4MP4A

Crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
212
structure length
198
Chain Sequence
EYFKLYTDSQFLSPYAFTVFVGLHEKQIPFEIAAIDLLTAKVPVLEHNDFALSESSAILEYLEELYPDTAIYPKDIQARARARQIQAWLRSDLVALRTERPTDVIFIQPKSTPLSEEGKKAAEKLFFVAEKLLASDAEFLFGSWSIVDAELALMLQRLIQNGDAVSERLKNYALQQWQRPSVQKWLALRHKAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase
publication title Crystal structure of a glutathione transferase family member from Acinetobacter baumannii, Target EFI-501785, apo structure
rcsb
source organism Acinetobacter baumannii
total genus 69
structure length 198
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mp4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mp4A01
5J4UA 3QFAC 3Q19A 2DLXA 2PPTA 3UL3A 3CXGA 5IO2A 14GSA 1GLPA 1XXUA 3TKSE 2QGVA 4PUFC 3QDNA 2XHFA 1THOA 6GSSA 4QQ7A 3KTLA 3ZMLA 2RIIA 1Y6EA 4IGJA 3R3EA 2LRCA 3GNJA 4GQCA 2LQQA 3GIXA 4K9ZA 2IMIA 2YCDA 2B5XA 3LG6A 3IBHA 5H5QA 3IK7A 5D96A 1QMVA 1KTEA 5JCGA 4TR3A 5AISA 3TOUA 2LNTA 3TKQA 4ISDA 4ULXA 2DJJA 2QC7A 5IPHA 4POLA 1AAZA 4LA1A 4ZILA 5ID2A 4MJAA 4GSSA 2I4AA 2A2RA 2P31A 2VL2A 4MH3A 2KLXA 2O7KA 2O87A 4JZQA 1EWXA 4NV5A 2YP6A 4KAEA 4BVYA 2GZPA 3NIVA 4WXTA 1F3AA 4HEA2 4HQZA 4G0KA 1V98A 3F3RA 3RDWA 2JZSA 4OD7A 3AY8A 1ZMAA 2VCTA 1OYJA 1ON4A 1SK2A 3QFBC 2F3MA 4EL1A 4ILFA 1GNWA 1TRUA 1Z6MA 4IJIA 3H4KA 2TRCP 2PWJA 2VAFA 2JADA 2H0HA 2GLRA 1S3DA 3RPNA 3FZAA 6GSUA 4XRAA 3IC8A 3LQ7A 4WETA 3EVIA 1I9DA 1LJRA 4EXJA 2OE0A 2OACA 5LCZA 4N0ZA 2IPAA 3PPUA 3M9JA 1SKWB 4TXOA 1GUMA 2H1DA 2GQMA 3CSHA 2MMAA 3D4MA 2AB6A 4ECCA 3D5JA 3HJPA 12GSA 3LYPA 5J5NA 2H8LA 3WGDA 3F4TA 4YH2A 1TK8B 1U3AA 1KBNA 4PQIA 2C0DA 3KMNA 1OE8A 5AIVA 5ECHB 1XWAA 3QR6A 1X9MB 1T7PB 3E3EA 1UVZA 4ID0A 6GSXA 2DJ1A 3ZITA 4KDUA 4E8EA 1GSSA 1XPVA 1DUGA 4BVXB 3P8WA 5COHA 2GVPA 2JZTA 4ACSA 4V2LA 1EEMA 4N10A 2LV3A 3GKXA 4ZL8A 5HR3A 1GTUA 5ECIB 1WE0A 1A2LA 4GXZA 2E7PA 2H72A 1GTBA 5F0GA 3O3TA 1TU7A 2PVOC 3WGEA 1OKDA 4HU7A 3E9JB 4OO5A 2K8SA 2OA7A 4PQHA 4BL7B 1R4WA 3KZQA 1BYEA 3Q18A 2V6OA 2H73A 4ZB8A 1ZYEA 1AQVA 3DKSA 1T3BA 4TXVA 4KSMA 4YQUA 1OAZA 1URMA 3MDKA 1RQMA 4GWRA 2EIRA 4NWYA 2PGTA 5CNWA 2HSNB 3TJKA 3ERGA 1JLVA 4HU9A 4OCEA 4GTUA 2L5LA 5E59A 1BG5A 2LRNA 1SJ6A 5BMUA 5IMAA 4IS0A 1FVKA 2WJUA 3IR4A 4POMA 3FW2A 2VLTA 4EC0A 4CDOA 4V1Ap 2DIZA 2IFQA 2LSTA 2YWNA 1Y25A 2B7KA 3CTGA 4MPGA 3PINA 3KXOA 1QXHA 3GN3A 1X9SB 5GZZB 4OMVA 3C71A 2B6MA 3HVSA 1M2BA 1YF0A 1TOFA 1YQ1A 1TI3A 2FCHA 2R4VA 4MJBA 2CX3A 1VF3A 4BPYA 2WFCA 4V2NA 3FR3A 1O8WA 5JCUA 3G7JA 3KMOA 3GA4A 2LNSA 2I9HA 4K1FA 5CREA 1VF4A 9GSSA 1FB6A 2F51A 1SL1B 3M3MA 2R6KA 2C1YA 2V2GA 4EDYA 1XBSA 4MCUA 2CQ9A 2VL2C 2AAWA 3TJGA 5JWRB 3TGZA 5F8BA 3H79A 4ZXGA 2I81A 4GQFA 4DVCA 1K0MA 4L0WA 4KGIA 1SJZA 1T1VA 2GGTA 5D9WA 3QPMA 5HFKA 1PN9A 2C3TA 1SU9A 4IJ3A 1GL8A 2VIMA 2B5EA 3FZ4A 5G30A 2H71A 1T8EB 2HSMB 2FHEA 5IMFA 1GUKA 4PURA 13GSA 4EKZA 5HR1A 1GSYA 1QQ2A 3CRUA 3D0ZA 4HI7A 5GSSA 1QFNA 3WT1A 5ENUA 1HNCA 1XIYA 2WRTA 3FR6A 2FGXA 1UC7A 2MMOA 2V32A 4AJ8A 3SWLA 5CRHA 4J2FA 1K3OA 1U6TA 4PXOA 4EUYA 1WIKA 4N11A 5CP1A 4ZL7A 3IXRA 1FG4A 2ZNMA 1EOGA 1QUWA 1Z9HA 3ERFA 1NW2A 2H76A 5B6MA 1XW5A 4NHZA 1GP1A 1R26A 2J9HA 2JACA 2VLVA 2E2GA 5CRGA 1GH2A 1O81A 19GSA 4LLRA 2ON5A 3KP9A 1GTIA 2VL3A 2X8HA 1S3AA 4EE0A 3H1NA 5E4WA 2YJHA 4KF9A 10GSA 4IQAA 2H01A 2EIQA 2H30A 5GAND 3HJMA 3GUSA 4V1Ag 1PKWA 4IW9A 1YJ6A 4XTSA 2TRXA 4ZBDA 3M1GA 1BAYA 4RQXA 5ECQB 3BBYA 1OC8A 4KDYA 5CRDA 1F2EA 4DSSA 5DALA 2X99A 1A23A 1WMJA 1K0NA 3VURA 1H4OA 1MDJA 3DWVA 4ZB6A 5ECKB 1C72A 3F63A 1QK8A 4KA0A 3HCZA 2A4VA 5L71A 3VK9A 4MLYA 1EGOA 1XVQA 3VWVA 4IQ1A 4LMWA 1F9MA 5KN0A 3MSZA 2LKUA 3EYTA 4K0NA 1GLQA 1M9BA 5A4UA 3VFIA 4I5QA 3RHBA 4MF7A 3KCMA 1AQXA 1EV4A 3HYPA 1TKDB 1XOAA 1V57A 2C8UA 2X64A 4NHWA 1SK1A 3DGQA 2FD3A 4I97A 2OKAA 3TRXA 1U88A 1DBYA 1EP7A 4Q5RA 3TCOA 1XVWA 1ERVA 1ZCPA 3ZRDA 5DCHA 5KEJA 3A2VA 1OVNA 5J41A 2VCQA 3US3A 4WF5A 1PQNA 2H1BA 2L6DA 3TKPA 4X43A 3ME7A 3DVWA 3ZMKA 3GMFA 3EMPA 3LWAA 3N9JA 4KH7A 4GLTA 2B1KA 3A2XA 3KH7A 5HFGA 2XPEA 3VWUA 1AXDA 3GL3A 4EDZA 5HQPA 4I6XA 5J9BA 2VL9A 1EGRA 1MD4A 4PX1A 2FLSA 2C3NA 2HSMA 2P0GA 3FHKA 4KNDA 2WULA 5DVBA 2MMNA 2M80A 1J9BA 1WOUA 5IM9A 5B8AA 5F05A 1Z6NA 2OJLA 1JZOA 2K8VA 1UA5A 2KOKA 1G7EA 1KNGA 4USSA 4MJEA 1FHEA 4KCAA 1V2AA 1AIUA 2PERA 2GS3A 3QD9A 1GSQA 5A4VA 2YPMA 3TJJA 2PVQA 1BX9A 2Z9SA 1SYRA 3NOFA 2PN8A 2N5AA 1TTZA 1XCCA 4IP6A 4EO3A 2F8AA 2YNXA 1A2JA 4K0GA 2IWTA 1MDKA 1TJDA 3EINA 3FEUA 2GQKA 5ECMB 2YZUA 2YZHA 3F9UA 1AUCA 2K9FA 3LXZA 1A8LA 1XWCA 2C4JA 3CBUA 4IKHA 1PX6A 3ZIVA 3QOUA 4MH2A 4WBRD 2VO4A 3C1RA 4DSRA 2V41A 3HDCA 3BCKA 3VLNA 22GSA 3F4SA 3PH9A 1BEDA 1MTCA 2YANA 4ZBAA 2HQTA 3IDVA 4H86A 1AW9A 2HNLA 1EV9A 2HZEA 1USBA 3ZL5A 1TI1A 1VRSD 3DYRA 2GSSA 3HVVA 2ALBA 3BJ5A 1FOVA 1OKTA 2HT9A 2GZYA 4TR1B 5ECOB 4AGSA 5GSTA 4PNFA 1TU8A 3UMAA 2H66A 5H5RA 3A3TA 4O32A 3EU3A 4Q5QA 3ISOA 3FY7A 3APSA 2YV7A 3IOSA 5DDLA 3GKMA 1TXXA 3GL5A 17GSA 1XWKA 5ELGA 3M9KA 1RW1A 5DBQA 4TR0A 4G19A 3W8JA 2IIYA 3CRTA 3L4NA 4G10A 1R7HA 3GRXA 4ZIJA 3I9V2 5IOXA 5HR0A 4ML6A 2MYGA 3IA1A 2JL4A 4HZ2A 1THXA 3HD5A 1M9AA 5DQSA 3ZFLA 1X5EA 4RI7A 3U5RE 3HKRA 4G0LA 2J23A 1WPIA 2A2SA 1JZRA 4IELA 1O85A 4ECBA 3VI5A 4PGTA 3LEFA 3W8SA 2REMA 5A5KA 4BWQA 5KN1A 4XRDA 3O6TA 3I43A 2L59A 3P7XA 4AJ7A 4GSNA 2QKEA 2CZ2A 2H0GA 4FQUA 4GRFA 2R5GA 5AN1A 1YKAA 3G7IA 3KD0A 1F3BA 1TRVA 1YF1A 1WRYA 1V58A 3EU4A 4O92A 4MPFA 2CAQA 5JWOB 3ZFBA 3FZ5A 3LXTA 3ME8A 4FYUA 4K6XA 4QL7A 1O6JA 4ECJA 5HR2A 2XBQA 3E0UA 5CAXA 4YQVA 2I3YA 4MZBA 1A0RP 2HSHA 2PMTA 1XW9A 2NDOA 5D93A 4GSTA 4K7OA 4ZBBA 2RM5A 1E2YA 4CHSA 3L78A 5C04A 5DAKB 1EEJA 3BD2A 1HNAA 4RUVA 5D9XA 3MNGA 6GSWA 3F8UA 2FY6A 1FO5A 5DJLA 1ACVA 4DSQA 5ABRA 3IK9A 4ZL9A 1DSBA 2WB9A 3ED3A 3GKKA 2VCWA 3J7Yb 3F6FA 4OWYA 1FAAA 1HYUA 3EC3A 2B1LA 4D73B 3I69A 2H19A 2VUPA 4NMUA 2H6XA 4J56E 4X1UA 20GSA 3MWHA 3GH6A 1GUHA 3M8NA 3VWWA 6GSVA 1MEKA 2R2JA 3DD3A 1ABAA 2GDRA 4P3YB 2AYTA 2H0IA 1G0TA 4JR6A 2GTUA 3EMXA 3HZ8A 1NHYA 2DJ2A 4BWSA 1M0UA 4K7IA 1A2MA 5G1LA 2MZCA 3D4TA 3IHQA 1RK4A 1NHOA 2NBSA 1XWBA 4BVXA 2HRAA 1T4YA 1ST9A 4I2TA 5IMZA 3J7Yk 3LJRA 1H75A 2CA8A 2X8CA 1U87A 1DE2A 5G1KA 1QGVA 2PBJA 3CMIA 2ZUPA 5FHIA 3L0HA 4BL7A 2C80A 1OE7A 3I6AA 3FKFA 3G9BA 3WGXA 5IO0A 3UAPA 1YKCA 1OC9B 1UN2A 3CSIA 2NVLA 2CZ3A 5B8BA 4N30A 2LS5A 1JLWA 1EZKA 5LNKe 3LGCA 4MA9A 2K6VA 1O8XA 2L6CA 1Z7RA 3EWLA 4F0CA 3CSJA 4G0IA 3FRCA 2L4QA 5B6NA 2FWEA 3KIJA 5F06A 3UBKA 4DEJA 3GFKA 1JZDA 1NM3A 3RAZA 2GSTA 2IMFA 1WP0A 1K0CA 1TP9A 1TK0B 2BTOT 2H6ZA 1SK0A 2P5QA 3VPTA 2B5YA 4JR4A 4K2DA 5D9TA 4MJCA 4HOJA 3GTUB 3GH9A 4MP4A 3TRPA 1X0RA 1SL0B 2H75A 4IP1A 4ECIA 2EIOA 4IBPA 3SBCA 1PA3A 2M72A 1PSQA 2H1AA 1IYIA 3WYWA 3TOTA 4EF0A 4XS6A 1F37A 1XOBA 2HRKB 1K3YA 3DIEA 5ECRB 1JZWA 1O7UA 5IMDA 1W4VA 5CO3A 3Q74A 1JFUA 2D2ZA 4MABA 3K8NA 4FH8A 1PL1A 4TR4A 4MK3A 2CT6A 5IIZA 1XWGA 3RPPA 2HRNA 1ERTA 1VGLA 3GHAA 4KE3A 2HZFA 4X0XA 3VWXA 4O5RA 2YOIA 4MF6A 3KGKA 1ERUA 5B7CA 2AUVA 1IYHA 2E2MA 1YEXA 1ZZYA 3D22A 2M46A 1TDIA 2PU9C 16GSA 1VF1A 1WJKA 2L4CA 5ECPB 4D73A 4MZCA 1BJXA 1G6YA 3CYNA 3UIWA 1MDIA 4Z7XA 1SKSB 2DMMA 3LSZA 1PD21 2RLIA 2YWOA 4F03A 3N5OA 2XC2A 1OC3A 4FYCA 5ECLB 3IPZA 2HE3A 2CX4A 3UVTA 4JEDA 2IMKA 2PUKC 1EP8A 1SYXA 3HZ4A 2HYXA 1GULA 4GCIA 3GSSA 5GAPD 4QL9A 2V6KA 3KTBA 5IMVA 3DMLA 3HJOA 3BOAA 3EURA 4L5OA 4TW5A 4HJMA 4XS4B 4L8EA 2XBIA 3IAM2 3ERWA 2IMDA 2HSYA 4GF0A 4MDCA 3IAS2 3QAGA 2H6YA 3PR8A 4TKYA 3JCML 2LRTA 2AJQB 1XZOA 3FK8A 3M0FA 5J9CA 1E6BA 2OBKA 2IFQB 3R2QA 2P5RA 1K0DA 3BCIA 6GSTA 2HI7A 2DMLA 4JBBA 3ZZXA 4HJ2A 2C0FA 5ECSA 4ML1A 1B4QA 4YAVA 3UOMA 3ZVJA 2WS2A 5JCWA 2IMEA 2WGRA 4JU5A 3WT2A 1V9WA 1LBKA 3F4RA 1OC9A 5EY6A 4TVEA 2C0EA 2NPBA 2H74A 2WDUA 4PQ1A 1M2AA 5C00A 2OE1A 5D9VA 1Z3EA 2VD1A 3TRQA 2NTOA 2GT6A 1M2DA 3QCPA 2FNOA 2OE3A 3PGTA 4ZB9A 3S9FA 4V2MA 4EVMA 1ZOFA 1HD2A 3TKSA 3MAKA 5G31A 4MMMA 3ZLPA 3TKRA 2O89A 4WR4A 1XFLA 4NXIA 3L9SA 5CYYA 3GTUA 5IPGA 2LUSA 2MMZA 4LMVA 3LYKA 1W89A 4XHMA 5AGYA 2CVBA 1N8JA 1PL2A 2TIRA 1BQ7A 3RHCA 4NV2A 2VCZA 2HFDA 1Z5YE 2CV4A 4FIWA 4JRRA 1Q98A 3IRAA 4OCFA 4RI6A 2HLSA 3P2AA 2AV4A 1B9XC 5G5FA 1LU4A 2HRKA 3DEXA 3GSTA 3QAWA 2YN1A 5ELAA 2VLUA 2RM6A 3C73A 1ZYQB 3G7YA 1A0FA 4TRXA 1T00A 2DSAA 1O73A 2XPDA 2QSIA 5F07A 1NSWA 2YWIA 4IHUA 4L0UA 1MD3A 2UZ8A 2FWHA 3F0IA 3HY2A 4PNGA 2H1GA 3C1SA 2DBCA 3C7MA 4Q5NA 1Z7PA 1ZGNA 3F3QA 2BJXA 3VPQA 2VM2A 2HRFA 3HVXA 3KJYA 1EOHA 5LD0A 2JU5A 5KN2A 4K8MA 1FB0A 3P90A 1YY7A 3APOA 2L5OA 2N5BA 3VI7A 2DJ3A 3GV1A 1Q4JA 2CVDA 1TRSA 1X9WB 2N5FA 3OR5A 1F6MC 4WR5A 4FYBA 1WWJA 1K0OA 4XS4A 3TJBA 4OFTA 3DVXA 4O7HA 1M99A 4DSSB 5DALB 1J08A 1R5PA 2BMXA 2IL3A 1J0FA 2JZRA 1GTAA 4WF4A 1PGTA 2EC4A 1GNEA 4OFNA 4G9HA 3A2WA 4J57E 4KW6A 2B7JA 2JSYA 4LL4B 1PRXA 2FWGA 1PX7A 5IQYA 18GSA 2F8FA 2VD0A 4WKWA 3ZREA 1X5DA 1FW1A 2HXKA 2YJ7A 2LJRA 4WBJA 4I8BA 2O85A 1ILOA 5ECNB 1CQHA 2B3SA 4KUNA 5A4WA 4K7NA 1YZXA 3H93A 2I1UA 1AQWA 4POBA 4TOPA 5EPFA 3C8EA 2VCVA 4NPBA 3W6GA 1U3IA 4F0BA 4PTSA 1GSEA 1S3CA 2G0FA 1K0AA 3DRNA 1SL2B 2YWMA 2FUG2 1VF2A 4BA7A 4TR1A 1AC1A 1GSUA 4KDXA 4FO5A 5INYA 2RUEA 3D21A 5J3RA 1HNBA 1A24A 1SENA 1B9YC 1JHBA 2LTKA 4JE1A 3FR9A 2GSQA 1XW6A 1ZL9A 4POKA 4I2UA 4TN8A 5JWQB 4G2EA 1KEBA 1GRXA 2OBIA 3TUEA 2R3XA 2C3QA 5FT3A 3TKSC 5DCGA 4IN0A 4CW9A 1PMTA 2ZCTA 3UJ1A 3O76A 3HHVA 5H5SA 4MZWA 4AF2A 2WCIA 3GYKA 4IVFA 2DIYA 3U6VA 2RUFA 3UARA 4F9ZA 5KN3A 1G6WA 2MBTA 4HS1A 3FYGA 4F2IA 4MF5A 4WEYA 2GSRA 5ID2B 6GSYA 3QMXA 3KH9A 4HZ4A 1M7TA 5G2ZA 2G2QA 1B8XA 1SD9A 3QAVA 1K3LA 2VCXA 2LEGA 4AJ6A 2C0GA 3L9VA 3GX8A 11GSA 1YDKA 5AIXA 1A8YA 5D8IA 3LORA 2KP2A 4BVYB 3WD6A 2LJKA 2LJAA 5G5EA 5IMCA 3GX0A 1TW9A 4XCSA 4KCEA 2ON7A 2FA4A 4HQSA 1CQGA 2GT5A 2O8VB 1GWCA 5EVOA 2H70A 3RBTA 4F82A 3GURA 3TJFA 4NAXA 4Q5FA 3F6DA 5DQYA 1K0BA 5CRWA 1PKZA 4KSOA 3FZ9A 1B4PA 3IE3A 4PUAA 2HZEB 4LL1B 1ML6A 1TRWA 2WZ9A 3UEMA 2ES7A 1SJIA 3L9UA 2DJKA 2DJ0A 5EL8A 3UVHA 2FA8A 1V40A 5DJMA 2FWFA 2KUCA 1R5AA 3GKNA 4XS1A 3TDGA 1HQOA 2F9SA 3IV4A 3TB2A 2CVKA 1GSFA 3APQA 2LQOA 4OO4A 1ERWA 7GSSA 3KEBA 3H8QA 2L57A 2IN3A 3KM6A 4KB3A 3NZNA 1TK5B 8GSSA 1YEPA 4TXOB 1B48A 1I5GA 1GSDA 2CAIA 1SD8A 2JSZA 5HFIA 1SKRB 2E0QA 3HA9A 5D73A 3IC4A 3DXBA 3EE2A 2DC5A 5DAKA 3UBLA 1N2AA 3KP8A 2R37A 2K18A 4E8HA 2OADA 2AHEA 4YQMA 3CTFA 3ZYWA 2VM1A 2MBSA 3LFLA 5FWGA 4XIHA 2YV9A 3HXSA 4OFMA 4HUAA 4L5LA 5IOWA 1DE1A 4HDEA 2KHPA 3ZTLA 4YAPA 4RQRA 2X8GA 1G7OA 2IJYA 1FVJA 3ZVJD 3ZIJA 3D6IA 1T4ZA 3A5WA 2V1MA 2GQLA 1X5CA 4N0VA 3V1WA 3Q6OA 4KX4A 2KP1A 2VOCA 2GZZA
