 2E0QA 1PKZA 2OBKA 3VWXA 2LJAA 4LL4B 5AIXA 1B8XA 1MD4A 3VPTA 4NV2A 4MF5A 5G1LA 1GRXA 4GSSA 5COHA 5KN0A 1FB6A 1O73A 1OE8A 2HQTA 5ECLB 1K0AA 1VF4A 2KOKA 1GTAA 3APQA 2EFHA 4L0UA 2NTOA 2VO4A 4E8HA 1BJXA 2AB6A 2LS5A 1B4PA 1V58A 4OCEA 1FB0A 3PH9A 2H73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KP2 A;  1UVZ A;  2HNL A;  5B8A A;  3KH9 A;  2P5R A;  1V57 A;  5IMF A;  4ECJ A;  4G0I A;  1KTE A;  4EDZ A;  1K0M A;  1X5D A;  4F0B A;  3KH7 A;  4ZBB A;  1U87 A;  2VCT A;  4POM A;  4K7O A;  3TOU A;  2XPE A;  5H5S A;  4ECB A;  1RW1 A;  3US3 A;  5D96 A;  4FIW A;  3TB2 A;  3H8Q A;  3P90 A;  4LMV A;  1IYI A;  3VPQ A;  3VFI A;  4MCU A;  5J9B A;  2FA4 A;  1PX6 A;  3PPU A;  3CTG A;  3F4R A;  3IBH A;  3IK7 A;  1GTI A;  2OE0 A;  2QKE A;  5ECQ B;  2V6K A;  1GSS A;  4MF6 A;  4G0L A;  2O85 A;  5F07 A;  2NPB A;  1TXX A;  1X9W B;  2FCH A;  2JAD A;  4MA9 A;  3GX0 A;  3IE3 A;  2V41 A;  4EVM A;  1FW1 A;  1B4Q A;  1SD8 A;  3RHC A;  2R4V A;  4KUN A;  2HRK A;  4USS A;  2C0G A;  4IHU A;  2MMN A;  1M2D A;  3EVI A;  4KDY A;  1EGR A;  3GX8 A;  3L9U A;  2M72 A;  1OAZ A;  1GUK A;  1BQ7 A;  2HRA A;  3FHK A;  3GYK A;  2H0I A;  3GUR A;  2RII A;  2GSQ A;  3UMA A;  3FR3 A;  3KXO A;  4XTS A;  3M0F A;  1PL2 A;  3HKR A;  2WRT A;  2FGX A;  3QR6 A;  1V9W A;  4ZXG A;  5IMD A;  3GNJ A;  2JAC A;  1ML6 A;  3KCM A;  1EP8 A;  2NVL A;  1A0R P;  1PQN A;  2HYX A;  3LEF A;  1QUW A;  1Z6M A;  3EMP A;  4IP1 A;  1MDJ A;  2YV7 A;  4O32 A;  3GKM A;  1SL2 B;  2HI7 A;  3VWV A;  2DBC A;  3E3E A;  3I9V 2;  3GKX A;  1VF1 A;  1GTB A;  2L4C A;  2C0F A;  1BAY A;  4N10 A;  3ZIJ A;  3GL3 A;  1T1V A;  4Q5Q A;  4GQC A;  3D6I A;  4AJ6 A;  5CO3 A;  4RQX A;  13GS A;  3C73 A;  2WGR A;  4GWR A;  2YV9 A;  2K18 A;  5D9T A;  3QCP A;  4ZBD A;  3KD0 A;  1A8L A;  4OCF A;  3DEX A;  4ZB9 A;  5ID2 B;  1ERV A;  1QQ2 A;  4HQZ A;  3RBT A;  3F0I A;  3IAM 2;  4BL7 B;  3H4K A;  2WS2 A;  4OO5 A;  3EWL A;  3VK9 A;  3HVX A;  3ERW A;  12GS A;  1A2L A;  1X5C A;  2C4J A;  3HVS A;  3L9V A;  4K1F A;  1YKA A;  2YWM A;  2FWG A;  3KGK A;  3G7I A;  4NHZ A;  4XS6 A;  4J56 E;  1DE2 A;  2HT9 A;  2X8C A;  3H93 A;  2HXK A;  2VLT A;  2C3N A;  4HU7 A;  1K0D A;  3FZ5 A;  1OE7 A;  3TKS C;  3GN3 A;  1OKT A;  2GLR A;  5G31 A;  3IR4 A;  2B6M A;  4MZC A;  3HYP A;  4XS4 B;  1EEM A;  5DAK A;  4K0G A;  2HZF A;  1N2A A;  4L5O A;  3KTB A;  4PUF C;  2VM1 A;  5AIS A;  1ERT A;  2KP1 A;  3GIX A;  5H5R A;  1NHY A;  4KAE A;  1K0C A;  1TK8 B;  1TK0 B;  2B5X A;  1ZYQ B;  2B7J A;  3C1S A;  4MF7 A;  2LRN A;  5CRE A;  3ZZX A;  1IYH A;  3ISO A;  2EIR A;  3EIN A;  3FRC A;  3TDG A;  4Z7X A;  4WBJ A;  4I8B A;  2OBI A;  4ILF A;  5DAL B;  3UIW A;  5CAX A;  2YZH A;  4AJ8 A;  4OFN A;  2LJR A;  2K8S A;  3APO A;  2VL2 C;  3KIJ A;  2LRT A;  2I9H A;  4QL9 A;  2IIY A;  3MWH A;  5J3R A;  4ML6 A;  4GCI A;  1YJ6 A;  2VAF A;  4KX4 A;  4ZIJ A;  4F2I A;  2B3S A;  3FZA A;  4L5L A;  4FO5 A;  2IN3 A;  3TCO A;  4GRF A;  4POB A;  2QGV A;  3DVW A;  2ALB A;  2CAI A;  3IC4 A;  2C1Y A;  3EMX A;  4KE3 A;  5HQP A;  5JWR B;  3TJF A;  4HJM A;  4ZBA A;  1XVW A;  4BA7 A;  3A2W A;  2EIO A;  3JCM L;  1WRY A;  6GSY A;  1NSW A;  1T4Z A;  2IFQ B;  1S3A A;  5DQY A;  1EP7 A;  3TKS A;  1THX A;  2CQ9 A;  2TIR A;  5C00 A;  3CRT A;  1R5A A;  3HA9 A;  1M2A A;  3S9F A;  2MZC A;  3TGZ A;  4TR0 A;  5KEJ A;  4K7I A;  3TJJ A;  4MJE A;  1PSQ A;  1AIU A;  4PQI A;  1A8Y A;  4IJI A;  1NM3 A;  4MAB A;  3RPP A;  4N30 A;  3A2V A;  5IMV A;  4G9H A;  3GH9 A;  2OAC A;  3CXG A;  4DSQ A;  3QMX A;  4JU5 A;  1XW6 A;  20GS A;  1GLP A;  1Z7P A;  3GFK A;  2H70 A;  4EO3 A;  2P0G A;  3EU4 A;  2LJK A;  3RDW A;  4YAV A;  4ECC A;  1ILO A;  3WGX A;  3TUE A;  4YQV A;  5GSS A;  2M46 A;  1G6Y A;  4NWY A;  2VCV A;  3HY2 A;  2JZT A;  1XWK A;  1F9M A;  2VL2 A;  1VF3 A;  3ZYW A;  3ZTL A;  5IMA A;  5G1K A;  3D22 A;  3GTU B;  5CRD A;  2H0G A;  1WIK A;  1RQM A;  3NOF A;  3D21 A;  5LD0 A;  4MZB A;  3VUR A;  1T8E B;  2R3X A;  5ELG A;  2ZCT A;  3W8J A;  5CP1 A;  2HSM B;  5DVB A;  4DSS B;  2YNX A;  3WYW A;  2DJ3 A;  5KN2 A;  3IOS A;  4BPY A;  3HZ4 A;  2AV4 A;  3DYR A;  2P31 A;  4TXO B;  5IM9 A;  3F63 A;  5A4U A;  1WE0 A;  4P3Y B;  5LCZ A;  5B6N A;  2HSY A;  1GLQ A;  4Q5R A;  4F82 A;  1V40 A;  14GS A;  1LJR A;  3QAV A;  2F9S A;  3APS A;  3GKK A;  2Z9S A;  4RUV A;  3UVH A;  4TR1 A;  4Q5F A;  2A2S A;  4I2T A;  3GV1 A;  4RI7 A;  2VL3 A;  2GT6 A;  1T3B A;  1HNC A;  5IO0 A;  2IMF A;  5ABR A;  5D73 A;  3BCK A;  1LU4 A;  1OC9 A;  3O76 A;  1GSF A;  1ZGN A;  2XBQ A;  4WF5 A;  2IWT A;  4EL1 A;  2OE1 A;  4J57 E;  3GH6 A;  3E9J B;  3CSJ A;  5G30 A;  1Y25 A;  5INY A;  2V32 A;  4YAP A;  3MSZ A;  1U3A A;  1Z3E A;  4I2U A;  1EEJ A;  1E2Y A;  5HR0 A;  1OKD A;  3DGQ A;  3RAZ A;  4WXT A;  3C7M A;  5F0G A;  5JCG A;  5DBQ A;  5A4V A;  1PN9 A;  5AN1 A;  18GS A;  5D9V A;  5GAP D;  1RK4 A;  3DVX A;  2C3Q A;  4WR4 A;  2GQM A;  2IL3 A;  4KW6 A;  4MJA A;  3W8S A;  2GZY A;  2KHP A;  4AGS A;  1GP1 A;  2J9H A;  3G7Y A;  3HXS A;  4IBP A;  1MDK A;  4FH8 A;  2GZZ A;  5D8I A;  4JE1 A;  1BYE A;  2GQK A;  4JR6 A;  1GSU A;  3L78 A;  3WT2 A;  3J7Y k;  5DJM A;  1XOB A;  1YF1 A;  3DXB A;  4TRX A;  4GLT A;  2DJK A;  2L57 A;  1XW5 A;  1OYJ A;  4ZB8 A;  2C3T A;  2VLU A;  1HYU A;  1SJZ A;  1X9S B;  5ECN B;  3GA4 A;  4G19 A;  2H0H A;  2FUG 2;  4ML1 A;  2YOI A;  4ISD A;  3IK9 A;  1EZK A;  1U3I A;  2NDO A;  4MJC A;  5GZZ B;  4KDU A;  1C72 A;  1YY7 A;  2WJU A;  1F6M C;  3HJM A;  2PER A;  4OFM A;  3LGC A;  4MH3 A;  4TVE A;  1K0O A;  2YN1 A;  10GS A;  3KTL A;  1TP9 A;  3TJK A;  4ZIL A;  2WB9 A;  4WKW A;  1DUG A;  2MBS A;  1UA5 A;  1TRV A;  4IQA A;  4O92 A;  1J08 A;  4GF0 A;  2CX4 A;  1ZMA A;  3VWU A;  1JZR A;  4KCA A;  