3F6FA

Crystal structure of glutathione transferase dmgstd10 from drosophila melanogaster
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
b'MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGWEENWAGCQEFRKYFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG18548-PA (IP02196p) (IP02193p)
publication title Structural evidence for conformational changes of Delta class glutathione transferases after ligand binding
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 81
structure length 209
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3f6fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f6fA01
1Z7RA 2GS3A 4DSSA 4IQAA 2C80A 5HFGA 4PQHA 2RUEA 2GSQA 4POBA 3L9SA 16GSA 2V32A 4FYUA 2VD0A 2FUG2 3VPQA 2BMXA 1GLQA 1ST9A 2K9FA 1TP9A 4MZBA 1XFLA 4AJ6A 2GQLA 3ISOA 5B7CA 2HSHA 1SD9A 2PUKC 3U6VA 1UA5A 5FHIA 4BVXB 2L57A 4QL7A 4GCIA 1TU8A 1HYUA 5EVOA 2EIQA 4I2UA 4ISDA 5CRDA 2L5OA 2O89A 4BVYB 2B6MA 1U87A 3UBKA 1UC7A 3A2XA 1CQGA 5JCWA 2F3MA 3GSTA 5J5NA 1GNWA 6GSVA 2TIRA 2YJ7A 5B6NA 3G7YA 3C1RA 2IMFA 1OAZA 1R7HA 4E8EA 2IFQB 2WB9A 3EU3A 2ZNMA 1SK0A 1NHYA 4YAVA 2RUFA 5INYA 5JWQB 5DQSA 2OA7A 1EEMA 5IOXA 1I5GA 2VL9A 3M3MA 4YQVA 4GF0A 1J9BA 3MDKA 3DVWA 3TB2A 3US3A 2DJKA 1ZYEA 4BA7A 3ZMLA 1XBSA 1BQ7A 4X1UA 2GT6A 4EDYA 4NMUA 2YP6A 3FZ9A 3F0IA 1HQOA 1PL2A 1YJ6A 4G9HA 4QL9A 4V1Ap 3WGDA 2YWOA 2F51A 1TW9A 1PA3A 2R4VA 5B6MA 3BOAA 1ZCPA 4G0IA 1XCCA 2FY6A 4DVCA 4G10A 4Q5QA 4V1Ag 5IO0A 4MJBA 3EMXA 4ZILA 4GQFA 4HQSA 3ZFBA 3I9V2 1XOAA 2HI7A 3GKXA 2YV7A 5EL8A 1FW1A 4WF4A 4GXZA 2P5RA 2A2RA 2B7KA 3HJPA 2B7JA 4J56E 2V1MA 3DD3A 3KP8A 4IHUA 5GAND 3DRNA 1NSWA 4IQ1A 3APSA 3KMNA 1YZXA 1SK1A 1JZRA 2H1GA 2K8VA 5A5KA 4KX4A 2L6CA 3PH9A 3ERWA 3W6GA 2QKEA 1R5PA 3ZL5A 2HRKB 1CQHA 3DWVA 4KDUA 5KN0A 3Q18A 3QD9A 2WFCA 3H79A 3IC8A 4KAEA 3TJGA 3GA4A 3Q6OA 1FVKA 3W8SA 1R26A 3HJMA 3GMFA 4ZBBA 3D0ZA 4DEJA 2VD1A 5JWRB 2VCXA 4F0CA 3D4TA 7GSSA 4EC0A 1ML6A 2VL2A 3WYWA 3IXRA 1J08A 3P7XA 2GZYA 2HSMB 4ZBAA 2HQTA 1MDIA 2Z9SA 2DIYA 1B8XA 5AIXA 2JZSA 2RM6A 2DJ2A 4KB3A 18GSA 1O8XA 4AJ8A 2R37A 2HNLA 1SJZA 1U6TA 5D93A 3W8JA 5JWOB 2PGTA 2C0FA 4TR4A 2R6KA 5CRHA 1PGTA 2H66A 4ZBDA 4IS0A 1YEPA 1GRXA 5G5FA 1N2AA 1X9WB 4K2DA 4RI6A 2H6YA 2VCTA 2KUCA 3QMXA 1FB0A 4XS4B 4POLA 3ZLPA 4CHSA 1VF1A 1TKDB 1ERWA 1Y25A 3P8WA 4K0GA 2XC2A 3ZTLA 1M2DA 2P5QA 5CRGA 4OMVA 3F6FA 2CVBA 4POKA 3M1GA 5EY6A 1LU4A 3I6AA 2P0GA 1LJRA 2A4VA 1A2LA 4ML1A 3G7IA 3CTFA 3IBHA 2NVLA 1T3BA 1M7TA 2MMAA 1BG5A 3FW2A 2LSTA 2NBSA 5KN3A 3HCZA 2PVOC 1JZDA 2CQ9A 2H70A 2K18A 3IC4A 1V57A 1XW9A 2YWMA 3WT1A 2R3XA 1RW1A 3DMLA 4XIHA 1TJDA 1MD4A 1XPVA 2PVQA 2WULA 3TKSC 1YKCA 1DBYA 1XXUA 3M9KA 1T7PB 4LMWA 4MP4A 5ECHB 5IQYA 1WWJA 4GRFA 5A4VA 2ES7A 3A2VA 4K7OA 5ELGA 1DUGA 6GSUA 2ALBA 2B3SA 2FHEA 1V98A 2GSTA 3E9JB 3QOUA 3UVTA 2X99A 4ECJA 4MPGA 1GSDA 5IMAA 2H1DA 2E0QA 4JRRA 3L78A 5HFKA 1OE8A 5B8AA 1FAAA 1TU7A 2F8AA 2VLVA 3D4MA 4DSRA 4L8EA 1XVQA 2QGVA 3ZVJD 1VF3A 2JL4A 3HZ8A 2H0IA 3ERFA 3QAGA 2OE1A 5IIZA 1O7UA 3LYKA 2PMTA 1SENA 2H30A 1SJ6A 1SU9A 3MWHA 4IELA 2H1AA 1BX9A 4HJMA 4GTUA 5ECOB 1X5DA 3G7JA 5HR3A 2H0HA 5AN1A 2IIYA 4NXIA 4GQCA 2LNSA 4CW9A 2TRCP 1EOGA 3HVXA 4ID0A 1OC9A 4GWRA 3TDGA 1GLPA 4IJIA 4KCEA 1IYHA 13GSA 1AQVA 1M9AA 1FHEA 2KP1A 2CAIA 4K6XA 5G1LA 1GTIA 3VLNA 5CO3A 2X8GA 1U3AA 1H4OA 4PQIA 2FA8A 2C8UA 1GUHA 1GSUA 2IMEA 2A2SA 3HXSA 3LFLA 3KTBA 2V6KA 2AV4A 4XS1A 1O85A 1G6YA 3LXTA 1PKWA 2OJLA 5DAKA 3E3EA 5DVBA 2VCZA 2LRCA 5DQYA 2MYGA 4K8MA 4ZB9A 4IBPA 4WF5A 2OE3A 5IM9A 3KZQA 3PPUA 1ZGNA 4MF6A 4FO5A 2RM5A 3L0HA 5IMVA 2VCVA 5A4WA 2HSNB 1GP1A 2YZHA 1PSQA 3UIWA 1JLVA 3UOMA 1SL1B 3O6TA 3FR9A 3V1WA 5HFIA 3TKRA 1ZMAA 4JU5A 1XW5A 3SBCA 2H0GA 4ZL9A 1A0FA 2L5LA 2CAQA 3FY7A 4OCFA 4ILFA 1AIUA 3ZRDA 5IMZA 2AB6A 3MAKA 2H74A 3H1NA 19GSA 3ZVJA 4FQUA 1EWXA 2X64A 4D73B 1F37A 2X8HA 3EE2A 4O7HA 1T00A 2PWJA 2R5GA 2LTKA 2PPTA 2YN1A 2GSRA 6GSYA 2H1BA 2WGRA 4BL7A 4O5RA 3H8QA 5AIVA 3VK9A 1M9BA 6GSWA 14GSA 5ECLB 3QCPA 3GL3A 4KA0A 2GVPA 4RQXA 2VM1A 3MNGA 2CVKA 2DMMA 4TRXA 4WR5A 2NDOA 4KGIA 1K0NA 2BJXA 3VI7A 1M2BA 3D5JA 4MZCA 4TVEA 2PN8A 3A3TA 1XZOA 3GRXA 2JACA 2VM2A 2QSIA 1SK2A 1G6WA 3FYGA 4TXOA 1EV9A 3LSZA 3CSJA 1PL1A 1SD8A 6GSTA 2M46A 1QMVA 3LYPA 11GSA 4WBRD 5HR0A 4EL1A 2NTOA 2DLXA 2YZUA 3QR6A 4HEA2 4XTSA 1USBA 5J9BA 1B4QA 3R2QA 1XW6A 1TXXA 3KD0A 3GKMA 1HNAA 4ZB6A 1U88A 3FK8A 2OADA 1JZOA 4HZ4A 2R2JA 2O85A 2YOIA 1SYXA 3PINA 3ZMKA 1AC1A 4MF7A 1EEJA 2VAFA 4KCAA 5IMFA 5D9XA 3GYKA 4N11A 4BWQA 2C3QA 4P3YB 1XWAA 1O8WA 1PX6A 3I69A 4JR6A 3TKSA 3M9JA 3APOA 3GIXA 2H8LA 5F8BA 2B5XA 1AW9A 3RAZA 4YQMA 5GSTA 5D73A 1K0CA 3O76A 3P90A 1RK4A 2L4CA 4KDYA 1SL0B 1E2YA 4MJCA 2GGTA 3UAPA 3IA1A 1XIYA 5J41A 3FR6A 5DCHA 1Z5YE 3C71A 2H71A 5CREA 3ZIJA 1UVZA 4HQZA 5H5QA 4HS1A 3RDWA 2EC4A 2JSZA 3F4TA 2HZEA 2ZCTA 4E8HA 1FOVA 1PQNA 4WKWA 3LWAA 2DBCA 2DJ3A 4G19A 3LG6A 3A2WA 4TR1A 3UBLA 2J9HA 1Q4JA 1TK0B 1XWKA 4Z7XA 4NV2A 3FHKA 2C0GA 1QFNA 2IMDA 3VI5A 3KH9A 4OWYA 1Z3EA 4FYCA 2MBSA 5A4UA 3F63A 3WGEA 5GAPD 5H5SA 4ZB8A 2FWFA 3GTUA 4HI7A 4RI7A 2OACA 1B9XC 4TN8A 2HZFA 3IE3A 3FKFA 5KEJA 2J23A 2ON7A 1KBNA 4OFTA 2M80A 1C72A 3BCKA 2VCQA 1TRSA 5C04A 4TR3A 4WBJA 3LXZA 5LNKe 4ML6A 1YF1A 1QK8A 2C4JA 1F9MA 5FT3A 2FGXA 3EYTA 2I4AA 3HD5A 3NZNA 4BVXA 1GSYA 2XBQA 5F05A 1YEXA 2HYXA 2MZCA 2FWEA 1JHBA 1TRWA 4BVYA 4PNFA 1TK5B 2BTOT 3EVIA 1F6MC 4TKYA 3QDNA 1IYIA 2O8VB 5AGYA 4N30A 3K8NA 5KN2A 2LS5A 3GH9A 2GZPA 2KOKA 3WT2A 2CX4A 1ON4A 1Y6EA 2DSAA 5CRWA 5DALB 4KUNA 2IFQA 1VF4A 4F2IA 1EZKA 1ERTA 3OR5A 2V6OA 3TUEA 3KGKA 3VFIA 1GNEA 2GT5A 2H72A 4TW5A 2ON5A 4X0XA 3H93A 5ID2B 4ZL7A 1AAZA 3U5RE 4EVMA 2REMA 3UEMA 5D9WA 2XHFA 3KXOA 1XVWA 3VWXA 1LBKA 3VURA 2HRNA 2VIMA 3FZ4A 5DBQA 4KE3A 4N0VA 3ZIVA 2YNXA 2E7PA 1HD2A 3HDCA 4AGSA 5L71A 2I3YA 2CZ3A 5CP1A 2MMZA 3JCML 3QAWA 3GFKA 1SKWB 4HDEA 1UN2A 1Z7PA 4EE0A 2I1UA 3WGXA 4ZL8A 1JFUA 2C0DA 4MK3A 4XHMA 3GHAA 1W4VA 9GSSA 1TRUA 3KM6A 1J0FA 3UVHA 1T1VA 1A24A 1RQMA 1ZL9A 1M2AA 1O81A 4MH2A 4NPBA 1YQ1A 3HVVA 1TI1A 1ERUA 1B4PA 4JEDA 2WDUA 4GSNA 4K0NA 2YJHA 3ME8A 3GX8A 1PD21 5G5EA 3GX0A 1K0OA 2KHPA 3ERGA 1X0RA 1ZYQB 3DXBA 1GTAA 1FVJA 10GSA 3J7Yk 2VCWA 4F9ZA 3EMPA 2JZRA 3GKNA 1EP8A 2HRKA 2VLTA 5J9CA 4IKHA 2B5YA 3IV4A 1NM3A 2FCHA 2O7KA 3GNJA 4MH3A 1X9MB 4EUYA 4DSSB 4TR0A 5E59A 2K8SA 3HZ4A 4IN0A 4NHZA 4LMVA 4K7IA 2OE0A 3KIJA 1ACVA 3RPNA 4O92A 5HQPA 3TJFA 1WP0A 3BD2A 17GSA 4EO3A 4KF9A 1PKZA 5ECKB 4MCUA 4MJEA 2DC5A 2I81A 5D96A 3EWLA 5G2ZA 3F6DA 1YDKA 4V2MA 1GH2A 3QFBC 6GSSA 3J7Yb 3G9BA 3M8NA 5F06A 3HJOA 3ZITA 2XPEA 1GSQA 4PTSA 2VLUA 4OO4A 3BCIA 4KSOA 3RHCA 3DVXA 4MLYA 5DJMA 5IPGA 4MZWA 2VOCA 4XS4A 2H19A 2FD3A 2YV9A 5GZZB 4IVFA 5G30A 3NIVA 2FWHA 3PGTA 3GKKA 1QQ2A 3TKPA 1ZZYA 4JE1A 2H01A 1WMJA 1T4YA 3TKSE 3TOUA 2VL2C 4KSMA 1GUKA 6GSXA 3TJKA 3L4NA 2UZ8A 4PXOA 2FA4A 4EXJA 1U3IA 1V40A 1URMA 4BPYA 4ACSA 3CXGA 3QFAC 1YKAA 3TRXA 3CRUA 1GUMA 2N5AA 1SKRB 3L9VA 1BYEA 3F9UA 3LGCA 3RHBA 2OKAA 3KP9A 5H5RA 4RUVA 1I9DA 3IRAA 3D6IA 4O32A 1MDJA 3TJJA 1SYRA 1A8LA 5ECMB 3F3QA 2I9HA 4XRDA 2YCDA 4WEYA 1QXHA 5ECRB 2JU5A 12GSA 3TOTA 4MDCA 1NHOA 2E2GA 3RPPA 1PRXA 3CRTA 3ZFLA 5BMUA 2X8CA 4KH7A 4USSA 1AQXA 3N9JA 1OC3A 1SKSB 5B8BA 2CX3A 2HLSA 1N8JA 4NV5A 2JZTA 2K6VA 3LORA 5ECQB 4EDZA 2FWGA 3H4KA 2LV3A 5CNWA 2AHEA 3FR3A 4JZQA 4G0KA 2O87A 4IP1A 2HRAA 3DKSA 4EKZA 1EOHA 3IDVA 2DJ1A 3TGZA 2WZ9A 5D8IA 2H75A 5KN1A 3DGQA 1FG4A 5ECSA 1MD3A 5CAXA 1QGVA 2CZ2A 1JZWA 2GZZA 1VF2A 2C3TA 3LJRA 1W89A 4TOPA 4WXTA 2F9SA 3GURA 3PR8A 3FEUA 1KNGA 4YQUA 4IJ3A 3KH7A 4N10A 4PURA 2YANA 1V58A 5DDLA 4PUFC 3F4RA 1OYJA 2AYTA 1XWCA 2LJKA 4ECIA 3VWVA 2LRNA 3TKQA 4HOJA 1T4ZA 2DJJA 2L6DA 5J3RA 3Q19A 3HKRA 1KEBA 2AJQB 4Q5NA 1F2EA 5HR2A 4Q5RA 1F3BA 1B9YC 2LJAA 2C3NA 2XPDA 1MDKA 3E0UA 4YAPA 3EC3A 3L9UA 3UMAA 1T8EB 2LQQA 3ZREA 1A2JA 1A0RP 3EU4A 3TJBA 2OBIA 2CT6A 4PUAA 4MA9A 2GDRA 3DEXA 3AY8A 3NOFA 3C8EA 4NWYA 5F0GA 3I43A 4HZ2A 1G7EA 5JCGA 1AXDA 4ULXA 1BEDA 5ECPB 3R3EA 2KP2A 1ZOFA 3N5OA 3HY2A 5E4WA 1ABAA 3VWUA 3FZ5A 4N0ZA 4CDOA 1PN9A 4L5LA 1GULA 4OFMA 3KMOA 2HRFA 4H86A 3DIEA 5ENUA 3C7MA 2CVDA 3IOSA 5D9TA 1TTZA 2LEGA 1PMTA 3P2AA 5G1KA 2WCIA 2VUPA 1WJKA 4D73A 3HVSA 4FIWA 2LNTA 4J2FA 4F03A 4FH8A 4AF2A 3Q74A 4L0WA 5J4UA 3FZAA 4MJAA 4BWSA 2PBJA 4WR4A 2YPMA 2N5FA 3IK9A 3RBTA 3IR4A 3LQ7A 5IMCA 4HUAA 4LL4B 1S3AA 4K9ZA 4XCSA 1GWCA 2L59A 3C1SA 1TK8B 2DJ0A 1X5CA 3S9FA 1OKTA 2WRTA 3IHQA 1OKDA 1TOFA 3UJ1A 2LKUA 3EINA 3TRPA 3GSSA 2YWIA 1WE0A 1EGRA 3EURA 2OBKA 3KCMA 3CSHA 20GSA 4KNDA 1GSSA 3ED3A 5ECIB 4FYBA 4G2EA 3CSIA 1PX7A 5F07A 4Q5FA 2IJYA 8GSSA 2HSYA 5AISA 1THOA 1WOUA 2MMNA 1SL2B 4MPFA 1DE2A 1FO5A 3VWWA 1HNCA 4LLRA 1OC9B 5CYYA 3QPMA 2GTUA 4JBBA 1VRSD 4HU9A 1Q98A 4EF0A 2V41A 1GL8A 4OO5A 3O3TA 2DMLA 3GUSA 2HXKA 2JSYA 4I6XA 2FNOA 2LRTA 3HYPA 2YWNA 4V2LA 2QC7A 5GSSA 2JADA 2TRXA 4WETA 4AJ7A 4PGTA 2CV4A 5COHA 1AQWA 4K7NA 5DCGA 1K0MA 5LCZA 4NAXA 1S3CA 1BJXA 1KTEA 5IPHA 5DAKB 1ERVA 1K0DA 2LUSA 1M0UA 4I2TA 2LJRA 3BJ5A 2RLIA 4PX1A 2B1LA 5HR1A 3MSZA 2GSSA 1R5AA 2ZUPA 4J57E 3F8UA 3KEBA 2VO4A 4F0BA 2HT9A 1K3OA 3HHVA 1YY7A 2HE3A 4POMA 1FB6A 3TRQA 2WS2A 5D9VA 2AUVA 4L0UA 2IMIA 2KLXA 4X43A 4IP6A 2GQMA 3TCOA 2LQOA 4OCEA 1O73A 1SJIA 3A5WA 3KTLA 22GSA 4ECBA 2IWTA 1QUWA 3WD6A 3CTGA 2M72A 1EV4A 1Z6NA 3SWLA 2NPBA 5DJLA 2H6XA 4HJ2A 4ZIJA 1S3DA 3GH6A 1B48A 5C00A 3HA9A 5IMDA 1GTUA 4K1FA 1A23A 1K0AA 4BL7B 1GTBA 1TRVA 5LD0A 2B5EA 3BBYA 1BAYA 2D2ZA 1V2AA 4I97A 2PU9C 2G2QA 1A2MA 2IN3A 4KW6A 2IMKA 1JLWA 4ECCA 2P31A 3D22A 3FRCA 2HSMA 5IOWA 2PERA 1XWBA 2L4QA 3CMIA 2V2GA 4TXOB 1VGLA 3APQA 2N5BA 1WPIA 4GSSA 5EPFA 4PNGA 1WRYA 4MF5A 4MMMA 2HFDA 2IPAA 1X9SB 5FWGA 4NHWA 5DALA 4PQ1A 3GL5A 3C73A 4I5QA 4G0LA 5ECNB 2IL3A 1OE7A 1TDIA 4QQ7A 1NW2A 3GV1A 4DSQA 1OVNA 1O6JA 5ID2A 2WJUA 4L5OA 1WIKA 2MBTA 1TI3A 4YH2A 3KJYA 5G31A 3M0FA 1G0TA 3F4SA 1EGOA 4IGJA 4MABA 2F8FA 1GSEA 2G0FA 1YF0A 1K3YA 1H75A 1OC8A 4KDXA 1ILOA 4RQRA 4TXVA 5IO2A 1MTCA 4F82A 1A8YA 3ZZXA 2E2MA 4JR4A 3UL3A 2C0EA 3VPTA 1XWGA 3F3RA 3D21A 1F3AA 2B1KA 5ABRA 1AUCA 1DE1A 2GQKA 3QAVA 1XOBA 4LA1A 2MMOA 2VL3A 2FLSA 3DYRA 3ME7A 4OD7A 1EP7A 3IAM2 1THXA 2EIRA 2XBIA 4XS6A 4I8BA 1V9WA 4ZXGA 1GSFA 2HZEB 2GLRA 4HU7A 2H6ZA 1Z9HA 3IAS2 4TR1B 2CA8A 3ZYWA 2H73A 4IW9A 3GN3A 1MEKA 1X5EA 4GLTA 2AAWA 1M99A 2RIIA 3LEFA 1R4WA 1E6BA 3IPZA 3CYNA 2EIOA 2C1YA 3IK7A 5ELAA 4GSTA 3UARA 3CBUA 2DIZA 4OFNA 1HNBA 4XRAA 2H76A 4LL1B 5JCUA 3GTUB 1DSBA 1K0BA 1G7OA 1Z6MA 4V2NA 1K3LA
