4MP4A

Crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
212
structure length
198
Chain Sequence
EYFKLYTDSQFLSPYAFTVFVGLHEKQIPFEIAAIDLLTAKVPVLEHNDFALSESSAILEYLEELYPDTAIYPKDIQARARARQIQAWLRSDLVALRTERPTDVIFIQPKSTPLSEEGKKAAEKLFFVAEKLLASDAEFLFGSWSIVDAELALMLQRLIQNGDAVSERLKNYALQQWQRPSVQKWLALRHKAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of a glutathione transferase family member from Acinetobacter baumannii, Target EFI-501785, apo structure
rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
total genus 69
structure length 198
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mp4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mp4A01
2LRTA 3FR6A 4I2TA 1WOUA 4YQMA 2X8HA 3DMLA 1XWCA 4N10A 1VF4A 3ZMLA 3MSZA 5DQSA 1UC7A 1PX6A 5IMAA 3C8EA 1JLVA 2OBKA 2LKUA 4V1Ag 2CV4A 4G0KA 5H5SA 4G0IA 2C1YA 2MZCA 4J2FA 4K8MA 4PURA 2HSMA 4TW5A 4YQVA 2XPEA 19GSA 4QQ7A 5CP1A 1JZOA 4IP6A 2OJLA 3EU3A 1EOGA 5J9BA 2DIYA 1BYEA 1FG4A 3KTBA 5ABRA 5CRWA 3ME8A 4EDYA 1EP8A 2B5XA 3FZ5A 4G9HA 2GTUA 5F07A 2CQ9A 2B7JA 1V40A 2TRCP 1QFNA 3F9UA 1TRSA 1M2DA 2DMMA 3IDVA 3UIWA 1U6TA 4PNGA 4YQUA 2AHEA 4IQ1A 4NXIA 5DQYA 2N5FA 1K0AA 4KDUA 4ECBA 2IPAA 1O8WA 3LWAA 3CTGA 2MMAA 3E3EA 6GSXA 4KDYA 2H72A 1SKWB 1GSYA 3FYGA 1B8XA 3L4NA 1M0UA 6GSYA 1QUWA 1NHOA 4Q5RA 1XWBA 3IOSA 1AAZA 4L8EA 3F3QA 1NSWA 4F2IA 3U5RE 2AAWA 1RW1A 4OFMA 5IO2A 4DSSB 3GX8A 4AGSA 1WP0A 1ZMAA 2IWTA 2V2GA 2PU9C 3WGEA 1SL2B 2L5OA 1PQNA 1DE2A 4MZBA 4IBPA 1THXA 2L6DA 5B6MA 4OCEA 5B8AA 3KZQA 3TUEA 2DC5A 3F4SA 2PUKC 3IK7A 4IVFA 1OE8A 2H76A 3Q74A 1T4ZA 3DVXA 5DCHA 1XVWA 4AF2A 1PGTA 3MNGA 2CAQA 2R6KA 3PR8A 5DCGA 4MH2A 3UBLA 2QC7A 4LL4B 4KW6A 1QQ2A 1FOVA 3P90A 4EC0A 3Q18A 4MP4A 3LEFA 4MA9A 2PVOC 1QMVA 2RUEA 1VF3A 1JFUA 11GSA 5KN0A 3QAVA 2LTKA 2WGRA 3E0UA 2IL3A 3BOAA 4OO5A 3IBHA 2K6VA 3W6GA 3M9KA 4GWRA 2DJ1A 3F3RA 3IC8A 2B1LA 3ZRDA 2GSTA 2I3YA 4H86A 2GSRA 1JZRA 1BJXA 4F82A 5ECLB 1Z6MA 2VL2C 3CRTA 3TRXA 5JCUA 3PINA 4JR4A 3C1SA 2LQOA 2IMEA 5J4UA 1OYJA 1TRUA 3APQA 1SENA 1XWKA 4LL1B 3CSIA 2NVLA 1O7UA 1GRXA 5EY6A 1JZWA 1O85A 3G7JA 4OCFA 2C3NA 3G7YA 3LSZA 5JCGA 4X43A 1F9MA 1K0BA 2GSQA 2GLRA 1Y25A 2B1KA 3M9JA 2WZ9A 5J3RA 3LYKA 5AIVA 4DEJA 2DJ2A 4OFNA 2FLSA 1GTAA 5HFGA 3O6TA 1JLWA 3HKRA 3WGXA 4MLYA 1GTUA 3EE2A 3FEUA 2MMOA 1OKTA 1MDIA 2IIYA 3UBKA 2ZNMA 4ZL8A 3L9UA 5ECNB 5CRDA 3APOA 3LXZA 4BWQA 1EGOA 5ID2B 1BEDA 2YJ7A 1T3BA 4P3YB 3QR6A 4OO4A 1SL1B 4OD7A 3GTUB 5CRGA 2P5QA 4ZBAA 4MF7A 1SJIA 2I4AA 2H73A 2C8UA 3APSA 1W4VA 1WJKA 3IHQA 2FD3A 1FB0A 4RI6A 5L71A 4HZ4A 1OC9B 3IRAA 4ZL7A 1FHEA 1ERUA 13GSA 1KBNA 3MDKA 4KUNA 5DVBA 1FAAA 3L78A 3J7Yk 5HR0A 3A2VA 2I81A 1M2AA 2V1MA 3HYPA 2KOKA 4XIHA 4JU5A 3DGQA 1YF0A 1H4OA 2B6MA 4V2NA 1ERWA 2O85A 1MTCA 3ED3A 3QOUA 2K18A 1GH2A 1Z3EA 4AJ7A 2H1GA 4XS4A 5AISA 4EF0A 3Q6OA 3GHAA 4V2MA 5LD0A 4MCUA 3P8WA 3BCKA 1GL8A 1GUHA 4K2DA 3GURA 2B3SA 1K0MA 4WR4A 1EWXA 1GSFA 2TRXA 1X9SB 1TOFA 2K8VA 2V41A 2P31A 6GSTA 4ZB9A 2H19A 4EE0A 1KEBA 5LNKe 1J08A 4KDXA 1PD21 1Z9HA 1FB6A 4MZCA 1F2EA 2YNXA 4FYBA 5B7CA 1HNAA 5ECPB 1XW5A 4MDCA 1URMA 4Z7XA 5ECHB 1XW9A 3WT2A 5LCZA 3TKSC 5IPHA 3IAS2 3GH9A 2CX4A 5JWOB 1EEMA 2H0HA 2GT5A 2F8AA 1B4QA 1R26A 3VWXA 1S3CA 3UAPA 1XVQA 3J7Yb 1Z5YE 2LNTA 2H6ZA 2H0IA 2E2GA 2H8LA 2HXKA 1HNCA 1A23A 3ZL5A 4I5QA 1ST9A 4IJ3A 1TU8A 5JCWA 2PBJA 5D9VA 2FWEA 5C04A 1XW6A 1DE1A 5ECOB 3F4TA 1C72A 1WWJA 3F4RA 4LMWA 4MH3A 4EUYA 2OACA 4EKZA 4BPYA 4G2EA 4XCSA 2C3TA 1GSEA 3GTUA 3CYNA 4K1FA 1EV4A 3O3TA 2A4VA 4TVEA 3HHVA 4TXOB 4NHWA 2B5EA 2H74A 3EC3A 4ZIJA 2BTOT 2LJRA 4N0VA 3GX0A 4ZILA 4GSTA 4F0BA 1M9BA 4HZ2A 1KNGA 4XRDA 5INYA 1V98A 4XRAA 1ZL9A 5JWQB 3EMXA 1X5EA 1A2JA 2H0GA 3M0FA 5DAKA 1OC9A 2C0DA 5C00A 5GZZB 4CHSA 2CAIA 5IMFA 3CRUA 4LMVA 3IC4A 4FIWA 3ISOA 2JZSA 5G30A 1F3AA 1PL2A 2K9FA 3IR4A 3LFLA 1E2YA 1YQ1A 4WF4A 3HJMA 3V1WA 4PX1A 4IW9A 1SD9A 1TU7A 2HNLA 3L9SA 1M7TA 3ZVJD 1TXXA 3PH9A 3GSSA 2WRTA 3CXGA 3FHKA 2M72A 1GULA 2OE0A 4X1UA 4ILFA 3ZIJA 1Z7PA 3RPNA 3C7MA 3IK9A 2H01A 4D73B 1SYRA 1ABAA 3UVHA 2AJQB 3TGZA 1NW2A 2F9SA 1ERTA 1B9YC 2R3XA 3QDNA 3ZLPA 4ZB8A 2A2SA 1ACVA 3GYKA 3ZREA 2GZYA 1T4YA 2IFQB 3DXBA 5AGYA 1AC1A 4JE1A 2C3QA 4O5RA 2YWOA 3KGKA 1DUGA 2QGVA 1FO5A 4TR1B 3HDCA 1ILOA 2DBCA 3TJJA 5HR1A 2AYTA 4MJBA 1K3LA 3JCML 3D4TA 3EWLA 4TXVA 2PVQA 1SYXA 1TI3A 1GUMA 3VURA 3WGDA 1EV9A 3GV1A 4FYUA 3CMIA 1E6BA 2HRAA 1TKDB 2LRNA 1ZOFA 2VIMA 2YCDA 1JZDA 1ZZYA 2LEGA 3UARA 8GSSA 1LJRA 1SK0A 3DRNA 4YAVA 3GSTA 2KUCA 5IQYA 4TR4A 1G6WA 2FUG2 5DJLA 5ELAA 2YZHA 3H79A 1V2AA 5ECIB 1F3BA 1YF1A 1K3YA 3CTFA 1ML6A 2VUPA 2YV9A 4TXOA 3QAWA 3VWVA 1KTEA 3FK8A 3RHCA 4FO5A 2GSSA 3FZ9A 6GSVA 2H66A 2H6YA 1EEJA 3FKFA 1T7PB 4F0CA 1A8YA 3GUSA 3L9VA 1B9XC 5HR2A 4ISDA 1TTZA 2P0GA 5GSTA 2GQKA 3ZYWA 4HJMA 1V58A 3N9JA 5IO0A 2GGTA 2J23A 4KGIA 3WD6A 1U3IA 4ZB6A 2VCWA 4I6XA 3QD9A 4ECJA 4AJ6A 5J41A 1QGVA 1K0OA 3HZ8A 2BMXA 5IMDA 1O81A 1SJ6A 1GSQA 2MBTA 1SKSB 1WRYA 3BD2A 1PMTA 4IP1A 2AUVA 5G5EA 4GLTA 5CREA 3QFBC 3OR5A 1V57A 3DYRA 2LNSA 4MF5A 5H5RA 4D73A 2JSYA 1IYIA 2X8GA 2HSYA 2XBQA 2PGTA 1N8JA 3DEXA 4WETA 1TW9A 1YEPA 1YZXA 2VCQA 2PWJA 4MPFA 2IMFA 3RAZA 5CNWA 1ZYQB 6GSSA 2ES7A 2RM5A 3VK9A 5EVOA 1TRWA 2IFQA 4J57E 4TOPA 4XS4B 2HRKB 3LXTA 4WF5A 4LLRA 4GF0A 4G10A 2PN8A 5D96A 2YOIA 2VD1A 4GQCA 4KSMA 3GIXA 1G7EA 4TR1A 1A2LA 4G0LA 1PL1A 4IHUA 3VI7A 5A4VA 1R7HA 4GSNA 4ECCA 4KH7A 4TKYA 3SBCA 4HUAA 2JU5A 1T8EB 1XBSA 1O8XA 5D9WA 3KP9A 2CZ2A 3F63A 3GKKA 4L5LA 2YP6A 1OVNA 5KEJA 1VF1A 3F6FA 3LORA 4NPBA 4QL7A 4HOJA 4K7IA 4CDOA 1Q4JA 3M8NA 4BA7A 2IJYA 4K0NA 2JSZA 4BWSA 3WT1A 3G7IA 3UOMA 2HFDA 2XC2A 3HY2A 2YANA 5A4WA 3TOUA 1GTIA 4WBJA 4N30A 4HDEA 1G7OA 5G1KA 12GSA 2WS2A 3TJKA 3LQ7A 1X5DA 1MDKA 3HA9A 4CW9A 1MEKA 4XS1A 2PMTA 4POMA 1GWCA 2GZZA 2V6KA 2XHFA 1TJDA 2HI7A 3O76A 3H1NA 2B5YA 1VRSD 2OADA 5ENUA 3EMPA 1XCCA 2AV4A 2GQLA 2YWMA 4Q5FA 5F06A 1TK8B 1OAZA 2FA4A 1GLPA 2F51A 3ZIVA 1XOAA 2FCHA 3HVVA 2R5GA 2HZEB 2FY6A 2LJAA 22GSA 1XPVA 3GKNA 17GSA 4FH8A 1B4PA 1YY7A 4WXTA 2J9HA 1PKWA 5DAKB 4ZBBA 4NV5A 3A2WA 20GSA 4KA0A 4NV2A 3GA4A 4WBRD 3E9JB 2RUFA 2GT6A 3HJOA 2KP2A 2E7PA 1GUKA 1YDKA 3TJBA 4EVMA 3PPUA 1G0TA 2FGXA 4JZQA 5D73A 2PERA 5F0GA 1CQGA 2HRKA 2OBIA 1RK4A 2H1AA 5E59A 3KEBA 3NOFA 5KN3A 1GSUA 4MJAA 1ON4A 4I8BA 5FWGA 2L5LA 4L5OA 4L0WA 3KXOA 1G6YA 5DBQA 1NM3A 3W8SA 1K3OA 2H6XA 1OC3A 2JZTA 1MD4A 5D93A 5JWRB 3C73A 1WMJA 1W89A 1GLQA 1AXDA 5EL8A 1HQOA 1GSDA 1PKZA 3R3EA 3TCOA 1RQMA 1F37A 2DJ0A 2FA8A 3KM6A 2G0FA 4FYCA 4HJ2A 1NHYA 1O6JA 4HQZA 2C80A 2ON7A 2FWGA 3DIEA 1U88A 2VLVA 2VL9A 2H1BA 7GSSA 1AUCA 3DKSA 4KCAA 3EINA 2EIQA 2VL3A 2X99A 4O92A 10GSA 2HSNB 3QPMA 1PSQA 1B48A 1XWGA 3UEMA 5CRHA 3VLNA 2KLXA 1WIKA 2PPTA 2LS5A 2FWHA 4YAPA 1BQ7A 4XS6A 4GSSA 2WULA 2H70A 2CA8A 3EU4A 1THOA 3US3A 3CSHA 2VLUA 3TKQA 4HU7A 3IE3A 3ERFA 1SK2A 1BAYA 3UJ1A 2LJKA 2VAFA 1K0DA 3I9V2 1BX9A 2HE3A 4KX4A 4MABA 4HU9A 3TOTA 1ZGNA 2K8SA 2MMZA 2HZEA 2WB9A 2LQQA 4V1Ap 3S9FA 4KCEA 5DALA 1A0RP 4GCIA 4RUVA 2WFCA 4F03A 5G2ZA 3IV4A 5HFKA 5B8BA 3GL3A 2VOCA 1TI1A 3TKPA 3A2XA 3KJYA 1PX7A 4JBBA 1XXUA 2RIIA 4MZWA 3SWLA 4BL7A 2VM2A 2TIRA 1XFLA 1J9BA 1K0NA 5HFIA 4AJ8A 3HJPA 4PQ1A 1FVKA 3ZMKA 1UVZA 3TKRA 2GQMA 3M1GA 3R2QA 1OC8A 2L57A 1XOBA 3FZAA 2G2QA 4K6XA 3QCPA 16GSA 2BJXA 1AQXA 2VCZA 1GNWA 4ZXGA 1Z7RA 2MMNA 1UA5A 4WR5A 2NPBA 3TJGA 2KHPA 1A8LA 1HYUA 3I69A 1OE7A 2EIRA 6GSWA 1AIUA 3KIJA 4DSQA 4K7NA 3D22A 3D5JA 1M2BA 1QXHA 3EURA 4XHMA 3D0ZA 3BCIA 1A2MA 2CVDA 1X0RA 1TK5B 1USBA 2YWIA 3A3TA 3GL5A 5IM9A 3KCMA 1R5AA 5G1LA 2LV3A 2F8FA 1YJ6A 1DBYA 5J9CA 2OKAA 4K7OA 2CZ3A 3PGTA 2VCXA 3KMNA 1FVJA 2I9HA 4JEDA 4OFTA 1U87A 1I9DA 4POKA 1HD2A 5A4UA 4TN8A 2E2MA 5GAND 1X9WB 1TRVA 2IMDA 5G31A 5D8IA 2DLXA 2CVBA 4HS1A 1I5GA 2NDOA 5IMVA 2P5RA 3GH6A 3K8NA 1AQWA 3ERGA 4HI7A 5D9TA 3GN3A 1XIYA 1SJZA 2M46A 1MD3A 4YH2A 2X8CA 4GRFA 2I1UA 1YEXA 4ZBDA 1SK1A 4IN0A 3LJRA 2OE3A 3HVSA 2NBSA 4GQFA 1YKCA 4ML6A 3C71A 5HR3A 5CYYA 4N11A 3IA1A 3HVXA 3FR3A 1ZCPA 2LUSA 2VL2A 4PQHA 4BVYA 5IIZA 4IQAA 1ERVA 2EIOA 4USSA 5E4WA 2VD0A 1H75A 2N5BA 3EYTA 3VWUA 2DSAA 4O32A 4IGJA 2YV7A 1GTBA 2YJHA 4IJIA 2WDUA 3GKXA 2XBIA 3IXRA 1K0CA 5J5NA 1F6MC 1V9WA 3W8JA 4KSOA 4PQIA 4NWYA 4POLA 4PUAA 1DSBA 4K0GA 5B6NA 3VI5A 2JL4A 4MK3A 3TDGA 2HRNA 3F8UA 2C4JA 2R4VA 2FWFA 3KH7A 4OWYA 4BVXB 5ELGA 3RPPA 4WKWA 1M99A 3IPZA 2HQTA 2CX3A 3KH9A 2DJKA 2YZUA 4ML1A 2X64A 1GNEA 4PXOA 1SKRB 3ZZXA 4E8EA 2O7KA 3TKSE 3BJ5A 1R5PA 3P7XA 2IN3A 2XPDA 4LA1A 1OKDA 2R2JA 1J0FA 2CVKA 1GP1A 3D6IA 3ZVJA 1GSSA 3F0IA 2GS3A 3LGCA 2WCIA 4ACSA 5GAPD 5F8BA 4KB3A 3M3MA 5IPGA 3ME7A 3MAKA 1UN2A 4MJCA 4RQXA 4RI7A 5AIXA 2F3MA 2IMKA 1A24A 2V32A 1CQHA 2KP1A 3ZFLA 3DD3A 3UL3A 5KN1A 1TK0B 5BMUA 3HXSA 1SL0B 2DIZA 1IYHA 5F05A 2GVPA 3C1RA 4XTSA 1LU4A 3U6VA 5IMZA 3VFIA 2VCTA 4KNDA 2L6CA 4IS0A 4MPGA 2VLTA 3G9BA 4F9ZA 4O7HA 2OA7A 5CO3A 3KD0A 1SU9A 4TR0A 4GTUA 5HQPA 5EPFA 2REMA 5A5KA 2WJUA 3DWVA 3KTLA 2ALBA 3HZ4A 1VF2A 3Q19A 5GSSA 2L4CA 3VPTA 1Z6NA 2CT6A 2HRFA 4DSSA 3H93A 4Q5QA 1PRXA 2H1DA 5AN1A 3H4KA 2O8VB 3D21A 4TRXA 1LBKA 3RBTA 3AY8A 3TB2A 2A2RA 1TDIA 1ZYEA 2HSHA 2IMIA 3P2AA 5FHIA 4J56E 3FW2A 14GSA 3IAM2 3TKSA 3LG6A 2GZPA 1T1VA 2ZCTA 5DALB 2YN1A 4JR6A 2DMLA 3GKMA 6GSUA 2N5AA 2MYGA 4E8HA 2AB6A 2JACA 2OE1A 3GFKA 4BVXA 1Q98A 3QAGA 3ZTLA 1A0FA 2UZ8A 3HD5A 3RHBA 2O89A 4K9ZA 2M80A 3A5WA 4BL7B 4DVCA 4Q5NA 1PN9A 2MBSA 1MDJA 3I6AA 3RDWA 4N0ZA 3CBUA 4OMVA 1HNBA 3GRXA 1R4WA 2V6OA 4ID0A 5IOWA 3TJFA 2FNOA 2C0FA 1YKAA 2R37A 1X9MB 3NZNA 1BG5A 5D9XA 2B7KA 9GSSA 4I97A 4NHZA 1XZOA 4DSRA 1XWAA 2HYXA 3VWWA 1TP9A 3UVTA 2HT9A 3GNJA 3D4MA 3ERWA 3ZITA 3DVWA 4MF6A 1S3AA 2YWNA 1X5CA 2HLSA 3LYPA 4PNFA 5CAXA 1U3AA 2HSMB 2C0EA 2L59A 1WE0A 1EZKA 2H75A 2RM6A 4MJEA 4PUFC 4TR3A 3TRPA 3I43A 4EDZA 5IMCA 5ECSA 3FZ4A 2QKEA 3BBYA 2YPMA 2RLIA 1Y6EA 2HZFA 4POBA 4WEYA 4L0UA 2FHEA 4HQSA 1SD8A 3EVIA 5COHA 2DJ3A 3L0HA 3H8QA 3CSJA 2H71A 5G5FA 4KF9A 1N2AA 3QMXA 4I2UA 4IKHA 4QL9A 2L4QA 2VO4A 3FR9A 2VCVA 4ULXA 5DJMA 4EO3A 5ECQB 4NMUA 4FQUA 1M9AA 3QFAC 2VM1A 4X0XA 4EXJA 3TRQA 5H5QA 3FRCA 3HCZA 1AW9A 4V2LA 3KP8A 5ECMB 2ZUPA 4RQRA 4PGTA 4IELA 5ID2A 2NTOA 2E0QA 2JADA 1PA3A 18GSA 2EC4A 2O87A 1FW1A 2LRCA 4HEA2 1WPIA 4GXZA 3MWHA 3WYWA 2JZRA 4KE3A 4JRRA 3KMOA 3NIVA 5ECKB 2ON5A 4ZL9A 3ZFBA 2QSIA 1QK8A 5IOXA 4BVYB 4NAXA 4EL1A 1AQVA 1O73A 2Z9SA 3F6DA 3FY7A 1VGLA 1EP7A 3GMFA 2LSTA 5FT3A 5KN2A 1EOHA 3UMAA 5DDLA 5ECRB 2D2ZA 4KAEA 2GDRA 4MMMA 1S3DA 2H30A 3N5OA 1JHBA 2DJJA 4ECIA 1T00A 3VPQA 4PTSA 4G19A 2C0GA 1EGRA