4QQ7 A;  3Q19 A;  2DJ0 A;  4F0C A;  5EL8 A;  3ZMK A;  2LKU A;  1I5G A;  3UBL A;  2CVB A;  2H19 A;  4HQS A;  3ZRE A;  5JCU A;  1YF0 A;  5IOX A;  4EC0 A;  4F03 A;  2LNS A;  2GVP A;  3KM6 A;  2IMK A;  3FY7 A;  2JSZ A;  1TI1 A;  3LG6 A;  3A2X A;  4KA0 A;  1SL1 B;  2WCI A;  4ACS A;  4TW5 A;  2H1G A;  4X1U A;  1TRU A;  2HRN A;  3I43 A;  2WUL A;  1WP0 A;  1O7U A;  3M9J A;  2AUV A;  5HR3 A;  2A2R A;  3UBK A;  4FYU A;  3L4N A;  1KEB A;  3EE2 A;  1PRX A;  16GS A;  3AY8 A;  4BVX B;  5IOW A;  1XPV A;  5E59 A;  3DML A;  5GAN D;  2TRX A;  1AW9 A;  3ZIV A;  4MLY A;  1XFL A;  2C0D A;  3L9S A;  4WET A;  2IME A;  5G5E A;  1BG5 A;  3VI5 A;  3GKN A;  2FA8 A;  3IRA A;  5ID2 A;  5IMZ A;  1WMJ A;  1W4V A;  1XBS A;  4BL7 A;  5DQS A;  4K6X A;  2B1L A;  2KLX A;  4MP4 A;  2CT6 A;  2R37 A;  2I4A A;  1A23 A;  4TKY A;  4MDC A;  2CVD A;  4HEA 2;  3FEU A;  4PNG A;  1WPI A;  4LLR A;  2QSI A;  1TOF A;  4LA1 A;  5ENU A;  3N9J A;  2O89 A;  4YQM A;  3GUS A;  5CYY A;  3SBC A;  5A5K A;  1VRS D;  4XS1 A;  4BWS A;  1UC7 A;  3GL5 A;  5G2Z A;  1R5P A;  4GST A;  2YP6 A;  3KP9 A;  4D73 B;  4XS4 A;  4ECI A;  1O8W A;  1GSQ A;  1SK1 A;  3UOM A;  2B1K A;  3LSZ A;  2RM6 A;  1S3C A;  5DCG A;  5D9X A;  3E0U A;  1EGO A;  1V98 A;  1A0F A;  2JL4 A;  1Z9H A;  2AYT A;  1FAA A;  1JLV A;  1BX9 A;  3F8U A;  3PIN A;  4FYB A;  4ZL7 A;  2PU9 C;  2L5L A;  4KGI A;  4POL A;  5HFG A;  3ZVJ D;  2GTU A;  4HZ2 A;  2QC7 A;  3HCZ A;  4OMV A;  5DAL A;  3P8W A;  2DIZ A;  2IMD A;  2WFC A;  4X43 A;  1J0F A;  4OD7 A;  3M8N A;  4CHS A;  4MPF A;  2E2G A;  3QDN A;  2L4Q A;  3ZFL A;  1T00 A;  2PVQ A;  5AGY A;  2P5Q A;  5BMU A;  22GS A;  3F3Q A;  1GSE A;  9GSS A;  4FQU A;  1WWJ A;  3LOR A;  2HRF A;  1AQV A;  2E7P A;  3UL3 A;  2L6C A;  2MYG A;  3VWW A;  4FYC A;  3QD9 A;  3GSS A;  4RI6 A;  3ERF A;  4GTU A;  3BOA A;  4F9Z A;  3M9K A;  3M3M A;  2LUS A;  4HU9 A;  3CRU A;  1TDI A;  2IFQ A;  5LNK e;  3UAP A;  2VCX A;  11GS A;  19GS A;  2VLV A;  3FR9 A;  1ABA A;  2BJX A;  3GST A;  4PTS A;  6GSV A;  2A4V A;  1Q4J A;  3DIE A;  2GT5 A;  3GRX A;  4DSR A;  4PQH A;  2O8V B;  2CZ3 A;  1AQX A;  4LMW A;  2VIM A;  1OC8 A;  1ERU A;  2YJH A;  1PKW A;  4IJ3 A;  4EXJ A;  5ECR B;  1GUM A;  1USB A;  2RUF A;  3RPN A;  2C8U A;  4G2E A;  1J9B A;  1T4Y A;  1TU7 A;  1FOV A;  2V6O A;  4HS1 A;  1ZL9 A;  3HVV A;  4IP6 A;  2FY6 A;  4BWQ A;  3ZIT A;  4K8M A;  2ON7 A;  4L0W A;  4OWY A;  1YDK A;  3CMI A;  5F06 A;  3U5R E;  2VD1 A;  2X99 A;  2RLI A;  4BVY B;  1AC1 A;  4N0Z A;  2AAW A;  3D0Z A;  3OR5 A;  2GSR A;  3I6A A;  4K7N A;  1X9M B;  3MNG A;  3QAW A;  1XWB A;  2YWI A;  2JZR A;  4XHM A;  2PBJ A;  2IPA A;  4KSM A;  2GZP A;  4IQ1 A;  3TJB A;  4WBR D;  2OKA A;  3KP8 A;  3CYN A;  3GTU A;  1EV9 A;  3R2Q A;  2K9F A;  4AJ7 A;  2PWJ A;  2DJJ A;  3O6T A;  1WJK A;  1BED A;  1EOG A;  1QK8 A;  4EUY A;  4EF0 A;  1K3Y A;  2HSM A;  2YWO A;  4CW9 A;  5B8B A;  1F3A A;  1O8X A;  4DSS A;  3N5O A;  3BBY A;  2H6Y A;  2HZE B;  2H6Z A;  3U6V A;  3H1N A;  3HDC A;  4HDE A;  5EY6 A;  1XWC A;  4TXO A;  1ERW A;  3DWV A;  3A3T A;  3DD3 A;  1GUH A;  3FK8 A;  2FHE A;  4G0K A;  2H74 A;  2E2M A;  2JU5 A;  3RHB A;  1NHO A;  4N11 A;  4KH7 A;  2MMA A;  1SJI A;  5DJL A;  4JZQ A;  2F3M A;  4PNF A;  1YKC A;  2VL9 A;  1XOA A;  4K9Z A;  2NBS A;  3TKS E;  3ZML A;  3O3T A;  2AHE A;  4V2N A;  2YZU A;  1R4W A;  2GSS A;  1GTU A;  6GSS A;  2DSA A;  4IEL A;  3TKP A;  1KNG A;  1SK0 A;  2H8L A;  3IC8 A;  6GST A;  3EC3 A;  1AXD A;  3ME7 A;  5J41 A;  5B7C A;  3C71 A;  1N8J A;  4GQF A;  1K3L A;  2PGT A;  3WGE A;  1YEX A;  1GH2 A;  1MDI A;  2EIQ A;  1URM A;  1PMT A;  2N5A A;  4PGT A;  4PQ1 A;  5EPF A;  5J4U A;  4MZW A;  2OJL A;  2RUE A;  4MK3 A;  2EC4 A;  3IXR A;  2O87 A;  5J9C A;  3WGD A;  5ECI B;  1B9Y C;  1AQW A;  4XCS A;  3WD6 A;  1XZO A;  3BD2 A;  4QL7 A;  2FLS A;  5HR2 A;  4X0X A;  2WDU A;  3G9B A;  2X8H A;  1A24 A;  3F4T A;  3WT1 A;  3LJR A;  1SL0 B;  5A4W A;  5HFI A;  3ZFB A;  4NAX A;  1SU9 A;  2TRC P;  1W89 A;  1F2E A;  1S3D A;  2YWN A;  1FO5 A;  1G7O A;  1JLW A;  3NZN A;  1XXU A;  3V1W A;  3L0H A;  5ECO B;  4MPG A;  2H71 A;  2VD0 A;  2HE3 A;  3HZ8 A;  3J7Y b;  5CNW A;  3LYK A;  4N0V A;  3IV4 A;  4JR4 A;  3DKS A;  3C8E A;  5H5Q A;  3LFL A;  1EV4 A;  4YQU A;  2LQO A;  2J23 A;  3F3R A;  5IQY A;  1M0U A;  4IKH A;  2GST A;  1K0B A;  4KND A;  1E6B A;  2X8G A;  2X64 A;  4KSO A;  1QGV A;  1GWC A;  1AUC A;  1MEK A;  1ZYE A;  2DMM A;  1HD2 A;  1QXH A;  5IPG A;  5B6M A;  2LEG A;  2AJQ B;  2HLS A;  3IAS 2;  4ZL9 A;  1YQ1 A;  2DIY A;  3R3E A;  4NV5 A;  3EUR A;  3F6F A;  6GSU A;  2YPM A;  4KB3 A;  1R7H A;  1VF2 A;  5FT3 A;  1ST9 A;  2JZS A;  2PUK C;  4LL1 B;  1A2J A;  1TRS A;  5ECM B;  2LV3 A;  2RM5 A;  3TRX A;  2VM2 A;  4TR4 A;  1U88 A;  3LXT A;  6GSX A;  1THO A;  1MD3 A;  1XWG A;  3PR8 A;  1SYX A;  1CQH A;  3H79 A;  2PN8 A;  2F8A A;  1FVJ A;  3UAR A;  2H72 A;  2M80 A;  3TRP A;  2OA7 A;  1K3O A;  5JWQ B;  4OO4 A;  2CX3 A;  4BVX A;  1TK5 B;  3D5J A;  1GSY A;  3G7J A;  3KJY A;  1YEP A;  2GQL A;  3UJ1 A;  2XPD A;  1PGT A;  2L5O A;  1JZW A;  5IO2 A;  5JCW A;  2I1U A;  1FG4 A;  1M7T A;  2FWE A;  1EWX A;  1O85 A;  2YAN A;  2HRK B;  1PL1 A;  5D9W A;  2UZ8 A;  2V2G A;  4PXO A;  1M9B A;  5JWO B;  2H75 A;  3HJO A;  4EE0 A;  3FW2 A;  5ECK B;  4WF4 A;  2OAD A;  1T7P B;  1SEN A;  2CA8 A;  3UEM A;  4NHW A;  3LYP A;  4H86 A;  2MMO A;  2XBI A;  4XRD A;  4KCE A;  2DML A;  1XVQ A;  1HNB A;  4IGJ A;  1TRW A;  1HNA A;  2H1A A;  1ACV A;  3HJP A;  1M99 A;  4PUR A;  1NW2 A;  4IS0 A;  5D93 A;  1Z7R A;  1JHB A;  3Q6O A;  2LST A;  2PPT A;  4E8E A;  2R5G A;  3QFA C;  1SKW B;  1TW9 A;  4D73 A;  5F8B A;  2GS3 A;  3MDK A;  1UN2 A;  1GNW A;  5L71 