chains in the Genus database with same CATH superfamily
1Z7RA 2GS3A 4DSSA 4IQAA 2C80A 5HFGA 4PQHA 2RUEA 2GSQA 4POBA 3L9SA 16GSA 2V32A 3EPTA 2VKZG 4FYUA 2VD0A 2FUG2 3VPQA 2BMXA 3CWGA 1GLQA 1ST9A 2K9FA 1TP9A 4MZBA 1XFLA 4AJ6A 2GQLA 3ISOA 5B7CA 2HSHA 1SD9A 2PUKC 3U6VA 1UA5A 5FHIA 4BVXB 4PHZC 2L57A 4QL7A 4GCIA 1TU8A 1HYUA 5EVOA 2EIQA 4I2UA 4ISDA 5CRDA 2EFHA 3TU3B 2L5OA 2O89A 4BVYB 2B6MA 1U87A 3UBKA 1UC7A 3A2XA 1CQGA 5JCWA 2F3MA 3GSTA 5J5NA 1GNWA 6GSVA 2TIRA 2YJ7A 5B6NA 3G7YA 3C1RA 2IMFA 2WW1A 1OAZA 1R7HA 4E8EA 2IFQB 2WB9A 3EU3A 2ZNMA 1SK0A 1NHYA 4YAVA 2RUFA 5INYA 5JWQB 5DQSA 2OA7A 1EEMA 5IOXA 1I5GA 2VL9A 3M3MA 4YQVA 4GF0A 1J9BA 3MDKA 3DVWA 3TB2A 3US3A 2DJKA 1ZYEA 4BA7A 3ZMLA 1XBSA 1BQ7A 4X1UA 2GT6A 4EDYA 4NMUA 2YP6A 3FZ9A 3F0IA 1HQOA 1PL2A 1YJ6A 4G9HA 1YVLA 4QL9A 4V1Ap 3WGDA 2YWOA 2F51A 1TW9A 1M3IA 1PA3A 2R4VA 5B6MA 3BOAA 1ZCPA 4G0IA 1XCCA 2FY6A 4DVCA 4G10A 4Q5QA 4V1Ag 5IO0A 4MJBA 3EMXA 4ZILA 4GQFA 4E68A 3MYDA 4HQSA 3ZFBA 3I9V2 1XOAA 2HI7A 3RFRC 3GKXA 2YV7A 5EL8A 1FW1A 4WF4A 4GXZA 2P5RA 2A2RA 4X4JA 2B7KA 3HJPA 2B7JA 4J56E 2V1MA 3DD3A 3KP8A 4IHUA 5GAND 3DRNA 1NSWA 4IQ1A 3APSA 3KMNA 1YZXA 1SK1A 1JZRA 2H1GA 2K8VA 5A5KA 4KX4A 2L6CA 3PH9A 3ERWA 3W6GA 2QKEA 1R5PA 3ZL5A 2HRKB 1CQHA 2A2PA 3DWVA 4KDUA 5KN0A 3Q18A 3QD9A 2WFCA 2O36A 3H79A 3IC8A 4KAEA 3TJGA 3GA4A 3Q6OA 1FVKA 3W8SA 1R26A 3HJMA 3GMFA 4ZBBA 3D0ZA 4DEJA 2VD1A 5JWRB 2VCXA 4F0CA 3D4TA 1TXUA 7GSSA 4EC0A 1ML6A 2VL2A 3WYWA 3IXRA 1J08A 3P7XA 2GZYA 2HSMB 4ZBAA 2HQTA 1MDIA 2Z9SA 2DIYA 1B8XA 5AIXA 2JZSA 2RM6A 2DJ2A 4KB3A 18GSA 1O8XA 4AJ8A 2R37A 2HNLA 1SJZA 1U6TA 5D93A 3W8JA 5JWOB 2PGTA 2C0FA 4TR4A 2R6KA 5CRHA 1PGTA 2H66A 4ZBDA 4IS0A 1YEPA 1GRXA 5G5FA 1N2AA 1X9WB 4K2DA 4RI6A 2H6YA 2VCTA 2KUCA 3QMXA 1FB0A 4XS4B 4POLA 3ZLPA 4CHSA 1VF1A 1TKDB 1ERWA 1Y25A 3P8WA 4K0GA 2XC2A 3ZTLA 4PI2C 1M2DA 2P5QA 5CRGA 4OMVA 3F6FA 1YEWC 2CVBA 4POKA 3M1GA 5EY6A 1LU4A 3I6AA 2P0GA 1LJRA 2A4VA 1A2LA 4GDFA 4ICYA 4ML1A 3G7IA 3CTFA 3IBHA 2NVLA 1T3BA 1M7TA 2MMAA 1BG5A 3FW2A 2LSTA 2NBSA 5KN3A 3HCZA 2PVOC 1JZDA 2CQ9A 2H70A 2K18A 3IC4A 1V57A 1XW9A 2YWMA 3WT1A 2R3XA 1RW1A 3DMLA 4XIHA 1TJDA 1MD4A 1XPVA 2PVQA 2WULA 3TKSC 1YKCA 1DBYA 1XXUA 3M9KA 1T7PB 4LMWA 4MP4A 5ECHB 5IQYA 1WWJA 4GRFA 5A4VA 2ES7A 3A2VA 4K7OA 5ELGA 2QA1A 1DUGA 6GSUA 2ALBA 2B3SA 2FHEA 1V98A 2GSTA 3E9JB 3QOUA 3UVTA 2X99A 4ECJA 4MPGA 1GSDA 5IMAA 2H1DA 2E0QA 5BMUB 4JRRA 3L78A 5HFKA 1OE8A 5B8AA 1FAAA 1TU7A 2F8AA 2VLVA 3D4MA 4DSRA 4L8EA 1XVQA 2QGVA 3ZVJD 1VF3A 2JL4A 3HZ8A 2H0IA 3ERFA 3QAGA 2OE1A 5IIZA 1O7UA 3LYKA 2PMTA 1SENA 2H30A 1SJ6A 1SU9A 3MWHA 2WVZA 4IELA 2H1AA 1BX9A 4HJMA 4GTUA 3RGBC 5ECOB 1X5DA 2A4HA 3G7JA 5HR3A 2H0HA 5AN1A 2IIYA 2R0PA 4NXIA 3IHGA 4GQCA 2LNSA 4CW9A 2TRCP 1EOGA 3HVXA 4ID0A 2O5VA 1OC9A 4GWRA 3TDGA 1GLPA 4IJIA 4KCEA 1IYHA 13GSA 1AQVA 1M9AA 5J4VA 1FHEA 2KP1A 2CAIA 4K6XA 5G1LA 1GTIA 3VLNA 5CO3A 2EFEA 2X8GA 1U3AA 1H4OA 2WVXB 4PQIA 2FA8A 2C8UA 1GUHA 1GSUA 2IMEA 2A2SA 3HXSA 3LFLA 3KTBA 2V6KA 2AV4A 4XS1A 1O85A 1G6YA 3LXTA 1PKWA 2OJLA 5DAKA 3E3EA 5DVBA 2VCZA 5A5HA 2LRCA 5DQYA 2MYGA 4K8MA 4ZB9A 4IBPA 4WF5A 2OE3A 5IM9A 3KZQA 3PPUA 4BIKA 1ZGNA 4MF6A 4FO5A 2RM5A 3L0HA 5IMVA 2VCVA 5KOXA 5A4WA 2HSNB 1GP1A 2YZHA 1PSQA 3UIWA 1JLVA 3UOMA 1SL1B 3O6TA 3FR9A 3V1WA 5HFIA 3TKRA 1ZMAA 4JU5A 1XW5A 3SBCA 4Z2TA 2H0GA 4ZL9A 1A0FA 2L5LA 2CAQA 3FY7A 4OCFA 4ILFA 1AIUA 3ZRDA 5IMZA 2AB6A 3MAKA 2H74A 3H1NA 19GSA 3ZVJA 4FQUA 1EWXA 4O5QA 2X64A 4D73B 1F37A 2X8HA 3EE2A 4O7HA 1T00A 4AKXB 2PWJA 2R5GA 2LTKA 2PPTA 4FXYP 2YN1A 2WZSA 2GSRA 6GSYA 4AKHA 2H1BA 2WGRA 4BL7A 4O5RA 3H8QA 5AIVA 3VK9A 4AI6A 1M9BA 6GSWA 14GSA 5ECLB 3QCPA 3GL3A 4KA0A 2GVPA 4RQXA 2VM1A 3MNGA 2CVKA 2DMMA 4TRXA 4WR5A 2NDOA 4KGIA 1K0NA 2BJXA 3VI7A 4O5UA 1M2BA 3D5JA 4MZCA 4TVEA 2PN8A 3A3TA 1XZOA 3GRXA 2JACA 2X49A 2VM2A 2QSIA 1SK2A 1G6WA 3FYGA 4TXOA 1EV9A 3LSZA 3CSJA 1PL1A 1SD8A 6GSTA 2M46A 1QMVA 3LYPA 5A1NB 11GSA 4WBRD 5HR0A 4EL1A 2NTOA 2DLXA 2YZUA 3QR6A 4HEA2 4XTSA 1USBA 3HVNA 2DKIA 2EFDA 5J9BA 1B4QA 3R2QA 1XW6A 1TXXA 3KD0A 3GKMA 1HNAA 4ZB6A 1U88A 3FK8A 2OADA 1JZOA 4HZ4A 4N3ZA 2R2JA 2O85A 2YOIA 1SYXA 3PINA 3ZMKA 2R0GA 1M3JA 1AC1A 4MF7A 1EEJA 2VAFA 4KCAA 5IMFA 5D9XA 3GYKA 4N11A 4BWQA 2C3QA 4P3YB 2R0CA 1XWAA 1O8WA 3A5IA 1PX6A 3I69A 4JR6A 3TKSA 3M9JA 3APOA 3GIXA 2H8LA 5F8BA 2B5XA 1AW9A 3RAZA 4YQMA 5GSTA 5D73A 1K0CA 3O76A 3P90A 1RK4A 2L4CA 4KDYA 1SL0B 5KOWA 1E2YA 4MJCA 2GGTA 3UAPA 3IA1A 1XIYA 5J41A 3FR6A 5DCHA 1Z5YE 3C71A 2H71A 5CREA 3ZIJA 1UVZA 4HQZA 5H5QA 4HS1A 1BG1A 2EC4A 5A34A 3RDWA 2JSZA 3F4TA 2HZEA 2ZCTA 4E8HA 1FOVA 1PQNA 4WKWA 3LWAA 2DBCA 2DJ3A 4G19A 3LG6A 3A2WA 4TR1A 3UBLA 2J9HA 5J40A 1Q4JA 1TK0B 1XWKA 4Z7XA 4NV2A 3FHKA 2C0GA 1QFNA 2IMDA 3VI5A 3KH9A 4OWYA 1Z3EA 4FYCA 2MBSA 5A4UA 3F63A 3WGEA 5GAPD 5H5SA 4ZB8A 2FWFA 3GTUA 4HI7A 4RI7A 2OACA 1B9XC 4TN8A 2HZFA 3IE3A 4AKGA 3FKFA 4W66A 5KEJA 2J23A 2ON7A 1KBNA 4OFTA 2M80A 1C72A 3BCKA 2VCQA 1TRSA 5C04A 4EIPA 4TR3A 4WBJA 3LXZA 5LNKe 4ML6A 1YF1A 1QK8A 2C4JA 1F9MA 5FT3A 2FGXA 3EYTA 2I4AA 3HD5A 3NZNA 4BVXA 1GSYA 2XBQA 5F05A 1YEXA 2HYXA 2MZCA 2FWEA 1JHBA 1TRWA 4BVYA 4PNFA 1TK5B 2BTOT 3EVIA 1F6MC 4TKYA 3QDNA 1IYIA 2O8VB 5AGYA 4N30A 3K8NA 5KN2A 1PFOA 2LS5A 3GH9A 2GZPA 2KOKA 3WT2A 2CX4A 1ON4A 1Y6EA 2DSAA 5CRWA 5DALB 4KUNA 2IFQA 1VF4A 4F2IA 1EZKA 1ERTA 3OR5A 2V6OA 3TUEA 3KGKA 3VFIA 1GNEA 2GT5A 2H72A 4TW5A 2ON5A 4X0XA 3H93A 5ID2B 4ZL7A 1AAZA 1BF5A 3U5RE 4EVMA 2REMA 3UEMA 5D9WA 2XHFA 3KXOA 1XVWA 3VWXA 1LBKA 3VURA 2HRNA 2VIMA 3FZ4A 5DBQA 4KE3A 4N0VA 3ZIVA 2YNXA 2E7PA 1HD2A 3HDCA 4AGSA 5L71A 2I3YA 2CZ3A 2OT3A 5CP1A 4A5PA 2MMZA 3JCML 3QAWA 3GFKA 1SKWB 4HDEA 1UN2A 5A5HB 1Z7PA 4EE0A 2I1UA 3WGXA 4ZL8A 1JFUA 2C0DA 4MK3A 4XHMA 3GHAA 1W4VA 9GSSA 1TRUA 3KM6A 2X4AA 4CY6A 1J0FA 3UVHA 1T1VA 1A24A 1RQMA 1ZL9A 1M2AA 1O81A 4MH2A 4NPBA 1YQ1A 3HVVA 1TI1A 1ERUA 4Z2RA 1B4PA 4JEDA 2WDUA 4GSNA 4K0NA 2YJHA 3ME8A 3GX8A 4EIQA 1PD21 5G5EA 3GX0A 1K0OA 2KHPA 3ERGA 1X0RA 1ZYQB 3DXBA 1GTAA 1FVJA 10GSA 3J7Yk 2VCWA 4F9ZA 1SVOA 3EMPA 2JZRA 3GKNA 1S4BP 1EP8A 2HRKA 2VLTA 5J9CA 4IKHA 2DKHA 2B5YA 3IV4A 1NM3A 2FCHA 2O7KA 3GNJA 4MH3A 1X9MB 4EUYA 4DSSB 4TR0A 5E59A 2K8SA 3HZ4A 4IN0A 4NHZA 4LMVA 4K7IA 2OE0A 3KIJA 1ACVA 3RPNA 4O92A 5HQPA 3TJFA 1WP0A 3BD2A 17GSA 4EO3A 4ZB7A 4KF9A 1PKZA 5ECKB 4MCUA 4MJEA 2DC5A 2I81A 5D96A 3EWLA 5G2ZA 3F6DA 1YDKA 4V2MA 1GH2A 3QFBC 6GSSA 3J7Yb 3G9BA 3M8NA 5F06A 3HJOA 3ZITA 2XPEA 1GSQA 1ZYPA 4PTSA 2VLUA 4OO4A 3BCIA 2H1LA 4KSOA 3RHCA 3DVXA 4MLYA 5DJMA 5IPGA 4MZWA 2VOCA 4XS4A 2H19A 2FD3A 2YV9A 5GZZB 1ZYNA 4IVFA 4AKIA 5G30A 3NIVA 2FWHA 3PGTA 3GKKA 1QQ2A 3TKPA 1ZZYA 4JE1A 1FOHA 2H01A 1WMJA 4K5RA 1T4YA 3TKSE 3TOUA 2VL2C 4KSMA 1GUKA 6GSXA 3TJKA 3L4NA 2UZ8A 4PXOA 2FA4A 4EXJA 1U3IA 1V40A 1URMA 4BPYA 4ACSA 3CXGA 1I1IP 3QFAC 1YKAA 3TRXA 3CRUA 1GUMA 2N5AA 1SKRB 3L9VA 1BYEA 3F9UA 3LGCA 3RHBA 2OKAA 3KP9A 5H5RA 4RUVA 1I9DA 3IRAA 3D6IA 1S3RA 4O32A 1MDJA 4K5SA 3TJJA 1SYRA 1A8LA 5ECMB 3F3QA 2I9HA 4XRDA 2YCDA 4WEYA 1QXHA 5ECRB 2JU5A 12GSA 3TOTA 4MDCA 1NHOA 2E2GA 3RPPA 1PRXA 3CRTA 3ZFLA 5BMUA 2X8CA 4KH7A 4USSA 1AQXA 3N9JA 1OC3A 1SKSB 5B8BA 2CX3A 2HLSA 1N8JA 4NV5A 2JZTA 2K6VA 3LORA 5ECQB 4EDZA 2FWGA 3H4KA 2LV3A 5CNWA 2AHEA 3FR3A 4JZQA 4G0KA 2O87A 4IP1A 2HRAA 3DKSA 4EKZA 1EOHA 3IDVA 2DJ1A 3LW9A 3TGZA 2WZ9A 5D8IA 2H75A 5KN1A 3DGQA 1FG4A 5ECSA 1MD3A 5CAXA 1QGVA 2CZ2A 1PN0A 1JZWA 2GZZA 1VF2A 2C3TA 3LJRA 1W89A 4TOPA 4WXTA 2F9SA 3GURA 3PR8A 3FEUA 1KNGA 4YQUA 4IJ3A 3KH7A 4N10A 4PURA 2YANA 1V58A 5DDLA 4PUFC 3F4RA 1OYJA 2AYTA 1XWCA 2LJKA 2O3EA 4ECIA 3VWVA 2LRNA 3TKQA 4HOJA 1T4ZA 2DJJA 2L6DA 5J3RA 3Q19A 3HKRA 1KEBA 2AJQB 4Q5NA 1F2EA 5HR2A 4Q5RA 1F3BA 1B9YC 2WVXA 2LJAA 2C3NA 2XPDA 1MDKA 3E0UA 4YAPA 3EC3A 3L9UA 3UMAA 1T8EB 2LQQA 3ZREA 1A2JA 4MNNA 1A0RP 3EU4A 3TJBA 2OBIA 2CT6A 4PUAA 4MA9A 2GDRA 3DEXA 3AY8A 3NOFA 3C8EA 4NWYA 5F0GA 3I43A 4K2XA 4HZ2A 1G7EA 5JCGA 1AXDA 2HSNA 4ULXA 1BEDA 5ECPB 3R3EA 2KP2A 2EFCA 1ZOFA 3N5OA 3HY2A 5E4WA 1ABAA 3VWUA 3FZ5A 4CY8A 4N0ZA 4CDOA 1PN9A 4L5LA 1GULA 4OFMA 3KMOA 2HRFA 4H86A 3DIEA 5ENUA 3C7MA 2CVDA 3IOSA 5D9TA 1TTZA 2LEGA 1PMTA 5J4YA 3P2AA 5G1KA 2WCIA 2VUPA 1WJKA 4D73A 4Z2UA 3HVSA 4FIWA 2LNTA 4J2FA 4F03A 4FH8A 1Y1UA 4AF2A 5J47A 3Q74A 4L0WA 5J4UA 3FZAA 2UV8G 4MJAA 4BWSA 2PBJA 4WR4A 2YPMA 2N5FA 3IK9A 3RBTA 3IR4A 3LQ7A 5IMCA 4HUAA 4YKGA 4LL4B 1S3AA 4K9ZA 2WW2A 4XCSA 1GWCA 2L59A 3C1SA 1TK8B 2DJ0A 1X5CA 3S9FA 1OKTA 2WRTA 3IHQA 1OKDA 1TOFA 3UJ1A 2LKUA 3EINA 3TRPA 3GSSA 2YWIA 1WE0A 1EGRA 3EURA 2OBKA 3KCMA 3CSHA 2WW3A 20GSA 4KNDA 1GSSA 1XG8A 3ED3A 2WW0A 5ECIB 5A1NA 4FYBA 4G2EA 3CSIA 1PX7A 4PI0C 5F07A 4Q5FA 2IJYA 8GSSA 2HSYA 1N25A 5AISA 1THOA 1WOUA 2MMNA 1SL2B 4MPFA 1DE2A 1FO5A 3VWWA 1HNCA 4LLRA 1OC9B 5CYYA 3QPMA 2GTUA 4JBBA 1VRSD 3MIXA 4HU9A 1Q98A 4EF0A 2V41A 1GL8A 4OO5A 3O3TA 2DMLA 3GUSA 2HXKA 2JSYA 4I6XA 2FNOA 2LRTA 3HYPA 2YWNA 4V2LA 2QC7A 5GSSA 2JADA 2TRXA 4WETA 4AJ7A 4PGTA 2CV4A 5COHA 1AQWA 4K7NA 5DCGA 1K0MA 5LCZA 4NAXA 1S3CA 1BJXA 