chains in the Genus database with same CATH superfamily
2LRTA 3FR6A 4I2TA 1WOUA 4YQMA 2X8HA 3DMLA 1XWCA 4N10A 4AKGA 1VF4A 3ZMLA 3MSZA 5DQSA 1UC7A 1PX6A 3FMWA 5IMAA 3C8EA 1JLVA 2OBKA 2LKUA 4V1Ag 2CV4A 4G0KA 5H5SA 4G0IA 2C1YA 2MZCA 4J2FA 4K8MA 1S3RA 4PURA 2HSMA 4TW5A 4YQVA 2XPEA 19GSA 4QQ7A 5CP1A 1JZOA 4IP6A 2OJLA 3EU3A 1EOGA 5J9BA 2DIYA 1BYEA 1FG4A 3KTBA 5ABRA 5CRWA 3ME8A 4EDYA 1EP8A 3LW9A 2B5XA 3FZ5A 4G9HA 2GTUA 5F07A 5A5HA 2CQ9A 4K2XA 2B7JA 1V40A 2TRCP 1QFNA 3F9UA 1TRSA 1M2DA 2DMMA 3IDVA 3UIWA 1U6TA 4PNGA 4YQUA 2AHEA 4IQ1A 4NXIA 5DQYA 2N5FA 1K0AA 4KDUA 4ECBA 2IPAA 1O8WA 3LWAA 3CTGA 2MMAA 3E3EA 6GSXA 4KDYA 2H72A 1SKWB 1GSYA 4HSCX 3FYGA 1B8XA 3L4NA 1M0UA 6GSYA 1QUWA 4PHZC 1NHOA 4Q5RA 1XWBA 2X4AA 3IOSA 1AAZA 2WVYA 4L8EA 3F3QA 1NSWA 4F2IA 3U5RE 2AAWA 1RW1A 4OFMA 5IO2A 4DSSB 3GX8A 4AGSA 1WP0A 1ZMAA 2IWTA 2V2GA 2PU9C 3WGEA 1SL2B 2L5OA 1PQNA 1DE2A 4MZBA 4IBPA 1THXA 2L6DA 5B6MA 4OCEA 5B8AA 3KZQA 3TUEA 2DC5A 3F4SA 2PUKC 3IK7A 4IVFA 1OE8A 2R0CA 2H76A 3Q74A 1T4ZA 3DVXA 5DCHA 1XVWA 4AF2A 1PGTA 3MNGA 3CWGA 3HMJG 2CAQA 2R6KA 3PR8A 5DCGA 4MH2A 3UBLA 2QC7A 4LL4B 4KW6A 1QQ2A 1FOVA 3P90A 4EC0A 4BIKA 3Q18A 4MP4A 3LEFA 4MA9A 1S4BP 2PVOC 1QMVA 2RUEA 1VF3A 1JFUA 11GSA 5KN0A 3QAVA 2LTKA 2WGRA 3E0UA 2IL3A 3BOAA 4OO5A 3IBHA 2K6VA 3W6GA 3M9KA 4GWRA 2WW0A 2DJ1A 3F3RA 3IC8A 2B1LA 3ZRDA 2GSTA 2I3YA 4H86A 2GSRA 1JZRA 1BJXA 4F82A 5ECLB 1Z6MA 2VL2C 3CRTA 3TRXA 5JCUA 3PINA 4JR4A 3C1SA 2LQOA 2IMEA 5J4UA 1OYJA 1TRUA 3APQA 1SENA 1XWKA 4LL1B 3CSIA 2NVLA 4G01A 1O7UA 1GRXA 5EY6A 1JZWA 1O85A 3G7JA 4OCFA 2C3NA 3G7YA 3LSZA 5JCGA 4X43A 1F9MA 1K0BA 2GSQA 2GLRA 1Y25A 2B1KA 3M9JA 2WZ9A 5J3RA 3LYKA 5AIVA 4DEJA 2DJ2A 4OFNA 2FLSA 1GTAA 5HFGA 3O6TA 1JLWA 3HKRA 3WGXA 2WW1A 4MLYA 1GTUA 3EE2A 3FEUA 2MMOA 2EFCA 1OKTA 1MDIA 2IIYA 3UBKA 2ZNMA 4ZL8A 3L9UA 5ECNB 5CRDA 3APOA 3LXZA 4BWQA 1EGOA 5ID2B 2WZSA 1BEDA 2YJ7A 1T3BA 4P3YB 3QR6A 4OO4A 1SL1B 4OD7A 3GTUB 1BG1A 5CRGA 2P5QA 2A4HA 4ZBAA 4MF7A 1SJIA 2I4AA 2H73A 2C8UA 3APSA 1W4VA 1WJKA 3IHQA 2FD3A 1FB0A 4RI6A 5L71A 4HZ4A 1OC9B 3IRAA 4ZL7A 1FHEA 1ERUA 13GSA 1KBNA 3MDKA 4KUNA 5DVBA 1FAAA 3L78A 3J7Yk 5HR0A 3A2VA 2I81A 1M2AA 2V1MA 3HYPA 2KOKA 4XIHA 4JU5A 3DGQA 1YF0A 1H4OA 2B6MA 4V2NA 1ERWA 2O85A 1MTCA 3ED3A 3QOUA 4A5PA 4GDFA 2K18A 4AKHA 1GH2A 1Z3EA 4AJ7A 2H1GA 4XS4A 5AISA 4EF0A 3Q6OA 3GHAA 4V2MA 5LD0A 4MCUA 3P8WA 3BCKA 1GL8A 1GUHA 4K2DA 3GURA 2B3SA 1K0MA 4WR4A 1EWXA 4AKIA 1GSFA 2TRXA 1X9SB 1TOFA 2K8VA 3EPTA 2V41A 2P31A 6GSTA 4ZB9A 2H19A 4EE0A 1KEBA 5LNKe 1J08A 4KDXA 1PD21 1Z9HA 1FB6A 4MZCA 1F2EA 2YNXA 4FYBA 5B7CA 1HNAA 5ECPB 1XW5A 4MDCA 1URMA 4Z7XA 5ECHB 1XW9A 3WT2A 5LCZA 3TKSC 5IPHA 3IAS2 3GH9A 2CX4A 5JWOB 1EEMA 2H0HA 2GT5A 2F8AA 1B4QA 1R26A 3VWXA 1S3CA 3UAPA 1XVQA 3J7Yb 1Z5YE 2LNTA 2H6ZA 2H0IA 2E2GA 2H8LA 2HXKA 1HNCA 2WVXB 1A23A 3ZL5A 4I5QA 1ST9A 4IJ3A 1TU8A 5JCWA 2PBJA 5D9VA 2FWEA 5C04A 1XW6A 1DE1A 5ECOB 3F4TA 1C72A 1WWJA 3F4RA 4LMWA 4MH3A 4EUYA 2OACA 4EKZA 4BPYA 4G2EA 4XCSA 2C3TA 1GSEA 3GTUA 3CYNA 4K1FA 1EV4A 3O3TA 2A4VA 4TVEA 1SVLA 3HHVA 4TXOB 4NHWA 2B5EA 2H74A 3EC3A 4ZIJA 2BTOT 2LJRA 4N0VA 3GX0A 4ZILA 4GSTA 4F0BA 5KOWA 1M9BA 4HZ2A 1KNGA 4XRDA 5INYA 1V98A 4XRAA 1ZL9A 5JWQB 3EMXA 1X5EA 1A2JA 2H0GA 3M0FA 5DAKA 1OC9A 2C0DA 5C00A 5GZZB 4CHSA 2CAIA 5IMFA 3CRUA 4LMVA 3IC4A 4FIWA 3ISOA 2JZSA 5G30A 1F3AA 1PL2A 2K9FA 3IR4A 5J40A 3LFLA 1E2YA 1YQ1A 3CHXC 4WF4A 3HJMA 3V1WA 4PX1A 4IW9A 1SD9A 1TU7A 1TXUA 2HNLA 3L9SA 1M7TA 3ZVJD 1TXXA 3PH9A 3GSSA 2WRTA 3CXGA 3FHKA 2M72A 1GULA 2OE0A 4X1UA 4ILFA 5J47A 4Z2TA 3ZIJA 1Z7PA 3RPNA 3C7MA 3IK9A 2H01A 4PI2C 4D73B 1SYRA 2WW3A 1ABAA 3UVHA 2AJQB 3TGZA 1NW2A 2F9SA 1ERTA 1B9YC 2R3XA 3QDNA 3ZLPA 4ZB8A 2A2SA 1ACVA 3GYKA 3ZREA 2GZYA 1T4YA 2IFQB 3DXBA 5AGYA 1AC1A 4JE1A 2C3QA 4O5RA 2YWOA 3KGKA 1DUGA 2QGVA 1FO5A 4TR1B 3HDCA 1ILOA 2DBCA 3TJJA 5HR1A 2AYTA 4MJBA 1K3LA 3JCML 3D4TA 3EWLA 4TXVA 2PVQA 1SYXA 1TI3A 1GUMA 3VURA 3WGDA 1EV9A 3GV1A 4FYUA 2WVXA 3CMIA 1E6BA 2HRAA 1TKDB 2LRNA 1ZOFA 2VIMA 2YCDA 1JZDA 1ZZYA 2LEGA 3UARA 8GSSA 1LJRA 1SK0A 3DRNA 4YAVA 3GSTA 2KUCA 5IQYA 4TR4A 1G6WA 2FUG2 5DJLA 5ELAA 2YZHA 3H79A 1V2AA 5ECIB 1F3BA 5J4VA 1YF1A 1K3YA 3CTFA 1ML6A 2VUPA 2YV9A 4TXOA 3QAWA 3VWVA 1KTEA 3FK8A 3HVNA 3RHCA 4FO5A 2GSSA 1BF5A 3FZ9A 6GSVA 2H66A 2H6YA 1EEJA 3FKFA 1T7PB 4F0CA 1A8YA 3GUSA 3L9VA 1B9XC 5HR2A 4ISDA 1TTZA 2P0GA 5GSTA 2GQKA 3ZYWA 4HJMA 1V58A 3N9JA 2R0GA 5IO0A 2GGTA 2J23A 4KGIA 3WD6A 1U3IA 4ZB6A 2VCWA 4I6XA 3QD9A 4ECJA 4AJ6A 5J41A 1QGVA 1K0OA 3HZ8A 4FXYP 2BMXA 5IMDA 1O81A 1SJ6A 1GSQA 2MBTA 1SKSB 1WRYA 3BD2A 1PMTA 4IP1A 2AUVA 5G5EA 4GLTA 5CREA 3QFBC 3OR5A 1V57A 3DYRA 1XG8A 2LNSA 4MF5A 5H5RA 4D73A 2JSYA 1IYIA 2X8GA 2HSYA 2XBQA 2PGTA 1N8JA 3DEXA 4WETA 1TW9A 1YEPA 1YZXA 2IMFA 2PWJA 2VCQA 4MPFA 3RAZA 5CNWA 1ZYQB 6GSSA 2ES7A 2RM5A 4QMKA 3VK9A 5EVOA 1TRWA 4ZB7A 2IFQA 4J57E 4TOPA 4XS4B 2HRKB 3LXTA 4WF5A 4LLRA 4GF0A 4G10A 2PN8A 5D96A 2YOIA 2VD1A 4GQCA 4KSMA 3GIXA 1G7EA 4TR1A 1A2LA 1PN0A 4G0LA 1PL1A 4IHUA 3VI7A 5A4VA 1R7HA 4GSNA 4ECCA 4KH7A 4TKYA 3SBCA 4HUAA 2JU5A 1T8EB 1XBSA 1O8XA 2EFHA 5D9WA 3KP9A 2CZ2A 3F63A 3GKKA 4L5LA 2YP6A 1OVNA 5KEJA 1VF1A 3F6FA 3LORA 4NPBA 2DKIA 4QL7A 4HOJA 4K7IA 4CDOA 1Q4JA 3M8NA 4BA7A 2IJYA 4K0NA 2JSZA 4BWSA 3WT1A 3G7IA 3UOMA 2HFDA 2XC2A 3HY2A 2YANA 5A4WA 3TOUA 1GTIA 4WBJA 4N30A 4HDEA 1G7OA 5G1KA 12GSA 2WS2A 4K5RA 3TJKA 3LQ7A 1X5DA 1MDKA 3HA9A 4CW9A 1MEKA 4XS1A 2PMTA 4POMA 1GWCA 2GZZA 2V6KA 2XHFA 1TJDA 2HI7A 3O76A 3H1NA 2B5YA 1VRSD 2OADA 5ENUA 3EMPA 1XCCA 2AV4A 2GQLA 2YWMA 4Q5FA 5F06A 1TK8B 1OAZA 2O3EA 2FA4A 1GLPA 2F51A 3ZIVA 1XOAA 2FCHA 3HVVA 5KOXA 2R5GA 2HZEB 2FY6A 2LJAA 22GSA 1XPVA 3GKNA 17GSA 4FH8A 4PI0C 1B4PA 1YY7A 4WXTA 2J9HA 1PKWA 5DAKB 4ZBBA 4NV5A 3A2WA 1ZYPA 20GSA 4KA0A 4NV2A 3GA4A 4WBRD 3E9JB 2RUFA 2GT6A 3HJOA 3MYDA 2KP2A 2E7PA 1GUKA 1YDKA 3TJBA 4EVMA 3PPUA 1G0TA 2FGXA 4JZQA 5D73A 2PERA 1PFOA 5F0GA 1CQGA 2HRKA 2OBIA 1RK4A 2H1AA 5E59A 3KEBA 3NOFA 5KN3A 1GSUA 4MJAA 1ON4A 4I8BA 5FWGA 2L5LA 4L5OA 4L0WA 3KXOA 2OT3A 1G6YA 5DBQA 1NM3A 3W8SA 1K3OA 2H6XA 5BRTA 1OC3A 2JZTA 1MD4A 5D93A 5JWRB 3C73A 1WMJA 1W89A 1GLQA 1AXDA 4W66A 5EL8A 1HQOA 1GSDA 1PKZA 3R3EA 3TCOA 1RQMA 1F37A 2DJ0A 2FA8A 3KM6A 2G0FA 4FYCA 4HJ2A 1NHYA 1O6JA 4HQZA 2C80A 2ON7A 2FWGA 3DIEA 1U88A 4AI6A 2VLVA 2VL9A 2H1BA 7GSSA 1AUCA 3DKSA 4KCAA 3EINA 2EIQA 2VL3A 2X99A 4O92A 10GSA 2HSNB 3QPMA 1PSQA 1B48A 1XWGA 3UEMA 5CRHA 3VLNA 2KLXA 1WIKA 4CY8A 2PPTA 2LS5A 4CY6A 2FWHA 4YAPA 1BQ7A 4XS6A 4GSSA 2WULA 2H70A 2CA8A 3EU4A 1THOA 3US3A 3CSHA 2VLUA 3TKQA 4HU7A 3IE3A 3ERFA 1SK2A 1BAYA 3UJ1A 2LJKA 2VAFA 1K0DA 3I9V2 1BX9A 2HE3A 4KX4A 4MABA 4HU9A 3TOTA 1ZGNA 2K8SA 2MMZA 2HZEA 2WB9A 2LQQA 4V1Ap 3S9FA 4KCEA 5DALA 1A0RP 4GCIA 4EIQA 4RUVA 2WFCA 4F03A 5G2ZA 3IV4A 5HFKA 5B8BA 3GL3A 2VOCA 1TI1A 3TKPA 3A2XA 3KJYA 1PX7A 4JBBA 1XXUA 2RIIA 4MZWA 3SWLA 4BL7A 2VM2A 2TIRA 1XFLA 1J9BA 1K0NA 5HFIA 4AJ8A 3HJPA 4PQ1A 1FVKA 3ZMKA 1UVZA 3TKRA 2GQMA 3M1GA 3R2QA 1OC8A 2L57A 1XOBA 3FZAA 2G2QA 4K6XA 3QCPA 16GSA 2BJXA 1AQXA 2VCZA 1GNWA 4ZXGA 1Y1UA 1Z7RA 2MMNA 1UA5A 4WR5A 2NPBA 3TJGA 2KHPA 1A8LA 1HYUA 3I69A 4EIPA 4YKGA 1OE7A 2EIRA 6GSWA 1AIUA 3KIJA 4DSQA 3D22A 3D5JA 4K7NA 1M2BA 1QXHA 3EURA 4XHMA 3D0ZA 3BCIA 1A2MA 2CVDA 3RGBC 1X0RA 1TK5B 1USBA 2YWIA 3A3TA 3GL5A 5IM9A 3KCMA 5J4YA 1R5AA 5G1LA 2LV3A 2F8FA 1YJ6A 1DBYA 5J9CA 2OKAA 4K7OA 2A2PA 2CZ3A 3PGTA 2VCXA 3KMNA 2HSNA 1FVJA 2I9HA 4JEDA 4O5UA 4OFTA 1U87A 1I9DA 4POKA 1HD2A 5A4UA 4TN8A 2E2MA 5GAND 1X9WB 1TRVA 2IMDA 5G31A 4K5SA 5D8IA 2DLXA 2CVBA 3CQFA 4HS1A 1I5GA 2NDOA 5IMVA 5BMUB 2P5RA 3GH6A 3K8NA 1AQWA 3ERGA 4HI7A 5D9TA 1YVLA 3GN3A 1XIYA 1SJZA 2M46A 1MD3A 4YH2A 2X8CA 4GRFA 2I1UA 1YEXA 2VKZG 4ZBDA 1SK1A 4IN0A 3LJRA 2OE3A 3HVSA 2NBSA 4GQFA 1YKCA 4ML6A 3C71A 5HR3A 5CYYA 4N11A 3IA1A 3HVXA 3FR3A 1ZCPA 2LUSA 2VL2A 4PQHA 4BVYA 5IIZA 4IQAA 1ERVA 2EIOA 4USSA 5E4WA 2VD0A 1H75A 2N5BA 3EYTA 4X4JA 3VWUA 2DSAA 4O32A 4IGJA 2YV7A 1GTBA 2YJHA 4IJIA 2WDUA 3GKXA 2XBIA 3IXRA 1K0CA 5A34B 5J5NA 1F6MC 1V9WA 3W8JA 4KSOA 1YEWC 4PQIA 4NWYA 4POLA 4PUAA 1DSBA 4K0GA 3IHGA 3VI5A 5B6NA 2JL4A 4MK3A 3TDGA 2HRNA 2WW2A 3F8UA 2C4JA 2R4VA 2FWFA 3KH7A 4OWYA 4BVXB 5ELGA 3RPPA 1FOHA 2WVZA 4WKWA 1M99A 3IPZA 2HQTA 2CX3A 3KH9A 2DJKA 2YZUA 4ML1A 2X64A 1GNEA 4PXOA 1SKRB 3ZZXA 2O36A 3MIXA 4E8EA 2O7KA 3TKSE 3BJ5A 1R5PA 3P7XA 2IN3A 2XPDA 5A1NB 4LA1A 1OKDA 2R2JA 1J0FA 2CVKA 1GP1A 3D6IA 3ZVJA 1ZYNA 1GSSA 3F0IA 2GS3A 3LGCA 2WCIA 4ACSA 5GAPD 5F8BA 4KB3A 3M3MA 5IPGA 3ME7A 3MAKA 1UN2A 4MJCA 4RQXA 4RI7A 5AIXA 2F3MA 2IMKA 1A24A 2V32A 2DKHA 1CQHA 2KP1A 3ZFLA 3DD3A 4N3ZA 3UL3A 5KN1A 1TK0B 5BMUA 3HXSA 1SL0B 2DIZA 1IYHA 5F05A 2GVPA 3C1RA 4XTSA 1LU4A 3TU3B 3U6VA 5IMZA 3VFIA 4Z2RA 2VCTA 4KNDA 2L6CA 4IS0A 4MPGA 2VLTA 3G9BA 4F9ZA 4O7HA 2OA7A 5CO3A 3KD0A 1SU9A 4TR0A 4GTUA 5HQPA 5EPFA 2REMA 5A5KA 2WJUA 3DWVA 3KTLA 2ALBA 3HZ4A 1VF2A 4YKFA 3Q19A 5GSSA 2L4CA 3VPTA 1Z6NA 2CT6A 2HRFA 4DSSA 3H93A 4Q5QA 1PRXA 