A;  2G2Q A;  3QAG A;  3CSI A;  3FYG A;  3KEB A;  4MJB A;  2VUP A;  1I9D A;  1QMV A;  1ZZY A;  3Q74 A;  3KZQ A;  2FWH A;  3TRQ A;  2DC5 A;  5KN1 A;  2B7K A;  2XC2 A;  2YCD A;  5ELA A;  3QFB C;  5KN3 A;  1O6J A;  1FVK A;  3FZ9 A;  2PMT A;  3LWA A;  2VOC A;  3ED3 A;  3C1R A;  2C80 A;  5GST A;  1G6W A;  4ULX A;  2ZNM A;  4TOP A;  3CTF A;  1Z5Y E;  2HSH A;  3TKR A;  2V1M A;  1VGL A;  3LXZ A;  4O7H A;  1V2A A;  1TTZ A;  1GUL A;  1TJD A;  2FWF A;  3CSH A;  4HOJ A;  2H76 A;  4EKZ A;  1LBK A;  3HHV A;  1ON4 A;  4MMM A;  3FR6 A;  4V2M A;  4G10 A;  3KMO A;  1KBN A;  1Q98 A;  3FKF A;  5HFK A;  1SKR B;  2YJ7 A;  3K8N A;  5ECP B;  2G0F A;  2MBT A;  2K6V A;  3EYT A;  2D2Z A;  5HR1 A;  4TN8 A;  1Y6E A;  4JRR A;  2ZUP A;  2LNT A;  2GGT A;  4XIH A;  1XIY A;  1ZOF A;  3BCI A;  3D4T A;  2H30 A;  5DAK B;  1XCC A;  2L6D A;  3IHQ A;  4MH2 A;  4TXV A;  5CRG A;  4WEY A;  3TOT A;  1SK2 A;  3SWL A;  3GMF A;  4IN0 A;  2HSN B;  3NIV A;  2ON5 A;  3CBU A;  6GSW A;  5C04 A;  3UVT A;  1B9X C;  1PA3 A;  3IDV A;  4V1A p;  3F4S A;  1SYR A;  1H4O A;  2B5Y A;  4J2F A;  5IPH A;  1O81 A;  4IVF A;  2JSY A;  2N5F A;  5CRH A;  4TR3 A;  3ZLP A;  1G0T A;  3ZRD A;  4RQR A;  1X5E A;  2F51 A;  4IW9 A;  3F9U A;  2L59 A;  4NPB A;  3GHA A;  2VCW A;  2CAQ A;  3LQ7 A;  4ID0 A;  3P2A A;  2CV4 A;  2IMI A;  2F8F A;  4HZ4 A;  2IJY A;  4DVC A;  2O7K A;  3ZVJ A;  2R6K A;  1F37 A;  1DBY A;  4V2L A;  2FNO A;  4BVY A;  1YZX A;  4O5R A;  4KF9 A;  5J5N A;  1TI3 A;  2BTO T;  1QFN A;  2K8V A;  1WOU A;  1X0R A;  4K2D A;  4WR5 A;  1R26 A;  4NMU A;  3PGT A;  2REM A;  1JZO A;  4L8E A;  2HFD A;  1Z6N A;  2BMX A;  4PX1 A;  3IPZ A;  4YH2 A;  3TKQ A;  5IIZ A;  2B5E A;  1GL8 A;  8GSS A;  3FZ4 A;  4I5Q A;  2XHF A;  2H1B A;  2HZE A;  1B48 A;  1EOH A;  3QPM A;  1OC3 A;  2H66 A;  5AIV A;  4PUA A;  1DSB A;  1M2B A;  4AF2 A;  2VCQ A;  2H6X A;  2CVK A;  3W6G A;  5FWG A;  5G5F A;  1SJ6 A;  3P7X A;  2H01 A;  2OE3 A;  2ES7 A;  1XWA A;  3VI7 A;  1CQG A;  3A5W A;  1ZCP A;  1U6T A;  1AAZ A;  4JBB A;  5ECS A;  2LQQ A;  4POK A;  4I6X A;  3QOU A;  4HJ2 A;  2VCZ A;  1DE1 A;  2CZ2 A;  3DRN A;  3I69 A;  2GDR A;  3MAK A;  2LTK A;  4XRA A;  1G7E A;  2C0E A;  4NXI A;  1A2M A;  17GS A;  4CDO A;  5IMC A;  1SKS B;  3IA1 A;  3ERG A;  4DEJ A;  3EU3 A;  3D4M A;  2H1D A;  4KDX A;  2DJ2 A;  1PD2 1;  2FD3 A;  2I81 A;  2N5B A;  1M9A A;  1F3B A;  5FHI A;  1FHE A;  1SD9 A;  1GSD A;  1TU8 A;  7GSS A;  2PVO C;  3ME8 A;  5DDL A;  5F05 A;  4GXZ A;  4HI7 A;  2KUC A;  2R2J A;  4I97 A;  2DJ1 A;  2WZ9 A;  3ZL5 A;  1XW9 A;  5EVO A;  4ZL8 A;  5ECH B;  4K0N A;  4JED A;  4EDY A;  1H75 A;  5E4W A;  4Q5N A;  3BJ5 A;  5CRW A;  1K0N A;  1JZD A;  3KMN A;  3HD5 A;  1PX7 A;  1OVN A;  5DCH A;  3M1G A;  4TR1 B;  2I3Y A;  1JFU A;  2LRC A;  3F6D A;  1TKD B;  1MTC A;  2DLX A;  2MMZ A;  3VLN A;  4GSN A;  1HQO A;  4V1A g;  4ZB6 A;  4OFT A;  1GNE A;  3TJG A;  1OC9 B;  3Q18 A;  4HUA A;  2E0Q A;  1PKZ A;  2OBK A;  3VWX A;  2LJA A;  4LL4 B;  5AIX A;  1B8X A;  1MD4 A;  3VPT A;  4NV2 A;  4MF5 A;  5G1L A;  1GRX A;  4GSS A;  5COH A;  5KN0 A;  1FB6 A;  1O73 A;  1OE8 A;  2HQT A;  5ECL B;  1K0A A;  1VF4 A;  2KOK A;  1GTA A;  3APQ A;  4L0U A;  2NTO A;  2VO4 A;  4E8H A;  1BJX A;  2AB6 A;  2LS5 A;  1B4P A;  1V58 A;  4OCE A;  1FB0 A;  3PH9 A;  2H73 A; 
#chains in the Genus database with same CATH topology
 2KP2 A;  1UVZ A;  2HNL A;  3LW9 A;  5B8A A;  3KH9 A;  2P5R A;  1V57 A;  5IMF A;  4ECJ A;  4G0I A;  1KTE A;  4EDZ A;  1K0M A;  1X5D A;  4F0B A;  4EIQ A;  3KH7 A;  4ZBB A;  1U87 A;  5J40 A;  2VCT A;  4POM A;  4K7O A;  3TOU A;  2XPE A;  5H5S A;  4ECB A;  1RW1 A;  3US3 A;  5D96 A;  4FIW A;  3TB2 A;  3H8Q A;  3P90 A;  2WW3 A;  4LMV A;  1IYI A;  3VPQ A;  3VFI A;  4MCU A;  2OT3 A;  5J9B A;  2FA4 A;  1PX6 A;  3PPU A;  3CTG A;  1SVO A;  3F4R A;  3IBH A;  3IK7 A;  1GTI A;  4Z2T A;  2OE0 A;  2QKE A;  5ECQ B;  2V6K A;  1GSS A;  4MF6 A;  4G0L A;  2O85 A;  5F07 A;  2NPB A;  1TXX A;  1X9W B;  2FCH A;  2JAD A;  4MA9 A;  3GX0 A;  3RGB C;  3IE3 A;  2V41 A;  4EVM A;  1FW1 A;  1B4Q A;  1SD8 A;  3RHC A;  5BRT A;  2R4V A;  4KUN A;  2HRK A;  2WW0 A;  4USS A;  2C0G A;  4IHU A;  2MMN A;  1M2D A;  3EVI A;  4KDY A;  1EGR A;  3GX8 A;  3L9U A;  2M72 A;  1OAZ A;  1GUK A;  1BQ7 A;  2HRA A;  3FHK A;  3GYK A;  4AI6 A;  2H0I A;  3GUR A;  2RII A;  2GSQ A;  3UMA A;  3FR3 A;  3KXO A;  4XTS A;  3M0F A;  1PL2 A;  3HKR A;  1ZYP A;  2WRT A;  2FGX A;  3QR6 A;  1V9W A;  4ZXG A;  5IMD A;  3GNJ A;  2JAC A;  1ML6 A;  3KCM A;  1EP8 A;  2NVL A;  1A0R P;  1PQN A;  2HYX A;  3LEF A;  1QUW A;  1Z6M A;  3EMP A;  4IP1 A;  1MDJ A;  2YV7 A;  4O32 A;  3GKM A;  4K5S A;  1SL2 B;  2HI7 A;  3VWV A;  2DBC A;  3E3E A;  3I9V 2;  3GKX A;  1VF1 A;  1GTB A;  2L4C A;  2C0F A;  1BAY A;  4N10 A;  3ZIJ A;  3GL3 A;  1T1V A;  4Q5Q A;  4GQC A;  3D6I A;  4AJ6 A;  5CO3 A;  4RQX A;  13GS A;  3C73 A;  2WGR A;  4AKG A;  4GWR A;  2YV9 A;  2K18 A;  5D9T A;  3QCP A;  4ZBD A;  3KD0 A;  1A8L A;  4OCF A;  3DEX A;  4ZB9 A;  5ID2 B;  1ERV A;  1QQ2 A;  4HQZ A;  3RBT A;  3F0I A;  3IAM 2;  4BL7 B;  3H4K A;  2WS2 A;  4OO5 A;  3EWL A;  3VK9 A;  3HVX A;  3ERW A;  12GS A;  1A2L A;  1X5C A;  4O5U A;  2C4J A;  3HVS A;  3L9V A;  4K1F A;  1YKA A;  2YWM A;  2FWG A;  3KGK A;  3G7I A;  4NHZ A;  4XS6 A;  4J56 E;  2A2P A;  3HVN A;  1DE2 A;  2HT9 A;  2X8C A;  3H93 A;  2HXK A;  2VLT A;  2C3N A;  4HU7 A;  1K0D A;  3FZ5 A;  1OE7 A;  3TKS C;  3GN3 A;  1OKT A;  2GLR A;  5G31 A;  3IR4 A;  2B6M A;  4MZC A;  3HYP A;  4XS4 B;  1EEM A;  5DAK A;  4K0G A;  2HZF A;  1N2A A;  4L5O A;  3KTB A;  4PUF C;  2VM1 A;  5AIS A;  1ERT A;  2HSN A;  2KP1 A;  3GIX A;  5H5R A;  1NHY A;  4KAE A;  1K0C A;  1TK8 B;  1TK0 B;  2B5X