chains in the Genus database with same CATH superfamily
5J4UA 3QFAC 3Q19A 2DLXA 2PPTA 3UL3A 3CXGA 5IO2A 14GSA 1GLPA 1XXUA 3TKSE 2QGVA 4PUFC 3QDNA 2XHFA 1THOA 6GSSA 4QQ7A 3KTLA 3ZMLA 2RIIA 2R0GA 1Y6EA 4IGJA 3R3EA 2LRCA 3GNJA 4GQCA 2WVZA 4G01A 2LQQA 3GIXA 4K9ZA 2IMIA 2YCDA 2B5XA 3LG6A 3IBHA 4FXYP 2WW0A 5H5QA 3IK7A 5D96A 1QMVA 1KTEA 1YVLA 5JCGA 4TR3A 5AISA 3TOUA 2LNTA 3TKQA 4ISDA 4ULXA 2DJJA 2QC7A 5IPHA 4POLA 1AAZA 4LA1A 4ZILA 5ID2A 4MJAA 4GSSA 1BF5A 2I4AA 2A2RA 2P31A 2VL2A 4MH3A 2KLXA 2O7KA 2O87A 4JZQA 1EWXA 4NV5A 2YP6A 4KAEA 4BVYA 2GZPA 3NIVA 4WXTA 1F3AA 4HEA2 4K5RA 4HQZA 4G0KA 1V98A 5A34B 3F3RA 3RDWA 2JZSA 2R0PA 4OD7A 1ZYNA 3AY8A 1ZMAA 2VCTA 1OYJA 1ON4A 1SK2A 3QFBC 2F3MA 4EL1A 4ILFA 1GNWA 1TRUA 1Z6MA 2O5VA 4IJIA 4YKFA 3H4KA 2TRCP 2PWJA 2VAFA 2JADA 2H0HA 2GLRA 1S3DA 3RPNA 3FZAA 6GSUA 4XRAA 3IC8A 3LQ7A 4WETA 3EVIA 1I9DA 1LJRA 4EXJA 2OE0A 2OACA 4CY6A 5LCZA 4N0ZA 2IPAA 3PPUA 3M9JA 1SKWB 4TXOA 1GUMA 2H1DA 2GQMA 3CSHA 2MMAA 3D4MA 2AB6A 4ECCA 3D5JA 3HJPA 12GSA 3LYPA 5J5NA 2H8LA 3WGDA 3F4TA 4YH2A 4E68A 1TK8B 1U3AA 1KBNA 4PQIA 2C0DA 3KMNA 1OE8A 5AIVA 5ECHB 1XWAA 3QR6A 1X9MB 1T7PB 3E3EA 1UVZA 4ID0A 6GSXA 2DJ1A 3ZITA 4KDUA 4E8EA 1GSSA 1XPVA 1DUGA 4BVXB 3P8WA 5COHA 2GVPA 2JZTA 4ACSA 4V2LA 1EEMA 4N10A 2LV3A 3GKXA 4ZL8A 5HR3A 1GTUA 5ECIB 1WE0A 1A2LA 4GXZA 2E7PA 2H72A 1GTBA 5F0GA 3O3TA 1TU7A 2PVOC 3WGEA 1OKDA 4HU7A 3E9JB 4OO5A 2K8SA 2OA7A 4PQHA 4BL7B 1R4WA 3KZQA 1BYEA 3Q18A 2V6OA 2H73A 5BRTA 4ZB8A 1ZYEA 1AQVA 3DKSA 1T3BA 4TXVA 4KSMA 4YQUA 1OAZA 1URMA 3MDKA 1RQMA 4GWRA 2EIRA 4NWYA 2PGTA 5CNWA 2HSNB 3TJKA 3ERGA 1JLVA 4HU9A 4OCEA 4GTUA 2L5LA 5E59A 1BG5A 2LRNA 1SJ6A 5BMUA 5IMAA 4IS0A 1FVKA 2WJUA 3IR4A 4POMA 3FW2A 2VLTA 2O36A 4EC0A 4CDOA 4V1Ap 2DIZA 2IFQA 2LSTA 2YWNA 1Y25A 2B7KA 3CTGA 4MPGA 3PINA 3KXOA 1QXHA 3GN3A 1X9SB 5GZZB 4OMVA 3C71A 2B6MA 3HVSA 4AI6A 1M2BA 1YF0A 1TOFA 4PHZC 2WVXB 1YQ1A 1TI3A 2FCHA 2R4VA 4MJBA 2CX3A 1VF3A 4BPYA 2WFCA 4V2NA 3FR3A 1O8WA 5JCUA 3G7JA 3KMOA 3GA4A 2LNSA 2I9HA 4K1FA 5CREA 1VF4A 9GSSA 1FB6A 2F51A 1SL1B 3M3MA 2R6KA 2C1YA 2V2GA 4EDYA 1XBSA 4MCUA 2CQ9A 2VL2C 2AAWA 3TJGA 5JWRB 3TGZA 5F8BA 4ZB7A 3H79A 4X4JA 4ZXGA 2I81A 4GQFA 4DVCA 1K0MA 4L0WA 4KGIA 1SJZA 1T1VA 2GGTA 2WZSA 5D9WA 3QPMA 5HFKA 1PN9A 2C3TA 1SU9A 2WVYA 4IJ3A 1GL8A 2VIMA 2B5EA 3FZ4A 5G30A 2H71A 1T8EB 2HSMB 2FHEA 5IMFA 1GUKA 4PURA 13GSA 4EKZA 5HR1A 1GSYA 1QQ2A 1SVMA 3CRUA 3D0ZA 4HI7A 5GSSA 1QFNA 3WT1A 5ENUA 1HNCA 1XIYA 2WRTA 3FR6A 2FGXA 1UC7A 2MMOA 2V32A 4AJ8A 3SWLA 5CRHA 4J2FA 1K3OA 1U6TA 4PXOA 4EUYA 1WIKA 4N11A 5CP1A 4ZL7A 3IXRA 4HSCX 1FG4A 2ZNMA 1EOGA 1QUWA 1Z9HA 3ERFA 1NW2A 2H76A 5B6MA 1XW5A 4NHZA 1GP1A 1R26A 2J9HA 2JACA 2VLVA 2E2GA 5CRGA 1GH2A 1O81A 19GSA 4LLRA 2ON5A 3KP9A 1GTIA 2VL3A 2X8HA 1S3AA 4EE0A 3H1NA 4BIKA 5E4WA 4K5SA 2EFDA 2YJHA 4AKIA 4KF9A 10GSA 4IQAA 2H01A 2EIQA 2H30A 5GAND 3HJMA 3GUSA 4V1Ag 1PKWA 4IW9A 1YJ6A 1N25A 4XTSA 2TRXA 2WW3A 4ZBDA 3M1GA 1BAYA 4RQXA 5ECQB 3BBYA 1OC8A 4KDYA 5A1NB 5CRDA 1F2EA 4DSSA 5DALA 2X99A 1A23A 1WMJA 1K0NA 3VURA 1H4OA 1MDJA 3DWVA 4Z2RA 4ZB6A 5ECKB 1C72A 3F63A 1QK8A 4KA0A 3HCZA 2A4VA 5L71A 3VK9A 4MLYA 1EGOA 1XVQA 3VWVA 4IQ1A 4LMWA 2WVXA 1F9MA 5KN0A 3MSZA 2LKUA 3EYTA 4K0NA 1GLQA 1M9BA 5A4UA 3VFIA 3TU3B 4I5QA 3RHBA 4MF7A 3KCMA 1AQXA 1EV4A 3HYPA 1TKDB 1XOAA 1V57A 2C8UA 2X64A 4AKHA 4NHWA 1SK1A 3DGQA 2FD3A 4I97A 3IHGA 2O3EA 2OKAA 3TRXA 1U88A 1DBYA 1EP7A 4Q5RA 3TCOA 1XVWA 1ERVA 1ZCPA 3ZRDA 5DCHA 5KEJA 3A2VA 1OVNA 5J41A 2VCQA 3US3A 4WF5A 1PQNA 2H1BA 2L6DA 3TKPA 4X43A 3ME7A 2X4AA 3DVWA 3ZMKA 3GMFA 3CHXC 3EMPA 3HMJG 3LWAA 3N9JA 4KH7A 4GLTA 2B1KA 3A2XA 3KH7A 5HFGA 2XPEA 3VWUA 2WW1A 1AXDA 3GL3A 4PI0C 4EDZA 5HQPA 4I6XA 5J9BA 2VL9A 1EGRA 1MD4A 4PX1A 2FLSA 2C3NA 2HSMA 2P0GA 3FHKA 4KNDA 2WULA 5DVBA 2MMNA 2M80A 1J9BA 1WOUA 5J4VA 5IM9A 5B8AA 5F05A 1Z6NA 2OJLA 1JZOA 2K8VA 4AKGA 1UA5A 2KOKA 1G7EA 1KNGA 4USSA 4MJEA 1FHEA 4KCAA 1V2AA 1AIUA 2PERA 2GS3A 3QD9A 1GSQA 5A4VA 2YPMA 3TJJA 2PVQA 1BX9A 2Z9SA 1SYRA 3NOFA 2PN8A 2N5AA 1TTZA 1XCCA 4IP6A 4EO3A 2F8AA 1S4BP 2YNXA 1A2JA 4K0GA 2IWTA 1MDKA 1TJDA 3EINA 3FEUA 2GQKA 5A5HA 5ECMB 2YZUA 2EFCA 2YZHA 3F9UA 1AUCA 2K9FA 3LXZA 1A8LA 1XWCA 2C4JA 3CBUA 4IKHA 1PX6A 3ZIVA 3QOUA 4MH2A 4WBRD 2VO4A 3C1RA 4DSRA 2DKIA 2V41A 3HDCA 3BCKA 3VLNA 22GSA 3F4SA 3PH9A 1BEDA 1MTCA 2YANA 4ZBAA 2HQTA 3IDVA 4H86A 1AW9A 2HNLA 1EV9A 2HZEA 1USBA 3ZL5A 1TI1A 1VRSD 3DYRA 2GSSA 3HVVA 2ALBA 3BJ5A 1FOVA 1OKTA 2HT9A 2GZYA 4TR1B 5ECOB 4AGSA 5GSTA 4PNFA 1TU8A 3UMAA 2H66A 5H5RA 3A3TA 4O32A 3EU3A 4Q5QA 3ISOA 3FY7A 3APSA 2YV7A 3IOSA 5DDLA 3GKMA 1TXXA 3GL5A 17GSA 1XWKA 5ELGA 3M9KA 1RW1A 5DBQA 4TR0A 4G19A 3W8JA 5KOXA 2IIYA 3CRTA 3L4NA 4G10A 2UV8G 1R7HA 3GRXA 4ZIJA 3I9V2 5IOXA 5HR0A 4ML6A 2MYGA 3IA1A 2JL4A 4HZ2A 1THXA 3HD5A 1M9AA 5DQSA 3ZFLA 1X5EA 4RI7A 3U5RE 3HKRA 4G0LA 2J23A 1WPIA 2A2SA 1JZRA 4IELA 1O85A 4ECBA 3VI5A 2EFEA 4PGTA 3LEFA 3W8SA 2REMA 5A5KA 4BWQA 5KN1A 4XRDA 3O6TA 3I43A 2L59A 3P7XA 4AJ7A 4GSNA 2QKEA 2CZ2A 2H0GA 1SVLA 4FQUA 4GRFA 2R5GA 5AN1A 1YKAA 3G7IA 3KD0A 1F3BA 1TRVA 1YF1A 1WRYA 1V58A 3EU4A 4O92A 4MPFA 2CAQA 5JWOB 3ZFBA 3FZ5A 3LXTA 3ME8A 4FYUA 4K6XA 4QL7A 1O6JA 4ECJA 5HR2A 2XBQA 3E0UA 5CAXA 4YQVA 2I3YA 4MZBA 1A0RP 2HSHA 2PMTA 2QA2A 1XW9A 2NDOA 5D93A 4GSTA 4K7OA 4ZBBA 2RM5A 1E2YA 4CHSA 3L78A 5C04A 5DAKB 1EEJA 3BD2A 1HNAA 4RUVA 5D9XA 3MNGA 6GSWA 5A34A 3F8UA 2FY6A 1FO5A 5DJLA 1ACVA 4DSQA 5ABRA 3IK9A 4ZL9A 1DSBA 2WB9A 1S3RA 3ED3A 3GKKA 2VCWA 3J7Yb 3F6FA 4OWYA 1FAAA 1HYUA 3EC3A 2B1LA 4D73B 3I69A 2H19A 2VUPA 4NMUA 2H6XA 4J56E 4X1UA 20GSA 3MWHA 3GH6A 1GUHA 3M8NA 3VWWA 6GSVA 1MEKA 2R2JA 3DD3A 1ABAA 2GDRA 2OT3A 3LW9A 4P3YB 2AYTA 1YEWC 2H0IA 3CWGA 1G0TA 4JR6A 2GTUA 3EMXA 3HZ8A 1NHYA 2DJ2A 4BWSA 1M0UA 4K7IA 1A2MA 5G1LA 2MZCA 3D4TA 3IHQA 1RK4A 1NHOA 2NBSA 1XWBA 4BVXA 2HRAA 1T4YA 1ST9A 4I2TA 5IMZA 3J7Yk 3LJRA 1H75A 2CA8A 2X8CA 1U87A 1DE2A 5G1KA 1QGVA 2PBJA 3CMIA 2ZUPA 5FHIA 3L0HA 4BL7A 2C80A 3I6AA 1OE7A 3FKFA 3G9BA 3WGXA 5IO0A 3UAPA 1YKCA 1OC9B 1UN2A 3CSIA 2NVLA 2CZ3A 5B8BA 4N30A 2X49A 2LS5A 1JLWA 1EZKA 5LNKe 3LGCA 4MA9A 4YKGA 2K6VA 1O8XA 2L6CA 1Z7RA 3EWLA 4F0CA 3CSJA 1FOHA 4G0IA 3FRCA 2L4QA 5B6NA 3CQFA 2FWEA 2HSNA 3KIJA 5F06A 3UBKA 4DEJA 3GFKA 1JZDA 1NM3A 3RAZA 2GSTA 2IMFA 1WP0A 1K0CA 1TP9A 1TK0B 2BTOT 5J4YA 2H6ZA 1SK0A 2P5QA 3VPTA 2B5YA 4JR4A 4K2DA 5D9TA 4MJCA 4HOJA 3GTUB 3GH9A 4MP4A 3TRPA 1X0RA 1SL0B 2H75A 4IP1A 4ECIA 2EIOA 4IBPA 3SBCA 1PA3A 2M72A 1PSQA 2H1AA 1IYIA 3WYWA 3TOTA 4EF0A 4XS6A 1F37A 1XOBA 2HRKB 1K3YA 3DIEA 5ECRB 1JZWA 1O7UA 5IMDA 1W4VA 5CO3A 3Q74A 1JFUA 2D2ZA 4MABA 3K8NA 4FH8A 1PL1A 4TR4A 4EIPA 4MK3A 2CT6A 5IIZA 1XWGA 3RPPA 2HRNA 1PFOA 1ERTA 1VGLA 3GHAA 4KE3A 1M3JA 2HZFA 1M3IA 3VWXA 4X0XA 4O5RA 2YOIA 4MF6A 3KGKA 1ERUA 5B7CA 2AUVA 1IYHA 2E2MA 1YEXA 1ZZYA 3D22A 2M46A 1TDIA 2PU9C 16GSA 1VF1A 1WJKA 2L4CA 4MNNA 5ECPB 2R0CA 4D73A 4MZCA 1BJXA 1G6YA 3CYNA 3UIWA 1MDIA 4Z7XA 1SKSB 2DMMA 3LSZA 1PD21 2RLIA 2YWOA 4Z2TA 4F03A 3N5OA 3EPTA 2XC2A 1OC3A 4FYCA 4A5PA 5ECLB 3IPZA 2HE3A 2CX4A 3UVTA 4JEDA 2IMKA 2PUKC 1EP8A 1SYXA 3HZ4A 2HYXA 1GULA 4GCIA 3GSSA 5GAPD 4QL9A 2V6KA 3KTBA 5IMVA 2A2PA 3DMLA 3HJOA 3BOAA 3EURA 4L5OA 4TW5A 4HJMA 4XS4B 4L8EA 2XBIA 3IAM2 5BMUB 3ERWA 2IMDA 2HSYA 4GF0A 4MDCA 3IAS2 2EFHA 3QAGA 1TXUA 2H6YA 3PR8A 4TKYA 3JCML 2LRTA 2AJQB 1XZOA 3FK8A 3M0FA 5J9CA 1E6BA 2OBKA 2IFQB 3R2QA 2P5RA 1K0DA 3BCIA 6GSTA 2HI7A 2DMLA 4JBBA 3ZZXA 4HJ2A 2C0FA 5ECSA 4ML1A 1B4QA 4YAVA 3UOMA 3ZVJA 2WS2A 5J40A 5JCWA 2IMEA 2WGRA 4JU5A 3WT2A 1V9WA 1LBKA 3F4RA 1OC9A 5EY6A 4TVEA 2C0EA 2NPBA 2H74A 2WDUA 3MYDA 4PQ1A 1M2AA 5C00A 2OE1A 5D9VA 1Z3EA 2VD1A 3TRQA 2NTOA 2GT6A 1M2DA 3QCPA 2FNOA 2OE3A 3PGTA 4ZB9A 3S9FA 4V2MA 4EVMA 1ZOFA 5A1NA 1HD2A 3TKSA 3MAKA 5G31A 4MMMA 3ZLPA 3TKRA 2O89A 4WR4A 1XFLA 4NXIA 3L9SA 5CYYA 3GTUA 5IPGA 2LUSA 2MMZA 4LMVA 3LYKA 1W89A 4XHMA 1I1IP 5AGYA 2CVBA 1N8JA 1PL2A 2TIRA 1BQ7A 3RHCA 4NV2A 2VCZA 2HFDA 1Z5YE 2CV4A 4FIWA 4JRRA 1Q98A 3IRAA 4OCFA 4RI6A 3FMWA 2HLSA 3P2AA 2AV4A 1B9XC 5G5FA 1LU4A 2HRKA 3DEXA 3GSTA 3QAWA 4ICYA 2YN1A 5ELAA 2VLUA 1SVOA 2RM6A 3C73A 4CY8A 1ZYQB 3G7YA 1A0FA 4TRXA 1T00A 2DSAA 1O73A 2XPDA 2QSIA 5F07A 1NSWA 2YWIA 4IHUA 4L0UA 1MD3A 2UZ8A 5KOWA 2FWHA 3F0IA 3HY2A 4PNGA 2H1GA 3C1SA 2DBCA 4O5QA 3C7MA 4Q5NA 1Z7PA 1ZGNA 2DKHA 3F3QA 2BJXA 3VPQA 2VM2A 2HRFA 3HVXA 3KJYA 1EOHA 5LD0A 2JU5A 5KN2A 4K8MA 1FB0A 4W66A 3P90A 1YY7A 3APOA 2L5OA 2N5BA 3VI7A 2DJ3A 3GV1A 1Q4JA 2CVDA 1TRSA 1Y1UA 1XG8A 1X9WB 2N5FA 3OR5A 1F6MC 4WR5A 4FYBA 1WWJA 1K0OA 4XS4A 3TJBA 4OFTA 3DVXA 4O7HA 1M99A 4DSSB 5DALB 3RFRC 1J08A 1R5PA 2BMXA 2IL3A 1J0FA 2JZRA 1GTAA 4WF4A 1PGTA 2EC4A 1GNEA 4OFNA 4G9HA 3A2WA 4J57E 4KW6A 2B7JA 2JSYA 4LL4B 1PRXA 2FWGA 1PX7A 5IQYA 18GSA 2F8FA 2VD0A 4WKWA 3ZREA 1X5DA 1FW1A 2HXKA 2YJ7A 4AKXB 2LJRA 3HVNA 4WBJA 4I8BA 2O85A 1ILOA 5ECNB 1CQHA 2B3SA 4KUNA 5A4WA 4K7NA 1YZXA 3H93A 2I1UA 1AQWA 4POBA 4TOPA 5EPFA 3C8EA 2VCVA 4NPBA 