3F6FA

Crystal structure of glutathione transferase dmgstd10 from drosophila melanogaster
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
209
structure length
209
Chain Sequence
MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGWEENWAGCQEFRKYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG18548-PA (IP02196p) (IP02193p)
publication title Structural evidence for conformational changes of Delta class glutathione transferases after ligand binding
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 81
structure length 209
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3f6fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f6fA01
1R4WA 3KMNA 1JFUA 3ERFA 5IMFA 4EXJA 2K6VA 5AIXA 2A2SA 2DJ1A 3IK7A 2MBTA 4D73B 2CQ9A 1JZWA 2H0GA 5ECOB 4LMWA 4I6XA 4TXOA 1PKZA 2I1UA 1BG5A 1ML6A 1U87A 2R2JA 3GH9A 2ES7A 5IPHA 3QOUA 4JZQA 2L6DA 4BL7A 2C0GA 2L6CA 1J08A 3TUEA 1S3DA 3EURA 2L4QA 1GWCA 2IMDA 2CAIA 5ECRB 1AIUA 3O6TA 3D5JA 3BJ5A 3GL5A 1K0BA 2IFQA 5FWGA 2YN1A 5C04A 5HR2A 2GSQA 2XHFA 1GH2A 3TB2A 4MH2A 1OC9B 4POKA 1GSUA 1N8JA 1XBSA 3KTLA 5IM9A 3EYTA 1VRSD 4IKHA 1K0NA 1M2BA 3FR3A 2V6KA 1NHOA 1ACVA 3EU4A 2DIYA 3CSIA 1S3AA 1A2LA 4JE1A 2OKAA 3LYKA 2C0FA 2RM5A 2DLXA 1GSQA 5CYYA 3TRPA 1YDKA 4KAEA 1H4OA 4V1Ap 3ZLPA 3EC3A 2HRAA 5AISA 2ZCTA 3M8NA 1FB6A 4HQZA 3Q74A 4MK3A 3Q19A 6GSWA 1OKDA 2QC7A 4XRAA 1GULA 3KXOA 2ALBA 3DWVA 2H6ZA 1EGRA 4OMVA 3O76A 4XS1A 4TXVA 4G0IA 3F3QA 4J2FA 1K3OA 1VF4A 4I97A 1T4YA 1MDKA 2VD1A 2EIOA 4QL7A 5F06A 1XOAA 5F07A 1TTZA 4GRFA 3QR6A 3ZYWA 4KF9A 2JSYA 1V2AA 4IW9A 1V57A 5IIZA 3CTFA 3BCKA 5IO0A 5IMCA 1F6MC 4HZ4A 4F0CA 3C73A 1PL1A 2DJJA 4G9HA 2VM1A 2LSTA 2PERA 2C3QA 1A8YA 1HNCA 2H71A 1O7UA 1Z6NA 4Q5RA 3TOTA 2GLRA 1Z5YE 2KHPA 4L0UA 4PUAA 1V40A 3N5OA 3APQA 6GSVA 2BTOT 3NIVA 3MWHA 1DE2A 4L0WA 2NPBA 4Q5QA 4H86A 3D4MA 3I6AA 1YKCA 4V2NA 1X9MB 1ZOFA 2FWEA 2WS2A 4ZBAA 1XVQA 5B8BA 2GQLA 1AC1A 2HRKB 4HEA2 1AW9A 2E7PA 4D73A 2P31A 2FY6A 1QQ2A 4I8BA 2X99A 4IP1A 3UJ1A 5FHIA 4J57E 5CRHA 4IN0A 1YY7A 2A2RA 2V6OA 1ZCPA 3Q18A 5ELAA 2IWTA 2O7KA 2ZNMA 2MMAA 2LNTA 3GL3A 3P7XA 1X5DA 2CA8A 1WE0A 3W8JA 4TR4A 3VWVA 1TRSA 1F9MA 2OJLA 9GSSA 1GSEA 5DBQA 3HXSA 5A5KA 2TRCP 4L8EA 2H0HA 1W4VA 2GGTA 5G1LA 2B5EA 5J3RA 3WGDA 4TOPA 7GSSA 1NSWA 5G1KA 2LRCA 2TIRA 1A23A 3UBLA 4HUAA 4LL4B 2WRTA 3P90A 2X8GA 2VO4A 2IL3A 1QUWA 3LWAA 1FOVA 3NZNA 3KCMA 1J0FA 4EKZA 3TJJA 1E2YA 2FHEA 4ZBDA 2H1DA 3LFLA 1LU4A 2JZTA 1XOBA 1VF1A 2FWHA 1FHEA 2TRXA 2V32A 3KEBA 2H74A 4ECBA 1Z7PA 1OKTA 3K8NA 2FWFA 3Q6OA 3ERGA 4PNGA 1XWGA 3H93A 4TXOB 1F3AA 1MEKA 1AQXA 4G2EA 2AUVA 4GXZA 3TKSC 4YQUA 1Q4JA 1JLWA 2H01A 4L5OA 4TKYA 2YV9A 3KH7A 1XCCA 4TR0A 3DD3A 2G0FA 1XWCA 4BL7B 4IQAA 1PMTA 3HVVA 3GHAA 5G31A 4EF0A 3U6VA 3FY7A 1ERWA 4X1UA 1ERTA 2VL3A 3DVWA 1GP1A 2EC4A 2HRNA 2O8VB 3FZ4A 2LS5A 2V41A 3LXZA 1GSYA 3GUSA 3C7MA 4KB3A 3MDKA 4IP6A 5DJLA 2IFQB 1HNBA 2IJYA 2PBJA 1X9SB 2GZPA 1U88A 1BEDA 5DQYA 1GUHA 2WFCA 3TOUA 1WWJA 3I9V2 1S3CA 5H5RA 1M7TA 1YF1A 4HI7A 2YANA 4J56E 1EV4A 4KDUA 1OC8A 3H8QA 2L57A 5CRWA 4JEDA 5JWOB 4YAPA 1G6YA 2HXKA 1OC3A 2DBCA 1M0UA 1V58A 2Z9SA 3HJMA 4RI6A 4LLRA 3DGQA 3J7Yk 4K0NA 3ME7A 1GLQA 5CREA 1FB0A 3TCOA 3KP9A 2JZRA 2DJ2A 1PGTA 3AY8A 2H6XA 3L78A 4XIHA 1TDIA 3FZ9A 4MJAA 3G9BA 2RLIA 3VWXA 5BMUA 1VF3A 2HT9A 1G0TA 4MH3A 4ZIJA 3ED3A 1PX7A 3E0UA 5D9VA 1DBYA 1WP0A 3KGKA 4EDYA 1SU9A 3MNGA 3UOMA 1T1VA 3E3EA 1TRUA 3L0HA 3O3TA 3GKNA 2MZCA 4ZB6A 1EP7A 4PXOA 5J4UA 5GZZB 4G10A 2HRKA 3LYPA 2PVOC 5A4WA 4EDZA 12GSA 1F37A 3A2WA 4PQ1A 4FQUA 2L4CA 4O92A 2EIQA 4OD7A 1KBNA 1SL2B 1TRVA 3EE2A 1YZXA 4Z7XA 2H66A 1JZRA 1M9AA 4XS6A 1JHBA 1ZGNA 5IQYA 1VGLA 3QFBC 5ECSA 4TVEA 3W8SA 4BVXB 3LJRA 3VK9A 1TI3A 2PN8A 1K0MA 1FAAA 2O89A 2EIRA 2AYTA 4TR3A 2J9HA 5ELGA 1WIKA 4YQVA 4EL1A 1MD3A 4NAXA 1QK8A 4O5RA 4HU7A 1WMJA 3W6GA 4MJEA 2IMEA 3GYKA 5GSSA 3GKMA 5D96A 1RW1A 3M1GA 3FRCA 1XPVA 1SK0A 1JZOA 4NXIA 2LJRA 1NW2A 1BX9A 5ECLB 2VCWA 2ON7A 3GMFA 1YEPA 1O8WA 2NBSA 3TKRA 4ML6A 1PN9A 1F3BA 8GSSA 3GSSA 4MLYA 3F6FA 5JCGA 1M2DA 3GX8A 2DMLA 4MABA 4BWQA 2VLUA 2VL2C 4NV5A 2OBIA 5INYA 2YWNA 3PR8A 2LRTA 4AJ8A 1BQ7A 3HCZA 4KE3A 1J9BA 3ZMLA 1SD8A 2YOIA 4GQFA 2F8AA 4KUNA 5DDLA 3A5WA 3CTGA 1K0CA 4RQRA 4I2UA 4ECJA 3HYPA 1QGVA 5G5EA 3RDWA 2WGRA 1OAZA 1IYIA 4HDEA 2YNXA 3UIWA 3QPMA 1AQVA 1SJZA 5A4VA 1M99A 2E2MA 5JCUA 3IOSA 3US3A 1G7OA 2M46A 4CDOA 5B7CA 4EC0A 2VM2A 3ISOA 2LEGA 2GT5A 2HSNB 5ENUA 4MP4A 3KP8A 3GTUB 5G5FA 3PH9A 3VURA 2HFDA 3BOAA 4TR1B 2VCZA 5ECQB 2C1YA 3HKRA 2GZYA 5IO2A 4IQ1A 2C0DA 3DRNA 3VI7A 5EL8A 3C1RA 3IXRA 3MSZA 3L9UA 4ACSA 2YJ7A 1FG4A 2IN3A 4ZL9A 1XFLA 3GURA 4OWYA 3TRQA 2N5FA 1SENA 5DJMA 4ZB9A 2K18A 2F8FA 4POBA 4MDCA 2B1LA 3GH6A 4EE0A 3BD2A 3C71A 4I5QA 3TJGA 2FD3A 4ZL7A 2JL4A 1ZMAA 2B7KA 2MMNA 3P2AA 3R2QA 1B48A 4TRXA 3TKQA 2H30A 2CZ2A 1XVWA 3TJKA 5G2ZA 2YV7A 2X8CA 2BMXA 2VIMA 3HZ4A 1GTUA 1TJDA 2PU9C 5DVBA 3IC4A 4N10A 5HFGA 1ABAA 3F9UA 2HZFA 1B9YC 3FHKA 3HZ8A 2IIYA 4OCFA 1XW6A 1GTBA 5ECIB 3A3TA 1URMA 1FVKA 3CRUA 5GAND 3KJYA 4ISDA 4OFMA 3EU3A 4BVXA 4WBRD 4V2LA 2R6KA 2PWJA 1EWXA 2BJXA 3MAKA 1EZKA 1W89A 3SBCA 4IVFA 2QSIA 2YJHA 1A0RP 3DEXA 2V1MA 4FH8A 1GTIA 2NDOA 4PGTA 5D8IA 2E2GA 3IRAA 5D9XA 5AN1A 2N5AA 4F9ZA 4BVYB 4KSMA 5FT3A 1TU8A 3IK9A 4IELA 5IOWA 1UN2A 5E4WA 1UVZA 2H70A 3FW2A 3ME8A 3VPQA 3GRXA 3VI5A 1SYRA 1ILOA 1NHYA 4HS1A 3L9SA 2LV3A 3RPNA 2B3SA 1GLPA 5CNWA 2CVDA 2B5YA 4ZL8A 3I43A 4BPYA 2HRFA 1RQMA 1KEBA 3G7IA 5HR3A 1MDIA 3ZMKA 2C0EA 4GLTA 3ZIVA 4TW5A 3D4TA 3DKSA 2H1AA 4GQCA 3F4TA 3GN3A 1B4PA 1SK1A 2OE1A 5DALA 3EWLA 2DMMA 3DMLA 3RPPA 2FUG2 1T00A 4XHMA 2GSSA 1XW9A 3DVXA 4N11A 1WPIA 1QXHA 2P5RA 3QCPA 1TK8B 3VWUA 1U3AA 5H5QA 1X5CA 2NVLA 2FGXA 2GSTA 5HFIA 3F4RA 5F8BA 4K1FA 2XBQA 4QL9A 2VCXA 3TRXA 4MJCA 4MZCA 5J41A 3GTUA 4NHWA 1PX6A 4V2MA 5LCZA 3NOFA 5IMVA 1HYUA 1X0RA 4DSRA 1Y6EA 3ZTLA 3HJPA 4TR1A 4NMUA 2AV4A 5L71A 4JR4A 2H1GA 3FEUA 3GFKA 2JADA 4MF5A 3DXBA 2PMTA 2MMZA 1SKSB 3TKSE 4XCSA 2KLXA 3R3EA 1PQNA 3KM6A 1TKDB 4WR5A 2WZ9A 2HSHA 1OVNA 4G0KA 1OYJA 3CMIA 1I5GA 4PTSA 4TN8A 1LJRA 4MPFA 1TU7A 2D2ZA 3EVIA 1ZL9A 3WYWA 2DC5A 4F0BA 2CX3A 4O32A 3FYGA 2C8UA 1SK2A 2I3YA 5IMAA 4X43A 1A8LA 1TOFA 3EINA 6GSUA 3TGZA 3FR6A 4DVCA 4PUFC 5J9CA 4JBBA 1ERUA 2C4JA 3QDNA 4F82A 1USBA 4BA7A 3J7Yb 1FW1A 2B5XA 4GTUA 5KN2A 2R3XA 3GKXA 4WKWA 4HJMA 2M80A 4NV2A 5JWRB 1T4ZA 2XBIA 4I2TA 5KEJA 2R4VA 4KW6A 4RI7A 2E0QA 3ZFLA 3GNJA 2FLSA 4N0VA 4OO4A 1JZDA 1U6TA 1TK0B 2YCDA 3IAS2 2CT6A 4GCIA 2G2QA 2L5LA 2WCIA 5D9TA 2XPDA 2AAWA 2R5GA 4USSA 3V1WA 2R37A 19GSA 5C00A 4ZB8A 2P5QA 5CRGA 3KIJA 4BVYA 2KP2A 2MYGA 1UA5A 4OCEA 4ID0A 5F05A 3QD9A 3CXGA 11GSA 2A4VA 4MCUA 3SWLA 2HLSA 2AB6A 4WR4A 1WJKA 4ML1A 2HE3A 2WB9A 1F2EA 1AAZA 3HVSA 3QAVA 2N5BA 3ZIJA 4CW9A 1FO5A 2JSZA 5F0GA 3FR9A 2OE3A 4ZXGA 3UBKA 2KP1A 4POLA 1VF2A 4DSSB 2CAQA 2LJAA 3IDVA 5JWQB 5HFKA 1GNEA 1TW9A 3FZAA 4L5LA 2HYXA 4CHSA 4IS0A 2IMKA 3M9KA 5GAPD 1MDJA 2B6MA 2ZUPA 3ZZXA 5B6NA 4JRRA 1K0OA 1DSBA 3RAZA 5J9BA 4ZBBA 5EVOA 4QQ7A 4YQMA 4DEJA 3IBHA 2RUEA 3FKFA 3RHBA 2K8SA 4WETA 2CZ3A 4N0ZA 4MPGA 1SL1B 3A2XA 3TJBA 2VAFA 3C1SA 4MZBA 1YF0A 2CX4A 3UVTA 1EGOA 3KMOA 2H19A 2FA8A 1SYXA 4FO5A 1PL2A 4GF0A 4RUVA 4MF7A 1SKWB 2RUFA 1XIYA 3PGTA 3EMPA 3CYNA 2NTOA 4GSSA 2LRNA 4XRDA 1MTCA 2YWMA 3EMXA 4KDYA 3IV4A 2LQQA 4KGIA 4AJ6A 2K9FA 3RHCA 5DQSA 1Z6MA 3ZFBA 2H1BA 1XWKA 4E8HA 3C8EA 6GSTA 1O81A 3QAGA 5J5NA 2XPEA 4OFNA 2IMIA 1ST9A 3M3MA 5DALB 5ECKB 2CVKA 2K8VA 4WF5A 4WBJA 1Q98A 3LSZA 1M9BA 1UC7A 3QMXA 1THOA 2VLTA 1ON4A 2DJ3A 3G7YA 4IJ3A 2GQMA 2F9SA 2QGVA 1OE7A 4XS4A 1E6BA 5D73A 3HVXA 1QMVA 1SJ6A 3WGXA 5HQPA 5CP1A 4EUYA 1K3YA 1AUCA 3KD0A 2GVPA 2VCVA 2JU5A 4PQIA 1I9DA 5CAXA 1H75A 4XTSA 3GKKA 3ZVJD 1B8XA 2C80A 3S9FA 2VCTA 1V98A 4GSNA 4IGJA 2LJKA 1EEMA 1K0DA 4N30A 4KCEA 3IE3A 2HZEB 1PSQA 2GSRA 2VCQA 4MZWA 3DIEA 2M72A 3JCML 2ON5A 5ID2B 3BBYA 1T8EB 2CVBA 3WD6A 4PNFA 5DAKA 4K2DA 2RM6A 2OACA 4G19A 2AJQB 4K7NA 1Z9HA 5B6MA 2L59A 3F4SA 22GSA 1PA3A 3E9JB 1DE1A 4ZILA 2LNSA 4AF2A 5GSTA 3A2VA 3F3RA 4Q5NA 5IOXA 2XC2A 4PX1A 18GSA 2YWIA 17GSA 1KNGA 2I9HA 2H6YA 3PINA 2YWOA 1RK4A 1ZZYA 2OE0A 1R5AA 5H5SA 10GSA 1K3LA 3M9JA 2H76A 1WRYA 2VUPA 3ZRDA 3CBUA 2HSYA 2JACA 2H0IA 5DCGA 3CSHA 3LG6A 3N9JA 5ECMB 3ZITA 1XWBA 4FIWA 3CSJA 2GQKA 1XWAA 3HHVA 3L4NA 5HR0A 4F03A 4DSSA 5IMZA 4P3YB 4AJ7A 1QFNA 4PQHA 2P0GA 3TDGA 3TKPA 3IC8A 1GUMA 3HY2A 1EV9A 2FCHA 2F51A 1JLVA 2REMA 5KN0A 5D9WA 5KN3A 1PRXA 1IYHA 1R7HA 1EEJA 4G0LA 2KUCA 4O7HA 4NHZA 4IHUA 1Z3EA 1N2AA 2VOCA 3LGCA 1GTAA 20GSA 4KH7A 3FK8A 3ZVJA 4NPBA 1TP9A 3IPZA 3GV1A 5ECNB 1YEXA 1XW5A 1YJ6A 2F3MA 3PPUA 1EOHA 4EO3A 5IPGA 2IPAA 3I69A 13GSA 3HA9A 3F6DA 1O8XA 1C72A 2HSMB 3UEMA 1O6JA 4LMVA 1GNWA 2DIZA 1EOGA 4F2IA 4JR6A 5ABRA 1R26A 4LA1A 1Y25A 2C3TA 4IJIA 1SD9A 3HDCA 4KNDA 2H75A 3UVHA 4K8MA 1GL8A 4ILFA 1R5PA 3UARA 5CO3A 4K6XA 3BCIA 4MJBA 3D22A 3LORA 1G6WA 2IMFA 2I81A 1GRXA 4WEYA 6GSYA 1XXUA 2DJKA 5E59A 3TKSA 1DUGA 14GSA 3LQ7A 1AQWA 2DSAA 16GSA 2WJUA 1HD2A 5DCHA 1EP8A 2MBSA 1T7PB 2PVQA 2PPTA 1PD21 2X8HA 2VL9A 2B1KA 3APSA 1GSSA 5LNKe 1GUKA 3ERWA 2O87A 1B4QA 1OC9A 4ULXA 1SKRB 4V1Ag 2YZUA 3D6IA 3FZ5A 4RQXA 2HQTA 2YPMA 2V2GA 1A2MA 2JZSA 1LBKA 3UAPA 4KCAA 4FYCA 4OO5A 1XZOA 1HNAA 2OA7A 1V9WA 2HZEA 5A4UA 2X64A 4MMMA 1A0FA 3TJFA 5ID2A 2RIIA 2HNLA 4BWSA 4YAVA 1CQHA 3GIXA 1TK5B 2UZ8A 2GZZA 3F8UA 4POMA 1CQGA 1TRWA 5COHA 2YZHA 4FYUA 2PUKC 2J23A 4AGSA 4K7IA 3APOA 4PURA 4XS4B 3UMAA 2VLVA 5EPFA 3WT1A 3VLNA 1ZYQB 2OBKA 2YP6A 1BAYA 1OE8A 3HD5A 3KTBA 3OR5A 1A2JA 2DJ0A 4KSOA 5KN1A 2GTUA 2HI7A 5EY6A 4HZ2A 4FYBA 1YQ1A 1FVJA 3KH9A 4GWRA 1PKWA 1X5EA 1G7EA 2FA4A 1O85A 3IHQA 1NM3A 3VWWA 2MMOA 1GSDA 2C3NA 2KOKA 4KX4A 2LKUA 5D93A 5ECHB 5JCWA 1TXXA 2GS3A 2LTKA 6GSXA 4MA9A 4JU5A 3IA1A 4KA0A 1B9XC 3GSTA 1WOUA 4Q5FA 3QAWA 4DSQA 2VD0A 4HOJA 1SL0B 2B7JA 1AXDA 2H8LA 5DAKB 2L5OA 2QKEA 4HQSA 3F63A 1ERVA 4K0GA 2I4AA 2H72A 3UL3A 3GX0A 5IMDA 4KDXA 1T3BA 5B8AA 3IAM2 4WXTA 3LXTA 2CV4A 5G30A 3D21A 3CRTA 3M0FA 3VPTA 3QFAC 1X9WB 2WDUA 2H73A 4K7OA 4HJ2A 1MD4A 2PGTA 4MF6A 2O85A 1A24A 3WT2A 3RBTA 4NWYA 4HU9A 5CRDA 2HSMA 4LL1B 3DYRA 4WF4A 4GSTA 4E8EA 2OADA 4X0XA 2WULA 3IR4A 2LUSA 1YKAA 1U3IA 2AHEA 2FWGA 2GDRA 3HJOA 4YH2A 3LEFA 3D0ZA 1O73A 1GSFA 3H79A 3ZREA 3KZQA 3H4KA 6GSSA 3ZL5A 2LQOA 2VL2A 1HQOA 3P8WA 3WGEA 5AIVA 3U5RE 1BYEA 4OFTA 5HR1A 3G7JA 3F0IA 4EVMA 4ECIA 3GA4A 4K9ZA 1TI1A 2GT6A 5AGYA 1BJXA 5ECPB 3VFIA 1ZYEA 1K0AA 5LD0A 2FNOA 1M2AA 1SJIA 1THXA 3L9VA 4IBPA 3H1NA 4ECCA 1KTEA 1Z7RA