A;  1ZYQ B;  2B7J A;  3C1S A;  4MF7 A;  2LRN A;  5CRE A;  3ZZX A;  1IYH A;  3ISO A;  2EIR A;  3EIN A;  3FRC A;  3TDG A;  4Z7X A;  4WBJ A;  4I8B A;  2OBI A;  4ILF A;  5DAL B;  3UIW A;  5CAX A;  2YZH A;  4AJ8 A;  4OFN A;  2LJR A;  2K8S A;  3APO A;  2VL2 C;  3KIJ A;  2LRT A;  2I9H A;  4QL9 A;  2IIY A;  3MWH A;  5J3R A;  4ML6 A;  4GCI A;  1YJ6 A;  2VAF A;  4KX4 A;  3MIX A;  4ZIJ A;  4F2I A;  2B3S A;  3FZA A;  4L5L A;  4K2X A;  5BMU B;  4EIP A;  4FO5 A;  2IN3 A;  3TCO A;  4GRF A;  4POB A;  2QGV A;  4CY8 A;  3DVW A;  2ALB A;  2CAI A;  3IC4 A;  2C1Y A;  3EMX A;  4KE3 A;  5HQP A;  5JWR B;  3TJF A;  4HJM A;  4ZBA A;  1XVW A;  4BA7 A;  3A2W A;  2EIO A;  3JCM L;  1WRY A;  6GSY A;  1NSW A;  1T4Z A;  2IFQ B;  1S3A A;  5DQY A;  1EP7 A;  3TKS A;  1THX A;  2CQ9 A;  2TIR A;  5C00 A;  3CRT A;  1R5A A;  3HA9 A;  1M2A A;  3S9F A;  1PFO A;  2MZC A;  3TGZ A;  4TR0 A;  5KEJ A;  4K7I A;  3TJJ A;  4MJE A;  1PSQ A;  1AIU A;  4PQI A;  1A8Y A;  4IJI A;  1NM3 A;  4MAB A;  3RPP A;  4N30 A;  3A2V A;  5IMV A;  4G9H A;  3GH9 A;  2OAC A;  3CXG A;  4DSQ A;  3QMX A;  4JU5 A;  1XW6 A;  20GS A;  1GLP A;  1Z7P A;  3GFK A;  2H70 A;  4EO3 A;  2P0G A;  3EU4 A;  2LJK A;  3RDW A;  4YAV A;  4ECC A;  1ILO A;  3WGX A;  3TUE A;  4YQV A;  5GSS A;  1M3I A;  2M46 A;  1G6Y A;  4NWY A;  2VCV A;  3HY2 A;  2JZT A;  2R0C A;  1XWK A;  1F9M A;  2VL2 A;  1VF3 A;  3ZYW A;  3ZTL A;  5IMA A;  5G1K A;  3D22 A;  3GTU B;  5CRD A;  2UV8 G;  2H0G A;  1WIK A;  1RQM A;  3NOF A;  3D21 A;  5LD0 A;  4MZB A;  3VUR A;  1T8E B;  2R3X A;  5ELG A;  2ZCT A;  3W8J A;  5CP1 A;  2HSM B;  5DVB A;  1TXU A;  4DSS B;  2YNX A;  3WYW A;  2DJ3 A;  5KN2 A;  3IOS A;  4BPY A;  3HZ4 A;  2AV4 A;  3DYR A;  2P31 A;  4TXO B;  5IM9 A;  3F63 A;  5A4U A;  1WE0 A;  4P3Y B;  5LCZ A;  5B6N A;  4AKI A;  2HSY A;  1GLQ A;  5A1N B;  4Q5R A;  4F82 A;  1V40 A;  14GS A;  1LJR A;  3QAV A;  2F9S A;  3APS A;  3GKK A;  2Z9S A;  4RUV A;  3UVH A;  4TR1 A;  4Q5F A;  2A2S A;  4I2T A;  3GV1 A;  1YVL A;  4RI7 A;  2VL3 A;  3TU3 B;  2GT6 A;  1T3B A;  1HNC A;  5IO0 A;  2IMF A;  5ABR A;  5D73 A;  3BCK A;  1LU4 A;  1OC9 A;  2O3E A;  1GSF A;  3O76 A;  1ZGN A;  2XBQ A;  4WF5 A;  2IWT A;  4EL1 A;  2OE1 A;  4J57 E;  3GH6 A;  3E9J B;  3CSJ A;  1YEW C;  5G30 A;  1Y25 A;  1Y1U A;  5INY A;  2V32 A;  4YAP A;  3MSZ A;  1U3A A;  1Z3E A;  4I2U A;  1EEJ A;  1E2Y A;  5HR0 A;  1OKD A;  3DGQ A;  3RAZ A;  4WXT A;  3C7M A;  5F0G A;  5JCG A;  5DBQ A;  5A4V A;  1PN9 A;  5AN1 A;  18GS A;  5D9V A;  5GAP D;  1RK4 A;  3DVX A;  2C3Q A;  4WR4 A;  1N25 A;  2GQM A;  2IL3 A;  4KW6 A;  4MJA A;  3W8S A;  2GZY A;  2KHP A;  4AGS A;  1GP1 A;  2J9H A;  3G7Y A;  3HXS A;  4IBP A;  1MDK A;  4HSC X;  4FH8 A;  2GZZ A;  5D8I A;  2WZS A;  4JE1 A;  2WVY A;  1BYE A;  2GQK A;  4JR6 A;  1GSU A;  3L78 A;  3WT2 A;  3J7Y k;  5DJM A;  1XOB A;  1YF1 A;  3DXB A;  1FOH A;  4TRX A;  4GLT A;  2DJK A;  2L57 A;  1XW5 A;  1OYJ A;  4ZB8 A;  2C3T A;  2VLU A;  1HYU A;  1SJZ A;  1X9S B;  5ECN B;  3GA4 A;  4G19 A;  2X4A A;  2H0H A;  2FUG 2;  4ML1 A;  2YOI A;  4ISD A;  3IK9 A;  1EZK A;  1U3I A;  2NDO A;  4MJC A;  5GZZ B;  4KDU A;  1C72 A;  1YY7 A;  2WJU A;  1F6M C;  3HJM A;  2PER A;  4MNN A;  4OFM A;  3LGC A;  4MH3 A;  4TVE A;  1K0O A;  4BIK A;  2YN1 A;  10GS A;  3KTL A;  1TP9 A;  3TJK A;  3IHG A;  4ZIL A;  2WB9 A;  1ZYN A;  4WKW A;  1DUG A;  2MBS A;  1UA5 A;  1TRV A;  4IQA A;  4O92 A;  1J08 A;  4GF0 A;  2CX4 A;  1ZMA A;  3VWU A;  1JZR A;  4KCA A;  4QQ7 A;  3Q19 A;  2DJ0 A;  4F0C A;  5EL8 A;  3ZMK A;  2LKU A;  1I5G A;  3UBL A;  2CVB A;  2H19 A;  4HQS A;  3ZRE A;  5JCU A;  1YF0 A;  5IOX A;  4EC0 A;  4F03 A;  2LNS A;  2GVP A;  3KM6 A;  2IMK A;  3FY7 A;  2JSZ A;  1TI1 A;  3LG6 A;  3A2X A;  4KA0 A;  1SL1 B;  2WCI A;  4ACS A;  4TW5 A;  2H1G A;  4X1U A;  1TRU A;  2HRN A;  3I43 A;  2WUL A;  1WP0 A;  4QMK A;  1O7U A;  3M9J A;  2AUV A;  5HR3 A;  2A2R A;  3UBK A;  4FYU A;  4YKG A;  3L4N A;  1KEB A;  3EE2 A;  1PRX A;  16GS A;  3AY8 A;  4BVX B;  5IOW A;  1XPV A;  5E59 A;  3DML A;  5GAN D;  2TRX A;  1AW9 A;  3ZIV A;  4MLY A;  1XFL A;  2C0D A;  3L9S A;  4WET A;  2IME A;  5G5E A;  4ZB7 A;  1BG5 A;  3VI5 A;  3GKN A;  2FA8 A;  3IRA A;  5ID2 A;  5IMZ A;  1WMJ A;  1W4V A;  1XBS A;  2EFE A;  4A5P A;  4BL7 A;  5DQS A;  4K6X A;  2B1L A;  2KLX A;  4MP4 A;  2CT6 A;  2R37 A;  2I4A A;  1A23 A;  4TKY A;  4MDC A;  2CVD A;  4HEA 2;  3FEU A;  4PNG A;  1WPI A;  4LLR A;  4FXY P;  2QSI A;  1TOF A;  4LA1 A;  5ENU A;  3N9J A;  2O89 A;  4YQM A;  3GUS A;  5CYY A;  3SBC A;  5A5K A;  1VRS D;  4XS1 A;  4BWS A;  1UC7 A;  3GL5 A;  5G2Z A;  1R5P A;  4GST A;  2YP6 A;  3KP9 A;  4D73 B;  4XS4 A;  4ECI A;  1O8W A;  1GSQ A;  1SK1 A;  3UOM A;  2B1K A;  3LSZ A;  2RM6 A;  1S3C A;  5DCG A;  5D9X A;  3E0U A;  1EGO A;  1V98 A;  1A0F A;  2JL4 A;  1Z9H A;  2AYT A;  1FAA A;  1JLV A;  1BX9 A;  3F8U A;  3PIN A;  4FYB A;  4ZL7 A;  1S3R A;  2PU9 C;  2L5L A;  4KGI A;  4POL A;  5HFG A;  3ZVJ D;  2GTU A;  4HZ2 A;  2QC7 A;  3HCZ A;  4OMV A;  5DAL A;  4N3Z A;  3P8W A;  2DIZ A;  1SVL A;  2IMD A;  2WFC A;  4X43 A;  1J0F A;  3CHX C;  4OD7 A;  3M8N A;  4CHS A;  4MPF A;  2E2G A;  3QDN A;  2L4Q A;  3ZFL A;  1T00 A;  2PVQ A;  5AGY A;  2P5Q A;  5BMU A;  22GS A;  3F3Q A;  1GSE A;  2R0G A;  9GSS A;  4FQU A;  1WWJ A;  3LOR A;  2HRF A;  1AQV A;  2E7P A;  3UL3 A;  2L6C A;  2MYG A;  3VWW A;  4FYC A;  3QD9 A;  3GSS A;  4RI6 A;  3ERF A;  4GTU A;  2O36 A;  3BOA A;  4F9Z A;  3M9K A;  3M3M A;  2LUS A;  4HU9 A;  3CRU A;  1TDI A;  2IFQ A;  5LNK e;  3UAP A;  2VCX A;  11GS A;  19GS A;  2VLV A;  3FR9 A;  4PI0 C;  1ABA A;  4AKX B;  2BJX A;  3GST A;  4PTS A;  6GSV A;  2A4V A;  4AKH A;  1Q4J A;  5A5H B;  3DIE A;  2GT5 A;  3GRX