1KTEA 5IPHA 5DAKB 1ERVA 1K0DA 2LUSA 1M0UA 3HMJG 4I2TA 2LJRA 5BRTA 3BJ5A 2RLIA 4PX1A 2B1LA 5HR1A 3MSZA 2GSSA 1R5AA 2ZUPA 4J57E 3F8UA 3KEBA 2VO4A 4F0BA 2HT9A 1K3OA 3HHVA 1YY7A 2HE3A 4POMA 1FB6A 3TRQA 2WS2A 5D9VA 2AUVA 4L0UA 2IMIA 2KLXA 4X43A 4IP6A 2GQMA 3TCOA 2LQOA 4OCEA 1O73A 1SJIA 3A5WA 3KTLA 22GSA 4ECBA 2IWTA 1QUWA 3WD6A 3CTGA 2M72A 1EV4A 1Z6NA 3SWLA 2NPBA 5DJLA 2H6XA 4HJ2A 4ZIJA 1S3DA 3GH6A 1B48A 5C00A 3HA9A 5IMDA 1GTUA 4K1FA 1A23A 1K0AA 4BL7B 1GTBA 1TRVA 5LD0A 2B5EA 3BBYA 1BAYA 2D2ZA 1V2AA 4I97A 2PU9C 1SVMA 2G2QA 1A2MA 2IN3A 4KW6A 2IMKA 1JLWA 4ECCA 2P31A 3D22A 3FRCA 2HSMA 5IOWA 2PERA 1XWBA 2L4QA 4HSCX 3CMIA 2V2GA 4TXOB 1VGLA 3APQA 2N5BA 1WPIA 4GSSA 5EPFA 4PNGA 1WRYA 4YKFA 4MF5A 4MMMA 2HFDA 2IPAA 1X9SB 5FWGA 4NHWA 5DALA 4PQ1A 3GL5A 3C73A 4I5QA 4G0LA 5ECNB 2QA2A 2IL3A 1OE7A 1TDIA 4QQ7A 1NW2A 3GV1A 4DSQA 1OVNA 1O6JA 5ID2A 2WJUA 1SVLA 4L5OA 1WIKA 2MBTA 1TI3A 4YH2A 2WVYA 3KJYA 5G31A 3M0FA 1G0TA 3F4SA 1EGOA 4IGJA 4MABA 2F8FA 4G01A 1GSEA 2G0FA 1YF0A 1K3YA 1H75A 1OC8A 4KDXA 1ILOA 4RQRA 4TXVA 5IO2A 1MTCA 4F82A 1A8YA 3ZZXA 2E2MA 4JR4A 3UL3A 2C0EA 3VPTA 1XWGA 3F3RA 3D21A 1F3AA 2B1KA 5ABRA 1AUCA 1DE1A 2GQKA 3QAVA 1XOBA 4LA1A 2MMOA 2VL3A 2FLSA 3DYRA 3ME7A 4OD7A 1EP7A 3IAM2 5A34B 1THXA 2EIRA 2XBIA 4XS6A 4I8BA 1V9WA 4ZXGA 1GSFA 2HZEB 2GLRA 4HU7A 2H6ZA 1Z9HA 3IAS2 4TR1B 3CHXC 2CA8A 3ZYWA 2H73A 3FMWA 4IW9A 3GN3A 1MEKA 1X5EA 4GLTA 2AAWA 1M99A 2RIIA 3LEFA 1R4WA 1E6BA 3IPZA 3CYNA 2EIOA 2C1YA 3CQFA 3IK7A 5ELAA 4GSTA 3UARA 3CBUA 2DIZA 4OFNA 1HNBA 4XRAA 2H76A 4LL1B 5JCUA 3GTUB 1DSBA 1K0BA 4QMKA 1G7OA 1Z6MA 4V2NA 1K3LA
chains in the Genus database with same CATH topology
1Z7RA 2GS3A 4DSSA 4IQAA 2C80A 5HFGA 4PQHA 2RUEA 2GSQA 4POBA 3L9SA 16GSA 2V32A 3EPTA 2VKZG 4FYUA 2VD0A 2FUG2 3VPQA 2BMXA 3CWGA 1GLQA 1ST9A 2K9FA 1TP9A 4MZBA 1XFLA 4AJ6A 2GQLA 3ISOA 5B7CA 2HSHA 1SD9A 2PUKC 3U6VA 1UA5A 5FHIA 4BVXB 2L57A 4QL7A 4GCIA 1TU8A 1HYUA 5EVOA 2EIQA 4I2UA 4ISDA 5CRDA 2EFHA 3TU3B 2L5OA 2O89A 4BVYB 2B6MA 1U87A 3UBKA 1UC7A 3A2XA 1CQGA 5JCWA 2F3MA 3GSTA 5J5NA 1GNWA 6GSVA 2TIRA 2YJ7A 5B6NA 3G7YA 3C1RA 2IMFA 1OAZA 1R7HA 4E8EA 2IFQB 2WB9A 3EU3A 2ZNMA 1SK0A 1NHYA 4YAVA 2RUFA 5INYA 5JWQB 5DQSA 2OA7A 1EEMA 5IOXA 1I5GA 2VL9A 3M3MA 4YQVA 4GF0A 1J9BA 3MDKA 3DVWA 3TB2A 3US3A 2DJKA 1ZYEA 4BA7A 3ZMLA 1XBSA 1BQ7A 4X1UA 2GT6A 4EDYA 4NMUA 2YP6A 3FZ9A 3F0IA 1HQOA 1PL2A 1YJ6A 4G9HA 1YVLA 4QL9A 4V1Ap 3WGDA 2YWOA 2F51A 1TW9A 1PA3A 2R4VA 5B6MA 3BOAA 1ZCPA 4G0IA 1XCCA 2FY6A 4DVCA 4G10A 4Q5QA 4V1Ag 5IO0A 4MJBA 3EMXA 4ZILA 4GQFA 4E68A 3MYDA 4HQSA 3ZFBA 3I9V2 1XOAA 2HI7A 3GKXA 2YV7A 5EL8A 1FW1A 4WF4A 4GXZA 2P5RA 2A2RA 4X4JA 2B7KA 3HJPA 2B7JA 4J56E 2V1MA 3DD3A 3KP8A 4IHUA 5GAND 3DRNA 1NSWA 4IQ1A 3APSA 3KMNA 1YZXA 1SK1A 1JZRA 2H1GA 2K8VA 5A5KA 4KX4A 2L6CA 3PH9A 3ERWA 3W6GA 2QKEA 1R5PA 3ZL5A 2HRKB 1CQHA 2A2PA 3DWVA 4KDUA 5KN0A 3Q18A 3QD9A 2WFCA 3H79A 3IC8A 4KAEA 3TJGA 3GA4A 3Q6OA 1FVKA 3W8SA 1R26A 3HJMA 3GMFA 4ZBBA 3D0ZA 4DEJA 2VD1A 5JWRB 2VCXA 4F0CA 3D4TA 1TXUA 7GSSA 4EC0A 1ML6A 2VL2A 3WYWA 3IXRA 1J08A 3P7XA 2GZYA 2HSMB 4ZBAA 2HQTA 1MDIA 2Z9SA 2DIYA 1B8XA 5AIXA 2JZSA 2RM6A 2DJ2A 4KB3A 18GSA 1O8XA 4AJ8A 2R37A 2HNLA 1SJZA 1U6TA 5D93A 3W8JA 5JWOB 2PGTA 2C0FA 4TR4A 2R6KA 5CRHA 1PGTA 2H66A 4ZBDA 4IS0A 1YEPA 1GRXA 5G5FA 1N2AA 1X9WB 4K2DA 4RI6A 2H6YA 2VCTA 2KUCA 3QMXA 1FB0A 4XS4B 4POLA 3ZLPA 4CHSA 1VF1A 1TKDB 1ERWA 1Y25A 3P8WA 4K0GA 2XC2A 3ZTLA 1M2DA 2P5QA 5CRGA 4OMVA 3F6FA 2CVBA 4POKA 3M1GA 5EY6A 1LU4A 3I6AA 2P0GA 1LJRA 2A4VA 1A2LA 4GDFA 4ICYA 4ML1A 3G7IA 3CTFA 3IBHA 2NVLA 1T3BA 1M7TA 2MMAA 1BG5A 3FW2A 2LSTA 2NBSA 5KN3A 3HCZA 2PVOC 1JZDA 2CQ9A 2H70A 2K18A 3IC4A 1V57A 1XW9A 2YWMA 3WT1A 2R3XA 1RW1A 3DMLA 4XIHA 1TJDA 1MD4A 1XPVA 2PVQA 2WULA 3TKSC 1YKCA 1DBYA 1XXUA 3M9KA 1T7PB 4LMWA 4MP4A 5ECHB 5IQYA 1WWJA 4GRFA 5A4VA 2ES7A 3A2VA 4K7OA 5ELGA 2QA1A 1DUGA 6GSUA 2ALBA 2B3SA 2FHEA 1V98A 2GSTA 3E9JB 3QOUA 3UVTA 2X99A 4ECJA 4MPGA 1GSDA 5IMAA 2H1DA 2E0QA 5BMUB 4JRRA 3L78A 5HFKA 1OE8A 5B8AA 1FAAA 1TU7A 2F8AA 2VLVA 3D4MA 4DSRA 4L8EA 1XVQA 2QGVA 3ZVJD 1VF3A 2JL4A 3HZ8A 2H0IA 3ERFA 3QAGA 2OE1A 5IIZA 1O7UA 3LYKA 2PMTA 1SENA 2H30A 1SJ6A 1SU9A 3MWHA 4IELA 2H1AA 1BX9A 4HJMA 4GTUA 5ECOB 1X5DA 2A4HA 3G7JA 5HR3A 2H0HA 5AN1A 2IIYA 2R0PA 4NXIA 3IHGA 4GQCA 2LNSA 4CW9A 2TRCP 1EOGA 3HVXA 4ID0A 2O5VA 1OC9A 4GWRA 3TDGA 1GLPA 4IJIA 4KCEA 1IYHA 13GSA 1AQVA 1M9AA 5J4VA 1FHEA 2KP1A 2CAIA 4K6XA 5G1LA 1GTIA 3VLNA 5CO3A 2EFEA 2X8GA 1U3AA 1H4OA 4PQIA 2FA8A 2C8UA 1GUHA 1GSUA 2IMEA 2A2SA 3HXSA 3LFLA 3KTBA 2V6KA 2AV4A 4XS1A 1O85A 1G6YA 3LXTA 1PKWA 2OJLA 5DAKA 3E3EA 5DVBA 2VCZA 5A5HA 2LRCA 5DQYA 2MYGA 4K8MA 4ZB9A 4IBPA 4WF5A 2OE3A 5IM9A 3KZQA 3PPUA 1ZGNA 4MF6A 4FO5A 2RM5A 3L0HA 5IMVA 2VCVA 5KOXA 5A4WA 2HSNB 1GP1A 2YZHA 1PSQA 3UIWA 1JLVA 3UOMA 1SL1B 3O6TA 3FR9A 3V1WA 5HFIA 3TKRA 1ZMAA 4JU5A 1XW5A 3SBCA 4Z2TA 2H0GA 4ZL9A 1A0FA 2L5LA 2CAQA 3FY7A 4OCFA 4ILFA 1AIUA 3ZRDA 5IMZA 2AB6A 3MAKA 2H74A 3H1NA 19GSA 3ZVJA 4FQUA 1EWXA 4O5QA 2X64A 4D73B 1F37A 2X8HA 3EE2A 4O7HA 1T00A 4AKXB 2PWJA 2R5GA 2LTKA 2PPTA 2YN1A 2GSRA 6GSYA 4AKHA 2H1BA 2WGRA 4BL7A 4O5RA 3H8QA 5AIVA 3VK9A 4AI6A 1M9BA 6GSWA 14GSA 5ECLB 3QCPA 3GL3A 4KA0A 2GVPA 4RQXA 2VM1A 3MNGA 2CVKA 2DMMA 4TRXA 4WR5A 2NDOA 4KGIA 1K0NA 2BJXA 3VI7A 4O5UA 1M2BA 3D5JA 4MZCA 4TVEA 2PN8A 3A3TA 1XZOA 3GRXA 2JACA 2X49A 2VM2A 2QSIA 1SK2A 1G6WA 3FYGA 4TXOA 1EV9A 3LSZA 3CSJA 1PL1A 1SD8A 6GSTA 2M46A 1QMVA 3LYPA 5A1NB 11GSA 4WBRD 5HR0A 4EL1A 2NTOA 2DLXA 2YZUA 3QR6A 4HEA2 4XTSA 1USBA 2DKIA 2EFDA 5J9BA 1B4QA 3R2QA 1XW6A 1TXXA 3KD0A 3GKMA 1HNAA 4ZB6A 1U88A 3FK8A 2OADA 1JZOA 4HZ4A 4N3ZA 2R2JA 2O85A 2YOIA 1SYXA 3PINA 3ZMKA 2R0GA 1AC1A 4MF7A 1EEJA 2VAFA 4KCAA 5IMFA 5D9XA 3GYKA 4N11A 4BWQA 2C3QA 4P3YB 2R0CA 1XWAA 1O8WA 3A5IA 1PX6A 3I69A 4JR6A 3TKSA 3M9JA 3APOA 3GIXA 2H8LA 5F8BA 2B5XA 1AW9A 3RAZA 4YQMA 5GSTA 5D73A 1K0CA 3O76A 3P90A 1RK4A 2L4CA 4KDYA 1SL0B 5KOWA 1E2YA 4MJCA 2GGTA 3UAPA 3IA1A 1XIYA 5J41A 3FR6A 5DCHA 1Z5YE 3C71A 2H71A 5CREA 3ZIJA 1UVZA 4HQZA 5H5QA 4HS1A 1BG1A 2EC4A 5A34A 3RDWA 2JSZA 3F4TA 2HZEA 2ZCTA 4E8HA 1FOVA 1PQNA 4WKWA 3LWAA 2DBCA 2DJ3A 4G19A 3LG6A 3A2WA 4TR1A 3UBLA 2J9HA 5J40A 1Q4JA 1TK0B 1XWKA 4Z7XA 4NV2A 3FHKA 2C0GA 1QFNA 2IMDA 3VI5A 3KH9A 4OWYA 1Z3EA 4FYCA 2MBSA 5A4UA 3F63A 3WGEA 5GAPD 5H5SA 4ZB8A 2FWFA 3GTUA 4HI7A 4RI7A 2OACA 1B9XC 4TN8A 2HZFA 3IE3A 4AKGA 3FKFA 4W66A 5KEJA 2J23A 2ON7A 1KBNA 4OFTA 2M80A 1C72A 3BCKA 2VCQA 1TRSA 5C04A 4EIPA 4TR3A 4WBJA 3LXZA 5LNKe 4ML6A 1YF1A 1QK8A 2C4JA 1F9MA 5FT3A 2FGXA 3EYTA 2I4AA 3HD5A 3NZNA 4BVXA 1GSYA 2XBQA 5F05A 1YEXA 2HYXA 2MZCA 2FWEA 1JHBA 1TRWA 4BVYA 4PNFA 1TK5B 2BTOT 3EVIA 1F6MC 4TKYA 3QDNA 1IYIA 2O8VB 5AGYA 4N30A 3K8NA 5KN2A 2LS5A 3GH9A 2GZPA 2KOKA 3WT2A 2CX4A 1ON4A 1Y6EA 2DSAA 5CRWA 5DALB 4KUNA 2IFQA 1VF4A 4F2IA 1EZKA 1ERTA 3OR5A 2V6OA 3TUEA 3KGKA 3VFIA 1GNEA 2GT5A 2H72A 4TW5A 2ON5A 4X0XA 3H93A 5ID2B 4ZL7A 1AAZA 1BF5A 3U5RE 4EVMA 2REMA 3UEMA 5D9WA 2XHFA 3KXOA 1XVWA 3VWXA 1LBKA 3VURA 2HRNA 2VIMA 3FZ4A 5DBQA 4KE3A 4N0VA 3ZIVA 2YNXA 2E7PA 1HD2A 3HDCA 4AGSA 5L71A 2I3YA 2CZ3A 2OT3A 5CP1A 4A5PA 2MMZA 3JCML 3QAWA 3GFKA 1SKWB 4HDEA 1UN2A 5A5HB 1Z7PA 4EE0A 2I1UA 3WGXA 4ZL8A 1JFUA 2C0DA 4MK3A 4XHMA 3GHAA 1W4VA 9GSSA 1TRUA 3KM6A 2X4AA 4CY6A 1J0FA 3UVHA 1T1VA 1A24A 1RQMA 1ZL9A 1M2AA 1O81A 4MH2A 4NPBA 1YQ1A 3HVVA 1TI1A 1ERUA 4Z2RA 1B4PA 4JEDA 2WDUA 4GSNA 4K0NA 2YJHA 3ME8A 3GX8A 4EIQA 1PD21 5G5EA 3GX0A 1K0OA 2KHPA 3ERGA 1X0RA 1ZYQB 3DXBA 1GTAA 1FVJA 10GSA 3J7Yk 2VCWA 4F9ZA 1SVOA 3EMPA 2JZRA 3GKNA 1EP8A 2HRKA 2VLTA 5J9CA 4IKHA 2DKHA 2B5YA 3IV4A 1NM3A 2FCHA 2O7KA 3GNJA 4MH3A 1X9MB 4EUYA 4DSSB 4TR0A 5E59A 2K8SA 3HZ4A 4IN0A 4NHZA 4LMVA 4K7IA 2OE0A 3KIJA 1ACVA 3RPNA 4O92A 5HQPA 3TJFA 1WP0A 3BD2A 17GSA 4EO3A 4ZB7A 4KF9A 1PKZA 5ECKB 4MCUA 4MJEA 2DC5A 2I81A 5D96A 3EWLA 5G2ZA 3F6DA 1YDKA 4V2MA 1GH2A 3QFBC 6GSSA 3J7Yb 3G9BA 3M8NA 5F06A 3HJOA 3ZITA 2XPEA 1GSQA 1ZYPA 4PTSA 2VLUA 4OO4A 3BCIA 2H1LA 4KSOA 3RHCA 3DVXA 4MLYA 5DJMA 5IPGA 4MZWA 2VOCA 4XS4A 2H19A 2FD3A 2YV9A 5GZZB 1ZYNA 4IVFA 4AKIA 5G30A 3NIVA 2FWHA 3PGTA 3GKKA 1QQ2A 3TKPA 1ZZYA 4JE1A 1FOHA 2H01A 1WMJA 4K5RA 1T4YA 3TKSE 3TOUA 2VL2C 4KSMA 1GUKA 6GSXA 3TJKA 3L4NA 2UZ8A 4PXOA 2FA4A 4EXJA 1U3IA 1V40A 1URMA 4BPYA 4ACSA 3CXGA 3QFAC 1YKAA 3TRXA 3CRUA 1GUMA 2N5AA 1SKRB 3L9VA 1BYEA 3F9UA 3LGCA 3RHBA 2OKAA 3KP9A 5H5RA 4RUVA 1I9DA 3IRAA 3D6IA 4O32A 1MDJA 4K5SA 3TJJA 1SYRA 1A8LA 5ECMB 3F3QA 2I9HA 4XRDA 2YCDA 4WEYA 1QXHA 5ECRB 2JU5A 12GSA 3TOTA 4MDCA 1NHOA 2E2GA 3RPPA 1PRXA 3CRTA 3ZFLA 5BMUA 2X8CA 4KH7A 4USSA 1AQXA 3N9JA 1OC3A 1SKSB 5B8BA 2CX3A 2HLSA 1N8JA 4NV5A 2JZTA 2K6VA 3LORA 5ECQB 4EDZA 2FWGA 3H4KA 2LV3A 5CNWA 2AHEA 3FR3A 4JZQA 4G0KA 2O87A 4IP1A 2HRAA 3DKSA 4EKZA 1EOHA 3IDVA 2DJ1A 3LW9A 3TGZA 2WZ9A 5D8IA 2H75A 5KN1A 3DGQA 1FG4A 5ECSA 1MD3A 5CAXA 1QGVA 2CZ2A 1PN0A 1JZWA 2GZZA 1VF2A 2C3TA 3LJRA 1W89A 4TOPA 4WXTA 2F9SA 3GURA 3PR8A 3FEUA 1KNGA 4YQUA 4IJ3A 3KH7A 4N10A 4PURA 2YANA 1V58A 5DDLA 4PUFC 3F4RA 1OYJA 2AYTA 1XWCA 2LJKA 4ECIA 3VWVA 2LRNA 3TKQA 4HOJA 1T4ZA 2DJJA 2L6DA 5J3RA 3Q19A 3HKRA 1KEBA 2AJQB 4Q5NA 1F2EA 5HR2A 4Q5RA 1F3BA 1B9YC 2LJAA 2C3NA 2XPDA 1MDKA 3E0UA 4YAPA 3EC3A 3L9UA 3UMAA 1T8EB 2LQQA 3ZREA 1A2JA 4MNNA 1A0RP 3EU4A 3TJBA 2OBIA 2CT6A 4PUAA 4MA9A 2GDRA 3DEXA 3AY8A 3NOFA 3C8EA 4NWYA 5F0GA 3I43A 4K2XA 4HZ2A 1G7EA 5JCGA 1AXDA 2HSNA 4ULXA 1BEDA 5ECPB 3R3EA 2KP2A 2EFCA 1ZOFA 3N5OA 3HY2A 5E4WA 1ABAA 3VWUA 3FZ5A 4CY8A 4N0ZA 4CDOA 1PN9A 4L5LA 1GULA 4OFMA 3KMOA 2HRFA 4H86A 3DIEA 5ENUA 3C7MA 2CVDA 3IOSA 5D9TA 1TTZA 2LEGA 1PMTA 5J4YA 3P2AA 5G1KA 2WCIA 2VUPA 1WJKA 4D73A 4Z2UA 3HVSA 4FIWA 2LNTA 4J2FA 4F03A 4FH8A 1Y1UA 4AF2A 5J47A 3Q74A 