chains in the Genus database with same CATH superfamily
1R4WA 3KMNA 1Y1UA 1JFUA 3ERFA 5IMFA 4EXJA 2K6VA 5AIXA 2A2SA 2DJ1A 3IK7A 2MBTA 4D73B 2CQ9A 1JZWA 4YKGA 2H0GA 5ECOB 4LMWA 2X49A 4I6XA 4TXOA 1PKZA 2I1UA 1BG5A 1ML6A 1U87A 2R2JA 3GH9A 2ES7A 5IPHA 5A5HA 3QOUA 4JZQA 2L6DA 4BL7A 2C0GA 2L6CA 1J08A 3TUEA 1S3DA 3EURA 2L4QA 1GWCA 2IMDA 2CAIA 5ECRB 1AIUA 3O6TA 1M3IA 3D5JA 3BJ5A 3GL5A 1K0BA 2IFQA 5FWGA 2YN1A 5C04A 5HR2A 2GSQA 2XHFA 1GH2A 3TB2A 4MH2A 1OC9B 5A1NA 4POKA 1GSUA 1N8JA 1XBSA 3KTLA 5IM9A 3EYTA 1VRSD 4IKHA 2QA2A 1K0NA 1M2BA 3FR3A 2DKIA 2V6KA 1NHOA 1ACVA 3EU4A 2DIYA 3CSIA 1S3AA 1A2LA 4JE1A 2OKAA 3LYKA 2C0FA 2RM5A 2DLXA 1GSQA 5CYYA 3TRPA 1YDKA 4KAEA 1H4OA 5J4VA 4V1Ap 3ZLPA 3EC3A 2HRAA 5AISA 2ZCTA 3M8NA 4QMKA 1FB6A 4HQZA 3Q74A 4MK3A 3Q19A 2WW3A 6GSWA 2VKZG 1OKDA 2WZSA 2QC7A 4XRAA 2A4HA 1GULA 3KXOA 2ALBA 3DWVA 2H6ZA 1EGRA 4OMVA 3O76A 4XS1A 4TXVA 4G0IA 3F3QA 4J2FA 1K3OA 1VF4A 4I97A 1T4YA 1MDKA 2VD1A 2EIOA 4QL7A 5F06A 1XOAA 5F07A 1TTZA 4MNNA 4GRFA 3QR6A 3ZYWA 4KF9A 2JSYA 1V2AA 4IW9A 1V57A 5IIZA 3CTFA 3BCKA 5IO0A 2QA1A 5IMCA 1F6MC 4HZ4A 4F0CA 3C73A 1PL1A 2DJJA 4G9HA 2VM1A 2LSTA 2PERA 2C3QA 1A8YA 1HNCA 2H71A 1O7UA 1Z6NA 4Q5RA 3TOTA 2GLRA 1Z5YE 2KHPA 5BMUB 4L0UA 4PUAA 1V40A 3N5OA 3APQA 6GSVA 2BTOT 3NIVA 3MWHA 1DE2A 2O36A 4L0WA 4O5UA 2NPBA 4Q5QA 2WW2A 4H86A 3D4MA 3I6AA 1YKCA 4V2NA 1X9MB 1ZOFA 2FWEA 2WS2A 4ZBAA 1XVQA 5B8BA 2GQLA 1AC1A 2HRKB 4HEA2 1AW9A 2E7PA 4D73A 2P31A 2FY6A 1QQ2A 4I8BA 2X99A 4IP1A 3A5IA 3UJ1A 5FHIA 4J57E 5CRHA 4IN0A 2WVZA 1YY7A 2A2RA 2V6OA 1ZCPA 3Q18A 5ELAA 2IWTA 2O7KA 2ZNMA 2MMAA 2LNTA 3GL3A 3P7XA 1X5DA 2CA8A 1WE0A 3W8JA 4TR4A 3VWVA 1TRSA 1F9MA 2OJLA 9GSSA 1GSEA 2R0GA 5DBQA 3HXSA 5A5KA 2TRCP 4L8EA 2H0HA 1W4VA 2GGTA 5G1LA 2B5EA 2EFDA 3HMJG 5J3RA 1S3RA 3WGDA 4TOPA 7GSSA 1NSWA 5G1KA 2LRCA 2TIRA 1A23A 3UBLA 4HUAA 4LL4B 2WRTA 3P90A 4Z2UA 2X8GA 2VO4A 2IL3A 1QUWA 3LWAA 1FOVA 3NZNA 3KCMA 1J0FA 4EKZA 3TJJA 1E2YA 2FHEA 4ZBDA 2H1DA 3LFLA 1LU4A 2JZTA 1XOBA 1VF1A 2FWHA 1FHEA 2TRXA 2V32A 3KEBA 2H74A 4ECBA 1Z7PA 1OKTA 3K8NA 2FWFA 3Q6OA 3ERGA 4PNGA 1XWGA 3H93A 4TXOB 1F3AA 1MEKA 1AQXA 2H1LA 4G2EA 2AUVA 4GXZA 3TKSC 4YQUA 1Q4JA 1JLWA 2H01A 4L5OA 4TKYA 2YV9A 3KH7A 1XCCA 4TR0A 3DD3A 2G0FA 1XWCA 4BL7B 4IQAA 1PMTA 3HVVA 3GHAA 5G31A 4EF0A 3U6VA 3FY7A 1ERWA 4X1UA 1ERTA 2VL3A 3DVWA 1GP1A 2EC4A 2HRNA 2O8VB 3FZ4A 2LS5A 2V41A 3LXZA 1GSYA 3GUSA 3C7MA 4KB3A 3MDKA 4IP6A 4PI2C 5DJLA 1HNBA 2IFQB 2IJYA 3MIXA 2PBJA 1X9SB 2GZPA 1U88A 1BEDA 5DQYA 1GUHA 2WFCA 3TOUA 1WWJA 3I9V2 1S3CA 5H5RA 1M7TA 4CY6A 1YF1A 4HI7A 2YANA 1EV4A 4KDUA 4J56E 1OC8A 3H8QA 2L57A 5CRWA 4JEDA 5JWOB 4YAPA 1G6YA 2HXKA 1OC3A 2DBCA 1M0UA 1V58A 2Z9SA 3HJMA 4RI6A 4LLRA 4X4JA 3DGQA 3J7Yk 4K0NA 3ME7A 1GLQA 5CREA 1FB0A 3TCOA 3KP9A 2JZRA 2DJ2A 1PGTA 3AY8A 2H6XA 3L78A 4XIHA 1TDIA 3FZ9A 4MJAA 3G9BA 2RLIA 3VWXA 5BMUA 1VF3A 2HT9A 4W66A 1G0TA 4MH3A 4ZIJA 3ED3A 1PX7A 3E0UA 5D9VA 1DBYA 1WP0A 3KGKA 4EDYA 1SU9A 3MNGA 3UOMA 1T1VA 3E3EA 1TRUA 3L0HA 3O3TA 3GKNA 2MZCA 4ZB6A 3MYDA 1EP7A 4PXOA 5J4UA 5GZZB 4G10A 2HRKA 3LYPA 2PVOC 5A4WA 4EDZA 12GSA 1F37A 3A2WA 4PQ1A 4FQUA 2L4CA 4O92A 2EIQA 4OD7A 1KBNA 1SL2B 1TRVA 3EE2A 1YZXA 4Z7XA 4Z2TA 2H66A 1JZRA 1M9AA 4XS6A 1JHBA 1ZGNA 5IQYA 1VGLA 3QFBC 5ECSA 2EFEA 4TVEA 3W8SA 4BVXB 3LJRA 3VK9A 1TI3A 2PN8A 1K0MA 1FAAA 2O89A 2EIRA 2AYTA 4TR3A 2J9HA 5ELGA 1WIKA 4YQVA 4EL1A 1MD3A 1PN0A 5BRTA 4NAXA 1QK8A 4O5RA 4HU7A 1WMJA 3W6GA 4MJEA 2IMEA 3GYKA 5GSSA 3GKMA 5D96A 1RW1A 3M1GA 3FRCA 1XPVA 1SK0A 1JZOA 4NXIA 2LJRA 1NW2A 1BX9A 5ECLB 2VCWA 2ON7A 3GMFA 1YEPA 1O8WA 2NBSA 3TKRA 4ML6A 1PN9A 1F3BA 8GSSA 3GSSA 4MLYA 3F6FA 5JCGA 1M2DA 3GX8A 2DMLA 4MABA 4BWQA 2VLUA 2VL2C 4NV5A 2OBIA 5INYA 2YWNA 3PR8A 2LRTA 4AJ8A 1BQ7A 3HCZA 4KE3A 1J9BA 3ZMLA 1SD8A 2YOIA 4GQFA 2F8AA 4KUNA 5DDLA 3A5WA 3CTGA 1K0CA 4RQRA 4I2UA 4ECJA 3HYPA 1QGVA 5G5EA 3RDWA 2WGRA 1OAZA 1IYIA 4HDEA 2YNXA 3UIWA 3QPMA 1AQVA 1SJZA 5A4VA 1M99A 2E2MA 5JCUA 3IOSA 3US3A 1G7OA 2M46A 4CDOA 5B7CA 4EC0A 2VM2A 3ISOA 2LEGA 2GT5A 2HSNB 5ENUA 4MP4A 3KP8A 3GTUB 5G5FA 3PH9A 3VURA 2HFDA 2EFHA 3BOAA 4TR1B 2VCZA 5ECQB 2C1YA 3HKRA 2GZYA 5IO2A 4IQ1A 2C0DA 3DRNA 3VI7A 5EL8A 3C1RA 3IXRA 3MSZA 3L9UA 4ACSA 2YJ7A 1FG4A 2IN3A 4ZL9A 1XFLA 3GURA 4OWYA 3TRQA 2UV8G 2N5FA 1SENA 5DJMA 4ZB9A 2K18A 2F8FA 1YVLA 4POBA 4MDCA 2B1LA 3GH6A 4EE0A 3BD2A 3C71A 4I5QA 3TJGA 2FD3A 4ZL7A 2JL4A 1ZMAA 2B7KA 2WVXB 2MMNA 3P2AA 3R2QA 1B48A 4TRXA 3TKQA 1BF5A 2H30A 2CZ2A 1XVWA 3TJKA 5G2ZA 2YV7A 2X8CA 2BMXA 2VIMA 3HZ4A 1GTUA 1TJDA 2PU9C 5DVBA 3IC4A 4N10A 5HFGA 1ABAA 3F9UA 2HZFA 1B9YC 3FHKA 3HZ8A 2IIYA 4OCFA 1XW6A 1GTBA 5ECIB 3A3TA 1URMA 1FVKA 3CRUA 5GAND 3KJYA 4ISDA 4OFMA 3EU3A 4BVXA 4WBRD 4V2LA 2R6KA 2PWJA 1EWXA 2BJXA 3MAKA 1EZKA 1W89A 3SBCA 2O5VA 4IVFA 2QSIA 2YJHA 1TXUA 1A0RP 3DEXA 2V1MA 4FH8A 1GTIA 2NDOA 2WW1A 4PGTA 5D8IA 2E2GA 3IRAA 5D9XA 5AN1A 2N5AA 4F9ZA 4BVYB 4KSMA 5FT3A 1TU8A 3IK9A 4IELA 5IOWA 1UN2A 5E4WA 1UVZA 2H70A 3FW2A 3ME8A 3VPQA 3GRXA 3VI5A 1SYRA 1N25A 1ILOA 1NHYA 4HS1A 3L9SA 2LV3A 3RFRC 3RPNA 2B3SA 1GLPA 5CNWA 2CVDA 2B5YA 4ZL8A 3I43A 4BPYA 2HRFA 1RQMA 1KEBA 3G7IA 5HR3A 4GDFA 1MDIA 3ZMKA 2C0EA 4GLTA 3ZIVA 3CHXC 4TW5A 3D4TA 3DKSA 2H1AA 4GQCA 3F4TA 1PFOA 3GN3A 1B4PA 1SK1A 4Z2RA 2OE1A 5DALA 3EWLA 2DMMA 3DMLA 3RPPA 4HSCX 2FUG2 1T00A 3HVNA 5J4YA 4XHMA 2GSSA 1XW9A 3DVXA 4N11A 1WPIA 1QXHA 2P5RA 3QCPA 1TK8B 3VWUA 4PI0C 1U3AA 5H5QA 1X5CA 2NVLA 2FGXA 2GSTA 5A34B 5HFIA 3F4RA 5F8BA 4K1FA 2XBQA 4QL9A 2VCXA 3TRXA 2HSNA 4MJCA 4MZCA 5J41A 4K5SA 3GTUA 4NHWA 1SVOA 1PX6A 4V2MA 5LCZA 3NOFA 5IMVA 1HYUA 1X0RA 4DSRA 1Y6EA 3ZTLA 3HJPA 4TR1A 4NMUA 2AV4A 5L71A 4JR4A 2H1GA 3FEUA 3GFKA 2JADA 4MF5A 3DXBA 2PMTA 2MMZA 1SKSB 3TKSE 4XCSA 2KLXA 3R3EA 1PQNA 3KM6A 1TKDB 4WR5A 2WZ9A 2HSHA 1OVNA 4G0KA 1OYJA 3CMIA 1I5GA 4PTSA 4TN8A 1LJRA 4MPFA 1TU7A 2D2ZA 3EVIA 1ZL9A 3WYWA 2DC5A 4F0BA 2CX3A 4O32A 3FYGA 4EIPA 4AKHA 2C8UA 1SK2A 1YEWC 2I3YA 5IMAA 4X43A 5KOWA 1A8LA 1TOFA 3EINA 6GSUA 3TGZA 3FR6A 4DVCA 4PUFC 5J9CA 4JBBA 1ERUA 2C4JA 2WVXA 3QDNA 4F82A 1USBA 4BA7A 3J7Yb 3CQFA 1FW1A 2B5XA 4GTUA 5KN2A 2R3XA 3GKXA 4WKWA 1ZYPA 4HJMA 2M80A 4NV2A 5JWRB 1T4ZA 2XBIA 4I2TA 5KEJA 2R4VA 4KW6A 4RI7A 2E0QA 3ZFLA 3GNJA 2FLSA 4N0VA 4OO4A 2DKHA 1JZDA 1U6TA 1TK0B 2YCDA 4EIQA 4YKFA 3IAS2 2CT6A 3FMWA 4GCIA 2G2QA 2L5LA 2WCIA 5D9TA 2XPDA 2AAWA 2R5GA 4USSA 3V1WA 2R37A 19GSA 5C00A 4ZB8A 2P5QA 5CRGA 3KIJA 4BVYA 2KP2A 2MYGA 1UA5A 4OCEA 4ID0A 5F05A 3QD9A 3CXGA 11GSA 2A4VA 4MCUA 3SWLA 2HLSA 2AB6A 4WR4A 1WJKA 4ML1A 2HE3A 2WB9A 1F2EA 1AAZA 3HVSA 3QAVA 2N5BA 3ZIJA 4CW9A 1FO5A 2JSZA 4E68A 5F0GA 3FR9A 2OE3A 4ZXGA 3UBKA 2KP1A 4POLA 1VF2A 4DSSB 2CAQA 2LJAA 3IDVA 4FXYP 5JWQB 5HFKA 1GNEA 1TW9A 3FZAA 4L5LA 2HYXA 4G01A 4CHSA 4IS0A 2IMKA 3M9KA 5GAPD 1MDJA 2B6MA 2ZUPA 3ZZXA 5B6NA 4JRRA 1K0OA 1DSBA 3RAZA 5J9BA 4ZBBA 5EVOA 4QQ7A 4YQMA 4DEJA 3IBHA 1SVLA 2RUEA 3FKFA 3RHBA 2K8SA 4WETA 2CZ3A 5A34A 4MPGA 4N0ZA 1SL1B 3A2XA 3TJBA 3RGBC 2VAFA 3C1SA 4MZBA 1YF0A 2CX4A 3UVTA 1EGOA 3KMOA 2H19A 2FA8A 1SYXA 4FO5A 1PL2A 4GF0A 4RUVA 4MF7A 1SKWB 3CWGA 2RUFA 1XIYA 3PGTA 3EMPA 3CYNA 4PHZC 2NTOA 4GSSA 2LRNA 4XRDA 1MTCA 2YWMA 3EMXA 4KDYA 3IV4A 2LQQA 4KGIA 2A2PA 4AJ6A 2K9FA 3RHCA 5DQSA 1Z6MA 3ZFBA 2H1BA 1XWKA 4E8HA 3C8EA 6GSTA 1O81A 3QAGA 5J5NA 2XPEA 4OFNA 2IMIA 1ST9A 3M3MA 5DALB 5ECKB 2CVKA 2K8VA 4K2XA 4WF5A 4WBJA 1Q98A 3LSZA 1M9BA 4AKXB 1UC7A 3QMXA 1THOA 2VLTA 1ON4A 2DJ3A 3G7YA 4IJ3A 2GQMA 2F9SA 2QGVA 1OE7A 4XS4A 1E6BA 5D73A 3HVXA 1QMVA 1SJ6A 3WGXA 5HQPA 5CP1A 4EUYA 1K3YA 1AUCA 3KD0A 2GVPA 2VCVA 2JU5A 5J40A 4PQIA 1I9DA 5CAXA 1H75A 4XTSA 3GKKA 3ZVJD 1B8XA 2X4AA 2R0PA 2C80A 3S9FA 2VCTA 1V98A 4GSNA 4IGJA 2LJKA 4AKGA 1EEMA 1K0DA 4N30A 4KCEA 3IE3A 2HZEB 1PSQA 2GSRA 2VCQA 4MZWA 3DIEA 2M72A 3JCML 2ON5A 5ID2B 3BBYA 1T8EB 2CVBA 5J47A 2WVYA 3WD6A 4PNFA 5DAKA 4K2DA 2RM6A 2OACA 4G19A 2AJQB 1FOHA 4K7NA 1Z9HA 5B6MA 2L59A 3F4SA 22GSA 1PA3A 3E9JB 1DE1A 4ZILA 2LNSA 4AF2A 5GSTA 3A2VA 3F3RA 4Q5NA 5IOXA 2XC2A 4PX1A 18GSA 2YWIA 17GSA 3IHGA 1KNGA 2I9HA 2H6YA 3PINA 2YWOA 1RK4A 1ZZYA 2OE0A 1R5AA 5H5SA 10GSA 1K3LA 3M9JA 2H76A 1WRYA 2VUPA 3ZRDA 3CBUA 2HSYA 2JACA 2H0IA 5DCGA 3CSHA 3LG6A 3N9JA 5ECMB 4CY8A 4K5RA 3ZITA 1XWBA 4FIWA 3CSJA 2GQKA 1XWAA 3HHVA 3L4NA 5HR0A 4F03A 4DSSA 5IMZA 4P3YB 4AJ7A 1QFNA 4PQHA 2P0GA 3TDGA 3TKPA 4O5QA 3IC8A 1GUMA 3HY2A 1EV9A 2FCHA 2F51A 1JLVA 2REMA 5KN0A 5D9WA 5KN3A 4N3ZA 1PRXA 1IYHA 1R7HA 1EEJA 4G0LA 2KUCA 1SVMA 4O7HA 4NHZA 4IHUA 1Z3EA 1N2AA 2VOCA 3LGCA 1GTAA 20GSA 4KH7A 3FK8A 3ZVJA 4NPBA 1TP9A 3IPZA 3GV1A 5ECNB 1YEXA 1XW5A 1YJ6A 2F3MA 3PPUA 1EOHA 4EO3A 5IPGA 2IPAA 3I69A 13GSA 3HA9A 3F6DA 1O8XA 1C72A 2HSMB 4AKIA 3UEMA 1O6JA 4LMVA 1GNWA 2DIZA 1EOGA 4F2IA 4JR6A 5ABRA 2OT3A 1R26A 4LA1A 1Y25A 2C3TA 2WW0A 4IJIA 1SD9A 3HDCA 4KNDA 2H75A 3UVHA 4K8MA 1GL8A 4ILFA 1R5PA 3UARA 5CO3A 4K6XA 3BCIA 4MJBA 3D22A 3LORA 1G6WA 2IMFA 2I81A 1GRXA 4WEYA 6GSYA 1XXUA 2DJKA 5E59A 3TKSA 1DUGA 14GSA 3LQ7A 1AQWA 