4MP4A

Crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
212
structure length
198
Chain Sequence
EYFKLYTDSQFLSPYAFTVFVGLHEKQIPFEIAAIDLLTAKVPVLEHNDFALSESSAILEYLEELYPDTAIYPKDIQARARARQIQAWLRSDLVALRTERPTDVIFIQPKSTPLSEEGKKAAEKLFFVAEKLLASDAEFLFGSWSIVDAELALMLQRLIQNGDAVSERLKNYALQQWQRPSVQKWLALRHKAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of a glutathione transferase family member from Acinetobacter baumannii, Target EFI-501785, apo structure
rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
total genus 69
structure length 198
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mp4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mp4A01
3EU4A 2FLSA 3MNGA 2C0GA 4EF0A 2AJQB 2IMEA 1GSUA 3GURA 3TDGA 4XS6A 3KJYA 2R37A 1AAZA 4IW9A 3DVWA 2LRTA 1Z9HA 5FT3A 1U3AA 3HVSA 1BYEA 5ABRA 4XS4A 4G9HA 4GXZA 4AJ7A 2JSZA 3IBHA 1YKCA 3LYKA 5DDLA 4O5RA 3FEUA 3KH9A 4TW5A 3FRCA 3ERFA 2OE1A 1MDKA 1USBA 4CHSA 3DD3A 5CREA 3W8SA 5AIXA 5C04A 2HZFA 1A2JA 2PU9C 4XCSA 1YF0A 4GCIA 3WD6A 1PRXA 4F2IA 1K0BA 2P5QA 2GDRA 3U6VA 5LNKe 2H0GA 2JADA 2V32A 4XHMA 3DEXA 1JLWA 1ZGNA 2VUPA 4ZIJA 2KLXA 5G1LA 4DSSA 2DJ1A 2CA8A 4ECJA 2CAIA 4F0BA 2O89A 2XBIA 3EINA 3P8WA 2F9SA 1W89A 4IP6A 1QMVA 3C73A 1OE7A 3CTGA 1TRWA 5F05A 2B1KA 1PX6A 5A4UA 1A24A 1M2AA 2QC7A 2HRKB 1XZOA 2F8AA 3KTBA 3Q6OA 4F82A 5HFGA 4MZWA 1DUGA 3ZIJA 2MBSA 4KB3A 1PKZA 2LV3A 4XS4B 3VK9A 1ZOFA 2V41A 3ME8A 4QQ7A 3NOFA 4EL1A 2C3NA 4EO3A 4KAEA 3ERGA 2IN3A 3ZFLA 2HYXA 5KN2A 5CRGA 4HEA2 5IQYA 1R7HA 3TJGA 2LSTA 5JWQB 2B6MA 3QFAC 4KW6A 4MJAA 4IQ1A 4Q5NA 3P7XA 6GSSA 3KIJA 4K9ZA 4KGIA 6GSWA 4ULXA 1Y6EA 5HR2A 1OC3A 1RQMA 3CSJA 1Z7PA 3IV4A 3IC8A 4DSSB 5DQSA 5DCHA 3RHCA 4FYBA 4TXOA 4I6XA 1ML6A 2YV7A 4OO5A 1EP8A 2X8CA 1PD21 3FKFA 3L9VA 1PA3A 2CZ3A 3ZZXA 2OA7A 1JZWA 1MD3A 4KF9A 1ERUA 2HZEA 4MH2A 1B4PA 3FW2A 3D0ZA 5ELGA 2FD3A 2NVLA 2C0EA 1A8LA 1WRYA 1G7OA 4LL4B 3CRTA 3F4RA 4FYCA 1EV9A 2DSAA 5F06A 4TR3A 3IHQA 2DJJA 2H75A 1BG5A 2CT6A 4PTSA 4KDYA 5ECMB 3ME7A 1ACVA 3HHVA 4OFNA 2YN1A 5GZZB 2HSYA 1YEPA 2YP6A 1O73A 2GSTA 2EIRA 5D8IA 2H0HA 2HI7A 3VWVA 3GNJA 5IO0A 3UJ1A 2JACA 2V2GA 4ISDA 3F8UA 1THOA 3QMXA 4G0KA 3GRXA 1J08A 3VWWA 6GSYA 4AF2A 1XVQA 1JHBA 3ZTLA 5DCGA 3E0UA 4NV5A 5CRWA 3GX0A 2YWIA 2GQKA 2HLSA 2YV9A 16GSA 4IHUA 1GNEA 1QGVA 1THXA 1YEXA 1UA5A 2RLIA 4XRDA 4JEDA 2HZEB 1FW1A 3MDKA 3ERWA 1XW6A 4WXTA 3BCIA 1T8EB 3ZL5A 4HOJA 2WB9A 1TI1A 3IAM2 2HSMA 5ECRB 3GV1A 5BMUA 2F3MA 1GRXA 1JFUA 4ILFA 4J57E 3RPNA 3C8EA 4PNGA 1WOUA 4IKHA 2H70A 3G9BA 3IR4A 4MPGA 4V2NA 2V6OA 4ZL7A 7GSSA 3ED3A 1A8YA 3QCPA 3I69A 2KHPA 5IOXA 5IM9A 1PQNA 4O92A 1JZRA 6GSVA 1XW9A 4D73A 4ZB9A 4GLTA 4IJIA 1XFLA 1J0FA 3F4TA 2A4VA 2DJ0A 2H8LA 4ZB6A 2CAQA 2CZ2A 3TGZA 3TJBA 2PGTA 3DGQA 1QQ2A 2CVKA 3GHAA 1F37A 1B4QA 1SENA 3H79A 2WDUA 1GL8A 2VD0A 3A2WA 1VF4A 3APSA 5B8BA 2PMTA 3PINA 1FO5A 12GSA 3A2VA 2M80A 3UMAA 2MZCA 2MYGA 4K6XA 4NAXA 2IPAA 2HSMB 3TOUA 2NDOA 4PNFA 4NPBA 4HZ2A 5G5EA 5E59A 3LORA 4EKZA 1GLQA 5ECSA 1G6WA 2YJ7A 3EWLA 5A4WA 1GUMA 2H73A 5A4VA 1AQXA 2Z9SA 5J41A 3WYWA 2C1YA 4G19A 2DLXA 2C4JA 2VL2C 1M2DA 1FB6A 4D73B 2CVBA 4K7IA 1ERVA 1GUKA 1O6JA 2ON7A 1M0UA 3FHKA 2HE3A 3LQ7A 3GH9A 1X9MB 5DAKA 1Z6NA 3KCMA 5F0GA 2NTOA 2FWHA 3DKSA 2C3TA 2GZPA 3F4SA 3WGEA 3LGCA 1H75A 4EDZA 3IA1A 2ALBA 3TOTA 1LBKA 5IMCA 1HNAA 1ZZYA 1R5PA 18GSA 5JWRB 2V6KA 4IVFA 3O6TA 3US3A 5GSSA 5H5QA 1MTCA 4N30A 1BAYA 3APOA 4F03A 2LRCA 3KZQA 5J9CA 6GSTA 3LEFA 1OAZA 3LXZA 2VIMA 2GT5A 3R2QA 2B5EA 4BVXB 3D22A 1Z7RA 8GSSA 2H74A 19GSA 1FHEA 5DALA 2FUG2 4BL7A 3GYKA 3U5RE 1V98A 2F51A 4OO4A 5EY6A 3GL5A 1O8WA 4KNDA 2YNXA 3CSIA 5J5NA 4J2FA 2QSIA 5DAKB 1OE8A 3C7MA 2BTOT 2O87A 2HFDA 4OCEA 5F07A 3QDNA 1G7EA 1MD4A 4K2DA 5AGYA 4JBBA 3HYPA 4PUAA 4PUFC 4N10A 3N9JA 1M9BA 4I2TA 1LU4A 5ID2A 4MJCA 4ZBAA 2X64A 3ZIVA 4HQZA 2VAFA 1SKWB 4HQSA 2VO4A 4MPFA 2VD1A 1AXDA 2LKUA 2LNSA 1S3AA 3CTFA 4K7OA 3K8NA 1BJXA 3M3MA 5FHIA 3L9UA 5ECNB 1F6MC 2GT6A 3C71A 2E7PA 5IMZA 4KDXA 2RM6A 3UEMA 3IRAA 20GSA 4BVYA 2E0QA 4I5QA 5CO3A 1TU8A 3IK9A 4EDYA 2PERA 4MK3A 2VLTA 3W8JA 5DALB 2NBSA 4BL7B 3ZMLA 3G7JA 22GSA 1BX9A 1ZYEA 2I3YA 1O81A 4KDUA 3IPZA 4XS1A 4LA1A 1EOHA 1U6TA 1OC9B 3HDCA 3KP8A 4GRFA 1HQOA 1TW9A 2QKEA 3HD5A 2HQTA 2VCXA 4O7HA 1X0RA 3OR5A 2H1DA 3F3RA 4YQUA 1PN9A 1LJRA 1MDIA 3RDWA 5ID2B 5D9VA 4POMA 5COHA 5L71A 3EE2A 2OJLA 2CQ9A 1VGLA 2WCIA 4ML6A 3L9SA 1F3BA 3LWAA 2HXKA 2YCDA 4HUAA 2OBIA 1U88A 2O8VB 3EVIA 4I8BA 2I9HA 4IGJA 4YAVA 3HVXA 2P0GA 4IP1A 3KH7A 3TRQA 1UN2A 2GTUA 4JZQA 3ZMKA 4BVYB 1XWBA 3C1SA 4ZB8A 5IPHA 3GL3A 1GUHA 2E2MA 5CRDA 2LQQA 2FNOA 1BQ7A 5JWOB 2I81A 2VCZA 4IS0A 2OBKA 1PGTA 4L8EA 5D9XA 4K1FA 1PL1A 13GSA 3RHBA 3DYRA 1V40A 1TTZA 2IWTA 3TKSE 4POKA 3R3EA 1RW1A 4XTSA 2WFCA 4NWYA 4TKYA 1ZL9A 5EL8A 4PQHA 2A2SA 3QAGA 2P5RA 3UAPA 4E8HA 5ENUA 2A2RA 3VI7A 2DBCA 1GSYA 4ACSA 4DEJA 1T00A 3TKSA 9GSSA 1NHYA 1EOGA 3I43A 3AY8A 4RI7A 1FG4A 2EC4A 4N11A 3KTLA 2IFQA 4MLYA 1GSEA 4HZ4A 5IMAA 5KN1A 1XWCA 1X5DA 2PVQA 1E2YA 3D4MA 2QGVA 5J9BA 2OADA 1SYXA 3FR9A 4QL7A 4TN8A 1GTIA 4MH3A 2H01A 1EV4A 1OYJA 4KSOA 4RUVA 4YH2A 2JZSA 5G5FA 3MSZA 2I1UA 2DMMA 2KOKA 3I6AA 1VRSD 2MMNA 1T3BA 1PKWA 3HXSA 2VL9A 2F8FA 4GQCA 4ECBA 5DJLA 3J7Yk 3LG6A 1T1VA 2FWFA 2ZCTA 4TOPA 2H6XA 1SJ6A 1SD8A 3TJJA 4WBJA 4WBRD 2WGRA 4POLA 3H4KA 1SK0A 2N5AA 2PVOC 5CAXA 1I5GA 2WZ9A 2H6ZA 1AC1A 1GWCA 1XBSA 3BJ5A 3G7YA 2PPTA 1PX7A 4IELA 4TXOB 5IMVA 5D73A 3RBTA 5B6NA 2GZYA 3VLNA 2WJUA 2LQOA 2CVDA 4FYUA 4OFMA 2ZNMA 4USSA 2L6CA 6GSXA 4Q5FA 4EVMA 1XIYA 2IFQB 3F0IA 1EGOA 4K7NA 3IC4A 3WGDA 3GMFA 5AN1A 4RQXA 2GGTA 2AHEA 4MCUA 2PN8A 3F6FA 4WR4A 4FIWA 4JE1A 1NW2A 2IIYA 3CYNA 2CX3A 1KEBA 2X8HA 1TKDB 2GS3A 3D21A 5HQPA 4V2MA 2YWOA 2FA8A 1Q98A 2CX4A 2HRNA 3NZNA 4G10A 3H8QA 4L5OA 5G30A 3I9V2 3MAKA 4RI6A 5ECHB 2B5YA 2BMXA 4MA9A 1X9WB 1XPVA 4Q5QA 2IMIA 3FZ4A 3CMIA 4BWQA 3ZVJA 1WWJA 4GQFA 2L59A 1PSQA 3WT2A 3E3EA 1QFNA 4WKWA 2G0FA 4GSNA 4HU9A 2WS2A 2LUSA 4F9ZA 1AQWA 4N0VA 4OD7A 1TK5B 1PMTA 4BA7A 3TCOA 3DIEA 1B8XA 2IMKA 4HU7A 2H30A 4NV2A 1KNGA 4NMUA 2HSNB 1XWGA 5B7CA 2YWNA 3QOUA 1S3DA 5AISA 2PBJA 1GP1A 2HT9A 2K9FA 4V2LA 3GIXA 2HRFA 2VCWA 2CV4A 3VPQA 3KD0A 5EPFA 3DMLA 1SL1B 1X5EA 2VOCA 4N0ZA 2N5BA 5IOWA 4ECCA 1AUCA 1FVJA 3TUEA 3FR3A 2RIIA 1YQ1A 1NSWA 2O85A 4NHWA 4EXJA 5GAND 4PX1A 4PXOA 2B7JA 1UC7A 4ID0A 2DIZA 2VCQA 2DC5A 3UL3A 1WMJA 2DJ3A 4GTUA 3DRNA 3RPPA 4FH8A 2OE0A 3FYGA 2H1BA 2RUEA 4ZBDA 5ELAA 2R4VA 2GQMA 1R26A 5KN3A 2FA4A 1ZYQB 3GX8A 4TR1A 3FY7A 1AIUA 5E4WA 3E9JB 2C8UA 4PURA 4TR4A 4IJ3A 2J9HA 4JRRA 1WP0A 5D9WA 4EUYA 5ECLB 4ML1A 3UARA 2B5XA 2C0FA 2AB6A 2XBQA 2FY6A 4IQAA 3H1NA 1XWAA 3ZVJD 4K8MA 5HR0A 2LJRA 3S9FA 4IN0A 3EURA 5H5RA 1VF2A 5A5KA 4ZBBA 1IYIA 4YQMA 5ECOB 4POBA 3FR6A 2M46A 3EMXA 4IBPA 4E8EA 3V1WA 2EIQA 2K8VA 1C72A 3ZLPA 4KCAA 3O3TA 4NXIA 1GSQA 4LLRA 4KA0A 4QL9A 3HVVA 4KH7A 1KTEA 1DE2A 1GLPA 3GSTA 2OKAA 3GA4A 3M9JA 4LMWA 2AV4A 4OCFA 1F3AA 2P31A 1OVNA 2C3QA 1W4VA 3QAWA 1SU9A 1SKSB 3D5JA 2HNLA 2DJKA 3KP9A 3BD2A 5HR3A 1Y25A 1U87A 1YY7A 1Q4JA 2ON5A 3TKSC 5DVBA 2AUVA 3HJMA 5CNWA 4TR1B 3TKQA 3A3TA 3FK8A 2N5FA 2FGXA 2IMDA 1M99A 1YJ6A 1QUWA 3FZAA 4X1UA 4EE0A 4KE3A 11GSA 3F9UA 1N2AA 3EU3A 4JR4A 4L0UA 2O7KA 1YDKA 2X99A 2DIYA 4PQIA 4TVEA 1HNBA 2K6VA 3IOSA 3TJFA 4AGSA 3GH6A 5INYA 2H6YA 1F2EA 2OE3A 2LEGA 3VFIA 3GKKA 4HS1A 3GTUA 4X43A 1G0TA 4TXVA 2ES7A 1QXHA 3GKMA 3BCKA 2HRKA 4K0GA 1DBYA 3N5OA 1B9YC 5ECQB 3PH9A 4RQRA 1E6BA 1O85A 1FVKA 2H71A 2LTKA 4ZL9A 1ERWA 4WETA 2VL3A 4ECIA 4HDEA 2WRTA 3HJOA 2G2QA 2H1GA 1WE0A 1TDIA 1NM3A 1M9AA 5IMDA 4MMMA 1A0FA 2LNTA 2IJYA 2VM2A 1J9BA 3C1RA 3CXGA 4JU5A 2VL2A 2LJKA 2J23A 