4L0WA 5J4UA 3FZAA 2UV8G 4MJAA 4BWSA 2PBJA 4WR4A 2YPMA 2N5FA 3IK9A 3RBTA 3IR4A 3LQ7A 5IMCA 4HUAA 4YKGA 4LL4B 1S3AA 4K9ZA 4XCSA 1GWCA 2L59A 3C1SA 1TK8B 2DJ0A 1X5CA 3S9FA 1OKTA 2WRTA 3IHQA 1OKDA 1TOFA 3UJ1A 2LKUA 3EINA 3TRPA 3GSSA 2YWIA 1WE0A 1EGRA 3EURA 2OBKA 3KCMA 3CSHA 20GSA 4KNDA 1GSSA 3ED3A 5ECIB 5A1NA 4FYBA 4G2EA 3CSIA 1PX7A 5F07A 4Q5FA 2IJYA 8GSSA 2HSYA 1N25A 5AISA 1THOA 1WOUA 2MMNA 1SL2B 4MPFA 1DE2A 1FO5A 3VWWA 1HNCA 4LLRA 1OC9B 5CYYA 3QPMA 2GTUA 4JBBA 1VRSD 3MIXA 4HU9A 1Q98A 4EF0A 2V41A 1GL8A 4OO5A 3O3TA 2DMLA 3GUSA 2HXKA 2JSYA 4I6XA 2FNOA 2LRTA 3HYPA 2YWNA 4V2LA 2QC7A 5GSSA 2JADA 2TRXA 4WETA 4AJ7A 4PGTA 2CV4A 5COHA 1AQWA 4K7NA 5DCGA 1K0MA 5LCZA 4NAXA 1S3CA 1BJXA 1KTEA 5IPHA 5DAKB 1ERVA 1K0DA 2LUSA 1M0UA 3HMJG 4I2TA 2LJRA 5BRTA 3BJ5A 2RLIA 4PX1A 2B1LA 5HR1A 3MSZA 2GSSA 1R5AA 2ZUPA 4J57E 3F8UA 3KEBA 2VO4A 4F0BA 2HT9A 1K3OA 3HHVA 1YY7A 2HE3A 4POMA 1FB6A 3TRQA 2WS2A 5D9VA 2AUVA 4L0UA 2IMIA 2KLXA 4X43A 4IP6A 2GQMA 3TCOA 2LQOA 4OCEA 1O73A 1SJIA 3A5WA 3KTLA 22GSA 4ECBA 2IWTA 1QUWA 3WD6A 3CTGA 2M72A 1EV4A 1Z6NA 3SWLA 2NPBA 5DJLA 2H6XA 4HJ2A 4ZIJA 1S3DA 3GH6A 1B48A 5C00A 3HA9A 5IMDA 1GTUA 4K1FA 1A23A 1K0AA 4BL7B 1GTBA 1TRVA 5LD0A 2B5EA 3BBYA 1BAYA 2D2ZA 1V2AA 4I97A 2PU9C 1SVMA 2G2QA 1A2MA 2IN3A 4KW6A 2IMKA 1JLWA 4ECCA 2P31A 3D22A 3FRCA 2HSMA 5IOWA 2PERA 1XWBA 2L4QA 3CMIA 2V2GA 4TXOB 1VGLA 3APQA 2N5BA 1WPIA 4GSSA 5EPFA 4PNGA 1WRYA 4YKFA 4MF5A 4MMMA 2HFDA 2IPAA 1X9SB 5FWGA 4NHWA 5DALA 4PQ1A 3GL5A 3C73A 4I5QA 4G0LA 5ECNB 2QA2A 2IL3A 1OE7A 1TDIA 4QQ7A 1NW2A 3GV1A 4DSQA 1OVNA 1O6JA 5ID2A 2WJUA 1SVLA 4L5OA 1WIKA 2MBTA 1TI3A 4YH2A 3KJYA 5G31A 3M0FA 1G0TA 3F4SA 1EGOA 4IGJA 4MABA 2F8FA 4G01A 1GSEA 2G0FA 1YF0A 1K3YA 1H75A 1OC8A 4KDXA 1ILOA 4RQRA 4TXVA 5IO2A 1MTCA 4F82A 1A8YA 3ZZXA 2E2MA 4JR4A 3UL3A 2C0EA 3VPTA 1XWGA 3F3RA 3D21A 1F3AA 2B1KA 5ABRA 1AUCA 1DE1A 2GQKA 3QAVA 1XOBA 4LA1A 2MMOA 2VL3A 2FLSA 3DYRA 3ME7A 4OD7A 1EP7A 3IAM2 5A34B 1THXA 2EIRA 2XBIA 4XS6A 4I8BA 1V9WA 4ZXGA 1GSFA 2HZEB 2GLRA 4HU7A 2H6ZA 1Z9HA 3IAS2 4TR1B 2CA8A 3ZYWA 2H73A 3FMWA 4IW9A 3GN3A 1MEKA 1X5EA 4GLTA 2AAWA 1M99A 2RIIA 3LEFA 1R4WA 1E6BA 3IPZA 3CYNA 2EIOA 2C1YA 3IK7A 5ELAA 4GSTA 3UARA 3CBUA 2DIZA 4OFNA 1HNBA 4XRAA 2H76A 4LL1B 5JCUA 3GTUB 1DSBA 1K0BA 4QMKA 1G7OA 1Z6MA 4V2NA 1K3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7R A;  2GS3 A;  4DSS A;  4IQA A;  2C80 A;  5HFG A;  4PQH A;  2RUE A;  2GSQ A;  4POB A;  3L9S A;  16GS A;  2V32 A;  4FYU A;  2VD0 A;  2FUG 2;  3VPQ A;  2BMX A;  1GLQ A;  1ST9 A;  2K9F A;  1TP9 A;  4MZB A;  1XFL A;  4AJ6 A;  2GQL A;  3ISO A;  5B7C A;  2HSH A;  1SD9 A;  2PUK C;  3U6V A;  1UA5 A;  5FHI A;  4BVX B;  2L57 A;  4QL7 A;  4GCI A;  1TU8 A;  1HYU A;  5EVO A;  2EIQ A;  4I2U A;  4ISD A;  5CRD A;  2L5O A;  2O89 A;  4BVY B;  2B6M A;  1U87 A;  3UBK A;  1UC7 A;  3A2X A;  1CQG A;  5JCW A;  2F3M A;  3GST A;  5J5N A;  1GNW A;  6GSV A;  2TIR A;  2YJ7 A;  5B6N A;  3G7Y A;  3C1R A;  2IMF A;  1OAZ A;  1R7H A;  4E8E A;  2IFQ B;  2WB9 A;  3EU3 A;  2ZNM A;  1SK0 A;  1NHY A;  4YAV A;  2RUF A;  5INY A;  5JWQ B;  5DQS A;  2OA7 A;  1EEM A;  5IOX A;  1I5G A;  2VL9 A;  3M3M A;  4YQV A;  4GF0 A;  1J9B A;  3MDK A;  3DVW A;  3TB2 A;  3US3 A;  2DJK A;  1ZYE A;  4BA7 A;  3ZML A;  1XBS A;  1BQ7 A;  4X1U A;  2GT6 A;  4EDY A;  4NMU A;  2YP6 A;  3FZ9 A;  3F0I A;  1HQO A;  1PL2 A;  1YJ6 A;  4G9H A;  4QL9 A;  4V1A p;  3WGD A;  2YWO A;  2F51 A;  1TW9 A;  1PA3 A;  2R4V A;  5B6M A;  3BOA A;  1ZCP A;  4G0I A;  1XCC A;  2FY6 A;  4DVC A;  4G10 A;  4Q5Q A;  4V1A g;  5IO0 A;  4MJB A;  3EMX A;  4ZIL A;  4GQF A;  4HQS A;  3ZFB A;  3I9V 2;  1XOA A;  2HI7 A;  3GKX A;  2YV7 A;  5EL8 A;  1FW1 A;  4WF4 A;  4GXZ A;  2P5R A;  2A2R A;  2B7K A;  3HJP A;  2B7J A;  4J56 E;  2V1M A;  3DD3 A;  3KP8 A;  4IHU A;  5GAN D;  3DRN A;  1NSW A;  4IQ1 A;  3APS A;  3KMN A;  1YZX A;  1SK1 A;  1JZR A;  2H1G A;  2K8V A;  5A5K A;  4KX4 A;  2L6C A;  3PH9 A;  3ERW A;  3W6G A;  2QKE A;  1R5P A;  3ZL5 A;  2HRK B;  1CQH A;  3DWV A;  4KDU A;  5KN0 A;  3Q18 A;  3QD9 A;  2WFC A;  3H79 A;  3IC8 A;  4KAE A;  3TJG A;  3GA4 A;  3Q6O A;  1FVK A;  3W8S A;  1R26 A;  3HJM A;  3GMF A;  4ZBB A;  3D0Z A;  4DEJ A;  2VD1 A;  5JWR B;  2VCX A;  4F0C A;  3D4T A;  7GSS A;  4EC0 A;  1ML6 A;  2VL2 A;  3WYW A;  3IXR A;  1J08 A;  3P7X A;  2GZY A;  2HSM B;  4ZBA A;  2HQT A;  1MDI A;  2Z9S A;  2DIY A;  1B8X A;  5AIX A;  2JZS A;  2RM6 A;  2DJ2 A;  4KB3 A;  18GS A;  1O8X A;  4AJ8 A;  2R37 A;  2HNL A;  1SJZ A;  1U6T A;  5D93 A;  3W8J A;  5JWO B;  2PGT A;  2C0F A;  4TR4 A;  2R6K A;  5CRH A;  1PGT A;  2H66 A;  4ZBD A;  4IS0 A;  1YEP A;  1GRX A;  5G5F A;  1N2A A;  1X9W B;  4K2D A;  4RI6 A;  2H6Y A;  2VCT A;  2KUC A;  3QMX A;  1FB0 A;  4XS4 B;  4POL A;  3ZLP A;  4CHS A;  1VF1 A;  1TKD B;  1ERW A;  1Y25 A;  3P8W A;  4K0G A;  2XC2 A;  3ZTL A;  1M2D A;  2P5Q A;  5CRG A;  4OMV A;  3F6F A;  2CVB A;  4POK A;  3M1G A;  5EY6 A;  1LU4 A;  3I6A A;  2P0G A;  1LJR A;  2A4V A;  1A2L A;  4ML1 A;  3G7I A;  3CTF A;  3IBH A;  2NVL A;  1T3B A;  1M7T A;  2MMA A;  1BG5 A;  3FW2 A;  2LST A;  2NBS A;  5KN3 A;  3HCZ A;  2PVO C;  1JZD A;  2CQ9 A;  2H70 A;  2K18 A;  3IC4 A;  1V57 A;  1XW9 A;  2YWM A;  3WT1 A;  2R3X A;  1RW1 A;  3DML A;  4XIH A;  1TJD A;  1MD4 A;  1XPV A;  2PVQ A;  2WUL A;  3TKS C;  1YKC A;  1DBY A;  1XXU A;  3M9K A;  1T7P B;  4LMW A;  4MP4 A;  5ECH B;  5IQY A;  1WWJ A;  4GRF A;  5A4V A;  2ES7 A;  3A2V A;  4K7O A;  5ELG A;  1DUG A;  6GSU A;  2ALB A;  2B3S A;  2FHE A;  1V98 A;  2GST A;  3E9J B;  3QOU A;  3UVT A;  2X99 A;  4ECJ A;  4MPG A;  1GSD A;  5IMA A;  2H1D A;  2E0Q A;  4JRR A;  3L78 A;  5HFK A;  1OE8 A;  5B8A A;  1FAA A;  1TU7 A;  2F8A A;  2VLV A;  3D4M A;  4DSR A;  4L8E A;  1XVQ A;  2QGV A;  3ZVJ D;  1VF3 A;  2JL4 A;  3HZ8 A;  2H0I A;  3ERF A;  3QAG A;  2OE1 A;  5IIZ A;  1O7U A;  3LYK A;  2PMT A;  1SEN A;  2H30 A;  1SJ6 A;  1SU9 A;  3MWH A;  4IEL A;  2H1A A;  1BX9 A;  4HJM A;  4GTU A;  5ECO B;  1X5D A;  3G7J A;  5HR3 A;  2H0H A;  5AN1 A;  2IIY A;  4NXI A;  4GQC A;  2LNS A;  4CW9 A;  2TRC P;  1EOG A;  3HVX A;  4ID0 A;  1OC9 A;  4GWR A;  3TDG A;  1GLP A;  4IJI A;  4KCE A;  1IYH A;  13GS A;  1AQV A;  1M9A A;  1FHE A;  2KP1 A;  2CAI A;  4K6X A;  5G1L A;  1GTI A;  3VLN A;  5CO3 A;  2X8G A;  1U3A A;  1H4O A;  4PQI A;  2FA8 A;  2C8U A;  1GUH A;  1GSU A;  2IME A;  2A2S A;  3HXS A;  3LFL A;  3KTB A;  2V6K A;  2AV4 A;  4XS1 A;  1O85 A;  1G6Y A;  3LXT A;  1PKW A;  2OJL A;  5DAK A;  3E3E A;  5DVB A;  2VCZ A;  2LRC A;  5DQY A;  2MYG A;  4K8M A;  4ZB9 A;  4IBP A;  4WF5 A;  2OE3 A;  5IM9 A;  3KZQ A;  3PPU A;  1ZGN A;  4MF6 A;  4FO5 A;  2RM5 A;  3L0H A;  5IMV A;  2VCV A;  5A4W A;  2HSN B;  1GP1 A;  2YZH A;  1PSQ A;  3UIW A;  1JLV A;  3UOM A;  1SL1 B;  3O6T A;  3FR9 A;  3V1W A;  5HFI A;  3TKR A;  1ZMA A;  4JU5 A;  1XW5 A;  3SBC A;  2H0G A;  4ZL9 A;  1A0F A;  2L5L A;  2CAQ A;  3FY7 A;  4OCF A;  4ILF A;  1AIU A;  3ZRD A;  5IMZ A;  2AB6 A;  3MAK A;  2H74 A;  3H1N A;  19GS A;  3ZVJ A;  4FQU A;  1EWX A;  2X64 A;  4D73 B;  1F37 A;  2X8H A;  3EE2 A;  4O7H A;  1T00 A;  2PWJ A;  2R5G A;  2LTK A;  2PPT A;  2YN1 A;  2GSR A;  6GSY A;  2H1B A;  2WGR A;  4BL7 A;  4O5R A;  3H8Q A;  5AIV A;  3VK9 A;  1M9B A;  6GSW A;  14GS A;  5ECL B;  3QCP A;  3GL3 A;  4KA0 A;  2GVP A;  4RQX A;  2VM1 A;  3MNG A;  2CVK A;  2DMM A;  4TRX A;  4WR5 A;  2NDO A;  4KGI A;  1K0N A;  2BJX A;  3VI7 A;  1M2B A;  3D5J A;  4MZC A;  4TVE A;  2PN8 A;  3A3T A;  1XZO A;  3GRX A;  2JAC A;  2VM2 A;  2QSI A;  1SK2 A;  1G6W A;  3FYG A;  4TXO A;  1EV9 A;  3LSZ A;  3CSJ A;  1PL1 A;  1SD8 A;  6GST A;  2M46 A;  1QMV A;  3LYP A;  11GS A;  4WBR D;  5HR0 A;  4EL1 A;  2NTO A;  2DLX A;  2YZU A;  3QR6 A;  4HEA 2;  4XTS A;  1USB A;  5J9B A;  1B4Q A;  3R2Q A;  1XW6 A;  1TXX A;  3KD0 A;  3GKM A;  1HNA A;  4ZB6 A;  1U88 A;  3FK8 A;  2OAD A;  1JZO A;  4HZ4 A;  2R2J A;  2O85 A;  2YOI A;  1SYX A;  3PIN A;  3ZMK A;  1AC1 A;  4MF7 A;  1EEJ A;  2VAF A;  4KCA A;  5IMF A;  5D9X A;  3GYK A;  4N11 A;  4BWQ A;  2C3Q A;  4P3Y B;  1XWA A;  1O8W A;  1PX6 A;  3I69 A;  4JR6 A;  3TKS A;  3M9J A;  3APO A;  3GIX A;  2H8L A;  5F8B A;  2B5X A;  1AW9 A;  3RAZ A;  4YQM A;  5GST A;  5D73 A;  1K0C A;  3O76 A;  3P90 A;  1RK4 A;  2L4C A;  4KDY A;  1SL0 B;  1E2Y A;  4MJC A;  2GGT A;  3UAP A;  3IA1 A;  1XIY A;  5J41 A;  3FR6 A;  5DCH A;  1Z5Y E;  3C71 A;  2H71 A;  5CRE A;  3ZIJ A;  1UVZ A;  4HQZ A;  5H5Q A;  4HS1 A;  3RDW A;  2EC4 A;  2JSZ A;  3F4T A;  2HZE A;  2ZCT A;  4E8H A;  1FOV A;  1PQN A;  4WKW A;  3LWA A;  2DBC A;  2DJ3 A;  4G19 A;  3LG6 A;  3A2W A;  4TR1 A;  3UBL A;  2J9H A;  1Q4J A;  1TK0 B;  1XWK A;  4Z7X A;  4NV2 A;  3FHK A;  2C0G A;  1QFN A;  2IMD A;  3VI5 A;  3KH9 A;  4OWY A;  1Z3E A;  4FYC A;  2MBS A;  5A4U A;  3F63 A;  3WGE A;  5GAP D;  5H5S A;  4ZB8 A;  2FWF A;  3GTU A;  4HI7 A;  4RI7 A;  2OAC A;  1B9X C;  4TN8 A;  2HZF A;  3IE3 A;  3FKF A;  5KEJ A;  2J23 A;  2ON7 A;  1KBN A;  4OFT A;  2M80 A;  1C72 A;  3BCK A;  2VCQ A;  1TRS A;  5C04 A;  4TR3 A;  4WBJ A;  3LXZ A;  5LNK e;  4ML6 A;  1YF1 A;  1QK8 A;  2C4J A;  1F9M A;  5FT3 A;  2FGX A;  3EYT A;  2I4A A;  3HD5 A;  3NZN A;  4BVX A;  1GSY A;  2XBQ A;  5F05 A;  1YEX A;  2HYX A;  2MZC A;  2FWE A;  1JHB A;  1TRW A;  4BVY A;  4PNF A;  1TK5 B;  2BTO T;  3EVI A;  1F6M C;  4TKY A;  3QDN A;  1IYI A;  2O8V B;  5AGY A;  4N30 A;  3K8N A;  5KN2 A;  2LS5 A;  3GH9 A;  2GZP A;  2KOK A;  3WT2 A;  2CX4 A;  1ON4 A;  1Y6E A;  2DSA A;  5CRW A;  5DAL B;  4KUN A;  2IFQ A;  1VF4 A;  4F2I A;  1EZK A;  1ERT A;  3OR5 A;  2V6O A;  