2DSAA 16GSA 2WJUA 2O3EA 1HD2A 5DCHA 1EP8A 4BIKA 2MBSA 1T7PB 2PVQA 2PPTA 1PD21 2X8HA 2VL9A 2EFCA 2B1KA 3APSA 1GSSA 4A5PA 5LNKe 1GUKA 3ERWA 2O87A 1B4QA 1OC9A 4ULXA 1SKRB 4V1Ag 2YZUA 3D6IA 3FZ5A 4RQXA 2HQTA 2YPMA 1I1IP 2V2GA 1A2MA 2JZSA 1LBKA 3UAPA 4KCAA 4FYCA 4OO5A 1XZOA 1HNAA 2OA7A 1V9WA 2HZEA 5A4UA 2X64A 4MMMA 1A0FA 3TJFA 5ID2A 2RIIA 2HNLA 4BWSA 4YAVA 2R0CA 1CQHA 5A5HB 5KOXA 3GIXA 1TK5B 2UZ8A 2GZZA 3F8UA 4POMA 1CQGA 1M3JA 1TRWA 5COHA 2YZHA 4FYUA 2PUKC 2J23A 4AGSA 4K7IA 3APOA 4PURA 3EPTA 4XS4B 3UMAA 2VLVA 5EPFA 3WT1A 3VLNA 1ZYQB 3TU3B 2OBKA 2YP6A 1BAYA 1OE8A 3HD5A 3KTBA 3OR5A 1A2JA 2DJ0A 4KSOA 5KN1A 2GTUA 2HI7A 5EY6A 4HZ2A 4FYBA 1YQ1A 1FVJA 3KH9A 4GWRA 1PKWA 5A1NB 1X5EA 1G7EA 2FA4A 1O85A 3IHQA 1NM3A 3VWWA 2MMOA 1GSDA 2C3NA 2KOKA 4ZB7A 4KX4A 2LKUA 5D93A 5ECHB 5JCWA 1TXXA 2GS3A 2LTKA 6GSXA 4MA9A 4JU5A 3IA1A 4KA0A 1B9XC 3GSTA 1WOUA 4Q5FA 3QAWA 4DSQA 2VD0A 4HOJA 1SL0B 2B7JA 1AXDA 2H8LA 5DAKB 2L5OA 2QKEA 4HQSA 3F63A 1ERVA 4K0GA 2I4AA 2H72A 3UL3A 3GX0A 5IMDA 4KDXA 1T3BA 5B8AA 3IAM2 4WXTA 3LXTA 4AI6A 2CV4A 5G30A 1S4BP 3D21A 3CRTA 3M0FA 3VPTA 1BG1A 3QFAC 1X9WB 2WDUA 2H73A 4K7OA 4HJ2A 1MD4A 2PGTA 4MF6A 2O85A 1A24A 3WT2A 3RBTA 4NWYA 4HU9A 5CRDA 2HSMA 1ZYNA 4LL1B 3DYRA 4WF4A 4GSTA 4E8EA 2OADA 4X0XA 2WULA 3IR4A 2LUSA 1YKAA 1U3IA 2AHEA 1XG8A 2FWGA 2GDRA 3HJOA 4YH2A 3LEFA 3LW9A 3D0ZA 1O73A 1GSFA 3H79A 3ZREA 4ICYA 3KZQA 3H4KA 6GSSA 3ZL5A 2LQOA 2VL2A 1HQOA 3P8WA 3WGEA 5AIVA 3U5RE 1BYEA 4OFTA 5HR1A 3G7JA 3F0IA 4EVMA 4ECIA 3GA4A 4K9ZA 1TI1A 2GT6A 5AGYA 1BJXA 5ECPB 3VFIA 1ZYEA 1K0AA 5LD0A 2FNOA 1M2AA 1SJIA 1THXA 3L9VA 4IBPA 3H1NA 4ECCA 1KTEA 1Z7RA
chains in the Genus database with same CATH topology
1R4WA 3KMNA 1Y1UA 1JFUA 3ERFA 5IMFA 4EXJA 2K6VA 5AIXA 2A2SA 2DJ1A 3IK7A 2MBTA 4D73B 2CQ9A 1JZWA 4YKGA 2H0GA 5ECOB 4LMWA 2X49A 4I6XA 4TXOA 1PKZA 2I1UA 1BG5A 1ML6A 1U87A 2R2JA 3GH9A 2ES7A 5IPHA 5A5HA 3QOUA 4JZQA 2L6DA 4BL7A 2C0GA 2L6CA 1J08A 3TUEA 1S3DA 3EURA 2L4QA 1GWCA 2IMDA 2CAIA 5ECRB 1AIUA 3O6TA 3D5JA 3BJ5A 3GL5A 1K0BA 2IFQA 5FWGA 2YN1A 5C04A 5HR2A 2GSQA 2XHFA 1GH2A 3TB2A 4MH2A 1OC9B 5A1NA 4POKA 1GSUA 1N8JA 1XBSA 3KTLA 5IM9A 3EYTA 1VRSD 4IKHA 2QA2A 1K0NA 1M2BA 3FR3A 2DKIA 2V6KA 1NHOA 1ACVA 3EU4A 2DIYA 3CSIA 1S3AA 1A2LA 4JE1A 2OKAA 3LYKA 2C0FA 2RM5A 2DLXA 1GSQA 5CYYA 3TRPA 1YDKA 4KAEA 1H4OA 5J4VA 4V1Ap 3ZLPA 3EC3A 2HRAA 5AISA 2ZCTA 3M8NA 4QMKA 1FB6A 4HQZA 3Q74A 4MK3A 3Q19A 6GSWA 2VKZG 1OKDA 2QC7A 4XRAA 2A4HA 1GULA 3KXOA 2ALBA 3DWVA 2H6ZA 1EGRA 4OMVA 3O76A 4XS1A 4TXVA 4G0IA 3F3QA 4J2FA 1K3OA 1VF4A 4I97A 1T4YA 1MDKA 2VD1A 2EIOA 4QL7A 5F06A 1XOAA 5F07A 1TTZA 4MNNA 4GRFA 3QR6A 3ZYWA 4KF9A 2JSYA 1V2AA 4IW9A 1V57A 5IIZA 3CTFA 3BCKA 5IO0A 2QA1A 5IMCA 1F6MC 4HZ4A 4F0CA 3C73A 1PL1A 2DJJA 4G9HA 2VM1A 2LSTA 2PERA 2C3QA 1A8YA 1HNCA 2H71A 1O7UA 1Z6NA 4Q5RA 3TOTA 2GLRA 1Z5YE 2KHPA 5BMUB 4L0UA 4PUAA 1V40A 3N5OA 3APQA 6GSVA 2BTOT 3NIVA 3MWHA 1DE2A 4L0WA 4O5UA 2NPBA 4Q5QA 4H86A 3D4MA 3I6AA 1YKCA 4V2NA 1X9MB 1ZOFA 2FWEA 2WS2A 4ZBAA 1XVQA 5B8BA 2GQLA 1AC1A 2HRKB 4HEA2 1AW9A 2E7PA 4D73A 2P31A 2FY6A 1QQ2A 4I8BA 2X99A 4IP1A 3A5IA 3UJ1A 5FHIA 4J57E 5CRHA 4IN0A 1YY7A 2A2RA 2V6OA 1ZCPA 3Q18A 5ELAA 2IWTA 2O7KA 2ZNMA 2MMAA 2LNTA 3GL3A 3P7XA 1X5DA 2CA8A 1WE0A 3W8JA 4TR4A 3VWVA 1TRSA 1F9MA 2OJLA 9GSSA 1GSEA 2R0GA 5DBQA 3HXSA 5A5KA 2TRCP 4L8EA 2H0HA 1W4VA 2GGTA 5G1LA 2B5EA 2EFDA 3HMJG 5J3RA 3WGDA 4TOPA 7GSSA 1NSWA 5G1KA 2LRCA 2TIRA 1A23A 3UBLA 4HUAA 4LL4B 2WRTA 3P90A 4Z2UA 2X8GA 2VO4A 2IL3A 1QUWA 3LWAA 1FOVA 3NZNA 3KCMA 1J0FA 4EKZA 3TJJA 1E2YA 2FHEA 4ZBDA 2H1DA 3LFLA 1LU4A 2JZTA 1XOBA 1VF1A 2FWHA 1FHEA 2TRXA 2V32A 3KEBA 2H74A 4ECBA 1Z7PA 1OKTA 3K8NA 2FWFA 3Q6OA 3ERGA 4PNGA 1XWGA 3H93A 4TXOB 1F3AA 1MEKA 1AQXA 2H1LA 4G2EA 2AUVA 4GXZA 3TKSC 4YQUA 1Q4JA 1JLWA 2H01A 4L5OA 4TKYA 2YV9A 3KH7A 1XCCA 4TR0A 3DD3A 2G0FA 1XWCA 4BL7B 4IQAA 1PMTA 3HVVA 3GHAA 5G31A 4EF0A 3U6VA 3FY7A 1ERWA 4X1UA 1ERTA 2VL3A 3DVWA 1GP1A 2EC4A 2HRNA 2O8VB 3FZ4A 2LS5A 2V41A 3LXZA 1GSYA 3GUSA 3C7MA 4KB3A 3MDKA 4IP6A 5DJLA 2IFQB 1HNBA 2IJYA 3MIXA 2PBJA 1X9SB 2GZPA 1U88A 1BEDA 5DQYA 1GUHA 2WFCA 3TOUA 1WWJA 3I9V2 1S3CA 5H5RA 1M7TA 4CY6A 1YF1A 4HI7A 2YANA 1EV4A 4KDUA 4J56E 1OC8A 3H8QA 2L57A 5CRWA 4JEDA 5JWOB 4YAPA 1G6YA 2HXKA 1OC3A 2DBCA 1M0UA 1V58A 2Z9SA 3HJMA 4RI6A 4LLRA 4X4JA 3DGQA 3J7Yk 4K0NA 3ME7A 1GLQA 5CREA 1FB0A 3TCOA 3KP9A 2JZRA 2DJ2A 1PGTA 3AY8A 2H6XA 3L78A 4XIHA 1TDIA 3FZ9A 4MJAA 3G9BA 2RLIA 3VWXA 5BMUA 1VF3A 2HT9A 4W66A 1G0TA 4MH3A 4ZIJA 3ED3A 1PX7A 3E0UA 5D9VA 1DBYA 1WP0A 3KGKA 4EDYA 1SU9A 3MNGA 3UOMA 1T1VA 3E3EA 1TRUA 3L0HA 3O3TA 3GKNA 2MZCA 4ZB6A 3MYDA 1EP7A 4PXOA 5J4UA 5GZZB 4G10A 2HRKA 3LYPA 2PVOC 5A4WA 4EDZA 12GSA 1F37A 3A2WA 4PQ1A 4FQUA 2L4CA 4O92A 2EIQA 4OD7A 1KBNA 1SL2B 1TRVA 3EE2A 1YZXA 4Z7XA 4Z2TA 2H66A 1JZRA 1M9AA 4XS6A 1JHBA 1ZGNA 5IQYA 1VGLA 3QFBC 5ECSA 2EFEA 4TVEA 3W8SA 4BVXB 3LJRA 3VK9A 1TI3A 2PN8A 1K0MA 1FAAA 2O89A 2EIRA 2AYTA 4TR3A 2J9HA 5ELGA 1WIKA 4YQVA 4EL1A 1MD3A 1PN0A 5BRTA 4NAXA 1QK8A 4O5RA 4HU7A 1WMJA 3W6GA 4MJEA 2IMEA 3GYKA 5GSSA 3GKMA 5D96A 1RW1A 3M1GA 3FRCA 1XPVA 1SK0A 1JZOA 4NXIA 2LJRA 1NW2A 1BX9A 5ECLB 2VCWA 2ON7A 3GMFA 1YEPA 1O8WA 2NBSA 3TKRA 4ML6A 1PN9A 1F3BA 8GSSA 3GSSA 4MLYA 3F6FA 5JCGA 1M2DA 3GX8A 2DMLA 4MABA 4BWQA 2VLUA 2VL2C 4NV5A 2OBIA 5INYA 2YWNA 3PR8A 2LRTA 4AJ8A 1BQ7A 3HCZA 4KE3A 1J9BA 3ZMLA 1SD8A 2YOIA 4GQFA 2F8AA 4KUNA 5DDLA 3A5WA 3CTGA 1K0CA 4RQRA 4I2UA 4ECJA 3HYPA 1QGVA 5G5EA 3RDWA 2WGRA 1OAZA 1IYIA 4HDEA 2YNXA 3UIWA 3QPMA 1AQVA 1SJZA 5A4VA 1M99A 2E2MA 5JCUA 3IOSA 3US3A 1G7OA 2M46A 4CDOA 5B7CA 4EC0A 2VM2A 3ISOA 2LEGA 2GT5A 2HSNB 5ENUA 4MP4A 3KP8A 3GTUB 5G5FA 3PH9A 3VURA 2HFDA 2EFHA 3BOAA 4TR1B 2VCZA 5ECQB 2C1YA 3HKRA 2GZYA 5IO2A 4IQ1A 2C0DA 3DRNA 3VI7A 5EL8A 3C1RA 3IXRA 3MSZA 3L9UA 4ACSA 2YJ7A 1FG4A 2IN3A 4ZL9A 1XFLA 3GURA 4OWYA 3TRQA 2UV8G 2N5FA 1SENA 5DJMA 4ZB9A 2K18A 2F8FA 1YVLA 4POBA 4MDCA 2B1LA 3GH6A 4EE0A 3BD2A 3C71A 4I5QA 3TJGA 2FD3A 4ZL7A 2JL4A 1ZMAA 2B7KA 2MMNA 3P2AA 3R2QA 1B48A 4TRXA 3TKQA 1BF5A 2H30A 2CZ2A 1XVWA 3TJKA 5G2ZA 2YV7A 2X8CA 2BMXA 2VIMA 3HZ4A 1GTUA 1TJDA 2PU9C 5DVBA 3IC4A 4N10A 5HFGA 1ABAA 3F9UA 2HZFA 1B9YC 3FHKA 3HZ8A 2IIYA 4OCFA 1XW6A 1GTBA 5ECIB 3A3TA 1URMA 1FVKA 3CRUA 5GAND 3KJYA 4ISDA 4OFMA 3EU3A 4BVXA 4WBRD 4V2LA 2R6KA 2PWJA 1EWXA 2BJXA 3MAKA 1EZKA 1W89A 3SBCA 2O5VA 4IVFA 2QSIA 2YJHA 1TXUA 1A0RP 3DEXA 2V1MA 4FH8A 1GTIA 2NDOA 4PGTA 5D8IA 2E2GA 3IRAA 5D9XA 5AN1A 2N5AA 4F9ZA 4BVYB 4KSMA 5FT3A 1TU8A 3IK9A 4IELA 5IOWA 1UN2A 5E4WA 1UVZA 2H70A 3FW2A 3ME8A 3VPQA 3GRXA 3VI5A 1SYRA 1N25A 1ILOA 1NHYA 4HS1A 3L9SA 2LV3A 3RPNA 2B3SA 1GLPA 5CNWA 2CVDA 2B5YA 4ZL8A 3I43A 4BPYA 2HRFA 1RQMA 1KEBA 3G7IA 5HR3A 4GDFA 1MDIA 3ZMKA 2C0EA 4GLTA 3ZIVA 4TW5A 3D4TA 3DKSA 2H1AA 4GQCA 3F4TA 3GN3A 1B4PA 1SK1A 4Z2RA 2OE1A 5DALA 3EWLA 2DMMA 3DMLA 3RPPA 2FUG2 1T00A 5J4YA 4XHMA 2GSSA 1XW9A 3DVXA 4N11A 1WPIA 1QXHA 2P5RA 3QCPA 1TK8B 3VWUA 1U3AA 5H5QA 1X5CA 2NVLA 2FGXA 2GSTA 5A34B 5HFIA 3F4RA 5F8BA 4K1FA 2XBQA 4QL9A 2VCXA 3TRXA 2HSNA 4MJCA 4MZCA 5J41A 4K5SA 3GTUA 4NHWA 1SVOA 1PX6A 4V2MA 5LCZA 3NOFA 5IMVA 1HYUA 1X0RA 4DSRA 1Y6EA 3ZTLA 3HJPA 4TR1A 4NMUA 2AV4A 5L71A 4JR4A 2H1GA 3FEUA 3GFKA 2JADA 4MF5A 3DXBA 2PMTA 2MMZA 1SKSB 3TKSE 4XCSA 2KLXA 3R3EA 1PQNA 3KM6A 1TKDB 4WR5A 2WZ9A 2HSHA 1OVNA 4G0KA 1OYJA 3CMIA 1I5GA 4PTSA 4TN8A 1LJRA 4MPFA 1TU7A 2D2ZA 3EVIA 1ZL9A 3WYWA 2DC5A 4F0BA 2CX3A 4O32A 3FYGA 4EIPA 4AKHA 2C8UA 1SK2A 2I3YA 5IMAA 4X43A 5KOWA 1A8LA 1TOFA 3EINA 6GSUA 3TGZA 3FR6A 4DVCA 4PUFC 5J9CA 4JBBA 1ERUA 2C4JA 3QDNA 4F82A 1USBA 4BA7A 3J7Yb 1FW1A 2B5XA 4GTUA 5KN2A 2R3XA 3GKXA 4WKWA 1ZYPA 4HJMA 2M80A 4NV2A 5JWRB 1T4ZA 2XBIA 4I2TA 5KEJA 2R4VA 4KW6A 4RI7A 2E0QA 3ZFLA 3GNJA 2FLSA 4N0VA 4OO4A 2DKHA 1JZDA 1U6TA 1TK0B 2YCDA 4EIQA 4YKFA 3IAS2 2CT6A 3FMWA 4GCIA 2G2QA 2L5LA 2WCIA 5D9TA 2XPDA 2AAWA 2R5GA 4USSA 3V1WA 2R37A 19GSA 5C00A 4ZB8A 2P5QA 5CRGA 3KIJA 4BVYA 2KP2A 2MYGA 1UA5A 4OCEA 4ID0A 5F05A 3QD9A 3CXGA 11GSA 2A4VA 4MCUA 3SWLA 2HLSA 2AB6A 4WR4A 1WJKA 4ML1A 2HE3A 2WB9A 1F2EA 1AAZA 3HVSA 3QAVA 2N5BA 3ZIJA 4CW9A 1FO5A 2JSZA 4E68A 5F0GA 3FR9A 2OE3A 4ZXGA 3UBKA 2KP1A 4POLA 1VF2A 4DSSB 2CAQA 2LJAA 3IDVA 5JWQB 5HFKA 1GNEA 1TW9A 3FZAA 4L5LA 2HYXA 4G01A 4CHSA 4IS0A 2IMKA 3M9KA 5GAPD 1MDJA 2B6MA 2ZUPA 3ZZXA 5B6NA 4JRRA 1K0OA 1DSBA 3RAZA 5J9BA 4ZBBA 5EVOA 4QQ7A 4YQMA 4DEJA 3IBHA 1SVLA 2RUEA 3FKFA 3RHBA 2K8SA 4WETA 2CZ3A 5A34A 4MPGA 4N0ZA 1SL1B 3A2XA 3TJBA 2VAFA 3C1SA 4MZBA 1YF0A 2CX4A 3UVTA 1EGOA 3KMOA 2H19A 2FA8A 1SYXA 4FO5A 1PL2A 4GF0A 4RUVA 4MF7A 1SKWB 3CWGA 2RUFA 1XIYA 3PGTA 3EMPA 3CYNA 2NTOA 4GSSA 2LRNA 4XRDA 1MTCA 2YWMA 3EMXA 4KDYA 3IV4A 2LQQA 4KGIA 2A2PA 4AJ6A 2K9FA 3RHCA 5DQSA 1Z6MA 3ZFBA 2H1BA 1XWKA 4E8HA 3C8EA 6GSTA 1O81A 3QAGA 5J5NA 2XPEA 4OFNA 2IMIA 1ST9A 3M3MA 5DALB 5ECKB 2CVKA 2K8VA 4K2XA 4WF5A 4WBJA 1Q98A 3LSZA 1M9BA 4AKXB 1UC7A 3QMXA 1THOA 2VLTA 1ON4A 2DJ3A 3G7YA 4IJ3A 2GQMA 2F9SA 2QGVA 1OE7A 4XS4A 1E6BA 5D73A 3HVXA 1QMVA 1SJ6A 3WGXA 5HQPA 5CP1A 4EUYA 1K3YA 1AUCA 3KD0A 2GVPA 2VCVA 2JU5A 5J40A 4PQIA 1I9DA 5CAXA 1H75A 4XTSA 3GKKA 3ZVJD 1B8XA 2X4AA 2R0PA 2C80A 3S9FA 2VCTA 1V98A 4GSNA 4IGJA 2LJKA 4AKGA 1EEMA 1K0DA 4N30A 4KCEA 3IE3A 2HZEB 1PSQA 2GSRA 2VCQA 4MZWA 3DIEA 2M72A 3JCML 2ON5A 5ID2B 3BBYA 1T8EB 2CVBA 5J47A 3WD6A 4PNFA 5DAKA 4K2DA 2RM6A 2OACA 4G19A 2AJQB 1FOHA 4K7NA 1Z9HA 5B6MA 2L59A 3F4SA 22GSA 1PA3A 3E9JB 1DE1A 4ZILA 2LNSA 4AF2A 5GSTA 3A2VA 3F3RA 4Q5NA 5IOXA 2XC2A 4PX1A 18GSA 2YWIA 17GSA 3IHGA 1KNGA 2I9HA 2H6YA 3PINA 2YWOA 1RK4A 1ZZYA 2OE0A 1R5AA 5H5SA 10GSA 1K3LA 3M9JA 2H76A 1WRYA 2VUPA 3ZRDA 3CBUA 2HSYA 2JACA 2H0IA 5DCGA 3CSHA 3LG6A 3N9JA 5ECMB 4CY8A 4K5RA 3ZITA 1XWBA 4FIWA 3CSJA 