2H1DA 5AN1A 3H4KA 2O8VB 3D21A 4TRXA 2R0PA 1LBKA 3RBTA 3AY8A 3TB2A 2A2RA 1TDIA 1ZYEA 2HSHA 2IMIA 3P2AA 5FHIA 5A34A 4J56E 3FW2A 14GSA 3IAM2 3TKSA 3LG6A 2GZPA 1T1VA 2ZCTA 5DALB 2YN1A 4JR6A 2DMLA 3GKMA 6GSUA 2N5AA 2MYGA 4E8HA 3A5IA 2AB6A 2JACA 2OE1A 3GFKA 4BVXA 1Q98A 3QAGA 3ZTLA 1A0FA 1M3JA 2UZ8A 3HD5A 3RHBA 4E68A 2H1LA 2O89A 4K9ZA 2M80A 3A5WA 2X49A 4BL7B 4DVCA 4Q5NA 4O5QA 1PN9A 2MBSA 4ICYA 1MDJA 3I6AA 2EFEA 3RDWA 4N0ZA 3CBUA 5A1NA 4OMVA 1HNBA 3GRXA 1R4WA 2V6OA 4ID0A 5IOWA 3TJFA 2FNOA 2C0FA 1YKAA 2R37A 1X9MB 3NZNA 1BG5A 5D9XA 2B7KA 9GSSA 4I97A 4NHZA 1XZOA 4DSRA 1XWAA 2HYXA 3VWWA 1TP9A 3UVTA 2HT9A 3GNJA 3D4MA 4Z2UA 3ERWA 3ZITA 3DVWA 4MF6A 1S3AA 2YWNA 1X5CA 2HLSA 3LYPA 4PNFA 5CAXA 1U3AA 2HSMB 2C0EA 2L59A 1WE0A 1EZKA 2H75A 2RM6A 4MJEA 4PUFC 4TR3A 3TRPA 3I43A 4EDZA 5IMCA 5ECSA 3FZ4A 1SVMA 2QKEA 3BBYA 2YPMA 2RLIA 1Y6EA 2HZFA 4POBA 4WEYA 4L0UA 2FHEA 5A5HB 4HQSA 1SD8A 3EVIA 5COHA 2DJ3A 4AKXB 3L0HA 3H8QA 2QA1A 3CSJA 2H71A 5G5FA 2EFDA 4KF9A 1N2AA 3QMXA 4I2UA 4IKHA 4QL9A 2L4QA 2VO4A 3FR9A 2QA2A 2VCVA 4ULXA 5DJMA 4EO3A 5ECQB 4NMUA 4FQUA 1M9AA 3QFAC 2VM1A 4X0XA 4EXJA 3TRQA 1M3IA 5H5QA 3FRCA 3HCZA 1AW9A 4V2LA 3KP8A 1N25A 5ECMB 2ZUPA 4RQRA 4PGTA 4IELA 5ID2A 3RFRC 2NTOA 2E0QA 2JADA 1PA3A 18GSA 2EC4A 2O87A 1FW1A 2LRCA 4HEA2 1WPIA 4GXZA 3MWHA 3WYWA 2JZRA 2UV8G 4KE3A 4JRRA 3KMOA 3NIVA 5ECKB 2ON5A 4ZL9A 3ZFBA 2QSIA 4MNNA 1QK8A 5IOXA 4BVYB 4NAXA 4EL1A 1AQVA 1O73A 2Z9SA 3F6DA 2O5VA 3FY7A 1VGLA 1EP7A 3GMFA 2LSTA 5FT3A 5KN2A 1EOHA 1I1IP 3UMAA 5DDLA 5ECRB 2D2ZA 4KAEA 2GDRA 4MMMA 1S3DA 2H30A 3N5OA 1JHBA 2DJJA 4ECIA 1T00A 1SVOA 3VPQA 4PTSA 4G19A 2C0GA 1EGRA
chains in the Genus database with same CATH topology
2LRTA 3FR6A 4I2TA 1WOUA 4YQMA 2X8HA 3DMLA 1XWCA 4N10A 4AKGA 1VF4A 3ZMLA 3MSZA 5DQSA 1UC7A 1PX6A 3FMWA 5IMAA 3C8EA 1JLVA 2OBKA 2LKUA 4V1Ag 2CV4A 4G0KA 5H5SA 4G0IA 2C1YA 2MZCA 4J2FA 4K8MA 4PURA 2HSMA 4TW5A 4YQVA 2XPEA 19GSA 4QQ7A 5CP1A 1JZOA 4IP6A 2OJLA 3EU3A 1EOGA 5J9BA 2DIYA 1BYEA 1FG4A 3KTBA 5ABRA 5CRWA 3ME8A 4EDYA 1EP8A 3LW9A 2B5XA 3FZ5A 4G9HA 2GTUA 5F07A 5A5HA 2CQ9A 4K2XA 2B7JA 1V40A 2TRCP 1QFNA 3F9UA 1TRSA 1M2DA 2DMMA 3IDVA 3UIWA 1U6TA 4PNGA 4YQUA 2AHEA 4IQ1A 4NXIA 5DQYA 2N5FA 1K0AA 4KDUA 4ECBA 2IPAA 1O8WA 3LWAA 3CTGA 2MMAA 3E3EA 6GSXA 4KDYA 2H72A 1SKWB 1GSYA 3FYGA 1B8XA 3L4NA 1M0UA 6GSYA 1QUWA 1NHOA 4Q5RA 1XWBA 2X4AA 3IOSA 1AAZA 4L8EA 3F3QA 1NSWA 4F2IA 3U5RE 2AAWA 1RW1A 4OFMA 5IO2A 4DSSB 3GX8A 4AGSA 1WP0A 1ZMAA 2IWTA 2V2GA 2PU9C 3WGEA 1SL2B 2L5OA 1PQNA 1DE2A 4MZBA 4IBPA 1THXA 2L6DA 5B6MA 4OCEA 5B8AA 3KZQA 3TUEA 2DC5A 3F4SA 2PUKC 3IK7A 4IVFA 1OE8A 2R0CA 2H76A 3Q74A 1T4ZA 3DVXA 5DCHA 1XVWA 4AF2A 1PGTA 3MNGA 3CWGA 3HMJG 2CAQA 2R6KA 3PR8A 5DCGA 4MH2A 3UBLA 2QC7A 4LL4B 4KW6A 1QQ2A 1FOVA 3P90A 4EC0A 3Q18A 4MP4A 3LEFA 4MA9A 2PVOC 1QMVA 2RUEA 1VF3A 1JFUA 11GSA 5KN0A 3QAVA 2LTKA 2WGRA 3E0UA 2IL3A 3BOAA 4OO5A 3IBHA 2K6VA 3W6GA 3M9KA 4GWRA 2DJ1A 3F3RA 3IC8A 2B1LA 3ZRDA 2GSTA 2I3YA 4H86A 2GSRA 1JZRA 1BJXA 4F82A 5ECLB 1Z6MA 2VL2C 3CRTA 3TRXA 5JCUA 3PINA 4JR4A 3C1SA 2LQOA 2IMEA 5J4UA 1OYJA 1TRUA 3APQA 1SENA 1XWKA 4LL1B 3CSIA 2NVLA 4G01A 1O7UA 1GRXA 5EY6A 1JZWA 1O85A 3G7JA 4OCFA 2C3NA 3G7YA 3LSZA 5JCGA 4X43A 1F9MA 1K0BA 2GSQA 2GLRA 1Y25A 2B1KA 3M9JA 2WZ9A 5J3RA 3LYKA 5AIVA 4DEJA 2DJ2A 4OFNA 2FLSA 1GTAA 5HFGA 3O6TA 1JLWA 3HKRA 3WGXA 4MLYA 1GTUA 3EE2A 3FEUA 2MMOA 2EFCA 1OKTA 1MDIA 2IIYA 3UBKA 2ZNMA 4ZL8A 3L9UA 5ECNB 5CRDA 3APOA 3LXZA 4BWQA 1EGOA 5ID2B 1BEDA 2YJ7A 1T3BA 4P3YB 3QR6A 4OO4A 1SL1B 4OD7A 3GTUB 1BG1A 5CRGA 2P5QA 2A4HA 4ZBAA 4MF7A 1SJIA 2I4AA 2H73A 2C8UA 3APSA 1W4VA 1WJKA 3IHQA 2FD3A 1FB0A 4RI6A 5L71A 4HZ4A 1OC9B 3IRAA 4ZL7A 1FHEA 1ERUA 13GSA 1KBNA 3MDKA 4KUNA 5DVBA 1FAAA 3L78A 3J7Yk 5HR0A 3A2VA 2I81A 1M2AA 2V1MA 3HYPA 2KOKA 4XIHA 4JU5A 3DGQA 1YF0A 1H4OA 2B6MA 4V2NA 1ERWA 2O85A 1MTCA 3ED3A 3QOUA 4A5PA 4GDFA 2K18A 4AKHA 1GH2A 1Z3EA 4AJ7A 2H1GA 4XS4A 5AISA 4EF0A 3Q6OA 3GHAA 4V2MA 5LD0A 4MCUA 3P8WA 3BCKA 1GL8A 1GUHA 4K2DA 3GURA 2B3SA 1K0MA 4WR4A 1EWXA 4AKIA 1GSFA 2TRXA 1X9SB 1TOFA 2K8VA 3EPTA 2V41A 2P31A 6GSTA 4ZB9A 2H19A 4EE0A 1KEBA 5LNKe 1J08A 4KDXA 1PD21 1Z9HA 1FB6A 4MZCA 1F2EA 2YNXA 4FYBA 5B7CA 1HNAA 5ECPB 1XW5A 4MDCA 1URMA 4Z7XA 5ECHB 1XW9A 3WT2A 5LCZA 3TKSC 5IPHA 3IAS2 3GH9A 2CX4A 5JWOB 1EEMA 2H0HA 2GT5A 2F8AA 1B4QA 1R26A 3VWXA 1S3CA 3UAPA 1XVQA 3J7Yb 1Z5YE 2LNTA 2H6ZA 2H0IA 2E2GA 2H8LA 2HXKA 1HNCA 1A23A 3ZL5A 4I5QA 1ST9A 4IJ3A 1TU8A 5JCWA 2PBJA 5D9VA 2FWEA 5C04A 1XW6A 1DE1A 5ECOB 3F4TA 1C72A 1WWJA 3F4RA 4LMWA 4MH3A 4EUYA 2OACA 4EKZA 4BPYA 4G2EA 4XCSA 2C3TA 1GSEA 3GTUA 3CYNA 4K1FA 1EV4A 3O3TA 2A4VA 4TVEA 1SVLA 3HHVA 4TXOB 4NHWA 2B5EA 2H74A 3EC3A 4ZIJA 2BTOT 2LJRA 4N0VA 3GX0A 4ZILA 4GSTA 4F0BA 5KOWA 1M9BA 4HZ2A 1KNGA 4XRDA 5INYA 1V98A 4XRAA 1ZL9A 5JWQB 3EMXA 1X5EA 1A2JA 2H0GA 3M0FA 5DAKA 1OC9A 2C0DA 5C00A 5GZZB 4CHSA 2CAIA 5IMFA 3CRUA 4LMVA 3IC4A 4FIWA 3ISOA 2JZSA 5G30A 1F3AA 1PL2A 2K9FA 3IR4A 5J40A 3LFLA 1E2YA 1YQ1A 4WF4A 3HJMA 3V1WA 4PX1A 4IW9A 1SD9A 1TU7A 1TXUA 2HNLA 3L9SA 1M7TA 3ZVJD 1TXXA 3PH9A 3GSSA 2WRTA 3CXGA 3FHKA 2M72A 1GULA 2OE0A 4X1UA 4ILFA 5J47A 4Z2TA 3ZIJA 1Z7PA 3RPNA 3C7MA 3IK9A 2H01A 4D73B 1SYRA 1ABAA 3UVHA 2AJQB 3TGZA 1NW2A 2F9SA 1ERTA 1B9YC 2R3XA 3QDNA 3ZLPA 4ZB8A 2A2SA 1ACVA 3GYKA 3ZREA 2GZYA 1T4YA 2IFQB 3DXBA 5AGYA 1AC1A 4JE1A 2C3QA 4O5RA 2YWOA 3KGKA 1DUGA 2QGVA 1FO5A 4TR1B 3HDCA 1ILOA 2DBCA 3TJJA 5HR1A 2AYTA 4MJBA 1K3LA 3JCML 3D4TA 3EWLA 4TXVA 2PVQA 1SYXA 1TI3A 1GUMA 3VURA 3WGDA 1EV9A 3GV1A 4FYUA 3CMIA 1E6BA 2HRAA 1TKDB 2LRNA 1ZOFA 2VIMA 2YCDA 1JZDA 1ZZYA 2LEGA 3UARA 8GSSA 1LJRA 1SK0A 3DRNA 4YAVA 3GSTA 2KUCA 5IQYA 4TR4A 1G6WA 2FUG2 5DJLA 5ELAA 2YZHA 3H79A 1V2AA 5ECIB 1F3BA 5J4VA 1YF1A 1K3YA 3CTFA 1ML6A 2VUPA 2YV9A 4TXOA 3QAWA 3VWVA 1KTEA 3FK8A 3RHCA 4FO5A 2GSSA 1BF5A 3FZ9A 6GSVA 2H66A 2H6YA 1EEJA 3FKFA 1T7PB 4F0CA 1A8YA 3GUSA 3L9VA 1B9XC 5HR2A 4ISDA 1TTZA 2P0GA 5GSTA 2GQKA 3ZYWA 4HJMA 1V58A 3N9JA 2R0GA 5IO0A 2GGTA 2J23A 4KGIA 3WD6A 1U3IA 4ZB6A 2VCWA 4I6XA 3QD9A 4ECJA 4AJ6A 5J41A 1QGVA 1K0OA 3HZ8A 2BMXA 5IMDA 1O81A 1SJ6A 1GSQA 2MBTA 1SKSB 1WRYA 3BD2A 1PMTA 4IP1A 2AUVA 5G5EA 4GLTA 5CREA 3QFBC 3OR5A 1V57A 3DYRA 2LNSA 4MF5A 5H5RA 4D73A 2JSYA 1IYIA 2X8GA 2HSYA 2XBQA 2PGTA 1N8JA 3DEXA 4WETA 1TW9A 1YEPA 1YZXA 2IMFA 2PWJA 2VCQA 4MPFA 3RAZA 5CNWA 1ZYQB 6GSSA 2ES7A 2RM5A 4QMKA 3VK9A 5EVOA 1TRWA 4ZB7A 2IFQA 4J57E 4TOPA 4XS4B 2HRKB 3LXTA 4WF5A 4LLRA 4GF0A 4G10A 2PN8A 5D96A 2YOIA 2VD1A 4GQCA 4KSMA 3GIXA 1G7EA 4TR1A 1A2LA 1PN0A 4G0LA 1PL1A 4IHUA 3VI7A 5A4VA 1R7HA 4GSNA 4ECCA 4KH7A 4TKYA 3SBCA 4HUAA 2JU5A 1T8EB 1XBSA 1O8XA 2EFHA 5D9WA 3KP9A 2CZ2A 3F63A 3GKKA 4L5LA 2YP6A 1OVNA 5KEJA 1VF1A 3F6FA 3LORA 4NPBA 2DKIA 4QL7A 4HOJA 4K7IA 4CDOA 1Q4JA 3M8NA 4BA7A 2IJYA 4K0NA 2JSZA 4BWSA 3WT1A 3G7IA 3UOMA 2HFDA 2XC2A 3HY2A 2YANA 5A4WA 3TOUA 1GTIA 4WBJA 4N30A 4HDEA 1G7OA 5G1KA 12GSA 2WS2A 4K5RA 3TJKA 3LQ7A 1X5DA 1MDKA 3HA9A 4CW9A 1MEKA 4XS1A 2PMTA 4POMA 1GWCA 2GZZA 2V6KA 2XHFA 1TJDA 2HI7A 3O76A 3H1NA 2B5YA 1VRSD 2OADA 5ENUA 3EMPA 1XCCA 2AV4A 2GQLA 2YWMA 4Q5FA 5F06A 1TK8B 1OAZA 2FA4A 1GLPA 2F51A 3ZIVA 1XOAA 2FCHA 3HVVA 5KOXA 2R5GA 2HZEB 2FY6A 2LJAA 22GSA 1XPVA 3GKNA 17GSA 4FH8A 1B4PA 1YY7A 4WXTA 2J9HA 1PKWA 5DAKB 4ZBBA 4NV5A 3A2WA 1ZYPA 20GSA 4KA0A 4NV2A 3GA4A 4WBRD 3E9JB 2RUFA 2GT6A 3HJOA 3MYDA 2KP2A 2E7PA 1GUKA 1YDKA 3TJBA 4EVMA 3PPUA 1G0TA 2FGXA 4JZQA 5D73A 2PERA 5F0GA 1CQGA 2HRKA 2OBIA 1RK4A 2H1AA 5E59A 3KEBA 3NOFA 5KN3A 1GSUA 4MJAA 1ON4A 4I8BA 5FWGA 2L5LA 4L5OA 4L0WA 3KXOA 2OT3A 1G6YA 5DBQA 1NM3A 3W8SA 1K3OA 2H6XA 5BRTA 1OC3A 2JZTA 1MD4A 5D93A 5JWRB 3C73A 1WMJA 1W89A 1GLQA 1AXDA 4W66A 5EL8A 1HQOA 1GSDA 1PKZA 3R3EA 3TCOA 1RQMA 1F37A 2DJ0A 2FA8A 3KM6A 2G0FA 4FYCA 4HJ2A 1NHYA 1O6JA 4HQZA 2C80A 2ON7A 2FWGA 3DIEA 1U88A 4AI6A 2VLVA 2VL9A 2H1BA 7GSSA 1AUCA 3DKSA 4KCAA 3EINA 2EIQA 2VL3A 2X99A 4O92A 10GSA 2HSNB 3QPMA 1PSQA 1B48A 1XWGA 3UEMA 5CRHA 3VLNA 2KLXA 1WIKA 4CY8A 2PPTA 2LS5A 4CY6A 2FWHA 4YAPA 1BQ7A 4XS6A 4GSSA 2WULA 2H70A 2CA8A 3EU4A 1THOA 3US3A 3CSHA 2VLUA 3TKQA 4HU7A 3IE3A 3ERFA 1SK2A 1BAYA 3UJ1A 2LJKA 2VAFA 1K0DA 3I9V2 1BX9A 2HE3A 4KX4A 4MABA 4HU9A 3TOTA 1ZGNA 2K8SA 2MMZA 2HZEA 2WB9A 2LQQA 4V1Ap 3S9FA 4KCEA 5DALA 1A0RP 4GCIA 4EIQA 4RUVA 2WFCA 4F03A 5G2ZA 3IV4A 5HFKA 5B8BA 3GL3A 2VOCA 1TI1A 3TKPA 3A2XA 3KJYA 1PX7A 4JBBA 1XXUA 2RIIA 4MZWA 3SWLA 4BL7A 2VM2A 2TIRA 1XFLA 1J9BA 1K0NA 5HFIA 4AJ8A 3HJPA 4PQ1A 1FVKA 3ZMKA 1UVZA 3TKRA 2GQMA 3M1GA 3R2QA 1OC8A 2L57A 1XOBA 3FZAA 2G2QA 4K6XA 3QCPA 16GSA 2BJXA 1AQXA 2VCZA 1GNWA 4ZXGA 1Y1UA 1Z7RA 2MMNA 1UA5A 4WR5A 2NPBA 3TJGA 2KHPA 1A8LA 1HYUA 3I69A 4EIPA 4YKGA 1OE7A 2EIRA 6GSWA 1AIUA 3KIJA 4DSQA 3D22A 3D5JA 4K7NA 1M2BA 1QXHA 3EURA 4XHMA 3D0ZA 3BCIA 1A2MA 2CVDA 1X0RA 1TK5B 1USBA 2YWIA 3A3TA 3GL5A 5IM9A 3KCMA 5J4YA 1R5AA 5G1LA 2LV3A 2F8FA 1YJ6A 1DBYA 5J9CA 2OKAA 4K7OA 2A2PA 2CZ3A 3PGTA 2VCXA 3KMNA 2HSNA 1FVJA 2I9HA 4JEDA 4O5UA 4OFTA 1U87A 1I9DA 4POKA 1HD2A 5A4UA 4TN8A 2E2MA 5GAND 1X9WB 1TRVA 2IMDA 5G31A 4K5SA 5D8IA 2DLXA 2CVBA 4HS1A 1I5GA 2NDOA 5IMVA 5BMUB 2P5RA 3GH6A 3K8NA 1AQWA 3ERGA 4HI7A 5D9TA 1YVLA 3GN3A 1XIYA 1SJZA 2M46A 1MD3A 4YH2A 2X8CA 4GRFA 2I1UA 1YEXA 2VKZG 4ZBDA 1SK1A 4IN0A 3LJRA 2OE3A 3HVSA 2NBSA 4GQFA 1YKCA 4ML6A 3C71A 5HR3A 5CYYA 4N11A 3IA1A 3HVXA 3FR3A 1ZCPA 2LUSA 2VL2A 4PQHA 4BVYA 5IIZA 4IQAA 1ERVA 2EIOA 4USSA 5E4WA 2VD0A 1H75A 2N5BA 3EYTA 4X4JA 3VWUA 2DSAA 4O32A 4IGJA 2YV7A 1GTBA 2YJHA 4IJIA 2WDUA 3GKXA 2XBIA 3IXRA 1K0CA 5A34B 5J5NA 1F6MC 1V9WA 3W8JA 4KSOA 4PQIA 4NWYA 4POLA 4PUAA 1DSBA 4K0GA 3IHGA 3VI5A 5B6NA 2JL4A 4MK3A 3TDGA 2HRNA 3F8UA 2C4JA 2R4VA 2FWFA 3KH7A 4OWYA 4BVXB 5ELGA 3RPPA 1FOHA 4WKWA 1M99A 3IPZA 2HQTA 