3TKRA 1G6YA 3BOAA 1YZXA 2TRCP 2UZ8A 1DSBA 2KP1A 4ZXGA 3KMNA 1H4OA 4MF5A 2PWJA 1XXUA 4WR5A 2H0IA 3UOMA 2BJXA 1XVWA 4MF7A 3P2AA 3ZREA 2MMAA 1JZDA 4NHZA 2YANA 3UIWA 2KP2A 2LS5A 2R2JA 3GTUB 2AAWA 3HA9A 4H86A 1GTBA 2VLUA 3EYTA 1F9MA 2RUFA 3RAZA 4I2UA 3PGTA 4Z7XA 5ECPB 4AJ8A 3TRXA 4K0NA 4HJMA 1EWXA 2IMFA 3LYPA 4GWRA 1TU7A 5F8BA 4Q5RA 2TIRA 1TRSA 1M7TA 4KUNA 3HKRA 4MZBA 3IAS2 4CDOA 2RM5A 1ERTA 2GZZA 5B8AA 2VLVA 4CW9A 4OFTA 4X0XA 2JSYA 2PUKC 3HZ4A 5D9TA 3WT1A 3SWLA 3FZ9A 1TXXA 2DJ2A 2E2GA 3ISOA 2R6KA 3P90A 5IPGA 2K18A 2I4AA 5ECIB 3KEBA 5IIZA 3D6IA 1SJIA 1B9XC 1VF3A 2TRXA 3LSZA 4ZILA 3GKXA 10GSA 1K0DA 2FCHA 4G2EA 3ZFBA 3TJKA 2IL3A 1Z6MA 2ZUPA 3QD9A 5HFKA 1R5AA 1GSFA 1ABAA 1Z5YE 2H66A 1RK4A 2GSSA 1R4WA 2M72A 3QR6A 1GTAA 3EC3A 1XCCA 3H93A 2VCTA 4YQVA 2MBTA 4FO5A 4DSRA 4KSMA 1TJDA 4YAPA 1ON4A 1K3OA 3F6DA 2HRAA 3UVTA 1XOAA 4F0CA 2B3SA 4WF4A 2XPDA 1S3CA 1SL0B 2H19A 2JU5A 1A23A 3G7IA 5GSTA 2MMOA 2YZUA 1TP9A 1GSDA 4EC0A 3PR8A 1BEDA 2YWMA 3Q19A 1K0MA 1TOFA 4XIHA 3L0HA 5H5SA 2L4QA 2LJAA 3F3QA 3WGXA 3KMOA 3CBUA 3M1GA 3IE3A 2GSRA 3L78A 2L5LA 5CRHA 2D2ZA 4V1Ap 3VI5A 2B7KA 2X8GA 5JCUA 1ILOA 2OACA 1GH2A 4HJ2A 4PQ1A 4JR6A 4AJ6A 4TRXA 5C00A 4O32A 3IXRA 2HSHA 1JZOA 2DMLA 1O7UA 3LFLA 3EMPA 4MZCA 3ZRDA 5GAPD 1TK0B 4GSSA 3UVHA 1M2BA 4FQUA 2AYTA 1N8JA 2XPEA 4I97A 3DVXA 3L4NA 3O76A 1V9WA 3DWVA 1TK8B 1FAAA 1T4ZA 1XW5A 2REMA 3TRPA 3FZ5A 5ECKB 1AW9A 1JLVA 1OKDA 1K3YA 3M0FA 5G31A 4OMVA 1X9SB 3BBYA 1NHOA 4MJBA 2YPMA 4P3YB 2L5OA 3F63A 5JCWA 1B48A 1FB0A 1XOBA 1UVZA 2H1AA 5LCZA 2YOIA 1X5CA 1EZKA 5DQYA 2XHFA 3ZITA 1PL2A 3Q74A 1OKTA 3APQA 4DSQA 5HFIA 4L0WA 3J7Yb 5CP1A 2C0DA 5B6MA 1U3IA 3VWUA 2B1LA 2GLRA 5JCGA 1O8XA 1DE1A 1GNWA 1V2AA 3CSHA 2LRNA 1MDJA 5KEJA 3GUSA 4ZL8A 1CQGA 5LD0A 3IDVA 1ZCPA 3IK7A 3CRUA 2XC2A 3QPMA 1EEJA 1FOVA 4HI7A 1K0NA 1MEKA 4GF0A 3M9KA 3GN3A 1HNCA 3GFKA 3LXTA 4PGTA 3MWHA 1AQVA 4BVXA 1SKRB 4G0LA 1GULA 4WEYA 4DVCA 3KGKA 5IMFA 1CQHA 2L4CA 6GSUA 1TRVA 2JZTA 5KN0A 1YF1A 4MF6A 3VURA 1I9DA 1K0CA 3A5WA 1SK1A 2C80A 5CYYA 3TKPA 3M8NA 2NPBA 5G2ZA 3HZ8A 1QK8A 1OC8A 4MJEA 4LMVA 3QFBC 1A2LA 5HR1A 3W6GA 1ZMAA 1T4YA 4XRAA 4MABA 2H76A 5J3RA 4BPYA 2FHEA 5AIVA 1SL2B 1Z3EA 1IYHA 2H72A 4L5LA 5DBQA 2KUCA 3HJPA 2YZHA 4G0IA 1GSSA 2VCVA 5J4UA 1TRUA 5D96A 4WF5A 3UBKA 1SYRA 1YKAA 5FWGA 1SK2A 1URMA 1VF1A 2JZRA 3KXOA 3DXBA 2WULA 2FWGA 3VPTA 4TR0A 1K0AA 3PPUA 14GSA 1ST9A 1T7PB 2V1MA 1SJZA 2L57A 1HD2A 5EVOA 3GKNA 5D93A 1WIKA 3LJRA 1WPIA 3JCML 17GSA 3D4TA 3HCZA 4V1Ag 4LL1B 3Q18A 2FWEA 3TB2A 2R3XA 4BWSA 1V57A 2GVPA 4OWYA 2GSQA 1XWKA 3HY2A 3GSSA 3ZYWA 1K0OA 3SBCA 5DJMA 2JL4A 1GTUA 2EIOA 5IO2A 3NIVA 1EP7A 4GSTA 1TI3A 4MDCA 4KX4A 3VWXA 1SD9A 2VM1A 1EGRA 1A2MA 2K8SA 1OC9A 3A2XA 5G1KA 2L6DA 1K3LA 2YJHA 1A0RP 1HYUA 1KBNA 1WJKA 1EEMA 3QAVA 3KM6A 2R5GA 2MMZA 4KCEA 4J56E 3UBLA 4MP4A 1V58A 2GQLA
chains in the Genus database with same CATH superfamily
3EU4A 1M3IA 2FLSA 3MNGA 2C0GA 4EF0A 2AJQB 2IMEA 4ZB7A 1GSUA 3GURA 3TDGA 4XS6A 3KJYA 2R37A 1AAZA 4IW9A 3DVWA 2LRTA 1Z9HA 1S4BP 5FT3A 1U3AA 3HVSA 1BYEA 5ABRA 4XS4A 4G9HA 4GXZA 4AJ7A 2JSZA 3IBHA 4PHZC 1YKCA 3LYKA 5DDLA 4O5RA 3FEUA 3KH9A 4TW5A 3FRCA 3ERFA 2OE1A 1MDKA 1USBA 4CHSA 3DD3A 5CREA 3W8SA 5AIXA 5C04A 2HZFA 1A2JA 2PU9C 4XCSA 1YF0A 4GCIA 3WD6A 1PRXA 4F2IA 1K0BA 2P5QA 2GDRA 3U6VA 5LNKe 2H0GA 2JADA 2V32A 4XHMA 3DEXA 1JLWA 1ZGNA 2VUPA 3LW9A 4ZIJA 2KLXA 5G1LA 4DSSA 2DJ1A 2CA8A 4ECJA 2CAIA 4F0BA 2O89A 2XBIA 3EINA 3P8WA 2F9SA 1W89A 4IP6A 1QMVA 3C73A 1OE7A 3CTGA 4YKGA 1TRWA 1ZYPA 5F05A 2B1KA 4A5PA 1PX6A 5A4UA 1A24A 1M2AA 2QC7A 2HRKB 1XZOA 2F8AA 3KTBA 3Q6OA 4F82A 2WW0A 5HFGA 4MZWA 1DUGA 3ZIJA 2MBSA 4KB3A 1PKZA 2LV3A 4XS4B 3VK9A 1ZOFA 2V41A 3ME8A 4QQ7A 3NOFA 4EL1A 2C3NA 4EO3A 4KAEA 3ERGA 2IN3A 3ZFLA 2HYXA 5KN2A 5CRGA 4HEA2 1M3JA 5IQYA 1R7HA 3TJGA 2LSTA 2EFDA 5JWQB 2B6MA 3QFAC 4KW6A 4MJAA 4CY8A 4IQ1A 4Q5NA 3P7XA 6GSSA 3KIJA 4K9ZA 4KGIA 6GSWA 4ULXA 1Y6EA 5HR2A 1OC3A 1RQMA 3CSJA 1Z7PA 3IV4A 3IC8A 4DSSB 5DQSA 5DCHA 3RHCA 4FYBA 4TXOA 4I6XA 3HVNA 1ML6A 2YV7A 4OO5A 1EP8A 2X8CA 1PD21 3FKFA 3L9VA 1PA3A 2CZ3A 3ZZXA 2OA7A 1JZWA 1MD3A 4KF9A 1ERUA 2HZEA 4MH2A 1B4PA 2X4AA 3FW2A 3D0ZA 5ELGA 2FD3A 2NVLA 2C0EA 1A8LA 1WRYA 4CY6A 1G7OA 4LL4B 3CRTA 3F4RA 4FYCA 1EV9A 2DSAA 5F06A 4TR3A 3IHQA 2WVZA 2DJJA 1BG1A 2H75A 1BG5A 2CT6A 4PTSA 5KOXA 4KDYA 5ECMB 3ME7A 1ACVA 3HHVA 4OFNA 2YN1A 5GZZB 2DKHA 2HSYA 1YEPA 3CHXC 2YP6A 1O73A 2GSTA 2EIRA 5D8IA 2H0HA 2HI7A 3VWVA 3GNJA 5IO0A 3UJ1A 2JACA 2V2GA 4ISDA 3F8UA 1THOA 3QMXA 4G0KA 3GRXA 1J08A 3VWWA 6GSYA 4AF2A 1XVQA 1JHBA 3ZTLA 5DCGA 3E0UA 4NV5A 5CRWA 3GX0A 2YWIA 2GQKA 2HLSA 2YV9A 16GSA 4IHUA 1GNEA 1QGVA 1THXA 1YEXA 1UA5A 2RLIA 4XRDA 4JEDA 2HZEB 1FW1A 3MDKA 2HSNA 3ERWA 1XW6A 4WXTA 3BCIA 1T8EB 3ZL5A 4HOJA 2WB9A 1TI1A 3IAM2 2HSMA 5ECRB 3GV1A 1PN0A 5BMUA 1YEWC 2F3MA 1GRXA 1JFUA 4ILFA 4J57E 3RPNA 3C8EA 4PNGA 1WOUA 4IKHA 2H70A 3G9BA 3IR4A 4MPGA 4V2NA 2V6OA 4ZL7A 7GSSA 3ED3A 1A8YA 3QCPA 3I69A 2KHPA 5IOXA 4HSCX 5IM9A 1PQNA 4O92A 1JZRA 6GSVA 1XW9A 4D73A 4ZB9A 4GLTA 4IJIA 1XFLA 1J0FA 3F4TA 2A4VA 2DJ0A 2H8LA 4ZB6A 2CAQA 2CZ2A 3TGZA 3TJBA 2PGTA 3DGQA 1QQ2A 2CVKA 3GHAA 1F37A 1B4QA 1SENA 3H79A 2WDUA 1GL8A 2VD0A 4Z2TA 3A2WA 1VF4A 3APSA 5B8BA 2PMTA 3PINA 1FO5A 12GSA 3A2VA 2M80A 3UMAA 2MZCA 2MYGA 4K6XA 4NAXA 4K2XA 2IPAA 2HSMB 3TOUA 2NDOA 4PNFA 4NPBA 4HZ2A 5G5EA 1N25A 5BMUB 5E59A 3LORA 4EKZA 1GLQA 5ECSA 1G6WA 2YJ7A 5A1NA 3EWLA 5A4WA 1GUMA 2H73A 5A4VA 1AQXA 2Z9SA 5J41A 3WYWA 2C1YA 4G19A 2DLXA 2C4JA 2VL2C 1M2DA 1FB6A 4D73B 2CVBA 4K7IA 1ERVA 1GUKA 1O6JA 2ON7A 1M0UA 3FHKA 2HE3A 3LQ7A 3GH9A 1X9MB 5DAKA 1Z6NA 3KCMA 5F0GA 2NTOA 3MIXA 2FWHA 3DKSA 2C3TA 2GZPA 3F4SA 3WGEA 3LGCA 4GDFA 1H75A 4EDZA 3IA1A 2ALBA 3TOTA 1LBKA 5IMCA 1HNAA 1ZZYA 1R5PA 18GSA 5JWRB 4EIPA 2V6KA 4IVFA 3O6TA 3US3A 4Z2RA 2O3EA 5GSSA 5H5QA 1MTCA 4N30A 1BAYA 3APOA 4F03A 2LRCA 3KZQA 5J9CA 6GSTA 3LEFA 1OAZA 3LXZA 5A1NB 2VIMA 2GT5A 3R2QA 2B5EA 4BVXB 3D22A 2WVYA 1Z7RA 8GSSA 2H74A 19GSA 1FHEA 5DALA 2FUG2 4BL7A 3GYKA 3U5RE 1V98A 2F51A 4OO4A 5EY6A 3GL5A 1O8WA 4KNDA 2YNXA 3CSIA 5J5NA 4J2FA 2QSIA 5DAKB 1OE8A 3C7MA 2BTOT 2O87A 2HFDA 4OCEA 5F07A 3QDNA 1G7EA 1MD4A 4K2DA 5AGYA 4JBBA 3HYPA 4PUAA 4PUFC 4N10A 3N9JA 1M9BA 4I2TA 1LU4A 5ID2A 4MJCA 4ZBAA 2X64A 3ZIVA 4HQZA 2VAFA 1SKWB 4HQSA 2VO4A 4MPFA 2VD1A 1AXDA 2LKUA 5J4VA 2LNSA 1S3AA 3CTFA 4K7OA 3K8NA 1BJXA 3M3MA 5FHIA 3L9UA 5ECNB 1F6MC 2GT6A 3C71A 2E7PA 5IMZA 4KDXA 2RM6A 3UEMA 3IRAA 20GSA 4BVYA 2E0QA 4I5QA 5CO3A 1TU8A 3IK9A 4EDYA 2PERA 4MK3A 2VLTA 3W8JA 4AKGA 5DALB 2NBSA 4BL7B 3ZMLA 3G7JA 22GSA 1BX9A 1ZYEA 2I3YA 1O81A 4KDUA 3IPZA 4XS1A 4LA1A 1EOHA 1U6TA 1YVLA 4O5QA 1OC9B 3HDCA 3KP8A 4GRFA 1HQOA 4E68A 2WZSA 2X49A 1TW9A 2QKEA 3HD5A 2HQTA 2VCXA 4O7HA 1X0RA 3OR5A 2H1DA 3F3RA 4YQUA 1PN9A 1LJRA 1MDIA 3RDWA 5ID2B 5D9VA 5KOWA 4POMA 5COHA 5L71A 3EE2A 2OJLA 2CQ9A 1VGLA 2WCIA 4ML6A 3L9SA 1F3BA 4AKHA 3LWAA 2HXKA 2YCDA 4HUAA 2OBIA 1U88A 2O8VB 3EVIA 4I8BA 2I9HA 4IGJA 4YAVA 3HVXA 2P0GA 3TU3B 4IP1A 3KH7A 3TRQA 1UN2A 2GTUA 4JZQA 3ZMKA 4BVYB 1XWBA 3C1SA 4ZB8A 5IPHA 3GL3A 1GUHA 2E2MA 5CRDA 2LQQA 2FNOA 1BQ7A 5JWOB 2I81A 2VCZA 4IS0A 4QMKA 2OBKA 4X4JA 1PGTA 4L8EA 5D9XA 4K1FA 1PL1A 13GSA 3RHBA 3DYRA 1V40A 1TTZA 2IWTA 3TKSE 4POKA 3R3EA 1RW1A 4XTSA 2WVXA 2WFCA 4NWYA 4TKYA 1ZL9A 5EL8A 2VKZG 4PQHA 2A2SA 3QAGA 2P5RA 3UAPA 4E8HA 5ENUA 2A2RA 3VI7A 2DBCA 1GSYA 4ACSA 4DEJA 1T00A 3TKSA 9GSSA 1NHYA 1EOGA 3I43A 3AY8A 4RI7A 1FG4A 2EC4A 2A2PA 4N11A 3KTLA 2IFQA 4MLYA 1GSEA 4HZ4A 5IMAA 5KN1A 1XWCA 1X5DA 1I1IP 2PVQA 1E2YA 3D4MA 2QGVA 5J9BA 2OADA 1SYXA 3FR9A 4QL7A 4TN8A 1GTIA 4MH3A 2H01A 1EV4A 1OYJA 