3TUE A;  3KGK A;  3VFI A;  1GNE A;  2GT5 A;  2H72 A;  4TW5 A;  2ON5 A;  4X0X A;  3H93 A;  5ID2 B;  4ZL7 A;  1AAZ A;  3U5R E;  4EVM A;  2REM A;  3UEM A;  5D9W A;  2XHF A;  3KXO A;  1XVW A;  3VWX A;  1LBK A;  3VUR A;  2HRN A;  2VIM A;  3FZ4 A;  5DBQ A;  4KE3 A;  4N0V A;  3ZIV A;  2YNX A;  2E7P A;  1HD2 A;  3HDC A;  4AGS A;  5L71 A;  2I3Y A;  2CZ3 A;  5CP1 A;  2MMZ A;  3JCM L;  3QAW A;  3GFK A;  1SKW B;  4HDE A;  1UN2 A;  1Z7P A;  4EE0 A;  2I1U A;  3WGX A;  4ZL8 A;  1JFU A;  2C0D A;  4MK3 A;  4XHM A;  3GHA A;  1W4V A;  9GSS A;  1TRU A;  3KM6 A;  1J0F A;  3UVH A;  1T1V A;  1A24 A;  1RQM A;  1ZL9 A;  1M2A A;  1O81 A;  4MH2 A;  4NPB A;  1YQ1 A;  3HVV A;  1TI1 A;  1ERU A;  1B4P A;  4JED A;  2WDU A;  4GSN A;  4K0N A;  2YJH A;  3ME8 A;  3GX8 A;  1PD2 1;  5G5E A;  3GX0 A;  1K0O A;  2KHP A;  3ERG A;  1X0R A;  1ZYQ B;  3DXB A;  1GTA A;  1FVJ A;  10GS A;  3J7Y k;  2VCW A;  4F9Z A;  3EMP A;  2JZR A;  3GKN A;  1EP8 A;  2HRK A;  2VLT A;  5J9C A;  4IKH A;  2B5Y A;  3IV4 A;  1NM3 A;  2FCH A;  2O7K A;  3GNJ A;  4MH3 A;  1X9M B;  4EUY A;  4DSS B;  4TR0 A;  5E59 A;  2K8S A;  3HZ4 A;  4IN0 A;  4NHZ A;  4LMV A;  4K7I A;  2OE0 A;  3KIJ A;  1ACV A;  3RPN A;  4O92 A;  5HQP A;  3TJF A;  1WP0 A;  3BD2 A;  17GS A;  4EO3 A;  4KF9 A;  1PKZ A;  5ECK B;  4MCU A;  4MJE A;  2DC5 A;  2I81 A;  5D96 A;  3EWL A;  5G2Z A;  3F6D A;  1YDK A;  4V2M A;  1GH2 A;  3QFB C;  6GSS A;  3J7Y b;  3G9B A;  3M8N A;  5F06 A;  3HJO A;  3ZIT A;  2XPE A;  1GSQ A;  4PTS A;  2VLU A;  4OO4 A;  3BCI A;  4KSO A;  3RHC A;  3DVX A;  4MLY A;  5DJM A;  5IPG A;  4MZW A;  2VOC A;  4XS4 A;  2H19 A;  2FD3 A;  2YV9 A;  5GZZ B;  4IVF A;  5G30 A;  3NIV A;  2FWH A;  3PGT A;  3GKK A;  1QQ2 A;  3TKP A;  1ZZY A;  4JE1 A;  2H01 A;  1WMJ A;  1T4Y A;  3TKS E;  3TOU A;  2VL2 C;  4KSM A;  1GUK A;  6GSX A;  3TJK A;  3L4N A;  2UZ8 A;  4PXO A;  2FA4 A;  4EXJ A;  1U3I A;  1V40 A;  1URM A;  4BPY A;  4ACS A;  3CXG A;  3QFA C;  1YKA A;  3TRX A;  3CRU A;  1GUM A;  2N5A A;  1SKR B;  3L9V A;  1BYE A;  3F9U A;  3LGC A;  3RHB A;  2OKA A;  3KP9 A;  5H5R A;  4RUV A;  1I9D A;  3IRA A;  3D6I A;  4O32 A;  1MDJ A;  3TJJ A;  1SYR A;  1A8L A;  5ECM B;  3F3Q A;  2I9H A;  4XRD A;  2YCD A;  4WEY A;  1QXH A;  5ECR B;  2JU5 A;  12GS A;  3TOT A;  4MDC A;  1NHO A;  2E2G A;  3RPP A;  1PRX A;  3CRT A;  3ZFL A;  5BMU A;  2X8C A;  4KH7 A;  4USS A;  1AQX A;  3N9J A;  1OC3 A;  1SKS B;  5B8B A;  2CX3 A;  2HLS A;  1N8J A;  4NV5 A;  2JZT A;  2K6V A;  3LOR A;  5ECQ B;  4EDZ A;  2FWG A;  3H4K A;  2LV3 A;  5CNW A;  2AHE A;  3FR3 A;  4JZQ A;  4G0K A;  2O87 A;  4IP1 A;  2HRA A;  3DKS A;  4EKZ A;  1EOH A;  3IDV A;  2DJ1 A;  3TGZ A;  2WZ9 A;  5D8I A;  2H75 A;  5KN1 A;  3DGQ A;  1FG4 A;  5ECS A;  1MD3 A;  5CAX A;  1QGV A;  2CZ2 A;  1JZW A;  2GZZ A;  1VF2 A;  2C3T A;  3LJR A;  1W89 A;  4TOP A;  4WXT A;  2F9S A;  3GUR A;  3PR8 A;  3FEU A;  1KNG A;  4YQU A;  4IJ3 A;  3KH7 A;  4N10 A;  4PUR A;  2YAN A;  1V58 A;  5DDL A;  4PUF C;  3F4R A;  1OYJ A;  2AYT A;  1XWC A;  2LJK A;  4ECI A;  3VWV A;  2LRN A;  3TKQ A;  4HOJ A;  1T4Z A;  2DJJ A;  2L6D A;  5J3R A;  3Q19 A;  3HKR A;  1KEB A;  2AJQ B;  4Q5N A;  1F2E A;  5HR2 A;  4Q5R A;  1F3B A;  1B9Y C;  2LJA A;  2C3N A;  2XPD A;  1MDK A;  3E0U A;  4YAP A;  3EC3 A;  3L9U A;  3UMA A;  1T8E B;  2LQQ A;  3ZRE A;  1A2J A;  1A0R P;  3EU4 A;  3TJB A;  2OBI A;  2CT6 A;  4PUA A;  4MA9 A;  2GDR A;  3DEX A;  3AY8 A;  3NOF A;  3C8E A;  4NWY A;  5F0G A;  3I43 A;  4HZ2 A;  1G7E A;  5JCG A;  1AXD A;  4ULX A;  1BED A;  5ECP B;  3R3E A;  2KP2 A;  1ZOF A;  3N5O A;  3HY2 A;  5E4W A;  1ABA A;  3VWU A;  3FZ5 A;  4N0Z A;  4CDO A;  1PN9 A;  4L5L A;  1GUL A;  4OFM A;  3KMO A;  2HRF A;  4H86 A;  3DIE A;  5ENU A;  3C7M A;  2CVD A;  3IOS A;  5D9T A;  1TTZ A;  2LEG A;  1PMT A;  3P2A A;  5G1K A;  2WCI A;  2VUP A;  1WJK A;  4D73 A;  3HVS A;  4FIW A;  2LNT A;  4J2F A;  4F03 A;  4FH8 A;  4AF2 A;  3Q74 A;  4L0W A;  5J4U A;  3FZA A;  4MJA A;  4BWS A;  2PBJ A;  4WR4 A;  2YPM A;  2N5F A;  3IK9 A;  3RBT A;  3IR4 A;  3LQ7 A;  5IMC A;  4HUA A;  4LL4 B;  1S3A A;  4K9Z A;  4XCS A;  1GWC A;  2L59 A;  3C1S A;  1TK8 B;  2DJ0 A;  1X5C A;  3S9F A;  1OKT A;  2WRT A;  3IHQ A;  1OKD A;  1TOF A;  3UJ1 A;  2LKU A;  3EIN A;  3TRP A;  3GSS A;  2YWI A;  1WE0 A;  1EGR A;  3EUR A;  2OBK A;  3KCM A;  3CSH A;  20GS A;  4KND A;  1GSS A;  3ED3 A;  5ECI B;  4FYB A;  4G2E A;  3CSI A;  1PX7 A;  5F07 A;  4Q5F A;  2IJY A;  8GSS A;  2HSY A;  5AIS A;  1THO A;  1WOU A;  2MMN A;  1SL2 B;  4MPF A;  1DE2 A;  1FO5 A;  3VWW A;  1HNC A;  4LLR A;  1OC9 B;  5CYY A;  3QPM A;  2GTU A;  4JBB A;  1VRS D;  4HU9 A;  1Q98 A;  4EF0 A;  2V41 A;  1GL8 A;  4OO5 A;  3O3T A;  2DML A;  3GUS A;  2HXK A;  2JSY A;  4I6X A;  2FNO A;  2LRT A;  3HYP A;  2YWN A;  4V2L A;  2QC7 A;  5GSS A;  2JAD A;  2TRX A;  4WET A;  4AJ7 A;  4PGT A;  2CV4 A;  5COH A;  1AQW A;  4K7N A;  5DCG A;  1K0M A;  5LCZ A;  4NAX A;  1S3C A;  1BJX A;  1KTE A;  5IPH A;  5DAK B;  1ERV A;  1K0D A;  2LUS A;  1M0U A;  4I2T A;  2LJR A;  3BJ5 A;  2RLI A;  4PX1 A;  2B1L A;  5HR1 A;  3MSZ A;  2GSS A;  1R5A A;  2ZUP A;  4J57 E;  3F8U A;  3KEB A;  2VO4 A;  4F0B A;  2HT9 A;  1K3O A;  3HHV A;  1YY7 A;  2HE3 A;  4POM A;  1FB6 A;  3TRQ A;  2WS2 A;  5D9V A;  2AUV A;  4L0U A;  2IMI A;  2KLX A;  4X43 A;  4IP6 A;  2GQM A;  3TCO A;  2LQO A;  4OCE A;  1O73 A;  1SJI A;  3A5W A;  3KTL A;  22GS A;  4ECB A;  2IWT A;  1QUW A;  3WD6 A;  3CTG A;  2M72 A;  1EV4 A;  1Z6N A;  3SWL A;  2NPB A;  5DJL A;  2H6X A;  4HJ2 A;  4ZIJ A;  1S3D A;  3GH6 A;  1B48 A;  5C00 A;  3HA9 A;  5IMD A;  1GTU A;  4K1F A;  1A23 A;  1K0A A;  4BL7 B;  1GTB A;  1TRV A;  5LD0 A;  2B5E A;  3BBY A;  1BAY A;  2D2Z A;  1V2A A;  4I97 A;  2PU9 C;  2G2Q A;  1A2M A;  2IN3 A;  4KW6 A;  2IMK A;  1JLW A;  4ECC A;  2P31 A;  3D22 A;  3FRC A;  2HSM A;  5IOW A;  2PER A;  1XWB A;  2L4Q A;  3CMI A;  2V2G A;  4TXO B;  1VGL A;  3APQ A;  2N5B A;  1WPI A;  4GSS A;  5EPF A;  4PNG A;  1WRY A;  4MF5 A;  4MMM A;  2HFD A;  2IPA A;  1X9S B;  5FWG A;  4NHW A;  5DAL A;  4PQ1 A;  3GL5 A;  3C73 A;  4I5Q A;  4G0L A;  5ECN B;  2IL3 A;  1OE7 A;  1TDI A;  4QQ7 A;  1NW2 A;  3GV1 A;  4DSQ A;  1OVN A;  1O6J A;  5ID2 A;  2WJU A;  4L5O A;  1WIK A;  2MBT A;  1TI3 A;  4YH2 A;  3KJY A;  5G31 A;  3M0F A;  1G0T A;  3F4S A;  1EGO A;  4IGJ A;  4MAB A;  2F8F A;  1GSE A;  2G0F A;  1YF0 A;  1K3Y A;  1H75 A;  1OC8 A;  4KDX A;  1ILO A;  4RQR A;  4TXV A;  5IO2 A;  1MTC A;  4F82 A;  1A8Y A;  3ZZX A;  2E2M A;  4JR4 A;  3UL3 A;  2C0E A;  3VPT A;  1XWG A;  3F3R A;  3D21 A;  1F3A A;  2B1K A;  5ABR A;  1AUC A;  1DE1 A;  2GQK A;  3QAV A;  1XOB A;  4LA1 A;  2MMO A;  2VL3 A;  2FLS A;  3DYR A;  3ME7 A;  4OD7 A;  1EP7 A;  3IAM 2;  1THX A;  2EIR A;  2XBI A;  4XS6 A;  4I8B A;  1V9W A;  4ZXG A;  1GSF A;  2HZE B;  2GLR A;  4HU7 A;  2H6Z A;  1Z9H A;  3IAS 2;  4TR1 B;  2CA8 A;  3ZYW A;  2H73 A;  4IW9 A;  3GN3 A;  1MEK A;  1X5E A;  4GLT A;  2AAW A;  1M99 A;  2RII A;  3LEF A;  1R4W A;  1E6B A;  3IPZ A;  3CYN A;  2EIO A;  2C1Y A;  3IK7 A;  5ELA A;  4GST A;  3UAR A;  3CBU A;  2DIZ A;  4OFN A;  1HNB A;  4XRA A;  2H76 A;  4LL1 B;  5JCU A;  3GTU B;  1DSB A;  1K0B A;  1G7O A;  1Z6M A;  4V2N A;  1K3L A; 
#chains in the Genus database with same CATH topology
 1Z7R A;  2GS3 A;  4DSS A;  4IQA A;  2C80 A;  5HFG A;  4PQH A;  2RUE A;  2GSQ A;  4POB A;  3L9S A;  16GS A;  2V32 A;  3EPT A;  2VKZ G;  4FYU A;  2VD0 A;  2FUG 2;  3VPQ A;  2BMX A;  3CWG A;  1GLQ A;  1ST9 A;  2K9F A;  1TP9 A;  4MZB A;  1XFL A;  4AJ6 A;  2GQL A;  3ISO A;  5B7C A;  2HSH A;  1SD9 A;  2PUK C;  3U6V A;  1UA5 A;  5FHI A;  4BVX B;  4PHZ C;  2L57 A;  4QL7 A;  4GCI A;  1TU8 A;  1HYU A;  5EVO A;  2EIQ A;  4I2U A;  4ISD A;  5CRD A;  2EFH A;  3TU3 B;  2L5O A;  2O89 A;  4BVY B;  2B6M A;  1U87 A;  3UBK A;  1UC7 A;  3A2X A;  1CQG A;  5JCW A;  2F3M A;  3GST A;  5J5N A;  1GNW A;  6GSV A;  2TIR A;  2YJ7 A;  5B6N A;  3G7Y A;  3C1R A;  2IMF A;  2WW1 A;  1OAZ A;  1R7H A;  4E8E A;  2IFQ B;  2WB9 A;  3EU3 A;  2ZNM A;  1SK0 A;  1NHY A;  4YAV A;  2RUF A;  5INY A;  5JWQ B;  5DQS A;  2OA7 A;  1EEM A;  5IOX A;  1I5G A;  2VL9 A;  3M3M A;  4YQV A;  4GF0 A;  1J9B A;  3MDK A;  3DVW A;  3TB2 A;  3US3 A;  2DJK A;  1ZYE A;  4BA7 A;  3ZML A;  1XBS A;  1BQ7 A;  4X1U A;  2GT6 A;  4EDY A;  4NMU A;  2YP6 A;  3FZ9 A;  3F0I A;  1HQO A;  1PL2 A;  1YJ6 A;  4G9H A;  1YVL A;  4QL9 A;  4V1A p;  3WGD A;  2YWO A;  2F51 A;  1TW9 A;  1M3I A;  1PA3 A;  2R4V A;  5B6M A;  3BOA A;  1ZCP A;  4G0I A;  1XCC A;  2FY6 A;  4DVC A;  4G10 A;  4Q5Q A;  4V1A g;  5IO0 A;  4MJB A;  3EMX A;  4ZIL A;  4GQF A;  4E68 A;  3MYD A;  4HQS A;  3ZFB A;  3I9V 2;  1XOA A;  2HI7 A;  3RFR C;  3GKX A;  2YV7 A;  5EL8 A;  1FW1 A;  4WF4 A;  4GXZ A;  2P5R A;  2A2R A;  4X4J A;  2B7K A;  3HJP A;  2B7J A;  4J56 E;  2V1M A;  3DD3 A;  3KP8 A;  4IHU A;  5GAN D;  3DRN A;  1NSW A;  4IQ1 A;  3APS A;  3KMN A;  1YZX A;  1SK1 A;  1JZR A;  2H1G A;  2K8V A;  5A5K A;  4KX4 A;  2L6C A;  3PH9 A;  3ERW A;  3W6G A;  2QKE A;  1R5P A;  3ZL5 A;  2HRK B;  1CQH A;  2A2P A;  3DWV A;  4KDU A;  5KN0 A;  3Q18 A;  3QD9 A;  2WFC A;  2O36 A;  3H79 A;  3IC8 A;  4KAE A;  3TJG A;  3GA4 A;  3Q6O A;  1FVK A;  3W8S A;  1R26 A;  3HJM A;  3GMF A;  4ZBB A;  3D0Z A;  4DEJ A;  2VD1 A;  5JWR B;  2VCX A;  4F0C A;  3D4T A;  1TXU A;  7GSS A;  4EC0 A;  1ML6 A;  2VL2 A;  3WYW A;  3IXR A;  1J08 A;  3P7X A;  2GZY A;  2HSM B;  4ZBA A;  2HQT A;  1MDI A;  2Z9S A;  2DIY A;  1B8X A;  5AIX A;  2JZS A;  2RM6 A;  2DJ2 A;  4KB3 A;  18GS A;  1O8X A;  4AJ8 A;  