3W6GA 1U3IA 4F0BA 4K2XA 4PTSA 1GSEA 1S3CA 2G0FA 1K0AA 3DRNA 1SL2B 2YWMA 2FUG2 1VF2A 4BA7A 4TR1A 1AC1A 1GSUA 4KDXA 4FO5A 5INYA 2RUEA 2A4HA 1ZYPA 2VKZG 3D21A 5J3RA 1HNBA 1A24A 1SENA 1B9YC 1JHBA 2LTKA 4JE1A 3FR9A 3A5IA 2GSQA 1XW6A 1ZL9A 4POKA 4I2UA 4TN8A 5JWQB 4G2EA 1KEBA 1GRXA 2OBIA 3TUEA 2R3XA 2C3QA 3MIXA 1PN0A 5FT3A 3TKSC 5DCGA 4IN0A 4CW9A 1PMTA 2ZCTA 3UJ1A 3O76A 3HHVA 5H5SA 4MZWA 4AF2A 2WCIA 3GYKA 4IVFA 2DIYA 3U6VA 2RUFA 3UARA 4F9ZA 5KN3A 1G6WA 2MBTA 4HS1A 3FYGA 4F2IA 4MF5A 4WEYA 2QA1A 2GSRA 5ID2B 6GSYA 3QMXA 3KH9A 4HZ4A 1M7TA 5G2ZA 2G2QA 1B8XA 1SD9A 3QAVA 1K3LA 2VCXA 2LEGA 4AJ6A 2C0GA 3L9VA 3GX8A 11GSA 1YDKA 5AIXA 1A8YA 5D8IA 3LORA 2KP2A 4BVYB 3WD6A 2LJKA 2LJAA 5G5EA 5IMCA 3GX0A 1TW9A 4XCSA 5A5HB 4KCEA 4QMKA 2ON7A 2FA4A 4HQSA 1CQGA 2GT5A 2O8VB 1GWCA 5EVOA 2H70A 3RBTA 4F82A 3GURA 3TJFA 4EIQA 4NAXA 4Q5FA 3F6DA 5DQYA 1K0BA 5CRWA 1PKZA 4KSOA 3FZ9A 1B4PA 3IE3A 4PUAA 2HZEB 4LL1B 1ML6A 1TRWA 2WZ9A 3UEMA 2ES7A 4Z2UA 1SJIA 3L9UA 2DJKA 2DJ0A 5EL8A 3UVHA 2FA8A 1V40A 5DJMA 2FWFA 2KUCA 1R5AA 3GKNA 4XS1A 3TDGA 1HQOA 4PI2C 2F9SA 3IV4A 3TB2A 2CVKA 1GSFA 3RGBC 3APQA 2LQOA 4OO4A 1ERWA 7GSSA 3KEBA 3H8QA 5J47A 2L57A 2IN3A 1BG1A 3KM6A 4KB3A 3NZNA 1TK5B 8GSSA 1YEPA 4TXOB 1B48A 1I5GA 1GSDA 2CAIA 1SD8A 2JSZA 5HFIA 1SKRB 2E0QA 3HA9A 5D73A 4GDFA 3IC4A 3DXBA 3EE2A 2DC5A 5DAKA 3UBLA 1N2AA 3KP8A 2R37A 2K18A 4E8HA 2OADA 2AHEA 4YQMA 3CTFA 3ZYWA 2VM1A 2H1LA 2MBSA 3LFLA 5FWGA 4XIHA 4O5UA 2YV9A 3HXSA 4OFMA 4HUAA 4L5LA 5IOWA 1DE1A 4HDEA 2KHPA 4N3ZA 3ZTLA 4YAPA 4RQRA 2X8GA 1G7OA 2WW2A 2IJYA 1FVJA 3ZVJD 3ZIJA 3D6IA 1T4ZA 3A5WA 2V1MA 2GQLA 1X5CA 4N0VA 3V1WA 3Q6OA 4KX4A 2KP1A 2VOCA 2GZZA
chains in the Genus database with same CATH topology
5J4UA 3QFAC 3Q19A 2DLXA 2PPTA 3UL3A 3CXGA 5IO2A 14GSA 1GLPA 1XXUA 3TKSE 2QGVA 4PUFC 3QDNA 2XHFA 1THOA 6GSSA 4QQ7A 3KTLA 3ZMLA 2RIIA 2R0GA 1Y6EA 4IGJA 3R3EA 2LRCA 3GNJA 4GQCA 4G01A 2LQQA 3GIXA 4K9ZA 2IMIA 2YCDA 2B5XA 3LG6A 3IBHA 5H5QA 3IK7A 5D96A 1QMVA 1KTEA 1YVLA 5JCGA 4TR3A 5AISA 3TOUA 2LNTA 3TKQA 4ISDA 4ULXA 2DJJA 2QC7A 5IPHA 4POLA 1AAZA 4LA1A 4ZILA 5ID2A 4MJAA 4GSSA 1BF5A 2I4AA 2A2RA 2P31A 2VL2A 4MH3A 2KLXA 2O7KA 2O87A 4JZQA 1EWXA 4NV5A 2YP6A 4KAEA 4BVYA 2GZPA 3NIVA 4WXTA 1F3AA 4HEA2 4K5RA 4HQZA 4G0KA 1V98A 5A34B 3F3RA 3RDWA 2JZSA 2R0PA 4OD7A 1ZYNA 3AY8A 1ZMAA 2VCTA 1OYJA 1ON4A 1SK2A 3QFBC 2F3MA 4EL1A 4ILFA 1GNWA 1TRUA 1Z6MA 2O5VA 4IJIA 4YKFA 3H4KA 2TRCP 2PWJA 2VAFA 2JADA 2H0HA 2GLRA 1S3DA 3RPNA 3FZAA 6GSUA 4XRAA 3IC8A 3LQ7A 4WETA 3EVIA 1I9DA 1LJRA 4EXJA 2OE0A 2OACA 4CY6A 5LCZA 4N0ZA 2IPAA 3PPUA 3M9JA 1SKWB 4TXOA 1GUMA 2H1DA 2GQMA 3CSHA 2MMAA 3D4MA 2AB6A 4ECCA 3D5JA 3HJPA 12GSA 3LYPA 5J5NA 2H8LA 3WGDA 3F4TA 4YH2A 4E68A 1TK8B 1U3AA 1KBNA 4PQIA 2C0DA 3KMNA 1OE8A 5AIVA 5ECHB 1XWAA 3QR6A 1X9MB 1T7PB 3E3EA 1UVZA 4ID0A 6GSXA 2DJ1A 3ZITA 4KDUA 4E8EA 1GSSA 1XPVA 1DUGA 4BVXB 3P8WA 5COHA 2GVPA 2JZTA 4ACSA 4V2LA 1EEMA 4N10A 2LV3A 3GKXA 4ZL8A 5HR3A 1GTUA 5ECIB 1WE0A 1A2LA 4GXZA 2E7PA 2H72A 1GTBA 5F0GA 3O3TA 1TU7A 2PVOC 3WGEA 1OKDA 4HU7A 3E9JB 4OO5A 2K8SA 2OA7A 4PQHA 4BL7B 1R4WA 3KZQA 1BYEA 3Q18A 2V6OA 2H73A 5BRTA 4ZB8A 1ZYEA 1AQVA 3DKSA 1T3BA 4TXVA 4KSMA 4YQUA 1OAZA 1URMA 3MDKA 1RQMA 4GWRA 2EIRA 4NWYA 2PGTA 5CNWA 2HSNB 3TJKA 3ERGA 1JLVA 4HU9A 4OCEA 4GTUA 2L5LA 5E59A 1BG5A 2LRNA 1SJ6A 5BMUA 5IMAA 4IS0A 1FVKA 2WJUA 3IR4A 4POMA 3FW2A 2VLTA 4EC0A 4CDOA 4V1Ap 2DIZA 2IFQA 2LSTA 2YWNA 1Y25A 2B7KA 3CTGA 4MPGA 3PINA 3KXOA 1QXHA 3GN3A 1X9SB 5GZZB 4OMVA 3C71A 2B6MA 3HVSA 4AI6A 1M2BA 1YF0A 1TOFA 1YQ1A 1TI3A 2FCHA 2R4VA 4MJBA 2CX3A 1VF3A 4BPYA 2WFCA 4V2NA 3FR3A 1O8WA 5JCUA 3G7JA 3KMOA 3GA4A 2LNSA 2I9HA 4K1FA 5CREA 1VF4A 9GSSA 1FB6A 2F51A 1SL1B 3M3MA 2R6KA 2C1YA 2V2GA 4EDYA 1XBSA 4MCUA 2CQ9A 2VL2C 2AAWA 3TJGA 5JWRB 3TGZA 5F8BA 4ZB7A 3H79A 4X4JA 4ZXGA 2I81A 4GQFA 4DVCA 1K0MA 4L0WA 4KGIA 1SJZA 1T1VA 2GGTA 5D9WA 3QPMA 5HFKA 1PN9A 2C3TA 1SU9A 4IJ3A 1GL8A 2VIMA 2B5EA 3FZ4A 5G30A 2H71A 1T8EB 2HSMB 2FHEA 5IMFA 1GUKA 4PURA 13GSA 4EKZA 5HR1A 1GSYA 1QQ2A 1SVMA 3CRUA 3D0ZA 4HI7A 5GSSA 1QFNA 3WT1A 5ENUA 1HNCA 1XIYA 2WRTA 3FR6A 2FGXA 1UC7A 2MMOA 2V32A 4AJ8A 3SWLA 5CRHA 4J2FA 1K3OA 1U6TA 4PXOA 4EUYA 1WIKA 4N11A 5CP1A 4ZL7A 3IXRA 1FG4A 2ZNMA 1EOGA 1QUWA 1Z9HA 3ERFA 1NW2A 2H76A 5B6MA 1XW5A 4NHZA 1GP1A 1R26A 2J9HA 2JACA 2VLVA 2E2GA 5CRGA 1GH2A 1O81A 19GSA 4LLRA 2ON5A 3KP9A 1GTIA 2VL3A 2X8HA 1S3AA 4EE0A 3H1NA 5E4WA 4K5SA 2EFDA 2YJHA 4AKIA 4KF9A 10GSA 4IQAA 2H01A 2EIQA 2H30A 5GAND 3HJMA 3GUSA 4V1Ag 1PKWA 4IW9A 1YJ6A 1N25A 4XTSA 2TRXA 4ZBDA 3M1GA 1BAYA 4RQXA 5ECQB 3BBYA 1OC8A 4KDYA 5A1NB 5CRDA 1F2EA 4DSSA 5DALA 2X99A 1A23A 1WMJA 1K0NA 3VURA 1H4OA 1MDJA 3DWVA 4Z2RA 4ZB6A 5ECKB 1C72A 3F63A 1QK8A 4KA0A 3HCZA 2A4VA 5L71A 3VK9A 4MLYA 1EGOA 1XVQA 3VWVA 4IQ1A 4LMWA 1F9MA 5KN0A 3MSZA 2LKUA 3EYTA 4K0NA 1GLQA 1M9BA 5A4UA 3VFIA 3TU3B 4I5QA 3RHBA 4MF7A 3KCMA 1AQXA 1EV4A 3HYPA 1TKDB 1XOAA 1V57A 2C8UA 2X64A 4AKHA 4NHWA 1SK1A 3DGQA 2FD3A 4I97A 3IHGA 2OKAA 3TRXA 1U88A 1DBYA 1EP7A 4Q5RA 3TCOA 1XVWA 1ERVA 1ZCPA 3ZRDA 5DCHA 5KEJA 3A2VA 1OVNA 5J41A 2VCQA 3US3A 4WF5A 1PQNA 2H1BA 2L6DA 3TKPA 4X43A 3ME7A 2X4AA 3DVWA 3ZMKA 3GMFA 3EMPA 3HMJG 3LWAA 3N9JA 4KH7A 4GLTA 2B1KA 3A2XA 3KH7A 5HFGA 2XPEA 3VWUA 1AXDA 3GL3A 4EDZA 5HQPA 4I6XA 5J9BA 2VL9A 1EGRA 1MD4A 4PX1A 2FLSA 2C3NA 2HSMA 2P0GA 3FHKA 4KNDA 2WULA 5DVBA 2MMNA 2M80A 1J9BA 1WOUA 5J4VA 5IM9A 5B8AA 5F05A 1Z6NA 2OJLA 1JZOA 2K8VA 4AKGA 1UA5A 2KOKA 1G7EA 1KNGA 4USSA 4MJEA 1FHEA 4KCAA 1V2AA 1AIUA 2PERA 2GS3A 3QD9A 1GSQA 5A4VA 2YPMA 3TJJA 2PVQA 1BX9A 2Z9SA 1SYRA 3NOFA 2PN8A 2N5AA 1TTZA 1XCCA 4IP6A 4EO3A 2F8AA 2YNXA 1A2JA 4K0GA 2IWTA 1MDKA 1TJDA 3EINA 3FEUA 2GQKA 5A5HA 5ECMB 2YZUA 2EFCA 2YZHA 3F9UA 1AUCA 2K9FA 3LXZA 1A8LA 1XWCA 2C4JA 3CBUA 4IKHA 1PX6A 3ZIVA 3QOUA 4MH2A 4WBRD 2VO4A 3C1RA 4DSRA 2DKIA 2V41A 3HDCA 3BCKA 3VLNA 22GSA 3F4SA 3PH9A 1BEDA 1MTCA 2YANA 4ZBAA 2HQTA 3IDVA 4H86A 1AW9A 2HNLA 1EV9A 2HZEA 1USBA 3ZL5A 1TI1A 1VRSD 3DYRA 2GSSA 3HVVA 2ALBA 3BJ5A 1FOVA 1OKTA 2HT9A 2GZYA 4TR1B 5ECOB 4AGSA 5GSTA 4PNFA 1TU8A 3UMAA 2H66A 5H5RA 3A3TA 4O32A 3EU3A 4Q5QA 3ISOA 3FY7A 3APSA 2YV7A 3IOSA 5DDLA 3GKMA 1TXXA 3GL5A 17GSA 1XWKA 5ELGA 3M9KA 1RW1A 5DBQA 4TR0A 4G19A 3W8JA 5KOXA 2IIYA 3CRTA 3L4NA 4G10A 2UV8G 1R7HA 3GRXA 4ZIJA 3I9V2 5IOXA 5HR0A 4ML6A 2MYGA 3IA1A 2JL4A 4HZ2A 1THXA 3HD5A 1M9AA 5DQSA 3ZFLA 1X5EA 4RI7A 3U5RE 3HKRA 4G0LA 2J23A 1WPIA 2A2SA 1JZRA 4IELA 1O85A 4ECBA 3VI5A 2EFEA 4PGTA 3LEFA 3W8SA 2REMA 5A5KA 4BWQA 5KN1A 4XRDA 3O6TA 3I43A 2L59A 3P7XA 4AJ7A 4GSNA 2QKEA 2CZ2A 2H0GA 1SVLA 4FQUA 4GRFA 2R5GA 5AN1A 1YKAA 3G7IA 3KD0A 1F3BA 1TRVA 1YF1A 1WRYA 1V58A 3EU4A 4O92A 4MPFA 2CAQA 5JWOB 3ZFBA 3FZ5A 3LXTA 3ME8A 4FYUA 4K6XA 4QL7A 1O6JA 4ECJA 5HR2A 2XBQA 3E0UA 5CAXA 4YQVA 2I3YA 4MZBA 1A0RP 2HSHA 2PMTA 2QA2A 1XW9A 2NDOA 5D93A 4GSTA 4K7OA 4ZBBA 2RM5A 1E2YA 4CHSA 3L78A 5C04A 5DAKB 1EEJA 3BD2A 1HNAA 4RUVA 5D9XA 3MNGA 6GSWA 5A34A 3F8UA 2FY6A 1FO5A 5DJLA 1ACVA 4DSQA 5ABRA 3IK9A 4ZL9A 1DSBA 2WB9A 3ED3A 3GKKA 2VCWA 3J7Yb 3F6FA 4OWYA 1FAAA 1HYUA 3EC3A 2B1LA 4D73B 3I69A 2H19A 2VUPA 4NMUA 2H6XA 4J56E 4X1UA 20GSA 3MWHA 3GH6A 1GUHA 3M8NA 3VWWA 6GSVA 1MEKA 2R2JA 3DD3A 1ABAA 2GDRA 2OT3A 3LW9A 4P3YB 2AYTA 2H0IA 3CWGA 1G0TA 4JR6A 2GTUA 3EMXA 3HZ8A 1NHYA 2DJ2A 4BWSA 1M0UA 4K7IA 1A2MA 5G1LA 2MZCA 3D4TA 3IHQA 1RK4A 1NHOA 2NBSA 1XWBA 4BVXA 2HRAA 1T4YA 1ST9A 4I2TA 5IMZA 3J7Yk 3LJRA 1H75A 2CA8A 2X8CA 1U87A 1DE2A 5G1KA 1QGVA 2PBJA 3CMIA 2ZUPA 5FHIA 3L0HA 4BL7A 2C80A 1OE7A 3I6AA 3FKFA 3G9BA 3WGXA 5IO0A 3UAPA 1YKCA 1OC9B 1UN2A 3CSIA 2NVLA 2CZ3A 5B8BA 4N30A 2X49A 2LS5A 1JLWA 1EZKA 5LNKe 3LGCA 4MA9A 4YKGA 2K6VA 1O8XA 2L6CA 1Z7RA 3EWLA 4F0CA 3CSJA 1FOHA 4G0IA 3FRCA 2L4QA 5B6NA 2FWEA 2HSNA 3KIJA 5F06A 3UBKA 4DEJA 3GFKA 1JZDA 1NM3A 3RAZA 2GSTA 2IMFA 1WP0A 1K0CA 1TP9A 1TK0B 2BTOT 5J4YA 2H6ZA 1SK0A 2P5QA 3VPTA 2B5YA 4JR4A 4K2DA 5D9TA 4MJCA 4HOJA 3GTUB 3GH9A 4MP4A 3TRPA 1X0RA 1SL0B 2H75A 4IP1A 4ECIA 2EIOA 4IBPA 3SBCA 1PA3A 2M72A 1PSQA 2H1AA 1IYIA 3WYWA 3TOTA 4EF0A 4XS6A 1F37A 1XOBA 2HRKB 1K3YA 3DIEA 5ECRB 1JZWA 1O7UA 5IMDA 1W4VA 5CO3A 3Q74A 1JFUA 2D2ZA 4MABA 3K8NA 4FH8A 1PL1A 4TR4A 4EIPA 4MK3A 2CT6A 5IIZA 1XWGA 3RPPA 2HRNA 1ERTA 1VGLA 3GHAA 4KE3A 2HZFA 4X0XA 3VWXA 4O5RA 2YOIA 4MF6A 3KGKA 1ERUA 5B7CA 2AUVA 1IYHA 2E2MA 1YEXA 1ZZYA 3D22A 2M46A 1TDIA 2PU9C 16GSA 1VF1A 1WJKA 2L4CA 4MNNA 5ECPB 2R0CA 4D73A 4MZCA 1BJXA 1G6YA 3CYNA 3UIWA 1MDIA 4Z7XA 1SKSB 2DMMA 3LSZA 1PD21 2RLIA 2YWOA 4Z2TA 4F03A 3N5OA 3EPTA 2XC2A 1OC3A 4FYCA 4A5PA 5ECLB 3IPZA 2HE3A 2CX4A 3UVTA 4JEDA 2IMKA 2PUKC 1EP8A 1SYXA 3HZ4A 2HYXA 1GULA 4GCIA 3GSSA 5GAPD 4QL9A 2V6KA 3KTBA 5IMVA 2A2PA 3DMLA 3HJOA 3BOAA 3EURA 4L5OA 4TW5A 4HJMA 4XS4B 4L8EA 2XBIA 3IAM2 5BMUB 3ERWA 2IMDA 2HSYA 4GF0A 4MDCA 3IAS2 2EFHA 3QAGA 1TXUA 2H6YA 3PR8A 4TKYA 3JCML 2LRTA 2AJQB 1XZOA 3FK8A 3M0FA 5J9CA 1E6BA 2OBKA 2IFQB 3R2QA 2P5RA 1K0DA 3BCIA 6GSTA 2HI7A 2DMLA 4JBBA 3ZZXA 4HJ2A 2C0FA 5ECSA 4ML1A 1B4QA 4YAVA 3UOMA 3ZVJA 2WS2A 5J40A 5JCWA 2IMEA 2WGRA 4JU5A 3WT2A 1V9WA 1LBKA 3F4RA 1OC9A 5EY6A 4TVEA 2C0EA 2NPBA 2H74A 2WDUA 3MYDA 4PQ1A 1M2AA 5C00A 2OE1A 5D9VA 1Z3EA 2VD1A 3TRQA 2NTOA 2GT6A 1M2DA 3QCPA 2FNOA 2OE3A 3PGTA 4ZB9A 3S9FA 4V2MA 4EVMA 1ZOFA 5A1NA 1HD2A 3TKSA 3MAKA 5G31A 4MMMA 3ZLPA 3TKRA 2O89A 4WR4A 1XFLA 4NXIA 3L9SA 5CYYA 3GTUA 5IPGA 2LUSA 2MMZA 4LMVA 3LYKA 1W89A 4XHMA 5AGYA 2CVBA 1N8JA 1PL2A 2TIRA 1BQ7A 3RHCA 4NV2A 2VCZA 2HFDA 1Z5YE 2CV4A 4FIWA 4JRRA 1Q98A 3IRAA 4OCFA 4RI6A 3FMWA 2HLSA 3P2AA 2AV4A 1B9XC 5G5FA 1LU4A 2HRKA 3DEXA 3GSTA 3QAWA 4ICYA 2YN1A 5ELAA 2VLUA 1SVOA 2RM6A 3C73A 4CY8A 1ZYQB 3G7YA 1A0FA 4TRXA 1T00A 2DSAA 1O73A 2XPDA 2QSIA 5F07A 1NSWA 2YWIA 4IHUA 4L0UA 1MD3A 2UZ8A 