4KSOA 4RUVA 4YH2A 2JZSA 5G5FA 3MSZA 2I1UA 4W66A 2DMMA 2KOKA 3I6AA 1VRSD 2MMNA 1T3BA 5BRTA 1PKWA 3HXSA 2VL9A 2F8FA 4GQCA 4ECBA 5DJLA 3J7Yk 3LG6A 1T1VA 2FWFA 2ZCTA 4TOPA 2H6XA 1XG8A 1SJ6A 1SD8A 3TJJA 4WBJA 4WBRD 2WGRA 4POLA 3H4KA 1SK0A 2N5AA 2PVOC 5CAXA 1I5GA 3FMWA 2WZ9A 2H6ZA 1AC1A 1GWCA 1XBSA 3BJ5A 3G7YA 2PPTA 1PX7A 4IELA 4TXOB 5IMVA 5D73A 3RBTA 5B6NA 2GZYA 3VLNA 2WJUA 2LQOA 2CVDA 4FYUA 4OFMA 2ZNMA 4USSA 2L6CA 6GSXA 4Q5FA 4EVMA 1XIYA 2IFQB 3F0IA 1EGOA 4K7NA 3IC4A 3WGDA 3GMFA 5AN1A 2R0PA 4RQXA 2GGTA 2AHEA 4MCUA 2PN8A 3F6FA 4WR4A 4FIWA 4JE1A 1NW2A 2IIYA 3CYNA 4K5SA 2CX3A 1KEBA 2X8HA 1TKDB 1TXUA 2GS3A 2H1LA 3D21A 5HQPA 4V2MA 2YWOA 2FA8A 1Q98A 2CX4A 1PFOA 2HRNA 3NZNA 4G10A 3H8QA 4L5OA 5G30A 3I9V2 3MAKA 4RI6A 5ECHB 2B5YA 4EIQA 2BMXA 4MA9A 1X9WB 1XPVA 4Q5QA 2IMIA 3FZ4A 3CMIA 4BWQA 3ZVJA 1WWJA 4AKXB 4GQFA 2L59A 1PSQA 3WT2A 3E3EA 1QFNA 4WKWA 2G0FA 4GSNA 4HU9A 2WS2A 2LUSA 4F9ZA 1AQWA 4N0VA 4OD7A 1TK5B 1PMTA 4AKIA 4BA7A 3TCOA 3DIEA 1B8XA 2IMKA 4HU7A 2H30A 4NV2A 1KNGA 4NMUA 2HSNB 5J4YA 1XWGA 5B7CA 2YWNA 3QOUA 1S3DA 5AISA 2PBJA 1GP1A 2HT9A 2K9FA 4V2LA 3GIXA 2HRFA 2VCWA 2CV4A 3VPQA 3KD0A 5EPFA 3DMLA 1SL1B 1X5EA 4O5UA 2VOCA 4N0ZA 2N5BA 5IOWA 4FXYP 4ECCA 1AUCA 1FVJA 3TUEA 3FR3A 2RIIA 1YQ1A 1NSWA 2O85A 4NHWA 4PI2C 4EXJA 5GAND 4PX1A 2UV8G 4PXOA 2B7JA 1UC7A 4ID0A 4G01A 2DIZA 2VCQA 2DC5A 3UL3A 1WMJA 2DJ3A 4GTUA 3DRNA 3RPPA 4FH8A 2OE0A 3FYGA 2H1BA 2RUEA 4ZBDA 5ELAA 2R4VA 2GQMA 1R26A 5KN3A 2FA4A 1ZYQB 3GX8A 4TR1A 3FY7A 1AIUA 5E4WA 3IHGA 3E9JB 2C8UA 2EFCA 4PURA 4TR4A 4IJ3A 2J9HA 4JRRA 1WP0A 5D9WA 4EUYA 5ECLB 4ML1A 3UARA 2B5XA 2C0FA 2AB6A 2XBQA 2FY6A 4IQAA 3H1NA 1XWAA 3ZVJD 4K8MA 5HR0A 2LJRA 3S9FA 4IN0A 2QA2A 3EURA 5H5RA 1VF2A 5A5KA 4ZBBA 1IYIA 4YQMA 5ECOB 4POBA 3FR6A 2M46A 2R0CA 4Z2UA 3EMXA 4IBPA 2DKIA 4E8EA 3V1WA 2EIQA 2K8VA 1C72A 3ZLPA 4KCAA 3O3TA 4NXIA 1GSQA 4LLRA 4KA0A 4QL9A 3HVVA 4KH7A 1KTEA 1DE2A 1GLPA 3GSTA 2OKAA 3GA4A 3M9JA 4LMWA 2AV4A 4OCFA 1F3AA 4K5RA 2P31A 1OVNA 2C3QA 1W4VA 3QAWA 1SU9A 1SKSB 3D5JA 2HNLA 2DJKA 3KP9A 3BD2A 5HR3A 1Y25A 1U87A 1YY7A 1Q4JA 2ON5A 3TKSC 5DVBA 2AUVA 3HJMA 5CNWA 4TR1B 2EFEA 3TKQA 3A3TA 3FK8A 2N5FA 2FGXA 2IMDA 1M99A 1YJ6A 1QUWA 1Y1UA 3FZAA 4X1UA 5A34A 4EE0A 4KE3A 3F9UA 11GSA 1N2AA 3EU3A 4JR4A 4L0UA 2O7KA 1YDKA 2X99A 2DIYA 4PQIA 4TVEA 1HNBA 2K6VA 3IOSA 3TJFA 4AGSA 3GH6A 5INYA 2H6YA 1F2EA 2OE3A 2LEGA 3VFIA 3GKKA 4HS1A 3GTUA 4X43A 1G0TA 1FOHA 4TXVA 2ES7A 1SVOA 1QXHA 3GKMA 3BCKA 2HRKA 4K0GA 1S3RA 1DBYA 3N5OA 1B9YC 5ECQB 3PH9A 4RQRA 1E6BA 1O85A 1FVKA 2H71A 2LTKA 4ZL9A 1ERWA 4WETA 2VL3A 4ECIA 4HDEA 3RFRC 2WRTA 3HJOA 2G2QA 2H1GA 1WE0A 1TDIA 1NM3A 1M9AA 5IMDA 4MMMA 1A0FA 2LNTA 2IJYA 2VM2A 1J9BA 3C1RA 3CXGA 4JU5A 2VL2A 2LJKA 2J23A 3TKRA 1G6YA 3BOAA 1YZXA 2TRCP 2UZ8A 1DSBA 2KP1A 4ZXGA 3A5IA 5A34B 3KMNA 1H4OA 4MF5A 2PWJA 1XXUA 4WR5A 2H0IA 3UOMA 2BJXA 1XVWA 4MF7A 3P2AA 3ZREA 2MMAA 1JZDA 4NHZA 2YANA 3UIWA 2KP2A 2LS5A 2R2JA 3GTUB 2AAWA 3HA9A 4H86A 1GTBA 5A5HA 2VLUA 3EYTA 1F9MA 3MYDA 2RUFA 3RAZA 4I2UA 3PGTA 4Z7XA 5ECPB 4AJ8A 3TRXA 4K0NA 4HJMA 1EWXA 2IMFA 3LYPA 4MNNA 4GWRA 1TU7A 5F8BA 4Q5RA 2TIRA 1TRSA 1M7TA 4KUNA 3HKRA 4MZBA 3RGBC 3IAS2 4CDOA 2RM5A 1ERTA 2GZZA 5B8AA 2VLVA 4CW9A 4OFTA 4X0XA 2JSYA 2PUKC 3HZ4A 5D9TA 3WT1A 3SWLA 3FZ9A 1TXXA 2DJ2A 2E2GA 3ISOA 2R6KA 3P90A 5IPGA 2K18A 2I4AA 5ECIB 3KEBA 5IIZA 3D6IA 1SJIA 4N3ZA 1B9XC 1VF3A 2TRXA 3LSZA 4ZILA 3GKXA 10GSA 1K0DA 2FCHA 4G2EA 3ZFBA 3TJKA 2IL3A 1Z6MA 2ZUPA 3QD9A 5HFKA 1R5AA 1GSFA 1ABAA 5A5HB 1Z5YE 2H66A 1RK4A 2GSSA 1R4WA 2M72A 3QR6A 1ZYNA 1GTAA 3EC3A 1XCCA 3H93A 2VCTA 4YQVA 2MBTA 4ICYA 4FO5A 4BIKA 4DSRA 4KSMA 1TJDA 4YAPA 1ON4A 1K3OA 3F6DA 2HRAA 3UVTA 1XOAA 4F0CA 2B3SA 4WF4A 2XPDA 1S3CA 1BF5A 1SL0B 2H19A 2JU5A 2A4HA 1A23A 3G7IA 5GSTA 2MMOA 2WVXB 2YZUA 1TP9A 1GSDA 4EC0A 3PR8A 1BEDA 2YWMA 3Q19A 1K0MA 1TOFA 4XIHA 3L0HA 5H5SA 2L4QA 3CQFA 2LJAA 3F3QA 3WGXA 3KMOA 3CBUA 3M1GA 3IE3A 2GSRA 4PI0C 2L5LA 3L78A 5CRHA 2D2ZA 4V1Ap 3VI5A 2B7KA 2X8GA 5JCUA 1ILOA 2OACA 1GH2A 4HJ2A 4PQ1A 4JR6A 4AJ6A 4TRXA 5C00A 4O32A 3IXRA 2HSHA 1JZOA 2DMLA 1O7UA 3LFLA 3EMPA 4MZCA 3ZRDA 5GAPD 1TK0B 4GSSA 3UVHA 1M2BA 4FQUA 3HMJG 2AYTA 1N8JA 2XPEA 4I97A 3DVXA 3L4NA 3O76A 1V9WA 3DWVA 1TK8B 1FAAA 1T4ZA 1XW5A 2REMA 3TRPA 3FZ5A 5ECKB 1AW9A 1JLVA 1OKDA 4AI6A 1K3YA 3M0FA 5G31A 4OMVA 1X9SB 3BBYA 1NHOA 4MJBA 2YPMA 4P3YB 2L5OA 3F63A 5JCWA 1B48A 1FB0A 1XOBA 1UVZA 2OT3A 2H1AA 5LCZA 2YOIA 3CWGA 1X5CA 1EZKA 5DQYA 2XHFA 3ZITA 1PL2A 3Q74A 1OKTA 3APQA 4DSQA 2R0GA 5J40A 5HFIA 4L0WA 3J7Yb 5CP1A 2C0DA 5B6MA 1U3IA 3VWUA 2B1LA 2GLRA 5JCGA 1O8XA 1DE1A 1GNWA 1V2AA 3CSHA 2O5VA 2LRNA 1MDJA 5KEJA 3GUSA 4ZL8A 1CQGA 5LD0A 3IDVA 1ZCPA 3IK7A 3CRUA 2XC2A 3QPMA 1EEJA 1FOVA 4HI7A 1K0NA 1MEKA 4GF0A 3M9KA 3GN3A 1HNCA 3GFKA 3LXTA 4PGTA 3MWHA 4YKFA 1AQVA 4BVXA 1SVLA 1SKRB 2WW3A 4G0LA 1GULA 4WEYA 4DVCA 2O36A 3KGKA 5IMFA 1CQHA 2L4CA 3EPTA 6GSUA 1TRVA 2JZTA 5KN0A 1YF1A 4MF6A 3VURA 1I9DA 1K0CA 3A5WA 1SK1A 2C80A 5CYYA 3TKPA 3M8NA 2NPBA 5G2ZA 3HZ8A 1QK8A 1OC8A 4MJEA 4LMVA 3QFBC 1A2LA 5HR1A 3W6GA 1ZMAA 1T4YA 4XRAA 4MABA 2H76A 5J3RA 4BPYA 2FHEA 5AIVA 1SL2B 1Z3EA 2WW2A 1IYHA 2H72A 4L5LA 5DBQA 2KUCA 3HJPA 2YZHA 4G0IA 1GSSA 2VCVA 5J4UA 1TRUA 5D96A 4WF5A 3UBKA 1SYRA 1YKAA 5FWGA 1SK2A 1URMA 1VF1A 2JZRA 3KXOA 3DXBA 2WULA 2FWGA 2EFHA 3VPTA 4TR0A 1K0AA 3PPUA 14GSA 1ST9A 1T7PB 2V1MA 1SJZA 2L57A 1HD2A 5EVOA 3GKNA 5D93A 1WIKA 3LJRA 1WPIA 3JCML 17GSA 3D4TA 3HCZA 4V1Ag 4LL1B 3Q18A 2FWEA 3TB2A 2R3XA 4BWSA 1V57A 2GVPA 4OWYA 2GSQA 1XWKA 3HY2A 3GSSA 1SVMA 3ZYWA 1K0OA 3SBCA 5DJMA 2WW1A 2JL4A 1GTUA 2EIOA 5IO2A 3NIVA 1EP7A 4GSTA 1TI3A 4MDCA 4KX4A 2QA1A 3VWXA 1SD9A 2VM1A 1EGRA 1A2MA 2K8SA 1OC9A 3A2XA 5G1KA 2L6DA 1K3LA 2YJHA 1A0RP 1HYUA 1KBNA 1WJKA 1EEMA 3QAVA 3KM6A 2R5GA 2MMZA 4KCEA 4J56E 5J47A 3UBLA 4MP4A 1V58A 2GQLA
chains in the Genus database with same CATH topology
3EU4A 2FLSA 3MNGA 2C0GA 4EF0A 2AJQB 2IMEA 4ZB7A 1GSUA 3GURA 3TDGA 4XS6A 3KJYA 2R37A 1AAZA 4IW9A 3DVWA 2LRTA 1Z9HA 5FT3A 1U3AA 3HVSA 1BYEA 5ABRA 4XS4A 4G9HA 4GXZA 4AJ7A 2JSZA 3IBHA 1YKCA 3LYKA 5DDLA 4O5RA 3FEUA 3KH9A 4TW5A 3FRCA 3ERFA 2OE1A 1MDKA 1USBA 4CHSA 3DD3A 5CREA 3W8SA 5AIXA 5C04A 2HZFA 1A2JA 2PU9C 4XCSA 1YF0A 4GCIA 3WD6A 1PRXA 4F2IA 1K0BA 2P5QA 2GDRA 3U6VA 5LNKe 2H0GA 2JADA 2V32A 4XHMA 3DEXA 1JLWA 1ZGNA 2VUPA 3LW9A 4ZIJA 2KLXA 5G1LA 4DSSA 2DJ1A 2CA8A 4ECJA 2CAIA 4F0BA 2O89A 2XBIA 3EINA 3P8WA 2F9SA 1W89A 4IP6A 1QMVA 3C73A 1OE7A 3CTGA 4YKGA 1TRWA 1ZYPA 5F05A 2B1KA 4A5PA 1PX6A 5A4UA 1A24A 1M2AA 2QC7A 2HRKB 1XZOA 2F8AA 3KTBA 3Q6OA 4F82A 5HFGA 4MZWA 1DUGA 3ZIJA 2MBSA 4KB3A 1PKZA 2LV3A 4XS4B 3VK9A 1ZOFA 2V41A 3ME8A 4QQ7A 3NOFA 4EL1A 2C3NA 4EO3A 4KAEA 3ERGA 2IN3A 3ZFLA 2HYXA 5KN2A 5CRGA 4HEA2 5IQYA 1R7HA 3TJGA 2LSTA 2EFDA 5JWQB 2B6MA 3QFAC 4KW6A 4MJAA 4CY8A 4IQ1A 4Q5NA 3P7XA 6GSSA 3KIJA 4K9ZA 4KGIA 6GSWA 4ULXA 1Y6EA 5HR2A 1OC3A 1RQMA 3CSJA 1Z7PA 3IV4A 3IC8A 4DSSB 5DQSA 5DCHA 3RHCA 4FYBA 4TXOA 4I6XA 1ML6A 2YV7A 4OO5A 1EP8A 2X8CA 1PD21 3FKFA 3L9VA 1PA3A 2CZ3A 3ZZXA 2OA7A 1JZWA 1MD3A 4KF9A 1ERUA 2HZEA 4MH2A 1B4PA 2X4AA 3FW2A 3D0ZA 5ELGA 2FD3A 2NVLA 2C0EA 1A8LA 1WRYA 4CY6A 1G7OA 4LL4B 3CRTA 3F4RA 4FYCA 1EV9A 2DSAA 5F06A 4TR3A 3IHQA 2DJJA 1BG1A 2H75A 1BG5A 2CT6A 4PTSA 5KOXA 4KDYA 5ECMB 3ME7A 1ACVA 3HHVA 4OFNA 2YN1A 5GZZB 2DKHA 2HSYA 1YEPA 2YP6A 1O73A 2GSTA 2EIRA 5D8IA 2H0HA 2HI7A 3VWVA 3GNJA 5IO0A 3UJ1A 2JACA 2V2GA 4ISDA 3F8UA 1THOA 3QMXA 4G0KA 3GRXA 1J08A 3VWWA 6GSYA 4AF2A 1XVQA 1JHBA 3ZTLA 5DCGA 3E0UA 4NV5A 5CRWA 3GX0A 2YWIA 2GQKA 2HLSA 2YV9A 16GSA 4IHUA 1GNEA 1QGVA 1THXA 1YEXA 1UA5A 2RLIA 4XRDA 4JEDA 2HZEB 1FW1A 