A;  4DSR A;  4PQH A;  2O8V B;  2CZ3 A;  1AQX A;  4LMW A;  2VIM A;  1OC8 A;  1ERU A;  2YJH A;  1PKW A;  4IJ3 A;  4EXJ A;  5ECR B;  1GUM A;  1USB A;  2RUF A;  3RPN A;  2C8U A;  4G2E A;  2WW1 A;  1J9B A;  1T4Y A;  1TU7 A;  1FOV A;  2V6O A;  4O5Q A;  4HS1 A;  1ZL9 A;  3HVV A;  4IP6 A;  2FY6 A;  4BWQ A;  3ZIT A;  4K8M A;  2ON7 A;  4L0W A;  4OWY A;  1YDK A;  3CMI A;  5F06 A;  3U5R E;  2VD1 A;  2X99 A;  2RLI A;  4BVY B;  1AC1 A;  4N0Z A;  2AAW A;  3D0Z A;  3OR5 A;  2GSR A;  4Z2U A;  3I6A A;  4K7N A;  1X9M B;  3MNG A;  3QAW A;  1XWB A;  2YWI A;  2JZR A;  4XHM A;  2PBJ A;  2IPA A;  4KSM A;  2GZP A;  4IQ1 A;  3TJB A;  4WBR D;  2OKA A;  3KP8 A;  3CYN A;  3GTU A;  1EV9 A;  3R2Q A;  2K9F A;  4AJ7 A;  2PWJ A;  2DJJ A;  3O6T A;  1WJK A;  1BED A;  1EOG A;  1QK8 A;  4EUY A;  4EF0 A;  1K3Y A;  2HSM A;  2YWO A;  4CW9 A;  5B8B A;  1F3A A;  1O8X A;  4DSS A;  3N5O A;  3BBY A;  2H6Y A;  2HZE B;  2H6Z A;  3U6V A;  4PI2 C;  3H1N A;  3HDC A;  4HDE A;  5EY6 A;  1XWC A;  4TXO A;  1ERW A;  3DWV A;  3A3T A;  3DD3 A;  1GUH A;  3FK8 A;  5KOW A;  2FHE A;  4G0K A;  2H74 A;  2E2M A;  2JU5 A;  3RHB A;  5A1N A;  1NHO A;  4N11 A;  4KH7 A;  2MMA A;  1SJI A;  5DJL A;  1BF5 A;  4JZQ A;  2F3M A;  4PNF A;  1YKC A;  2VL9 A;  3RFR C;  1XOA A;  4K9Z A;  2NBS A;  3TKS E;  2VKZ G;  3ZML A;  3O3T A;  2AHE A;  4V2N A;  2YZU A;  1R4W A;  2GSS A;  1GTU A;  6GSS A;  2DSA A;  4IEL A;  3TKP A;  1KNG A;  1SK0 A;  2H8L A;  3IC8 A;  6GST A;  3EC3 A;  1AXD A;  3ME7 A;  5A34 B;  5J41 A;  5B7C A;  3C71 A;  1N8J A;  4GQF A;  1K3L A;  2PGT A;  2WVX B;  3WGE A;  1YEX A;  1GH2 A;  1MDI A;  2EIQ A;  1URM A;  1PMT A;  2N5A A;  1M3J A;  4PGT A;  4PQ1 A;  5EPF A;  5J4Y A;  5J4U A;  4MZW A;  2OJL A;  2RUE A;  4MK3 A;  2EC4 A;  3IXR A;  2O87 A;  5J9C A;  3WGD A;  5ECI B;  1B9Y C;  1AQW A;  4XCS A;  3WD6 A;  1XZO A;  3BD2 A;  4QL7 A;  2FLS A;  5HR2 A;  4X0X A;  2WDU A;  3G9B A;  2X8H A;  1A24 A;  3F4T A;  3EPT A;  3WT1 A;  3LJR A;  1SL0 B;  5A4W A;  5HFI A;  3ZFB A;  4NAX A;  1SU9 A;  2TRC P;  1W89 A;  1PN0 A;  1F2E A;  1S3D A;  2YWN A;  1FO5 A;  1G7O A;  1JLW A;  3NZN A;  1XXU A;  3V1W A;  3L0H A;  5ECO B;  4MPG A;  2X49 A;  2H71 A;  2VD0 A;  2HE3 A;  3HZ8 A;  3J7Y b;  5CNW A;  3LYK A;  4N0V A;  3IV4 A;  4JR4 A;  3DKS A;  3C8E A;  5H5Q A;  3LFL A;  1EV4 A;  4YQU A;  2LQO A;  2J23 A;  3F3R A;  5IQY A;  2DKH A;  1M0U A;  4IKH A;  2GST A;  1K0B A;  2QA2 A;  4KND A;  3CWG A;  1E6B A;  2X8G A;  2X64 A;  4KSO A;  1QGV A;  1GWC A;  1AUC A;  1MEK A;  1ZYE A;  2DMM A;  1HD2 A;  1QXH A;  5IPG A;  5B6M A;  2LEG A;  2AJQ B;  2HLS A;  3IAS 2;  5J4V A;  4ZL9 A;  1YQ1 A;  2DIY A;  3R3E A;  3FMW A;  4NV5 A;  3EUR A;  3F6F A;  6GSU A;  2YPM A;  4KB3 A;  1R7H A;  2A4H A;  1VF2 A;  5FT3 A;  1ST9 A;  2JZS A;  2PUK C;  4LL1 B;  1A2J A;  1BG1 A;  1TRS A;  5ECM B;  2WVZ A;  2LV3 A;  2RM5 A;  3TRX A;  2VM2 A;  4TR4 A;  5KOX A;  1U88 A;  3LXT A;  6GSX A;  1THO A;  1MD3 A;  1XWG A;  3PR8 A;  1SYX A;  3HMJ G;  1CQH A;  3H79 A;  2PN8 A;  2F8A A;  1FVJ A;  2R0P A;  3UAR A;  2H72 A;  2M80 A;  3TRP A;  2OA7 A;  1K3O A;  5JWQ B;  4X4J A;  4OO4 A;  2CX3 A;  4BVX A;  1TK5 B;  3D5J A;  1GSY A;  3G7J A;  3KJY A;  1YEP A;  2GQL A;  3UJ1 A;  2XPD A;  1PGT A;  2L5O A;  1JZW A;  5IO2 A;  5JCW A;  2I1U A;  1FG4 A;  1M7T A;  2FWE A;  1EWX A;  1O85 A;  2YAN A;  2HRK B;  1PL1 A;  5D9W A;  2UZ8 A;  2V2G A;  4PXO A;  1M9B A;  5JWO B;  2H75 A;  3HJO A;  4EE0 A;  3FW2 A;  5ECK B;  4WF4 A;  2OAD A;  1T7P B;  1SEN A;  2CA8 A;  3UEM A;  4NHW A;  3LYP A;  4H86 A;  2MMO A;  2XBI A;  4XRD A;  4KCE A;  2DML A;  1XVQ A;  1HNB A;  4IGJ A;  1TRW A;  1HNA A;  2H1A A;  1ACV A;  3HJP A;  1M99 A;  4PUR A;  1NW2 A;  4IS0 A;  5D93 A;  1Z7R A;  1JHB A;  3Q6O A;  2LST A;  2PPT A;  4E8E A;  2R5G A;  1XG8 A;  3QFA C;  1SKW B;  1TW9 A;  4D73 A;  5F8B A;  4W66 A;  2GS3 A;  3MDK A;  2H1L A;  1UN2 A;  1GNW A;  5L71 A;  2G2Q A;  3QAG A;  3CSI A;  3FYG A;  3KEB A;  4MJB A;  2VUP A;  1I9D A;  1QMV A;  1ZZY A;  3Q74 A;  3KZQ A;  2FWH A;  3TRQ A;  2DC5 A;  5KN1 A;  2B7K A;  2XC2 A;  2YCD A;  5ELA A;  3QFB C;  5KN3 A;  1O6J A;  1FVK A;  3FZ9 A;  2PMT A;  3LWA A;  2VOC A;  3ED3 A;  3C1R A;  2C80 A;  5GST A;  1G6W A;  4ULX A;  2ZNM A;  4TOP A;  2QA1 A;  3CTF A;  1Z5Y E;  2HSH A;  3TKR A;  2V1M A;  1VGL A;  3LXZ A;  4O7H A;  1V2A A;  1I1I P;  1TTZ A;  1GUL A;  1TJD A;  2FWF A;  3CSH A;  4HOJ A;  2H76 A;  4EKZ A;  1LBK A;  3HHV A;  1ON4 A;  4YKF A;  4MMM A;  3FR6 A;  4V2M A;  4G10 A;  3KMO A;  1KBN A;  1Q98 A;  3FKF A;  5HFK A;  1SKR B;  2YJ7 A;  3K8N A;  5ECP B;  2G0F A;  2MBT A;  2K6V A;  3EYT A;  2D2Z A;  4GDF A;  4TN8 A;  5HR1 A;  5J47 A;  1Y6E A;  4JRR A;  2ZUP A;  2LNT A;  2GGT A;  4XIH A;  1XIY A;  1ZOF A;  3BCI A;  3D4T A;  2H30 A;  5DAK B;  1XCC A;  2L6D A;  3IHQ A;  4MH2 A;  4TXV A;  5CRG A;  4WEY A;  3TOT A;  1SK2 A;  3SWL A;  3GMF A;  4IN0 A;  2HSN B;  3NIV A;  2ON5 A;  3CBU A;  6GSW A;  5C04 A;  3UVT A;  1B9X C;  5A5H A;  1PA3 A;  3IDV A;  4V1A p;  3F4S A;  1SYR A;  1H4O A;  2B5Y A;  4J2F A;  5IPH A;  1O81 A;  4IVF A;  2JSY A;  2N5F A;  5CRH A;  4TR3 A;  3ZLP A;  1G0T A;  3ZRD A;  4RQR A;  4E68 A;  1X5E A;  2F51 A;  4IW9 A;  3F9U A;  2L59 A;  4NPB A;  3GHA A;  2VCW A;  2CAQ A;  3LQ7 A;  4ID0 A;  3P2A A;  2CV4 A;  2IMI A;  2F8F A;  4HZ4 A;  4G01 A;  2IJY A;  4DVC A;  2O7K A;  3ZVJ A;  4ICY A;  2R6K A;  1F37 A;  1DBY A;  1S4B P;  4V2L A;  2FNO A;  4BVY A;  1YZX A;  4O5R A;  4KF9 A;  5J5N A;  1TI3 A;  2BTO T;  1QFN A;  2K8V A;  1WOU A;  1X0R A;  4K2D A;  4WR5 A;  1R26 A;  4NMU A;  3PGT A;  2REM A;  1JZO A;  4L8E A;  2HFD A;  4Z2R A;  1Z6N A;  2BMX A;  4PX1 A;  3IPZ A;  4YH2 A;  3TKQ A;  