5KOWA 2FWHA 3F0IA 3HY2A 4PNGA 2H1GA 3C1SA 2DBCA 4O5QA 3C7MA 4Q5NA 1Z7PA 1ZGNA 2DKHA 3F3QA 2BJXA 3VPQA 2VM2A 2HRFA 3HVXA 3KJYA 1EOHA 5LD0A 2JU5A 5KN2A 4K8MA 1FB0A 4W66A 3P90A 1YY7A 3APOA 2L5OA 2N5BA 3VI7A 2DJ3A 3GV1A 1Q4JA 2CVDA 1TRSA 1Y1UA 1X9WB 2N5FA 3OR5A 1F6MC 4WR5A 4FYBA 1WWJA 1K0OA 4XS4A 3TJBA 4OFTA 3DVXA 4O7HA 1M99A 4DSSB 5DALB 1J08A 1R5PA 2BMXA 2IL3A 1J0FA 2JZRA 1GTAA 4WF4A 1PGTA 2EC4A 1GNEA 4OFNA 4G9HA 3A2WA 4J57E 4KW6A 2B7JA 2JSYA 4LL4B 1PRXA 2FWGA 1PX7A 5IQYA 18GSA 2F8FA 2VD0A 4WKWA 3ZREA 1X5DA 1FW1A 2HXKA 2YJ7A 4AKXB 2LJRA 4WBJA 4I8BA 2O85A 1ILOA 5ECNB 1CQHA 2B3SA 4KUNA 5A4WA 4K7NA 1YZXA 3H93A 2I1UA 1AQWA 4POBA 4TOPA 5EPFA 3C8EA 2VCVA 4NPBA 3W6GA 1U3IA 4F0BA 4K2XA 4PTSA 1GSEA 1S3CA 2G0FA 1K0AA 3DRNA 1SL2B 2YWMA 2FUG2 1VF2A 4BA7A 4TR1A 1AC1A 1GSUA 4KDXA 4FO5A 5INYA 2RUEA 2A4HA 1ZYPA 2VKZG 3D21A 5J3RA 1HNBA 1A24A 1SENA 1B9YC 1JHBA 2LTKA 4JE1A 3FR9A 3A5IA 2GSQA 1XW6A 1ZL9A 4POKA 4I2UA 4TN8A 5JWQB 4G2EA 1KEBA 1GRXA 2OBIA 3TUEA 2R3XA 2C3QA 3MIXA 1PN0A 5FT3A 3TKSC 5DCGA 4IN0A 4CW9A 1PMTA 2ZCTA 3UJ1A 3O76A 3HHVA 5H5SA 4MZWA 4AF2A 2WCIA 3GYKA 4IVFA 2DIYA 3U6VA 2RUFA 3UARA 4F9ZA 5KN3A 1G6WA 2MBTA 4HS1A 3FYGA 4F2IA 4MF5A 4WEYA 2QA1A 2GSRA 5ID2B 6GSYA 3QMXA 3KH9A 4HZ4A 1M7TA 5G2ZA 2G2QA 1B8XA 1SD9A 3QAVA 1K3LA 2VCXA 2LEGA 4AJ6A 2C0GA 3L9VA 3GX8A 11GSA 1YDKA 5AIXA 1A8YA 5D8IA 3LORA 2KP2A 4BVYB 3WD6A 2LJKA 2LJAA 5G5EA 5IMCA 3GX0A 1TW9A 4XCSA 5A5HB 4KCEA 4QMKA 2ON7A 2FA4A 4HQSA 1CQGA 2GT5A 2O8VB 1GWCA 5EVOA 2H70A 3RBTA 4F82A 3GURA 3TJFA 4EIQA 4NAXA 4Q5FA 3F6DA 5DQYA 1K0BA 5CRWA 1PKZA 4KSOA 3FZ9A 1B4PA 3IE3A 4PUAA 2HZEB 4LL1B 1ML6A 1TRWA 2WZ9A 3UEMA 2ES7A 4Z2UA 1SJIA 3L9UA 2DJKA 2DJ0A 5EL8A 3UVHA 2FA8A 1V40A 5DJMA 2FWFA 2KUCA 1R5AA 3GKNA 4XS1A 3TDGA 1HQOA 2F9SA 3IV4A 3TB2A 2CVKA 1GSFA 3APQA 2LQOA 4OO4A 1ERWA 7GSSA 3KEBA 3H8QA 5J47A 2L57A 2IN3A 1BG1A 3KM6A 4KB3A 3NZNA 1TK5B 8GSSA 1YEPA 4TXOB 1B48A 1I5GA 1GSDA 2CAIA 1SD8A 2JSZA 5HFIA 1SKRB 2E0QA 3HA9A 5D73A 4GDFA 3IC4A 3DXBA 3EE2A 2DC5A 5DAKA 3UBLA 1N2AA 3KP8A 2R37A 2K18A 4E8HA 2OADA 2AHEA 4YQMA 3CTFA 3ZYWA 2VM1A 2H1LA 2MBSA 3LFLA 5FWGA 4XIHA 4O5UA 2YV9A 3HXSA 4OFMA 4HUAA 4L5LA 5IOWA 1DE1A 4HDEA 2KHPA 4N3ZA 3ZTLA 4YAPA 4RQRA 2X8GA 1G7OA 2IJYA 1FVJA 3ZVJD 3ZIJA 3D6IA 1T4ZA 3A5WA 2V1MA 2GQLA 1X5CA 4N0VA 3V1WA 3Q6OA 4KX4A 2KP1A 2VOCA 2GZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J4U A;  3QFA C;  3Q19 A;  2DLX A;  2PPT A;  3UL3 A;  3CXG A;  5IO2 A;  14GS A;  1GLP A;  1XXU A;  3TKS E;  2QGV A;  4PUF C;  3QDN A;  2XHF A;  1THO A;  6GSS A;  4QQ7 A;  3KTL A;  3ZML A;  2RII A;  1Y6E A;  4IGJ A;  3R3E A;  2LRC A;  3GNJ A;  4GQC A;  2LQQ A;  3GIX A;  4K9Z A;  2IMI A;  2YCD A;  2B5X A;  3LG6 A;  3IBH A;  5H5Q A;  3IK7 A;  5D96 A;  1QMV A;  1KTE A;  5JCG A;  4TR3 A;  5AIS A;  3TOU A;  2LNT A;  3TKQ A;  4ISD A;  4ULX A;  2DJJ A;  2QC7 A;  5IPH A;  4POL A;  1AAZ A;  4LA1 A;  4ZIL A;  5ID2 A;  4MJA A;  4GSS A;  2I4A A;  2A2R A;  2P31 A;  2VL2 A;  4MH3 A;  2KLX A;  2O7K A;  2O87 A;  4JZQ A;  1EWX A;  4NV5 A;  2YP6 A;  4KAE A;  4BVY A;  2GZP A;  3NIV A;  4WXT A;  1F3A A;  4HEA 2;  4HQZ A;  4G0K A;  1V98 A;  3F3R A;  3RDW A;  2JZS A;  4OD7 A;  3AY8 A;  1ZMA A;  2VCT A;  1OYJ A;  1ON4 A;  1SK2 A;  3QFB C;  2F3M A;  4EL1 A;  4ILF A;  1GNW A;  1TRU A;  1Z6M A;  4IJI A;  3H4K A;  2TRC P;  2PWJ A;  2VAF A;  2JAD A;  2H0H A;  2GLR A;  1S3D A;  3RPN A;  3FZA A;  6GSU A;  4XRA A;  3IC8 A;  3LQ7 A;  4WET A;  3EVI A;  1I9D A;  1LJR A;  4EXJ A;  2OE0 A;  2OAC A;  5LCZ A;  4N0Z A;  2IPA A;  3PPU A;  3M9J A;  1SKW B;  4TXO A;  1GUM A;  2H1D A;  2GQM A;  3CSH A;  2MMA A;  3D4M A;  2AB6 A;  4ECC A;  3D5J A;  3HJP A;  12GS A;  3LYP A;  5J5N A;  2H8L A;  3WGD A;  3F4T A;  4YH2 A;  1TK8 B;  1U3A A;  1KBN A;  4PQI A;  2C0D A;  3KMN A;  1OE8 A;  5AIV A;  5ECH B;  1XWA A;  3QR6 A;  1X9M B;  1T7P B;  3E3E A;  1UVZ A;  4ID0 A;  6GSX A;  2DJ1 A;  3ZIT A;  4KDU A;  4E8E A;  1GSS A;  1XPV A;  1DUG A;  4BVX B;  3P8W A;  5COH A;  2GVP A;  2JZT A;  4ACS A;  4V2L A;  1EEM A;  4N10 A;  2LV3 A;  3GKX A;  4ZL8 A;  5HR3 A;  1GTU A;  5ECI B;  1WE0 A;  1A2L A;  4GXZ A;  2E7P A;  2H72 A;  1GTB A;  5F0G A;  3O3T A;  1TU7 A;  2PVO C;  3WGE A;  1OKD A;  4HU7 A;  3E9J B;  4OO5 A;  2K8S A;  2OA7 A;  4PQH A;  4BL7 B;  1R4W A;  3KZQ A;  1BYE A;  3Q18 A;  2V6O A;  2H73 A;  4ZB8 A;  1ZYE A;  1AQV A;  3DKS A;  1T3B A;  4TXV A;  4KSM A;  4YQU A;  1OAZ A;  1URM A;  3MDK A;  1RQM A;  4GWR A;  2EIR A;  4NWY A;  2PGT A;  5CNW A;  2HSN B;  3TJK A;  3ERG A;  1JLV A;  4HU9 A;  4OCE A;  4GTU A;  2L5L A;  5E59 A;  1BG5 A;  2LRN A;  1SJ6 A;  5BMU A;  5IMA A;  4IS0 A;  1FVK A;  2WJU A;  3IR4 A;  4POM A;  3FW2 A;  2VLT A;  4EC0 A;  4CDO A;  4V1A p;  2DIZ A;  2IFQ A;  2LST A;  2YWN A;  1Y25 A;  2B7K A;  3CTG A;  4MPG A;  3PIN A;  3KXO A;  1QXH A;  3GN3 A;  1X9S B;  5GZZ B;  4OMV A;  3C71 A;  2B6M A;  3HVS A;  1M2B A;  1YF0 A;  1TOF A;  1YQ1 A;  1TI3 A;  2FCH A;  2R4V A;  4MJB A;  2CX3 A;  1VF3 A;  4BPY A;  2WFC A;  4V2N A;  3FR3 A;  1O8W A;  5JCU A;  3G7J A;  3KMO A;  3GA4 A;  2LNS A;  2I9H A;  4K1F A;  5CRE A;  1VF4 A;  9GSS A;  1FB6 A;  2F51 A;  1SL1 B;  3M3M A;  2R6K A;  2C1Y A;  2V2G A;  4EDY A;  1XBS A;  4MCU A;  2CQ9 A;  2VL2 C;  2AAW A;  3TJG A;  5JWR B;  3TGZ A;  5F8B A;  3H79 A;  4ZXG A;  2I81 A;  4GQF A;  4DVC A;  1K0M A;  4L0W A;  4KGI A;  1SJZ A;  1T1V A;  2GGT A;  5D9W A;  3QPM A;  5HFK A;  1PN9 A;  2C3T A;  1SU9 A;  4IJ3 A;  1GL8 A;  2VIM A;  2B5E A;  3FZ4 A;  5G30 A;  2H71 A;  1T8E B;  2HSM B;  2FHE A;  5IMF A;  1GUK A;  4PUR A;  13GS A;  4EKZ A;  5HR1 A;  1GSY A;  1QQ2 A;  3CRU A;  3D0Z A;  4HI7 A;  5GSS A;  1QFN A;  3WT1 A;  5ENU A;  1HNC A;  1XIY A;  2WRT A;  3FR6 A;  2FGX A;  1UC7 A;  2MMO A;  2V32 A;  4AJ8 A;  3SWL A;  5CRH A;  4J2F A;  1K3O A;  1U6T A;  4PXO A;  4EUY A;  1WIK A;  4N11 A;  5CP1 A;  4ZL7 A;  3IXR A;  1FG4 A;  2ZNM A;  1EOG A;  1QUW A;  1Z9H A;  3ERF A;  1NW2 A;  2H76 A;  5B6M A;  1XW5 A;  4NHZ A;  1GP1 A;  1R26 A;  2J9H A;  2JAC A;  2VLV A;  2E2G A;  5CRG A;  1GH2 A;  1O81 A;  19GS A;  4LLR A;  2ON5 A;  3KP9 A;  1GTI A;  2VL3 A;  2X8H A;  1S3A A;  4EE0 A;  3H1N A;  5E4W A;  2YJH A;  4KF9 A;  10GS A;  4IQA A;  2H01 A;  2EIQ A;  2H30 A;  5GAN D;  3HJM A;  3GUS A;  4V1A g;  1PKW A;  4IW9 A;  1YJ6 A;  4XTS A;  2TRX A;  4ZBD A;  3M1G A;  1BAY A;  4RQX A;  5ECQ B;  3BBY A;  1OC8 A;  4KDY A;  5CRD A;  1F2E A;  4DSS A;  5DAL A;  2X99 A;  1A23 A;  1WMJ A;  1K0N A;  3VUR A;  1H4O A;  1MDJ A;  3DWV A;  4ZB6 A;  5ECK B;  1C72 A;  3F63 A;  1QK8 A;  4KA0 A;  3HCZ A;  2A4V A;  5L71 A;  3VK9 A;  4MLY A;  1EGO A;  1XVQ A;  3VWV A;  4IQ1 A;  4LMW A;  1F9M A;  5KN0 A;  3MSZ A;  2LKU A;  3EYT A;  4K0N A;  1GLQ A;  1M9B A;  5A4U A;  3VFI A;  4I5Q A;  3RHB A;  4MF7 A;  3KCM A;  1AQX A;  1EV4 A;  3HYP A;  1TKD B;  1XOA A;  1V57 A;  2C8U A;  2X64 A;  4NHW A;  1SK1 A;  3DGQ A;  2FD3 A;  4I97 A;  2OKA A;  3TRX A;  1U88 A;  1DBY A;  1EP7 A;  4Q5R A;  3TCO A;  1XVW A;  1ERV A;  1ZCP A;  3ZRD A;  5DCH A;  5KEJ A;  3A2V A;  1OVN A;  5J41 A;  2VCQ A;  3US3 A;  4WF5 A;  1PQN A;  2H1B A;  2L6D A;  3TKP A;  4X43 A;  3ME7 A;  3DVW A;  3ZMK A;  3GMF A;  3EMP A;  3LWA A;  3N9J A;  4KH7 A;  4GLT A;  2B1K A;  3A2X A;  3KH7 A;  5HFG A;  2XPE A;  3VWU A;  1AXD A;  3GL3 A;  4EDZ A;  5HQP A;  4I6X A;  5J9B A;  2VL9 A;  1EGR A;  1MD4 A;  4PX1 A;  2FLS A;  2C3N A;  2HSM A;  2P0G A;  3FHK A;  4KND A;  2WUL A;  5DVB A;  2MMN A;  2M80 A;  1J9B A;  1WOU A;  5IM9 A;  5B8A A;  5F05 A;  1Z6N A;  2OJL A;  1JZO A;  2K8V A;  1UA5 A;  2KOK A;  1G7E A;  1KNG A;  4USS A;  4MJE A;  1FHE A;  4KCA A;  1V2A A;  1AIU A;  2PER A;  2GS3 A;  3QD9 A;  1GSQ A;  5A4V A;  2YPM A;  3TJJ A;  2PVQ A;  1BX9 A;  2Z9S A;  1SYR A;  3NOF A;  2PN8 A;  2N5A A;  1TTZ A;  1XCC A;  4IP6 A;  4EO3 A;  2F8A A;  2YNX A;  1A2J A;  4K0G A;  2IWT A;  1MDK A;  1TJD A;  3EIN A;  3FEU A;  2GQK A;  5ECM B;  2YZU A;  2YZH A;  3F9U A;  1AUC A;  2K9F A;  3LXZ A;  1A8L A;  1XWC A;  2C4J A;  3CBU A;  4IKH A;  1PX6 A;  3ZIV A;  3QOU A;  4MH2 A;  4WBR D;  2VO4 A;  3C1R A;  4DSR A;  2V41 A;  3HDC A;  3BCK A;  3VLN A;  22GS A;  3F4S A;  3PH9 A;  1BED A;  1MTC A;  2YAN A;  4ZBA A;  2HQT A;  3IDV A;  4H86 A;  1AW9 A;  2HNL A;  1EV9 A;  2HZE A;  1USB A;  3ZL5 A;  1TI1 A;  1VRS D;  3DYR A;  2GSS A;  3HVV A;  2ALB A;  3BJ5 A;  1FOV A;  1OKT A;  2HT9 A;  2GZY A;  4TR1 B;  5ECO B;  4AGS A;  5GST A;  4PNF A;  1TU8 A;  3UMA A;  2H66 A;  5H5R A;  3A3T A;  4O32 A;  3EU3 A;  4Q5Q A;  3ISO A;  3FY7 A;  3APS A;  2YV7 A;  3IOS A;  5DDL A;  3GKM A;  1TXX A;  3GL5 A;  17GS A;  1XWK A;  5ELG A;  3M9K A;  1RW1 A;  5DBQ A;  4TR0 A;  4G19 A;  3W8J A;  2IIY A;  3CRT A;  3L4N A;  4G10 A;  1R7H A;  3GRX A;  4ZIJ A;  3I9V 2;  5IOX A;  5HR0 A;  4ML6 A;  2MYG A;  3IA1 A;  2JL4 A;  4HZ2 A;  1THX A;  3HD5 A;  1M9A A;  5DQS A;  3ZFL A;  1X5E A;  4RI7 A;  3U5R E;  3HKR A;  4G0L A;  2J23 A;  1WPI A;  2A2S A;  1JZR A;  4IEL A;  1O85 A;  4ECB A;  3VI5 A;  4PGT A;  3LEF A;  3W8S A;  2REM A;  5A5K A;  4BWQ A;  5KN1 A;  4XRD A;  3O6T A;  3I43 A;  2L59 A;  3P7X A;  4AJ7 A;  4GSN A;  2QKE A;  2CZ2 A;  2H0G A;  4FQU A;  4GRF A;  2R5G A;  5AN1 A;  1YKA A;  3G7I A;  3KD0 A;  1F3B A;  1TRV A;  1YF1 A;  1WRY A;  1V58 A;  3EU4 A;  4O92 A;  4MPF A;  2CAQ A;  5JWO B;  3ZFB A;  3FZ5 A;  3LXT A;  3ME8 A;  4FYU A;  4K6X A;  4QL7 A;  1O6J A;  4ECJ A;  5HR2 A;  2XBQ A;  3E0U A;  5CAX A;  4YQV A;  2I3Y A;  4MZB A;  1A0R P;  2HSH A;  2PMT A;  1XW9 A;  2NDO A;  5D93 A;  4GST A;  4K7O A;  