3MDKA 2HSNA 3ERWA 1XW6A 4WXTA 3BCIA 1T8EB 3ZL5A 4HOJA 2WB9A 1TI1A 3IAM2 2HSMA 5ECRB 3GV1A 1PN0A 5BMUA 2F3MA 1GRXA 1JFUA 4ILFA 4J57E 3RPNA 3C8EA 4PNGA 1WOUA 4IKHA 2H70A 3G9BA 3IR4A 4MPGA 4V2NA 2V6OA 4ZL7A 7GSSA 3ED3A 1A8YA 3QCPA 3I69A 2KHPA 5IOXA 5IM9A 1PQNA 4O92A 1JZRA 6GSVA 1XW9A 4D73A 4ZB9A 4GLTA 4IJIA 1XFLA 1J0FA 3F4TA 2A4VA 2DJ0A 2H8LA 4ZB6A 2CAQA 2CZ2A 3TGZA 3TJBA 2PGTA 3DGQA 1QQ2A 2CVKA 3GHAA 1F37A 1B4QA 1SENA 3H79A 2WDUA 1GL8A 2VD0A 4Z2TA 3A2WA 1VF4A 3APSA 5B8BA 2PMTA 3PINA 1FO5A 12GSA 3A2VA 2M80A 3UMAA 2MZCA 2MYGA 4K6XA 4NAXA 4K2XA 2IPAA 2HSMB 3TOUA 2NDOA 4PNFA 4NPBA 4HZ2A 5G5EA 1N25A 5BMUB 5E59A 3LORA 4EKZA 1GLQA 5ECSA 1G6WA 2YJ7A 5A1NA 3EWLA 5A4WA 1GUMA 2H73A 5A4VA 1AQXA 2Z9SA 5J41A 3WYWA 2C1YA 4G19A 2DLXA 2C4JA 2VL2C 1M2DA 1FB6A 4D73B 2CVBA 4K7IA 1ERVA 1GUKA 1O6JA 2ON7A 1M0UA 3FHKA 2HE3A 3LQ7A 3GH9A 1X9MB 5DAKA 1Z6NA 3KCMA 5F0GA 2NTOA 3MIXA 2FWHA 3DKSA 2C3TA 2GZPA 3F4SA 3WGEA 3LGCA 4GDFA 1H75A 4EDZA 3IA1A 2ALBA 3TOTA 1LBKA 5IMCA 1HNAA 1ZZYA 1R5PA 18GSA 5JWRB 4EIPA 2V6KA 4IVFA 3O6TA 3US3A 4Z2RA 5GSSA 5H5QA 1MTCA 4N30A 1BAYA 3APOA 4F03A 2LRCA 3KZQA 5J9CA 6GSTA 3LEFA 1OAZA 3LXZA 5A1NB 2VIMA 2GT5A 3R2QA 2B5EA 4BVXB 3D22A 1Z7RA 8GSSA 2H74A 19GSA 1FHEA 5DALA 2FUG2 4BL7A 3GYKA 3U5RE 1V98A 2F51A 4OO4A 5EY6A 3GL5A 1O8WA 4KNDA 2YNXA 3CSIA 5J5NA 4J2FA 2QSIA 5DAKB 1OE8A 3C7MA 2BTOT 2O87A 2HFDA 4OCEA 5F07A 3QDNA 1G7EA 1MD4A 4K2DA 5AGYA 4JBBA 3HYPA 4PUAA 4PUFC 4N10A 3N9JA 1M9BA 4I2TA 1LU4A 5ID2A 4MJCA 4ZBAA 2X64A 3ZIVA 4HQZA 2VAFA 1SKWB 4HQSA 2VO4A 4MPFA 2VD1A 1AXDA 2LKUA 5J4VA 2LNSA 1S3AA 3CTFA 4K7OA 3K8NA 1BJXA 3M3MA 5FHIA 3L9UA 5ECNB 1F6MC 2GT6A 3C71A 2E7PA 5IMZA 4KDXA 2RM6A 3UEMA 3IRAA 20GSA 4BVYA 2E0QA 4I5QA 5CO3A 1TU8A 3IK9A 4EDYA 2PERA 4MK3A 2VLTA 3W8JA 4AKGA 5DALB 2NBSA 4BL7B 3ZMLA 3G7JA 22GSA 1BX9A 1ZYEA 2I3YA 1O81A 4KDUA 3IPZA 4XS1A 4LA1A 1EOHA 1U6TA 1YVLA 4O5QA 1OC9B 3HDCA 3KP8A 4GRFA 1HQOA 4E68A 2X49A 1TW9A 2QKEA 3HD5A 2HQTA 2VCXA 4O7HA 1X0RA 3OR5A 2H1DA 3F3RA 4YQUA 1PN9A 1LJRA 1MDIA 3RDWA 5ID2B 5D9VA 5KOWA 4POMA 5COHA 5L71A 3EE2A 2OJLA 2CQ9A 1VGLA 2WCIA 4ML6A 3L9SA 1F3BA 4AKHA 3LWAA 2HXKA 2YCDA 4HUAA 2OBIA 1U88A 2O8VB 3EVIA 4I8BA 2I9HA 4IGJA 4YAVA 3HVXA 2P0GA 3TU3B 4IP1A 3KH7A 3TRQA 1UN2A 2GTUA 4JZQA 3ZMKA 4BVYB 1XWBA 3C1SA 4ZB8A 5IPHA 3GL3A 1GUHA 2E2MA 5CRDA 2LQQA 2FNOA 1BQ7A 5JWOB 2I81A 2VCZA 4IS0A 4QMKA 2OBKA 4X4JA 1PGTA 4L8EA 5D9XA 4K1FA 1PL1A 13GSA 3RHBA 3DYRA 1V40A 1TTZA 2IWTA 3TKSE 4POKA 3R3EA 1RW1A 4XTSA 2WFCA 4NWYA 4TKYA 1ZL9A 5EL8A 2VKZG 4PQHA 2A2SA 3QAGA 2P5RA 3UAPA 4E8HA 5ENUA 2A2RA 3VI7A 2DBCA 1GSYA 4ACSA 4DEJA 1T00A 3TKSA 9GSSA 1NHYA 1EOGA 3I43A 3AY8A 4RI7A 1FG4A 2EC4A 2A2PA 4N11A 3KTLA 2IFQA 4MLYA 1GSEA 4HZ4A 5IMAA 5KN1A 1XWCA 1X5DA 2PVQA 1E2YA 3D4MA 2QGVA 5J9BA 2OADA 1SYXA 3FR9A 4QL7A 4TN8A 1GTIA 4MH3A 2H01A 1EV4A 1OYJA 4KSOA 4RUVA 4YH2A 2JZSA 5G5FA 3MSZA 2I1UA 4W66A 2DMMA 2KOKA 3I6AA 1VRSD 2MMNA 1T3BA 5BRTA 1PKWA 3HXSA 2VL9A 2F8FA 4GQCA 4ECBA 5DJLA 3J7Yk 3LG6A 1T1VA 2FWFA 2ZCTA 4TOPA 2H6XA 1SJ6A 1SD8A 3TJJA 4WBJA 4WBRD 2WGRA 4POLA 3H4KA 1SK0A 2N5AA 2PVOC 5CAXA 1I5GA 3FMWA 2WZ9A 2H6ZA 1AC1A 1GWCA 1XBSA 3BJ5A 3G7YA 2PPTA 1PX7A 4IELA 4TXOB 5IMVA 5D73A 3RBTA 5B6NA 2GZYA 3VLNA 2WJUA 2LQOA 2CVDA 4FYUA 4OFMA 2ZNMA 4USSA 2L6CA 6GSXA 4Q5FA 4EVMA 1XIYA 2IFQB 3F0IA 1EGOA 4K7NA 3IC4A 3WGDA 3GMFA 5AN1A 2R0PA 4RQXA 2GGTA 2AHEA 4MCUA 2PN8A 3F6FA 4WR4A 4FIWA 4JE1A 1NW2A 2IIYA 3CYNA 4K5SA 2CX3A 1KEBA 2X8HA 1TKDB 1TXUA 2GS3A 2H1LA 3D21A 5HQPA 4V2MA 2YWOA 2FA8A 1Q98A 2CX4A 2HRNA 3NZNA 4G10A 3H8QA 4L5OA 5G30A 3I9V2 3MAKA 4RI6A 5ECHB 2B5YA 4EIQA 2BMXA 4MA9A 1X9WB 1XPVA 4Q5QA 2IMIA 3FZ4A 3CMIA 4BWQA 3ZVJA 1WWJA 4AKXB 4GQFA 2L59A 1PSQA 3WT2A 3E3EA 1QFNA 4WKWA 2G0FA 4GSNA 4HU9A 2WS2A 2LUSA 4F9ZA 1AQWA 4N0VA 4OD7A 1TK5B 1PMTA 4AKIA 4BA7A 3TCOA 3DIEA 1B8XA 2IMKA 4HU7A 2H30A 4NV2A 1KNGA 4NMUA 2HSNB 5J4YA 1XWGA 5B7CA 2YWNA 3QOUA 1S3DA 5AISA 2PBJA 1GP1A 2HT9A 2K9FA 4V2LA 3GIXA 2HRFA 2VCWA 2CV4A 3VPQA 3KD0A 5EPFA 3DMLA 1SL1B 1X5EA 4O5UA 2VOCA 4N0ZA 2N5BA 5IOWA 4ECCA 1AUCA 1FVJA 3TUEA 3FR3A 2RIIA 1YQ1A 1NSWA 2O85A 4NHWA 4EXJA 5GAND 4PX1A 2UV8G 4PXOA 2B7JA 1UC7A 4ID0A 4G01A 2DIZA 2VCQA 2DC5A 3UL3A 1WMJA 2DJ3A 4GTUA 3DRNA 3RPPA 4FH8A 2OE0A 3FYGA 2H1BA 2RUEA 4ZBDA 5ELAA 2R4VA 2GQMA 1R26A 5KN3A 2FA4A 1ZYQB 3GX8A 4TR1A 3FY7A 1AIUA 5E4WA 3IHGA 3E9JB 2C8UA 2EFCA 4PURA 4TR4A 4IJ3A 2J9HA 4JRRA 1WP0A 5D9WA 4EUYA 5ECLB 4ML1A 3UARA 2B5XA 2C0FA 2AB6A 2XBQA 2FY6A 4IQAA 3H1NA 1XWAA 3ZVJD 4K8MA 5HR0A 2LJRA 3S9FA 4IN0A 2QA2A 3EURA 5H5RA 1VF2A 5A5KA 4ZBBA 1IYIA 4YQMA 5ECOB 4POBA 3FR6A 2M46A 2R0CA 4Z2UA 3EMXA 4IBPA 2DKIA 4E8EA 3V1WA 2EIQA 2K8VA 1C72A 3ZLPA 4KCAA 3O3TA 4NXIA 1GSQA 4LLRA 4KA0A 4QL9A 3HVVA 4KH7A 1KTEA 1DE2A 1GLPA 3GSTA 2OKAA 3GA4A 3M9JA 4LMWA 2AV4A 4OCFA 1F3AA 4K5RA 2P31A 1OVNA 2C3QA 1W4VA 3QAWA 1SU9A 1SKSB 3D5JA 2HNLA 2DJKA 3KP9A 3BD2A 5HR3A 1Y25A 1U87A 1YY7A 1Q4JA 2ON5A 3TKSC 5DVBA 2AUVA 3HJMA 5CNWA 4TR1B 2EFEA 3TKQA 3A3TA 3FK8A 2N5FA 2FGXA 2IMDA 1M99A 1YJ6A 1QUWA 1Y1UA 3FZAA 4X1UA 5A34A 4EE0A 4KE3A 3F9UA 11GSA 1N2AA 3EU3A 4JR4A 4L0UA 2O7KA 1YDKA 2X99A 2DIYA 4PQIA 4TVEA 1HNBA 2K6VA 3IOSA 3TJFA 4AGSA 3GH6A 5INYA 2H6YA 1F2EA 2OE3A 2LEGA 3VFIA 3GKKA 4HS1A 3GTUA 4X43A 1G0TA 1FOHA 4TXVA 2ES7A 1SVOA 1QXHA 3GKMA 3BCKA 2HRKA 4K0GA 1DBYA 3N5OA 1B9YC 5ECQB 3PH9A 4RQRA 1E6BA 1O85A 1FVKA 2H71A 2LTKA 4ZL9A 1ERWA 4WETA 2VL3A 4ECIA 4HDEA 2WRTA 3HJOA 2G2QA 2H1GA 1WE0A 1TDIA 1NM3A 1M9AA 5IMDA 4MMMA 1A0FA 2LNTA 2IJYA 2VM2A 1J9BA 3C1RA 3CXGA 4JU5A 2VL2A 2LJKA 2J23A 3TKRA 1G6YA 3BOAA 1YZXA 2TRCP 2UZ8A 1DSBA 2KP1A 4ZXGA 3A5IA 5A34B 3KMNA 1H4OA 4MF5A 2PWJA 1XXUA 4WR5A 2H0IA 3UOMA 2BJXA 1XVWA 4MF7A 3P2AA 3ZREA 2MMAA 1JZDA 4NHZA 2YANA 3UIWA 2KP2A 2LS5A 2R2JA 3GTUB 2AAWA 3HA9A 4H86A 1GTBA 5A5HA 2VLUA 3EYTA 1F9MA 3MYDA 2RUFA 3RAZA 4I2UA 3PGTA 4Z7XA 5ECPB 4AJ8A 3TRXA 4K0NA 4HJMA 1EWXA 2IMFA 3LYPA 4MNNA 4GWRA 1TU7A 5F8BA 4Q5RA 2TIRA 1TRSA 1M7TA 4KUNA 3HKRA 4MZBA 3IAS2 4CDOA 2RM5A 1ERTA 2GZZA 5B8AA 2VLVA 4CW9A 4OFTA 4X0XA 2JSYA 2PUKC 3HZ4A 5D9TA 3WT1A 3SWLA 3FZ9A 1TXXA 2DJ2A 2E2GA 3ISOA 2R6KA 3P90A 5IPGA 2K18A 2I4AA 5ECIB 3KEBA 5IIZA 3D6IA 1SJIA 4N3ZA 1B9XC 1VF3A 2TRXA 3LSZA 4ZILA 3GKXA 10GSA 1K0DA 2FCHA 4G2EA 3ZFBA 3TJKA 2IL3A 1Z6MA 2ZUPA 3QD9A 5HFKA 1R5AA 1GSFA 1ABAA 5A5HB 1Z5YE 2H66A 1RK4A 2GSSA 1R4WA 2M72A 3QR6A 1ZYNA 1GTAA 3EC3A 1XCCA 3H93A 2VCTA 4YQVA 2MBTA 4ICYA 4FO5A 4DSRA 4KSMA 1TJDA 4YAPA 1ON4A 1K3OA 3F6DA 2HRAA 3UVTA 1XOAA 4F0CA 2B3SA 4WF4A 2XPDA 1S3CA 1BF5A 1SL0B 2H19A 2JU5A 2A4HA 1A23A 3G7IA 5GSTA 2MMOA 2YZUA 1TP9A 1GSDA 4EC0A 3PR8A 1BEDA 2YWMA 3Q19A 1K0MA 1TOFA 4XIHA 3L0HA 5H5SA 2L4QA 2LJAA 3F3QA 3WGXA 3KMOA 3CBUA 3M1GA 3IE3A 2GSRA 3L78A 2L5LA 5CRHA 2D2ZA 4V1Ap 3VI5A 2B7KA 2X8GA 5JCUA 1ILOA 2OACA 1GH2A 4HJ2A 4PQ1A 4JR6A 4AJ6A 4TRXA 5C00A 4O32A 3IXRA 2HSHA 1JZOA 2DMLA 1O7UA 3LFLA 3EMPA 4MZCA 3ZRDA 5GAPD 1TK0B 4GSSA 3UVHA 1M2BA 4FQUA 3HMJG 2AYTA 1N8JA 2XPEA 4I97A 3DVXA 3L4NA 3O76A 1V9WA 3DWVA 1TK8B 1FAAA 1T4ZA 1XW5A 2REMA 3TRPA 3FZ5A 5ECKB 1AW9A 1JLVA 1OKDA 4AI6A 1K3YA 3M0FA 5G31A 4OMVA 1X9SB 3BBYA 1NHOA 4MJBA 2YPMA 4P3YB 2L5OA 3F63A 5JCWA 1B48A 1FB0A 1XOBA 1UVZA 2OT3A 2H1AA 5LCZA 2YOIA 3CWGA 1X5CA 1EZKA 5DQYA 2XHFA 3ZITA 1PL2A 3Q74A 1OKTA 3APQA 4DSQA 2R0GA 5J40A 5HFIA 4L0WA 3J7Yb 5CP1A 2C0DA 5B6MA 1U3IA 3VWUA 2B1LA 2GLRA 5JCGA 1O8XA 1DE1A 1GNWA 1V2AA 3CSHA 2O5VA 2LRNA 1MDJA 5KEJA 3GUSA 4ZL8A 1CQGA 5LD0A 3IDVA 1ZCPA 3IK7A 3CRUA 2XC2A 3QPMA 1EEJA 1FOVA 4HI7A 1K0NA 1MEKA 4GF0A 3M9KA 3GN3A 1HNCA 3GFKA 3LXTA 4PGTA 3MWHA 4YKFA 1AQVA 4BVXA 1SVLA 1SKRB 