2GQKA 1XWAA 3HHVA 3L4NA 5HR0A 4F03A 4DSSA 5IMZA 4P3YB 4AJ7A 1QFNA 4PQHA 2P0GA 3TDGA 3TKPA 4O5QA 3IC8A 1GUMA 3HY2A 1EV9A 2FCHA 2F51A 1JLVA 2REMA 5KN0A 5D9WA 5KN3A 4N3ZA 1PRXA 1IYHA 1R7HA 1EEJA 4G0LA 2KUCA 1SVMA 4O7HA 4NHZA 4IHUA 1Z3EA 1N2AA 2VOCA 3LGCA 1GTAA 20GSA 4KH7A 3FK8A 3ZVJA 4NPBA 1TP9A 3IPZA 3GV1A 5ECNB 1YEXA 1XW5A 1YJ6A 2F3MA 3PPUA 1EOHA 4EO3A 5IPGA 2IPAA 3I69A 13GSA 3HA9A 3F6DA 1O8XA 1C72A 2HSMB 4AKIA 3UEMA 1O6JA 4LMVA 1GNWA 2DIZA 1EOGA 4F2IA 4JR6A 5ABRA 2OT3A 1R26A 4LA1A 1Y25A 2C3TA 4IJIA 1SD9A 3HDCA 4KNDA 2H75A 3UVHA 4K8MA 1GL8A 4ILFA 1R5PA 3UARA 5CO3A 4K6XA 3BCIA 4MJBA 3D22A 3LORA 1G6WA 2IMFA 2I81A 1GRXA 4WEYA 6GSYA 1XXUA 2DJKA 5E59A 3TKSA 1DUGA 14GSA 3LQ7A 1AQWA 2DSAA 16GSA 2WJUA 1HD2A 5DCHA 1EP8A 2MBSA 1T7PB 2PVQA 2PPTA 1PD21 2X8HA 2VL9A 2EFCA 2B1KA 3APSA 1GSSA 4A5PA 5LNKe 1GUKA 3ERWA 2O87A 1B4QA 1OC9A 4ULXA 1SKRB 4V1Ag 2YZUA 3D6IA 3FZ5A 4RQXA 2HQTA 2YPMA 2V2GA 1A2MA 2JZSA 1LBKA 3UAPA 4KCAA 4FYCA 4OO5A 1XZOA 1HNAA 2OA7A 1V9WA 2HZEA 5A4UA 2X64A 4MMMA 1A0FA 3TJFA 5ID2A 2RIIA 2HNLA 4BWSA 4YAVA 2R0CA 1CQHA 5A5HB 5KOXA 3GIXA 1TK5B 2UZ8A 2GZZA 3F8UA 4POMA 1CQGA 1TRWA 5COHA 2YZHA 4FYUA 2PUKC 2J23A 4AGSA 4K7IA 3APOA 4PURA 3EPTA 4XS4B 3UMAA 2VLVA 5EPFA 3WT1A 3VLNA 1ZYQB 3TU3B 2OBKA 2YP6A 1BAYA 1OE8A 3HD5A 3KTBA 3OR5A 1A2JA 2DJ0A 4KSOA 5KN1A 2GTUA 2HI7A 5EY6A 4HZ2A 4FYBA 1YQ1A 1FVJA 3KH9A 4GWRA 1PKWA 5A1NB 1X5EA 1G7EA 2FA4A 1O85A 3IHQA 1NM3A 3VWWA 2MMOA 1GSDA 2C3NA 2KOKA 4ZB7A 4KX4A 2LKUA 5D93A 5ECHB 5JCWA 1TXXA 2GS3A 2LTKA 6GSXA 4MA9A 4JU5A 3IA1A 4KA0A 1B9XC 3GSTA 1WOUA 4Q5FA 3QAWA 4DSQA 2VD0A 4HOJA 1SL0B 2B7JA 1AXDA 2H8LA 5DAKB 2L5OA 2QKEA 4HQSA 3F63A 1ERVA 4K0GA 2I4AA 2H72A 3UL3A 3GX0A 5IMDA 4KDXA 1T3BA 5B8AA 3IAM2 4WXTA 3LXTA 4AI6A 2CV4A 5G30A 3D21A 3CRTA 3M0FA 3VPTA 1BG1A 3QFAC 1X9WB 2WDUA 2H73A 4K7OA 4HJ2A 1MD4A 2PGTA 4MF6A 2O85A 1A24A 3WT2A 3RBTA 4NWYA 4HU9A 5CRDA 2HSMA 1ZYNA 4LL1B 3DYRA 4WF4A 4GSTA 4E8EA 2OADA 4X0XA 2WULA 3IR4A 2LUSA 1YKAA 1U3IA 2AHEA 2FWGA 2GDRA 3HJOA 4YH2A 3LEFA 3LW9A 3D0ZA 1O73A 1GSFA 3H79A 3ZREA 4ICYA 3KZQA 3H4KA 6GSSA 3ZL5A 2LQOA 2VL2A 1HQOA 3P8WA 3WGEA 5AIVA 3U5RE 1BYEA 4OFTA 5HR1A 3G7JA 3F0IA 4EVMA 4ECIA 3GA4A 4K9ZA 1TI1A 2GT6A 5AGYA 1BJXA 5ECPB 3VFIA 1ZYEA 1K0AA 5LD0A 2FNOA 1M2AA 1SJIA 1THXA 3L9VA 4IBPA 3H1NA 4ECCA 1KTEA 1Z7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4W A;  3KMN A;  1JFU A;  3ERF A;  5IMF A;  4EXJ A;  2K6V A;  5AIX A;  2A2S A;  2DJ1 A;  3IK7 A;  2MBT A;  4D73 B;  2CQ9 A;  1JZW A;  2H0G A;  5ECO B;  4LMW A;  4I6X A;  4TXO A;  1PKZ A;  2I1U A;  1BG5 A;  1ML6 A;  1U87 A;  2R2J A;  3GH9 A;  2ES7 A;  5IPH A;  3QOU A;  4JZQ A;  2L6D A;  4BL7 A;  2C0G A;  2L6C A;  1J08 A;  3TUE A;  1S3D A;  3EUR A;  2L4Q A;  1GWC A;  2IMD A;  2CAI A;  5ECR B;  1AIU A;  3O6T A;  3D5J A;  3BJ5 A;  3GL5 A;  1K0B A;  2IFQ A;  5FWG A;  2YN1 A;  5C04 A;  5HR2 A;  2GSQ A;  2XHF A;  1GH2 A;  3TB2 A;  4MH2 A;  1OC9 B;  4POK A;  1GSU A;  1N8J A;  1XBS A;  3KTL A;  5IM9 A;  3EYT A;  1VRS D;  4IKH A;  1K0N A;  1M2B A;  3FR3 A;  2V6K A;  1NHO A;  1ACV A;  3EU4 A;  2DIY A;  3CSI A;  1S3A A;  1A2L A;  4JE1 A;  2OKA A;  3LYK A;  2C0F A;  2RM5 A;  2DLX A;  1GSQ A;  5CYY A;  3TRP A;  1YDK A;  4KAE A;  1H4O A;  4V1A p;  3ZLP A;  3EC3 A;  2HRA A;  5AIS A;  2ZCT A;  3M8N A;  1FB6 A;  4HQZ A;  3Q74 A;  4MK3 A;  3Q19 A;  6GSW A;  1OKD A;  2QC7 A;  4XRA A;  1GUL A;  3KXO A;  2ALB A;  3DWV A;  2H6Z A;  1EGR A;  4OMV A;  3O76 A;  4XS1 A;  4TXV A;  4G0I A;  3F3Q A;  4J2F A;  1K3O A;  1VF4 A;  4I97 A;  1T4Y A;  1MDK A;  2VD1 A;  2EIO A;  4QL7 A;  5F06 A;  1XOA A;  5F07 A;  1TTZ A;  4GRF A;  3QR6 A;  3ZYW A;  4KF9 A;  2JSY A;  1V2A A;  4IW9 A;  1V57 A;  5IIZ A;  3CTF A;  3BCK A;  5IO0 A;  5IMC A;  1F6M C;  4HZ4 A;  4F0C A;  3C73 A;  1PL1 A;  2DJJ A;  4G9H A;  2VM1 A;  2LST A;  2PER A;  2C3Q A;  1A8Y A;  1HNC A;  2H71 A;  1O7U A;  1Z6N A;  4Q5R A;  3TOT A;  2GLR A;  1Z5Y E;  2KHP A;  4L0U A;  4PUA A;  1V40 A;  3N5O A;  3APQ A;  6GSV A;  2BTO T;  3NIV A;  3MWH A;  1DE2 A;  4L0W A;  2NPB A;  4Q5Q A;  4H86 A;  3D4M A;  3I6A A;  1YKC A;  4V2N A;  1X9M B;  1ZOF A;  2FWE A;  2WS2 A;  4ZBA A;  1XVQ A;  5B8B A;  2GQL A;  1AC1 A;  2HRK B;  4HEA 2;  1AW9 A;  2E7P A;  4D73 A;  2P31 A;  2FY6 A;  1QQ2 A;  4I8B A;  2X99 A;  4IP1 A;  3UJ1 A;  5FHI A;  4J57 E;  5CRH A;  4IN0 A;  1YY7 A;  2A2R A;  2V6O A;  1ZCP A;  3Q18 A;  5ELA A;  2IWT A;  2O7K A;  2ZNM A;  2MMA A;  2LNT A;  3GL3 A;  3P7X A;  1X5D A;  2CA8 A;  1WE0 A;  3W8J A;  4TR4 A;  3VWV A;  1TRS A;  1F9M A;  2OJL A;  9GSS A;  1GSE A;  5DBQ A;  3HXS A;  5A5K A;  2TRC P;  4L8E A;  2H0H A;  1W4V A;  2GGT A;  5G1L A;  2B5E A;  5J3R A;  3WGD A;  4TOP A;  7GSS A;  1NSW A;  5G1K A;  2LRC A;  2TIR A;  1A23 A;  3UBL A;  4HUA A;  4LL4 B;  2WRT A;  3P90 A;  2X8G A;  2VO4 A;  2IL3 A;  1QUW A;  3LWA A;  1FOV A;  3NZN A;  3KCM A;  1J0F A;  4EKZ A;  3TJJ A;  1E2Y A;  2FHE A;  4ZBD A;  2H1D A;  3LFL A;  1LU4 A;  2JZT A;  1XOB A;  1VF1 A;  2FWH A;  1FHE A;  2TRX A;  2V32 A;  3KEB A;  2H74 A;  4ECB A;  1Z7P A;  1OKT A;  3K8N A;  2FWF A;  3Q6O A;  3ERG A;  4PNG A;  1XWG A;  3H93 A;  4TXO B;  1F3A A;  1MEK A;  1AQX A;  4G2E A;  2AUV A;  4GXZ A;  3TKS C;  4YQU A;  1Q4J A;  1JLW A;  2H01 A;  4L5O A;  4TKY A;  2YV9 A;  3KH7 A;  1XCC A;  4TR0 A;  3DD3 A;  2G0F A;  1XWC A;  4BL7 B;  4IQA A;  1PMT A;  3HVV A;  3GHA A;  5G31 A;  4EF0 A;  3U6V A;  3FY7 A;  1ERW A;  4X1U A;  1ERT A;  2VL3 A;  3DVW A;  1GP1 A;  2EC4 A;  2HRN A;  2O8V B;  3FZ4 A;  2LS5 A;  2V41 A;  3LXZ A;  1GSY A;  3GUS A;  3C7M A;  4KB3 A;  3MDK A;  4IP6 A;  5DJL A;  2IFQ B;  1HNB A;  2IJY A;  2PBJ A;  1X9S B;  2GZP A;  1U88 A;  1BED A;  5DQY A;  1GUH A;  2WFC A;  3TOU A;  1WWJ A;  3I9V 2;  1S3C A;  5H5R A;  1M7T A;  1YF1 A;  4HI7 A;  2YAN A;  4J56 E;  1EV4 A;  4KDU A;  1OC8 A;  3H8Q A;  2L57 A;  5CRW A;  4JED A;  5JWO B;  4YAP A;  1G6Y A;  2HXK A;  1OC3 A;  2DBC A;  1M0U A;  1V58 A;  2Z9S A;  3HJM A;  4RI6 A;  4LLR A;  3DGQ A;  3J7Y k;  4K0N A;  3ME7 A;  1GLQ A;  5CRE A;  1FB0 A;  3TCO A;  3KP9 A;  2JZR A;  2DJ2 A;  1PGT A;  3AY8 A;  2H6X A;  3L78 A;  4XIH A;  1TDI A;  3FZ9 A;  4MJA A;  3G9B A;  2RLI A;  3VWX A;  5BMU A;  1VF3 A;  2HT9 A;  1G0T A;  4MH3 A;  4ZIJ A;  3ED3 A;  1PX7 A;  3E0U A;  5D9V A;  1DBY A;  1WP0 A;  3KGK A;  4EDY A;  1SU9 A;  3MNG A;  3UOM A;  1T1V A;  3E3E A;  1TRU A;  3L0H A;  3O3T A;  3GKN A;  2MZC A;  4ZB6 A;  1EP7 A;  4PXO A;  5J4U A;  5GZZ B;  4G10 A;  2HRK A;  3LYP A;  2PVO C;  5A4W A;  4EDZ A;  12GS A;  1F37 A;  3A2W A;  4PQ1 A;  4FQU A;  2L4C A;  4O92 A;  2EIQ A;  4OD7 A;  1KBN A;  1SL2 B;  1TRV A;  3EE2 A;  1YZX A;  4Z7X A;  2H66 A;  1JZR A;  1M9A A;  4XS6 A;  1JHB A;  1ZGN A;  5IQY A;  1VGL A;  3QFB C;  5ECS A;  4TVE A;  3W8S A;  4BVX B;  3LJR A;  3VK9 A;  1TI3 A;  2PN8 A;  1K0M A;  1FAA A;  2O89 A;  2EIR A;  2AYT A;  4TR3 A;  2J9H A;  5ELG A;  1WIK A;  4YQV A;  4EL1 A;  1MD3 A;  4NAX A;  1QK8 A;  4O5R A;  4HU7 A;  1WMJ A;  3W6G A;  4MJE A;  2IME A;  3GYK A;  5GSS A;  3GKM A;  5D96 A;  1RW1 A;  3M1G A;  3FRC A;  1XPV A;  1SK0 A;  1JZO A;  4NXI A;  2LJR A;  1NW2 A;  1BX9 A;  5ECL B;  2VCW A;  2ON7 A;  3GMF A;  1YEP A;  1O8W A;  2NBS A;  3TKR A;  4ML6 A;  1PN9 A;  1F3B A;  8GSS A;  3GSS A;  4MLY A;  3F6F A;  5JCG A;  1M2D A;  3GX8 A;  2DML A;  4MAB A;  4BWQ A;  2VLU A;  2VL2 C;  4NV5 A;  2OBI A;  5INY A;  2YWN A;  3PR8 A;  2LRT A;  4AJ8 A;  1BQ7 A;  3HCZ A;  4KE3 A;  1J9B A;  3ZML A;  1SD8 A;  2YOI A;  4GQF A;  2F8A A;  4KUN A;  5DDL A;  3A5W A;  3CTG A;  1K0C A;  4RQR A;  4I2U A;  4ECJ A;  3HYP A;  1QGV A;  5G5E A;  3RDW A;  2WGR A;  1OAZ A;  1IYI A;  4HDE A;  2YNX A;  3UIW A;  3QPM A;  1AQV A;  1SJZ A;  5A4V A;  1M99 A;  2E2M A;  5JCU A;  3IOS A;  3US3 A;  1G7O A;  2M46 A;  4CDO A;  5B7C A;  4EC0 A;  2VM2 A;  3ISO A;  2LEG A;  2GT5 A;  2HSN B;  5ENU A;  4MP4 A;  3KP8 A;  3GTU B;  5G5F A;  3PH9 A;  3VUR A;  2HFD A;  3BOA A;  4TR1 B;  2VCZ A;  5ECQ B;  2C1Y A;  3HKR A;  2GZY A;  5IO2 A;  4IQ1 A;  2C0D A;  3DRN A;  3VI7 A;  5EL8 A;  3C1R A;  3IXR A;  3MSZ A;  3L9U A;  4ACS A;  2YJ7 A;  1FG4 A;  2IN3 A;  4ZL9 A;  1XFL A;  3GUR A;  4OWY A;  3TRQ A;  2N5F A;  1SEN A;  5DJM A;  4ZB9 A;  2K18 A;  2F8F A;  4POB A;  4MDC A;  2B1L A;  3GH6 A;  4EE0 A;  3BD2 A;  3C71 A;  4I5Q A;  3TJG A;  2FD3 A;  4ZL7 A;  2JL4 A;  1ZMA A;  2B7K A;  2MMN A;  3P2A A;  3R2Q A;  1B48 A;  4TRX A;  3TKQ A;  2H30 A;  2CZ2 A;  1XVW A;  3TJK A;  5G2Z A;  2YV7 A;  2X8C A;  2BMX A;  2VIM A;  3HZ4 A;  1GTU A;  1TJD A;  2PU9 C;  5DVB A;  3IC4 A;  4N10 A;  5HFG A;  1ABA A;  3F9U A;  2HZF A;  1B9Y C;  3FHK A;  3HZ8 A;  2IIY A;  4OCF A;  1XW6 A;  1GTB A;  5ECI B;  3A3T A;  1URM A;  1FVK A;  3CRU A;  5GAN D;  3KJY A;  4ISD A;  4OFM A;  3EU3 A;  4BVX A;  4WBR D;  4V2L A;  2R6K A;  2PWJ A;  1EWX A;  2BJX A;  3MAK A;  1EZK A;  1W89 A;  3SBC A;  4IVF A;  2QSI A;  2YJH A;  1A0R P;  3DEX A;  2V1M A;  4FH8 A;  1GTI A;  2NDO A;  4PGT A;  5D8I A;  2E2G A;  3IRA A;  5D9X A;  5AN1 A;  2N5A A;  4F9Z A;  4BVY B;  4KSM A;  5FT3 A;  1TU8 A;  3IK9 A;  4IEL A;  5IOW A;  1UN2 A;  5E4W A;  1UVZ A;  2H70 A;  3FW2 A;  3ME8 A;  3VPQ A;  3GRX A;  3VI5 A;  1SYR A;  1ILO A;  1NHY A;  4HS1 A;  3L9S A;  2LV3 A;  3RPN A;  2B3S A;  1GLP A;  5CNW A;  2CVD A;  2B5Y A;  4ZL8 A;  3I43 A;  4BPY A;  2HRF A;  1RQM A;  1KEB A;  3G7I A;  5HR3 A;  1MDI A;  3ZMK A;  2C0E A;  4GLT A;  3ZIV A;  4TW5 A;  3D4T A;  3DKS A;  2H1A A;  4GQC A;  3F4T A;  3GN3 A;  1B4P A;  1SK1 A;  2OE1 A;  5DAL A;  3EWL A;  2DMM A;  