2R37 A;  2HNL A;  1SJZ A;  1U6T A;  5D93 A;  3W8J A;  5JWO B;  2PGT A;  2C0F A;  4TR4 A;  2R6K A;  5CRH A;  1PGT A;  2H66 A;  4ZBD A;  4IS0 A;  1YEP A;  1GRX A;  5G5F A;  1N2A A;  1X9W B;  4K2D A;  4RI6 A;  2H6Y A;  2VCT A;  2KUC A;  3QMX A;  1FB0 A;  4XS4 B;  4POL A;  3ZLP A;  4CHS A;  1VF1 A;  1TKD B;  1ERW A;  1Y25 A;  3P8W A;  4K0G A;  2XC2 A;  3ZTL A;  4PI2 C;  1M2D A;  2P5Q A;  5CRG A;  4OMV A;  3F6F A;  1YEW C;  2CVB A;  4POK A;  3M1G A;  5EY6 A;  1LU4 A;  3I6A A;  2P0G A;  1LJR A;  2A4V A;  1A2L A;  4GDF A;  4ICY A;  4ML1 A;  3G7I A;  3CTF A;  3IBH A;  2NVL A;  1T3B A;  1M7T A;  2MMA A;  1BG5 A;  3FW2 A;  2LST A;  2NBS A;  5KN3 A;  3HCZ A;  2PVO C;  1JZD A;  2CQ9 A;  2H70 A;  2K18 A;  3IC4 A;  1V57 A;  1XW9 A;  2YWM A;  3WT1 A;  2R3X A;  1RW1 A;  3DML A;  4XIH A;  1TJD A;  1MD4 A;  1XPV A;  2PVQ A;  2WUL A;  3TKS C;  1YKC A;  1DBY A;  1XXU A;  3M9K A;  1T7P B;  4LMW A;  4MP4 A;  5ECH B;  5IQY A;  1WWJ A;  4GRF A;  5A4V A;  2ES7 A;  3A2V A;  4K7O A;  5ELG A;  2QA1 A;  1DUG A;  6GSU A;  2ALB A;  2B3S A;  2FHE A;  1V98 A;  2GST A;  3E9J B;  3QOU A;  3UVT A;  2X99 A;  4ECJ A;  4MPG A;  1GSD A;  5IMA A;  2H1D A;  2E0Q A;  5BMU B;  4JRR A;  3L78 A;  5HFK A;  1OE8 A;  5B8A A;  1FAA A;  1TU7 A;  2F8A A;  2VLV A;  3D4M A;  4DSR A;  4L8E A;  1XVQ A;  2QGV A;  3ZVJ D;  1VF3 A;  2JL4 A;  3HZ8 A;  2H0I A;  3ERF A;  3QAG A;  2OE1 A;  5IIZ A;  1O7U A;  3LYK A;  2PMT A;  1SEN A;  2H30 A;  1SJ6 A;  1SU9 A;  3MWH A;  2WVZ A;  4IEL A;  2H1A A;  1BX9 A;  4HJM A;  4GTU A;  3RGB C;  5ECO B;  1X5D A;  2A4H A;  3G7J A;  5HR3 A;  2H0H A;  5AN1 A;  2IIY A;  2R0P A;  4NXI A;  3IHG A;  4GQC A;  2LNS A;  4CW9 A;  2TRC P;  1EOG A;  3HVX A;  4ID0 A;  2O5V A;  1OC9 A;  4GWR A;  3TDG A;  1GLP A;  4IJI A;  4KCE A;  1IYH A;  13GS A;  1AQV A;  1M9A A;  5J4V A;  1FHE A;  2KP1 A;  2CAI A;  4K6X A;  5G1L A;  1GTI A;  3VLN A;  5CO3 A;  2EFE A;  2X8G A;  1U3A A;  1H4O A;  2WVX B;  4PQI A;  2FA8 A;  2C8U A;  1GUH A;  1GSU A;  2IME A;  2A2S A;  3HXS A;  3LFL A;  3KTB A;  2V6K A;  2AV4 A;  4XS1 A;  1O85 A;  1G6Y A;  3LXT A;  1PKW A;  2OJL A;  5DAK A;  3E3E A;  5DVB A;  2VCZ A;  5A5H A;  2LRC A;  5DQY A;  2MYG A;  4K8M A;  4ZB9 A;  4IBP A;  4WF5 A;  2OE3 A;  5IM9 A;  3KZQ A;  3PPU A;  4BIK A;  1ZGN A;  4MF6 A;  4FO5 A;  2RM5 A;  3L0H A;  5IMV A;  2VCV A;  5KOX A;  5A4W A;  2HSN B;  1GP1 A;  2YZH A;  1PSQ A;  3UIW A;  1JLV A;  3UOM A;  1SL1 B;  3O6T A;  3FR9 A;  3V1W A;  5HFI A;  3TKR A;  1ZMA A;  4JU5 A;  1XW5 A;  3SBC A;  4Z2T A;  2H0G A;  4ZL9 A;  1A0F A;  2L5L A;  2CAQ A;  3FY7 A;  4OCF A;  4ILF A;  1AIU A;  3ZRD A;  5IMZ A;  2AB6 A;  3MAK A;  2H74 A;  3H1N A;  19GS A;  3ZVJ A;  4FQU A;  1EWX A;  4O5Q A;  2X64 A;  4D73 B;  1F37 A;  2X8H A;  3EE2 A;  4O7H A;  1T00 A;  4AKX B;  2PWJ A;  2R5G A;  2LTK A;  2PPT A;  4FXY P;  2YN1 A;  2WZS A;  2GSR A;  6GSY A;  4AKH A;  2H1B A;  2WGR A;  4BL7 A;  4O5R A;  3H8Q A;  5AIV A;  3VK9 A;  4AI6 A;  1M9B A;  6GSW A;  14GS A;  5ECL B;  3QCP A;  3GL3 A;  4KA0 A;  2GVP A;  4RQX A;  2VM1 A;  3MNG A;  2CVK A;  2DMM A;  4TRX A;  4WR5 A;  2NDO A;  4KGI A;  1K0N A;  2BJX A;  3VI7 A;  4O5U A;  1M2B A;  3D5J A;  4MZC A;  4TVE A;  2PN8 A;  3A3T A;  1XZO A;  3GRX A;  2JAC A;  2X49 A;  2VM2 A;  2QSI A;  1SK2 A;  1G6W A;  3FYG A;  4TXO A;  1EV9 A;  3LSZ A;  3CSJ A;  1PL1 A;  1SD8 A;  6GST A;  2M46 A;  1QMV A;  3LYP A;  5A1N B;  11GS A;  4WBR D;  5HR0 A;  4EL1 A;  2NTO A;  2DLX A;  2YZU A;  3QR6 A;  4HEA 2;  4XTS A;  1USB A;  3HVN A;  2DKI A;  2EFD A;  5J9B A;  1B4Q A;  3R2Q A;  1XW6 A;  1TXX A;  3KD0 A;  3GKM A;  1HNA A;  4ZB6 A;  1U88 A;  3FK8 A;  2OAD A;  1JZO A;  4HZ4 A;  4N3Z A;  2R2J A;  2O85 A;  2YOI A;  1SYX A;  3PIN A;  3ZMK A;  2R0G A;  1M3J A;  1AC1 A;  4MF7 A;  1EEJ A;  2VAF A;  4KCA A;  5IMF A;  5D9X A;  3GYK A;  4N11 A;  4BWQ A;  2C3Q A;  4P3Y B;  2R0C A;  1XWA A;  1O8W A;  3A5I A;  1PX6 A;  3I69 A;  4JR6 A;  3TKS A;  3M9J A;  3APO A;  3GIX A;  2H8L A;  5F8B A;  2B5X A;  1AW9 A;  3RAZ A;  4YQM A;  5GST A;  5D73 A;  1K0C A;  3O76 A;  3P90 A;  1RK4 A;  2L4C A;  4KDY A;  1SL0 B;  5KOW A;  1E2Y A;  4MJC A;  2GGT A;  3UAP A;  3IA1 A;  1XIY A;  5J41 A;  3FR6 A;  5DCH A;  1Z5Y E;  3C71 A;  2H71 A;  5CRE A;  3ZIJ A;  1UVZ A;  4HQZ A;  5H5Q A;  4HS1 A;  1BG1 A;  2EC4 A;  5A34 A;  3RDW A;  2JSZ A;  3F4T A;  2HZE A;  2ZCT A;  4E8H A;  1FOV A;  1PQN A;  4WKW A;  3LWA A;  2DBC A;  2DJ3 A;  4G19 A;  3LG6 A;  3A2W A;  4TR1 A;  3UBL A;  2J9H A;  5J40 A;  1Q4J A;  1TK0 B;  1XWK A;  4Z7X A;  4NV2 A;  3FHK A;  2C0G A;  1QFN A;  2IMD A;  3VI5 A;  3KH9 A;  4OWY A;  1Z3E A;  4FYC A;  2MBS A;  5A4U A;  3F63 A;  3WGE A;  5GAP D;  5H5S A;  4ZB8 A;  2FWF A;  3GTU A;  4HI7 A;  4RI7 A;  2OAC A;  1B9X C;  4TN8 A;  2HZF A;  3IE3 A;  4AKG A;  3FKF A;  4W66 A;  5KEJ A;  2J23 A;  2ON7 A;  1KBN A;  4OFT A;  2M80 A;  1C72 A;  3BCK A;  2VCQ A;  1TRS A;  5C04 A;  4EIP A;  4TR3 A;  4WBJ A;  3LXZ A;  5LNK e;  4ML6 A;  1YF1 A;  1QK8 A;  2C4J A;  1F9M A;  5FT3 A;  2FGX A;  3EYT A;  2I4A A;  3HD5 A;  3NZN A;  4BVX A;  1GSY A;  2XBQ A;  5F05 A;  1YEX A;  2HYX A;  2MZC A;  2FWE A;  1JHB A;  1TRW A;  4BVY A;  4PNF A;  1TK5 B;  2BTO T;  3EVI A;  1F6M C;  4TKY A;  3QDN A;  1IYI A;  2O8V B;  5AGY A;  4N30 A;  3K8N A;  5KN2 A;  1PFO A;  2LS5 A;  3GH9 A;  2GZP A;  2KOK A;  3WT2 A;  2CX4 A;  1ON4 A;  1Y6E A;  2DSA A;  5CRW A;  5DAL B;  4KUN A;  2IFQ A;  1VF4 A;  4F2I A;  1EZK A;  1ERT A;  3OR5 A;  2V6O A;  3TUE A;  3KGK A;  3VFI A;  1GNE A;  2GT5 A;  2H72 A;  4TW5 A;  2ON5 A;  4X0X A;  3H93 A;  5ID2 B;  4ZL7 A;  1AAZ A;  1BF5 A;  3U5R E;  4EVM A;  2REM A;  3UEM A;  5D9W A;  2XHF A;  3KXO A;  1XVW A;  3VWX A;  1LBK A;  3VUR A;  2HRN A;  2VIM A;  3FZ4 A;  5DBQ A;  4KE3 A;  4N0V A;  3ZIV A;  2YNX A;  2E7P A;  1HD2 A;  3HDC A;  4AGS A;  5L71 A;  2I3Y A;  2CZ3 A;  2OT3 A;  5CP1 A;  4A5P A;  2MMZ A;  3JCM L;  3QAW A;  3GFK A;  1SKW B;  4HDE A;  1UN2 A;  5A5H B;  1Z7P A;  4EE0 A;  2I1U A;  3WGX A;  4ZL8 A;  1JFU A;  2C0D A;  4MK3 A;  4XHM A;  3GHA A;  1W4V A;  9GSS A;  1TRU A;  3KM6 A;  2X4A A;  4CY6 A;  1J0F A;  3UVH A;  1T1V A;  1A24 A;  1RQM A;  1ZL9 A;  1M2A A;  1O81 A;  4MH2 A;  4NPB A;  1YQ1 A;  3HVV A;  1TI1 A;  1ERU A;  4Z2R A;  1B4P A;  4JED A;  2WDU A;  4GSN A;  4K0N A;  2YJH A;  3ME8 A;  3GX8 A;  4EIQ A;  1PD2 1;  5G5E A;  3GX0 A;  1K0O A;  2KHP A;  3ERG A;  1X0R A;  1ZYQ B;  3DXB A;  1GTA A;  1FVJ A;  10GS A;  3J7Y k;  2VCW A;  4F9Z A;  1SVO A;  3EMP A;  2JZR A;  3GKN A;  1S4B P;  1EP8 A;  2HRK A;  2VLT A;  5J9C A;  4IKH A;  2DKH A;  2B5Y A;  3IV4 A;  1NM3 A;  2FCH A;  2O7K A;  3GNJ A;  4MH3 A;  1X9M B;  4EUY A;  4DSS B;  4TR0 A;  5E59 A;  2K8S A;  3HZ4 A;  4IN0 A;  4NHZ A;  4LMV A;  4K7I A;  2OE0 A;  3KIJ A;  1ACV A;  3RPN A;  4O92 A;  5HQP A;  3TJF A;  1WP0 A;  3BD2 A;  17GS A;  4EO3 A;  4ZB7 A;  4KF9 A;  1PKZ A;  5ECK B;  4MCU A;  4MJE A;  2DC5 A;  2I81 A;  5D96 A;  3EWL A;  5G2Z A;  3F6D A;  1YDK A;  4V2M A;  1GH2 A;  3QFB C;  6GSS A;  3J7Y b;  3G9B A;  3M8N A;  5F06 A;  3HJO A;  3ZIT A;  2XPE A;  1GSQ A;  1ZYP A;  4PTS A;  2VLU A;  4OO4 A;  3BCI A;  2H1L A;  4KSO A;  3RHC A;  3DVX A;  4MLY A;  5DJM A;  5IPG A;  4MZW A;  2VOC A;  4XS4 A;  2H19 A;  2FD3 A;  2YV9 A;  5GZZ B;  1ZYN A;  4IVF A;  4AKI A;  5G30 A;  3NIV A;  2FWH A;  3PGT A;  3GKK A;  1QQ2 A;  3TKP A;  1ZZY A;  4JE1 A;  1FOH A;  2H01 A;  1WMJ A;  4K5R A;  1T4Y A;  3TKS E;  3TOU A;  2VL2 C;  4KSM A;  1GUK A;  6GSX A;  3TJK A;  3L4N A;  2UZ8 A;  4PXO A;  2FA4 A;  4EXJ A;  1U3I A;  1V40 A;  1URM A;  4BPY A;  4ACS A;  3CXG A;  1I1I P;  3QFA C;  1YKA A;  3TRX A;  3CRU A;  1GUM A;  2N5A A;  1SKR B;  3L9V A;  1BYE A;  3F9U A;  3LGC A;  3RHB A;  2OKA A;  3KP9 A;  5H5R A;  4RUV A;  1I9D A;  3IRA A;  3D6I A;  1S3R A;  4O32 A;  1MDJ A;  4K5S A;  3TJJ A;  1SYR A;  1A8L A;  5ECM B;  3F3Q A;  2I9H A;  4XRD A;  2YCD A;  4WEY A;  1QXH A;  5ECR B;  2JU5 A;  12GS A;  3TOT A;  4MDC A;  1NHO A;  2E2G A;  3RPP A;  1PRX A;  3CRT A;  3ZFL A;  5BMU A;  2X8C A;  4KH7 A;  4USS A;  1AQX A;  3N9J A;  1OC3 A;  1SKS B;  5B8B A;  2CX3 A;  2HLS A;  1N8J A;  4NV5 A;  2JZT A;  2K6V A;  3LOR A;  5ECQ B;  4EDZ A;  2FWG A;  3H4K A;  2LV3 A;  5CNW A;  2AHE A;  3FR3 A;  4JZQ A;  4G0K A;  2O87 A;  4IP1 A;  2HRA A;  3DKS A;  4EKZ A;  1EOH A;  3IDV A;  2DJ1 A;  3LW9 A;  3TGZ A;  2WZ9 A;  5D8I A;  2H75 A;  5KN1 A;  3DGQ A;  1FG4 A;  5ECS A;  1MD3 A;  5CAX A;  1QGV A;  2CZ2 A;  1PN0 A;  1JZW A;  2GZZ A;  1VF2 A;  2C3T A;  3LJR A;  1W89 A;  4TOP A;  4WXT A;  2F9S A;  3GUR A;  3PR8 A;  3FEU A;  1KNG A;  4YQU A;  4IJ3 A;  3KH7 A;  4N10 A;  4PUR A;  2YAN A;  1V58 A;  5DDL A;  4PUF C;  3F4R A;  1OYJ A;  2AYT A;  1XWC A;  2LJK A;  2O3E A;  4ECI A;  3VWV A;  2LRN A;  3TKQ A;  4HOJ A;  1T4Z A;  2DJJ A;  2L6D A;  5J3R A;  3Q19 A;  3HKR A;  1KEB A;  2AJQ B;  4Q5N A;  1F2E A;  5HR2 A;  4Q5R A;  1F3B A;  1B9Y C;  2WVX A;  2LJA A;  2C3N A;  2XPD A;  1MDK A;  3E0U A;  4YAP A;  3EC3 A;  3L9U A;  3UMA A;  1T8E B;  2LQQ A;  3ZRE A;  1A2J A;  4MNN A;  1A0R P;  3EU4 A;  3TJB A;  2OBI A;  2CT6 A;  4PUA A;  4MA9 A;  2GDR A;  3DEX A;  3AY8 A;  3NOF A;  3C8E A;  4NWY A;  5F0G A;  3I43 A;  4K2X A;  4HZ2 A;  1G7E A;  5JCG A;  1AXD A;  2HSN A;  4ULX A;  1BED A;  5ECP B;  3R3E A;  2KP2 A;  2EFC A;  1ZOF A;  3N5O A;  3HY2 A;  5E4W A;  1ABA A;  3VWU A;  3FZ5 A;  4CY8 A;  4N0Z A;  4CDO A;  1PN9 A;  4L5L A;  1GUL A;  4OFM A;  3KMO A;  2HRF A;  4H86 A;  3DIE A;  5ENU A;  3C7M A;  2CVD A;  