4G0LA 1GULA 4WEYA 4DVCA 3KGKA 5IMFA 1CQHA 2L4CA 3EPTA 6GSUA 1TRVA 2JZTA 5KN0A 1YF1A 4MF6A 3VURA 1I9DA 1K0CA 3A5WA 1SK1A 2C80A 5CYYA 3TKPA 3M8NA 2NPBA 5G2ZA 3HZ8A 1QK8A 1OC8A 4MJEA 4LMVA 3QFBC 1A2LA 5HR1A 3W6GA 1ZMAA 1T4YA 4XRAA 4MABA 2H76A 5J3RA 4BPYA 2FHEA 5AIVA 1SL2B 1Z3EA 1IYHA 2H72A 4L5LA 5DBQA 2KUCA 3HJPA 2YZHA 4G0IA 1GSSA 2VCVA 5J4UA 1TRUA 5D96A 4WF5A 3UBKA 1SYRA 1YKAA 5FWGA 1SK2A 1URMA 1VF1A 2JZRA 3KXOA 3DXBA 2WULA 2FWGA 2EFHA 3VPTA 4TR0A 1K0AA 3PPUA 14GSA 1ST9A 1T7PB 2V1MA 1SJZA 2L57A 1HD2A 5EVOA 3GKNA 5D93A 1WIKA 3LJRA 1WPIA 3JCML 17GSA 3D4TA 3HCZA 4V1Ag 4LL1B 3Q18A 2FWEA 3TB2A 2R3XA 4BWSA 1V57A 2GVPA 4OWYA 2GSQA 1XWKA 3HY2A 3GSSA 1SVMA 3ZYWA 1K0OA 3SBCA 5DJMA 2JL4A 1GTUA 2EIOA 5IO2A 3NIVA 1EP7A 4GSTA 1TI3A 4MDCA 4KX4A 2QA1A 3VWXA 1SD9A 2VM1A 1EGRA 1A2MA 2K8SA 1OC9A 3A2XA 5G1KA 2L6DA 1K3LA 2YJHA 1A0RP 1HYUA 1KBNA 1WJKA 1EEMA 3QAVA 3KM6A 2R5GA 2MMZA 4KCEA 4J56E 5J47A 3UBLA 4MP4A 1V58A 2GQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EU4 A;  2FLS A;  3MNG A;  2C0G A;  4EF0 A;  2AJQ B;  2IME A;  1GSU A;  3GUR A;  3TDG A;  4XS6 A;  3KJY A;  2R37 A;  1AAZ A;  4IW9 A;  3DVW A;  2LRT A;  1Z9H A;  5FT3 A;  1U3A A;  3HVS A;  1BYE A;  5ABR A;  4XS4 A;  4G9H A;  4GXZ A;  4AJ7 A;  2JSZ A;  3IBH A;  1YKC A;  3LYK A;  5DDL A;  4O5R A;  3FEU A;  3KH9 A;  4TW5 A;  3FRC A;  3ERF A;  2OE1 A;  1MDK A;  1USB A;  4CHS A;  3DD3 A;  5CRE A;  3W8S A;  5AIX A;  5C04 A;  2HZF A;  1A2J A;  2PU9 C;  4XCS A;  1YF0 A;  4GCI A;  3WD6 A;  1PRX A;  4F2I A;  1K0B A;  2P5Q A;  2GDR A;  3U6V A;  5LNK e;  2H0G A;  2JAD A;  2V32 A;  4XHM A;  3DEX A;  1JLW A;  1ZGN A;  2VUP A;  4ZIJ A;  2KLX A;  5G1L A;  4DSS A;  2DJ1 A;  2CA8 A;  4ECJ A;  2CAI A;  4F0B A;  2O89 A;  2XBI A;  3EIN A;  3P8W A;  2F9S A;  1W89 A;  4IP6 A;  1QMV A;  3C73 A;  1OE7 A;  3CTG A;  1TRW A;  5F05 A;  2B1K A;  1PX6 A;  5A4U A;  1A24 A;  1M2A A;  2QC7 A;  2HRK B;  1XZO A;  2F8A A;  3KTB A;  3Q6O A;  4F82 A;  5HFG A;  4MZW A;  1DUG A;  3ZIJ A;  2MBS A;  4KB3 A;  1PKZ A;  2LV3 A;  4XS4 B;  3VK9 A;  1ZOF A;  2V41 A;  3ME8 A;  4QQ7 A;  3NOF A;  4EL1 A;  2C3N A;  4EO3 A;  4KAE A;  3ERG A;  2IN3 A;  3ZFL A;  2HYX A;  5KN2 A;  5CRG A;  4HEA 2;  5IQY A;  1R7H A;  3TJG A;  2LST A;  5JWQ B;  2B6M A;  3QFA C;  4KW6 A;  4MJA A;  4IQ1 A;  4Q5N A;  3P7X A;  6GSS A;  3KIJ A;  4K9Z A;  4KGI A;  6GSW A;  4ULX A;  1Y6E A;  5HR2 A;  1OC3 A;  1RQM A;  3CSJ A;  1Z7P A;  3IV4 A;  3IC8 A;  4DSS B;  5DQS A;  5DCH A;  3RHC A;  4FYB A;  4TXO A;  4I6X A;  1ML6 A;  2YV7 A;  4OO5 A;  1EP8 A;  2X8C A;  1PD2 1;  3FKF A;  3L9V A;  1PA3 A;  2CZ3 A;  3ZZX A;  2OA7 A;  1JZW A;  1MD3 A;  4KF9 A;  1ERU A;  2HZE A;  4MH2 A;  1B4P A;  3FW2 A;  3D0Z A;  5ELG A;  2FD3 A;  2NVL A;  2C0E A;  1A8L A;  1WRY A;  1G7O A;  4LL4 B;  3CRT A;  3F4R A;  4FYC A;  1EV9 A;  2DSA A;  5F06 A;  4TR3 A;  3IHQ A;  2DJJ A;  2H75 A;  1BG5 A;  2CT6 A;  4PTS A;  4KDY A;  5ECM B;  3ME7 A;  1ACV A;  3HHV A;  4OFN A;  2YN1 A;  5GZZ B;  2HSY A;  1YEP A;  2YP6 A;  1O73 A;  2GST A;  2EIR A;  5D8I A;  2H0H A;  2HI7 A;  3VWV A;  3GNJ A;  5IO0 A;  3UJ1 A;  2JAC A;  2V2G A;  4ISD A;  3F8U A;  1THO A;  3QMX A;  4G0K A;  3GRX A;  1J08 A;  3VWW A;  6GSY A;  4AF2 A;  1XVQ A;  1JHB A;  3ZTL A;  5DCG A;  3E0U A;  4NV5 A;  5CRW A;  3GX0 A;  2YWI A;  2GQK A;  2HLS A;  2YV9 A;  16GS A;  4IHU A;  1GNE A;  1QGV A;  1THX A;  1YEX A;  1UA5 A;  2RLI A;  4XRD A;  4JED A;  2HZE B;  1FW1 A;  3MDK A;  3ERW A;  1XW6 A;  4WXT A;  3BCI A;  1T8E B;  3ZL5 A;  4HOJ A;  2WB9 A;  1TI1 A;  3IAM 2;  2HSM A;  5ECR B;  3GV1 A;  5BMU A;  2F3M A;  1GRX A;  1JFU A;  4ILF A;  4J57 E;  3RPN A;  3C8E A;  4PNG A;  1WOU A;  4IKH A;  2H70 A;  3G9B A;  3IR4 A;  4MPG A;  4V2N A;  2V6O A;  4ZL7 A;  7GSS A;  3ED3 A;  1A8Y A;  3QCP A;  3I69 A;  2KHP A;  5IOX A;  5IM9 A;  1PQN A;  4O92 A;  1JZR A;  6GSV A;  1XW9 A;  4D73 A;  4ZB9 A;  4GLT A;  4IJI A;  1XFL A;  1J0F A;  3F4T A;  2A4V A;  2DJ0 A;  2H8L A;  4ZB6 A;  2CAQ A;  2CZ2 A;  3TGZ A;  3TJB A;  2PGT A;  3DGQ A;  1QQ2 A;  2CVK A;  3GHA A;  1F37 A;  1B4Q A;  1SEN A;  3H79 A;  2WDU A;  1GL8 A;  2VD0 A;  3A2W A;  1VF4 A;  3APS A;  5B8B A;  2PMT A;  3PIN A;  1FO5 A;  12GS A;  3A2V A;  2M80 A;  3UMA A;  2MZC A;  2MYG A;  4K6X A;  4NAX A;  2IPA A;  2HSM B;  3TOU A;  2NDO A;  4PNF A;  4NPB A;  4HZ2 A;  5G5E A;  5E59 A;  3LOR A;  4EKZ A;  1GLQ A;  5ECS A;  1G6W A;  2YJ7 A;  3EWL A;  5A4W A;  1GUM A;  2H73 A;  5A4V A;  1AQX A;  2Z9S A;  5J41 A;  3WYW A;  2C1Y A;  4G19 A;  2DLX A;  2C4J A;  2VL2 C;  1M2D A;  1FB6 A;  4D73 B;  2CVB A;  4K7I A;  1ERV A;  1GUK A;  1O6J A;  2ON7 A;  1M0U A;  3FHK A;  2HE3 A;  3LQ7 A;  3GH9 A;  1X9M B;  5DAK A;  1Z6N A;  3KCM A;  5F0G A;  2NTO A;  2FWH A;  3DKS A;  2C3T A;  2GZP A;  3F4S A;  3WGE A;  3LGC A;  1H75 A;  4EDZ A;  3IA1 A;  2ALB A;  3TOT A;  1LBK A;  5IMC A;  1HNA A;  1ZZY A;  1R5P A;  18GS A;  5JWR B;  2V6K A;  4IVF A;  3O6T A;  3US3 A;  5GSS A;  5H5Q A;  1MTC A;  4N30 A;  1BAY A;  3APO A;  4F03 A;  2LRC A;  3KZQ A;  5J9C A;  6GST A;  3LEF A;  1OAZ A;  3LXZ A;  2VIM A;  2GT5 A;  3R2Q A;  2B5E A;  4BVX B;  3D22 A;  1Z7R A;  8GSS A;  2H74 A;  19GS A;  1FHE A;  5DAL A;  2FUG 2;  4BL7 A;  3GYK A;  3U5R E;  1V98 A;  2F51 A;  4OO4 A;  5EY6 A;  3GL5 A;  1O8W A;  4KND A;  2YNX A;  3CSI A;  5J5N A;  4J2F A;  2QSI A;  5DAK B;  1OE8 A;  3C7M A;  2BTO T;  2O87 A;  2HFD A;  4OCE A;  5F07 A;  3QDN A;  1G7E A;  1MD4 A;  4K2D A;  5AGY A;  4JBB A;  3HYP A;  4PUA A;  4PUF C;  4N10 A;  3N9J A;  1M9B A;  4I2T A;  1LU4 A;  5ID2 A;  4MJC A;  4ZBA A;  2X64 A;  3ZIV A;  4HQZ A;  2VAF A;  1SKW B;  4HQS A;  2VO4 A;  4MPF A;  2VD1 A;  1AXD A;  2LKU A;  2LNS A;  1S3A A;  3CTF A;  4K7O A;  3K8N A;  1BJX A;  3M3M A;  5FHI A;  3L9U A;  5ECN B;  1F6M C;  2GT6 A;  3C71 A;  2E7P A;  5IMZ A;  4KDX A;  2RM6 A;  3UEM A;  3IRA A;  20GS A;  4BVY A;  2E0Q A;  4I5Q A;  5CO3 A;  1TU8 A;  3IK9 A;  4EDY A;  2PER A;  4MK3 A;  2VLT A;  3W8J A;  5DAL B;  2NBS A;  4BL7 B;  3ZML A;  3G7J A;  22GS A;  1BX9 A;  1ZYE A;  2I3Y A;  1O81 A;  4KDU A;  3IPZ A;  4XS1 A;  4LA1 A;  1EOH A;  1U6T A;  1OC9 B;  3HDC A;  3KP8 A;  4GRF A;  1HQO A;  1TW9 A;  2QKE A;  3HD5 A;  2HQT A;  2VCX A;  4O7H A;  1X0R A;  3OR5 A;  2H1D A;  3F3R A;  4YQU A;  1PN9 A;  1LJR A;  1MDI A;  3RDW A;  5ID2 B;  5D9V A;  4POM A;  5COH A;  5L71 A;  3EE2 A;  2OJL A;  2CQ9 A;  1VGL A;  2WCI A;  4ML6 A;  3L9S A;  1F3B A;  3LWA A;  2HXK A;  2YCD A;  4HUA A;  2OBI A;  1U88 A;  2O8V B;  3EVI A;  4I8B A;  2I9H A;  4IGJ A;  4YAV A;  3HVX A;  2P0G A;  4IP1 A;  3KH7 A;  3TRQ A;  1UN2 A;  2GTU A;  4JZQ A;  3ZMK A;  4BVY B;  1XWB A;  3C1S A;  4ZB8 A;  5IPH A;  3GL3 A;  1GUH A;  2E2M A;  5CRD A;  2LQQ A;  2FNO A;  1BQ7 A;  5JWO B;  2I81 A;  2VCZ A;  4IS0 A;  2OBK A;  1PGT A;  4L8E A;  5D9X A;  4K1F A;  1PL1 A;  13GS A;  3RHB A;  3DYR A;  1V40 A;  1TTZ A;  2IWT A;  3TKS E;  4POK A;  3R3E A;  1RW1 A;  4XTS A;  2WFC A;  4NWY A;  4TKY A;  1ZL9 A;  5EL8 A;  4PQH A;  2A2S A;  3QAG A;  2P5R A;  3UAP A;  4E8H A;  5ENU A;  2A2R A;  3VI7 A;  2DBC A;  1GSY A;  4ACS A;  4DEJ A;  1T00 A;  3TKS A;  9GSS A;  1NHY A;  1EOG A;  3I43 A;  3AY8 A;  4RI7 A;  1FG4 A;  2EC4 A;  4N11 A;  3KTL A;  2IFQ A;  4MLY A;  1GSE A;  4HZ4 A;  5IMA A;  5KN1 A;  1XWC A;  1X5D A;  2PVQ A;  1E2Y A;  3D4M A;  2QGV A;  5J9B A;  2OAD A;  1SYX A;  3FR9 A;  4QL7 A;  4TN8 A;  1GTI A;  4MH3 A;  2H01 A;  1EV4 A;  1OYJ A;  4KSO A;  4RUV A;  4YH2 A;  2JZS