3DML A;  3RPP A;  2FUG 2;  1T00 A;  4XHM A;  2GSS A;  1XW9 A;  3DVX A;  4N11 A;  1WPI A;  1QXH A;  2P5R A;  3QCP A;  1TK8 B;  3VWU A;  1U3A A;  5H5Q A;  1X5C A;  2NVL A;  2FGX A;  2GST A;  5HFI A;  3F4R A;  5F8B A;  4K1F A;  2XBQ A;  4QL9 A;  2VCX A;  3TRX A;  4MJC A;  4MZC A;  5J41 A;  3GTU A;  4NHW A;  1PX6 A;  4V2M A;  5LCZ A;  3NOF A;  5IMV A;  1HYU A;  1X0R A;  4DSR A;  1Y6E A;  3ZTL A;  3HJP A;  4TR1 A;  4NMU A;  2AV4 A;  5L71 A;  4JR4 A;  2H1G A;  3FEU A;  3GFK A;  2JAD A;  4MF5 A;  3DXB A;  2PMT A;  2MMZ A;  1SKS B;  3TKS E;  4XCS A;  2KLX A;  3R3E A;  1PQN A;  3KM6 A;  1TKD B;  4WR5 A;  2WZ9 A;  2HSH A;  1OVN A;  4G0K A;  1OYJ A;  3CMI A;  1I5G A;  4PTS A;  4TN8 A;  1LJR A;  4MPF A;  1TU7 A;  2D2Z A;  3EVI A;  1ZL9 A;  3WYW A;  2DC5 A;  4F0B A;  2CX3 A;  4O32 A;  3FYG A;  2C8U A;  1SK2 A;  2I3Y A;  5IMA A;  4X43 A;  1A8L A;  1TOF A;  3EIN A;  6GSU A;  3TGZ A;  3FR6 A;  4DVC A;  4PUF C;  5J9C A;  4JBB A;  1ERU A;  2C4J A;  3QDN A;  4F82 A;  1USB A;  4BA7 A;  3J7Y b;  1FW1 A;  2B5X A;  4GTU A;  5KN2 A;  2R3X A;  3GKX A;  4WKW A;  4HJM A;  2M80 A;  4NV2 A;  5JWR B;  1T4Z A;  2XBI A;  4I2T A;  5KEJ A;  2R4V A;  4KW6 A;  4RI7 A;  2E0Q A;  3ZFL A;  3GNJ A;  2FLS A;  4N0V A;  4OO4 A;  1JZD A;  1U6T A;  1TK0 B;  2YCD A;  3IAS 2;  2CT6 A;  4GCI A;  2G2Q A;  2L5L A;  2WCI A;  5D9T A;  2XPD A;  2AAW A;  2R5G A;  4USS A;  3V1W A;  2R37 A;  19GS A;  5C00 A;  4ZB8 A;  2P5Q A;  5CRG A;  3KIJ A;  4BVY A;  2KP2 A;  2MYG A;  1UA5 A;  4OCE A;  4ID0 A;  5F05 A;  3QD9 A;  3CXG A;  11GS A;  2A4V A;  4MCU A;  3SWL A;  2HLS A;  2AB6 A;  4WR4 A;  1WJK A;  4ML1 A;  2HE3 A;  2WB9 A;  1F2E A;  1AAZ A;  3HVS A;  3QAV A;  2N5B A;  3ZIJ A;  4CW9 A;  1FO5 A;  2JSZ A;  5F0G A;  3FR9 A;  2OE3 A;  4ZXG A;  3UBK A;  2KP1 A;  4POL A;  1VF2 A;  4DSS B;  2CAQ A;  2LJA A;  3IDV A;  5JWQ B;  5HFK A;  1GNE A;  1TW9 A;  3FZA A;  4L5L A;  2HYX A;  4CHS A;  4IS0 A;  2IMK A;  3M9K A;  5GAP D;  1MDJ A;  2B6M A;  2ZUP A;  3ZZX A;  5B6N A;  4JRR A;  1K0O A;  1DSB A;  3RAZ A;  5J9B A;  4ZBB A;  5EVO A;  4QQ7 A;  4YQM A;  4DEJ A;  3IBH A;  2RUE A;  3FKF A;  3RHB A;  2K8S A;  4WET A;  2CZ3 A;  4N0Z A;  4MPG A;  1SL1 B;  3A2X A;  3TJB A;  2VAF A;  3C1S A;  4MZB A;  1YF0 A;  2CX4 A;  3UVT A;  1EGO A;  3KMO A;  2H19 A;  2FA8 A;  1SYX A;  4FO5 A;  1PL2 A;  4GF0 A;  4RUV A;  4MF7 A;  1SKW B;  2RUF A;  1XIY A;  3PGT A;  3EMP A;  3CYN A;  2NTO A;  4GSS A;  2LRN A;  4XRD A;  1MTC A;  2YWM A;  3EMX A;  4KDY A;  3IV4 A;  2LQQ A;  4KGI A;  4AJ6 A;  2K9F A;  3RHC A;  5DQS A;  1Z6M A;  3ZFB A;  2H1B A;  1XWK A;  4E8H A;  3C8E A;  6GST A;  1O81 A;  3QAG A;  5J5N A;  2XPE A;  4OFN A;  2IMI A;  1ST9 A;  3M3M A;  5DAL B;  5ECK B;  2CVK A;  2K8V A;  4WF5 A;  4WBJ A;  1Q98 A;  3LSZ A;  1M9B A;  1UC7 A;  3QMX A;  1THO A;  2VLT A;  1ON4 A;  2DJ3 A;  3G7Y A;  4IJ3 A;  2GQM A;  2F9S A;  2QGV A;  1OE7 A;  4XS4 A;  1E6B A;  5D73 A;  3HVX A;  1QMV A;  1SJ6 A;  3WGX A;  5HQP A;  5CP1 A;  4EUY A;  1K3Y A;  1AUC A;  3KD0 A;  2GVP A;  2VCV A;  2JU5 A;  4PQI A;  1I9D A;  5CAX A;  1H75 A;  4XTS A;  3GKK A;  3ZVJ D;  1B8X A;  2C80 A;  3S9F A;  2VCT A;  1V98 A;  4GSN A;  4IGJ A;  2LJK A;  1EEM A;  1K0D A;  4N30 A;  4KCE A;  3IE3 A;  2HZE B;  1PSQ A;  2GSR A;  2VCQ A;  4MZW A;  3DIE A;  2M72 A;  3JCM L;  2ON5 A;  5ID2 B;  3BBY A;  1T8E B;  2CVB A;  3WD6 A;  4PNF A;  5DAK A;  4K2D A;  2RM6 A;  2OAC A;  4G19 A;  2AJQ B;  4K7N A;  1Z9H A;  5B6M A;  2L59 A;  3F4S A;  22GS A;  1PA3 A;  3E9J B;  1DE1 A;  4ZIL A;  2LNS A;  4AF2 A;  5GST A;  3A2V A;  3F3R A;  4Q5N A;  5IOX A;  2XC2 A;  4PX1 A;  18GS A;  2YWI A;  17GS A;  1KNG A;  2I9H A;  2H6Y A;  3PIN A;  2YWO A;  1RK4 A;  1ZZY A;  2OE0 A;  1R5A A;  5H5S A;  10GS A;  1K3L A;  3M9J A;  2H76 A;  1WRY A;  2VUP A;  3ZRD A;  3CBU A;  2HSY A;  2JAC A;  2H0I A;  5DCG A;  3CSH A;  3LG6 A;  3N9J A;  5ECM B;  3ZIT A;  1XWB A;  4FIW A;  3CSJ A;  2GQK A;  1XWA A;  3HHV A;  3L4N A;  5HR0 A;  4F03 A;  4DSS A;  5IMZ A;  4P3Y B;  4AJ7 A;  1QFN A;  4PQH A;  2P0G A;  3TDG A;  3TKP A;  3IC8 A;  1GUM A;  3HY2 A;  1EV9 A;  2FCH A;  2F51 A;  1JLV A;  2REM A;  5KN0 A;  5D9W A;  5KN3 A;  1PRX A;  1IYH A;  1R7H A;  1EEJ A;  4G0L A;  2KUC A;  4O7H A;  4NHZ A;  4IHU A;  1Z3E A;  1N2A A;  2VOC A;  3LGC A;  1GTA A;  20GS A;  4KH7 A;  3FK8 A;  3ZVJ A;  4NPB A;  1TP9 A;  3IPZ A;  3GV1 A;  5ECN B;  1YEX A;  1XW5 A;  1YJ6 A;  2F3M A;  3PPU A;  1EOH A;  4EO3 A;  5IPG A;  2IPA A;  3I69 A;  13GS A;  3HA9 A;  3F6D A;  1O8X A;  1C72 A;  2HSM B;  3UEM A;  1O6J A;  4LMV A;  1GNW A;  2DIZ A;  1EOG A;  4F2I A;  4JR6 A;  5ABR A;  1R26 A;  4LA1 A;  1Y25 A;  2C3T A;  4IJI A;  1SD9 A;  3HDC A;  4KND A;  2H75 A;  3UVH A;  4K8M A;  1GL8 A;  4ILF A;  1R5P A;  3UAR A;  5CO3 A;  4K6X A;  3BCI A;  4MJB A;  3D22 A;  3LOR A;  1G6W A;  2IMF A;  2I81 A;  1GRX A;  4WEY A;  6GSY A;  1XXU A;  2DJK A;  5E59 A;  3TKS A;  1DUG A;  14GS A;  3LQ7 A;  1AQW A;  2DSA A;  16GS A;  2WJU A;  1HD2 A;  5DCH A;  1EP8 A;  2MBS A;  1T7P B;  2PVQ A;  2PPT A;  1PD2 1;  2X8H A;  2VL9 A;  2B1K A;  3APS A;  1GSS A;  5LNK e;  1GUK A;  3ERW A;  2O87 A;  1B4Q A;  1OC9 A;  4ULX A;  1SKR B;  4V1A g;  2YZU A;  3D6I A;  3FZ5 A;  4RQX A;  2HQT A;  2YPM A;  2V2G A;  1A2M A;  2JZS A;  1LBK A;  3UAP A;  4KCA A;  4FYC A;  4OO5 A;  1XZO A;  1HNA A;  2OA7 A;  1V9W A;  2HZE A;  5A4U A;  2X64 A;  4MMM A;  1A0F A;  3TJF A;  5ID2 A;  2RII A;  2HNL A;  4BWS A;  4YAV A;  1CQH A;  3GIX A;  1TK5 B;  2UZ8 A;  2GZZ A;  3F8U A;  4POM A;  1CQG A;  1TRW A;  5COH A;  2YZH A;  4FYU A;  2PUK C;  2J23 A;  4AGS A;  4K7I A;  3APO A;  4PUR A;  4XS4 B;  3UMA A;  2VLV A;  5EPF A;  3WT1 A;  3VLN A;  1ZYQ B;  2OBK A;  2YP6 A;  1BAY A;  1OE8 A;  3HD5 A;  3KTB A;  3OR5 A;  1A2J A;  2DJ0 A;  4KSO A;  5KN1 A;  2GTU A;  2HI7 A;  5EY6 A;  4HZ2 A;  4FYB A;  1YQ1 A;  1FVJ A;  3KH9 A;  4GWR A;  1PKW A;  1X5E A;  1G7E A;  2FA4 A;  1O85 A;  3IHQ A;  1NM3 A;  3VWW A;  2MMO A;  1GSD A;  2C3N A;  2KOK A;  4KX4 A;  2LKU A;  5D93 A;  5ECH B;  5JCW A;  1TXX A;  2GS3 A;  2LTK A;  6GSX A;  4MA9 A;  4JU5 A;  3IA1 A;  4KA0 A;  1B9X C;  3GST A;  1WOU A;  4Q5F A;  3QAW A;  4DSQ A;  2VD0 A;  4HOJ A;  1SL0 B;  2B7J A;  1AXD A;  2H8L A;  5DAK B;  2L5O A;  2QKE A;  4HQS A;  3F63 A;  1ERV A;  4K0G A;  2I4A A;  2H72 A;  3UL3 A;  3GX0 A;  5IMD A;  4KDX A;  1T3B A;  5B8A A;  3IAM 2;  4WXT A;  3LXT A;  2CV4 A;  5G30 A;  3D21 A;  3CRT A;  3M0F A;  3VPT A;  3QFA C;  1X9W B;  2WDU A;  2H73 A;  4K7O A;  4HJ2 A;  1MD4 A;  2PGT A;  4MF6 A;  2O85 A;  1A24 A;  3WT2 A;  3RBT A;  4NWY A;  4HU9 A;  5CRD A;  2HSM A;  4LL1 B;  3DYR A;  4WF4 A;  4GST A;  4E8E A;  2OAD A;  4X0X A;  2WUL A;  3IR4 A;  2LUS A;  1YKA A;  1U3I A;  2AHE A;  2FWG A;  2GDR A;  3HJO A;  4YH2 A;  3LEF A;  3D0Z A;  1O73 A;  1GSF A;  3H79 A;  3ZRE A;  3KZQ A;  3H4K A;  6GSS A;  3ZL5 A;  2LQO A;  2VL2 A;  1HQO A;  3P8W A;  3WGE A;  5AIV A;  3U5R E;  1BYE A;  4OFT A;  5HR1 A;  3G7J A;  3F0I A;  4EVM A;  4ECI A;  3GA4 A;  4K9Z A;  1TI1 A;  2GT6 A;  5AGY A;  1BJX A;  5ECP B;  3VFI A;  1ZYE A;  1K0A A;  5LD0 A;  2FNO A;  1M2A A;  1SJI A;  1THX A;  3L9V A;  4IBP A;  3H1N A;  4ECC A;  1KTE A;  1Z7R A; 
#chains in the Genus database with same CATH topology
 1R4W A;  3KMN A;  1Y1U A;  1JFU A;  3ERF A;  5IMF A;  4EXJ A;  2K6V A;  5AIX A;  2A2S A;  2DJ1 A;  3IK7 A;  2MBT A;  4D73 B;  2CQ9 A;  1JZW A;  4YKG A;  2H0G A;  5ECO B;  4LMW A;  2X49 A;  4I6X A;  4TXO A;  1PKZ A;  2I1U A;  1BG5 A;  1ML6 A;  1U87 A;  2R2J A;  3GH9 A;  2ES7 A;  5IPH A;  5A5H A;  3QOU A;  4JZQ A;  2L6D A;  4BL7 A;  2C0G A;  2L6C A;  1J08 A;  3TUE A;  1S3D A;  3EUR A;  2L4Q A;  1GWC A;  2IMD A;  2CAI A;  5ECR B;  1AIU A;  3O6T A;  1M3I A;  3D5J A;  3BJ5 A;  3GL5 A;  1K0B A;  2IFQ A;  5FWG A;  2YN1 A;  5C04 A;  5HR2 A;  2GSQ A;  2XHF A;  1GH2 A;  3TB2 A;  4MH2 A;  1OC9 B;  5A1N A;  4POK A;  1GSU A;  1N8J A;  1XBS A;  3KTL A;  5IM9 A;  3EYT A;  1VRS D;  4IKH A;  2QA2 A;  1K0N A;  1M2B A;  3FR3 A;  2DKI A;  2V6K A;  1NHO A;  1ACV A;  3EU4 A;  2DIY A;  3CSI A;  1S3A A;  1A2L A;  4JE1 A;  2OKA A;  3LYK A;  2C0F A;  2RM5 A;  2DLX A;  1GSQ A;  5CYY A;  3TRP A;  1YDK A;  4KAE A;  1H4O A;  5J4V A;  4V1A p;  3ZLP A;  3EC3 A;  2HRA A;  5AIS A;  2ZCT A;  3M8N A;  4QMK A;  1FB6 A;  4HQZ A;  3Q74 A;  4MK3 A;  3Q19 A;  2WW3 A;  6GSW A;  2VKZ G;  1OKD A;  2WZS A;  2QC7 A;  4XRA A;  2A4H A;  1GUL A;  3KXO A;  2ALB A;  3DWV A;  2H6Z A;  1EGR A;  4OMV A;  3O76 A;  4XS1 A;  4TXV A;  4G0I A;  3F3Q A;  4J2F A;  1K3O A;  1VF4 A;  4I97 A;  1T4Y A;  1MDK A;  2VD1 A;  2EIO A;  4QL7 A;  5F06 A;  1XOA A;  5F07 A;  1TTZ A;  4MNN A;  4GRF A;  3QR6 A;  3ZYW A;  4KF9 A;  2JSY A;  1V2A A;  4IW9 A;  1V57 A;  5IIZ A;  3CTF A;  3BCK A;  5IO0 A;  2QA1 A;  5IMC A;  1F6M C;  4HZ4 A;  4F0C A;  3C73 A;  1PL1 A;  2DJJ A;  4G9H A;  2VM1 A;  2LST A;  2PER A;  2C3Q A;  1A8Y A;  1HNC A;  2H71 A;  1O7U A;  1Z6N A;  4Q5R A;  3TOT A;  2GLR A;  1Z5Y E;  2KHP A;  5BMU B;  4L0U A;  4PUA A;  1V40 A;  3N5O A;  3APQ A;  6GSV A;  2BTO T;  3NIV A;  3MWH A;  1DE2 A;  2O36 A;  4L0W A;  4O5U A;  2NPB A;  4Q5Q A;  2WW2 A;  4H86 A;  3D4M A;  3I6A A;  1YKC A;  4V2N A;  1X9M B;  1ZOF A;  2FWE A;  2WS2 A;  4ZBA A;  1XVQ A;  5B8B A;  2GQL A;  1AC1 A;  2HRK B;  4HEA 2;  1AW9 A;  2E7P A;  4D73 A;  2P31 A;  2FY6 A;  1QQ2 A;  4I8B A;  2X99 A;  4IP1 A;  3A5I A;  3UJ1 A;  5FHI A;  4J57 E;  5CRH A;  4IN0 A;  2WVZ A;  1YY7 A;  2A2R A;  2V6O A;  1ZCP A;  3Q18 A;  5ELA A;  2IWT