3IOS A;  5D9T A;  1TTZ A;  2LEG A;  1PMT A;  5J4Y A;  3P2A A;  5G1K A;  2WCI A;  2VUP A;  1WJK A;  4D73 A;  4Z2U A;  3HVS A;  4FIW A;  2LNT A;  4J2F A;  4F03 A;  4FH8 A;  1Y1U A;  4AF2 A;  5J47 A;  3Q74 A;  4L0W A;  5J4U A;  3FZA A;  2UV8 G;  4MJA A;  4BWS A;  2PBJ A;  4WR4 A;  2YPM A;  2N5F A;  3IK9 A;  3RBT A;  3IR4 A;  3LQ7 A;  5IMC A;  4HUA A;  4YKG A;  4LL4 B;  1S3A A;  4K9Z A;  2WW2 A;  4XCS A;  1GWC A;  2L59 A;  3C1S A;  1TK8 B;  2DJ0 A;  1X5C A;  3S9F A;  1OKT A;  2WRT A;  3IHQ A;  1OKD A;  1TOF A;  3UJ1 A;  2LKU A;  3EIN A;  3TRP A;  3GSS A;  2YWI A;  1WE0 A;  1EGR A;  3EUR A;  2OBK A;  3KCM A;  3CSH A;  2WW3 A;  20GS A;  4KND A;  1GSS A;  1XG8 A;  3ED3 A;  2WW0 A;  5ECI B;  5A1N A;  4FYB A;  4G2E A;  3CSI A;  1PX7 A;  4PI0 C;  5F07 A;  4Q5F A;  2IJY A;  8GSS A;  2HSY A;  1N25 A;  5AIS A;  1THO A;  1WOU A;  2MMN A;  1SL2 B;  4MPF A;  1DE2 A;  1FO5 A;  3VWW A;  1HNC A;  4LLR A;  1OC9 B;  5CYY A;  3QPM A;  2GTU A;  4JBB A;  1VRS D;  3MIX A;  4HU9 A;  1Q98 A;  4EF0 A;  2V41 A;  1GL8 A;  4OO5 A;  3O3T A;  2DML A;  3GUS A;  2HXK A;  2JSY A;  4I6X A;  2FNO A;  2LRT A;  3HYP A;  2YWN A;  4V2L A;  2QC7 A;  5GSS A;  2JAD A;  2TRX A;  4WET A;  4AJ7 A;  4PGT A;  2CV4 A;  5COH A;  1AQW A;  4K7N A;  5DCG A;  1K0M A;  5LCZ A;  4NAX A;  1S3C A;  1BJX A;  1KTE A;  5IPH A;  5DAK B;  1ERV A;  1K0D A;  2LUS A;  1M0U A;  3HMJ G;  4I2T A;  2LJR A;  5BRT A;  3BJ5 A;  2RLI A;  4PX1 A;  2B1L A;  5HR1 A;  3MSZ A;  2GSS A;  1R5A A;  2ZUP A;  4J57 E;  3F8U A;  3KEB A;  2VO4 A;  4F0B A;  2HT9 A;  1K3O A;  3HHV A;  1YY7 A;  2HE3 A;  4POM A;  1FB6 A;  3TRQ A;  2WS2 A;  5D9V A;  2AUV A;  4L0U A;  2IMI A;  2KLX A;  4X43 A;  4IP6 A;  2GQM A;  3TCO A;  2LQO A;  4OCE A;  1O73 A;  1SJI A;  3A5W A;  3KTL A;  22GS A;  4ECB A;  2IWT A;  1QUW A;  3WD6 A;  3CTG A;  2M72 A;  1EV4 A;  1Z6N A;  3SWL A;  2NPB A;  5DJL A;  2H6X A;  4HJ2 A;  4ZIJ A;  1S3D A;  3GH6 A;  1B48 A;  5C00 A;  3HA9 A;  5IMD A;  1GTU A;  4K1F A;  1A23 A;  1K0A A;  4BL7 B;  1GTB A;  1TRV A;  5LD0 A;  2B5E A;  3BBY A;  1BAY A;  2D2Z A;  1V2A A;  4I97 A;  2PU9 C;  1SVM A;  2G2Q A;  1A2M A;  2IN3 A;  4KW6 A;  2IMK A;  1JLW A;  4ECC A;  2P31 A;  3D22 A;  3FRC A;  2HSM A;  5IOW A;  2PER A;  1XWB A;  2L4Q A;  4HSC X;  3CMI A;  2V2G A;  4TXO B;  1VGL A;  3APQ A;  2N5B A;  1WPI A;  4GSS A;  5EPF A;  4PNG A;  1WRY A;  4YKF A;  4MF5 A;  4MMM A;  2HFD A;  2IPA A;  1X9S B;  5FWG A;  4NHW A;  5DAL A;  4PQ1 A;  3GL5 A;  3C73 A;  4I5Q A;  4G0L A;  5ECN B;  2QA2 A;  2IL3 A;  1OE7 A;  1TDI A;  4QQ7 A;  1NW2 A;  3GV1 A;  4DSQ A;  1OVN A;  1O6J A;  5ID2 A;  2WJU A;  1SVL A;  4L5O A;  1WIK A;  2MBT A;  1TI3 A;  4YH2 A;  2WVY A;  3KJY A;  5G31 A;  3M0F A;  1G0T A;  3F4S A;  1EGO A;  4IGJ A;  4MAB A;  2F8F A;  4G01 A;  1GSE A;  2G0F A;  1YF0 A;  1K3Y A;  1H75 A;  1OC8 A;  4KDX A;  1ILO A;  4RQR A;  4TXV A;  5IO2 A;  1MTC A;  4F82 A;  1A8Y A;  3ZZX A;  2E2M A;  4JR4 A;  3UL3 A;  2C0E A;  3VPT A;  1XWG A;  3F3R A;  3D21 A;  1F3A A;  2B1K A;  5ABR A;  1AUC A;  1DE1 A;  2GQK A;  3QAV A;  1XOB A;  4LA1 A;  2MMO A;  2VL3 A;  2FLS A;  3DYR A;  3ME7 A;  4OD7 A;  1EP7 A;  3IAM 2;  5A34 B;  1THX A;  2EIR A;  2XBI A;  4XS6 A;  4I8B A;  1V9W A;  4ZXG A;  1GSF A;  2HZE B;  2GLR A;  4HU7 A;  2H6Z A;  1Z9H A;  3IAS 2;  4TR1 B;  3CHX C;  2CA8 A;  3ZYW A;  2H73 A;  3FMW A;  4IW9 A;  3GN3 A;  1MEK A;  1X5E A;  4GLT A;  2AAW A;  1M99 A;  2RII A;  3LEF A;  1R4W A;  1E6B A;  3IPZ A;  3CYN A;  2EIO A;  2C1Y A;  3CQF A;  3IK7 A;  5ELA A;  4GST A;  3UAR A;  3CBU A;  2DIZ A;  4OFN A;  1HNB A;  4XRA A;  2H76 A;  4LL1 B;  5JCU A;  3GTU B;  1DSB A;  1K0B A;  4QMK A;  1G7O A;  1Z6M A;  4V2N A;  1K3L A; 
#chains in the Genus database with same CATH homology
 1Z7R A;  2GS3 A;  4DSS A;  4IQA A;  2C80 A;  5HFG A;  4PQH A;  2RUE A;  2GSQ A;  4POB A;  3L9S A;  16GS A;  2V32 A;  3EPT A;  2VKZ G;  4FYU A;  2VD0 A;  2FUG 2;  3VPQ A;  2BMX A;  3CWG A;  1GLQ A;  1ST9 A;  2K9F A;  1TP9 A;  4MZB A;  1XFL A;  4AJ6 A;  2GQL A;  3ISO A;  5B7C A;  2HSH A;  1SD9 A;  2PUK C;  3U6V A;  1UA5 A;  5FHI A;  4BVX B;  2L57 A;  4QL7 A;  4GCI A;  1TU8 A;  1HYU A;  5EVO A;  2EIQ A;  4I2U A;  4ISD A;  5CRD A;  2EFH A;  3TU3 B;  2L5O A;  2O89 A;  4BVY B;  2B6M A;  1U87 A;  3UBK A;  1UC7 A;  3A2X A;  1CQG A;  5JCW A;  2F3M A;  3GST A;  5J5N A;  1GNW A;  6GSV A;  2TIR A;  2YJ7 A;  5B6N A;  3G7Y A;  3C1R A;  2IMF A;  1OAZ A;  1R7H A;  4E8E A;  2IFQ B;  2WB9 A;  3EU3 A;  2ZNM A;  1SK0 A;  1NHY A;  4YAV A;  2RUF A;  5INY A;  5JWQ B;  5DQS A;  2OA7 A;  1EEM A;  5IOX A;  1I5G A;  2VL9 A;  3M3M A;  4YQV A;  4GF0 A;  1J9B A;  3MDK A;  3DVW A;  3TB2 A;  3US3 A;  2DJK A;  1ZYE A;  4BA7 A;  3ZML A;  1XBS A;  1BQ7 A;  4X1U A;  2GT6 A;  4EDY A;  4NMU A;  2YP6 A;  3FZ9 A;  3F0I A;  1HQO A;  1PL2 A;  1YJ6 A;  4G9H A;  1YVL A;  4QL9 A;  4V1A p;  3WGD A;  2YWO A;  2F51 A;  1TW9 A;  1PA3 A;  2R4V A;  5B6M A;  3BOA A;  1ZCP A;  4G0I A;  1XCC A;  2FY6 A;  4DVC A;  4G10 A;  4Q5Q A;  4V1A g;  5IO0 A;  4MJB A;  3EMX A;  4ZIL A;  4GQF A;  4E68 A;  3MYD A;  4HQS A;  3ZFB A;  3I9V 2;  1XOA A;  2HI7 A;  3GKX A;  2YV7 A;  5EL8 A;  1FW1 A;  4WF4 A;  4GXZ A;  2P5R A;  2A2R A;  4X4J A;  2B7K A;  3HJP A;  2B7J A;  4J56 E;  2V1M A;  3DD3 A;  3KP8 A;  4IHU A;  5GAN D;  3DRN A;  1NSW A;  4IQ1 A;  3APS A;  3KMN A;  1YZX A;  1SK1 A;  1JZR A;  2H1G A;  2K8V A;  5A5K A;  4KX4 A;  2L6C A;  3PH9 A;  3ERW A;  3W6G A;  2QKE A;  1R5P A;  3ZL5 A;  2HRK B;  1CQH A;  2A2P A;  3DWV A;  4KDU A;  5KN0 A;  3Q18 A;  3QD9 A;  2WFC A;  3H79 A;  3IC8 A;  4KAE A;  3TJG A;  3GA4 A;  3Q6O A;  1FVK A;  3W8S A;  1R26 A;  3HJM A;  3GMF A;  4ZBB A;  3D0Z A;  4DEJ A;  2VD1 A;  5JWR B;  2VCX A;  4F0C A;  3D4T A;  1TXU A;  7GSS A;  4EC0 A;  1ML6 A;  2VL2 A;  3WYW A;  3IXR A;  1J08 A;  3P7X A;  2GZY A;  2HSM B;  4ZBA A;  2HQT A;  1MDI A;  2Z9S A;  2DIY A;  1B8X A;  5AIX A;  2JZS A;  2RM6 A;  2DJ2 A;  4KB3 A;  18GS A;  1O8X A;  4AJ8 A;  2R37 A;  2HNL A;  1SJZ A;  1U6T A;  5D93 A;  3W8J A;  5JWO B;  2PGT A;  2C0F A;  4TR4 A;  2R6K A;  5CRH A;  1PGT A;  2H66 A;  4ZBD A;  4IS0 A;  1YEP A;  1GRX A;  5G5F A;  1N2A A;  1X9W B;  4K2D A;  4RI6 A;  2H6Y A;  2VCT A;  2KUC A;  3QMX A;  1FB0 A;  4XS4 B;  4POL A;  3ZLP A;  4CHS A;  1VF1 A;  1TKD B;  1ERW A;  1Y25 A;  3P8W A;  4K0G A;  2XC2 A;  3ZTL A;  1M2D A;  2P5Q A;  5CRG A;  4OMV A;  3F6F A;  2CVB A;  4POK A;  3M1G A;  5EY6 A;  1LU4 A;  3I6A A;  2P0G A;  1LJR A;  2A4V A;  1A2L A;  4GDF A;  4ICY A;  4ML1 A;  3G7I A;  3CTF A;  3IBH A;  2NVL A;  1T3B A;  1M7T A;  2MMA A;  1BG5 A;  3FW2 A;  2LST A;  2NBS A;  5KN3 A;  3HCZ A;  2PVO C;  1JZD A;  2CQ9 A;  2H70 A;  2K18 A;  3IC4 A;  1V57 A;  1XW9 A;  2YWM A;  3WT1 A;  2R3X A;  1RW1 A;  3DML A;  4XIH A;  1TJD A;  1MD4 A;  1XPV A;  2PVQ A;  2WUL A;  3TKS C;  1YKC A;  1DBY A;  1XXU A;  3M9K A;  1T7P B;  4LMW A;  4MP4 A;  5ECH B;  5IQY A;  1WWJ A;  4GRF A;  5A4V A;  2ES7 A;  3A2V A;  4K7O A;  5ELG A;  2QA1 A;  1DUG A;  6GSU A;  2ALB A;  2B3S A;  2FHE A;  1V98 A;  2GST A;  3E9J B;  3QOU A;  3UVT A;  2X99 A;  4ECJ A;  4MPG A;  1GSD A;  5IMA A;  2H1D A;  2E0Q A;  5BMU B;  4JRR A;  3L78 A;  5HFK A;  1OE8 A;  5B8A A;  1FAA A;  1TU7 A;  2F8A A;  2VLV A;  3D4M A;  4DSR A;  4L8E A;  1XVQ A;  2QGV A;  3ZVJ D;  1VF3 A;  2JL4 A;  3HZ8 A;  2H0I A;  3ERF A;  3QAG A;  2OE1 A;  5IIZ A;  1O7U A;  3LYK A;  2PMT A;  1SEN A;  2H30 A;  1SJ6 A;  1SU9 A;  3MWH A;  4IEL A;  2H1A A;  1BX9 A;  4HJM A;  4GTU A;  5ECO B;  1X5D A;  2A4H A;  3G7J A;  5HR3 A;  2H0H A;  5AN1 A;  2IIY A;  2R0P A;  4NXI A;  3IHG A;  4GQC A;  2LNS A;  4CW9 A;  2TRC P;  1EOG A;  3HVX A;  4ID0 A;  2O5V A;  1OC9 A;  4GWR A;  3TDG A;  1GLP A;  4IJI A;  4KCE A;  1IYH A;  13GS A;  1AQV A;  1M9A A;  5J4V A;  1FHE A;  2KP1 A;  2CAI A;  4K6X A;  5G1L A;  1GTI A;  3VLN A;  5CO3 A;  2EFE A;  2X8G A;  1U3A A;  1H4O A;  4PQI A;  2FA8 A;  2C8U A;  1GUH A;  1GSU A;  2IME A;  2A2S A;  3HXS A;  3LFL A;  3KTB A;  2V6K A;  2AV4 A;  4XS1 A;  1O85 A;  1G6Y A;  3LXT A;  1PKW A;  2OJL A;  5DAK A;  3E3E A;  5DVB A;  2VCZ A;  5A5H A;  2LRC A;  5DQY A;  2MYG A;  4K8M A;  4ZB9 A;  4IBP A;  4WF5 A;  2OE3 A;  5IM9 A;  3KZQ A;  3PPU A;  1ZGN A;  4MF6 A;  4FO5 A;  2RM5 A;  3L0H A;  5IMV A;  2VCV A;  5KOX A;  5A4W A;  2HSN B;  1GP1 A;  2YZH A;  1PSQ A;  3UIW A;  1JLV A;  3UOM A;  1SL1 B;  3O6T A;  3FR9 A;  3V1W A;  5HFI A;  3TKR A;  1ZMA A;  4JU5 A;  1XW5 A;  3SBC A;  4Z2T A;  2H0G A;  4ZL9 A;  1A0F A;  2L5L A;  2CAQ A;  3FY7 A;  4OCF A;  4ILF A;  1AIU A;  3ZRD A;  5IMZ A;  2AB6 A;  3MAK A;  2H74 A;  3H1N A;  19GS A;  3ZVJ A;  4FQU A;  1EWX A;  4O5Q A;  2X64 A;  4D73 B;  1F37 A;  2X8H A;  3EE2 A;  4O7H A;  1T00 A;  4AKX B;  2PWJ A;  2R5G A;  2LTK A;  2PPT A;  2YN1 A;  2GSR A;  6GSY A;  4AKH A;  2H1B A;  2WGR A;  4BL7 A;  4O5R A;  3H8Q A;  5AIV A;  3VK9 A;  4AI6 A;  1M9B A;  6GSW A;  14GS A;  5ECL B;  3QCP A;  3GL3 A;  4KA0 A;  2GVP A;  4RQX A;  2VM1 A;  3MNG A;  2CVK A;  2DMM A;  4TRX A;  4WR5 A;  2NDO A;  4KGI A;  1K0N A;  2BJX A;  3VI7 A;  4O5U A;  1M2B A;  3D5J A;  4MZC A;  4TVE A;  2PN8 A;  3A3T A;  1XZO A;  3GRX A;  2JAC A;  2X49 A;  2VM2 A;  2QSI A;  1SK2 A;  1G6W A;  3FYG A;  4TXO A;  1EV9 A;  3LSZ A;  3CSJ A;  1PL1 A;  1SD8 A;  6GST A;  2M46 A;  1QMV A;  3LYP A;  5A1N B;  11GS A;  4WBR D;  5HR0 A;  4EL1 A;  2NTO A;  2DLX A;  2YZU A;  3QR6 A;  4HEA 2;  4XTS A;  1USB A;  2DKI A;  2EFD A;  5J9B A;  1B4Q A;  3R2Q A;  1XW6 A;  1TXX A;  3KD0 A;  3GKM