A;  5G5F A;  3MSZ A;  2I1U A;  2DMM A;  2KOK A;  3I6A A;  1VRS D;  2MMN A;  1T3B A;  1PKW A;  3HXS A;  2VL9 A;  2F8F A;  4GQC A;  4ECB A;  5DJL A;  3J7Y k;  3LG6 A;  1T1V A;  2FWF A;  2ZCT A;  4TOP A;  2H6X A;  1SJ6 A;  1SD8 A;  3TJJ A;  4WBJ A;  4WBR D;  2WGR A;  4POL A;  3H4K A;  1SK0 A;  2N5A A;  2PVO C;  5CAX A;  1I5G A;  2WZ9 A;  2H6Z A;  1AC1 A;  1GWC A;  1XBS A;  3BJ5 A;  3G7Y A;  2PPT A;  1PX7 A;  4IEL A;  4TXO B;  5IMV A;  5D73 A;  3RBT A;  5B6N A;  2GZY A;  3VLN A;  2WJU A;  2LQO A;  2CVD A;  4FYU A;  4OFM A;  2ZNM A;  4USS A;  2L6C A;  6GSX A;  4Q5F A;  4EVM A;  1XIY A;  2IFQ B;  3F0I A;  1EGO A;  4K7N A;  3IC4 A;  3WGD A;  3GMF A;  5AN1 A;  4RQX A;  2GGT A;  2AHE A;  4MCU A;  2PN8 A;  3F6F A;  4WR4 A;  4FIW A;  4JE1 A;  1NW2 A;  2IIY A;  3CYN A;  2CX3 A;  1KEB A;  2X8H A;  1TKD B;  2GS3 A;  3D21 A;  5HQP A;  4V2M A;  2YWO A;  2FA8 A;  1Q98 A;  2CX4 A;  2HRN A;  3NZN A;  4G10 A;  3H8Q A;  4L5O A;  5G30 A;  3I9V 2;  3MAK A;  4RI6 A;  5ECH B;  2B5Y A;  2BMX A;  4MA9 A;  1X9W B;  1XPV A;  4Q5Q A;  2IMI A;  3FZ4 A;  3CMI A;  4BWQ A;  3ZVJ A;  1WWJ A;  4GQF A;  2L59 A;  1PSQ A;  3WT2 A;  3E3E A;  1QFN A;  4WKW A;  2G0F A;  4GSN A;  4HU9 A;  2WS2 A;  2LUS A;  4F9Z A;  1AQW A;  4N0V A;  4OD7 A;  1TK5 B;  1PMT A;  4BA7 A;  3TCO A;  3DIE A;  1B8X A;  2IMK A;  4HU7 A;  2H30 A;  4NV2 A;  1KNG A;  4NMU A;  2HSN B;  1XWG A;  5B7C A;  2YWN A;  3QOU A;  1S3D A;  5AIS A;  2PBJ A;  1GP1 A;  2HT9 A;  2K9F A;  4V2L A;  3GIX A;  2HRF A;  2VCW A;  2CV4 A;  3VPQ A;  3KD0 A;  5EPF A;  3DML A;  1SL1 B;  1X5E A;  2VOC A;  4N0Z A;  2N5B A;  5IOW A;  4ECC A;  1AUC A;  1FVJ A;  3TUE A;  3FR3 A;  2RII A;  1YQ1 A;  1NSW A;  2O85 A;  4NHW A;  4EXJ A;  5GAN D;  4PX1 A;  4PXO A;  2B7J A;  1UC7 A;  4ID0 A;  2DIZ A;  2VCQ A;  2DC5 A;  3UL3 A;  1WMJ A;  2DJ3 A;  4GTU A;  3DRN A;  3RPP A;  4FH8 A;  2OE0 A;  3FYG A;  2H1B A;  2RUE A;  4ZBD A;  5ELA A;  2R4V A;  2GQM A;  1R26 A;  5KN3 A;  2FA4 A;  1ZYQ B;  3GX8 A;  4TR1 A;  3FY7 A;  1AIU A;  5E4W A;  3E9J B;  2C8U A;  4PUR A;  4TR4 A;  4IJ3 A;  2J9H A;  4JRR A;  1WP0 A;  5D9W A;  4EUY A;  5ECL B;  4ML1 A;  3UAR A;  2B5X A;  2C0F A;  2AB6 A;  2XBQ A;  2FY6 A;  4IQA A;  3H1N A;  1XWA A;  3ZVJ D;  4K8M A;  5HR0 A;  2LJR A;  3S9F A;  4IN0 A;  3EUR A;  5H5R A;  1VF2 A;  5A5K A;  4ZBB A;  1IYI A;  4YQM A;  5ECO B;  4POB A;  3FR6 A;  2M46 A;  3EMX A;  4IBP A;  4E8E A;  3V1W A;  2EIQ A;  2K8V A;  1C72 A;  3ZLP A;  4KCA A;  3O3T A;  4NXI A;  1GSQ A;  4LLR A;  4KA0 A;  4QL9 A;  3HVV A;  4KH7 A;  1KTE A;  1DE2 A;  1GLP A;  3GST A;  2OKA A;  3GA4 A;  3M9J A;  4LMW A;  2AV4 A;  4OCF A;  1F3A A;  2P31 A;  1OVN A;  2C3Q A;  1W4V A;  3QAW A;  1SU9 A;  1SKS B;  3D5J A;  2HNL A;  2DJK A;  3KP9 A;  3BD2 A;  5HR3 A;  1Y25 A;  1U87 A;  1YY7 A;  1Q4J A;  2ON5 A;  3TKS C;  5DVB A;  2AUV A;  3HJM A;  5CNW A;  4TR1 B;  3TKQ A;  3A3T A;  3FK8 A;  2N5F A;  2FGX A;  2IMD A;  1M99 A;  1YJ6 A;  1QUW A;  3FZA A;  4X1U A;  4EE0 A;  4KE3 A;  11GS A;  3F9U A;  1N2A A;  3EU3 A;  4JR4 A;  4L0U A;  2O7K A;  1YDK A;  2X99 A;  2DIY A;  4PQI A;  4TVE A;  1HNB A;  2K6V A;  3IOS A;  3TJF A;  4AGS A;  3GH6 A;  5INY A;  2H6Y A;  1F2E A;  2OE3 A;  2LEG A;  3VFI A;  3GKK A;  4HS1 A;  3GTU A;  4X43 A;  1G0T A;  4TXV A;  2ES7 A;  1QXH A;  3GKM A;  3BCK A;  2HRK A;  4K0G A;  1DBY A;  3N5O A;  1B9Y C;  5ECQ B;  3PH9 A;  4RQR A;  1E6B A;  1O85 A;  1FVK A;  2H71 A;  2LTK A;  4ZL9 A;  1ERW A;  4WET A;  2VL3 A;  4ECI A;  4HDE A;  2WRT A;  3HJO A;  2G2Q A;  2H1G A;  1WE0 A;  1TDI A;  1NM3 A;  1M9A A;  5IMD A;  4MMM A;  1A0F A;  2LNT A;  2IJY A;  2VM2 A;  1J9B A;  3C1R A;  3CXG A;  4JU5 A;  2VL2 A;  2LJK A;  2J23 A;  3TKR A;  1G6Y A;  3BOA A;  1YZX A;  2TRC P;  2UZ8 A;  1DSB A;  2KP1 A;  4ZXG A;  3KMN A;  1H4O A;  4MF5 A;  2PWJ A;  1XXU A;  4WR5 A;  2H0I A;  3UOM A;  2BJX A;  1XVW A;  4MF7 A;  3P2A A;  3ZRE A;  2MMA A;  1JZD A;  4NHZ A;  2YAN A;  3UIW A;  2KP2 A;  2LS5 A;  2R2J A;  3GTU B;  2AAW A;  3HA9 A;  4H86 A;  1GTB A;  2VLU A;  3EYT A;  1F9M A;  2RUF A;  3RAZ A;  4I2U A;  3PGT A;  4Z7X A;  5ECP B;  4AJ8 A;  3TRX A;  4K0N A;  4HJM A;  1EWX A;  2IMF A;  3LYP A;  4GWR A;  1TU7 A;  5F8B A;  4Q5R A;  2TIR A;  1TRS A;  1M7T A;  4KUN A;  3HKR A;  4MZB A;  3IAS 2;  4CDO A;  2RM5 A;  1ERT A;  2GZZ A;  5B8A A;  2VLV A;  4CW9 A;  4OFT A;  4X0X A;  2JSY A;  2PUK C;  3HZ4 A;  5D9T A;  3WT1 A;  3SWL A;  3FZ9 A;  1TXX A;  2DJ2 A;  2E2G A;  3ISO A;  2R6K A;  3P90 A;  5IPG A;  2K18 A;  2I4A A;  5ECI B;  3KEB A;  5IIZ A;  3D6I A;  1SJI A;  1B9X C;  1VF3 A;  2TRX A;  3LSZ A;  4ZIL A;  3GKX A;  10GS A;  1K0D A;  2FCH A;  4G2E A;  3ZFB A;  3TJK A;  2IL3 A;  1Z6M A;  2ZUP A;  3QD9 A;  5HFK A;  1R5A A;  1GSF A;  1ABA A;  1Z5Y E;  2H66 A;  1RK4 A;  2GSS A;  1R4W A;  2M72 A;  3QR6 A;  1GTA A;  3EC3 A;  1XCC A;  3H93 A;  2VCT A;  4YQV A;  2MBT A;  4FO5 A;  4DSR A;  4KSM A;  1TJD A;  4YAP A;  1ON4 A;  1K3O A;  3F6D A;  2HRA A;  3UVT A;  1XOA A;  4F0C A;  2B3S A;  4WF4 A;  2XPD A;  1S3C A;  1SL0 B;  2H19 A;  2JU5 A;  1A23 A;  3G7I A;  5GST A;  2MMO A;  2YZU A;  1TP9 A;  1GSD A;  4EC0 A;  3PR8 A;  1BED A;  2YWM A;  3Q19 A;  1K0M A;  1TOF A;  4XIH A;  3L0H A;  5H5S A;  2L4Q A;  2LJA A;  3F3Q A;  3WGX A;  3KMO A;  3CBU A;  3M1G A;  3IE3 A;  2GSR A;  3L78 A;  2L5L A;  5CRH A;  2D2Z A;  4V1A p;  3VI5 A;  2B7K A;  2X8G A;  5JCU A;  1ILO A;  2OAC A;  1GH2 A;  4HJ2 A;  4PQ1 A;  4JR6 A;  4AJ6 A;  4TRX A;  5C00 A;  4O32 A;  3IXR A;  2HSH A;  1JZO A;  2DML A;  1O7U A;  3LFL A;  3EMP A;  4MZC A;  3ZRD A;  5GAP D;  1TK0 B;  4GSS A;  3UVH A;  1M2B A;  4FQU A;  2AYT A;  1N8J A;  2XPE A;  4I97 A;  3DVX A;  3L4N A;  3O76 A;  1V9W A;  3DWV A;  1TK8 B;  1FAA A;  1T4Z A;  1XW5 A;  2REM A;  3TRP A;  3FZ5 A;  5ECK B;  1AW9 A;  1JLV A;  1OKD A;  1K3Y A;  3M0F A;  5G31 A;  4OMV A;  1X9S B;  3BBY A;  1NHO A;  4MJB A;  2YPM A;  4P3Y B;  2L5O A;  3F63 A;  5JCW A;  1B48 A;  1FB0 A;  1XOB A;  1UVZ A;  2H1A A;  5LCZ A;  2YOI A;  1X5C A;  1EZK A;  5DQY A;  2XHF A;  3ZIT A;  1PL2 A;  3Q74 A;  1OKT A;  3APQ A;  4DSQ A;  5HFI A;  4L0W A;  3J7Y b;  5CP1 A;  2C0D A;  5B6M A;  1U3I A;  3VWU A;  2B1L A;  2GLR A;  5JCG A;  1O8X A;  1DE1 A;  1GNW A;  1V2A A;  3CSH A;  2LRN A;  1MDJ A;  5KEJ A;  3GUS A;  4ZL8 A;  1CQG A;  5LD0 A;  3IDV A;  1ZCP A;  3IK7 A;  3CRU A;  2XC2 A;  3QPM A;  1EEJ A;  1FOV A;  4HI7 A;  1K0N A;  1MEK A;  4GF0 A;  3M9K A;  3GN3 A;  1HNC A;  3GFK A;  3LXT A;  4PGT A;  3MWH A;  1AQV A;  4BVX A;  1SKR B;  4G0L A;  1GUL A;  4WEY A;  4DVC A;  3KGK A;  5IMF A;  1CQH A;  2L4C A;  6GSU A;  1TRV A;  2JZT A;  5KN0 A;  1YF1 A;  4MF6 A;  3VUR A;  1I9D A;  1K0C A;  3A5W A;  1SK1 A;  2C80 A;  5CYY A;  3TKP A;  3M8N A;  2NPB A;  5G2Z A;  3HZ8 A;  1QK8 A;  1OC8 A;  4MJE A;  4LMV A;  3QFB C;  1A2L A;  5HR1 A;  3W6G A;  1ZMA A;  1T4Y A;  4XRA A;  4MAB A;  2H76 A;  5J3R A;  4BPY A;  2FHE A;  5AIV A;  1SL2 B;  1Z3E A;  1IYH A;  2H72 A;  4L5L A;  5DBQ A;  2KUC A;  3HJP A;  2YZH A;  4G0I A;  1GSS A;  2VCV A;  5J4U A;  1TRU A;  5D96 A;  4WF5 A;  3UBK A;  1SYR A;  1YKA A;  5FWG A;  1SK2 A;  1URM A;  1VF1 A;  2JZR A;  3KXO A;  3DXB A;  2WUL A;  2FWG A;  3VPT A;  4TR0 A;  1K0A A;  3PPU A;  14GS A;  1ST9 A;  1T7P B;  2V1M A;  1SJZ A;  2L57 A;  1HD2 A;  5EVO A;  3GKN A;  5D93 A;  1WIK A;  3LJR A;  1WPI A;  3JCM L;  17GS A;  3D4T A;  3HCZ A;  4V1A g;  4LL1 B;  3Q18 A;  2FWE A;  3TB2 A;  2R3X A;  4BWS A;  1V57 A;  2GVP A;  4OWY A;  2GSQ A;  1XWK A;  3HY2 A;  3GSS A;  3ZYW A;  1K0O A;  3SBC A;  5DJM A;  2JL4 A;  1GTU A;  2EIO A;  5IO2 A;  3NIV A;  1EP7 A;  4GST A;  1TI3 A;  4MDC A;  4KX4 A;  3VWX A;  1SD9 A;  2VM1 A;  1EGR A;  1A2M A;  2K8S A;  1OC9 A;  3A2X A;  5G1K A;  2L6D A;  1K3L A;  2YJH A;  1A0R P;  1HYU A;  1KBN A;  1WJK A;  1EEM A;  3QAV A;  3KM6 A;  2R5G A;  2MMZ A;  4KCE A;  4J56 E;  3UBL A;  4MP4 A;  1V58 A;  2GQL A; 