A;  2O7K A;  2ZNM A;  2MMA A;  2LNT A;  3GL3 A;  3P7X A;  1X5D A;  2CA8 A;  1WE0 A;  3W8J A;  4TR4 A;  3VWV A;  1TRS A;  1F9M A;  2OJL A;  9GSS A;  1GSE A;  2R0G A;  5DBQ A;  3HXS A;  5A5K A;  2TRC P;  4L8E A;  2H0H A;  1W4V A;  2GGT A;  5G1L A;  2B5E A;  2EFD A;  3HMJ G;  5J3R A;  1S3R A;  3WGD A;  4TOP A;  7GSS A;  1NSW A;  5G1K A;  2LRC A;  2TIR A;  1A23 A;  3UBL A;  4HUA A;  4LL4 B;  2WRT A;  3P90 A;  4Z2U A;  2X8G A;  2VO4 A;  2IL3 A;  1QUW A;  3LWA A;  1FOV A;  3NZN A;  3KCM A;  1J0F A;  4EKZ A;  3TJJ A;  1E2Y A;  2FHE A;  4ZBD A;  2H1D A;  3LFL A;  1LU4 A;  2JZT A;  1XOB A;  1VF1 A;  2FWH A;  1FHE A;  2TRX A;  2V32 A;  3KEB A;  2H74 A;  4ECB A;  1Z7P A;  1OKT A;  3K8N A;  2FWF A;  3Q6O A;  3ERG A;  4PNG A;  1XWG A;  3H93 A;  4TXO B;  1F3A A;  1MEK A;  1AQX A;  2H1L A;  4G2E A;  2AUV A;  4GXZ A;  3TKS C;  4YQU A;  1Q4J A;  1JLW A;  2H01 A;  4L5O A;  4TKY A;  2YV9 A;  3KH7 A;  1XCC A;  4TR0 A;  3DD3 A;  2G0F A;  1XWC A;  4BL7 B;  4IQA A;  1PMT A;  3HVV A;  3GHA A;  5G31 A;  4EF0 A;  3U6V A;  3FY7 A;  1ERW A;  4X1U A;  1ERT A;  2VL3 A;  3DVW A;  1GP1 A;  2EC4 A;  2HRN A;  2O8V B;  3FZ4 A;  2LS5 A;  2V41 A;  3LXZ A;  1GSY A;  3GUS A;  3C7M A;  4KB3 A;  3MDK A;  4IP6 A;  4PI2 C;  5DJL A;  1HNB A;  2IFQ B;  2IJY A;  3MIX A;  2PBJ A;  1X9S B;  2GZP A;  1U88 A;  1BED A;  5DQY A;  1GUH A;  2WFC A;  3TOU A;  1WWJ A;  3I9V 2;  1S3C A;  5H5R A;  1M7T A;  4CY6 A;  1YF1 A;  4HI7 A;  2YAN A;  1EV4 A;  4KDU A;  4J56 E;  1OC8 A;  3H8Q A;  2L57 A;  5CRW A;  4JED A;  5JWO B;  4YAP A;  1G6Y A;  2HXK A;  1OC3 A;  2DBC A;  1M0U A;  1V58 A;  2Z9S A;  3HJM A;  4RI6 A;  4LLR A;  4X4J A;  3DGQ A;  3J7Y k;  4K0N A;  3ME7 A;  1GLQ A;  5CRE A;  1FB0 A;  3TCO A;  3KP9 A;  2JZR A;  2DJ2 A;  1PGT A;  3AY8 A;  2H6X A;  3L78 A;  4XIH A;  1TDI A;  3FZ9 A;  4MJA A;  3G9B A;  2RLI A;  3VWX A;  5BMU A;  1VF3 A;  2HT9 A;  4W66 A;  1G0T A;  4MH3 A;  4ZIJ A;  3ED3 A;  1PX7 A;  3E0U A;  5D9V A;  1DBY A;  1WP0 A;  3KGK A;  4EDY A;  1SU9 A;  3MNG A;  3UOM A;  1T1V A;  3E3E A;  1TRU A;  3L0H A;  3O3T A;  3GKN A;  2MZC A;  4ZB6 A;  3MYD A;  1EP7 A;  4PXO A;  5J4U A;  5GZZ B;  4G10 A;  2HRK A;  3LYP A;  2PVO C;  5A4W A;  4EDZ A;  12GS A;  1F37 A;  3A2W A;  4PQ1 A;  4FQU A;  2L4C A;  4O92 A;  2EIQ A;  4OD7 A;  1KBN A;  1SL2 B;  1TRV A;  3EE2 A;  1YZX A;  4Z7X A;  4Z2T A;  2H66 A;  1JZR A;  1M9A A;  4XS6 A;  1JHB A;  1ZGN A;  5IQY A;  1VGL A;  3QFB C;  5ECS A;  2EFE A;  4TVE A;  3W8S A;  4BVX B;  3LJR A;  3VK9 A;  1TI3 A;  2PN8 A;  1K0M A;  1FAA A;  2O89 A;  2EIR A;  2AYT A;  4TR3 A;  2J9H A;  5ELG A;  1WIK A;  4YQV A;  4EL1 A;  1MD3 A;  1PN0 A;  5BRT A;  4NAX A;  1QK8 A;  4O5R A;  4HU7 A;  1WMJ A;  3W6G A;  4MJE A;  2IME A;  3GYK A;  5GSS A;  3GKM A;  5D96 A;  1RW1 A;  3M1G A;  3FRC A;  1XPV A;  1SK0 A;  1JZO A;  4NXI A;  2LJR A;  1NW2 A;  1BX9 A;  5ECL B;  2VCW A;  2ON7 A;  3GMF A;  1YEP A;  1O8W A;  2NBS A;  3TKR A;  4ML6 A;  1PN9 A;  1F3B A;  8GSS A;  3GSS A;  4MLY A;  3F6F A;  5JCG A;  1M2D A;  3GX8 A;  2DML A;  4MAB A;  4BWQ A;  2VLU A;  2VL2 C;  4NV5 A;  2OBI A;  5INY A;  2YWN A;  3PR8 A;  2LRT A;  4AJ8 A;  1BQ7 A;  3HCZ A;  4KE3 A;  1J9B A;  3ZML A;  1SD8 A;  2YOI A;  4GQF A;  2F8A A;  4KUN A;  5DDL A;  3A5W A;  3CTG A;  1K0C A;  4RQR A;  4I2U A;  4ECJ A;  3HYP A;  1QGV A;  5G5E A;  3RDW A;  2WGR A;  1OAZ A;  1IYI A;  4HDE A;  2YNX A;  3UIW A;  3QPM A;  1AQV A;  1SJZ A;  5A4V A;  1M99 A;  2E2M A;  5JCU A;  3IOS A;  3US3 A;  1G7O A;  2M46 A;  4CDO A;  5B7C A;  4EC0 A;  2VM2 A;  3ISO A;  2LEG A;  2GT5 A;  2HSN B;  5ENU A;  4MP4 A;  3KP8 A;  3GTU B;  5G5F A;  3PH9 A;  3VUR A;  2HFD A;  2EFH A;  3BOA A;  4TR1 B;  2VCZ A;  5ECQ B;  2C1Y A;  3HKR A;  2GZY A;  5IO2 A;  4IQ1 A;  2C0D A;  3DRN A;  3VI7 A;  5EL8 A;  3C1R A;  3IXR A;  3MSZ A;  3L9U A;  4ACS A;  2YJ7 A;  1FG4 A;  2IN3 A;  4ZL9 A;  1XFL A;  3GUR A;  4OWY A;  3TRQ A;  2UV8 G;  2N5F A;  1SEN A;  5DJM A;  4ZB9 A;  2K18 A;  2F8F A;  1YVL A;  4POB A;  4MDC A;  2B1L A;  3GH6 A;  4EE0 A;  3BD2 A;  3C71 A;  4I5Q A;  3TJG A;  2FD3 A;  4ZL7 A;  2JL4 A;  1ZMA A;  2B7K A;  2WVX B;  2MMN A;  3P2A A;  3R2Q A;  1B48 A;  4TRX A;  3TKQ A;  1BF5 A;  2H30 A;  2CZ2 A;  1XVW A;  3TJK A;  5G2Z A;  2YV7 A;  2X8C A;  2BMX A;  2VIM A;  3HZ4 A;  1GTU A;  1TJD A;  2PU9 C;  5DVB A;  3IC4 A;  4N10 A;  5HFG A;  1ABA A;  3F9U A;  2HZF A;  1B9Y C;  3FHK A;  3HZ8 A;  2IIY A;  4OCF A;  1XW6 A;  1GTB A;  5ECI B;  3A3T A;  1URM A;  1FVK A;  3CRU A;  5GAN D;  3KJY A;  4ISD A;  4OFM A;  3EU3 A;  4BVX A;  4WBR D;  4V2L A;  2R6K A;  2PWJ A;  1EWX A;  2BJX A;  3MAK A;  1EZK A;  1W89 A;  3SBC A;  2O5V A;  4IVF A;  2QSI A;  2YJH A;  1TXU A;  1A0R P;  3DEX A;  2V1M A;  4FH8 A;  1GTI A;  2NDO A;  2WW1 A;  4PGT A;  5D8I A;  2E2G A;  3IRA A;  5D9X A;  5AN1 A;  2N5A A;  4F9Z A;  4BVY B;  4KSM A;  5FT3 A;  1TU8 A;  3IK9 A;  4IEL A;  5IOW A;  1UN2 A;  5E4W A;  1UVZ A;  2H70 A;  3FW2 A;  3ME8 A;  3VPQ A;  3GRX A;  3VI5 A;  1SYR A;  1N25 A;  1ILO A;  1NHY A;  4HS1 A;  3L9S A;  2LV3 A;  3RFR C;  3RPN A;  2B3S A;  1GLP A;  5CNW A;  2CVD A;  2B5Y A;  4ZL8 A;  3I43 A;  4BPY A;  2HRF A;  1RQM A;  1KEB A;  3G7I A;  5HR3 A;  4GDF A;  1MDI A;  3ZMK A;  2C0E A;  4GLT A;  3ZIV A;  3CHX C;  4TW5 A;  3D4T A;  3DKS A;  2H1A A;  4GQC A;  3F4T A;  1PFO A;  3GN3 A;  1B4P A;  1SK1 A;  4Z2R A;  2OE1 A;  5DAL A;  3EWL A;  2DMM A;  3DML A;  3RPP A;  4HSC X;  2FUG 2;  1T00 A;  3HVN A;  5J4Y A;  4XHM A;  2GSS A;  1XW9 A;  3DVX A;  4N11 A;  1WPI A;  1QXH A;  2P5R A;  3QCP A;  1TK8 B;  3VWU A;  4PI0 C;  1U3A A;  5H5Q A;  1X5C A;  2NVL A;  2FGX A;  2GST A;  5A34 B;  5HFI A;  3F4R A;  5F8B A;  4K1F A;  2XBQ A;  4QL9 A;  2VCX A;  3TRX A;  2HSN A;  4MJC A;  4MZC A;  5J41 A;  4K5S A;  3GTU A;  4NHW A;  1SVO A;  1PX6 A;  4V2M A;  5LCZ A;  3NOF A;  5IMV A;  1HYU A;  1X0R A;  4DSR A;  1Y6E A;  3ZTL A;  3HJP A;  4TR1 A;  4NMU A;  2AV4 A;  5L71 A;  4JR4 A;  2H1G A;  3FEU A;  3GFK A;  2JAD A;  4MF5 A;  3DXB A;  2PMT A;  2MMZ A;  1SKS B;  3TKS E;  4XCS A;  2KLX A;  3R3E A;  1PQN A;  3KM6 A;  1TKD B;  4WR5 A;  2WZ9 A;  2HSH A;  1OVN A;  4G0K A;  1OYJ A;  3CMI A;  1I5G A;  4PTS A;  4TN8 A;  1LJR A;  4MPF A;  1TU7 A;  2D2Z A;  3EVI A;  1ZL9 A;  3WYW A;  2DC5 A;  4F0B A;  2CX3 A;  4O32 A;  3FYG A;  4EIP A;  4AKH A;  2C8U A;  1SK2 A;  1YEW C;  2I3Y A;  5IMA A;  4X43 A;  5KOW A;  1A8L A;  1TOF A;  3EIN A;  6GSU A;  3TGZ A;  3FR6 A;  4DVC A;  4PUF C;  5J9C A;  4JBB A;  1ERU A;  2C4J A;  2WVX A;  3QDN A;  4F82 A;  1USB A;  4BA7 A;  3J7Y b;  3CQF A;  1FW1 A;  2B5X A;  4GTU A;  5KN2 A;  2R3X A;  3GKX A;  4WKW A;  1ZYP A;  4HJM A;  2M80 A;  4NV2 A;  5JWR B;  1T4Z A;  2XBI A;  4I2T A;  5KEJ A;  2R4V A;  4KW6 A;  4RI7 A;  2E0Q A;  3ZFL A;  3GNJ A;  2FLS A;  4N0V A;  4OO4 A;  2DKH A;  1JZD A;  1U6T A;  1TK0 B;  2YCD A;  4EIQ A;  4YKF A;  3IAS 2;  2CT6 A;  3FMW A;  4GCI A;  2G2Q A;  2L5L A;  2WCI A;  5D9T A;  2XPD A;  2AAW A;  2R5G A;  4USS A;  3V1W A;  2R37 A;  19GS A;  5C00 A;  4ZB8 A;  2P5Q A;  5CRG A;  3KIJ A;  4BVY A;  2KP2 A;  2MYG A;  1UA5 A;  4OCE A;  4ID0 A;  5F05 A;  3QD9 A;  3CXG A;  11GS A;  2A4V A;  4MCU A;  3SWL A;  2HLS A;  2AB6 A;  4WR4 A;  1WJK A;  4ML1 A;  2HE3 A;  2WB9 A;  1F2E A;  1AAZ A;  3HVS A;  3QAV A;  2N5B A;  3ZIJ A;  4CW9 A;  1FO5 A;  2JSZ A;  4E68 A;  5F0G A;  3FR9 A;  2OE3 A;  4ZXG A;  3UBK A;  2KP1 A;  4POL A;  1VF2 A;  4DSS B;  2CAQ A;  2LJA A;  3IDV A;  4FXY P;  5JWQ B;  5HFK A;  1GNE A;  1TW9 A;  3FZA A;  4L5L A;  2HYX A;  4G01 A;  4CHS A;  4IS0 A;  2IMK A;  3M9K A;  5GAP D;  1MDJ A;  2B6M A;  2ZUP A;  3ZZX A;  5B6N A;  4JRR A;  1K0O A;  1DSB A;  3RAZ A;  5J9B A;  4ZBB A;  5EVO A;  4QQ7 A;  4YQM A;  4DEJ A;  3IBH A;  1SVL A;  2RUE A;  3FKF A;  3RHB A;  2K8S A;  4WET A;  2CZ3 A;  5A34 A;  4MPG A;  4N0Z A;  1SL1 B;  3A2X A;  3TJB A;  3RGB C;  2VAF A;  3C1S A;  4MZB A;  1YF0 A;  2CX4 A;  3UVT A;  1EGO A;  3KMO A;  2H19 A;  2FA8 A;  1SYX A;  4FO5 A;  1PL2 A;  4GF0 A;  4RUV A;  4MF7 A;  1SKW B;  3CWG A;  2RUF A;  1XIY A;  3PGT A;  3EMP A;  3CYN A;  4PHZ C;  2NTO A;  4GSS A;  2LRN A;  4XRD A;  1MTC A;  2YWM A;  3EMX A;  4KDY A;  3IV4 A;  2LQQ A;  4KGI A;  2A2P A;  4AJ6 A;  2K9F A;  3RHC A;  5DQS A;  1Z6M A;  3ZFB A;  2H1B A;  1XWK A;  4E8H A;  3C8E A;  6GST A;  1O81 A;  3QAG A;  5J5N A;  2XPE A;  4OFN A;  2IMI A;  1ST9 A;  3M3M A;  5DAL B;  5ECK B;  2CVK A;  2K8V A;  4K2X A;  4WF5 A;  4WBJ A;  1Q98 A;  3LSZ A;  1M9B A;  4AKX B;  1UC7 A;  3QMX A;  1THO A;  2VLT A;  1ON4 A;  2DJ3 A;  3G7Y A;  4IJ3 A;  2GQM A;  2F9S A;  2QGV A;  1OE7 A;  4XS4 A;  1E6B A;  5D73 A;  3HVX A;  1QMV A;  1SJ6 A;  3WGX A;  5HQP A;  5CP1 A;  4EUY A;  1K3Y A;  1AUC A;  3KD0 A;  2GVP A;  2VCV A;  2JU5 A;  5J40 A;  4PQI A;  1I9D A;  5CAX A;  1H75 A;  4XTS A;  3GKK A;  3ZVJ D;  1B8X A;  2X4A A;  2R0P A;  2C80 A;  3S9F A;  2VCT A;  1V98 A;  4GSN A;  4IGJ A;  2LJK A;  4AKG A;  1EEM A;  1K0D A;  4N30 A;  4KCE A;  3IE3 A;  2HZE B;  1PSQ A;  2GSR A;  2VCQ A;  4MZW A;  3DIE A;  2M72 A;  3JCM L;  2ON5 A;  5ID2 B;  3BBY A;  1T8E B;  2CVB A;  5J47 A;  2WVY A;  3WD6 A;  4PNF A;  5DAK A;  4K2D A;  2RM6 A;  2OAC A;  4G19 A;  2AJQ B;  1FOH A;  4K7N A;  1Z9H A;  5B6M A;  2L59 A;  3F4S A;  22GS A;  1PA3 A;  3E9J B;  1DE1 A;  4ZIL A;  2LNS A;  4AF2 A;  5GST A;  3A2V A;  3F3R A;  4Q5N A;  5IOX A;  2XC2 A;  4PX1 A;  18GS A;  2YWI A;  17GS A;  3IHG A;  1KNG A;  2I9H A;  2H6Y A;  3PIN A;  2YWO A;  1RK4 A;  1ZZY A;  2OE0 A;  1R5A A;  5H5S A;  