4ZBB A;  2RM5 A;  1E2Y A;  4CHS A;  3L78 A;  5C04 A;  5DAK B;  1EEJ A;  3BD2 A;  1HNA A;  4RUV A;  5D9X A;  3MNG A;  6GSW A;  3F8U A;  2FY6 A;  1FO5 A;  5DJL A;  1ACV A;  4DSQ A;  5ABR A;  3IK9 A;  4ZL9 A;  1DSB A;  2WB9 A;  3ED3 A;  3GKK A;  2VCW A;  3J7Y b;  3F6F A;  4OWY A;  1FAA A;  1HYU A;  3EC3 A;  2B1L A;  4D73 B;  3I69 A;  2H19 A;  2VUP A;  4NMU A;  2H6X A;  4J56 E;  4X1U A;  20GS A;  3MWH A;  3GH6 A;  1GUH A;  3M8N A;  3VWW A;  6GSV A;  1MEK A;  2R2J A;  3DD3 A;  1ABA A;  2GDR A;  4P3Y B;  2AYT A;  2H0I A;  1G0T A;  4JR6 A;  2GTU A;  3EMX A;  3HZ8 A;  1NHY A;  2DJ2 A;  4BWS A;  1M0U A;  4K7I A;  1A2M A;  5G1L A;  2MZC A;  3D4T A;  3IHQ A;  1RK4 A;  1NHO A;  2NBS A;  1XWB A;  4BVX A;  2HRA A;  1T4Y A;  1ST9 A;  4I2T A;  5IMZ A;  3J7Y k;  3LJR A;  1H75 A;  2CA8 A;  2X8C A;  1U87 A;  1DE2 A;  5G1K A;  1QGV A;  2PBJ A;  3CMI A;  2ZUP A;  5FHI A;  3L0H A;  4BL7 A;  2C80 A;  1OE7 A;  3I6A A;  3FKF A;  3G9B A;  3WGX A;  5IO0 A;  3UAP A;  1YKC A;  1OC9 B;  1UN2 A;  3CSI A;  2NVL A;  2CZ3 A;  5B8B A;  4N30 A;  2LS5 A;  1JLW A;  1EZK A;  5LNK e;  3LGC A;  4MA9 A;  2K6V A;  1O8X A;  2L6C A;  1Z7R A;  3EWL A;  4F0C A;  3CSJ A;  4G0I A;  3FRC A;  2L4Q A;  5B6N A;  2FWE A;  3KIJ A;  5F06 A;  3UBK A;  4DEJ A;  3GFK A;  1JZD A;  1NM3 A;  3RAZ A;  2GST A;  2IMF A;  1WP0 A;  1K0C A;  1TP9 A;  1TK0 B;  2BTO T;  2H6Z A;  1SK0 A;  2P5Q A;  3VPT A;  2B5Y A;  4JR4 A;  4K2D A;  5D9T A;  4MJC A;  4HOJ A;  3GTU B;  3GH9 A;  4MP4 A;  3TRP A;  1X0R A;  1SL0 B;  2H75 A;  4IP1 A;  4ECI A;  2EIO A;  4IBP A;  3SBC A;  1PA3 A;  2M72 A;  1PSQ A;  2H1A A;  1IYI A;  3WYW A;  3TOT A;  4EF0 A;  4XS6 A;  1F37 A;  1XOB A;  2HRK B;  1K3Y A;  3DIE A;  5ECR B;  1JZW A;  1O7U A;  5IMD A;  1W4V A;  5CO3 A;  3Q74 A;  1JFU A;  2D2Z A;  4MAB A;  3K8N A;  4FH8 A;  1PL1 A;  4TR4 A;  4MK3 A;  2CT6 A;  5IIZ A;  1XWG A;  3RPP A;  2HRN A;  1ERT A;  1VGL A;  3GHA A;  4KE3 A;  2HZF A;  4X0X A;  3VWX A;  4O5R A;  2YOI A;  4MF6 A;  3KGK A;  1ERU A;  5B7C A;  2AUV A;  1IYH A;  2E2M A;  1YEX A;  1ZZY A;  3D22 A;  2M46 A;  1TDI A;  2PU9 C;  16GS A;  1VF1 A;  1WJK A;  2L4C A;  5ECP B;  4D73 A;  4MZC A;  1BJX A;  1G6Y A;  3CYN A;  3UIW A;  1MDI A;  4Z7X A;  1SKS B;  2DMM A;  3LSZ A;  1PD2 1;  2RLI A;  2YWO A;  4F03 A;  3N5O A;  2XC2 A;  1OC3 A;  4FYC A;  5ECL B;  3IPZ A;  2HE3 A;  2CX4 A;  3UVT A;  4JED A;  2IMK A;  2PUK C;  1EP8 A;  1SYX A;  3HZ4 A;  2HYX A;  1GUL A;  4GCI A;  3GSS A;  5GAP D;  4QL9 A;  2V6K A;  3KTB A;  5IMV A;  3DML A;  3HJO A;  3BOA A;  3EUR A;  4L5O A;  4TW5 A;  4HJM A;  4XS4 B;  4L8E A;  2XBI A;  3IAM 2;  3ERW A;  2IMD A;  2HSY A;  4GF0 A;  4MDC A;  3IAS 2;  3QAG A;  2H6Y A;  3PR8 A;  4TKY A;  3JCM L;  2LRT A;  2AJQ B;  1XZO A;  3FK8 A;  3M0F A;  5J9C A;  1E6B A;  2OBK A;  2IFQ B;  3R2Q A;  2P5R A;  1K0D A;  3BCI A;  6GST A;  2HI7 A;  2DML A;  4JBB A;  3ZZX A;  4HJ2 A;  2C0F A;  5ECS A;  4ML1 A;  1B4Q A;  4YAV A;  3UOM A;  3ZVJ A;  2WS2 A;  5JCW A;  2IME A;  2WGR A;  4JU5 A;  3WT2 A;  1V9W A;  1LBK A;  3F4R A;  1OC9 A;  5EY6 A;  4TVE A;  2C0E A;  2NPB A;  2H74 A;  2WDU A;  4PQ1 A;  1M2A A;  5C00 A;  2OE1 A;  5D9V A;  1Z3E A;  2VD1 A;  3TRQ A;  2NTO A;  2GT6 A;  1M2D A;  3QCP A;  2FNO A;  2OE3 A;  3PGT A;  4ZB9 A;  3S9F A;  4V2M A;  4EVM A;  1ZOF A;  1HD2 A;  3TKS A;  3MAK A;  5G31 A;  4MMM A;  3ZLP A;  3TKR A;  2O89 A;  4WR4 A;  1XFL A;  4NXI A;  3L9S A;  5CYY A;  3GTU A;  5IPG A;  2LUS A;  2MMZ A;  4LMV A;  3LYK A;  1W89 A;  4XHM A;  5AGY A;  2CVB A;  1N8J A;  1PL2 A;  2TIR A;  1BQ7 A;  3RHC A;  4NV2 A;  2VCZ A;  2HFD A;  1Z5Y E;  2CV4 A;  4FIW A;  4JRR A;  1Q98 A;  3IRA A;  4OCF A;  4RI6 A;  2HLS A;  3P2A A;  2AV4 A;  1B9X C;  5G5F A;  1LU4 A;  2HRK A;  3DEX A;  3GST A;  3QAW A;  2YN1 A;  5ELA A;  2VLU A;  2RM6 A;  3C73 A;  1ZYQ B;  3G7Y A;  1A0F A;  4TRX A;  1T00 A;  2DSA A;  1O73 A;  2XPD A;  2QSI A;  5F07 A;  1NSW A;  2YWI A;  4IHU A;  4L0U A;  1MD3 A;  2UZ8 A;  2FWH A;  3F0I A;  3HY2 A;  4PNG A;  2H1G A;  3C1S A;  2DBC A;  3C7M A;  4Q5N A;  1Z7P A;  1ZGN A;  3F3Q A;  2BJX A;  3VPQ A;  2VM2 A;  2HRF A;  3HVX A;  3KJY A;  1EOH A;  5LD0 A;  2JU5 A;  5KN2 A;  4K8M A;  1FB0 A;  3P90 A;  1YY7 A;  3APO A;  2L5O A;  2N5B A;  3VI7 A;  2DJ3 A;  3GV1 A;  1Q4J A;  2CVD A;  1TRS A;  1X9W B;  2N5F A;  3OR5 A;  1F6M C;  4WR5 A;  4FYB A;  1WWJ A;  1K0O A;  4XS4 A;  3TJB A;  4OFT A;  3DVX A;  4O7H A;  1M99 A;  4DSS B;  5DAL B;  1J08 A;  1R5P A;  2BMX A;  2IL3 A;  1J0F A;  2JZR A;  1GTA A;  4WF4 A;  1PGT A;  2EC4 A;  1GNE A;  4OFN A;  4G9H A;  3A2W A;  4J57 E;  4KW6 A;  2B7J A;  2JSY A;  4LL4 B;  1PRX A;  2FWG A;  1PX7 A;  5IQY A;  18GS A;  2F8F A;  2VD0 A;  4WKW A;  3ZRE A;  1X5D A;  1FW1 A;  2HXK A;  2YJ7 A;  2LJR A;  4WBJ A;  4I8B A;  2O85 A;  1ILO A;  5ECN B;  1CQH A;  2B3S A;  4KUN A;  5A4W A;  4K7N A;  1YZX A;  3H93 A;  2I1U A;  1AQW A;  4POB A;  4TOP A;  5EPF A;  3C8E A;  2VCV A;  4NPB A;  3W6G A;  1U3I A;  4F0B A;  4PTS A;  1GSE A;  1S3C A;  2G0F A;  1K0A A;  3DRN A;  1SL2 B;  2YWM A;  2FUG 2;  1VF2 A;  4BA7 A;  4TR1 A;  1AC1 A;  1GSU A;  4KDX A;  4FO5 A;  5INY A;  2RUE A;  3D21 A;  5J3R A;  1HNB A;  1A24 A;  1SEN A;  1B9Y C;  1JHB A;  2LTK A;  4JE1 A;  3FR9 A;  2GSQ A;  1XW6 A;  1ZL9 A;  4POK A;  4I2U A;  4TN8 A;  5JWQ B;  4G2E A;  1KEB A;  1GRX A;  2OBI A;  3TUE A;  2R3X A;  2C3Q A;  5FT3 A;  3TKS C;  5DCG A;  4IN0 A;  4CW9 A;  1PMT A;  2ZCT A;  3UJ1 A;  3O76 A;  3HHV A;  5H5S A;  4MZW A;  4AF2 A;  2WCI A;  3GYK A;  4IVF A;  2DIY A;  3U6V A;  2RUF A;  3UAR A;  4F9Z A;  5KN3 A;  1G6W A;  2MBT A;  4HS1 A;  3FYG A;  4F2I A;  4MF5 A;  4WEY A;  2GSR A;  5ID2 B;  6GSY A;  3QMX A;  3KH9 A;  4HZ4 A;  1M7T A;  5G2Z A;  2G2Q A;  1B8X A;  1SD9 A;  3QAV A;  1K3L A;  2VCX A;  2LEG A;  4AJ6 A;  2C0G A;  3L9V A;  3GX8 A;  11GS A;  1YDK A;  5AIX A;  1A8Y A;  5D8I A;  3LOR A;  2KP2 A;  4BVY B;  3WD6 A;  2LJK A;  2LJA A;  5G5E A;  5IMC A;  3GX0 A;  1TW9 A;  4XCS A;  4KCE A;  2ON7 A;  2FA4 A;  4HQS A;  1CQG A;  2GT5 A;  2O8V B;  1GWC A;  5EVO A;  2H70 A;  3RBT A;  4F82 A;  3GUR A;  3TJF A;  4NAX A;  4Q5F A;  3F6D A;  5DQY A;  1K0B A;  5CRW A;  1PKZ A;  4KSO A;  3FZ9 A;  1B4P A;  3IE3 A;  4PUA A;  2HZE B;  4LL1 B;  1ML6 A;  1TRW A;  2WZ9 A;  3UEM A;  2ES7 A;  1SJI A;  3L9U A;  2DJK A;  2DJ0 A;  5EL8 A;  3UVH A;  2FA8 A;  1V40 A;  5DJM A;  2FWF A;  2KUC A;  1R5A A;  3GKN A;  4XS1 A;  3TDG A;  1HQO A;  2F9S A;  3IV4 A;  3TB2 A;  2CVK A;  1GSF A;  3APQ A;  2LQO A;  4OO4 A;  1ERW A;  7GSS A;  3KEB A;  3H8Q A;  2L57 A;  2IN3 A;  3KM6 A;  4KB3 A;  3NZN A;  1TK5 B;  8GSS A;  1YEP A;  4TXO B;  1B48 A;  1I5G A;  1GSD A;  2CAI A;  1SD8 A;  2JSZ A;  5HFI A;  1SKR B;  2E0Q A;  3HA9 A;  5D73 A;  3IC4 A;  3DXB A;  3EE2 A;  2DC5 A;  5DAK A;  3UBL A;  1N2A A;  3KP8 A;  2R37 A;  2K18 A;  4E8H A;  2OAD A;  2AHE A;  4YQM A;  3CTF A;  3ZYW A;  2VM1 A;  2MBS A;  3LFL A;  5FWG A;  4XIH A;  2YV9 A;  3HXS A;  4OFM A;  4HUA A;  4L5L A;  5IOW A;  1DE1 A;  4HDE A;  2KHP A;  3ZTL A;  4YAP A;  4RQR A;  2X8G A;  1G7O A;  2IJY A;  1FVJ A;  3ZVJ D;  3ZIJ A;  3D6I A;  1T4Z A;  3A5W A;  2V1M A;  2GQL A;  1X5C A;  4N0V A;  3V1W A;  3Q6O A;  4KX4 A;  2KP1 A;  2VOC A;  2GZZ A; 
#chains in the Genus database with same CATH topology
 5J4U A;  3QFA C;  3Q19 A;  2DLX A;  2PPT A;  3UL3 A;  3CXG A;  5IO2 A;  14GS A;  1GLP A;  1XXU A;  3TKS E;  2QGV A;  4PUF C;  3QDN A;  2XHF A;  1THO A;  6GSS A;  4QQ7 A;  3KTL A;  3ZML A;  2RII A;  2R0G A;  1Y6E A;  4IGJ A;  3R3E A;  2LRC A;  3GNJ A;  4GQC A;  2WVZ A;  4G01 A;  2LQQ A;  3GIX A;  4K9Z A;  2IMI A;  2YCD A;  2B5X A;  3LG6 A;  3IBH A;  4FXY P;  2WW0 A;  5H5Q A;  3IK7 A;  5D96 A;  1QMV A;  1KTE A;  1YVL A;  5JCG A;  4TR3 A;  5AIS A;  3TOU A;  2LNT A;  3TKQ A;  4ISD A;  4ULX A;  2DJJ A;  2QC7 A;  5IPH A;  4POL A;  1AAZ A;  4LA1 A;  4ZIL A;  5ID2 A;  4MJA A;  4GSS A;  1BF5 A;  2I4A A;  2A2R A;  2P31 A;  2VL2 A;  4MH3 A;  2KLX A;  2O7K A;  2O87 A;  4JZQ A;  1EWX A;  4NV5 A;  2YP6 A;  4KAE A;  4BVY A;  2GZP A;  3NIV A;  4WXT A;  1F3A A;  4HEA 2;  4K5R A;  4HQZ A;  4G0K A;  1V98 A;  5A34 B;  3F3R A;  3RDW A;  2JZS A;  2R0P A;  4OD7 A;  1ZYN A;  3AY8 A;  1ZMA A;  2VCT A;  1OYJ A;  1ON4 A;  1SK2 A;  3QFB C;  2F3M A;  4EL1 A;  4ILF A;  1GNW A;  1TRU A;  1Z6M A;  2O5V A;  4IJI A;  4YKF A;  3H4K A;  2TRC P;  2PWJ A;  2VAF A;  2JAD A;  2H0H A;  2GLR A;  1S3D A;  3RPN A;  3FZA A;  6GSU A;  4XRA A;  3IC8 A;  3LQ7 A;  4WET A;  3EVI A;  1I9D A;  1LJR A;  4EXJ A;  2OE0 A;  2OAC A;  4CY6 A;  5LCZ A;  4N0Z A;  2IPA A;  3PPU A;  3M9J A;  1SKW B;  4TXO A;  1GUM A;  2H1D A;  2GQM A;  3CSH A;  2MMA A;  3D4M A;  2AB6 A;  4ECC A;  3D5J A;  3HJP A;  12GS A;  3LYP A;  5J5N A;  2H8L A;  3WGD A;  3F4T A;  4YH2 A;  4E68 A;  1TK8 B;  1U3A A;  1KBN A;  4PQI A;  2C0D A;  3KMN A;  1OE8 A;  5AIV A;  5ECH B;  1XWA A;  3QR6 A;  1X9M B;  1T7P B;  3E3E A;  1UVZ A;  4ID0 A;  6GSX A;  2DJ1 A;  3ZIT A;  4KDU A;  4E8E A;  1GSS A;  1XPV A;  1DUG A;  4BVX B;  3P8W A;  5COH A;  2GVP A;  2JZT A;  4ACS A;  4V2L A;  1EEM A;  4N10 A;  2LV3 A;  3GKX A;  4ZL8 A;  5HR3 A;  1GTU A;  5ECI B;  1WE0 A;  1A2L A;  4GXZ A;  2E7P A;  2H72 A;  1GTB A;  5F0G A;  3O3T A;  1TU7 A;  2PVO C;  3WGE A;  1OKD A;  4HU7 A;  3E9J B;  4OO5 A;  2K8S A;  2OA7 A;  4PQH A;  4BL7 B;  1R4W A;  3KZQ A;  1BYE A;  3Q18 A;  2V6O A;  2H73 A;  5BRT A;  4ZB8 A;  1ZYE A;  1AQV A;  3DKS A;  1T3B A;  4TXV A;  4KSM A;  4YQU A;  1OAZ A;  1URM A;  3MDK A;  1RQM A;  4GWR A;  2EIR A;  