A;  1HNA A;  4ZB6 A;  1U88 A;  3FK8 A;  2OAD A;  1JZO A;  4HZ4 A;  4N3Z A;  2R2J A;  2O85 A;  2YOI A;  1SYX A;  3PIN A;  3ZMK A;  2R0G A;  1AC1 A;  4MF7 A;  1EEJ A;  2VAF A;  4KCA A;  5IMF A;  5D9X A;  3GYK A;  4N11 A;  4BWQ A;  2C3Q A;  4P3Y B;  2R0C A;  1XWA A;  1O8W A;  3A5I A;  1PX6 A;  3I69 A;  4JR6 A;  3TKS A;  3M9J A;  3APO A;  3GIX A;  2H8L A;  5F8B A;  2B5X A;  1AW9 A;  3RAZ A;  4YQM A;  5GST A;  5D73 A;  1K0C A;  3O76 A;  3P90 A;  1RK4 A;  2L4C A;  4KDY A;  1SL0 B;  5KOW A;  1E2Y A;  4MJC A;  2GGT A;  3UAP A;  3IA1 A;  1XIY A;  5J41 A;  3FR6 A;  5DCH A;  1Z5Y E;  3C71 A;  2H71 A;  5CRE A;  3ZIJ A;  1UVZ A;  4HQZ A;  5H5Q A;  4HS1 A;  1BG1 A;  2EC4 A;  5A34 A;  3RDW A;  2JSZ A;  3F4T A;  2HZE A;  2ZCT A;  4E8H A;  1FOV A;  1PQN A;  4WKW A;  3LWA A;  2DBC A;  2DJ3 A;  4G19 A;  3LG6 A;  3A2W A;  4TR1 A;  3UBL A;  2J9H A;  5J40 A;  1Q4J A;  1TK0 B;  1XWK A;  4Z7X A;  4NV2 A;  3FHK A;  2C0G A;  1QFN A;  2IMD A;  3VI5 A;  3KH9 A;  4OWY A;  1Z3E A;  4FYC A;  2MBS A;  5A4U A;  3F63 A;  3WGE A;  5GAP D;  5H5S A;  4ZB8 A;  2FWF A;  3GTU A;  4HI7 A;  4RI7 A;  2OAC A;  1B9X C;  4TN8 A;  2HZF A;  3IE3 A;  4AKG A;  3FKF A;  4W66 A;  5KEJ A;  2J23 A;  2ON7 A;  1KBN A;  4OFT A;  2M80 A;  1C72 A;  3BCK A;  2VCQ A;  1TRS A;  5C04 A;  4EIP A;  4TR3 A;  4WBJ A;  3LXZ A;  5LNK e;  4ML6 A;  1YF1 A;  1QK8 A;  2C4J A;  1F9M A;  5FT3 A;  2FGX A;  3EYT A;  2I4A A;  3HD5 A;  3NZN A;  4BVX A;  1GSY A;  2XBQ A;  5F05 A;  1YEX A;  2HYX A;  2MZC A;  2FWE A;  1JHB A;  1TRW A;  4BVY A;  4PNF A;  1TK5 B;  2BTO T;  3EVI A;  1F6M C;  4TKY A;  3QDN A;  1IYI A;  2O8V B;  5AGY A;  4N30 A;  3K8N A;  5KN2 A;  2LS5 A;  3GH9 A;  2GZP A;  2KOK A;  3WT2 A;  2CX4 A;  1ON4 A;  1Y6E A;  2DSA A;  5CRW A;  5DAL B;  4KUN A;  2IFQ A;  1VF4 A;  4F2I A;  1EZK A;  1ERT A;  3OR5 A;  2V6O A;  3TUE A;  3KGK A;  3VFI A;  1GNE A;  2GT5 A;  2H72 A;  4TW5 A;  2ON5 A;  4X0X A;  3H93 A;  5ID2 B;  4ZL7 A;  1AAZ A;  1BF5 A;  3U5R E;  4EVM A;  2REM A;  3UEM A;  5D9W A;  2XHF A;  3KXO A;  1XVW A;  3VWX A;  1LBK A;  3VUR A;  2HRN A;  2VIM A;  3FZ4 A;  5DBQ A;  4KE3 A;  4N0V A;  3ZIV A;  2YNX A;  2E7P A;  1HD2 A;  3HDC A;  4AGS A;  5L71 A;  2I3Y A;  2CZ3 A;  2OT3 A;  5CP1 A;  4A5P A;  2MMZ A;  3JCM L;  3QAW A;  3GFK A;  1SKW B;  4HDE A;  1UN2 A;  5A5H B;  1Z7P A;  4EE0 A;  2I1U A;  3WGX A;  4ZL8 A;  1JFU A;  2C0D A;  4MK3 A;  4XHM A;  3GHA A;  1W4V A;  9GSS A;  1TRU A;  3KM6 A;  2X4A A;  4CY6 A;  1J0F A;  3UVH A;  1T1V A;  1A24 A;  1RQM A;  1ZL9 A;  1M2A A;  1O81 A;  4MH2 A;  4NPB A;  1YQ1 A;  3HVV A;  1TI1 A;  1ERU A;  4Z2R A;  1B4P A;  4JED A;  2WDU A;  4GSN A;  4K0N A;  2YJH A;  3ME8 A;  3GX8 A;  4EIQ A;  1PD2 1;  5G5E A;  3GX0 A;  1K0O A;  2KHP A;  3ERG A;  1X0R A;  1ZYQ B;  3DXB A;  1GTA A;  1FVJ A;  10GS A;  3J7Y k;  2VCW A;  4F9Z A;  1SVO A;  3EMP A;  2JZR A;  3GKN A;  1EP8 A;  2HRK A;  2VLT A;  5J9C A;  4IKH A;  2DKH A;  2B5Y A;  3IV4 A;  1NM3 A;  2FCH A;  2O7K A;  3GNJ A;  4MH3 A;  1X9M B;  4EUY A;  4DSS B;  4TR0 A;  5E59 A;  2K8S A;  3HZ4 A;  4IN0 A;  4NHZ A;  4LMV A;  4K7I A;  2OE0 A;  3KIJ A;  1ACV A;  3RPN A;  4O92 A;  5HQP A;  3TJF A;  1WP0 A;  3BD2 A;  17GS A;  4EO3 A;  4ZB7 A;  4KF9 A;  1PKZ A;  5ECK B;  4MCU A;  4MJE A;  2DC5 A;  2I81 A;  5D96 A;  3EWL A;  5G2Z A;  3F6D A;  1YDK A;  4V2M A;  1GH2 A;  3QFB C;  6GSS A;  3J7Y b;  3G9B A;  3M8N A;  5F06 A;  3HJO A;  3ZIT A;  2XPE A;  1GSQ A;  1ZYP A;  4PTS A;  2VLU A;  4OO4 A;  3BCI A;  2H1L A;  4KSO A;  3RHC A;  3DVX A;  4MLY A;  5DJM A;  5IPG A;  4MZW A;  2VOC A;  4XS4 A;  2H19 A;  2FD3 A;  2YV9 A;  5GZZ B;  1ZYN A;  4IVF A;  4AKI A;  5G30 A;  3NIV A;  2FWH A;  3PGT A;  3GKK A;  1QQ2 A;  3TKP A;  1ZZY A;  4JE1 A;  1FOH A;  2H01 A;  1WMJ A;  4K5R A;  1T4Y A;  3TKS E;  3TOU A;  2VL2 C;  4KSM A;  1GUK A;  6GSX A;  3TJK A;  3L4N A;  2UZ8 A;  4PXO A;  2FA4 A;  4EXJ A;  1U3I A;  1V40 A;  1URM A;  4BPY A;  4ACS A;  3CXG A;  3QFA C;  1YKA A;  3TRX A;  3CRU A;  1GUM A;  2N5A A;  1SKR B;  3L9V A;  1BYE A;  3F9U A;  3LGC A;  3RHB A;  2OKA A;  3KP9 A;  5H5R A;  4RUV A;  1I9D A;  3IRA A;  3D6I A;  4O32 A;  1MDJ A;  4K5S A;  3TJJ A;  1SYR A;  1A8L A;  5ECM B;  3F3Q A;  2I9H A;  4XRD A;  2YCD A;  4WEY A;  1QXH A;  5ECR B;  2JU5 A;  12GS A;  3TOT A;  4MDC A;  1NHO A;  2E2G A;  3RPP A;  1PRX A;  3CRT A;  3ZFL A;  5BMU A;  2X8C A;  4KH7 A;  4USS A;  1AQX A;  3N9J A;  1OC3 A;  1SKS B;  5B8B A;  2CX3 A;  2HLS A;  1N8J A;  4NV5 A;  2JZT A;  2K6V A;  3LOR A;  5ECQ B;  4EDZ A;  2FWG A;  3H4K A;  2LV3 A;  5CNW A;  2AHE A;  3FR3 A;  4JZQ A;  4G0K A;  2O87 A;  4IP1 A;  2HRA A;  3DKS A;  4EKZ A;  1EOH A;  3IDV A;  2DJ1 A;  3LW9 A;  3TGZ A;  2WZ9 A;  5D8I A;  2H75 A;  5KN1 A;  3DGQ A;  1FG4 A;  5ECS A;  1MD3 A;  5CAX A;  1QGV A;  2CZ2 A;  1PN0 A;  1JZW A;  2GZZ A;  1VF2 A;  2C3T A;  3LJR A;  1W89 A;  4TOP A;  4WXT A;  2F9S A;  3GUR A;  3PR8 A;  3FEU A;  1KNG A;  4YQU A;  4IJ3 A;  3KH7 A;  4N10 A;  4PUR A;  2YAN A;  1V58 A;  5DDL A;  4PUF C;  3F4R A;  1OYJ A;  2AYT A;  1XWC A;  2LJK A;  4ECI A;  3VWV A;  2LRN A;  3TKQ A;  4HOJ A;  1T4Z A;  2DJJ A;  2L6D A;  5J3R A;  3Q19 A;  3HKR A;  1KEB A;  2AJQ B;  4Q5N A;  1F2E A;  5HR2 A;  4Q5R A;  1F3B A;  1B9Y C;  2LJA A;  2C3N A;  2XPD A;  1MDK A;  3E0U A;  4YAP A;  3EC3 A;  3L9U A;  3UMA A;  1T8E B;  2LQQ A;  3ZRE A;  1A2J A;  4MNN A;  1A0R P;  3EU4 A;  3TJB A;  2OBI A;  2CT6 A;  4PUA A;  4MA9 A;  2GDR A;  3DEX A;  3AY8 A;  3NOF A;  3C8E A;  4NWY A;  5F0G A;  3I43 A;  4K2X A;  4HZ2 A;  1G7E A;  5JCG A;  1AXD A;  2HSN A;  4ULX A;  1BED A;  5ECP B;  3R3E A;  2KP2 A;  2EFC A;  1ZOF A;  3N5O A;  3HY2 A;  5E4W A;  1ABA A;  3VWU A;  3FZ5 A;  4CY8 A;  4N0Z A;  4CDO A;  1PN9 A;  4L5L A;  1GUL A;  4OFM A;  3KMO A;  2HRF A;  4H86 A;  3DIE A;  5ENU A;  3C7M A;  2CVD A;  3IOS A;  5D9T A;  1TTZ A;  2LEG A;  1PMT A;  5J4Y A;  3P2A A;  5G1K A;  2WCI A;  2VUP A;  1WJK A;  4D73 A;  4Z2U A;  3HVS A;  4FIW A;  2LNT A;  4J2F A;  4F03 A;  4FH8 A;  1Y1U A;  4AF2 A;  5J47 A;  3Q74 A;  4L0W A;  5J4U A;  3FZA A;  2UV8 G;  4MJA A;  4BWS A;  2PBJ A;  4WR4 A;  2YPM A;  2N5F A;  3IK9 A;  3RBT A;  3IR4 A;  3LQ7 A;  5IMC A;  4HUA A;  4YKG A;  4LL4 B;  1S3A A;  4K9Z A;  4XCS A;  1GWC A;  2L59 A;  3C1S A;  1TK8 B;  2DJ0 A;  1X5C A;  3S9F A;  1OKT A;  2WRT A;  3IHQ A;  1OKD A;  1TOF A;  3UJ1 A;  2LKU A;  3EIN A;  3TRP A;  3GSS A;  2YWI A;  1WE0 A;  1EGR A;  3EUR A;  2OBK A;  3KCM A;  3CSH A;  20GS A;  4KND A;  1GSS A;  3ED3 A;  5ECI B;  5A1N A;  4FYB A;  4G2E A;  3CSI A;  1PX7 A;  5F07 A;  4Q5F A;  2IJY A;  8GSS A;  2HSY A;  1N25 A;  5AIS A;  1THO A;  1WOU A;  2MMN A;  1SL2 B;  4MPF A;  1DE2 A;  1FO5 A;  3VWW A;  1HNC A;  4LLR A;  1OC9 B;  5CYY A;  3QPM A;  2GTU A;  4JBB A;  1VRS D;  3MIX A;  4HU9 A;  1Q98 A;  4EF0 A;  2V41 A;  1GL8 A;  4OO5 A;  3O3T A;  2DML A;  3GUS A;  2HXK A;  2JSY A;  4I6X A;  2FNO A;  2LRT A;  3HYP A;  2YWN A;  4V2L A;  2QC7 A;  5GSS A;  2JAD A;  2TRX A;  4WET A;  4AJ7 A;  4PGT A;  2CV4 A;  5COH A;  1AQW A;  4K7N A;  5DCG A;  1K0M A;  5LCZ A;  4NAX A;  1S3C A;  1BJX A;  1KTE A;  5IPH A;  5DAK B;  1ERV A;  1K0D A;  2LUS A;  1M0U A;  3HMJ G;  4I2T A;  2LJR A;  5BRT A;  3BJ5 A;  2RLI A;  4PX1 A;  2B1L A;  5HR1 A;  3MSZ A;  2GSS A;  1R5A A;  2ZUP A;  4J57 E;  3F8U A;  3KEB A;  2VO4 A;  4F0B A;  2HT9 A;  1K3O A;  3HHV A;  1YY7 A;  2HE3 A;  4POM A;  1FB6 A;  3TRQ A;  2WS2 A;  5D9V A;  2AUV A;  4L0U A;  2IMI A;  2KLX A;  4X43 A;  4IP6 A;  2GQM A;  3TCO A;  2LQO A;  4OCE A;  1O73 A;  1SJI A;  3A5W A;  3KTL A;  22GS A;  4ECB A;  2IWT A;  1QUW A;  3WD6 A;  3CTG A;  2M72 A;  1EV4 A;  1Z6N A;  3SWL A;  2NPB A;  5DJL A;  2H6X A;  4HJ2 A;  4ZIJ A;  1S3D A;  3GH6 A;  1B48 A;  5C00 A;  3HA9 A;  5IMD A;  1GTU A;  4K1F A;  1A23 A;  1K0A A;  4BL7 B;  1GTB A;  1TRV A;  5LD0 A;  2B5E A;  3BBY A;  1BAY A;  2D2Z A;  1V2A A;  4I97 A;  2PU9 C;  1SVM A;  2G2Q A;  1A2M A;  2IN3 A;  4KW6 A;  2IMK A;  1JLW A;  4ECC A;  2P31 A;  3D22 A;  3FRC A;  2HSM A;  5IOW A;  2PER A;  1XWB A;  2L4Q A;  3CMI A;  2V2G A;  4TXO B;  1VGL A;  3APQ A;  2N5B A;  1WPI A;  4GSS A;  5EPF A;  4PNG A;  1WRY A;  4YKF A;  4MF5 A;  4MMM A;  2HFD A;  2IPA A;  1X9S B;  5FWG A;  4NHW A;  5DAL A;  4PQ1 A;  3GL5 A;  3C73 A;  4I5Q A;  4G0L A;  5ECN B;  2QA2 A;  2IL3 A;  1OE7 A;  1TDI A;  4QQ7 A;  1NW2 A;  3GV1 A;  4DSQ A;  1OVN A;  1O6J A;  5ID2 A;  2WJU A;  1SVL A;  4L5O A;  1WIK A;  2MBT A;  1TI3 A;  4YH2 A;  3KJY A;  5G31 A;  3M0F A;  1G0T A;  3F4S A;  1EGO A;  4IGJ A;  4MAB A;  2F8F A;  4G01 A;  1GSE A;  2G0F A;  1YF0 A;  1K3Y A;  1H75 A;  1OC8 A;  4KDX A;  1ILO A;  4RQR A;  4TXV A;  5IO2 A;  1MTC A;  4F82 A;  1A8Y A;  3ZZX A;  2E2M A;  4JR4 A;  3UL3 A;  2C0E A;  3VPT A;  1XWG A;  3F3R A;  3D21 A;  1F3A A;  2B1K A;  5ABR A;  1AUC A;  1DE1 A;  2GQK A;  3QAV A;  1XOB A;  4LA1 A;  2MMO A;  2VL3 A;  2FLS A;  3DYR A;  3ME7 A;  4OD7 A;  1EP7 A;  3IAM 2;  5A34 B;  1THX A;  2EIR A;  2XBI A;  4XS6 A;  4I8B A;  1V9W A;  4ZXG A;  1GSF A;  2HZE B;  2GLR A;  4HU7 A;  2H6Z A;  1Z9H A;  3IAS 2;  4TR1 B;  2CA8 A;  3ZYW A;  2H73 A;  3FMW A;  4IW9 A;  3GN3 A;  1MEK A;  1X5E A;  4GLT A;  2AAW A;  1M99 A;  2RII A;  3LEF A;  1R4W A;  1E6B A;  3IPZ A;  3CYN A;  2EIO A;  2C1Y A;  3IK7 A;  5ELA A;  4GST A;  3UAR A;  3CBU A;  2DIZ A;  4OFN A;  1HNB A;  4XRA A;  2H76 A;  4LL1 B;  5JCU A;  3GTU B;  1DSB A;  1K0B A;  4QMK A;  1G7O A;  1Z6M A;  4V2N A;  1K3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...