10GS A;  1K3L A;  3M9J A;  2H76 A;  1WRY A;  2VUP A;  3ZRD A;  3CBU A;  2HSY A;  2JAC A;  2H0I A;  5DCG A;  3CSH A;  3LG6 A;  3N9J A;  5ECM B;  4CY8 A;  4K5R A;  3ZIT A;  1XWB A;  4FIW A;  3CSJ A;  2GQK A;  1XWA A;  3HHV A;  3L4N A;  5HR0 A;  4F03 A;  4DSS A;  5IMZ A;  4P3Y B;  4AJ7 A;  1QFN A;  4PQH A;  2P0G A;  3TDG A;  3TKP A;  4O5Q A;  3IC8 A;  1GUM A;  3HY2 A;  1EV9 A;  2FCH A;  2F51 A;  1JLV A;  2REM A;  5KN0 A;  5D9W A;  5KN3 A;  4N3Z A;  1PRX A;  1IYH A;  1R7H A;  1EEJ A;  4G0L A;  2KUC A;  1SVM A;  4O7H A;  4NHZ A;  4IHU A;  1Z3E A;  1N2A A;  2VOC A;  3LGC A;  1GTA A;  20GS A;  4KH7 A;  3FK8 A;  3ZVJ A;  4NPB A;  1TP9 A;  3IPZ A;  3GV1 A;  5ECN B;  1YEX A;  1XW5 A;  1YJ6 A;  2F3M A;  3PPU A;  1EOH A;  4EO3 A;  5IPG A;  2IPA A;  3I69 A;  13GS A;  3HA9 A;  3F6D A;  1O8X A;  1C72 A;  2HSM B;  4AKI A;  3UEM A;  1O6J A;  4LMV A;  1GNW A;  2DIZ A;  1EOG A;  4F2I A;  4JR6 A;  5ABR A;  2OT3 A;  1R26 A;  4LA1 A;  1Y25 A;  2C3T A;  2WW0 A;  4IJI A;  1SD9 A;  3HDC A;  4KND A;  2H75 A;  3UVH A;  4K8M A;  1GL8 A;  4ILF A;  1R5P A;  3UAR A;  5CO3 A;  4K6X A;  3BCI A;  4MJB A;  3D22 A;  3LOR A;  1G6W A;  2IMF A;  2I81 A;  1GRX A;  4WEY A;  6GSY A;  1XXU A;  2DJK A;  5E59 A;  3TKS A;  1DUG A;  14GS A;  3LQ7 A;  1AQW A;  2DSA A;  16GS A;  2WJU A;  2O3E A;  1HD2 A;  5DCH A;  1EP8 A;  4BIK A;  2MBS A;  1T7P B;  2PVQ A;  2PPT A;  1PD2 1;  2X8H A;  2VL9 A;  2EFC A;  2B1K A;  3APS A;  1GSS A;  4A5P A;  5LNK e;  1GUK A;  3ERW A;  2O87 A;  1B4Q A;  1OC9 A;  4ULX A;  1SKR B;  4V1A g;  2YZU A;  3D6I A;  3FZ5 A;  4RQX A;  2HQT A;  2YPM A;  1I1I P;  2V2G A;  1A2M A;  2JZS A;  1LBK A;  3UAP A;  4KCA A;  4FYC A;  4OO5 A;  1XZO A;  1HNA A;  2OA7 A;  1V9W A;  2HZE A;  5A4U A;  2X64 A;  4MMM A;  1A0F A;  3TJF A;  5ID2 A;  2RII A;  2HNL A;  4BWS A;  4YAV A;  2R0C A;  1CQH A;  5A5H B;  5KOX A;  3GIX A;  1TK5 B;  2UZ8 A;  2GZZ A;  3F8U A;  4POM A;  1CQG A;  1M3J A;  1TRW A;  5COH A;  2YZH A;  4FYU A;  2PUK C;  2J23 A;  4AGS A;  4K7I A;  3APO A;  4PUR A;  3EPT A;  4XS4 B;  3UMA A;  2VLV A;  5EPF A;  3WT1 A;  3VLN A;  1ZYQ B;  3TU3 B;  2OBK A;  2YP6 A;  1BAY A;  1OE8 A;  3HD5 A;  3KTB A;  3OR5 A;  1A2J A;  2DJ0 A;  4KSO A;  5KN1 A;  2GTU A;  2HI7 A;  5EY6 A;  4HZ2 A;  4FYB A;  1YQ1 A;  1FVJ A;  3KH9 A;  4GWR A;  1PKW A;  5A1N B;  1X5E A;  1G7E A;  2FA4 A;  1O85 A;  3IHQ A;  1NM3 A;  3VWW A;  2MMO A;  1GSD A;  2C3N A;  2KOK A;  4ZB7 A;  4KX4 A;  2LKU A;  5D93 A;  5ECH B;  5JCW A;  1TXX A;  2GS3 A;  2LTK A;  6GSX A;  4MA9 A;  4JU5 A;  3IA1 A;  4KA0 A;  1B9X C;  3GST A;  1WOU A;  4Q5F A;  3QAW A;  4DSQ A;  2VD0 A;  4HOJ A;  1SL0 B;  2B7J A;  1AXD A;  2H8L A;  5DAK B;  2L5O A;  2QKE A;  4HQS A;  3F63 A;  1ERV A;  4K0G A;  2I4A A;  2H72 A;  3UL3 A;  3GX0 A;  5IMD A;  4KDX A;  1T3B A;  5B8A A;  3IAM 2;  4WXT A;  3LXT A;  4AI6 A;  2CV4 A;  5G30 A;  1S4B P;  3D21 A;  3CRT A;  3M0F A;  3VPT A;  1BG1 A;  3QFA C;  1X9W B;  2WDU A;  2H73 A;  4K7O A;  4HJ2 A;  1MD4 A;  2PGT A;  4MF6 A;  2O85 A;  1A24 A;  3WT2 A;  3RBT A;  4NWY A;  4HU9 A;  5CRD A;  2HSM A;  1ZYN A;  4LL1 B;  3DYR A;  4WF4 A;  4GST A;  4E8E A;  2OAD A;  4X0X A;  2WUL A;  3IR4 A;  2LUS A;  1YKA A;  1U3I A;  2AHE A;  1XG8 A;  2FWG A;  2GDR A;  3HJO A;  4YH2 A;  3LEF A;  3LW9 A;  3D0Z A;  1O73 A;  1GSF A;  3H79 A;  3ZRE A;  4ICY A;  3KZQ A;  3H4K A;  6GSS A;  3ZL5 A;  2LQO A;  2VL2 A;  1HQO A;  3P8W A;  3WGE A;  5AIV A;  3U5R E;  1BYE A;  4OFT A;  5HR1 A;  3G7J A;  3F0I A;  4EVM A;  4ECI A;  3GA4 A;  4K9Z A;  1TI1 A;  2GT6 A;  5AGY A;  1BJX A;  5ECP B;  3VFI A;  1ZYE A;  1K0A A;  5LD0 A;  2FNO A;  1M2A A;  1SJI A;  1THX A;  3L9V A;  4IBP A;  3H1N A;  4ECC A;  1KTE A;  1Z7R A; 
#chains in the Genus database with same CATH homology
 1R4W A;  3KMN A;  1Y1U A;  1JFU A;  3ERF A;  5IMF A;  4EXJ A;  2K6V A;  5AIX A;  2A2S A;  2DJ1 A;  3IK7 A;  2MBT A;  4D73 B;  2CQ9 A;  1JZW A;  4YKG A;  2H0G A;  5ECO B;  4LMW A;  2X49 A;  4I6X A;  4TXO A;  1PKZ A;  2I1U A;  1BG5 A;  1ML6 A;  1U87 A;  2R2J A;  3GH9 A;  2ES7 A;  5IPH A;  5A5H A;  3QOU A;  4JZQ A;  2L6D A;  4BL7 A;  2C0G A;  2L6C A;  1J08 A;  3TUE A;  1S3D A;  3EUR A;  2L4Q A;  1GWC A;  2IMD A;  2CAI A;  5ECR B;  1AIU A;  3O6T A;  3D5J A;  3BJ5 A;  3GL5 A;  1K0B A;  2IFQ A;  5FWG A;  2YN1 A;  5C04 A;  5HR2 A;  2GSQ A;  2XHF A;  1GH2 A;  3TB2 A;  4MH2 A;  1OC9 B;  5A1N A;  4POK A;  1GSU A;  1N8J A;  1XBS A;  3KTL A;  5IM9 A;  3EYT A;  1VRS D;  4IKH A;  2QA2 A;  1K0N A;  1M2B A;  3FR3 A;  2DKI A;  2V6K A;  1NHO A;  1ACV A;  3EU4 A;  2DIY A;  3CSI A;  1S3A A;  1A2L A;  4JE1 A;  2OKA A;  3LYK A;  2C0F A;  2RM5 A;  2DLX A;  1GSQ A;  5CYY A;  3TRP A;  1YDK A;  4KAE A;  1H4O A;  5J4V A;  4V1A p;  3ZLP A;  3EC3 A;  2HRA A;  5AIS A;  2ZCT A;  3M8N A;  4QMK A;  1FB6 A;  4HQZ A;  3Q74 A;  4MK3 A;  3Q19 A;  6GSW A;  2VKZ G;  1OKD A;  2QC7 A;  4XRA A;  2A4H A;  1GUL A;  3KXO A;  2ALB A;  3DWV A;  2H6Z A;  1EGR A;  4OMV A;  3O76 A;  4XS1 A;  4TXV A;  4G0I A;  3F3Q A;  4J2F A;  1K3O A;  1VF4 A;  4I97 A;  1T4Y A;  1MDK A;  2VD1 A;  2EIO A;  4QL7 A;  5F06 A;  1XOA A;  5F07 A;  1TTZ A;  4MNN A;  4GRF A;  3QR6 A;  3ZYW A;  4KF9 A;  2JSY A;  1V2A A;  4IW9 A;  1V57 A;  5IIZ A;  3CTF A;  3BCK A;  5IO0 A;  2QA1 A;  5IMC A;  1F6M C;  4HZ4 A;  4F0C A;  3C73 A;  1PL1 A;  2DJJ A;  4G9H A;  2VM1 A;  2LST A;  2PER A;  2C3Q A;  1A8Y A;  1HNC A;  2H71 A;  1O7U A;  1Z6N A;  4Q5R A;  3TOT A;  2GLR A;  1Z5Y E;  2KHP A;  5BMU B;  4L0U A;  4PUA A;  1V40 A;  3N5O A;  3APQ A;  6GSV A;  2BTO T;  3NIV A;  3MWH A;  1DE2 A;  4L0W A;  4O5U A;  2NPB A;  4Q5Q A;  4H86 A;  3D4M A;  3I6A A;  1YKC A;  4V2N A;  1X9M B;  1ZOF A;  2FWE A;  2WS2 A;  4ZBA A;  1XVQ A;  5B8B A;  2GQL A;  1AC1 A;  2HRK B;  4HEA 2;  1AW9 A;  2E7P A;  4D73 A;  2P31 A;  2FY6 A;  1QQ2 A;  4I8B A;  2X99 A;  4IP1 A;  3A5I A;  3UJ1 A;  5FHI A;  4J57 E;  5CRH A;  4IN0 A;  1YY7 A;  2A2R A;  2V6O A;  1ZCP A;  3Q18 A;  5ELA A;  2IWT A;  2O7K A;  2ZNM A;  2MMA A;  2LNT A;  3GL3 A;  3P7X A;  1X5D A;  2CA8 A;  1WE0 A;  3W8J A;  4TR4 A;  3VWV A;  1TRS A;  1F9M A;  2OJL A;  9GSS A;  1GSE A;  2R0G A;  5DBQ A;  3HXS A;  5A5K A;  2TRC P;  4L8E A;  2H0H A;  1W4V A;  2GGT A;  5G1L A;  2B5E A;  2EFD A;  3HMJ G;  5J3R A;  3WGD A;  4TOP A;  7GSS A;  1NSW A;  5G1K A;  2LRC A;  2TIR A;  1A23 A;  3UBL A;  4HUA A;  4LL4 B;  2WRT A;  3P90 A;  4Z2U A;  2X8G A;  2VO4 A;  2IL3 A;  1QUW A;  3LWA A;  1FOV A;  3NZN A;  3KCM A;  1J0F A;  4EKZ A;  3TJJ A;  1E2Y A;  2FHE A;  4ZBD A;  2H1D A;  3LFL A;  1LU4 A;  2JZT A;  1XOB A;  1VF1 A;  2FWH A;  1FHE A;  2TRX A;  2V32 A;  3KEB A;  2H74 A;  4ECB A;  1Z7P A;  1OKT A;  3K8N A;  2FWF A;  3Q6O A;  3ERG A;  4PNG A;  1XWG A;  3H93 A;  4TXO B;  1F3A A;  1MEK A;  1AQX A;  2H1L A;  4G2E A;  2AUV A;  4GXZ A;  3TKS C;  4YQU A;  1Q4J A;  1JLW A;  2H01 A;  4L5O A;  4TKY A;  2YV9 A;  3KH7 A;  1XCC A;  4TR0 A;  3DD3 A;  2G0F A;  1XWC A;  4BL7 B;  4IQA A;  1PMT A;  3HVV A;  3GHA A;  5G31 A;  4EF0 A;  3U6V A;  3FY7 A;  1ERW A;  4X1U A;  1ERT A;  2VL3 A;  3DVW A;  1GP1 A;  2EC4 A;  2HRN A;  2O8V B;  3FZ4 A;  2LS5 A;  2V41 A;  3LXZ A;  1GSY A;  3GUS A;  3C7M A;  4KB3 A;  3MDK A;  4IP6 A;  5DJL A;  2IFQ B;  1HNB A;  2IJY A;  3MIX A;  2PBJ A;  1X9S B;  2GZP A;  1U88 A;  1BED A;  5DQY A;  1GUH A;  2WFC A;  3TOU A;  1WWJ A;  3I9V 2;  1S3C A;  5H5R A;  1M7T A;  4CY6 A;  1YF1 A;  4HI7 A;  2YAN A;  1EV4 A;  4KDU A;  4J56 E;  1OC8 A;  3H8Q A;  2L57 A;  5CRW A;  4JED A;  5JWO B;  4YAP A;  1G6Y A;  2HXK A;  1OC3 A;  2DBC A;  1M0U A;  1V58 A;  2Z9S A;  3HJM A;  4RI6 A;  4LLR A;  4X4J A;  3DGQ A;  3J7Y k;  4K0N A;  3ME7 A;  1GLQ A;  5CRE A;  1FB0 A;  3TCO A;  3KP9 A;  2JZR A;  2DJ2 A;  1PGT A;  3AY8 A;  2H6X A;  3L78 A;  4XIH A;  1TDI A;  3FZ9 A;  4MJA A;  3G9B A;  2RLI A;  3VWX A;  5BMU A;  1VF3 A;  2HT9 A;  4W66 A;  1G0T A;  4MH3 A;  4ZIJ A;  3ED3 A;  1PX7 A;  3E0U A;  5D9V A;  1DBY A;  1WP0 A;  3KGK A;  4EDY A;  1SU9 A;  3MNG A;  3UOM A;  1T1V A;  3E3E A;  1TRU A;  3L0H A;  3O3T A;  3GKN A;  2MZC A;  4ZB6 A;  3MYD A;  1EP7 A;  4PXO A;  5J4U A;  5GZZ B;  4G10 A;  2HRK A;  3LYP A;  2PVO C;  5A4W A;  4EDZ A;  12GS A;  1F37 A;  3A2W A;  4PQ1 A;  4FQU A;  2L4C A;  4O92 A;  2EIQ A;  4OD7 A;  1KBN A;  1SL2 B;  1TRV A;  3EE2 A;  1YZX A;  4Z7X A;  4Z2T A;  2H66 A;  1JZR A;  1M9A A;  4XS6 A;  1JHB A;  1ZGN A;  5IQY A;  1VGL A;  3QFB C;  5ECS A;  2EFE A;  4TVE A;  3W8S A;  4BVX B;  3LJR A;  3VK9 A;  1TI3 A;  2PN8 A;  1K0M A;  1FAA A;  2O89 A;  2EIR A;  2AYT A;  4TR3 A;  2J9H A;  5ELG A;  1WIK A;  4YQV A;  4EL1 A;  1MD3 A;  1PN0 A;  5BRT A;  4NAX A;  1QK8 A;  4O5R A;  4HU7 A;  1WMJ A;  3W6G A;  4MJE A;  2IME A;  3GYK A;  5GSS A;  3GKM A;  5D96 A;  1RW1 A;  3M1G A;  3FRC A;  1XPV A;  1SK0 A;  1JZO A;  4NXI A;  2LJR A;  1NW2 A;  1BX9 A;  5ECL B;  2VCW A;  2ON7 A;  3GMF A;  1YEP A;  1O8W A;  2NBS A;  3TKR A;  4ML6 A;  1PN9 A;  1F3B A;  8GSS A;  3GSS A;  4MLY A;  3F6F A;  5JCG A;  1M2D A;  3GX8 A;  2DML A;  4MAB A;  4BWQ A;  2VLU A;  2VL2 C;  4NV5 A;  2OBI A;  5INY A;  2YWN A;  3PR8 A;  2LRT A;  4AJ8 A;  1BQ7 A;  3HCZ A;  4KE3 A;  1J9B A;  3ZML A;  1SD8 A;  2YOI A;  4GQF A;  2F8A A;  4KUN A;  5DDL A;  3A5W A;  3CTG A;  1K0C A;  4RQR A;  4I2U A;  4ECJ A;  3HYP A;  1QGV A;  5G5E A;  3RDW A;  2WGR A;  1OAZ A;  1IYI A;  4HDE A;  2YNX A;  3UIW A;  3QPM A;  1AQV A;  1SJZ A;  5A4V A;  1M99 A;  2E2M A;  5JCU A;  3IOS A;  3US3 A;  1G7O A;  2M46 A;  4CDO A;  5B7C A;  4EC0 A;  2VM2 A;  3ISO A;  