2CX3A 3KH9A 2DJKA 2YZUA 4ML1A 2X64A 1GNEA 4PXOA 1SKRB 3ZZXA 3MIXA 4E8EA 2O7KA 3TKSE 3BJ5A 1R5PA 3P7XA 2IN3A 2XPDA 5A1NB 4LA1A 1OKDA 2R2JA 1J0FA 2CVKA 1GP1A 3D6IA 3ZVJA 1ZYNA 1GSSA 3F0IA 2GS3A 3LGCA 2WCIA 4ACSA 5GAPD 5F8BA 4KB3A 3M3MA 5IPGA 3ME7A 3MAKA 1UN2A 4MJCA 4RQXA 4RI7A 5AIXA 2F3MA 2IMKA 1A24A 2V32A 2DKHA 1CQHA 2KP1A 3ZFLA 3DD3A 4N3ZA 3UL3A 5KN1A 1TK0B 5BMUA 3HXSA 1SL0B 2DIZA 1IYHA 5F05A 2GVPA 3C1RA 4XTSA 1LU4A 3TU3B 3U6VA 5IMZA 3VFIA 4Z2RA 2VCTA 4KNDA 2L6CA 4IS0A 4MPGA 2VLTA 3G9BA 4F9ZA 4O7HA 2OA7A 5CO3A 3KD0A 1SU9A 4TR0A 4GTUA 5HQPA 5EPFA 2REMA 5A5KA 2WJUA 3DWVA 3KTLA 2ALBA 3HZ4A 1VF2A 4YKFA 3Q19A 5GSSA 2L4CA 3VPTA 1Z6NA 2CT6A 2HRFA 4DSSA 3H93A 4Q5QA 1PRXA 2H1DA 5AN1A 3H4KA 2O8VB 3D21A 4TRXA 2R0PA 1LBKA 3RBTA 3AY8A 3TB2A 2A2RA 1TDIA 1ZYEA 2HSHA 2IMIA 3P2AA 5FHIA 5A34A 4J56E 3FW2A 14GSA 3IAM2 3TKSA 3LG6A 2GZPA 1T1VA 2ZCTA 5DALB 2YN1A 4JR6A 2DMLA 3GKMA 6GSUA 2N5AA 2MYGA 4E8HA 3A5IA 2AB6A 2JACA 2OE1A 3GFKA 4BVXA 1Q98A 3QAGA 3ZTLA 1A0FA 2UZ8A 3HD5A 3RHBA 4E68A 2H1LA 2O89A 4K9ZA 2M80A 3A5WA 2X49A 4BL7B 4DVCA 4Q5NA 4O5QA 1PN9A 2MBSA 4ICYA 1MDJA 3I6AA 2EFEA 3RDWA 4N0ZA 3CBUA 5A1NA 4OMVA 1HNBA 3GRXA 1R4WA 2V6OA 4ID0A 5IOWA 3TJFA 2FNOA 2C0FA 1YKAA 2R37A 1X9MB 3NZNA 1BG5A 5D9XA 2B7KA 9GSSA 4I97A 4NHZA 1XZOA 4DSRA 1XWAA 2HYXA 3VWWA 1TP9A 3UVTA 2HT9A 3GNJA 3D4MA 4Z2UA 3ERWA 3ZITA 3DVWA 4MF6A 1S3AA 2YWNA 1X5CA 2HLSA 3LYPA 4PNFA 5CAXA 1U3AA 2HSMB 2C0EA 2L59A 1WE0A 1EZKA 2H75A 2RM6A 4MJEA 4PUFC 4TR3A 3TRPA 3I43A 4EDZA 5IMCA 5ECSA 3FZ4A 1SVMA 2QKEA 3BBYA 2YPMA 2RLIA 1Y6EA 2HZFA 4POBA 4WEYA 4L0UA 2FHEA 5A5HB 4HQSA 1SD8A 3EVIA 5COHA 2DJ3A 4AKXB 3L0HA 3H8QA 2QA1A 3CSJA 2H71A 5G5FA 2EFDA 4KF9A 1N2AA 3QMXA 4I2UA 4IKHA 4QL9A 2L4QA 2VO4A 3FR9A 2QA2A 2VCVA 4ULXA 5DJMA 4EO3A 5ECQB 4NMUA 4FQUA 1M9AA 3QFAC 2VM1A 4X0XA 4EXJA 3TRQA 5H5QA 3FRCA 3HCZA 1AW9A 4V2LA 3KP8A 1N25A 5ECMB 2ZUPA 4RQRA 4PGTA 4IELA 5ID2A 2NTOA 2E0QA 2JADA 1PA3A 18GSA 2EC4A 2O87A 1FW1A 2LRCA 4HEA2 1WPIA 4GXZA 3MWHA 3WYWA 2JZRA 2UV8G 4KE3A 4JRRA 3KMOA 3NIVA 5ECKB 2ON5A 4ZL9A 3ZFBA 2QSIA 4MNNA 1QK8A 5IOXA 4BVYB 4NAXA 4EL1A 1AQVA 1O73A 2Z9SA 3F6DA 2O5VA 3FY7A 1VGLA 1EP7A 3GMFA 2LSTA 5FT3A 5KN2A 1EOHA 3UMAA 5DDLA 5ECRB 2D2ZA 4KAEA 2GDRA 4MMMA 1S3DA 2H30A 3N5OA 1JHBA 2DJJA 4ECIA 1T00A 1SVOA 3VPQA 4PTSA 4G19A 2C0GA 1EGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRT A;  3FR6 A;  4I2T A;  1WOU A;  4YQM A;  2X8H A;  3DML A;  1XWC A;  4N10 A;  1VF4 A;  3ZML A;  3MSZ A;  5DQS A;  1UC7 A;  1PX6 A;  5IMA A;  3C8E A;  1JLV A;  2OBK A;  2LKU A;  4V1A g;  2CV4 A;  4G0K A;  5H5S A;  4G0I A;  2C1Y A;  2MZC A;  4J2F A;  4K8M A;  4PUR A;  2HSM A;  4TW5 A;  4YQV A;  2XPE A;  19GS A;  4QQ7 A;  5CP1 A;  1JZO A;  4IP6 A;  2OJL A;  3EU3 A;  1EOG A;  5J9B A;  2DIY A;  1BYE A;  1FG4 A;  3KTB A;  5ABR A;  5CRW A;  3ME8 A;  4EDY A;  1EP8 A;  2B5X A;  3FZ5 A;  4G9H A;  2GTU A;  5F07 A;  2CQ9 A;  2B7J A;  1V40 A;  2TRC P;  1QFN A;  3F9U A;  1TRS A;  1M2D A;  2DMM A;  3IDV A;  3UIW A;  1U6T A;  4PNG A;  4YQU A;  2AHE A;  4IQ1 A;  4NXI A;  5DQY A;  2N5F A;  1K0A A;  4KDU A;  4ECB A;  2IPA A;  1O8W A;  3LWA A;  3CTG A;  2MMA A;  3E3E A;  6GSX A;  4KDY A;  2H72 A;  1SKW B;  1GSY A;  3FYG A;  1B8X A;  3L4N A;  1M0U A;  6GSY A;  1QUW A;  1NHO A;  4Q5R A;  1XWB A;  3IOS A;  1AAZ A;  4L8E A;  3F3Q A;  1NSW A;  4F2I A;  3U5R E;  2AAW A;  1RW1 A;  4OFM A;  5IO2 A;  4DSS B;  3GX8 A;  4AGS A;  1WP0 A;  1ZMA A;  2IWT A;  2V2G A;  2PU9 C;  3WGE A;  1SL2 B;  2L5O A;  1PQN A;  1DE2 A;  4MZB A;  4IBP A;  1THX A;  2L6D A;  5B6M A;  4OCE A;  5B8A A;  3KZQ A;  3TUE A;  2DC5 A;  3F4S A;  2PUK C;  3IK7 A;  4IVF A;  1OE8 A;  2H76 A;  3Q74 A;  1T4Z A;  3DVX A;  5DCH A;  1XVW A;  4AF2 A;  1PGT A;  3MNG A;  2CAQ A;  2R6K A;  3PR8 A;  5DCG A;  4MH2 A;  3UBL A;  2QC7 A;  4LL4 B;  4KW6 A;  1QQ2 A;  1FOV A;  3P90 A;  4EC0 A;  3Q18 A;  4MP4 A;  3LEF A;  4MA9 A;  2PVO C;  1QMV A;  2RUE A;  1VF3 A;  1JFU A;  11GS A;  5KN0 A;  3QAV A;  2LTK A;  2WGR A;  3E0U A;  2IL3 A;  3BOA A;  4OO5 A;  3IBH A;  2K6V A;  3W6G A;  3M9K A;  4GWR A;  2DJ1 A;  3F3R A;  3IC8 A;  2B1L A;  3ZRD A;  2GST A;  2I3Y A;  4H86 A;  2GSR A;  1JZR A;  1BJX A;  4F82 A;  5ECL B;  1Z6M A;  2VL2 C;  3CRT A;  3TRX A;  5JCU A;  3PIN A;  4JR4 A;  3C1S A;  2LQO A;  2IME A;  5J4U A;  1OYJ A;  1TRU A;  3APQ A;  1SEN A;  1XWK A;  4LL1 B;  3CSI A;  2NVL A;  1O7U A;  1GRX A;  5EY6 A;  1JZW A;  1O85 A;  3G7J A;  4OCF A;  2C3N A;  3G7Y A;  3LSZ A;  5JCG A;  4X43 A;  1F9M A;  1K0B A;  2GSQ A;  2GLR A;  1Y25 A;  2B1K A;  3M9J A;  2WZ9 A;  5J3R A;  3LYK A;  5AIV A;  4DEJ A;  2DJ2 A;  4OFN A;  2FLS A;  1GTA A;  5HFG A;  3O6T A;  1JLW A;  3HKR A;  3WGX A;  4MLY A;  1GTU A;  3EE2 A;  3FEU A;  2MMO A;  1OKT A;  1MDI A;  2IIY A;  3UBK A;  2ZNM A;  4ZL8 A;  3L9U A;  5ECN B;  5CRD A;  3APO A;  3LXZ A;  4BWQ A;  1EGO A;  5ID2 B;  1BED A;  2YJ7 A;  1T3B A;  4P3Y B;  3QR6 A;  4OO4 A;  1SL1 B;  4OD7 A;  3GTU B;  5CRG A;  2P5Q A;  4ZBA A;  4MF7 A;  1SJI A;  2I4A A;  2H73 A;  2C8U A;  3APS A;  1W4V A;  1WJK A;  3IHQ A;  2FD3 A;  1FB0 A;  4RI6 A;  5L71 A;  4HZ4 A;  1OC9 B;  3IRA A;  4ZL7 A;  1FHE A;  1ERU A;  13GS A;  1KBN A;  3MDK A;  4KUN A;  5DVB A;  1FAA A;  3L78 A;  3J7Y k;  5HR0 A;  3A2V A;  2I81 A;  1M2A A;  2V1M A;  3HYP A;  2KOK A;  4XIH A;  4JU5 A;  3DGQ A;  1YF0 A;  1H4O A;  2B6M A;  4V2N A;  1ERW A;  2O85 A;  1MTC A;  3ED3 A;  3QOU A;  2K18 A;  1GH2 A;  1Z3E A;  4AJ7 A;  2H1G A;  4XS4 A;  5AIS A;  4EF0 A;  3Q6O A;  3GHA A;  4V2M A;  5LD0 A;  4MCU A;  3P8W A;  3BCK A;  1GL8 A;  1GUH A;  4K2D A;  3GUR A;  2B3S A;  1K0M A;  4WR4 A;  1EWX A;  1GSF A;  2TRX A;  1X9S B;  1TOF A;  2K8V A;  2V41 A;  2P31 A;  6GST A;  4ZB9 A;  2H19 A;  4EE0 A;  1KEB A;  5LNK e;  1J08 A;  4KDX A;  1PD2 1;  1Z9H A;  1FB6 A;  4MZC A;  1F2E A;  2YNX A;  4FYB A;  5B7C A;  1HNA A;  5ECP B;  1XW5 A;  4MDC A;  1URM A;  4Z7X A;  5ECH B;  1XW9 A;  3WT2 A;  5LCZ A;  3TKS C;  5IPH A;  3IAS 2;  3GH9 A;  2CX4 A;  5JWO B;  1EEM A;  2H0H A;  2GT5 A;  2F8A A;  1B4Q A;  1R26 A;  3VWX A;  1S3C A;  3UAP A;  1XVQ A;  3J7Y b;  1Z5Y E;  2LNT A;  2H6Z A;  2H0I A;  2E2G A;  2H8L A;  2HXK A;  1HNC A;  1A23 A;  3ZL5 A;  4I5Q A;  1ST9 A;  4IJ3 A;  1TU8 A;  5JCW A;  2PBJ A;  5D9V A;  2FWE A;  5C04 A;  1XW6 A;  1DE1 A;  5ECO B;  3F4T A;  1C72 A;  1WWJ A;  3F4R A;  4LMW A;  4MH3 A;  4EUY A;  2OAC A;  4EKZ A;  4BPY A;  4G2E A;  4XCS A;  2C3T A;  1GSE A;  3GTU A;  3CYN A;  4K1F A;  1EV4 A;  3O3T A;  2A4V A;  4TVE A;  3HHV A;  4TXO B;  4NHW A;  2B5E A;  2H74 A;  3EC3 A;  4ZIJ A;  2BTO T;  2LJR A;  4N0V A;  3GX0 A;  4ZIL A;  4GST A;  4F0B A;  1M9B A;  4HZ2 A;  1KNG A;  4XRD A;  5INY A;  1V98 A;  4XRA A;  1ZL9 A;  5JWQ B;  3EMX A;  1X5E A;  1A2J A;  2H0G A;  3M0F A;  5DAK A;  1OC9 A;  2C0D A;  5C00 A;  5GZZ B;  4CHS A;  2CAI A;  5IMF A;  3CRU A;  4LMV A;  3IC4 A;  4FIW A;  3ISO A;  2JZS A;  5G30 A;  1F3A A;  1PL2 A;  2K9F A;  3IR4 A;  3LFL A;  1E2Y A;  1YQ1 A;  4WF4 A;  3HJM A;  3V1W A;  4PX1 A;  4IW9 A;  1SD9 A;  1TU7 A;  2HNL A;  3L9S A;  1M7T A;  3ZVJ D;  1TXX A;  3PH9 A;  3GSS A;  2WRT A;  3CXG A;  3FHK A;  2M72 A;  1GUL A;  2OE0 A;  4X1U A;  4ILF A;  3ZIJ A;  1Z7P A;  3RPN A;  3C7M A;  3IK9 A;  2H01 A;  4D73 B;  1SYR A;  1ABA A;  3UVH A;  2AJQ B;  3TGZ A;  1NW2 A;  2F9S A;  1ERT A;  1B9Y C;  2R3X A;  3QDN A;  3ZLP A;  4ZB8 A;  2A2S A;  1ACV A;  3GYK A;  3ZRE A;  2GZY A;  1T4Y A;  2IFQ B;  3DXB A;  5AGY A;  1AC1 A;  4JE1 A;  2C3Q A;  4O5R A;  2YWO A;  3KGK A;  1DUG A;  2QGV A;  1FO5 A;  4TR1 B;  3HDC A;  1ILO A;  2DBC A;  3TJJ A;  5HR1 A;  2AYT A;  4MJB A;  1K3L A;  3JCM L;  3D4T A;  3EWL A;  4TXV A;  2PVQ A;  1SYX A;  1TI3 A;  1GUM A;  3VUR A;  3WGD A;  1EV9 A;  3GV1 A;  4FYU A;  3CMI A;  1E6B A;  2HRA A;  1TKD B;  2LRN A;  1ZOF A;  2VIM A;  2YCD A;  1JZD A;  1ZZY A;  2LEG A;  3UAR A;  8GSS A;  1LJR A;  1SK0 A;  3DRN A;  4YAV A;  3GST A;  2KUC A;  5IQY A;  4TR4 A;  1G6W A;  2FUG 2;  5DJL A;  5ELA A;  2YZH A;  3H79 A;  1V2A A;  5ECI B;  1F3B A;  1YF1 A;  1K3Y A;  3CTF A;  1ML6 A;  2VUP A;  2YV9 A;  4TXO A;  3QAW A;  3VWV A;  1KTE A;  3FK8 A;  3RHC A;  4FO5 A;  2GSS A;  3FZ9 A;  6GSV A;  2H66 A;  2H6Y A;  1EEJ A;  3FKF A;  1T7P B;  4F0C A;  1A8Y A;  3GUS A;  3L9V A;  1B9X C;  5HR2 A;  4ISD A;  1TTZ A;  2P0G A;  5GST A;  2GQK A;  3ZYW A;  4HJM A;  1V58 A;  3N9J A;  5IO0 A;  2GGT A;  2J23 A;  4KGI A;  3WD6 A;  1U3I A;  4ZB6 A;  2VCW A;  4I6X A;  3QD9 A;  4ECJ A;  4AJ6 A;  5J41 A;  1QGV A;  1K0O A;  3HZ8 A;  2BMX A;  5IMD A;  1O81 A;  1SJ6 A;  1GSQ A;  2MBT A;  1SKS B;  1WRY A;  3BD2 A;  1PMT A;  4IP1 A;  2AUV A;  5G5E A;  4GLT A;  5CRE A;  3QFB C;  3OR5 A;  1V57 A;  3DYR A;  2LNS A;  4MF5 A;  5H5R A;  4D73 A;  2JSY A;  1IYI A;  2X8G A;  2HSY A;  2XBQ A;  2PGT A;  1N8J A;  3DEX A;  4WET A;  1TW9 A;  1YEP A;  1YZX A;  2VCQ A;  2PWJ A;  4MPF A;  2IMF A;  3RAZ A;  5CNW A;  1ZYQ B;  6GSS A;  2ES7 A;  2RM5 A;  3VK9 A;  5EVO A;  1TRW A;  2IFQ A;  4J57 E;  4TOP A;  4XS4 B;  2HRK B;  3LXT A;  4WF5 A;  4LLR A;  4GF0 A;  4G10 A;  2PN8 A;  5D96 A;  2YOI A;  2VD1 A;  4GQC A;  4KSM A;  3GIX A;  1G7E A;  4TR1 A;  1A2L A;  4G0L A;  1PL1 A;  4IHU A;  3VI7 A;  5A4V A;  1R7H A;  4GSN A;  4ECC A;  4KH7 A;  4TKY A;  3SBC A;  4HUA A;  2JU5 A;  1T8E B;  1XBS A;  1O8X A;  5D9W A;  3KP9 A;  2CZ2 A;  3F63 A;  3GKK A;  4L5L A;  2YP6 A;  1OVN A;  5KEJ A;  1VF1 A;  3F6F A;  3LOR A;  4NPB A;  4QL7 A;  4HOJ A;  4K7I A;  4CDO A;  1Q4J A;  3M8N A;  4BA7 A;  2IJY A;  4K0N A;  2JSZ A;  4BWS