#chains in the Genus database with same CATH topology
 3EU4 A;  1M3I A;  2FLS A;  3MNG A;  2C0G A;  4EF0 A;  2AJQ B;  2IME A;  4ZB7 A;  1GSU A;  3GUR A;  3TDG A;  4XS6 A;  3KJY A;  2R37 A;  1AAZ A;  4IW9 A;  3DVW A;  2LRT A;  1Z9H A;  1S4B P;  5FT3 A;  1U3A A;  3HVS A;  1BYE A;  5ABR A;  4XS4 A;  4G9H A;  4GXZ A;  4AJ7 A;  2JSZ A;  3IBH A;  4PHZ C;  1YKC A;  3LYK A;  5DDL A;  4O5R A;  3FEU A;  3KH9 A;  4TW5 A;  3FRC A;  3ERF A;  2OE1 A;  1MDK A;  1USB A;  4CHS A;  3DD3 A;  5CRE A;  3W8S A;  5AIX A;  5C04 A;  2HZF A;  1A2J A;  2PU9 C;  4XCS A;  1YF0 A;  4GCI A;  3WD6 A;  1PRX A;  4F2I A;  1K0B A;  2P5Q A;  2GDR A;  3U6V A;  5LNK e;  2H0G A;  2JAD A;  2V32 A;  4XHM A;  3DEX A;  1JLW A;  1ZGN A;  2VUP A;  3LW9 A;  4ZIJ A;  2KLX A;  5G1L A;  4DSS A;  2DJ1 A;  2CA8 A;  4ECJ A;  2CAI A;  4F0B A;  2O89 A;  2XBI A;  3EIN A;  3P8W A;  2F9S A;  1W89 A;  4IP6 A;  1QMV A;  3C73 A;  1OE7 A;  3CTG A;  4YKG A;  1TRW A;  1ZYP A;  5F05 A;  2B1K A;  4A5P A;  1PX6 A;  5A4U A;  1A24 A;  1M2A A;  2QC7 A;  2HRK B;  1XZO A;  2F8A A;  3KTB A;  3Q6O A;  4F82 A;  2WW0 A;  5HFG A;  4MZW A;  1DUG A;  3ZIJ A;  2MBS A;  4KB3 A;  1PKZ A;  2LV3 A;  4XS4 B;  3VK9 A;  1ZOF A;  2V41 A;  3ME8 A;  4QQ7 A;  3NOF A;  4EL1 A;  2C3N A;  4EO3 A;  4KAE A;  3ERG A;  2IN3 A;  3ZFL A;  2HYX A;  5KN2 A;  5CRG A;  4HEA 2;  1M3J A;  5IQY A;  1R7H A;  3TJG A;  2LST A;  2EFD A;  5JWQ B;  2B6M A;  3QFA C;  4KW6 A;  4MJA A;  4CY8 A;  4IQ1 A;  4Q5N A;  3P7X A;  6GSS A;  3KIJ A;  4K9Z A;  4KGI A;  6GSW A;  4ULX A;  1Y6E A;  5HR2 A;  1OC3 A;  1RQM A;  3CSJ A;  1Z7P A;  3IV4 A;  3IC8 A;  4DSS B;  5DQS A;  5DCH A;  3RHC A;  4FYB A;  4TXO A;  4I6X A;  3HVN A;  1ML6 A;  2YV7 A;  4OO5 A;  1EP8 A;  2X8C A;  1PD2 1;  3FKF A;  3L9V A;  1PA3 A;  2CZ3 A;  3ZZX A;  2OA7 A;  1JZW A;  1MD3 A;  4KF9 A;  1ERU A;  2HZE A;  4MH2 A;  1B4P A;  2X4A A;  3FW2 A;  3D0Z A;  5ELG A;  2FD3 A;  2NVL A;  2C0E A;  1A8L A;  1WRY A;  4CY6 A;  1G7O A;  4LL4 B;  3CRT A;  3F4R A;  4FYC A;  1EV9 A;  2DSA A;  5F06 A;  4TR3 A;  3IHQ A;  2WVZ A;  2DJJ A;  1BG1 A;  2H75 A;  1BG5 A;  2CT6 A;  4PTS A;  5KOX A;  4KDY A;  5ECM B;  3ME7 A;  1ACV A;  3HHV A;  4OFN A;  2YN1 A;  5GZZ B;  2DKH A;  2HSY A;  1YEP A;  3CHX C;  2YP6 A;  1O73 A;  2GST A;  2EIR A;  5D8I A;  2H0H A;  2HI7 A;  3VWV A;  3GNJ A;  5IO0 A;  3UJ1 A;  2JAC A;  2V2G A;  4ISD A;  3F8U A;  1THO A;  3QMX A;  4G0K A;  3GRX A;  1J08 A;  3VWW A;  6GSY A;  4AF2 A;  1XVQ A;  1JHB A;  3ZTL A;  5DCG A;  3E0U A;  4NV5 A;  5CRW A;  3GX0 A;  2YWI A;  2GQK A;  2HLS A;  2YV9 A;  16GS A;  4IHU A;  1GNE A;  1QGV A;  1THX A;  1YEX A;  1UA5 A;  2RLI A;  4XRD A;  4JED A;  2HZE B;  1FW1 A;  3MDK A;  2HSN A;  3ERW A;  1XW6 A;  4WXT A;  3BCI A;  1T8E B;  3ZL5 A;  4HOJ A;  2WB9 A;  1TI1 A;  3IAM 2;  2HSM A;  5ECR B;  3GV1 A;  1PN0 A;  5BMU A;  1YEW C;  2F3M A;  1GRX A;  1JFU A;  4ILF A;  4J57 E;  3RPN A;  3C8E A;  4PNG A;  1WOU A;  4IKH A;  2H70 A;  3G9B A;  3IR4 A;  4MPG A;  4V2N A;  2V6O A;  4ZL7 A;  7GSS A;  3ED3 A;  1A8Y A;  3QCP A;  3I69 A;  2KHP A;  5IOX A;  4HSC X;  5IM9 A;  1PQN A;  4O92 A;  1JZR A;  6GSV A;  1XW9 A;  4D73 A;  4ZB9 A;  4GLT A;  4IJI A;  1XFL A;  1J0F A;  3F4T A;  2A4V A;  2DJ0 A;  2H8L A;  4ZB6 A;  2CAQ A;  2CZ2 A;  3TGZ A;  3TJB A;  2PGT A;  3DGQ A;  1QQ2 A;  2CVK A;  3GHA A;  1F37 A;  1B4Q A;  1SEN A;  3H79 A;  2WDU A;  1GL8 A;  2VD0 A;  4Z2T A;  3A2W A;  1VF4 A;  3APS A;  5B8B A;  2PMT A;  3PIN A;  1FO5 A;  12GS A;  3A2V A;  2M80 A;  3UMA A;  2MZC A;  2MYG A;  4K6X A;  4NAX A;  4K2X A;  2IPA A;  2HSM B;  3TOU A;  2NDO A;  4PNF A;  4NPB A;  4HZ2 A;  5G5E A;  1N25 A;  5BMU B;  5E59 A;  3LOR A;  4EKZ A;  1GLQ A;  5ECS A;  1G6W A;  2YJ7 A;  5A1N A;  3EWL A;  5A4W A;  1GUM A;  2H73 A;  5A4V A;  1AQX A;  2Z9S A;  5J41 A;  3WYW A;  2C1Y A;  4G19 A;  2DLX A;  2C4J A;  2VL2 C;  1M2D A;  1FB6 A;  4D73 B;  2CVB A;  4K7I A;  1ERV A;  1GUK A;  1O6J A;  2ON7 A;  1M0U A;  3FHK A;  2HE3 A;  3LQ7 A;  3GH9 A;  1X9M B;  5DAK A;  1Z6N A;  3KCM A;  5F0G A;  2NTO A;  3MIX A;  2FWH A;  3DKS A;  2C3T A;  2GZP A;  3F4S A;  3WGE A;  3LGC A;  4GDF A;  1H75 A;  4EDZ A;  3IA1 A;  2ALB A;  3TOT A;  1LBK A;  5IMC A;  1HNA A;  1ZZY A;  1R5P A;  18GS A;  5JWR B;  4EIP A;  2V6K A;  4IVF A;  3O6T A;  3US3 A;  4Z2R A;  2O3E A;  5GSS A;  5H5Q A;  1MTC A;  4N30 A;  1BAY A;  3APO A;  4F03 A;  2LRC A;  3KZQ A;  5J9C A;  6GST A;  3LEF A;  1OAZ A;  3LXZ A;  5A1N B;  2VIM A;  2GT5 A;  3R2Q A;  2B5E A;  4BVX B;  3D22 A;  2WVY A;  1Z7R A;  8GSS A;  2H74 A;  19GS A;  1FHE A;  5DAL A;  2FUG 2;  4BL7 A;  3GYK A;  3U5R E;  1V98 A;  2F51 A;  4OO4 A;  5EY6 A;  3GL5 A;  1O8W A;  4KND A;  2YNX A;  3CSI A;  5J5N A;  4J2F A;  2QSI A;  5DAK B;  1OE8 A;  3C7M A;  2BTO T;  2O87 A;  2HFD A;  4OCE A;  5F07 A;  3QDN A;  1G7E A;  1MD4 A;  4K2D A;  5AGY A;  4JBB A;  3HYP A;  4PUA A;  4PUF C;  4N10 A;  3N9J A;  1M9B A;  4I2T A;  1LU4 A;  5ID2 A;  4MJC A;  4ZBA A;  2X64 A;  3ZIV A;  4HQZ A;  2VAF A;  1SKW B;  4HQS A;  2VO4 A;  4MPF A;  2VD1 A;  1AXD A;  2LKU A;  5J4V A;  2LNS A;  1S3A A;  3CTF A;  4K7O A;  3K8N A;  1BJX A;  3M3M A;  5FHI A;  3L9U A;  5ECN B;  1F6M C;  2GT6 A;  3C71 A;  2E7P A;  5IMZ A;  4KDX A;  2RM6 A;  3UEM A;  3IRA A;  20GS A;  4BVY A;  2E0Q A;  4I5Q A;  5CO3 A;  1TU8 A;  3IK9 A;  4EDY A;  2PER A;  4MK3 A;  2VLT A;  3W8J A;  4AKG A;  5DAL B;  2NBS A;  4BL7 B;  3ZML A;  3G7J A;  22GS A;  1BX9 A;  1ZYE A;  2I3Y A;  1O81 A;  4KDU A;  3IPZ A;  4XS1 A;  4LA1 A;  1EOH A;  1U6T A;  1YVL A;  4O5Q A;  1OC9 B;  3HDC A;  3KP8 A;  4GRF A;  1HQO A;  4E68 A;  2WZS A;  2X49 A;  1TW9 A;  2QKE A;  3HD5 A;  2HQT A;  2VCX A;  4O7H A;  1X0R A;  3OR5 A;  2H1D A;  3F3R A;  4YQU A;  1PN9 A;  1LJR A;  1MDI A;  3RDW A;  5ID2 B;  5D9V A;  5KOW A;  4POM A;  5COH A;  5L71 A;  3EE2 A;  2OJL A;  2CQ9 A;  1VGL A;  2WCI A;  4ML6 A;  3L9S A;  1F3B A;  4AKH A;  3LWA A;  2HXK A;  2YCD A;  4HUA A;  2OBI A;  1U88 A;  2O8V B;  3EVI A;  4I8B A;  2I9H A;  4IGJ A;  4YAV A;  3HVX A;  2P0G A;  3TU3 B;  4IP1 A;  3KH7 A;  3TRQ A;  1UN2 A;  2GTU A;  4JZQ A;  3ZMK A;  4BVY B;  1XWB A;  3C1S A;  4ZB8 A;  5IPH A;  3GL3 A;  1GUH A;  2E2M A;  5CRD A;  2LQQ A;  2FNO A;  1BQ7 A;  5JWO B;  2I81 A;  2VCZ A;  4IS0 A;  4QMK A;  2OBK A;  4X4J A;  1PGT A;  4L8E A;  5D9X A;  4K1F A;  1PL1 A;  13GS A;  3RHB A;  3DYR A;  1V40 A;  1TTZ A;  2IWT A;  3TKS E;  4POK A;  3R3E A;  1RW1 A;  4XTS A;  2WVX A;  2WFC A;  4NWY A;  4TKY A;  1ZL9 A;  5EL8 A;  2VKZ G;  4PQH A;  2A2S A;  3QAG A;  2P5R A;  3UAP A;  4E8H A;  5ENU A;  2A2R A;  3VI7 A;  2DBC A;  1GSY A;  4ACS A;  4DEJ A;  1T00 A;  3TKS A;  9GSS A;  1NHY A;  1EOG A;  3I43 A;  3AY8 A;  4RI7 A;  1FG4 A;  2EC4 A;  2A2P A;  4N11 A;  3KTL A;  2IFQ A;  4MLY A;  1GSE A;  4HZ4 A;  5IMA A;  5KN1 A;  1XWC A;  1X5D A;  1I1I P;  2PVQ A;  1E2Y A;  3D4M A;  2QGV A;  5J9B A;  2OAD A;  1SYX A;  3FR9 A;  4QL7 A;  4TN8 A;  1GTI A;  4MH3 A;  2H01 A;  1EV4 A;  1OYJ A;  4KSO A;  4RUV A;  4YH2 A;  2JZS A;  5G5F A;  3MSZ A;  2I1U