2LEG A;  2GT5 A;  2HSN B;  5ENU A;  4MP4 A;  3KP8 A;  3GTU B;  5G5F A;  3PH9 A;  3VUR A;  2HFD A;  2EFH A;  3BOA A;  4TR1 B;  2VCZ A;  5ECQ B;  2C1Y A;  3HKR A;  2GZY A;  5IO2 A;  4IQ1 A;  2C0D A;  3DRN A;  3VI7 A;  5EL8 A;  3C1R A;  3IXR A;  3MSZ A;  3L9U A;  4ACS A;  2YJ7 A;  1FG4 A;  2IN3 A;  4ZL9 A;  1XFL A;  3GUR A;  4OWY A;  3TRQ A;  2UV8 G;  2N5F A;  1SEN A;  5DJM A;  4ZB9 A;  2K18 A;  2F8F A;  1YVL A;  4POB A;  4MDC A;  2B1L A;  3GH6 A;  4EE0 A;  3BD2 A;  3C71 A;  4I5Q A;  3TJG A;  2FD3 A;  4ZL7 A;  2JL4 A;  1ZMA A;  2B7K A;  2MMN A;  3P2A A;  3R2Q A;  1B48 A;  4TRX A;  3TKQ A;  1BF5 A;  2H30 A;  2CZ2 A;  1XVW A;  3TJK A;  5G2Z A;  2YV7 A;  2X8C A;  2BMX A;  2VIM A;  3HZ4 A;  1GTU A;  1TJD A;  2PU9 C;  5DVB A;  3IC4 A;  4N10 A;  5HFG A;  1ABA A;  3F9U A;  2HZF A;  1B9Y C;  3FHK A;  3HZ8 A;  2IIY A;  4OCF A;  1XW6 A;  1GTB A;  5ECI B;  3A3T A;  1URM A;  1FVK A;  3CRU A;  5GAN D;  3KJY A;  4ISD A;  4OFM A;  3EU3 A;  4BVX A;  4WBR D;  4V2L A;  2R6K A;  2PWJ A;  1EWX A;  2BJX A;  3MAK A;  1EZK A;  1W89 A;  3SBC A;  2O5V A;  4IVF A;  2QSI A;  2YJH A;  1TXU A;  1A0R P;  3DEX A;  2V1M A;  4FH8 A;  1GTI A;  2NDO A;  4PGT A;  5D8I A;  2E2G A;  3IRA A;  5D9X A;  5AN1 A;  2N5A A;  4F9Z A;  4BVY B;  4KSM A;  5FT3 A;  1TU8 A;  3IK9 A;  4IEL A;  5IOW A;  1UN2 A;  5E4W A;  1UVZ A;  2H70 A;  3FW2 A;  3ME8 A;  3VPQ A;  3GRX A;  3VI5 A;  1SYR A;  1N25 A;  1ILO A;  1NHY A;  4HS1 A;  3L9S A;  2LV3 A;  3RPN A;  2B3S A;  1GLP A;  5CNW A;  2CVD A;  2B5Y A;  4ZL8 A;  3I43 A;  4BPY A;  2HRF A;  1RQM A;  1KEB A;  3G7I A;  5HR3 A;  4GDF A;  1MDI A;  3ZMK A;  2C0E A;  4GLT A;  3ZIV A;  4TW5 A;  3D4T A;  3DKS A;  2H1A A;  4GQC A;  3F4T A;  3GN3 A;  1B4P A;  1SK1 A;  4Z2R A;  2OE1 A;  5DAL A;  3EWL A;  2DMM A;  3DML A;  3RPP A;  2FUG 2;  1T00 A;  5J4Y A;  4XHM A;  2GSS A;  1XW9 A;  3DVX A;  4N11 A;  1WPI A;  1QXH A;  2P5R A;  3QCP A;  1TK8 B;  3VWU A;  1U3A A;  5H5Q A;  1X5C A;  2NVL A;  2FGX A;  2GST A;  5A34 B;  5HFI A;  3F4R A;  5F8B A;  4K1F A;  2XBQ A;  4QL9 A;  2VCX A;  3TRX A;  2HSN A;  4MJC A;  4MZC A;  5J41 A;  4K5S A;  3GTU A;  4NHW A;  1SVO A;  1PX6 A;  4V2M A;  5LCZ A;  3NOF A;  5IMV A;  1HYU A;  1X0R A;  4DSR A;  1Y6E A;  3ZTL A;  3HJP A;  4TR1 A;  4NMU A;  2AV4 A;  5L71 A;  4JR4 A;  2H1G A;  3FEU A;  3GFK A;  2JAD A;  4MF5 A;  3DXB A;  2PMT A;  2MMZ A;  1SKS B;  3TKS E;  4XCS A;  2KLX A;  3R3E A;  1PQN A;  3KM6 A;  1TKD B;  4WR5 A;  2WZ9 A;  2HSH A;  1OVN A;  4G0K A;  1OYJ A;  3CMI A;  1I5G A;  4PTS A;  4TN8 A;  1LJR A;  4MPF A;  1TU7 A;  2D2Z A;  3EVI A;  1ZL9 A;  3WYW A;  2DC5 A;  4F0B A;  2CX3 A;  4O32 A;  3FYG A;  4EIP A;  4AKH A;  2C8U A;  1SK2 A;  2I3Y A;  5IMA A;  4X43 A;  5KOW A;  1A8L A;  1TOF A;  3EIN A;  6GSU A;  3TGZ A;  3FR6 A;  4DVC A;  4PUF C;  5J9C A;  4JBB A;  1ERU A;  2C4J A;  3QDN A;  4F82 A;  1USB A;  4BA7 A;  3J7Y b;  1FW1 A;  2B5X A;  4GTU A;  5KN2 A;  2R3X A;  3GKX A;  4WKW A;  1ZYP A;  4HJM A;  2M80 A;  4NV2 A;  5JWR B;  1T4Z A;  2XBI A;  4I2T A;  5KEJ A;  2R4V A;  4KW6 A;  4RI7 A;  2E0Q A;  3ZFL A;  3GNJ A;  2FLS A;  4N0V A;  4OO4 A;  2DKH A;  1JZD A;  1U6T A;  1TK0 B;  2YCD A;  4EIQ A;  4YKF A;  3IAS 2;  2CT6 A;  3FMW A;  4GCI A;  2G2Q A;  2L5L A;  2WCI A;  5D9T A;  2XPD A;  2AAW A;  2R5G A;  4USS A;  3V1W A;  2R37 A;  19GS A;  5C00 A;  4ZB8 A;  2P5Q A;  5CRG A;  3KIJ A;  4BVY A;  2KP2 A;  2MYG A;  1UA5 A;  4OCE A;  4ID0 A;  5F05 A;  3QD9 A;  3CXG A;  11GS A;  2A4V A;  4MCU A;  3SWL A;  2HLS A;  2AB6 A;  4WR4 A;  1WJK A;  4ML1 A;  2HE3 A;  2WB9 A;  1F2E A;  1AAZ A;  3HVS A;  3QAV A;  2N5B A;  3ZIJ A;  4CW9 A;  1FO5 A;  2JSZ A;  4E68 A;  5F0G A;  3FR9 A;  2OE3 A;  4ZXG A;  3UBK A;  2KP1 A;  4POL A;  1VF2 A;  4DSS B;  2CAQ A;  2LJA A;  3IDV A;  5JWQ B;  5HFK A;  1GNE A;  1TW9 A;  3FZA A;  4L5L A;  2HYX A;  4G01 A;  4CHS A;  4IS0 A;  2IMK A;  3M9K A;  5GAP D;  1MDJ A;  2B6M A;  2ZUP A;  3ZZX A;  5B6N A;  4JRR A;  1K0O A;  1DSB A;  3RAZ A;  5J9B A;  4ZBB A;  5EVO A;  4QQ7 A;  4YQM A;  4DEJ A;  3IBH A;  1SVL A;  2RUE A;  3FKF A;  3RHB A;  2K8S A;  4WET A;  2CZ3 A;  5A34 A;  4MPG A;  4N0Z A;  1SL1 B;  3A2X A;  3TJB A;  2VAF A;  3C1S A;  4MZB A;  1YF0 A;  2CX4 A;  3UVT A;  1EGO A;  3KMO A;  2H19 A;  2FA8 A;  1SYX A;  4FO5 A;  1PL2 A;  4GF0 A;  4RUV A;  4MF7 A;  1SKW B;  3CWG A;  2RUF A;  1XIY A;  3PGT A;  3EMP A;  3CYN A;  2NTO A;  4GSS A;  2LRN A;  4XRD A;  1MTC A;  2YWM A;  3EMX A;  4KDY A;  3IV4 A;  2LQQ A;  4KGI A;  2A2P A;  4AJ6 A;  2K9F A;  3RHC A;  5DQS A;  1Z6M A;  3ZFB A;  2H1B A;  1XWK A;  4E8H A;  3C8E A;  6GST A;  1O81 A;  3QAG A;  5J5N A;  2XPE A;  4OFN A;  2IMI A;  1ST9 A;  3M3M A;  5DAL B;  5ECK B;  2CVK A;  2K8V A;  4K2X A;  4WF5 A;  4WBJ A;  1Q98 A;  3LSZ A;  1M9B A;  4AKX B;  1UC7 A;  3QMX A;  1THO A;  2VLT A;  1ON4 A;  2DJ3 A;  3G7Y A;  4IJ3 A;  2GQM A;  2F9S A;  2QGV A;  1OE7 A;  4XS4 A;  1E6B A;  5D73 A;  3HVX A;  1QMV A;  1SJ6 A;  3WGX A;  5HQP A;  5CP1 A;  4EUY A;  1K3Y A;  1AUC A;  3KD0 A;  2GVP A;  2VCV A;  2JU5 A;  5J40 A;  4PQI A;  1I9D A;  5CAX A;  1H75 A;  4XTS A;  3GKK A;  3ZVJ D;  1B8X A;  2X4A A;  2R0P A;  2C80 A;  3S9F A;  2VCT A;  1V98 A;  4GSN A;  4IGJ A;  2LJK A;  4AKG A;  1EEM A;  1K0D A;  4N30 A;  4KCE A;  3IE3 A;  2HZE B;  1PSQ A;  2GSR A;  2VCQ A;  4MZW A;  3DIE A;  2M72 A;  3JCM L;  2ON5 A;  5ID2 B;  3BBY A;  1T8E B;  2CVB A;  5J47 A;  3WD6 A;  4PNF A;  5DAK A;  4K2D A;  2RM6 A;  2OAC A;  4G19 A;  2AJQ B;  1FOH A;  4K7N A;  1Z9H A;  5B6M A;  2L59 A;  3F4S A;  22GS A;  1PA3 A;  3E9J B;  1DE1 A;  4ZIL A;  2LNS A;  4AF2 A;  5GST A;  3A2V A;  3F3R A;  4Q5N A;  5IOX A;  2XC2 A;  4PX1 A;  18GS A;  2YWI A;  17GS A;  3IHG A;  1KNG A;  2I9H A;  2H6Y A;  3PIN A;  2YWO A;  1RK4 A;  1ZZY A;  2OE0 A;  1R5A A;  5H5S A;  10GS A;  1K3L A;  3M9J A;  2H76 A;  1WRY A;  2VUP A;  3ZRD A;  3CBU A;  2HSY A;  2JAC A;  2H0I A;  5DCG A;  3CSH A;  3LG6 A;  3N9J A;  5ECM B;  4CY8 A;  4K5R A;  3ZIT A;  1XWB A;  4FIW A;  3CSJ A;  2GQK A;  1XWA A;  3HHV A;  3L4N A;  5HR0 A;  4F03 A;  4DSS A;  5IMZ A;  4P3Y B;  4AJ7 A;  1QFN A;  4PQH A;  2P0G A;  3TDG A;  3TKP A;  4O5Q A;  3IC8 A;  1GUM A;  3HY2 A;  1EV9 A;  2FCH A;  2F51 A;  1JLV A;  2REM A;  5KN0 A;  5D9W A;  5KN3 A;  4N3Z A;  1PRX A;  1IYH A;  1R7H A;  1EEJ A;  4G0L A;  2KUC A;  1SVM A;  4O7H A;  4NHZ A;  4IHU A;  1Z3E A;  1N2A A;  2VOC A;  3LGC A;  1GTA A;  20GS A;  4KH7 A;  3FK8 A;  3ZVJ A;  4NPB A;  1TP9 A;  3IPZ A;  3GV1 A;  5ECN B;  1YEX A;  1XW5 A;  1YJ6 A;  2F3M A;  3PPU A;  1EOH A;  4EO3 A;  5IPG A;  2IPA A;  3I69 A;  13GS A;  3HA9 A;  3F6D A;  1O8X A;  1C72 A;  2HSM B;  4AKI A;  3UEM A;  1O6J A;  4LMV A;  1GNW A;  2DIZ A;  1EOG A;  4F2I A;  4JR6 A;  5ABR A;  2OT3 A;  1R26 A;  4LA1 A;  1Y25 A;  2C3T A;  4IJI A;  1SD9 A;  3HDC A;  4KND A;  2H75 A;  3UVH A;  4K8M A;  1GL8 A;  4ILF A;  1R5P A;  3UAR A;  5CO3 A;  4K6X A;  3BCI A;  4MJB A;  3D22 A;  3LOR A;  1G6W A;  2IMF A;  2I81 A;  1GRX A;  4WEY A;  6GSY A;  1XXU A;  2DJK A;  5E59 A;  3TKS A;  1DUG A;  14GS A;  3LQ7 A;  1AQW A;  2DSA A;  16GS A;  2WJU A;  1HD2 A;  5DCH A;  1EP8 A;  2MBS A;  1T7P B;  2PVQ A;  2PPT A;  1PD2 1;  2X8H A;  2VL9 A;  2EFC A;  2B1K A;  3APS A;  1GSS A;  4A5P A;  5LNK e;  1GUK A;  3ERW A;  2O87 A;  1B4Q A;  1OC9 A;  4ULX A;  1SKR B;  4V1A g;  2YZU A;  3D6I A;  3FZ5 A;  4RQX A;  2HQT A;  2YPM A;  2V2G A;  1A2M A;  2JZS A;  1LBK A;  3UAP A;  4KCA A;  4FYC A;  4OO5 A;  1XZO A;  1HNA A;  2OA7 A;  1V9W A;  2HZE A;  5A4U A;  2X64 A;  4MMM A;  1A0F A;  3TJF A;  5ID2 A;  2RII A;  2HNL A;  4BWS A;  4YAV A;  2R0C A;  1CQH A;  5A5H B;  5KOX A;  3GIX A;  1TK5 B;  2UZ8 A;  2GZZ A;  3F8U A;  4POM A;  1CQG A;  1TRW A;  5COH A;  2YZH A;  4FYU A;  2PUK C;  2J23 A;  4AGS A;  4K7I A;  3APO A;  4PUR A;  3EPT A;  4XS4 B;  3UMA A;  2VLV A;  5EPF A;  3WT1 A;  3VLN A;  1ZYQ B;  3TU3 B;  2OBK A;  2YP6 A;  1BAY A;  1OE8 A;  3HD5 A;  3KTB A;  3OR5 A;  1A2J A;  2DJ0 A;  4KSO A;  5KN1 A;  2GTU A;  2HI7 A;  5EY6 A;  4HZ2 A;  4FYB A;  1YQ1 A;  1FVJ A;  3KH9 A;  4GWR A;  1PKW A;  5A1N B;  1X5E A;  1G7E A;  2FA4 A;  1O85 A;  3IHQ A;  1NM3 A;  3VWW A;  2MMO A;  1GSD A;  2C3N A;  2KOK A;  4ZB7 A;  4KX4 A;  2LKU A;  5D93 A;  5ECH B;  5JCW A;  1TXX A;  2GS3 A;  2LTK A;  6GSX A;  4MA9 A;  4JU5 A;  3IA1 A;  4KA0 A;  1B9X C;  3GST A;  1WOU A;  4Q5F A;  3QAW A;  4DSQ A;  2VD0 A;  4HOJ A;  1SL0 B;  2B7J A;  1AXD A;  2H8L A;  5DAK B;  2L5O A;  2QKE A;  4HQS A;  3F63 A;  1ERV A;  4K0G A;  2I4A A;  2H72 A;  3UL3 A;  3GX0 A;  5IMD A;  4KDX A;  1T3B A;  5B8A A;  3IAM 2;  4WXT A;  3LXT A;  4AI6 A;  2CV4 A;  5G30 A;  3D21 A;  3CRT A;  3M0F A;  3VPT A;  1BG1 A;  3QFA C;  1X9W B;  2WDU A;  2H73 A;  4K7O A;  4HJ2 A;  1MD4 A;  2PGT A;  4MF6 A;  2O85 A;  1A24 A;  3WT2 A;  3RBT A;  4NWY A;  4HU9 A;  5CRD A;  2HSM A;  1ZYN A;  4LL1 B;  3DYR A;  4WF4 A;  4GST A;  4E8E A;  2OAD A;  4X0X A;  2WUL A;  3IR4 A;  2LUS A;  1YKA A;  1U3I A;  2AHE A;  2FWG A;  2GDR A;  3HJO A;  4YH2 A;  3LEF A;  3LW9 A;  3D0Z A;  1O73 A;  1GSF A;  3H79 A;  3ZRE A;  4ICY A;  3KZQ A;  3H4K A;  6GSS A;  3ZL5 A;  2LQO A;  2VL2 A;  1HQO A;  3P8W A;  3WGE A;  5AIV A;  3U5R E;  1BYE A;  4OFT A;  5HR1 A;  3G7J A;  3F0I A;  4EVM A;  4ECI A;  3GA4 A;  4K9Z A;  1TI1 A;  2GT6 A;  5AGY A;  1BJX A;  5ECP B;  3VFI A;  1ZYE A;  1K0A A;  5LD0 A;  2FNO A;  1M2A A;  1SJI A;  1THX A;  3L9V A;  4IBP A;  3H1N A;  4ECC A;  1KTE A;  1Z7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...