5IIZ A;  2B5E A;  1GL8 A;  8GSS A;  3FZ4 A;  4I5Q A;  2XHF A;  2H1B A;  2HZE A;  1B48 A;  1EOH A;  3QPM A;  1OC3 A;  2H66 A;  5AIV A;  4PUA A;  1DSB A;  1M2B A;  4AF2 A;  2O5V A;  2VCQ A;  2H6X A;  2CVK A;  3W6G A;  5FWG A;  5G5F A;  1SJ6 A;  3P7X A;  4PHZ C;  2H01 A;  2OE3 A;  2WW2 A;  2ES7 A;  1XWA A;  3VI7 A;  1CQG A;  3A5W A;  1ZCP A;  1U6T A;  1AAZ A;  2DKI A;  4JBB A;  5ECS A;  2LQQ A;  4POK A;  4I6X A;  3QOU A;  2EFC A;  4HJ2 A;  2VCZ A;  1DE1 A;  2CZ2 A;  3DRN A;  3I69 A;  2GDR A;  3MAK A;  2LTK A;  4XRA A;  1G7E A;  2C0E A;  4NXI A;  1A2M A;  4CY6 A;  17GS A;  4CDO A;  5IMC A;  1SKS B;  3A5I A;  3IA1 A;  3ERG A;  4DEJ A;  3EU3 A;  3D4M A;  2H1D A;  5A34 A;  4KDX A;  2DJ2 A;  1PD2 1;  2FD3 A;  1SVM A;  2I81 A;  2N5B A;  1M9A A;  1F3B A;  2WVX A;  5FHI A;  1FHE A;  1SD9 A;  3CQF A;  1GSD A;  1TU8 A;  7GSS A;  3MYD A;  2PVO C;  3ME8 A;  5DDL A;  5F05 A;  4GXZ A;  4HI7 A;  2KUC A;  2R2J A;  4I97 A;  2DJ1 A;  2WZ9 A;  3ZL5 A;  1XW9 A;  5EVO A;  4ZL8 A;  4K5R A;  5ECH B;  4K0N A;  4JED A;  2EFD A;  4EDY A;  1H75 A;  5E4W A;  4Q5N A;  3BJ5 A;  5CRW A;  1K0N A;  1JZD A;  3KMN A;  3HD5 A;  1PX7 A;  1OVN A;  5DCH A;  3M1G A;  4TR1 B;  2I3Y A;  1JFU A;  2LRC A;  3F6D A;  1TKD B;  1MTC A;  2DLX A;  2MMZ A;  3VLN A;  4GSN A;  1HQO A;  4V1A g;  4ZB6 A;  4OFT A;  1GNE A;  3TJG A;  1OC9 B;  3Q18 A;  4HUA A;  2E0Q A;  1PKZ A;  2OBK A;  3VWX A;  2LJA A;  4LL4 B;  5AIX A;  1B8X A;  1MD4 A;  3VPT A;  4NV2 A;  4MF5 A;  5G1L A;  1GRX A;  4GSS A;  5COH A;  5KN0 A;  1FB6 A;  1O73 A;  1OE8 A;  2HQT A;  5ECL B;  1K0A A;  1VF4 A;  2KOK A;  1GTA A;  3APQ A;  2EFH A;  4L0U A;  2NTO A;  2VO4 A;  4E8H A;  1BJX A;  2AB6 A;  2LS5 A;  1B4P A;  1V58 A;  4OCE A;  1FB0 A;  3PH9 A;  2H73 A; 
#chains in the Genus database with same CATH homology
 2KP2 A;  1UVZ A;  2HNL A;  3LW9 A;  5B8A A;  3KH9 A;  2P5R A;  1V57 A;  5IMF A;  4ECJ A;  4G0I A;  1KTE A;  4EDZ A;  1K0M A;  1X5D A;  4F0B A;  4EIQ A;  3KH7 A;  4ZBB A;  1U87 A;  5J40 A;  2VCT A;  4POM A;  4K7O A;  3TOU A;  2XPE A;  5H5S A;  4ECB A;  1RW1 A;  3US3 A;  5D96 A;  4FIW A;  3TB2 A;  3H8Q A;  3P90 A;  4LMV A;  1IYI A;  3VPQ A;  3VFI A;  4MCU A;  2OT3 A;  5J9B A;  2FA4 A;  1PX6 A;  3PPU A;  3CTG A;  1SVO A;  3F4R A;  3IBH A;  3IK7 A;  1GTI A;  4Z2T A;  2OE0 A;  2QKE A;  5ECQ B;  2V6K A;  1GSS A;  4MF6 A;  4G0L A;  2O85 A;  5F07 A;  2NPB A;  1TXX A;  1X9W B;  2FCH A;  2JAD A;  4MA9 A;  3GX0 A;  3IE3 A;  2V41 A;  4EVM A;  1FW1 A;  1B4Q A;  1SD8 A;  3RHC A;  5BRT A;  2R4V A;  4KUN A;  2HRK A;  4USS A;  2C0G A;  4IHU A;  2MMN A;  1M2D A;  3EVI A;  4KDY A;  1EGR A;  3GX8 A;  3L9U A;  2M72 A;  1OAZ A;  1GUK A;  1BQ7 A;  2HRA A;  3FHK A;  3GYK A;  4AI6 A;  2H0I A;  3GUR A;  2RII A;  2GSQ A;  3UMA A;  3FR3 A;  3KXO A;  4XTS A;  3M0F A;  1PL2 A;  3HKR A;  1ZYP A;  2WRT A;  2FGX A;  3QR6 A;  1V9W A;  4ZXG A;  5IMD A;  3GNJ A;  2JAC A;  1ML6 A;  3KCM A;  1EP8 A;  2NVL A;  1A0R P;  1PQN A;  2HYX A;  3LEF A;  1QUW A;  1Z6M A;  3EMP A;  4IP1 A;  1MDJ A;  2YV7 A;  4O32 A;  3GKM A;  4K5S A;  1SL2 B;  2HI7 A;  3VWV A;  2DBC A;  3E3E A;  3I9V 2;  3GKX A;  1VF1 A;  1GTB A;  2L4C A;  2C0F A;  1BAY A;  4N10 A;  3ZIJ A;  3GL3 A;  1T1V A;  4Q5Q A;  4GQC A;  3D6I A;  4AJ6 A;  5CO3 A;  4RQX A;  13GS A;  3C73 A;  2WGR A;  4AKG A;  4GWR A;  2YV9 A;  2K18 A;  5D9T A;  3QCP A;  4ZBD A;  3KD0 A;  1A8L A;  4OCF A;  3DEX A;  4ZB9 A;  5ID2 B;  1ERV A;  1QQ2 A;  4HQZ A;  3RBT A;  3F0I A;  3IAM 2;  4BL7 B;  3H4K A;  2WS2 A;  4OO5 A;  3EWL A;  3VK9 A;  3HVX A;  3ERW A;  12GS A;  1A2L A;  1X5C A;  4O5U A;  2C4J A;  3HVS A;  3L9V A;  4K1F A;  1YKA A;  2YWM A;  2FWG A;  3KGK A;  3G7I A;  4NHZ A;  4XS6 A;  4J56 E;  2A2P A;  1DE2 A;  2HT9 A;  2X8C A;  3H93 A;  2HXK A;  2VLT A;  2C3N A;  4HU7 A;  1K0D A;  3FZ5 A;  1OE7 A;  3TKS C;  3GN3 A;  1OKT A;  2GLR A;  5G31 A;  3IR4 A;  2B6M A;  4MZC A;  3HYP A;  4XS4 B;  1EEM A;  5DAK A;  4K0G A;  2HZF A;  1N2A A;  4L5O A;  3KTB A;  4PUF C;  2VM1 A;  5AIS A;  1ERT A;  2HSN A;  2KP1 A;  3GIX A;  5H5R A;  1NHY A;  4KAE A;  1K0C A;  1TK8 B;  1TK0 B;  2B5X A;  1ZYQ B;  2B7J A;  3C1S A;  4MF7 A;  2LRN A;  5CRE A;  3ZZX A;  1IYH A;  3ISO A;  2EIR A;  3EIN A;  3FRC A;  3TDG A;  4Z7X A;  4WBJ A;  4I8B A;  2OBI A;  4ILF A;  5DAL B;  3UIW A;  5CAX A;  2YZH A;  4AJ8 A;  4OFN A;  2LJR A;  2K8S A;  3APO A;  2VL2 C;  3KIJ A;  2LRT A;  2I9H A;  4QL9 A;  2IIY A;  3MWH A;  5J3R A;  4ML6 A;  4GCI A;  1YJ6 A;  2VAF A;  4KX4 A;  3MIX A;  4ZIJ A;  4F2I A;  2B3S A;  3FZA A;  4L5L A;  4K2X A;  5BMU B;  4EIP A;  4FO5 A;  2IN3 A;  3TCO A;  4GRF A;  4POB A;  2QGV A;  4CY8 A;  3DVW A;  2ALB A;  2CAI A;  3IC4 A;  2C1Y A;  3EMX A;  4KE3 A;  5HQP A;  5JWR B;  3TJF A;  4HJM A;  4ZBA A;  1XVW A;  4BA7 A;  3A2W A;  2EIO A;  3JCM L;  1WRY A;  6GSY A;  1NSW A;  1T4Z A;  2IFQ B;  1S3A A;  5DQY A;  1EP7 A;  3TKS A;  1THX A;  2CQ9 A;  2TIR A;  5C00 A;  3CRT A;  1R5A A;  3HA9 A;  1M2A A;  3S9F A;  2MZC A;  3TGZ A;  4TR0 A;  5KEJ A;  4K7I A;  3TJJ A;  4MJE A;  1PSQ A;  1AIU A;  4PQI A;  1A8Y A;  4IJI A;  1NM3 A;  4MAB A;  3RPP A;  4N30 A;  3A2V A;  5IMV A;  4G9H A;  3GH9 A;  2OAC A;  3CXG A;  4DSQ A;  3QMX A;  4JU5 A;  1XW6 A;  20GS A;  1GLP A;  1Z7P A;  3GFK A;  2H70 A;  4EO3 A;  2P0G A;  3EU4 A;  2LJK A;  3RDW A;  4YAV A;  4ECC A;  1ILO A;  3WGX A;  3TUE A;  4YQV A;  5GSS A;  2M46 A;  1G6Y A;  4NWY A;  2VCV A;  3HY2 A;  2JZT A;  2R0C A;  1XWK A;  1F9M A;  2VL2 A;  1VF3 A;  3ZYW A;  3ZTL A;  5IMA A;  5G1K A;  3D22 A;  3GTU B;  5CRD A;  2UV8 G;  2H0G A;  1WIK A;  1RQM A;  3NOF A;  3D21 A;  5LD0 A;  4MZB A;  3VUR A;  1T8E B;  2R3X A;  5ELG A;  2ZCT A;  3W8J A;  5CP1 A;  