A;  3WT1 A;  3G7I A;  3UOM A;  2HFD A;  2XC2 A;  3HY2 A;  2YAN A;  5A4W A;  3TOU A;  1GTI A;  4WBJ A;  4N30 A;  4HDE A;  1G7O A;  5G1K A;  12GS A;  2WS2 A;  3TJK A;  3LQ7 A;  1X5D A;  1MDK A;  3HA9 A;  4CW9 A;  1MEK A;  4XS1 A;  2PMT A;  4POM A;  1GWC A;  2GZZ A;  2V6K A;  2XHF A;  1TJD A;  2HI7 A;  3O76 A;  3H1N A;  2B5Y A;  1VRS D;  2OAD A;  5ENU A;  3EMP A;  1XCC A;  2AV4 A;  2GQL A;  2YWM A;  4Q5F A;  5F06 A;  1TK8 B;  1OAZ A;  2FA4 A;  1GLP A;  2F51 A;  3ZIV A;  1XOA A;  2FCH A;  3HVV A;  2R5G A;  2HZE B;  2FY6 A;  2LJA A;  22GS A;  1XPV A;  3GKN A;  17GS A;  4FH8 A;  1B4P A;  1YY7 A;  4WXT A;  2J9H A;  1PKW A;  5DAK B;  4ZBB A;  4NV5 A;  3A2W A;  20GS A;  4KA0 A;  4NV2 A;  3GA4 A;  4WBR D;  3E9J B;  2RUF A;  2GT6 A;  3HJO A;  2KP2 A;  2E7P A;  1GUK A;  1YDK A;  3TJB A;  4EVM A;  3PPU A;  1G0T A;  2FGX A;  4JZQ A;  5D73 A;  2PER A;  5F0G A;  1CQG A;  2HRK A;  2OBI A;  1RK4 A;  2H1A A;  5E59 A;  3KEB A;  3NOF A;  5KN3 A;  1GSU A;  4MJA A;  1ON4 A;  4I8B A;  5FWG A;  2L5L A;  4L5O A;  4L0W A;  3KXO A;  1G6Y A;  5DBQ A;  1NM3 A;  3W8S A;  1K3O A;  2H6X A;  1OC3 A;  2JZT A;  1MD4 A;  5D93 A;  5JWR B;  3C73 A;  1WMJ A;  1W89 A;  1GLQ A;  1AXD A;  5EL8 A;  1HQO A;  1GSD A;  1PKZ A;  3R3E A;  3TCO A;  1RQM A;  1F37 A;  2DJ0 A;  2FA8 A;  3KM6 A;  2G0F A;  4FYC A;  4HJ2 A;  1NHY A;  1O6J A;  4HQZ A;  2C80 A;  2ON7 A;  2FWG A;  3DIE A;  1U88 A;  2VLV A;  2VL9 A;  2H1B A;  7GSS A;  1AUC A;  3DKS A;  4KCA A;  3EIN A;  2EIQ A;  2VL3 A;  2X99 A;  4O92 A;  10GS A;  2HSN B;  3QPM A;  1PSQ A;  1B48 A;  1XWG A;  3UEM A;  5CRH A;  3VLN A;  2KLX A;  1WIK A;  2PPT A;  2LS5 A;  2FWH A;  4YAP A;  1BQ7 A;  4XS6 A;  4GSS A;  2WUL A;  2H70 A;  2CA8 A;  3EU4 A;  1THO A;  3US3 A;  3CSH A;  2VLU A;  3TKQ A;  4HU7 A;  3IE3 A;  3ERF A;  1SK2 A;  1BAY A;  3UJ1 A;  2LJK A;  2VAF A;  1K0D A;  3I9V 2;  1BX9 A;  2HE3 A;  4KX4 A;  4MAB A;  4HU9 A;  3TOT A;  1ZGN A;  2K8S A;  2MMZ A;  2HZE A;  2WB9 A;  2LQQ A;  4V1A p;  3S9F A;  4KCE A;  5DAL A;  1A0R P;  4GCI A;  4RUV A;  2WFC A;  4F03 A;  5G2Z A;  3IV4 A;  5HFK A;  5B8B A;  3GL3 A;  2VOC A;  1TI1 A;  3TKP A;  3A2X A;  3KJY A;  1PX7 A;  4JBB A;  1XXU A;  2RII A;  4MZW A;  3SWL A;  4BL7 A;  2VM2 A;  2TIR A;  1XFL A;  1J9B A;  1K0N A;  5HFI A;  4AJ8 A;  3HJP A;  4PQ1 A;  1FVK A;  3ZMK A;  1UVZ A;  3TKR A;  2GQM A;  3M1G A;  3R2Q A;  1OC8 A;  2L57 A;  1XOB A;  3FZA A;  2G2Q A;  4K6X A;  3QCP A;  16GS A;  2BJX A;  1AQX A;  2VCZ A;  1GNW A;  4ZXG A;  1Z7R A;  2MMN A;  1UA5 A;  4WR5 A;  2NPB A;  3TJG A;  2KHP A;  1A8L A;  1HYU A;  3I69 A;  1OE7 A;  2EIR A;  6GSW A;  1AIU A;  3KIJ A;  4DSQ A;  4K7N A;  3D22 A;  3D5J A;  1M2B A;  1QXH A;  3EUR A;  4XHM A;  3D0Z A;  3BCI A;  1A2M A;  2CVD A;  1X0R A;  1TK5 B;  1USB A;  2YWI A;  3A3T A;  3GL5 A;  5IM9 A;  3KCM A;  1R5A A;  5G1L A;  2LV3 A;  2F8F A;  1YJ6 A;  1DBY A;  5J9C A;  2OKA A;  4K7O A;  2CZ3 A;  3PGT A;  2VCX A;  3KMN A;  1FVJ A;  2I9H A;  4JED A;  4OFT A;  1U87 A;  1I9D A;  4POK A;  1HD2 A;  5A4U A;  4TN8 A;  2E2M A;  5GAN D;  1X9W B;  1TRV A;  2IMD A;  5G31 A;  5D8I A;  2DLX A;  2CVB A;  4HS1 A;  1I5G A;  2NDO A;  5IMV A;  2P5R A;  3GH6 A;  3K8N A;  1AQW A;  3ERG A;  4HI7 A;  5D9T A;  3GN3 A;  1XIY A;  1SJZ A;  2M46 A;  1MD3 A;  4YH2 A;  2X8C A;  4GRF A;  2I1U A;  1YEX A;  4ZBD A;  1SK1 A;  4IN0 A;  3LJR A;  2OE3 A;  3HVS A;  2NBS A;  4GQF A;  1YKC A;  4ML6 A;  3C71 A;  5HR3 A;  5CYY A;  4N11 A;  3IA1 A;  3HVX A;  3FR3 A;  1ZCP A;  2LUS A;  2VL2 A;  4PQH A;  4BVY A;  5IIZ A;  4IQA A;  1ERV A;  2EIO A;  4USS A;  5E4W A;  2VD0 A;  1H75 A;  2N5B A;  3EYT A;  3VWU A;  2DSA A;  4O32 A;  4IGJ A;  2YV7 A;  1GTB A;  2YJH A;  4IJI A;  2WDU A;  3GKX A;  2XBI A;  3IXR A;  1K0C A;  5J5N A;  1F6M C;  1V9W A;  3W8J A;  4KSO A;  4PQI A;  4NWY A;  4POL A;  4PUA A;  1DSB A;  4K0G A;  5B6N A;  3VI5 A;  2JL4 A;  4MK3 A;  3TDG A;  2HRN A;  3F8U A;  2C4J A;  2R4V A;  2FWF A;  3KH7 A;  4OWY A;  4BVX B;  5ELG A;  3RPP A;  4WKW A;  1M99 A;  3IPZ A;  2HQT A;  2CX3 A;  3KH9 A;  2DJK A;  2YZU A;  4ML1 A;  2X64 A;  1GNE A;  4PXO A;  1SKR B;  3ZZX A;  4E8E A;  2O7K A;  3TKS E;  3BJ5 A;  1R5P A;  3P7X A;  2IN3 A;  2XPD A;  4LA1 A;  1OKD A;  2R2J A;  1J0F A;  2CVK A;  1GP1 A;  3D6I A;  3ZVJ A;  1GSS A;  3F0I A;  2GS3 A;  3LGC A;  2WCI A;  4ACS A;  5GAP D;  5F8B A;  4KB3 A;  3M3M A;  5IPG A;  3ME7 A;  3MAK A;  1UN2 A;  4MJC A;  4RQX A;  4RI7 A;  5AIX A;  2F3M A;  2IMK A;  1A24 A;  2V32 A;  1CQH A;  2KP1 A;  3ZFL A;  3DD3 A;  3UL3 A;  5KN1 A;  1TK0 B;  5BMU A;  3HXS A;  1SL0 B;  2DIZ A;  1IYH A;  5F05 A;  2GVP A;  3C1R A;  4XTS A;  1LU4 A;  3U6V A;  5IMZ A;  3VFI A;  2VCT A;  4KND A;  2L6C A;  4IS0 A;  4MPG A;  2VLT A;  3G9B A;  4F9Z A;  4O7H A;  2OA7 A;  5CO3 A;  3KD0 A;  1SU9 A;  4TR0 A;  4GTU A;  5HQP A;  5EPF A;  2REM A;  5A5K A;  2WJU A;  3DWV A;  3KTL A;  2ALB A;  3HZ4 A;  1VF2 A;  3Q19 A;  5GSS A;  2L4C A;  3VPT A;  1Z6N A;  2CT6 A;  2HRF A;  4DSS A;  3H93 A;  4Q5Q A;  1PRX A;  2H1D A;  5AN1 A;  3H4K A;  2O8V B;  3D21 A;  4TRX A;  1LBK A;  3RBT A;  3AY8 A;  3TB2 A;  2A2R A;  1TDI A;  1ZYE A;  2HSH A;  2IMI A;  3P2A A;  5FHI A;  4J56 E;  3FW2 A;  14GS A;  3IAM 2;  3TKS A;  3LG6 A;  2GZP A;  1T1V A;  2ZCT A;  5DAL B;  2YN1 A;  4JR6 A;  2DML A;  3GKM A;  6GSU A;  2N5A A;  2MYG A;  4E8H A;  2AB6 A;  2JAC A;  2OE1 A;  3GFK A;  4BVX A;  1Q98 A;  3QAG A;  3ZTL A;  1A0F A;  2UZ8 A;  3HD5 A;  3RHB A;  2O89 A;  4K9Z A;  2M80 A;  3A5W A;  4BL7 B;  4DVC A;  4Q5N A;  1PN9 A;  2MBS A;  1MDJ A;  3I6A A;  3RDW A;  4N0Z A;  3CBU A;  4OMV A;  1HNB A;  3GRX A;  1R4W A;  2V6O A;  4ID0 A;  5IOW A;  3TJF A;  2FNO A;  2C0F A;  1YKA A;  2R37 A;  1X9M B;  3NZN A;  1BG5 A;  5D9X A;  2B7K A;  9GSS A;  4I97 A;  4NHZ A;  1XZO A;  4DSR A;  1XWA A;  2HYX A;  3VWW A;  1TP9 A;  3UVT A;  2HT9 A;  3GNJ A;  3D4M A;  3ERW A;  3ZIT A;  3DVW A;  4MF6 A;  1S3A A;  2YWN A;  1X5C A;  2HLS A;  3LYP A;  4PNF A;  5CAX A;  1U3A A;  2HSM B;  2C0E A;  2L59 A;  1WE0 A;  1EZK A;  2H75 A;  2RM6 A;  4MJE A;  4PUF C;  4TR3 A;  3TRP A;  3I43 A;  4EDZ A;  5IMC A;  5ECS A;  3FZ4 A;  2QKE A;  3BBY A;  2YPM A;  2RLI A;  1Y6E A;  2HZF A;  4POB A;  4WEY A;  4L0U A;  2FHE A;  4HQS A;  1SD8 A;  3EVI A;  5COH A;  2DJ3 A;  3L0H A;  3H8Q A;  3CSJ A;  2H71 A;  5G5F A;  4KF9 A;  1N2A A;  3QMX A;  4I2U A;  4IKH A;  4QL9 A;  2L4Q A;  2VO4 A;  3FR9 A;  2VCV A;  4ULX A;  5DJM A;  4EO3 A;  5ECQ B;  4NMU A;  4FQU A;  1M9A A;  3QFA C;  2VM1 A;  4X0X A;  4EXJ A;  3TRQ A;  5H5Q A;  3FRC A;  3HCZ A;  1AW9 A;  4V2L A;  3KP8 A;  5ECM B;  2ZUP A;  4RQR A;  4PGT A;  4IEL A;  5ID2 A;  2NTO A;  2E0Q A;  2JAD A;  1PA3 A;  18GS A;  2EC4 A;  2O87 A;  1FW1 A;  2LRC A;  4HEA 2;  1WPI A;  4GXZ A;  3MWH A;  3WYW A;  2JZR A;  4KE3 A;  4JRR A;  3KMO A;  3NIV A;  5ECK B;  2ON5 A;  4ZL9 A;  3ZFB A;  2QSI A;  1QK8 A;  5IOX A;  4BVY B;  4NAX A;  4EL1 A;  1AQV A;  1O73 A;  2Z9S A;  3F6D A;  3FY7 A;  1VGL A;  1EP7 A;  3GMF A;  2LST A;  5FT3 A;  5KN2 A;  1EOH A;  3UMA A;  5DDL A;  5ECR B;  2D2Z A;  4KAE A;  2GDR A;  4MMM A;  1S3D A;  2H30 A;  3N5O A;  1JHB A;  2DJJ A;  4ECI A;  1T00 A;  3VPQ A;  4PTS A;  4G19 A;  2C0G A;  1EGR A; 
#chains in the Genus database with same CATH topology
 2LRT A;  3FR6 A;  4I2T A;  1WOU A;  4YQM A;  2X8H A;  3DML A;  1XWC A;  4N10 A;  4AKG A;  1VF4 A;  3ZML A;  3MSZ A;  5DQS A;  1UC7 A;  1PX6 A;  3FMW A;  5IMA A;  3C8E A;  1JLV A;  2OBK A;  2LKU A;  4V1A g;  2CV4 A;  4G0K A;  5H5S A;  4G0I A;  2C1Y A;  2MZC A;  4J2F A;  4K8M A;  1S3R A;  4PUR A;  2HSM A;  4TW5 A;  4YQV A;  2XPE A;  19GS A;  4QQ7 A;  5CP1 A;  1JZO A;  4IP6 A;  2OJL A;  3EU3 A;  1EOG A;  5J9B A;  2DIY A;  1BYE A;  1FG4 A;  3KTB A;  5ABR A;  5CRW A;  3ME8 A;  4EDY A;  1EP8 A;  3LW9 A;  2B5X A;  3FZ5 A;  4G9H A;  2GTU A;  5F07 A;  5A5H A;  2CQ9 A;  4K2X A;  2B7J A;  1V40 A;  2TRC P;  1QFN A;  3F9U A;  1TRS A;  1M2D A;  2DMM A;  3IDV A;  3UIW A;  1U6T A;  4PNG A;  4YQU A;  2AHE A;  4IQ1 A;  4NXI A;  5DQY A;  2N5F A;  1K0A A;  4KDU A;  4ECB A;  2IPA A;  1O8W A;  3LWA A;  3CTG A;  2MMA A;  3E3E A;  6GSX A;  4KDY A;  2H72 A;  1SKW B;  1GSY A;  4HSC X;  3FYG A;  1B8X A;  3L4N A;  1M0U A;  6GSY A;  1QUW A;  4PHZ C;  1NHO A;  4Q5R A;  1XWB A;  2X4A A;  3IOS A;  1AAZ A;  2WVY A;  4L8E A;  3F3Q A;  1NSW A;  4F2I A;  3U5R E;  2AAW A;  1RW1 A;  4OFM A;  5IO2 A;  4DSS B;  3GX8 A;  4AGS A;  1WP0 A;  1ZMA A;  2IWT A;  2V2G A;  2PU9 C;  3WGE A;  1SL2 B;  2L5O A;  1PQN A;  1DE2 A;  4MZB A;  4IBP A;  1THX A;  2L6D A;  5B6M A;  4OCE A;  5B8A A;  3KZQ A;  3TUE A;  2DC5 A;  3F4S A;  2PUK C;  3IK7 A;  4IVF A;  1OE8 A;  2R0C A;  2H76 A;  3Q74 A;  1T4Z A;  3DVX A;  5DCH A;  1XVW A;  4AF2 A;  1PGT A;  3MNG A;  3CWG A;  3HMJ G;  2CAQ A;  2R6K A;  3PR8 A;  5DCG A;  4MH2 A;  3UBL A;  2QC7 A;  4LL4 B;  4KW6 A;  1QQ2 A;  1FOV A;  3P90 A;  4EC0 A;  4BIK A;  3Q18 A;  4MP4 A;  3LEF A;  4MA9 A;  1S4B P;  2PVO C;  1QMV A;  2RUE A;  1VF3 A;  1JFU A;  11GS A;  5KN0 A;  3QAV A;  2LTK A;  2WGR A;  3E0U A;  2IL3 A;  3BOA A;  4OO5 A;  3IBH A;  2K6V A;  3W6G A;  3M9K A;  4GWR A;  2WW0 A;  2DJ1 A;  3F3R A;  3IC8 A;  2B1L A;  3ZRD A;  2GST A;  2I3Y A;  4H86 A;  2GSR A;  1JZR A;  1BJX A;  4F82 A;  5ECL B;  1Z6M A;  2VL2 C;  3CRT A;  3TRX A;  5JCU A;  3PIN A;  4JR4 A;  3C1S A;  2LQO A;  2IME A;  5J4U A;  1OYJ A;  1TRU A;  3APQ A;  1SEN A;  1XWK A;  4LL1 B;  3CSI A;  2NVL A;  4G01 A;  1O7U A;  1GRX A;  5EY6 A;  1JZW A;  1O85 A;  3G7J A;  4OCF A;  2C3N