4NWY A;  2PGT A;  5CNW A;  2HSN B;  3TJK A;  3ERG A;  1JLV A;  4HU9 A;  4OCE A;  4GTU A;  2L5L A;  5E59 A;  1BG5 A;  2LRN A;  1SJ6 A;  5BMU A;  5IMA A;  4IS0 A;  1FVK A;  2WJU A;  3IR4 A;  4POM A;  3FW2 A;  2VLT A;  2O36 A;  4EC0 A;  4CDO A;  4V1A p;  2DIZ A;  2IFQ A;  2LST A;  2YWN A;  1Y25 A;  2B7K A;  3CTG A;  4MPG A;  3PIN A;  3KXO A;  1QXH A;  3GN3 A;  1X9S B;  5GZZ B;  4OMV A;  3C71 A;  2B6M A;  3HVS A;  4AI6 A;  1M2B A;  1YF0 A;  1TOF A;  4PHZ C;  2WVX B;  1YQ1 A;  1TI3 A;  2FCH A;  2R4V A;  4MJB A;  2CX3 A;  1VF3 A;  4BPY A;  2WFC A;  4V2N A;  3FR3 A;  1O8W A;  5JCU A;  3G7J A;  3KMO A;  3GA4 A;  2LNS A;  2I9H A;  4K1F A;  5CRE A;  1VF4 A;  9GSS A;  1FB6 A;  2F51 A;  1SL1 B;  3M3M A;  2R6K A;  2C1Y A;  2V2G A;  4EDY A;  1XBS A;  4MCU A;  2CQ9 A;  2VL2 C;  2AAW A;  3TJG A;  5JWR B;  3TGZ A;  5F8B A;  4ZB7 A;  3H79 A;  4X4J A;  4ZXG A;  2I81 A;  4GQF A;  4DVC A;  1K0M A;  4L0W A;  4KGI A;  1SJZ A;  1T1V A;  2GGT A;  2WZS A;  5D9W A;  3QPM A;  5HFK A;  1PN9 A;  2C3T A;  1SU9 A;  2WVY A;  4IJ3 A;  1GL8 A;  2VIM A;  2B5E A;  3FZ4 A;  5G30 A;  2H71 A;  1T8E B;  2HSM B;  2FHE A;  5IMF A;  1GUK A;  4PUR A;  13GS A;  4EKZ A;  5HR1 A;  1GSY A;  1QQ2 A;  1SVM A;  3CRU A;  3D0Z A;  4HI7 A;  5GSS A;  1QFN A;  3WT1 A;  5ENU A;  1HNC A;  1XIY A;  2WRT A;  3FR6 A;  2FGX A;  1UC7 A;  2MMO A;  2V32 A;  4AJ8 A;  3SWL A;  5CRH A;  4J2F A;  1K3O A;  1U6T A;  4PXO A;  4EUY A;  1WIK A;  4N11 A;  5CP1 A;  4ZL7 A;  3IXR A;  4HSC X;  1FG4 A;  2ZNM A;  1EOG A;  1QUW A;  1Z9H A;  3ERF A;  1NW2 A;  2H76 A;  5B6M A;  1XW5 A;  4NHZ A;  1GP1 A;  1R26 A;  2J9H A;  2JAC A;  2VLV A;  2E2G A;  5CRG A;  1GH2 A;  1O81 A;  19GS A;  4LLR A;  2ON5 A;  3KP9 A;  1GTI A;  2VL3 A;  2X8H A;  1S3A A;  4EE0 A;  3H1N A;  4BIK A;  5E4W A;  4K5S A;  2EFD A;  2YJH A;  4AKI A;  4KF9 A;  10GS A;  4IQA A;  2H01 A;  2EIQ A;  2H30 A;  5GAN D;  3HJM A;  3GUS A;  4V1A g;  1PKW A;  4IW9 A;  1YJ6 A;  1N25 A;  4XTS A;  2TRX A;  2WW3 A;  4ZBD A;  3M1G A;  1BAY A;  4RQX A;  5ECQ B;  3BBY A;  1OC8 A;  4KDY A;  5A1N B;  5CRD A;  1F2E A;  4DSS A;  5DAL A;  2X99 A;  1A23 A;  1WMJ A;  1K0N A;  3VUR A;  1H4O A;  1MDJ A;  3DWV A;  4Z2R A;  4ZB6 A;  5ECK B;  1C72 A;  3F63 A;  1QK8 A;  4KA0 A;  3HCZ A;  2A4V A;  5L71 A;  3VK9 A;  4MLY A;  1EGO A;  1XVQ A;  3VWV A;  4IQ1 A;  4LMW A;  2WVX A;  1F9M A;  5KN0 A;  3MSZ A;  2LKU A;  3EYT A;  4K0N A;  1GLQ A;  1M9B A;  5A4U A;  3VFI A;  3TU3 B;  4I5Q A;  3RHB A;  4MF7 A;  3KCM A;  1AQX A;  1EV4 A;  3HYP A;  1TKD B;  1XOA A;  1V57 A;  2C8U A;  2X64 A;  4AKH A;  4NHW A;  1SK1 A;  3DGQ A;  2FD3 A;  4I97 A;  3IHG A;  2O3E A;  2OKA A;  3TRX A;  1U88 A;  1DBY A;  1EP7 A;  4Q5R A;  3TCO A;  1XVW A;  1ERV A;  1ZCP A;  3ZRD A;  5DCH A;  5KEJ A;  3A2V A;  1OVN A;  5J41 A;  2VCQ A;  3US3 A;  4WF5 A;  1PQN A;  2H1B A;  2L6D A;  3TKP A;  4X43 A;  3ME7 A;  2X4A A;  3DVW A;  3ZMK A;  3GMF A;  3CHX C;  3EMP A;  3HMJ G;  3LWA A;  3N9J A;  4KH7 A;  4GLT A;  2B1K A;  3A2X A;  3KH7 A;  5HFG A;  2XPE A;  3VWU A;  2WW1 A;  1AXD A;  3GL3 A;  4PI0 C;  4EDZ A;  5HQP A;  4I6X A;  5J9B A;  2VL9 A;  1EGR A;  1MD4 A;  4PX1 A;  2FLS A;  2C3N A;  2HSM A;  2P0G A;  3FHK A;  4KND A;  2WUL A;  5DVB A;  2MMN A;  2M80 A;  1J9B A;  1WOU A;  5J4V A;  5IM9 A;  5B8A A;  5F05 A;  1Z6N A;  2OJL A;  1JZO A;  2K8V A;  4AKG A;  1UA5 A;  2KOK A;  1G7E A;  1KNG A;  4USS A;  4MJE A;  1FHE A;  4KCA A;  1V2A A;  1AIU A;  2PER A;  2GS3 A;  3QD9 A;  1GSQ A;  5A4V A;  2YPM A;  3TJJ A;  2PVQ A;  1BX9 A;  2Z9S A;  1SYR A;  3NOF A;  2PN8 A;  2N5A A;  1TTZ A;  1XCC A;  4IP6 A;  4EO3 A;  2F8A A;  1S4B P;  2YNX A;  1A2J A;  4K0G A;  2IWT A;  1MDK A;  1TJD A;  3EIN A;  3FEU A;  2GQK A;  5A5H A;  5ECM B;  2YZU A;  2EFC A;  2YZH A;  3F9U A;  1AUC A;  2K9F A;  3LXZ A;  1A8L A;  1XWC A;  2C4J A;  3CBU A;  4IKH A;  1PX6 A;  3ZIV A;  3QOU A;  4MH2 A;  4WBR D;  2VO4 A;  3C1R A;  4DSR A;  2DKI A;  2V41 A;  3HDC A;  3BCK A;  3VLN A;  22GS A;  3F4S A;  3PH9 A;  1BED A;  1MTC A;  2YAN A;  4ZBA A;  2HQT A;  3IDV A;  4H86 A;  1AW9 A;  2HNL A;  1EV9 A;  2HZE A;  1USB A;  3ZL5 A;  1TI1 A;  1VRS D;  3DYR A;  2GSS A;  3HVV A;  2ALB A;  3BJ5 A;  1FOV A;  1OKT A;  2HT9 A;  2GZY A;  4TR1 B;  5ECO B;  4AGS A;  5GST A;  4PNF A;  1TU8 A;  3UMA A;  2H66 A;  5H5R A;  3A3T A;  4O32 A;  3EU3 A;  4Q5Q A;  3ISO A;  3FY7 A;  3APS A;  2YV7 A;  3IOS A;  5DDL A;  3GKM A;  1TXX A;  3GL5 A;  17GS A;  1XWK A;  5ELG A;  3M9K A;  1RW1 A;  5DBQ A;  4TR0 A;  4G19 A;  3W8J A;  5KOX A;  2IIY A;  3CRT A;  3L4N A;  4G10 A;  2UV8 G;  1R7H A;  3GRX A;  4ZIJ A;  3I9V 2;  5IOX A;  5HR0 A;  4ML6 A;  2MYG A;  3IA1 A;  2JL4 A;  4HZ2 A;  1THX A;  3HD5 A;  1M9A A;  5DQS A;  3ZFL A;  1X5E A;  4RI7 A;  3U5R E;  3HKR A;  4G0L A;  2J23 A;  1WPI A;  2A2S A;  1JZR A;  4IEL A;  1O85 A;  4ECB A;  3VI5 A;  2EFE A;  4PGT A;  3LEF A;  3W8S A;  2REM A;  5A5K A;  4BWQ A;  5KN1 A;  4XRD A;  3O6T A;  3I43 A;  2L59 A;  3P7X A;  4AJ7 A;  4GSN A;  2QKE A;  2CZ2 A;  2H0G A;  1SVL A;  4FQU A;  4GRF A;  2R5G A;  5AN1 A;  1YKA A;  3G7I A;  3KD0 A;  1F3B A;  1TRV A;  1YF1 A;  1WRY A;  1V58 A;  3EU4 A;  4O92 A;  4MPF A;  2CAQ A;  5JWO B;  3ZFB A;  3FZ5 A;  3LXT A;  3ME8 A;  4FYU A;  4K6X A;  4QL7 A;  1O6J A;  4ECJ A;  5HR2 A;  2XBQ A;  3E0U A;  5CAX A;  4YQV A;  2I3Y A;  4MZB A;  1A0R P;  2HSH A;  2PMT A;  2QA2 A;  1XW9 A;  2NDO A;  5D93 A;  4GST A;  4K7O A;  4ZBB A;  2RM5 A;  1E2Y A;  4CHS A;  3L78 A;  5C04 A;  5DAK B;  1EEJ A;  3BD2 A;  1HNA A;  4RUV A;  5D9X A;  3MNG A;  6GSW A;  5A34 A;  3F8U A;  2FY6 A;  1FO5 A;  5DJL A;  1ACV A;  4DSQ A;  5ABR A;  3IK9 A;  4ZL9 A;  1DSB A;  2WB9 A;  1S3R A;  3ED3 A;  3GKK A;  2VCW A;  3J7Y b;  3F6F A;  4OWY A;  1FAA A;  1HYU A;  3EC3 A;  2B1L A;  4D73 B;  3I69 A;  2H19 A;  2VUP A;  4NMU A;  2H6X A;  4J56 E;  4X1U A;  20GS A;  3MWH A;  3GH6 A;  1GUH A;  3M8N A;  3VWW A;  6GSV A;  1MEK A;  2R2J A;  3DD3 A;  1ABA A;  2GDR A;  2OT3 A;  3LW9 A;  4P3Y B;  2AYT A;  1YEW C;  2H0I A;  3CWG A;  1G0T A;  4JR6 A;  2GTU A;  3EMX A;  3HZ8 A;  1NHY A;  2DJ2 A;  4BWS A;  1M0U A;  4K7I A;  1A2M A;  5G1L A;  2MZC A;  3D4T A;  3IHQ A;  1RK4 A;  1NHO A;  2NBS A;  1XWB A;  4BVX A;  2HRA A;  1T4Y A;  1ST9 A;  4I2T A;  5IMZ A;  3J7Y k;  3LJR A;  1H75 A;  2CA8 A;  2X8C A;  1U87 A;  1DE2 A;  5G1K A;  1QGV A;  2PBJ A;  3CMI A;  2ZUP A;  5FHI A;  3L0H A;  4BL7 A;  2C80 A;  3I6A A;  1OE7 A;  3FKF A;  3G9B A;  3WGX A;  5IO0 A;  3UAP A;  1YKC A;  1OC9 B;  1UN2 A;  3CSI A;  2NVL A;  2CZ3 A;  5B8B A;  4N30 A;  2X49 A;  2LS5 A;  1JLW A;  1EZK A;  5LNK e;  3LGC A;  4MA9 A;  4YKG A;  2K6V A;  1O8X A;  2L6C A;  1Z7R A;  3EWL A;  4F0C A;  3CSJ A;  1FOH A;  4G0I A;  3FRC A;  2L4Q A;  5B6N A;  3CQF A;  2FWE A;  2HSN A;  3KIJ A;  5F06 A;  3UBK A;  4DEJ A;  3GFK A;  1JZD A;  1NM3 A;  3RAZ A;  2GST A;  2IMF A;  1WP0 A;  1K0C A;  1TP9 A;  1TK0 B;  2BTO T;  5J4Y A;  2H6Z A;  1SK0 A;  2P5Q A;  3VPT A;  2B5Y A;  4JR4 A;  4K2D A;  5D9T A;  4MJC A;  4HOJ A;  3GTU B;  3GH9 A;  4MP4 A;  3TRP A;  1X0R A;  1SL0 B;  2H75 A;  4IP1 A;  4ECI A;  2EIO A;  4IBP A;  3SBC A;  1PA3 A;  2M72 A;  1PSQ A;  2H1A A;  1IYI A;  3WYW A;  3TOT A;  4EF0 A;  4XS6 A;  1F37 A;  1XOB A;  2HRK B;  1K3Y A;  3DIE A;  5ECR B;  1JZW A;  1O7U A;  5IMD A;  1W4V A;  5CO3 A;  3Q74 A;  1JFU A;  2D2Z A;  4MAB A;  3K8N A;  4FH8 A;  1PL1 A;  4TR4 A;  4EIP A;  4MK3 A;  2CT6 A;  5IIZ A;  1XWG A;  3RPP A;  2HRN A;  1PFO A;  1ERT A;  1VGL A;  3GHA A;  4KE3 A;  1M3J A;  2HZF A;  1M3I A;  3VWX A;  4X0X A;  4O5R A;  2YOI A;  4MF6 A;  3KGK A;  1ERU A;  5B7C A;  2AUV A;  1IYH A;  2E2M A;  1YEX A;  1ZZY A;  3D22 A;  2M46 A;  1TDI A;  2PU9 C;  16GS A;  1VF1 A;  1WJK A;  2L4C A;  4MNN A;  5ECP B;  2R0C A;  4D73 A;  4MZC A;  1BJX A;  1G6Y A;  3CYN A;  3UIW A;  1MDI A;  4Z7X A;  1SKS B;  2DMM A;  3LSZ A;  1PD2 1;  2RLI A;  2YWO A;  4Z2T A;  4F03 A;  3N5O A;  3EPT A;  2XC2 A;  1OC3 A;  4FYC A;  4A5P A;  5ECL B;  3IPZ A;  2HE3 A;  2CX4 A;  3UVT A;  4JED A;  2IMK A;  2PUK C;  1EP8 A;  1SYX A;  3HZ4 A;  2HYX A;  1GUL A;  4GCI A;  3GSS A;  5GAP D;  4QL9 A;  2V6K A;  3KTB A;  5IMV A;  2A2P A;  3DML A;  3HJO A;  3BOA A;  3EUR A;  4L5O A;  4TW5 A;  4HJM A;  4XS4 B;  4L8E A;  2XBI A;  3IAM 2;  5BMU B;  3ERW A;  2IMD A;  2HSY A;  4GF0 A;  4MDC A;  3IAS 2;  2EFH A;  3QAG A;  1TXU A;  2H6Y A;  3PR8 A;  4TKY A;  3JCM L;  2LRT A;  2AJQ B;  1XZO A;  3FK8 A;  3M0F A;  5J9C A;  1E6B A;  2OBK A;  2IFQ B;  3R2Q A;  2P5R A;  1K0D A;  3BCI A;  6GST A;  2HI7 A;  2DML A;  4JBB A;  3ZZX A;  4HJ2 A;  2C0F A;  5ECS A;  4ML1 A;  1B4Q A;  4YAV A;  3UOM A;  3ZVJ A;  2WS2 A;  5J40 A;  5JCW A;  2IME A;  2WGR A;  4JU5 A;  3WT2 A;  1V9W A;  1LBK A;  3F4R A;  1OC9 A;  5EY6 A;  4TVE A;  2C0E A;  2NPB A;  2H74 A;  2WDU A;  3MYD A;  4PQ1 A;  1M2A A;  5C00 A;  2OE1 A;  5D9V A;  1Z3E A;  2VD1 A;  3TRQ A;  2NTO A;  2GT6 A;  1M2D A;  3QCP A;  2FNO A;  2OE3 A;  3PGT A;  4ZB9 A;  3S9F A;  4V2M A;  4EVM A;  1ZOF A;  5A1N A;  1HD2 A;  3TKS A;  3MAK A;  5G31 A;  4MMM A;  3ZLP A;  3TKR A;  2O89 A;  4WR4 A;  1XFL A;  4NXI A;  3L9S A;  5CYY A;  3GTU A;  5IPG A;  2LUS A;  2MMZ A;  4LMV A;  3LYK A;  1W89 A;  4XHM A;  1I1I P;  5AGY A;  2CVB A;  1N8J A;  1PL2 A;  2TIR A;  1BQ7 A;  3RHC A;  4NV2 A;  2VCZ A;  2HFD A;  1Z5Y E;  2CV4 A;  4FIW A;  4JRR A;  1Q98 A;  3IRA A;  4OCF A;  4RI6 A;  3FMW A;  2HLS A;  3P2A A;  2AV4 A;  1B9X C;  5G5F A;  1LU4 A;  2HRK A;  3DEX A;  3GST A;  3QAW A;  4ICY A;  2YN1 A;  5ELA A;  2VLU