2HSM B;  5DVB A;  1TXU A;  4DSS B;  2YNX A;  3WYW A;  2DJ3 A;  5KN2 A;  3IOS A;  4BPY A;  3HZ4 A;  2AV4 A;  3DYR A;  2P31 A;  4TXO B;  5IM9 A;  3F63 A;  5A4U A;  1WE0 A;  4P3Y B;  5LCZ A;  5B6N A;  4AKI A;  2HSY A;  1GLQ A;  5A1N B;  4Q5R A;  4F82 A;  1V40 A;  14GS A;  1LJR A;  3QAV A;  2F9S A;  3APS A;  3GKK A;  2Z9S A;  4RUV A;  3UVH A;  4TR1 A;  4Q5F A;  2A2S A;  4I2T A;  3GV1 A;  1YVL A;  4RI7 A;  2VL3 A;  3TU3 B;  2GT6 A;  1T3B A;  1HNC A;  5IO0 A;  2IMF A;  5ABR A;  5D73 A;  3BCK A;  1LU4 A;  1OC9 A;  1GSF A;  3O76 A;  1ZGN A;  2XBQ A;  4WF5 A;  2IWT A;  4EL1 A;  2OE1 A;  4J57 E;  3GH6 A;  3E9J B;  3CSJ A;  5G30 A;  1Y25 A;  1Y1U A;  5INY A;  2V32 A;  4YAP A;  3MSZ A;  1U3A A;  1Z3E A;  4I2U A;  1EEJ A;  1E2Y A;  5HR0 A;  1OKD A;  3DGQ A;  3RAZ A;  4WXT A;  3C7M A;  5F0G A;  5JCG A;  5DBQ A;  5A4V A;  1PN9 A;  5AN1 A;  18GS A;  5D9V A;  5GAP D;  1RK4 A;  3DVX A;  2C3Q A;  4WR4 A;  1N25 A;  2GQM A;  2IL3 A;  4KW6 A;  4MJA A;  3W8S A;  2GZY A;  2KHP A;  4AGS A;  1GP1 A;  2J9H A;  3G7Y A;  3HXS A;  4IBP A;  1MDK A;  4FH8 A;  2GZZ A;  5D8I A;  4JE1 A;  1BYE A;  2GQK A;  4JR6 A;  1GSU A;  3L78 A;  3WT2 A;  3J7Y k;  5DJM A;  1XOB A;  1YF1 A;  3DXB A;  1FOH A;  4TRX A;  4GLT A;  2DJK A;  2L57 A;  1XW5 A;  1OYJ A;  4ZB8 A;  2C3T A;  2VLU A;  1HYU A;  1SJZ A;  1X9S B;  5ECN B;  3GA4 A;  4G19 A;  2X4A A;  2H0H A;  2FUG 2;  4ML1 A;  2YOI A;  4ISD A;  3IK9 A;  1EZK A;  1U3I A;  2NDO A;  4MJC A;  5GZZ B;  4KDU A;  1C72 A;  1YY7 A;  2WJU A;  1F6M C;  3HJM A;  2PER A;  4MNN A;  4OFM A;  3LGC A;  4MH3 A;  4TVE A;  1K0O A;  2YN1 A;  10GS A;  3KTL A;  1TP9 A;  3TJK A;  3IHG A;  4ZIL A;  2WB9 A;  1ZYN A;  4WKW A;  1DUG A;  2MBS A;  1UA5 A;  1TRV A;  4IQA A;  4O92 A;  1J08 A;  4GF0 A;  2CX4 A;  1ZMA A;  3VWU A;  1JZR A;  4KCA A;  4QQ7 A;  3Q19 A;  2DJ0 A;  4F0C A;  5EL8 A;  3ZMK A;  2LKU A;  1I5G A;  3UBL A;  2CVB A;  2H19 A;  4HQS A;  3ZRE A;  5JCU A;  1YF0 A;  5IOX A;  4EC0 A;  4F03 A;  2LNS A;  2GVP A;  3KM6 A;  2IMK A;  3FY7 A;  2JSZ A;  1TI1 A;  3LG6 A;  3A2X A;  4KA0 A;  1SL1 B;  2WCI A;  4ACS A;  4TW5 A;  2H1G A;  4X1U A;  1TRU A;  2HRN A;  3I43 A;  2WUL A;  1WP0 A;  4QMK A;  1O7U A;  3M9J A;  2AUV A;  5HR3 A;  2A2R A;  3UBK A;  4FYU A;  4YKG A;  3L4N A;  1KEB A;  3EE2 A;  1PRX A;  16GS A;  3AY8 A;  4BVX B;  5IOW A;  1XPV A;  5E59 A;  3DML A;  5GAN D;  2TRX A;  1AW9 A;  3ZIV A;  4MLY A;  1XFL A;  2C0D A;  3L9S A;  4WET A;  2IME A;  5G5E A;  4ZB7 A;  1BG5 A;  3VI5 A;  3GKN A;  2FA8 A;  3IRA A;  5ID2 A;  5IMZ A;  1WMJ A;  1W4V A;  1XBS A;  2EFE A;  4A5P A;  4BL7 A;  5DQS A;  4K6X A;  2B1L A;  2KLX A;  4MP4 A;  2CT6 A;  2R37 A;  2I4A A;  1A23 A;  4TKY A;  4MDC A;  2CVD A;  4HEA 2;  3FEU A;  4PNG A;  1WPI A;  4LLR A;  2QSI A;  1TOF A;  4LA1 A;  5ENU A;  3N9J A;  2O89 A;  4YQM A;  3GUS A;  5CYY A;  3SBC A;  5A5K A;  1VRS D;  4XS1 A;  4BWS A;  1UC7 A;  3GL5 A;  5G2Z A;  1R5P A;  4GST A;  2YP6 A;  3KP9 A;  4D73 B;  4XS4 A;  4ECI A;  1O8W A;  1GSQ A;  1SK1 A;  3UOM A;  2B1K A;  3LSZ A;  2RM6 A;  1S3C A;  5DCG A;  5D9X A;  3E0U A;  1EGO A;  1V98 A;  1A0F A;  2JL4 A;  1Z9H A;  2AYT A;  1FAA A;  1JLV A;  1BX9 A;  3F8U A;  3PIN A;  4FYB A;  4ZL7 A;  2PU9 C;  2L5L A;  4KGI A;  4POL A;  5HFG A;  3ZVJ D;  2GTU A;  4HZ2 A;  2QC7 A;  3HCZ A;  4OMV A;  5DAL A;  4N3Z A;  3P8W A;  2DIZ A;  1SVL A;  2IMD A;  2WFC A;  4X43 A;  1J0F A;  4OD7 A;  3M8N A;  4CHS A;  4MPF A;  2E2G A;  3QDN A;  2L4Q A;  3ZFL A;  1T00 A;  2PVQ A;  5AGY A;  2P5Q A;  5BMU A;  22GS A;  3F3Q A;  1GSE A;  2R0G A;  9GSS A;  4FQU A;  1WWJ A;  3LOR A;  2HRF A;  1AQV A;  2E7P A;  3UL3 A;  2L6C A;  2MYG A;  3VWW A;  4FYC A;  3QD9 A;  3GSS A;  4RI6 A;  3ERF A;  4GTU A;  3BOA A;  4F9Z A;  3M9K A;  3M3M A;  2LUS A;  4HU9 A;  3CRU A;  1TDI A;  2IFQ A;  5LNK e;  3UAP A;  2VCX A;  11GS A;  19GS A;  2VLV A;  3FR9 A;  1ABA A;  4AKX B;  2BJX A;  3GST A;  4PTS A;  6GSV A;  2A4V A;  4AKH A;  1Q4J A;  5A5H B;  3DIE A;  2GT5 A;  3GRX A;  4DSR A;  4PQH A;  2O8V B;  2CZ3 A;  1AQX A;  4LMW A;  2VIM A;  1OC8 A;  1ERU A;  2YJH A;  1PKW A;  4IJ3 A;  4EXJ A;  5ECR B;  1GUM A;  1USB A;  2RUF A;  3RPN A;  2C8U A;  4G2E A;  1J9B A;  1T4Y A;  1TU7 A;  1FOV A;  2V6O A;  4O5Q A;  4HS1 A;  1ZL9 A;  3HVV A;  4IP6 A;  2FY6 A;  4BWQ A;  3ZIT A;  4K8M A;  2ON7 A;  4L0W A;  4OWY A;  1YDK A;  3CMI A;  5F06 A;  3U5R E;  2VD1 A;  2X99 A;  2RLI A;  4BVY B;  1AC1 A;  4N0Z A;  2AAW A;  3D0Z A;  3OR5 A;  2GSR A;  4Z2U A;  3I6A A;  4K7N A;  1X9M B;  3MNG A;  3QAW A;  1XWB A;  2YWI A;  2JZR A;  4XHM A;  2PBJ A;  2IPA A;  4KSM A;  2GZP A;  4IQ1 A;  3TJB A;  4WBR D;  2OKA A;  3KP8 A;  3CYN A;  3GTU A;  1EV9 A;  3R2Q A;  2K9F A;  4AJ7 A;  2PWJ A;  2DJJ A;  3O6T A;  1WJK A;  1BED A;  1EOG A;  1QK8 A;  4EUY A;  4EF0 A;  1K3Y A;  2HSM A;  2YWO A;  4CW9 A;  5B8B A;  1F3A A;  1O8X A;  4DSS A;  3N5O A;  3BBY A;  2H6Y A;  2HZE B;  2H6Z A;  3U6V A;  3H1N A;  3HDC A;  4HDE A;  5EY6 A;  1XWC A;  4TXO A;  1ERW A;  3DWV A;  3A3T A;  3DD3 A;  1GUH A;  3FK8 A;  5KOW A;  2FHE A;  4G0K A;  2H74 A;  2E2M A;  2JU5 A;  3RHB A;  5A1N A;  1NHO A;  4N11 A;  4KH7 A;  2MMA A;  1SJI A;  5DJL A;  1BF5 A;  4JZQ A;  2F3M A;  4PNF A;  1YKC A;  2VL9 A;  1XOA A;  4K9Z A;  2NBS A;  3TKS E;  2VKZ G;  3ZML A;  3O3T A;  2AHE A;  4V2N A;  2YZU A;  1R4W A;  2GSS A;  1GTU A;  6GSS A;  2DSA A;  4IEL A;  3TKP A;  1KNG A;  1SK0 A;  2H8L A;  3IC8 A;  6GST A;  3EC3 A;  1AXD A;  3ME7 A;  5A34 B;  5J41 A;  5B7C A;  3C71 A;  1N8J A;  4GQF A;  1K3L A;  2PGT A;  3WGE A;  1YEX A;  1GH2 A;  1MDI A;  2EIQ A;  1URM A;  1PMT A;  2N5A A;  4PGT A;  4PQ1 A;  5EPF A;  5J4Y A;  5J4U A;  4MZW A;  2OJL A;  2RUE A;  