A;  3G7Y A;  3LSZ A;  5JCG A;  4X43 A;  1F9M A;  1K0B A;  2GSQ A;  2GLR A;  1Y25 A;  2B1K A;  3M9J A;  2WZ9 A;  5J3R A;  3LYK A;  5AIV A;  4DEJ A;  2DJ2 A;  4OFN A;  2FLS A;  1GTA A;  5HFG A;  3O6T A;  1JLW A;  3HKR A;  3WGX A;  2WW1 A;  4MLY A;  1GTU A;  3EE2 A;  3FEU A;  2MMO A;  2EFC A;  1OKT A;  1MDI A;  2IIY A;  3UBK A;  2ZNM A;  4ZL8 A;  3L9U A;  5ECN B;  5CRD A;  3APO A;  3LXZ A;  4BWQ A;  1EGO A;  5ID2 B;  2WZS A;  1BED A;  2YJ7 A;  1T3B A;  4P3Y B;  3QR6 A;  4OO4 A;  1SL1 B;  4OD7 A;  3GTU B;  1BG1 A;  5CRG A;  2P5Q A;  2A4H A;  4ZBA A;  4MF7 A;  1SJI A;  2I4A A;  2H73 A;  2C8U A;  3APS A;  1W4V A;  1WJK A;  3IHQ A;  2FD3 A;  1FB0 A;  4RI6 A;  5L71 A;  4HZ4 A;  1OC9 B;  3IRA A;  4ZL7 A;  1FHE A;  1ERU A;  13GS A;  1KBN A;  3MDK A;  4KUN A;  5DVB A;  1FAA A;  3L78 A;  3J7Y k;  5HR0 A;  3A2V A;  2I81 A;  1M2A A;  2V1M A;  3HYP A;  2KOK A;  4XIH A;  4JU5 A;  3DGQ A;  1YF0 A;  1H4O A;  2B6M A;  4V2N A;  1ERW A;  2O85 A;  1MTC A;  3ED3 A;  3QOU A;  4A5P A;  4GDF A;  2K18 A;  4AKH A;  1GH2 A;  1Z3E A;  4AJ7 A;  2H1G A;  4XS4 A;  5AIS A;  4EF0 A;  3Q6O A;  3GHA A;  4V2M A;  5LD0 A;  4MCU A;  3P8W A;  3BCK A;  1GL8 A;  1GUH A;  4K2D A;  3GUR A;  2B3S A;  1K0M A;  4WR4 A;  1EWX A;  4AKI A;  1GSF A;  2TRX A;  1X9S B;  1TOF A;  2K8V A;  3EPT A;  2V41 A;  2P31 A;  6GST A;  4ZB9 A;  2H19 A;  4EE0 A;  1KEB A;  5LNK e;  1J08 A;  4KDX A;  1PD2 1;  1Z9H A;  1FB6 A;  4MZC A;  1F2E A;  2YNX A;  4FYB A;  5B7C A;  1HNA A;  5ECP B;  1XW5 A;  4MDC A;  1URM A;  4Z7X A;  5ECH B;  1XW9 A;  3WT2 A;  5LCZ A;  3TKS C;  5IPH A;  3IAS 2;  3GH9 A;  2CX4 A;  5JWO B;  1EEM A;  2H0H A;  2GT5 A;  2F8A A;  1B4Q A;  1R26 A;  3VWX A;  1S3C A;  3UAP A;  1XVQ A;  3J7Y b;  1Z5Y E;  2LNT A;  2H6Z A;  2H0I A;  2E2G A;  2H8L A;  2HXK A;  1HNC A;  2WVX B;  1A23 A;  3ZL5 A;  4I5Q A;  1ST9 A;  4IJ3 A;  1TU8 A;  5JCW A;  2PBJ A;  5D9V A;  2FWE A;  5C04 A;  1XW6 A;  1DE1 A;  5ECO B;  3F4T A;  1C72 A;  1WWJ A;  3F4R A;  4LMW A;  4MH3 A;  4EUY A;  2OAC A;  4EKZ A;  4BPY A;  4G2E A;  4XCS A;  2C3T A;  1GSE A;  3GTU A;  3CYN A;  4K1F A;  1EV4 A;  3O3T A;  2A4V A;  4TVE A;  1SVL A;  3HHV A;  4TXO B;  4NHW A;  2B5E A;  2H74 A;  3EC3 A;  4ZIJ A;  2BTO T;  2LJR A;  4N0V A;  3GX0 A;  4ZIL A;  4GST A;  4F0B A;  5KOW A;  1M9B A;  4HZ2 A;  1KNG A;  4XRD A;  5INY A;  1V98 A;  4XRA A;  1ZL9 A;  5JWQ B;  3EMX A;  1X5E A;  1A2J A;  2H0G A;  3M0F A;  5DAK A;  1OC9 A;  2C0D A;  5C00 A;  5GZZ B;  4CHS A;  2CAI A;  5IMF A;  3CRU A;  4LMV A;  3IC4 A;  4FIW A;  3ISO A;  2JZS A;  5G30 A;  1F3A A;  1PL2 A;  2K9F A;  3IR4 A;  5J40 A;  3LFL A;  1E2Y A;  1YQ1 A;  3CHX C;  4WF4 A;  3HJM A;  3V1W A;  4PX1 A;  4IW9 A;  1SD9 A;  1TU7 A;  1TXU A;  2HNL A;  3L9S A;  1M7T A;  3ZVJ D;  1TXX A;  3PH9 A;  3GSS A;  2WRT A;  3CXG A;  3FHK A;  2M72 A;  1GUL A;  2OE0 A;  4X1U A;  4ILF A;  5J47 A;  4Z2T A;  3ZIJ A;  1Z7P A;  3RPN A;  3C7M A;  3IK9 A;  2H01 A;  4PI2 C;  4D73 B;  1SYR A;  2WW3 A;  1ABA A;  3UVH A;  2AJQ B;  3TGZ A;  1NW2 A;  2F9S A;  1ERT A;  1B9Y C;  2R3X A;  3QDN A;  3ZLP A;  4ZB8 A;  2A2S A;  1ACV A;  3GYK A;  3ZRE A;  2GZY A;  1T4Y A;  2IFQ B;  3DXB A;  5AGY A;  1AC1 A;  4JE1 A;  2C3Q A;  4O5R A;  2YWO A;  3KGK A;  1DUG A;  2QGV A;  1FO5 A;  4TR1 B;  3HDC A;  1ILO A;  2DBC A;  3TJJ A;  5HR1 A;  2AYT A;  4MJB A;  1K3L A;  3JCM L;  3D4T A;  3EWL A;  4TXV A;  2PVQ A;  1SYX A;  1TI3 A;  1GUM A;  3VUR A;  3WGD A;  1EV9 A;  3GV1 A;  4FYU A;  2WVX A;  3CMI A;  1E6B A;  2HRA A;  1TKD B;  2LRN A;  1ZOF A;  2VIM A;  2YCD A;  1JZD A;  1ZZY A;  2LEG A;  3UAR A;  8GSS A;  1LJR A;  1SK0 A;  3DRN A;  4YAV A;  3GST A;  2KUC A;  5IQY A;  4TR4 A;  1G6W A;  2FUG 2;  5DJL A;  5ELA A;  2YZH A;  3H79 A;  1V2A A;  5ECI B;  1F3B A;  5J4V A;  1YF1 A;  1K3Y A;  3CTF A;  1ML6 A;  2VUP A;  2YV9 A;  4TXO A;  3QAW A;  3VWV A;  1KTE A;  3FK8 A;  3HVN A;  3RHC A;  4FO5 A;  2GSS A;  1BF5 A;  3FZ9 A;  6GSV A;  2H66 A;  2H6Y A;  1EEJ A;  3FKF A;  1T7P B;  4F0C A;  1A8Y A;  3GUS A;  3L9V A;  1B9X C;  5HR2 A;  4ISD A;  1TTZ A;  2P0G A;  5GST A;  2GQK A;  3ZYW A;  4HJM A;  1V58 A;  3N9J A;  2R0G A;  5IO0 A;  2GGT A;  2J23 A;  4KGI A;  3WD6 A;  1U3I A;  4ZB6 A;  2VCW A;  4I6X A;  3QD9 A;  4ECJ A;  4AJ6 A;  5J41 A;  1QGV A;  1K0O A;  3HZ8 A;  4FXY P;  2BMX A;  5IMD A;  1O81 A;  1SJ6 A;  1GSQ A;  2MBT A;  1SKS B;  1WRY A;  3BD2 A;  1PMT A;  4IP1 A;  2AUV A;  5G5E A;  4GLT A;  5CRE A;  3QFB C;  3OR5 A;  1V57 A;  3DYR A;  1XG8 A;  2LNS A;  4MF5 A;  5H5R A;  4D73 A;  2JSY A;  1IYI A;  2X8G A;  2HSY A;  2XBQ A;  2PGT A;  1N8J A;  3DEX A;  4WET A;  1TW9 A;  1YEP A;  1YZX A;  2IMF A;  2PWJ A;  2VCQ A;  4MPF A;  3RAZ A;  5CNW A;  1ZYQ B;  6GSS A;  2ES7 A;  2RM5 A;  4QMK A;  3VK9 A;  5EVO A;  1TRW A;  4ZB7 A;  2IFQ A;  4J57 E;  4TOP A;  4XS4 B;  2HRK B;  3LXT A;  4WF5 A;  4LLR A;  4GF0 A;  4G10 A;  2PN8 A;  5D96 A;  2YOI A;  2VD1 A;  4GQC A;  4KSM A;  3GIX A;  1G7E A;  4TR1 A;  1A2L A;  1PN0 A;  4G0L A;  1PL1 A;  4IHU A;  3VI7 A;  5A4V A;  1R7H A;  4GSN A;  4ECC A;  4KH7 A;  4TKY A;  3SBC A;  4HUA A;  2JU5 A;  1T8E B;  1XBS A;  1O8X A;  2EFH A;  5D9W A;  3KP9 A;  2CZ2 A;  3F63 A;  3GKK A;  4L5L A;  2YP6 A;  1OVN A;  5KEJ A;  1VF1 A;  3F6F A;  3LOR A;  4NPB A;  2DKI A;  4QL7 A;  4HOJ A;  4K7I A;  4CDO A;  1Q4J A;  3M8N A;  4BA7 A;  2IJY A;  4K0N A;  2JSZ A;  4BWS A;  3WT1 A;  3G7I A;  3UOM A;  2HFD A;  2XC2 A;  3HY2 A;  2YAN A;  5A4W A;  3TOU A;  1GTI A;  4WBJ A;  4N30 A;  4HDE A;  1G7O A;  5G1K A;  12GS A;  2WS2 A;  4K5R A;  3TJK A;  3LQ7 A;  1X5D A;  1MDK A;  3HA9 A;  4CW9 A;  1MEK A;  4XS1 A;  2PMT A;  4POM A;  1GWC A;  2GZZ A;  2V6K A;  2XHF A;  1TJD A;  2HI7 A;  3O76 A;  3H1N A;  2B5Y A;  1VRS D;  2OAD A;  5ENU A;  3EMP A;  1XCC A;  2AV4 A;  2GQL A;  2YWM A;  4Q5F A;  5F06 A;  1TK8 B;  1OAZ A;  2O3E A;  2FA4 A;  1GLP A;  2F51 A;  3ZIV A;  1XOA A;  2FCH A;  3HVV A;  5KOX A;  2R5G A;  2HZE B;  2FY6 A;  2LJA A;  22GS A;  1XPV A;  3GKN A;  17GS A;  4FH8 A;  4PI0 C;  1B4P A;  1YY7 A;  4WXT A;  2J9H A;  1PKW A;  5DAK B;  4ZBB A;  4NV5 A;  3A2W A;  1ZYP A;  20GS A;  4KA0 A;  4NV2 A;  3GA4 A;  4WBR D;  3E9J B;  2RUF A;  2GT6 A;  3HJO A;  3MYD A;  2KP2 A;  2E7P A;  1GUK A;  1YDK A;  3TJB A;  4EVM A;  3PPU A;  1G0T A;  2FGX A;  4JZQ A;  5D73 A;  2PER A;  1PFO A;  5F0G A;  1CQG A;  2HRK A;  2OBI A;  1RK4 A;  2H1A A;  5E59 A;  3KEB A;  3NOF A;  5KN3 A;  1GSU A;  4MJA A;  1ON4 A;  4I8B A;  5FWG A;  2L5L A;  4L5O A;  4L0W A;  3KXO A;  2OT3 A;  1G6Y A;  5DBQ A;  1NM3 A;  3W8S A;  1K3O A;  2H6X A;  5BRT A;  1OC3 A;  2JZT A;  1MD4 A;  5D93 A;  5JWR B;  3C73 A;  1WMJ A;  1W89 A;  1GLQ A;  1AXD A;  4W66 A;  5EL8 A;  1HQO A;  1GSD A;  1PKZ A;  3R3E A;  3TCO A;  1RQM A;  1F37 A;  2DJ0 A;  2FA8 A;  3KM6 A;  2G0F A;  4FYC A;  4HJ2 A;  1NHY A;  1O6J A;  4HQZ A;  2C80 A;  2ON7 A;  2FWG A;  3DIE A;  1U88 A;  4AI6 A;  2VLV A;  2VL9 A;  2H1B A;  7GSS A;  1AUC A;  3DKS A;  4KCA A;  3EIN A;  2EIQ A;  2VL3 A;  2X99 A;  4O92 A;  10GS A;  2HSN B;  3QPM A;  1PSQ A;  1B48 A;  1XWG A;  3UEM A;  5CRH A;  3VLN A;  2KLX A;  1WIK A;  4CY8 A;  2PPT A;  2LS5 A;  4CY6 A;  2FWH A;  4YAP A;  1BQ7 A;  4XS6 A;  4GSS A;  2WUL A;  2H70 A;  2CA8 A;  3EU4 A;  1THO A;  3US3 A;  3CSH A;  2VLU A;  3TKQ A;  4HU7 A;  3IE3 A;  3ERF A;  1SK2 A;  1BAY A;  3UJ1 A;  2LJK A;  2VAF A;  1K0D A;  3I9V 2;  1BX9 A;  2HE3 A;  4KX4 A;  4MAB A;  4HU9 A;  3TOT A;  1ZGN A;  2K8S A;  2MMZ A;  2HZE A;  2WB9 A;  2LQQ A;  4V1A p;  3S9F A;  4KCE A;  5DAL A;  1A0R P;  4GCI A;  4EIQ A;  4RUV A;  2WFC A;  4F03 A;  5G2Z A;  3IV4 A;  5HFK A;  5B8B A;  3GL3 A;  2VOC A;  1TI1 A;  3TKP A;  3A2X A;  3KJY A;  1PX7 A;  4JBB A;  1XXU A;  2RII A;  4MZW A;  3SWL A;  4BL7 A;  2VM2 A;  2TIR A;  1XFL A;  1J9B A;  1K0N A;  5HFI A;  4AJ8 A;  3HJP A;  4PQ1 A;  1FVK A;  3ZMK A;  1UVZ A;  3TKR A;  2GQM A;  3M1G A;  3R2Q A;  1OC8 A;  2L57 A;  1XOB A;  3FZA A;  2G2Q A;  4K6X A;  3QCP A;  16GS A;  2BJX A;  1AQX A;  2VCZ A;  1GNW A;  4ZXG A;  1Y1U A;  1Z7R A;  2MMN A;  1UA5 A;  4WR5 A;  2NPB A;  3TJG A;  2KHP A;  1A8L A;  1HYU A;  3I69 A;  4EIP A;  4YKG A;  1OE7 A;  2EIR A;  6GSW A;  1AIU A;  3KIJ A;  4DSQ A;  3D22 A;  3D5J A;  4K7N A;  1M2B A;  1QXH A;  3EUR A;  4XHM A;  3D0Z A;  3BCI A;  1A2M A;  2CVD A;  3RGB C;  1X0R A;  1TK5 B;  1USB A;  2YWI A;  3A3T A;  3GL5 A;  5IM9 A;  3KCM A;  5J4Y A;  1R5A A;  5G1L A;  2LV3 A;  2F8F A;  1YJ6 A;  1DBY A;  5J9C A;  2OKA A;  4K7O A;  2A2P A;  2CZ3 A;  3PGT A;  2VCX A;  3KMN A;  2HSN A;  1FVJ A;  2I9H A;  4JED A;  4O5U A;  4OFT A;  1U87 A;  1I9D A;  4POK A;  1HD2 A;  5A4U A;  4TN8 A;  2E2M A;  5GAN D;  1X9W B;  1TRV A;  2IMD A;  5G31 A;  4K5S A;  5D8I A;  2DLX A;  2CVB A;  3CQF A;  4HS1 A;  1I5G A;  2NDO A;  5IMV A;  5BMU B;  2P5R A;  3GH6 A;  3K8N A;  1AQW A;  3ERG A;  4HI7 A;  5D9T A;  1YVL A;  3GN3 A;  1XIY A;  1SJZ A;  2M46 A;  1MD3 A;  4YH2 A;  2X8C A;  4GRF A;  2I1U A;  1YEX A;  2VKZ G;  4ZBD A;  1SK1 A;  4IN0 A;  3LJR A;  2OE3 A;  3HVS A;  2NBS A;  4GQF A;  1YKC A;  4ML6 A;  3C71 A;  5HR3 A;  5CYY A;  4N11 A;  3IA1 A;  3HVX A;  3FR3 A;  1ZCP A;  2LUS A;  2VL2 A;  4PQH A;  4BVY A;  5IIZ A;  4IQA A;  1ERV A;  2EIO A;  4USS A;  5E4W A;  2VD0 A;  1H75 A;  2N5B A;  3EYT A;  4X4J A;  3VWU A;  2DSA A;  4O32 A;  4IGJ A;  2YV7 A;  1GTB A;  2YJH A;  4IJI A;  2WDU A;  3GKX A;  2XBI A;  3IXR A;  1K0C A;  5A34 B;  5J5N A;  1F6M C;  1V9W A;  3W8J A;  4KSO A;  1YEW C;  4PQI A;  4NWY A;  4POL A;  4PUA A;  1DSB A;  