A;  1SVO A;  2RM6 A;  3C73 A;  4CY8 A;  1ZYQ B;  3G7Y A;  1A0F A;  4TRX A;  1T00 A;  2DSA A;  1O73 A;  2XPD A;  2QSI A;  5F07 A;  1NSW A;  2YWI A;  4IHU A;  4L0U A;  1MD3 A;  2UZ8 A;  5KOW A;  2FWH A;  3F0I A;  3HY2 A;  4PNG A;  2H1G A;  3C1S A;  2DBC A;  4O5Q A;  3C7M A;  4Q5N A;  1Z7P A;  1ZGN A;  2DKH A;  3F3Q A;  2BJX A;  3VPQ A;  2VM2 A;  2HRF A;  3HVX A;  3KJY A;  1EOH A;  5LD0 A;  2JU5 A;  5KN2 A;  4K8M A;  1FB0 A;  4W66 A;  3P90 A;  1YY7 A;  3APO A;  2L5O A;  2N5B A;  3VI7 A;  2DJ3 A;  3GV1 A;  1Q4J A;  2CVD A;  1TRS A;  1Y1U A;  1XG8 A;  1X9W B;  2N5F A;  3OR5 A;  1F6M C;  4WR5 A;  4FYB A;  1WWJ A;  1K0O A;  4XS4 A;  3TJB A;  4OFT A;  3DVX A;  4O7H A;  1M99 A;  4DSS B;  5DAL B;  3RFR C;  1J08 A;  1R5P A;  2BMX A;  2IL3 A;  1J0F A;  2JZR A;  1GTA A;  4WF4 A;  1PGT A;  2EC4 A;  1GNE A;  4OFN A;  4G9H A;  3A2W A;  4J57 E;  4KW6 A;  2B7J A;  2JSY A;  4LL4 B;  1PRX A;  2FWG A;  1PX7 A;  5IQY A;  18GS A;  2F8F A;  2VD0 A;  4WKW A;  3ZRE A;  1X5D A;  1FW1 A;  2HXK A;  2YJ7 A;  4AKX B;  2LJR A;  3HVN A;  4WBJ A;  4I8B A;  2O85 A;  1ILO A;  5ECN B;  1CQH A;  2B3S A;  4KUN A;  5A4W A;  4K7N A;  1YZX A;  3H93 A;  2I1U A;  1AQW A;  4POB A;  4TOP A;  5EPF A;  3C8E A;  2VCV A;  4NPB A;  3W6G A;  1U3I A;  4F0B A;  4K2X A;  4PTS A;  1GSE A;  1S3C A;  2G0F A;  1K0A A;  3DRN A;  1SL2 B;  2YWM A;  2FUG 2;  1VF2 A;  4BA7 A;  4TR1 A;  1AC1 A;  1GSU A;  4KDX A;  4FO5 A;  5INY A;  2RUE A;  2A4H A;  1ZYP A;  2VKZ G;  3D21 A;  5J3R A;  1HNB A;  1A24 A;  1SEN A;  1B9Y C;  1JHB A;  2LTK A;  4JE1 A;  3FR9 A;  3A5I A;  2GSQ A;  1XW6 A;  1ZL9 A;  4POK A;  4I2U A;  4TN8 A;  5JWQ B;  4G2E A;  1KEB A;  1GRX A;  2OBI A;  3TUE A;  2R3X A;  2C3Q A;  3MIX A;  1PN0 A;  5FT3 A;  3TKS C;  5DCG A;  4IN0 A;  4CW9 A;  1PMT A;  2ZCT A;  3UJ1 A;  3O76 A;  3HHV A;  5H5S A;  4MZW A;  4AF2 A;  2WCI A;  3GYK A;  4IVF A;  2DIY A;  3U6V A;  2RUF A;  3UAR A;  4F9Z A;  5KN3 A;  1G6W A;  2MBT A;  4HS1 A;  3FYG A;  4F2I A;  4MF5 A;  4WEY A;  2QA1 A;  2GSR A;  5ID2 B;  6GSY A;  3QMX A;  3KH9 A;  4HZ4 A;  1M7T A;  5G2Z A;  2G2Q A;  1B8X A;  1SD9 A;  3QAV A;  1K3L A;  2VCX A;  2LEG A;  4AJ6 A;  2C0G A;  3L9V A;  3GX8 A;  11GS A;  1YDK A;  5AIX A;  1A8Y A;  5D8I A;  3LOR A;  2KP2 A;  4BVY B;  3WD6 A;  2LJK A;  2LJA A;  5G5E A;  5IMC A;  3GX0 A;  1TW9 A;  4XCS A;  5A5H B;  4KCE A;  4QMK A;  2ON7 A;  2FA4 A;  4HQS A;  1CQG A;  2GT5 A;  2O8V B;  1GWC A;  5EVO A;  2H70 A;  3RBT A;  4F82 A;  3GUR A;  3TJF A;  4EIQ A;  4NAX A;  4Q5F A;  3F6D A;  5DQY A;  1K0B A;  5CRW A;  1PKZ A;  4KSO A;  3FZ9 A;  1B4P A;  3IE3 A;  4PUA A;  2HZE B;  4LL1 B;  1ML6 A;  1TRW A;  2WZ9 A;  3UEM A;  2ES7 A;  4Z2U A;  1SJI A;  3L9U A;  2DJK A;  2DJ0 A;  5EL8 A;  3UVH A;  2FA8 A;  1V40 A;  5DJM A;  2FWF A;  2KUC A;  1R5A A;  3GKN A;  4XS1 A;  3TDG A;  1HQO A;  4PI2 C;  2F9S A;  3IV4 A;  3TB2 A;  2CVK A;  1GSF A;  3RGB C;  3APQ A;  2LQO A;  4OO4 A;  1ERW A;  7GSS A;  3KEB A;  3H8Q A;  5J47 A;  2L57 A;  2IN3 A;  1BG1 A;  3KM6 A;  4KB3 A;  3NZN A;  1TK5 B;  8GSS A;  1YEP A;  4TXO B;  1B48 A;  1I5G A;  1GSD A;  2CAI A;  1SD8 A;  2JSZ A;  5HFI A;  1SKR B;  2E0Q A;  3HA9 A;  5D73 A;  4GDF A;  3IC4 A;  3DXB A;  3EE2 A;  2DC5 A;  5DAK A;  3UBL A;  1N2A A;  3KP8 A;  2R37 A;  2K18 A;  4E8H A;  2OAD A;  2AHE A;  4YQM A;  3CTF A;  3ZYW A;  2VM1 A;  2H1L A;  2MBS A;  3LFL A;  5FWG A;  4XIH A;  4O5U A;  2YV9 A;  3HXS A;  4OFM A;  4HUA A;  4L5L A;  5IOW A;  1DE1 A;  4HDE A;  2KHP A;  4N3Z A;  3ZTL A;  4YAP A;  4RQR A;  2X8G A;  1G7O A;  2WW2 A;  2IJY A;  1FVJ A;  3ZVJ D;  3ZIJ A;  3D6I A;  1T4Z A;  3A5W A;  2V1M A;  2GQL A;  1X5C A;  4N0V A;  3V1W A;  3Q6O A;  4KX4 A;  2KP1 A;  2VOC A;  2GZZ A; 
#chains in the Genus database with same CATH homology
 5J4U A;  3QFA C;  3Q19 A;  2DLX A;  2PPT A;  3UL3 A;  3CXG A;  5IO2 A;  14GS A;  1GLP A;  1XXU A;  3TKS E;  2QGV A;  4PUF C;  3QDN A;  2XHF A;  1THO A;  6GSS A;  4QQ7 A;  3KTL A;  3ZML A;  2RII A;  2R0G A;  1Y6E A;  4IGJ A;  3R3E A;  2LRC A;  3GNJ A;  4GQC A;  4G01 A;  2LQQ A;  3GIX A;  4K9Z A;  2IMI A;  2YCD A;  2B5X A;  3LG6 A;  3IBH A;  5H5Q A;  3IK7 A;  5D96 A;  1QMV A;  1KTE A;  1YVL A;  5JCG A;  4TR3 A;  5AIS A;  3TOU A;  2LNT A;  3TKQ A;  4ISD A;  4ULX A;  2DJJ A;  2QC7 A;  5IPH A;  4POL A;  1AAZ A;  4LA1 A;  4ZIL A;  5ID2 A;  4MJA A;  4GSS A;  1BF5 A;  2I4A A;  2A2R A;  2P31 A;  2VL2 A;  4MH3 A;  2KLX A;  2O7K A;  2O87 A;  4JZQ A;  1EWX A;  4NV5 A;  2YP6 A;  4KAE A;  4BVY A;  2GZP A;  3NIV A;  4WXT A;  1F3A A;  4HEA 2;  4K5R A;  4HQZ A;  4G0K A;  1V98 A;  5A34 B;  3F3R A;  3RDW A;  2JZS A;  2R0P A;  4OD7 A;  1ZYN A;  3AY8 A;  1ZMA A;  2VCT A;  1OYJ A;  1ON4 A;  1SK2 A;  3QFB C;  2F3M A;  4EL1 A;  4ILF A;  1GNW A;  1TRU A;  1Z6M A;  2O5V A;  4IJI A;  4YKF A;  3H4K A;  2TRC P;  2PWJ A;  2VAF A;  2JAD A;  2H0H A;  2GLR A;  1S3D A;  3RPN A;  3FZA A;  6GSU A;  4XRA A;  3IC8 A;  3LQ7 A;  4WET A;  3EVI A;  1I9D A;  1LJR A;  4EXJ A;  2OE0 A;  2OAC A;  4CY6 A;  5LCZ A;  4N0Z A;  2IPA A;  3PPU A;  3M9J A;  1SKW B;  4TXO A;  1GUM A;  2H1D A;  2GQM A;  3CSH A;  2MMA A;  3D4M A;  2AB6 A;  4ECC A;  3D5J A;  3HJP A;  12GS A;  3LYP A;  5J5N A;  2H8L A;  3WGD A;  3F4T A;  4YH2 A;  4E68 A;  1TK8 B;  1U3A A;  1KBN A;  4PQI A;  2C0D A;  3KMN A;  1OE8 A;  5AIV A;  5ECH B;  1XWA A;  3QR6 A;  1X9M B;  1T7P B;  3E3E A;  1UVZ A;  4ID0 A;  6GSX A;  2DJ1 A;  3ZIT A;  4KDU A;  4E8E A;  1GSS A;  1XPV A;  1DUG A;  4BVX B;  3P8W A;  5COH A;  2GVP A;  2JZT A;  4ACS A;  4V2L A;  1EEM A;  4N10 A;  2LV3 A;  3GKX A;  4ZL8 A;  5HR3 A;  1GTU A;  5ECI B;  1WE0 A;  1A2L A;  4GXZ A;  2E7P A;  2H72 A;  1GTB A;  5F0G A;  3O3T A;  1TU7 A;  2PVO C;  3WGE A;  1OKD A;  4HU7 A;  3E9J B;  4OO5 A;  2K8S A;  2OA7 A;  4PQH A;  4BL7 B;  1R4W A;  3KZQ A;  1BYE A;  3Q18 A;  2V6O A;  2H73 A;  5BRT A;  4ZB8 A;  1ZYE A;  1AQV A;  3DKS A;  1T3B A;  4TXV A;  4KSM A;  4YQU A;  1OAZ A;  1URM A;  3MDK A;  1RQM A;  4GWR A;  2EIR A;  4NWY A;  2PGT A;  5CNW A;  2HSN B;  3TJK A;  3ERG A;  1JLV A;  4HU9 A;  4OCE A;  4GTU A;  2L5L A;  5E59 A;  1BG5 A;  2LRN A;  1SJ6 A;  5BMU A;  5IMA A;  4IS0 A;  1FVK A;  2WJU A;  3IR4 A;  4POM A;  3FW2 A;  2VLT A;  4EC0 A;  4CDO A;  4V1A p;  2DIZ A;  2IFQ A;  2LST A;  2YWN A;  1Y25 A;  2B7K A;  3CTG A;  4MPG A;  3PIN A;  3KXO A;  1QXH A;  3GN3 A;  1X9S B;  5GZZ B;  4OMV A;  3C71 A;  2B6M A;  3HVS A;  4AI6 A;  1M2B A;  1YF0 A;  1TOF A;  1YQ1 A;  1TI3 A;  2FCH A;  2R4V A;  4MJB A;  2CX3 A;  1VF3 A;  4BPY A;  2WFC A;  4V2N A;  3FR3 A;  1O8W A;  5JCU A;  3G7J A;  3KMO A;  3GA4 A;  2LNS A;  2I9H A;  4K1F A;  5CRE A;  1VF4 A;  9GSS A;  1FB6 A;  2F51 A;  1SL1 B;  3M3M A;  2R6K A;  2C1Y A;  2V2G A;  4EDY A;  1XBS A;  4MCU A;  2CQ9 A;  2VL2 C;  2AAW A;  3TJG A;  5JWR B;  3TGZ A;  5F8B A;  4ZB7 A;  3H79 A;  4X4J A;  4ZXG A;  2I81 A;  4GQF A;  4DVC A;  1K0M A;  4L0W A;  4KGI A;  1SJZ A;  1T1V A;  2GGT A;  5D9W A;  3QPM A;  5HFK A;  1PN9 A;  2C3T A;  1SU9 A;  4IJ3 A;  1GL8 A;  2VIM A;  2B5E A;  3FZ4 A;  5G30 A;  2H71 A;  1T8E B;  2HSM B;  2FHE A;  5IMF A;  1GUK A;  4PUR A;  13GS A;  4EKZ A;  5HR1 A;  1GSY A;  1QQ2 A;  1SVM A;  3CRU A;  3D0Z A;  4HI7 A;  5GSS A;  1QFN A;  3WT1 A;  5ENU A;  1HNC A;  1XIY A;  2WRT A;  3FR6 A;  2FGX A;  1UC7 A;  2MMO A;  2V32 A;  4AJ8 A;  3SWL A;  5CRH A;  4J2F A;  1K3O A;  1U6T A;  4PXO A;  4EUY A;  1WIK A;  4N11 A;  5CP1 A;  4ZL7 A;  3IXR A;  1FG4 A;  2ZNM A;  1EOG A;  1QUW A;  1Z9H A;  3ERF A;  1NW2 A;  2H76 A;  5B6M A;  1XW5 A;  4NHZ A;  1GP1 A;  1R26 A;  2J9H A;  2JAC A;  2VLV A;  2E2G A;  5CRG A;  1GH2 A;  1O81 A;  19GS A;  4LLR A;  2ON5 A;  3KP9 A;  1GTI A;  2VL3 A;  2X8H A;  1S3A A;  4EE0 A;  3H1N A;  5E4W A;  4K5S A;  2EFD A;  2YJH A;  4AKI A;  4KF9 A;  10GS A;  4IQA A;  2H01 A;  2EIQ A;  2H30 A;  5GAN D;  3HJM A;  3GUS A;  4V1A g;  1PKW A;  4IW9 A;  1YJ6 A;  1N25 A;  4XTS A;  2TRX A;  4ZBD A;  3M1G A;  1BAY A;  4RQX A;  5ECQ B;  3BBY A;  1OC8 A;  4KDY A;  5A1N B;  5CRD A;  1F2E A;  4DSS A;  5DAL A;  2X99 A;  1A23 A;  1WMJ A;  1K0N A;  3VUR A;  1H4O A;  1MDJ A;  3DWV A;  4Z2R A;  4ZB6 A;  5ECK B;  1C72 A;  3F63 A;  1QK8 A;  4KA0 A;  3HCZ A;  2A4V A;  5L71 A;  3VK9 A;  4MLY A;  1EGO A;  1XVQ A;  3VWV A;  4IQ1 A;  4LMW A;  1F9M A;  5KN0 A;  3MSZ A;  2LKU A;  3EYT A;  4K0N A;  1GLQ A;  1M9B A;  5A4U A;  3VFI A;  3TU3 B;  4I5Q A;  3RHB A;  4MF7 A;  3KCM A;  1AQX A;  1EV4 A;  3HYP A;  1TKD B;  1XOA A;  1V57 A;  2C8U A;  2X64 A;  4AKH A;  4NHW A;  1SK1 A;  3DGQ A;  2FD3 A;  4I97 A;  3IHG A;  2OKA A;  3TRX A;  1U88 A;  1DBY A;  1EP7 A;  4Q5R A;  3TCO A;  1XVW A;  1ERV A;  1ZCP A;  3ZRD A;  5DCH A;  5KEJ A;  3A2V A;  1OVN A;  5J41 A;  2VCQ A;  3US3 A;  4WF5 A;  1PQN A;  2H1B A;  2L6D A;  3TKP A;  4X43 A;  3ME7 A;  2X4A A;  3DVW A;  3ZMK A;  3GMF A;  3EMP A;  3HMJ G;  3LWA A;  3N9J A;  4KH7 A;  4GLT A;  2B1K A;  3A2X A;  3KH7 A;  5HFG A;  2XPE A;  3VWU A;  1AXD A;  3GL3 A;  4EDZ A;  5HQP A;  4I6X A;  5J9B A;  2VL9 A;  1EGR A;  1MD4 A;  4PX1 A;  2FLS A;  2C3N A;  2HSM A;  2P0G A;  3FHK A;  4KND A;  2WUL A;  5DVB A;  2MMN A;  2M80 A;  1J9B A;  1WOU A;  5J4V A;  5IM9 A;  5B8A A;  5F05 A;  1Z6N A;  2OJL A;  1JZO A;  2K8V A;  4AKG A;  1UA5 A;  2KOK A;  1G7E A;  1KNG A;  4USS A;  4MJE A;  1FHE A;  4KCA A;  1V2A A;  1AIU A;  2PER A;  2GS3 A;  3QD9 A;  1GSQ A;  5A4V A;  2YPM A;  3TJJ A;  2PVQ A;  1BX9 A;  2Z9S A;  1SYR A;  3NOF A;  2PN8 A;  2N5A A;  1TTZ A;  1XCC A;  4IP6 A;  4EO3 A;  2F8A A;  2YNX A;  1A2J