4MK3 A;  2EC4 A;  3IXR A;  2O87 A;  5J9C A;  3WGD A;  5ECI B;  1B9Y C;  1AQW A;  4XCS A;  3WD6 A;  1XZO A;  3BD2 A;  4QL7 A;  2FLS A;  5HR2 A;  4X0X A;  2WDU A;  3G9B A;  2X8H A;  1A24 A;  3F4T A;  3EPT A;  3WT1 A;  3LJR A;  1SL0 B;  5A4W A;  5HFI A;  3ZFB A;  4NAX A;  1SU9 A;  2TRC P;  1W89 A;  1PN0 A;  1F2E A;  1S3D A;  2YWN A;  1FO5 A;  1G7O A;  1JLW A;  3NZN A;  1XXU A;  3V1W A;  3L0H A;  5ECO B;  4MPG A;  2X49 A;  2H71 A;  2VD0 A;  2HE3 A;  3HZ8 A;  3J7Y b;  5CNW A;  3LYK A;  4N0V A;  3IV4 A;  4JR4 A;  3DKS A;  3C8E A;  5H5Q A;  3LFL A;  1EV4 A;  4YQU A;  2LQO A;  2J23 A;  3F3R A;  5IQY A;  2DKH A;  1M0U A;  4IKH A;  2GST A;  1K0B A;  2QA2 A;  4KND A;  3CWG A;  1E6B A;  2X8G A;  2X64 A;  4KSO A;  1QGV A;  1GWC A;  1AUC A;  1MEK A;  1ZYE A;  2DMM A;  1HD2 A;  1QXH A;  5IPG A;  5B6M A;  2LEG A;  2AJQ B;  2HLS A;  3IAS 2;  5J4V A;  4ZL9 A;  1YQ1 A;  2DIY A;  3R3E A;  3FMW A;  4NV5 A;  3EUR A;  3F6F A;  6GSU A;  2YPM A;  4KB3 A;  1R7H A;  2A4H A;  1VF2 A;  5FT3 A;  1ST9 A;  2JZS A;  2PUK C;  4LL1 B;  1A2J A;  1BG1 A;  1TRS A;  5ECM B;  2LV3 A;  2RM5 A;  3TRX A;  2VM2 A;  4TR4 A;  5KOX A;  1U88 A;  3LXT A;  6GSX A;  1THO A;  1MD3 A;  1XWG A;  3PR8 A;  1SYX A;  3HMJ G;  1CQH A;  3H79 A;  2PN8 A;  2F8A A;  1FVJ A;  2R0P A;  3UAR A;  2H72 A;  2M80 A;  3TRP A;  2OA7 A;  1K3O A;  5JWQ B;  4X4J A;  4OO4 A;  2CX3 A;  4BVX A;  1TK5 B;  3D5J A;  1GSY A;  3G7J A;  3KJY A;  1YEP A;  2GQL A;  3UJ1 A;  2XPD A;  1PGT A;  2L5O A;  1JZW A;  5IO2 A;  5JCW A;  2I1U A;  1FG4 A;  1M7T A;  2FWE A;  1EWX A;  1O85 A;  2YAN A;  2HRK B;  1PL1 A;  5D9W A;  2UZ8 A;  2V2G A;  4PXO A;  1M9B A;  5JWO B;  2H75 A;  3HJO A;  4EE0 A;  3FW2 A;  5ECK B;  4WF4 A;  2OAD A;  1T7P B;  1SEN A;  2CA8 A;  3UEM A;  4NHW A;  3LYP A;  4H86 A;  2MMO A;  2XBI A;  4XRD A;  4KCE A;  2DML A;  1XVQ A;  1HNB A;  4IGJ A;  1TRW A;  1HNA A;  2H1A A;  1ACV A;  3HJP A;  1M99 A;  4PUR A;  1NW2 A;  4IS0 A;  5D93 A;  1Z7R A;  1JHB A;  3Q6O A;  2LST A;  2PPT A;  4E8E A;  2R5G A;  3QFA C;  1SKW B;  1TW9 A;  4D73 A;  5F8B A;  4W66 A;  2GS3 A;  3MDK A;  2H1L A;  1UN2 A;  1GNW A;  5L71 A;  2G2Q A;  3QAG A;  3CSI A;  3FYG A;  3KEB A;  4MJB A;  2VUP A;  1I9D A;  1QMV A;  1ZZY A;  3Q74 A;  3KZQ A;  2FWH A;  3TRQ A;  2DC5 A;  5KN1 A;  2B7K A;  2XC2 A;  2YCD A;  5ELA A;  3QFB C;  5KN3 A;  1O6J A;  1FVK A;  3FZ9 A;  2PMT A;  3LWA A;  2VOC A;  3ED3 A;  3C1R A;  2C80 A;  5GST A;  1G6W A;  4ULX A;  2ZNM A;  4TOP A;  2QA1 A;  3CTF A;  1Z5Y E;  2HSH A;  3TKR A;  2V1M A;  1VGL A;  3LXZ A;  4O7H A;  1V2A A;  1TTZ A;  1GUL A;  1TJD A;  2FWF A;  3CSH A;  4HOJ A;  2H76 A;  4EKZ A;  1LBK A;  3HHV A;  1ON4 A;  4YKF A;  4MMM A;  3FR6 A;  4V2M A;  4G10 A;  3KMO A;  1KBN A;  1Q98 A;  3FKF A;  5HFK A;  1SKR B;  2YJ7 A;  3K8N A;  5ECP B;  2G0F A;  2MBT A;  2K6V A;  3EYT A;  2D2Z A;  4GDF A;  4TN8 A;  5HR1 A;  5J47 A;  1Y6E A;  4JRR A;  2ZUP A;  2LNT A;  2GGT A;  4XIH A;  1XIY A;  1ZOF A;  3BCI A;  3D4T A;  2H30 A;  5DAK B;  1XCC A;  2L6D A;  3IHQ A;  4MH2 A;  4TXV A;  5CRG A;  4WEY A;  3TOT A;  1SK2 A;  3SWL A;  3GMF A;  4IN0 A;  2HSN B;  3NIV A;  2ON5 A;  3CBU A;  6GSW A;  5C04 A;  3UVT A;  1B9X C;  5A5H A;  1PA3 A;  3IDV A;  4V1A p;  3F4S A;  1SYR A;  1H4O A;  2B5Y A;  4J2F A;  5IPH A;  1O81 A;  4IVF A;  2JSY A;  2N5F A;  5CRH A;  4TR3 A;  3ZLP A;  1G0T A;  3ZRD A;  4RQR A;  4E68 A;  1X5E A;  2F51 A;  4IW9 A;  3F9U A;  2L59 A;  4NPB A;  3GHA A;  2VCW A;  2CAQ A;  3LQ7 A;  4ID0 A;  3P2A A;  2CV4 A;  2IMI A;  2F8F A;  4HZ4 A;  4G01 A;  2IJY A;  4DVC A;  2O7K A;  3ZVJ A;  4ICY A;  2R6K A;  1F37 A;  1DBY A;  4V2L A;  2FNO A;  4BVY A;  1YZX A;  4O5R A;  4KF9 A;  5J5N A;  1TI3 A;  2BTO T;  1QFN A;  2K8V A;  1WOU A;  1X0R A;  4K2D A;  4WR5 A;  1R26 A;  4NMU A;  3PGT A;  2REM A;  1JZO A;  4L8E A;  2HFD A;  4Z2R A;  1Z6N A;  2BMX A;  4PX1 A;  3IPZ A;  4YH2 A;  3TKQ A;  5IIZ A;  2B5E A;  1GL8 A;  8GSS A;  3FZ4 A;  4I5Q A;  2XHF A;  2H1B A;  2HZE A;  1B48 A;  1EOH A;  3QPM A;  1OC3 A;  2H66 A;  5AIV A;  4PUA A;  1DSB A;  1M2B A;  4AF2 A;  2O5V A;  2VCQ A;  2H6X A;  2CVK A;  3W6G A;  5FWG A;  5G5F A;  1SJ6 A;  3P7X A;  2H01 A;  2OE3 A;  2ES7 A;  1XWA A;  3VI7 A;  1CQG A;  3A5W A;  1ZCP A;  1U6T A;  1AAZ A;  2DKI A;  4JBB A;  5ECS A;  2LQQ A;  4POK A;  4I6X A;  3QOU A;  2EFC A;  4HJ2 A;  2VCZ A;  1DE1 A;  2CZ2 A;  3DRN A;  3I69 A;  2GDR A;  3MAK A;  2LTK A;  4XRA A;  1G7E A;  2C0E A;  4NXI A;  1A2M A;  4CY6 A;  17GS A;  4CDO A;  5IMC A;  1SKS B;  3A5I A;  3IA1 A;  3ERG A;  4DEJ A;  3EU3 A;  3D4M A;  2H1D A;  5A34 A;  4KDX A;  2DJ2 A;  1PD2 1;  2FD3 A;  1SVM A;  2I81 A;  2N5B A;  1M9A A;  1F3B A;  5FHI A;  1FHE A;  1SD9 A;  1GSD A;  1TU8 A;  7GSS A;  3MYD A;  2PVO C;  3ME8 A;  5DDL A;  5F05 A;  4GXZ A;  4HI7 A;  2KUC A;  2R2J A;  4I97 A;  2DJ1 A;  2WZ9 A;  3ZL5 A;  1XW9 A;  5EVO A;  4ZL8 A;  4K5R A;  5ECH B;  4K0N A;  4JED A;  2EFD A;  4EDY A;  1H75 A;  5E4W A;  4Q5N A;  3BJ5 A;  5CRW A;  1K0N A;  1JZD A;  3KMN A;  3HD5 A;  1PX7 A;  1OVN A;  5DCH A;  3M1G A;  4TR1 B;  2I3Y A;  1JFU A;  2LRC A;  3F6D A;  1TKD B;  1MTC A;  2DLX A;  2MMZ A;  3VLN A;  4GSN A;  1HQO A;  4V1A g;  4ZB6 A;  4OFT A;  1GNE A;  3TJG A;  1OC9 B;  3Q18 A;  4HUA A;  2E0Q A;  1PKZ A;  2OBK A;  3VWX A;  2LJA A;  4LL4 B;  5AIX A;  1B8X A;  1MD4 A;  3VPT A;  4NV2 A;  4MF5 A;  5G1L A;  1GRX A;  4GSS A;  5COH A;  5KN0 A;  1FB6 A;  1O73 A;  1OE8 A;  2HQT A;  5ECL B;  1K0A A;  1VF4 A;  2KOK A;  1GTA A;  3APQ A;  2EFH A;  4L0U A;  2NTO A;  2VO4 A;  4E8H A;  1BJX A;  2AB6 A;  2LS5 A;  1B4P A;  1V58 A;  4OCE A;  1FB0 A;  3PH9 A;  2H73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...