4K0G A;  3IHG A;  3VI5 A;  5B6N A;  2JL4 A;  4MK3 A;  3TDG A;  2HRN A;  2WW2 A;  3F8U A;  2C4J A;  2R4V A;  2FWF A;  3KH7 A;  4OWY A;  4BVX B;  5ELG A;  3RPP A;  1FOH A;  2WVZ A;  4WKW A;  1M99 A;  3IPZ A;  2HQT A;  2CX3 A;  3KH9 A;  2DJK A;  2YZU A;  4ML1 A;  2X64 A;  1GNE A;  4PXO A;  1SKR B;  3ZZX A;  2O36 A;  3MIX A;  4E8E A;  2O7K A;  3TKS E;  3BJ5 A;  1R5P A;  3P7X A;  2IN3 A;  2XPD A;  5A1N B;  4LA1 A;  1OKD A;  2R2J A;  1J0F A;  2CVK A;  1GP1 A;  3D6I A;  3ZVJ A;  1ZYN A;  1GSS A;  3F0I A;  2GS3 A;  3LGC A;  2WCI A;  4ACS A;  5GAP D;  5F8B A;  4KB3 A;  3M3M A;  5IPG A;  3ME7 A;  3MAK A;  1UN2 A;  4MJC A;  4RQX A;  4RI7 A;  5AIX A;  2F3M A;  2IMK A;  1A24 A;  2V32 A;  2DKH A;  1CQH A;  2KP1 A;  3ZFL A;  3DD3 A;  4N3Z A;  3UL3 A;  5KN1 A;  1TK0 B;  5BMU A;  3HXS A;  1SL0 B;  2DIZ A;  1IYH A;  5F05 A;  2GVP A;  3C1R A;  4XTS A;  1LU4 A;  3TU3 B;  3U6V A;  5IMZ A;  3VFI A;  4Z2R A;  2VCT A;  4KND A;  2L6C A;  4IS0 A;  4MPG A;  2VLT A;  3G9B A;  4F9Z A;  4O7H A;  2OA7 A;  5CO3 A;  3KD0 A;  1SU9 A;  4TR0 A;  4GTU A;  5HQP A;  5EPF A;  2REM A;  5A5K A;  2WJU A;  3DWV A;  3KTL A;  2ALB A;  3HZ4 A;  1VF2 A;  4YKF A;  3Q19 A;  5GSS A;  2L4C A;  3VPT A;  1Z6N A;  2CT6 A;  2HRF A;  4DSS A;  3H93 A;  4Q5Q A;  1PRX A;  2H1D A;  5AN1 A;  3H4K A;  2O8V B;  3D21 A;  4TRX A;  2R0P A;  1LBK A;  3RBT A;  3AY8 A;  3TB2 A;  2A2R A;  1TDI A;  1ZYE A;  2HSH A;  2IMI A;  3P2A A;  5FHI A;  5A34 A;  4J56 E;  3FW2 A;  14GS A;  3IAM 2;  3TKS A;  3LG6 A;  2GZP A;  1T1V A;  2ZCT A;  5DAL B;  2YN1 A;  4JR6 A;  2DML A;  3GKM A;  6GSU A;  2N5A A;  2MYG A;  4E8H A;  3A5I A;  2AB6 A;  2JAC A;  2OE1 A;  3GFK A;  4BVX A;  1Q98 A;  3QAG A;  3ZTL A;  1A0F A;  1M3J A;  2UZ8 A;  3HD5 A;  3RHB A;  4E68 A;  2H1L A;  2O89 A;  4K9Z A;  2M80 A;  3A5W A;  2X49 A;  4BL7 B;  4DVC A;  4Q5N A;  4O5Q A;  1PN9 A;  2MBS A;  4ICY A;  1MDJ A;  3I6A A;  2EFE A;  3RDW A;  4N0Z A;  3CBU A;  5A1N A;  4OMV A;  1HNB A;  3GRX A;  1R4W A;  2V6O A;  4ID0 A;  5IOW A;  3TJF A;  2FNO A;  2C0F A;  1YKA A;  2R37 A;  1X9M B;  3NZN A;  1BG5 A;  5D9X A;  2B7K A;  9GSS A;  4I97 A;  4NHZ A;  1XZO A;  4DSR A;  1XWA A;  2HYX A;  3VWW A;  1TP9 A;  3UVT A;  2HT9 A;  3GNJ A;  3D4M A;  4Z2U A;  3ERW A;  3ZIT A;  3DVW A;  4MF6 A;  1S3A A;  2YWN A;  1X5C A;  2HLS A;  3LYP A;  4PNF A;  5CAX A;  1U3A A;  2HSM B;  2C0E A;  2L59 A;  1WE0 A;  1EZK A;  2H75 A;  2RM6 A;  4MJE A;  4PUF C;  4TR3 A;  3TRP A;  3I43 A;  4EDZ A;  5IMC A;  5ECS A;  3FZ4 A;  1SVM A;  2QKE A;  3BBY A;  2YPM A;  2RLI A;  1Y6E A;  2HZF A;  4POB A;  4WEY A;  4L0U A;  2FHE A;  5A5H B;  4HQS A;  1SD8 A;  3EVI A;  5COH A;  2DJ3 A;  4AKX B;  3L0H A;  3H8Q A;  2QA1 A;  3CSJ A;  2H71 A;  5G5F A;  2EFD A;  4KF9 A;  1N2A A;  3QMX A;  4I2U A;  4IKH A;  4QL9 A;  2L4Q A;  2VO4 A;  3FR9 A;  2QA2 A;  2VCV A;  4ULX A;  5DJM A;  4EO3 A;  5ECQ B;  4NMU A;  4FQU A;  1M9A A;  3QFA C;  2VM1 A;  4X0X A;  4EXJ A;  3TRQ A;  1M3I A;  5H5Q A;  3FRC A;  3HCZ A;  1AW9 A;  4V2L A;  3KP8 A;  1N25 A;  5ECM B;  2ZUP A;  4RQR A;  4PGT A;  4IEL A;  5ID2 A;  3RFR C;  2NTO A;  2E0Q A;  2JAD A;  1PA3 A;  18GS A;  2EC4 A;  2O87 A;  1FW1 A;  2LRC A;  4HEA 2;  1WPI A;  4GXZ A;  3MWH A;  3WYW A;  2JZR A;  2UV8 G;  4KE3 A;  4JRR A;  3KMO A;  3NIV A;  5ECK B;  2ON5 A;  4ZL9 A;  3ZFB A;  2QSI A;  4MNN A;  1QK8 A;  5IOX A;  4BVY B;  4NAX A;  4EL1 A;  1AQV A;  1O73 A;  2Z9S A;  3F6D A;  2O5V A;  3FY7 A;  1VGL A;  1EP7 A;  3GMF A;  2LST A;  5FT3 A;  5KN2 A;  1EOH A;  1I1I P;  3UMA A;  5DDL A;  5ECR B;  2D2Z A;  4KAE A;  2GDR A;  4MMM A;  1S3D A;  2H30 A;  3N5O A;  1JHB A;  2DJJ A;  4ECI A;  1T00 A;  1SVO A;  3VPQ A;  4PTS A;  4G19 A;  2C0G A;  1EGR A; 
#chains in the Genus database with same CATH homology
 2LRT A;  3FR6 A;  4I2T A;  1WOU A;  4YQM A;  2X8H A;  3DML A;  1XWC A;  4N10 A;  4AKG A;  1VF4 A;  3ZML A;  3MSZ A;  5DQS A;  1UC7 A;  1PX6 A;  3FMW A;  5IMA A;  3C8E A;  1JLV A;  2OBK A;  2LKU A;  4V1A g;  2CV4 A;  4G0K A;  5H5S A;  4G0I A;  2C1Y A;  2MZC A;  4J2F A;  4K8M A;  4PUR A;  2HSM A;  4TW5 A;  4YQV A;  2XPE A;  19GS A;  4QQ7 A;  5CP1 A;  1JZO A;  4IP6 A;  2OJL A;  3EU3 A;  1EOG A;  5J9B A;  2DIY A;  1BYE A;  1FG4 A;  3KTB A;  5ABR A;  5CRW A;  3ME8 A;  4EDY A;  1EP8 A;  3LW9 A;  2B5X A;  3FZ5 A;  4G9H A;  2GTU A;  5F07 A;  5A5H A;  2CQ9 A;  4K2X A;  2B7J A;  1V40 A;  2TRC P;  1QFN A;  3F9U A;  1TRS A;  1M2D A;  2DMM A;  3IDV A;  3UIW A;  1U6T A;  4PNG A;  4YQU A;  2AHE A;  4IQ1 A;  4NXI A;  5DQY A;  2N5F A;  1K0A A;  4KDU A;  4ECB A;  2IPA A;  1O8W A;  3LWA A;  3CTG A;  2MMA A;  3E3E A;  6GSX A;  4KDY A;  2H72 A;  1SKW B;  1GSY A;  3FYG A;  1B8X A;  3L4N A;  1M0U A;  6GSY A;  1QUW A;  1NHO A;  4Q5R A;  1XWB A;  2X4A A;  3IOS A;  1AAZ A;  4L8E A;  3F3Q A;  1NSW A;  4F2I A;  3U5R E;  2AAW A;  1RW1 A;  4OFM A;  5IO2 A;  4DSS B;  3GX8 A;  4AGS A;  1WP0 A;  1ZMA A;  2IWT A;  2V2G A;  2PU9 C;  3WGE A;  1SL2 B;  2L5O A;  1PQN A;  1DE2 A;  4MZB A;  4IBP A;  1THX A;  2L6D A;  5B6M A;  4OCE A;  5B8A A;  3KZQ A;  3TUE A;  2DC5 A;  3F4S A;  2PUK C;  3IK7 A;  4IVF A;  1OE8 A;  2R0C A;  2H76 A;  3Q74 A;  1T4Z A;  3DVX A;  5DCH A;  1XVW A;  4AF2 A;  1PGT A;  3MNG A;  3CWG A;  3HMJ G;  2CAQ A;  2R6K A;  3PR8 A;  5DCG A;  4MH2 A;  3UBL A;  2QC7 A;  4LL4 B;  4KW6 A;  1QQ2 A;  1FOV A;  3P90 A;  4EC0 A;  3Q18 A;  4MP4 A;  3LEF A;  4MA9 A;  2PVO C;  1QMV A;  2RUE A;  1VF3 A;  1JFU A;  11GS A;  5KN0 A;  3QAV A;  2LTK A;  2WGR A;  3E0U A;  2IL3 A;  3BOA A;  4OO5 A;  3IBH A;  2K6V A;  3W6G A;  3M9K A;  4GWR A;  2DJ1 A;  3F3R A;  3IC8 A;  2B1L A;  3ZRD A;  2GST A;  2I3Y A;  4H86 A;  2GSR A;  1JZR A;  1BJX A;  4F82 A;  5ECL B;  1Z6M A;  2VL2 C;  3CRT A;  3TRX A;  5JCU A;  3PIN A;  4JR4 A;  3C1S A;  2LQO A;  2IME A;  5J4U A;  1OYJ A;  1TRU A;  3APQ A;  1SEN A;  1XWK A;  4LL1 B;  3CSI A;  2NVL A;  4G01 A;  1O7U A;  1GRX A;  5EY6 A;  1JZW A;  1O85 A;  3G7J A;  4OCF A;  2C3N A;  3G7Y A;  3LSZ A;  5JCG A;  4X43 A;  1F9M A;  1K0B A;  2GSQ A;  2GLR A;  1Y25 A;  2B1K A;  3M9J A;  2WZ9 A;  5J3R A;  3LYK A;  5AIV A;  4DEJ A;  2DJ2 A;  4OFN A;  2FLS A;  1GTA A;  5HFG A;  3O6T A;  1JLW A;  3HKR A;  3WGX A;  4MLY A;  1GTU A;  3EE2 A;  3FEU A;  2MMO A;  2EFC A;  1OKT A;  1MDI A;  2IIY A;  3UBK A;  2ZNM A;  4ZL8 A;  3L9U A;  5ECN B;  5CRD A;  3APO A;  3LXZ A;  4BWQ A;  1EGO A;  5ID2 B;  1BED A;  2YJ7 A;  1T3B A;  4P3Y B;  3QR6 A;  4OO4 A;  1SL1 B;  4OD7 A;  3GTU B;  1BG1 A;  5CRG A;  2P5Q A;  2A4H A;  4ZBA A;  4MF7 A;  1SJI A;  2I4A A;  2H73 A;  2C8U A;  3APS A;  1W4V A;  1WJK A;  3IHQ A;  2FD3 A;  1FB0 A;  4RI6 A;  5L71 A;  4HZ4 A;  1OC9 B;  3IRA A;  4ZL7 A;  1FHE A;  1ERU A;  13GS A;  1KBN A;  3MDK A;  4KUN A;  5DVB A;  1FAA A;  3L78 A;  3J7Y k;  5HR0 A;  3A2V A;  2I81 A;  1M2A A;  2V1M A;  3HYP A;  2KOK A;  4XIH A;  4JU5 A;  3DGQ A;  1YF0 A;  1H4O A;  2B6M A;  4V2N A;  1ERW A;  2O85 A;  1MTC A;  3ED3 A;  3QOU A;  4A5P A;  4GDF A;  2K18 A;  4AKH A;  1GH2 A;  1Z3E A;  4AJ7 A;  2H1G A;  4XS4 A;  5AIS A;  4EF0 A;  3Q6O A;  3GHA A;  4V2M A;  5LD0 A;  4MCU A;  3P8W A;  3BCK A;  1GL8 A;  1GUH A;  4K2D A;  3GUR A;  2B3S A;  1K0M A;  4WR4 A;  1EWX A;  4AKI A;  1GSF A;  2TRX A;  1X9S B;  1TOF A;  2K8V A;  3EPT A;  2V41 A;  2P31 A;  6GST A;  4ZB9 A;  2H19 A;  4EE0 A;  1KEB A;  5LNK e;  1J08 A;  4KDX A;  1PD2 1;  1Z9H A;  1FB6 A;  4MZC A;  1F2E A;  2YNX A;  4FYB A;  5B7C A;  1HNA A;  5ECP B;  1XW5 A;  4MDC A;  1URM A;  4Z7X A;  5ECH B;  1XW9 A;  3WT2 A;  5LCZ A;  3TKS C;  5IPH A;  3IAS 2;  3GH9 A;  2CX4 A;  5JWO B;  1EEM A;  2H0H A;  2GT5 A;  2F8A A;  1B4Q A;  1R26 A;  3VWX A;  1S3C A;  3UAP A;  1XVQ A;  3J7Y b;  1Z5Y E;  2LNT A;  2H6Z A;  2H0I A;  2E2G A;  2H8L A;  2HXK A;  1HNC A;  1A23 A;  3ZL5 A;  4I5Q A;  1ST9 A;  4IJ3 A;  1TU8 A;  5JCW A;  2PBJ A;  5D9V A;  2FWE A;  5C04 A;  1XW6 A;  1DE1 A;  5ECO B;  3F4T A;  1C72 A;  1WWJ A;  3F4R A;  4LMW A;  4MH3 A;  4EUY A;  2OAC A;  4EKZ A;  4BPY A;  4G2E A;  4XCS A;  2C3T A;  1GSE A;  3GTU A;  3CYN A;  4K1F A;  1EV4 A;  3O3T A;  2A4V A;  4TVE A;  1SVL A;  3HHV A;  4TXO B;  4NHW A;  2B5E A;  2H74 A;  3EC3 A;  4ZIJ A;  2BTO T;  2LJR A;  4N0V A;  3GX0 A;  4ZIL A;  4GST A;  4F0B A;  5KOW A;  1M9B A;  4HZ2 A;  1KNG A;  4XRD A;  5INY A;  1V98 A;  4XRA A;  1ZL9 A;  5JWQ B;  3EMX A;  1X5E A;  1A2J A;  2H0G A;  3M0F A;  5DAK A;  1OC9 A;  2C0D A;  5C00 A;  5GZZ B;  4CHS A;  2CAI A;  5IMF A;  3CRU A;  4LMV A;  3IC4 A;  4FIW A;  3ISO A;  2JZS A;  5G30 A;  1F3A A;  1PL2 A;  2K9F A;  3IR4 A;  5J40 A;  3LFL A;  1E2Y A;  1YQ1 A;  4WF4 A;  3HJM A;  3V1W A;  4PX1 A;  4IW9 A;  1SD9 A;  1TU7 A;  1TXU A;  2HNL A;  3L9S A;  1M7T A;  3ZVJ D;  1TXX A;  3PH9 A;  3GSS A;  2WRT A;  3CXG A;  3FHK A;  2M72 A;  1GUL A;  2OE0 A;  4X1U A;  4ILF A;  5J47 A;  4Z2T A;  3ZIJ A;  1Z7P A;  3RPN A;  3C7M A;  3IK9 A;  2H01 A;  4D73 B;  1SYR A;  1ABA A;  3UVH A;  2AJQ B;  3TGZ A;  1NW2 A;  2F9S A;  1ERT A;  1B9Y C;  2R3X A;  3QDN A;  3ZLP A;  4ZB8 A;  2A2S A;  1ACV A;  3GYK A;  3ZRE A;  2GZY A;  1T4Y A;  2IFQ B;  3DXB A;  5AGY A;  1AC1 A;  4JE1 A;  2C3Q A;  4O5R A;  2YWO A;  3KGK A;  1DUG A;  2QGV A;  1FO5 A;  4TR1 B;  3HDC A;  1ILO A;  2DBC A;  3TJJ A;  5HR1 A;  2AYT A;  4MJB A;  1K3L A;  3JCM L;  3D4T A;  3EWL A;  4TXV A;  2PVQ A;  1SYX A;  1TI3 A;  1GUM A;  3VUR A;  3WGD A;  1EV9 A;  3GV1 A;  4FYU A;  3CMI A;  1E6B A;  2HRA A;  1TKD B;  2LRN A;  1ZOF A;  2VIM A;  2YCD A;  1JZD A;  1ZZY A;  2LEG A;  3UAR A;  8GSS A;  1LJR A;  