A;  4K0G A;  2IWT A;  1MDK A;  1TJD A;  3EIN A;  3FEU A;  2GQK A;  5A5H A;  5ECM B;  2YZU A;  2EFC A;  2YZH A;  3F9U A;  1AUC A;  2K9F A;  3LXZ A;  1A8L A;  1XWC A;  2C4J A;  3CBU A;  4IKH A;  1PX6 A;  3ZIV A;  3QOU A;  4MH2 A;  4WBR D;  2VO4 A;  3C1R A;  4DSR A;  2DKI A;  2V41 A;  3HDC A;  3BCK A;  3VLN A;  22GS A;  3F4S A;  3PH9 A;  1BED A;  1MTC A;  2YAN A;  4ZBA A;  2HQT A;  3IDV A;  4H86 A;  1AW9 A;  2HNL A;  1EV9 A;  2HZE A;  1USB A;  3ZL5 A;  1TI1 A;  1VRS D;  3DYR A;  2GSS A;  3HVV A;  2ALB A;  3BJ5 A;  1FOV A;  1OKT A;  2HT9 A;  2GZY A;  4TR1 B;  5ECO B;  4AGS A;  5GST A;  4PNF A;  1TU8 A;  3UMA A;  2H66 A;  5H5R A;  3A3T A;  4O32 A;  3EU3 A;  4Q5Q A;  3ISO A;  3FY7 A;  3APS A;  2YV7 A;  3IOS A;  5DDL A;  3GKM A;  1TXX A;  3GL5 A;  17GS A;  1XWK A;  5ELG A;  3M9K A;  1RW1 A;  5DBQ A;  4TR0 A;  4G19 A;  3W8J A;  5KOX A;  2IIY A;  3CRT A;  3L4N A;  4G10 A;  2UV8 G;  1R7H A;  3GRX A;  4ZIJ A;  3I9V 2;  5IOX A;  5HR0 A;  4ML6 A;  2MYG A;  3IA1 A;  2JL4 A;  4HZ2 A;  1THX A;  3HD5 A;  1M9A A;  5DQS A;  3ZFL A;  1X5E A;  4RI7 A;  3U5R E;  3HKR A;  4G0L A;  2J23 A;  1WPI A;  2A2S A;  1JZR A;  4IEL A;  1O85 A;  4ECB A;  3VI5 A;  2EFE A;  4PGT A;  3LEF A;  3W8S A;  2REM A;  5A5K A;  4BWQ A;  5KN1 A;  4XRD A;  3O6T A;  3I43 A;  2L59 A;  3P7X A;  4AJ7 A;  4GSN A;  2QKE A;  2CZ2 A;  2H0G A;  1SVL A;  4FQU A;  4GRF A;  2R5G A;  5AN1 A;  1YKA A;  3G7I A;  3KD0 A;  1F3B A;  1TRV A;  1YF1 A;  1WRY A;  1V58 A;  3EU4 A;  4O92 A;  4MPF A;  2CAQ A;  5JWO B;  3ZFB A;  3FZ5 A;  3LXT A;  3ME8 A;  4FYU A;  4K6X A;  4QL7 A;  1O6J A;  4ECJ A;  5HR2 A;  2XBQ A;  3E0U A;  5CAX A;  4YQV A;  2I3Y A;  4MZB A;  1A0R P;  2HSH A;  2PMT A;  2QA2 A;  1XW9 A;  2NDO A;  5D93 A;  4GST A;  4K7O A;  4ZBB A;  2RM5 A;  1E2Y A;  4CHS A;  3L78 A;  5C04 A;  5DAK B;  1EEJ A;  3BD2 A;  1HNA A;  4RUV A;  5D9X A;  3MNG A;  6GSW A;  5A34 A;  3F8U A;  2FY6 A;  1FO5 A;  5DJL A;  1ACV A;  4DSQ A;  5ABR A;  3IK9 A;  4ZL9 A;  1DSB A;  2WB9 A;  3ED3 A;  3GKK A;  2VCW A;  3J7Y b;  3F6F A;  4OWY A;  1FAA A;  1HYU A;  3EC3 A;  2B1L A;  4D73 B;  3I69 A;  2H19 A;  2VUP A;  4NMU A;  2H6X A;  4J56 E;  4X1U A;  20GS A;  3MWH A;  3GH6 A;  1GUH A;  3M8N A;  3VWW A;  6GSV A;  1MEK A;  2R2J A;  3DD3 A;  1ABA A;  2GDR A;  2OT3 A;  3LW9 A;  4P3Y B;  2AYT A;  2H0I A;  3CWG A;  1G0T A;  4JR6 A;  2GTU A;  3EMX A;  3HZ8 A;  1NHY A;  2DJ2 A;  4BWS A;  1M0U A;  4K7I A;  1A2M A;  5G1L A;  2MZC A;  3D4T A;  3IHQ A;  1RK4 A;  1NHO A;  2NBS A;  1XWB A;  4BVX A;  2HRA A;  1T4Y A;  1ST9 A;  4I2T A;  5IMZ A;  3J7Y k;  3LJR A;  1H75 A;  2CA8 A;  2X8C A;  1U87 A;  1DE2 A;  5G1K A;  1QGV A;  2PBJ A;  3CMI A;  2ZUP A;  5FHI A;  3L0H A;  4BL7 A;  2C80 A;  1OE7 A;  3I6A A;  3FKF A;  3G9B A;  3WGX A;  5IO0 A;  3UAP A;  1YKC A;  1OC9 B;  1UN2 A;  3CSI A;  2NVL A;  2CZ3 A;  5B8B A;  4N30 A;  2X49 A;  2LS5 A;  1JLW A;  1EZK A;  5LNK e;  3LGC A;  4MA9 A;  4YKG A;  2K6V A;  1O8X A;  2L6C A;  1Z7R A;  3EWL A;  4F0C A;  3CSJ A;  1FOH A;  4G0I A;  3FRC A;  2L4Q A;  5B6N A;  2FWE A;  2HSN A;  3KIJ A;  5F06 A;  3UBK A;  4DEJ A;  3GFK A;  1JZD A;  1NM3 A;  3RAZ A;  2GST A;  2IMF A;  1WP0 A;  1K0C A;  1TP9 A;  1TK0 B;  2BTO T;  5J4Y A;  2H6Z A;  1SK0 A;  2P5Q A;  3VPT A;  2B5Y A;  4JR4 A;  4K2D A;  5D9T A;  4MJC A;  4HOJ A;  3GTU B;  3GH9 A;  4MP4 A;  3TRP A;  1X0R A;  1SL0 B;  2H75 A;  4IP1 A;  4ECI A;  2EIO A;  4IBP A;  3SBC A;  1PA3 A;  2M72 A;  1PSQ A;  2H1A A;  1IYI A;  3WYW A;  3TOT A;  4EF0 A;  4XS6 A;  1F37 A;  1XOB A;  2HRK B;  1K3Y A;  3DIE A;  5ECR B;  1JZW A;  1O7U A;  5IMD A;  1W4V A;  5CO3 A;  3Q74 A;  1JFU A;  2D2Z A;  4MAB A;  3K8N A;  4FH8 A;  1PL1 A;  4TR4 A;  4EIP A;  4MK3 A;  2CT6 A;  5IIZ A;  1XWG A;  3RPP A;  2HRN A;  1ERT A;  1VGL A;  3GHA A;  4KE3 A;  2HZF A;  4X0X A;  3VWX A;  4O5R A;  2YOI A;  4MF6 A;  3KGK A;  1ERU A;  5B7C A;  2AUV A;  1IYH A;  2E2M A;  1YEX A;  1ZZY A;  3D22 A;  2M46 A;  1TDI A;  2PU9 C;  16GS A;  1VF1 A;  1WJK A;  2L4C A;  4MNN A;  5ECP B;  2R0C A;  4D73 A;  4MZC A;  1BJX A;  1G6Y A;  3CYN A;  3UIW A;  1MDI A;  4Z7X A;  1SKS B;  2DMM A;  3LSZ A;  1PD2 1;  2RLI A;  2YWO A;  4Z2T A;  4F03 A;  3N5O A;  3EPT A;  2XC2 A;  1OC3 A;  4FYC A;  4A5P A;  5ECL B;  3IPZ A;  2HE3 A;  2CX4 A;  3UVT A;  4JED A;  2IMK A;  2PUK C;  1EP8 A;  1SYX A;  3HZ4 A;  2HYX A;  1GUL A;  4GCI A;  3GSS A;  5GAP D;  4QL9 A;  2V6K A;  3KTB A;  5IMV A;  2A2P A;  3DML A;  3HJO A;  3BOA A;  3EUR A;  4L5O A;  4TW5 A;  4HJM A;  4XS4 B;  4L8E A;  2XBI A;  3IAM 2;  5BMU B;  3ERW A;  2IMD A;  2HSY A;  4GF0 A;  4MDC A;  3IAS 2;  2EFH A;  3QAG A;  1TXU A;  2H6Y A;  3PR8 A;  4TKY A;  3JCM L;  2LRT A;  2AJQ B;  1XZO A;  3FK8 A;  3M0F A;  5J9C A;  1E6B A;  2OBK A;  2IFQ B;  3R2Q A;  2P5R A;  1K0D A;  3BCI A;  6GST A;  2HI7 A;  2DML A;  4JBB A;  3ZZX A;  4HJ2 A;  2C0F A;  5ECS A;  4ML1 A;  1B4Q A;  4YAV A;  3UOM A;  3ZVJ A;  2WS2 A;  5J40 A;  5JCW A;  2IME A;  2WGR A;  4JU5 A;  3WT2 A;  1V9W A;  1LBK A;  3F4R A;  1OC9 A;  5EY6 A;  4TVE A;  2C0E A;  2NPB A;  2H74 A;  2WDU A;  3MYD A;  4PQ1 A;  1M2A A;  5C00 A;  2OE1 A;  5D9V A;  1Z3E A;  2VD1 A;  3TRQ A;  2NTO A;  2GT6 A;  1M2D A;  3QCP A;  2FNO A;  2OE3 A;  3PGT A;  4ZB9 A;  3S9F A;  4V2M A;  4EVM A;  1ZOF A;  5A1N A;  1HD2 A;  3TKS A;  3MAK A;  5G31 A;  4MMM A;  3ZLP A;  3TKR A;  2O89 A;  4WR4 A;  1XFL A;  4NXI A;  3L9S A;  5CYY A;  3GTU A;  5IPG A;  2LUS A;  2MMZ A;  4LMV A;  3LYK A;  1W89 A;  4XHM A;  5AGY A;  2CVB A;  1N8J A;  1PL2 A;  2TIR A;  1BQ7 A;  3RHC A;  4NV2 A;  2VCZ A;  2HFD A;  1Z5Y E;  2CV4 A;  4FIW A;  4JRR A;  1Q98 A;  3IRA A;  4OCF A;  4RI6 A;  3FMW A;  2HLS A;  3P2A A;  2AV4 A;  1B9X C;  5G5F A;  1LU4 A;  2HRK A;  3DEX A;  3GST A;  3QAW A;  4ICY A;  2YN1 A;  5ELA A;  2VLU A;  1SVO A;  2RM6 A;  3C73 A;  4CY8 A;  1ZYQ B;  3G7Y A;  1A0F A;  4TRX A;  1T00 A;  2DSA A;  1O73 A;  2XPD A;  2QSI A;  5F07 A;  1NSW A;  2YWI A;  4IHU A;  4L0U A;  1MD3 A;  2UZ8 A;  5KOW A;  2FWH A;  3F0I A;  3HY2 A;  4PNG A;  2H1G A;  3C1S A;  2DBC A;  4O5Q A;  3C7M A;  4Q5N A;  1Z7P A;  1ZGN A;  2DKH A;  3F3Q A;  2BJX A;  3VPQ A;  2VM2 A;  2HRF A;  3HVX A;  3KJY A;  1EOH A;  5LD0 A;  2JU5 A;  5KN2 A;  4K8M A;  1FB0 A;  4W66 A;  3P90 A;  1YY7 A;  3APO A;  2L5O A;  2N5B A;  3VI7 A;  2DJ3 A;  3GV1 A;  1Q4J A;  2CVD A;  1TRS A;  1Y1U A;  1X9W B;  2N5F A;  3OR5 A;  1F6M C;  4WR5 A;  4FYB A;  1WWJ A;  1K0O A;  4XS4 A;  3TJB A;  4OFT A;  3DVX A;  4O7H A;  1M99 A;  4DSS B;  5DAL B;  1J08 A;  1R5P A;  2BMX A;  2IL3 A;  1J0F A;  2JZR A;  1GTA A;  4WF4 A;  1PGT A;  2EC4 A;  1GNE A;  4OFN A;  4G9H A;  3A2W A;  4J57 E;  4KW6 A;  2B7J A;  2JSY A;  4LL4 B;  1PRX A;  2FWG A;  1PX7 A;  5IQY A;  18GS A;  2F8F A;  2VD0 A;  4WKW A;  3ZRE A;  1X5D A;  1FW1 A;  2HXK A;  2YJ7 A;  4AKX B;  2LJR A;  4WBJ A;  4I8B A;  2O85 A;  1ILO A;  5ECN B;  1CQH A;  2B3S A;  4KUN A;  5A4W A;  4K7N A;  1YZX A;  3H93 A;  2I1U A;  1AQW A;  4POB A;  4TOP A;  5EPF A;  3C8E A;  2VCV A;  4NPB A;  3W6G A;  1U3I A;  4F0B A;  4K2X A;  4PTS A;  1GSE A;  1S3C A;  2G0F A;  1K0A A;  3DRN A;  1SL2 B;  2YWM A;  2FUG 2;  1VF2 A;  4BA7 A;  4TR1 A;  1AC1 A;  1GSU A;  4KDX A;  4FO5 A;  5INY A;  2RUE A;  2A4H A;  1ZYP A;  2VKZ G;  3D21 A;  5J3R A;  1HNB A;  1A24 A;  1SEN A;  1B9Y C;  1JHB A;  2LTK A;  4JE1 A;  3FR9 A;  3A5I A;  2GSQ A;  1XW6 A;  1ZL9 A;  4POK A;  4I2U A;  4TN8 A;  5JWQ B;  4G2E A;  1KEB A;  1GRX A;  2OBI A;  3TUE A;  2R3X A;  2C3Q A;  3MIX A;  1PN0 A;  5FT3 A;  3TKS C;  5DCG A;  4IN0 A;  4CW9 A;  1PMT A;  2ZCT A;  3UJ1 A;  3O76 A;  3HHV A;  5H5S A;  4MZW A;  4AF2 A;  2WCI A;  3GYK A;  4IVF A;  2DIY A;  3U6V A;  2RUF A;  3UAR A;  4F9Z A;  5KN3 A;  1G6W A;  2MBT A;  4HS1 A;  3FYG A;  4F2I A;  4MF5 A;  4WEY A;  2QA1 A;  2GSR A;  5ID2 B;  6GSY A;  3QMX A;  3KH9 A;  4HZ4 A;  1M7T A;  5G2Z A;  2G2Q A;  1B8X A;  1SD9 A;  3QAV A;  1K3L A;  2VCX A;  2LEG A;  4AJ6 A;  2C0G A;  3L9V A;  3GX8 A;  11GS A;  1YDK A;  5AIX A;  1A8Y A;  5D8I A;  3LOR A;  2KP2 A;  4BVY B;  3WD6 A;  2LJK A;  2LJA A;  5G5E A;  5IMC A;  3GX0 A;  1TW9 A;  4XCS A;  5A5H B;  4KCE A;  4QMK A;  2ON7 A;  2FA4 A;  4HQS A;  1CQG A;  2GT5 A;  2O8V B;  1GWC A;  5EVO A;  2H70 A;  3RBT A;  4F82 A;  3GUR A;  3TJF A;  4EIQ A;  4NAX A;  4Q5F A;  3F6D A;  5DQY A;  1K0B A;  5CRW A;  1PKZ A;  4KSO A;  3FZ9 A;  1B4P A;  3IE3 A;  4PUA A;  2HZE B;  4LL1 B;  1ML6 A;  1TRW A;  2WZ9 A;  3UEM A;  2ES7 A;  4Z2U A;  1SJI A;  3L9U A;  2DJK A;  2DJ0 A;  5EL8 A;  3UVH A;  2FA8 A;  1V40 A;  5DJM A;  2FWF A;  2KUC A;  1R5A A;  3GKN A;  4XS1 A;  3TDG A;  1HQO A;  2F9S A;  3IV4 A;  3TB2 A;  2CVK A;  1GSF A;  3APQ A;  2LQO A;  4OO4 A;  1ERW A;  7GSS A;  3KEB A;  3H8Q A;  5J47 A;  2L57 A;  2IN3 A;  1BG1 A;  3KM6 A;  4KB3 A;  3NZN A;  1TK5 B;  8GSS A;  1YEP A;  4TXO B;  1B48 A;  1I5G A;  1GSD A;  2CAI A;  1SD8 A;  2JSZ A;  5HFI A;  1SKR B;  2E0Q A;  3HA9 A;  5D73 A;  4GDF A;  3IC4 A;  3DXB A;  3EE2 A;  2DC5 A;  5DAK A;  3UBL A;  1N2A A;  3KP8 A;  2R37 A;  2K18 A;  4E8H A;  2OAD A;  2AHE A;  4YQM A;  3CTF A;  3ZYW A;  2VM1 A;  2H1L A;  2MBS A;  3LFL A;  5FWG A;  4XIH A;  4O5U A;  2YV9 A;  3HXS A;  4OFM A;  4HUA A;  4L5L A;  5IOW A;  1DE1 A;  4HDE A;  2KHP A;  4N3Z A;  3ZTL A;  4YAP A;  4RQR A;  2X8G A;  1G7O A;  2IJY A;  1FVJ A;  3ZVJ D;  3ZIJ A;  3D6I A;  1T4Z A;  3A5W A;  2V1M A;  2GQL A;  1X5C A;  4N0V A;  3V1W A;  3Q6O A;  4KX4 A;  2KP1 A;  2VOC A;  2GZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...