1SK0 A;  3DRN A;  4YAV A;  3GST A;  2KUC A;  5IQY A;  4TR4 A;  1G6W A;  2FUG 2;  5DJL A;  5ELA A;  2YZH A;  3H79 A;  1V2A A;  5ECI B;  1F3B A;  5J4V A;  1YF1 A;  1K3Y A;  3CTF A;  1ML6 A;  2VUP A;  2YV9 A;  4TXO A;  3QAW A;  3VWV A;  1KTE A;  3FK8 A;  3RHC A;  4FO5 A;  2GSS A;  1BF5 A;  3FZ9 A;  6GSV A;  2H66 A;  2H6Y A;  1EEJ A;  3FKF A;  1T7P B;  4F0C A;  1A8Y A;  3GUS A;  3L9V A;  1B9X C;  5HR2 A;  4ISD A;  1TTZ A;  2P0G A;  5GST A;  2GQK A;  3ZYW A;  4HJM A;  1V58 A;  3N9J A;  2R0G A;  5IO0 A;  2GGT A;  2J23 A;  4KGI A;  3WD6 A;  1U3I A;  4ZB6 A;  2VCW A;  4I6X A;  3QD9 A;  4ECJ A;  4AJ6 A;  5J41 A;  1QGV A;  1K0O A;  3HZ8 A;  2BMX A;  5IMD A;  1O81 A;  1SJ6 A;  1GSQ A;  2MBT A;  1SKS B;  1WRY A;  3BD2 A;  1PMT A;  4IP1 A;  2AUV A;  5G5E A;  4GLT A;  5CRE A;  3QFB C;  3OR5 A;  1V57 A;  3DYR A;  2LNS A;  4MF5 A;  5H5R A;  4D73 A;  2JSY A;  1IYI A;  2X8G A;  2HSY A;  2XBQ A;  2PGT A;  1N8J A;  3DEX A;  4WET A;  1TW9 A;  1YEP A;  1YZX A;  2IMF A;  2PWJ A;  2VCQ A;  4MPF A;  3RAZ A;  5CNW A;  1ZYQ B;  6GSS A;  2ES7 A;  2RM5 A;  4QMK A;  3VK9 A;  5EVO A;  1TRW A;  4ZB7 A;  2IFQ A;  4J57 E;  4TOP A;  4XS4 B;  2HRK B;  3LXT A;  4WF5 A;  4LLR A;  4GF0 A;  4G10 A;  2PN8 A;  5D96 A;  2YOI A;  2VD1 A;  4GQC A;  4KSM A;  3GIX A;  1G7E A;  4TR1 A;  1A2L A;  1PN0 A;  4G0L A;  1PL1 A;  4IHU A;  3VI7 A;  5A4V A;  1R7H A;  4GSN A;  4ECC A;  4KH7 A;  4TKY A;  3SBC A;  4HUA A;  2JU5 A;  1T8E B;  1XBS A;  1O8X A;  2EFH A;  5D9W A;  3KP9 A;  2CZ2 A;  3F63 A;  3GKK A;  4L5L A;  2YP6 A;  1OVN A;  5KEJ A;  1VF1 A;  3F6F A;  3LOR A;  4NPB A;  2DKI A;  4QL7 A;  4HOJ A;  4K7I A;  4CDO A;  1Q4J A;  3M8N A;  4BA7 A;  2IJY A;  4K0N A;  2JSZ A;  4BWS A;  3WT1 A;  3G7I A;  3UOM A;  2HFD A;  2XC2 A;  3HY2 A;  2YAN A;  5A4W A;  3TOU A;  1GTI A;  4WBJ A;  4N30 A;  4HDE A;  1G7O A;  5G1K A;  12GS A;  2WS2 A;  4K5R A;  3TJK A;  3LQ7 A;  1X5D A;  1MDK A;  3HA9 A;  4CW9 A;  1MEK A;  4XS1 A;  2PMT A;  4POM A;  1GWC A;  2GZZ A;  2V6K A;  2XHF A;  1TJD A;  2HI7 A;  3O76 A;  3H1N A;  2B5Y A;  1VRS D;  2OAD A;  5ENU A;  3EMP A;  1XCC A;  2AV4 A;  2GQL A;  2YWM A;  4Q5F A;  5F06 A;  1TK8 B;  1OAZ A;  2FA4 A;  1GLP A;  2F51 A;  3ZIV A;  1XOA A;  2FCH A;  3HVV A;  5KOX A;  2R5G A;  2HZE B;  2FY6 A;  2LJA A;  22GS A;  1XPV A;  3GKN A;  17GS A;  4FH8 A;  1B4P A;  1YY7 A;  4WXT A;  2J9H A;  1PKW A;  5DAK B;  4ZBB A;  4NV5 A;  3A2W A;  1ZYP A;  20GS A;  4KA0 A;  4NV2 A;  3GA4 A;  4WBR D;  3E9J B;  2RUF A;  2GT6 A;  3HJO A;  3MYD A;  2KP2 A;  2E7P A;  1GUK A;  1YDK A;  3TJB A;  4EVM A;  3PPU A;  1G0T A;  2FGX A;  4JZQ A;  5D73 A;  2PER A;  5F0G A;  1CQG A;  2HRK A;  2OBI A;  1RK4 A;  2H1A A;  5E59 A;  3KEB A;  3NOF A;  5KN3 A;  1GSU A;  4MJA A;  1ON4 A;  4I8B A;  5FWG A;  2L5L A;  4L5O A;  4L0W A;  3KXO A;  2OT3 A;  1G6Y A;  5DBQ A;  1NM3 A;  3W8S A;  1K3O A;  2H6X A;  5BRT A;  1OC3 A;  2JZT A;  1MD4 A;  5D93 A;  5JWR B;  3C73 A;  1WMJ A;  1W89 A;  1GLQ A;  1AXD A;  4W66 A;  5EL8 A;  1HQO A;  1GSD A;  1PKZ A;  3R3E A;  3TCO A;  1RQM A;  1F37 A;  2DJ0 A;  2FA8 A;  3KM6 A;  2G0F A;  4FYC A;  4HJ2 A;  1NHY A;  1O6J A;  4HQZ A;  2C80 A;  2ON7 A;  2FWG A;  3DIE A;  1U88 A;  4AI6 A;  2VLV A;  2VL9 A;  2H1B A;  7GSS A;  1AUC A;  3DKS A;  4KCA A;  3EIN A;  2EIQ A;  2VL3 A;  2X99 A;  4O92 A;  10GS A;  2HSN B;  3QPM A;  1PSQ A;  1B48 A;  1XWG A;  3UEM A;  5CRH A;  3VLN A;  2KLX A;  1WIK A;  4CY8 A;  2PPT A;  2LS5 A;  4CY6 A;  2FWH A;  4YAP A;  1BQ7 A;  4XS6 A;  4GSS A;  2WUL A;  2H70 A;  2CA8 A;  3EU4 A;  1THO A;  3US3 A;  3CSH A;  2VLU A;  3TKQ A;  4HU7 A;  3IE3 A;  3ERF A;  1SK2 A;  1BAY A;  3UJ1 A;  2LJK A;  2VAF A;  1K0D A;  3I9V 2;  1BX9 A;  2HE3 A;  4KX4 A;  4MAB A;  4HU9 A;  3TOT A;  1ZGN A;  2K8S A;  2MMZ A;  2HZE A;  2WB9 A;  2LQQ A;  4V1A p;  3S9F A;  4KCE A;  5DAL A;  1A0R P;  4GCI A;  4EIQ A;  4RUV A;  2WFC A;  4F03 A;  5G2Z A;  3IV4 A;  5HFK A;  5B8B A;  3GL3 A;  2VOC A;  1TI1 A;  3TKP A;  3A2X A;  3KJY A;  1PX7 A;  4JBB A;  1XXU A;  2RII A;  4MZW A;  3SWL A;  4BL7 A;  2VM2 A;  2TIR A;  1XFL A;  1J9B A;  1K0N A;  5HFI A;  4AJ8 A;  3HJP A;  4PQ1 A;  1FVK A;  3ZMK A;  1UVZ A;  3TKR A;  2GQM A;  3M1G A;  3R2Q A;  1OC8 A;  2L57 A;  1XOB A;  3FZA A;  2G2Q A;  4K6X A;  3QCP A;  16GS A;  2BJX A;  1AQX A;  2VCZ A;  1GNW A;  4ZXG A;  1Y1U A;  1Z7R A;  2MMN A;  1UA5 A;  4WR5 A;  2NPB A;  3TJG A;  2KHP A;  1A8L A;  1HYU A;  3I69 A;  4EIP A;  4YKG A;  1OE7 A;  2EIR A;  6GSW A;  1AIU A;  3KIJ A;  4DSQ A;  3D22 A;  3D5J A;  4K7N A;  1M2B A;  1QXH A;  3EUR A;  4XHM A;  3D0Z A;  3BCI A;  1A2M A;  2CVD A;  1X0R A;  1TK5 B;  1USB A;  2YWI A;  3A3T A;  3GL5 A;  5IM9 A;  3KCM A;  5J4Y A;  1R5A A;  5G1L A;  2LV3 A;  2F8F A;  1YJ6 A;  1DBY A;  5J9C A;  2OKA A;  4K7O A;  2A2P A;  2CZ3 A;  3PGT A;  2VCX A;  3KMN A;  2HSN A;  1FVJ A;  2I9H A;  4JED A;  4O5U A;  4OFT A;  1U87 A;  1I9D A;  4POK A;  1HD2 A;  5A4U A;  4TN8 A;  2E2M A;  5GAN D;  1X9W B;  1TRV A;  2IMD A;  5G31 A;  4K5S A;  5D8I A;  2DLX A;  2CVB A;  4HS1 A;  1I5G A;  2NDO A;  5IMV A;  5BMU B;  2P5R A;  3GH6 A;  3K8N A;  1AQW A;  3ERG A;  4HI7 A;  5D9T A;  1YVL A;  3GN3 A;  1XIY A;  1SJZ A;  2M46 A;  1MD3 A;  4YH2 A;  2X8C A;  4GRF A;  2I1U A;  1YEX A;  2VKZ G;  4ZBD A;  1SK1 A;  4IN0 A;  3LJR A;  2OE3 A;  3HVS A;  2NBS A;  4GQF A;  1YKC A;  4ML6 A;  3C71 A;  5HR3 A;  5CYY A;  4N11 A;  3IA1 A;  3HVX A;  3FR3 A;  1ZCP A;  2LUS A;  2VL2 A;  4PQH A;  4BVY A;  5IIZ A;  4IQA A;  1ERV A;  2EIO A;  4USS A;  5E4W A;  2VD0 A;  1H75 A;  2N5B A;  3EYT A;  4X4J A;  3VWU A;  2DSA A;  4O32 A;  4IGJ A;  2YV7 A;  1GTB A;  2YJH A;  4IJI A;  2WDU A;  3GKX A;  2XBI A;  3IXR A;  1K0C A;  5A34 B;  5J5N A;  1F6M C;  1V9W A;  3W8J A;  4KSO A;  4PQI A;  4NWY A;  4POL A;  4PUA A;  1DSB A;  4K0G A;  3IHG A;  3VI5 A;  5B6N A;  2JL4 A;  4MK3 A;  3TDG A;  2HRN A;  3F8U A;  2C4J A;  2R4V A;  2FWF A;  3KH7 A;  4OWY A;  4BVX B;  5ELG A;  3RPP A;  1FOH A;  4WKW A;  1M99 A;  3IPZ A;  2HQT A;  2CX3 A;  3KH9 A;  2DJK A;  2YZU A;  4ML1 A;  2X64 A;  1GNE A;  4PXO A;  1SKR B;  3ZZX A;  3MIX A;  4E8E A;  2O7K A;  3TKS E;  3BJ5 A;  1R5P A;  3P7X A;  2IN3 A;  2XPD A;  5A1N B;  4LA1 A;  1OKD A;  2R2J A;  1J0F A;  2CVK A;  1GP1 A;  3D6I A;  3ZVJ A;  1ZYN A;  1GSS A;  3F0I A;  2GS3 A;  3LGC A;  2WCI A;  4ACS A;  5GAP D;  5F8B A;  4KB3 A;  3M3M A;  5IPG A;  3ME7 A;  3MAK A;  1UN2 A;  4MJC A;  4RQX A;  4RI7 A;  5AIX A;  2F3M A;  2IMK A;  1A24 A;  2V32 A;  2DKH A;  1CQH A;  2KP1 A;  3ZFL A;  3DD3 A;  4N3Z A;  3UL3 A;  5KN1 A;  1TK0 B;  5BMU A;  3HXS A;  1SL0 B;  2DIZ A;  1IYH A;  5F05 A;  2GVP A;  3C1R A;  4XTS A;  1LU4 A;  3TU3 B;  3U6V A;  5IMZ A;  3VFI A;  4Z2R A;  2VCT A;  4KND A;  2L6C A;  4IS0 A;  4MPG A;  2VLT A;  3G9B A;  4F9Z A;  4O7H A;  2OA7 A;  5CO3 A;  3KD0 A;  1SU9 A;  4TR0 A;  4GTU A;  5HQP A;  5EPF A;  2REM A;  5A5K A;  2WJU A;  3DWV A;  3KTL A;  2ALB A;  3HZ4 A;  1VF2 A;  4YKF A;  3Q19 A;  5GSS A;  2L4C A;  3VPT A;  1Z6N A;  2CT6 A;  2HRF A;  4DSS A;  3H93 A;  4Q5Q A;  1PRX A;  2H1D A;  5AN1 A;  3H4K A;  2O8V B;  3D21 A;  4TRX A;  2R0P A;  1LBK A;  3RBT A;  3AY8 A;  3TB2 A;  2A2R A;  1TDI A;  1ZYE A;  2HSH A;  2IMI A;  3P2A A;  5FHI A;  5A34 A;  4J56 E;  3FW2 A;  14GS A;  3IAM 2;  3TKS A;  3LG6 A;  2GZP A;  1T1V A;  2ZCT A;  5DAL B;  2YN1 A;  4JR6 A;  2DML A;  3GKM A;  6GSU A;  2N5A A;  2MYG A;  4E8H A;  3A5I A;  2AB6 A;  2JAC A;  2OE1 A;  3GFK A;  4BVX A;  1Q98 A;  3QAG A;  3ZTL A;  1A0F A;  2UZ8 A;  3HD5 A;  3RHB A;  4E68 A;  2H1L A;  2O89 A;  4K9Z A;  2M80 A;  3A5W A;  2X49 A;  4BL7 B;  4DVC A;  4Q5N A;  4O5Q A;  1PN9 A;  2MBS A;  4ICY A;  1MDJ A;  3I6A A;  2EFE A;  3RDW A;  4N0Z A;  3CBU A;  5A1N A;  4OMV A;  1HNB A;  3GRX A;  1R4W A;  2V6O A;  4ID0 A;  5IOW A;  3TJF A;  2FNO A;  2C0F A;  1YKA A;  2R37 A;  1X9M B;  3NZN A;  1BG5 A;  5D9X A;  2B7K A;  9GSS A;  4I97 A;  4NHZ A;  1XZO A;  4DSR A;  1XWA A;  2HYX A;  3VWW A;  1TP9 A;  3UVT A;  2HT9 A;  3GNJ A;  3D4M A;  4Z2U A;  3ERW A;  3ZIT A;  3DVW A;  4MF6 A;  1S3A A;  2YWN A;  1X5C A;  2HLS A;  3LYP A;  4PNF A;  5CAX A;  1U3A A;  2HSM B;  2C0E A;  2L59 A;  1WE0 A;  1EZK A;  2H75 A;  2RM6 A;  4MJE A;  4PUF C;  4TR3 A;  3TRP A;  3I43 A;  4EDZ A;  5IMC A;  5ECS A;  3FZ4 A;  1SVM A;  2QKE A;  3BBY A;  2YPM A;  2RLI A;  1Y6E A;  2HZF A;  4POB A;  4WEY A;  4L0U A;  2FHE A;  5A5H B;  4HQS A;  1SD8 A;  3EVI A;  5COH A;  2DJ3 A;  4AKX B;  3L0H A;  3H8Q A;  2QA1 A;  3CSJ A;  2H71 A;  5G5F A;  2EFD A;  4KF9 A;  1N2A A;  3QMX A;  4I2U A;  4IKH A;  4QL9 A;  2L4Q A;  2VO4 A;  3FR9 A;  2QA2 A;  2VCV A;  4ULX A;  5DJM A;  4EO3 A;  5ECQ B;  4NMU A;  4FQU A;  1M9A A;  3QFA C;  2VM1 A;  4X0X A;  4EXJ A;  3TRQ A;  5H5Q A;  3FRC A;  3HCZ A;  1AW9 A;  4V2L A;  3KP8 A;  1N25 A;  5ECM B;  2ZUP A;  4RQR A;  4PGT A;  4IEL A;  5ID2 A;  2NTO A;  2E0Q A;  2JAD A;  1PA3 A;  18GS A;  2EC4 A;  2O87 A;  1FW1 A;  2LRC A;  4HEA 2;  1WPI A;  4GXZ A;  3MWH A;  3WYW A;  2JZR A;  2UV8 G;  4KE3 A;  4JRR A;  3KMO A;  3NIV A;  5ECK B;  2ON5 A;  4ZL9 A;  3ZFB A;  2QSI A;  4MNN A;  1QK8 A;  5IOX A;  4BVY B;  4NAX A;  4EL1 A;  1AQV A;  1O73 A;  2Z9S A;  3F6D A;  2O5V A;  3FY7 A;  1VGL A;  1EP7 A;  3GMF A;  2LST A;  5FT3 A;  5KN2 A;  1EOH A;  3UMA A;  5DDL A;  5ECR B;  2D2Z A;  4KAE A;  2GDR A;  4MMM A;  1S3D A;  2H30 A;  3N5O A;  1JHB A;  2DJJ A;  4ECI A;  1T00 A;  1SVO A;  3VPQ A;  4PTS A;  4G19 A;  2C0G A;  1EGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...