A;  4W66 A;  2DMM A;  2KOK A;  3I6A A;  1VRS D;  2MMN A;  1T3B A;  5BRT A;  1PKW A;  3HXS A;  2VL9 A;  2F8F A;  4GQC A;  4ECB A;  5DJL A;  3J7Y k;  3LG6 A;  1T1V A;  2FWF A;  2ZCT A;  4TOP A;  2H6X A;  1XG8 A;  1SJ6 A;  1SD8 A;  3TJJ A;  4WBJ A;  4WBR D;  2WGR A;  4POL A;  3H4K A;  1SK0 A;  2N5A A;  2PVO C;  5CAX A;  1I5G A;  3FMW A;  2WZ9 A;  2H6Z A;  1AC1 A;  1GWC A;  1XBS A;  3BJ5 A;  3G7Y A;  2PPT A;  1PX7 A;  4IEL A;  4TXO B;  5IMV A;  5D73 A;  3RBT A;  5B6N A;  2GZY A;  3VLN A;  2WJU A;  2LQO A;  2CVD A;  4FYU A;  4OFM A;  2ZNM A;  4USS A;  2L6C A;  6GSX A;  4Q5F A;  4EVM A;  1XIY A;  2IFQ B;  3F0I A;  1EGO A;  4K7N A;  3IC4 A;  3WGD A;  3GMF A;  5AN1 A;  2R0P A;  4RQX A;  2GGT A;  2AHE A;  4MCU A;  2PN8 A;  3F6F A;  4WR4 A;  4FIW A;  4JE1 A;  1NW2 A;  2IIY A;  3CYN A;  4K5S A;  2CX3 A;  1KEB A;  2X8H A;  1TKD B;  1TXU A;  2GS3 A;  2H1L A;  3D21 A;  5HQP A;  4V2M A;  2YWO A;  2FA8 A;  1Q98 A;  2CX4 A;  1PFO A;  2HRN A;  3NZN A;  4G10 A;  3H8Q A;  4L5O A;  5G30 A;  3I9V 2;  3MAK A;  4RI6 A;  5ECH B;  2B5Y A;  4EIQ A;  2BMX A;  4MA9 A;  1X9W B;  1XPV A;  4Q5Q A;  2IMI A;  3FZ4 A;  3CMI A;  4BWQ A;  3ZVJ A;  1WWJ A;  4AKX B;  4GQF A;  2L59 A;  1PSQ A;  3WT2 A;  3E3E A;  1QFN A;  4WKW A;  2G0F A;  4GSN A;  4HU9 A;  2WS2 A;  2LUS A;  4F9Z A;  1AQW A;  4N0V A;  4OD7 A;  1TK5 B;  1PMT A;  4AKI A;  4BA7 A;  3TCO A;  3DIE A;  1B8X A;  2IMK A;  4HU7 A;  2H30 A;  4NV2 A;  1KNG A;  4NMU A;  2HSN B;  5J4Y A;  1XWG A;  5B7C A;  2YWN A;  3QOU A;  1S3D A;  5AIS A;  2PBJ A;  1GP1 A;  2HT9 A;  2K9F A;  4V2L A;  3GIX A;  2HRF A;  2VCW A;  2CV4 A;  3VPQ A;  3KD0 A;  5EPF A;  3DML A;  1SL1 B;  1X5E A;  4O5U A;  2VOC A;  4N0Z A;  2N5B A;  5IOW A;  4FXY P;  4ECC A;  1AUC A;  1FVJ A;  3TUE A;  3FR3 A;  2RII A;  1YQ1 A;  1NSW A;  2O85 A;  4NHW A;  4PI2 C;  4EXJ A;  5GAN D;  4PX1 A;  2UV8 G;  4PXO A;  2B7J A;  1UC7 A;  4ID0 A;  4G01 A;  2DIZ A;  2VCQ A;  2DC5 A;  3UL3 A;  1WMJ A;  2DJ3 A;  4GTU A;  3DRN A;  3RPP A;  4FH8 A;  2OE0 A;  3FYG A;  2H1B A;  2RUE A;  4ZBD A;  5ELA A;  2R4V A;  2GQM A;  1R26 A;  5KN3 A;  2FA4 A;  1ZYQ B;  3GX8 A;  4TR1 A;  3FY7 A;  1AIU A;  5E4W A;  3IHG A;  3E9J B;  2C8U A;  2EFC A;  4PUR A;  4TR4 A;  4IJ3 A;  2J9H A;  4JRR A;  1WP0 A;  5D9W A;  4EUY A;  5ECL B;  4ML1 A;  3UAR A;  2B5X A;  2C0F A;  2AB6 A;  2XBQ A;  2FY6 A;  4IQA A;  3H1N A;  1XWA A;  3ZVJ D;  4K8M A;  5HR0 A;  2LJR A;  3S9F A;  4IN0 A;  2QA2 A;  3EUR A;  5H5R A;  1VF2 A;  5A5K A;  4ZBB A;  1IYI A;  4YQM A;  5ECO B;  4POB A;  3FR6 A;  2M46 A;  2R0C A;  4Z2U A;  3EMX A;  4IBP A;  2DKI A;  4E8E A;  3V1W A;  2EIQ A;  2K8V A;  1C72 A;  3ZLP A;  4KCA A;  3O3T A;  4NXI A;  1GSQ A;  4LLR A;  4KA0 A;  4QL9 A;  3HVV A;  4KH7 A;  1KTE A;  1DE2 A;  1GLP A;  3GST A;  2OKA A;  3GA4 A;  3M9J A;  4LMW A;  2AV4 A;  4OCF A;  1F3A A;  4K5R A;  2P31 A;  1OVN A;  2C3Q A;  1W4V A;  3QAW A;  1SU9 A;  1SKS B;  3D5J A;  2HNL A;  2DJK A;  3KP9 A;  3BD2 A;  5HR3 A;  1Y25 A;  1U87 A;  1YY7 A;  1Q4J A;  2ON5 A;  3TKS C;  5DVB A;  2AUV A;  3HJM A;  5CNW A;  4TR1 B;  2EFE A;  3TKQ A;  3A3T A;  3FK8 A;  2N5F A;  2FGX A;  2IMD A;  1M99 A;  1YJ6 A;  1QUW A;  1Y1U A;  3FZA A;  4X1U A;  5A34 A;  4EE0 A;  4KE3 A;  3F9U A;  11GS A;  1N2A A;  3EU3 A;  4JR4 A;  4L0U A;  2O7K A;  1YDK A;  2X99 A;  2DIY A;  4PQI A;  4TVE A;  1HNB A;  2K6V A;  3IOS A;  3TJF A;  4AGS A;  3GH6 A;  5INY A;  2H6Y A;  1F2E A;  2OE3 A;  2LEG A;  3VFI A;  3GKK A;  4HS1 A;  3GTU A;  4X43 A;  1G0T A;  1FOH A;  4TXV A;  2ES7 A;  1SVO A;  1QXH A;  3GKM A;  3BCK A;  2HRK A;  4K0G A;  1S3R A;  1DBY A;  3N5O A;  1B9Y C;  5ECQ B;  3PH9 A;  4RQR A;  1E6B A;  1O85 A;  1FVK A;  2H71 A;  2LTK A;  4ZL9 A;  1ERW A;  4WET A;  2VL3 A;  4ECI A;  4HDE A;  3RFR C;  2WRT A;  3HJO A;  2G2Q A;  2H1G A;  1WE0 A;  1TDI A;  1NM3 A;  1M9A A;  5IMD A;  4MMM A;  1A0F A;  2LNT A;  2IJY A;  2VM2 A;  1J9B A;  3C1R A;  3CXG A;  4JU5 A;  2VL2 A;  2LJK A;  2J23 A;  3TKR A;  1G6Y A;  3BOA A;  1YZX A;  2TRC P;  2UZ8 A;  1DSB A;  2KP1 A;  4ZXG A;  3A5I A;  5A34 B;  3KMN A;  1H4O A;  4MF5 A;  2PWJ A;  1XXU A;  4WR5 A;  2H0I A;  3UOM A;  2BJX A;  1XVW A;  4MF7 A;  3P2A A;  3ZRE A;  2MMA A;  1JZD A;  4NHZ A;  2YAN A;  3UIW A;  2KP2 A;  2LS5 A;  2R2J A;  3GTU B;  2AAW A;  3HA9 A;  4H86 A;  1GTB A;  5A5H A;  2VLU A;  3EYT A;  1F9M A;  3MYD A;  2RUF A;  3RAZ A;  4I2U A;  3PGT A;  4Z7X A;  5ECP B;  4AJ8 A;  3TRX A;  4K0N A;  4HJM A;  1EWX A;  2IMF A;  3LYP A;  4MNN A;  4GWR A;  1TU7 A;  5F8B A;  4Q5R A;  2TIR A;  1TRS A;  1M7T A;  4KUN A;  3HKR A;  4MZB A;  3RGB C;  3IAS 2;  4CDO A;  2RM5 A;  1ERT A;  2GZZ A;  5B8A A;  2VLV A;  4CW9 A;  4OFT A;  4X0X A;  2JSY A;  2PUK C;  3HZ4 A;  5D9T A;  3WT1 A;  3SWL A;  3FZ9 A;  1TXX A;  2DJ2 A;  2E2G A;  3ISO A;  2R6K A;  3P90 A;  5IPG A;  2K18 A;  2I4A A;  5ECI B;  3KEB A;  5IIZ A;  3D6I A;  1SJI A;  4N3Z A;  1B9X C;  1VF3 A;  2TRX A;  3LSZ A;  4ZIL A;  3GKX A;  10GS A;  1K0D A;  2FCH A;  4G2E A;  3ZFB A;  3TJK A;  2IL3 A;  1Z6M A;  2ZUP A;  3QD9 A;  5HFK A;  1R5A A;  1GSF A;  1ABA A;  5A5H B;  1Z5Y E;  2H66 A;  1RK4 A;  2GSS A;  1R4W A;  2M72 A;  3QR6 A;  1ZYN A;  1GTA A;  3EC3 A;  1XCC A;  3H93 A;  2VCT A;  4YQV A;  2MBT A;  4ICY A;  4FO5 A;  4BIK A;  4DSR A;  4KSM A;  1TJD A;  4YAP A;  1ON4 A;  1K3O A;  3F6D A;  2HRA A;  3UVT A;  1XOA A;  4F0C A;  2B3S A;  4WF4 A;  2XPD A;  1S3C A;  1BF5 A;  1SL0 B;  2H19 A;  2JU5 A;  2A4H A;  1A23 A;  3G7I A;  5GST A;  2MMO A;  2WVX B;  2YZU A;  1TP9 A;  1GSD A;  4EC0 A;  3PR8 A;  1BED A;  2YWM A;  3Q19 A;  1K0M A;  1TOF A;  4XIH A;  3L0H A;  5H5S A;  2L4Q A;  3CQF A;  2LJA A;  3F3Q A;  3WGX A;  3KMO A;  3CBU A;  3M1G A;  3IE3 A;  2GSR A;  4PI0 C;  2L5L A;  3L78 A;  5CRH A;  2D2Z A;  4V1A p;  3VI5 A;  2B7K A;  2X8G A;  5JCU A;  1ILO A;  2OAC A;  1GH2 A;  4HJ2 A;  4PQ1 A;  4JR6 A;  4AJ6 A;  4TRX A;  5C00 A;  4O32 A;  3IXR A;  2HSH A;  1JZO A;  2DML A;  1O7U A;  3LFL A;  3EMP A;  4MZC A;  3ZRD A;  5GAP D;  1TK0 B;  4GSS A;  3UVH A;  1M2B A;  4FQU A;  3HMJ G;  2AYT A;  1N8J A;  2XPE A;  4I97 A;  3DVX A;  3L4N A;  3O76 A;  1V9W A;  3DWV A;  1TK8 B;  1FAA A;  1T4Z A;  1XW5 A;  2REM A;  3TRP A;  3FZ5 A;  5ECK B;  1AW9 A;  1JLV A;  1OKD A;  4AI6 A;  1K3Y A;  3M0F A;  5G31 A;  4OMV A;  1X9S B;  3BBY A;  1NHO A;  4MJB A;  2YPM A;  4P3Y B;  2L5O A;  3F63 A;  5JCW A;  1B48 A;  1FB0 A;  1XOB A;  1UVZ A;  2OT3 A;  2H1A A;  5LCZ A;  2YOI A;  3CWG A;  1X5C A;  1EZK A;  5DQY A;  2XHF A;  3ZIT A;  1PL2 A;  3Q74 A;  1OKT A;  3APQ A;  4DSQ A;  2R0G A;  5J40 A;  5HFI A;  4L0W A;  3J7Y b;  5CP1 A;  2C0D A;  5B6M A;  1U3I A;  3VWU A;  2B1L A;  2GLR A;  5JCG A;  1O8X A;  1DE1 A;  1GNW A;  1V2A A;  3CSH A;  2O5V A;  2LRN A;  1MDJ A;  5KEJ A;  3GUS A;  4ZL8 A;  1CQG A;  5LD0 A;  3IDV A;  1ZCP A;  3IK7 A;  3CRU A;  2XC2 A;  3QPM A;  1EEJ A;  1FOV A;  4HI7 A;  1K0N A;  1MEK A;  4GF0 A;  3M9K A;  3GN3 A;  1HNC A;  3GFK A;  3LXT A;  4PGT A;  3MWH A;  4YKF A;  1AQV A;  4BVX A;  1SVL A;  1SKR B;  2WW3 A;  4G0L A;  1GUL A;  4WEY A;  4DVC A;  2O36 A;  3KGK A;  5IMF A;  1CQH A;  2L4C A;  3EPT A;  6GSU A;  1TRV A;  2JZT A;  5KN0 A;  1YF1 A;  4MF6 A;  3VUR A;  1I9D A;  1K0C A;  3A5W A;  1SK1 A;  2C80 A;  5CYY A;  3TKP A;  3M8N A;  2NPB A;  5G2Z A;  3HZ8 A;  1QK8 A;  1OC8 A;  4MJE A;  4LMV A;  3QFB C;  1A2L A;  5HR1 A;  3W6G A;  1ZMA A;  1T4Y A;  4XRA A;  4MAB A;  2H76 A;  5J3R A;  4BPY A;  2FHE A;  5AIV A;  1SL2 B;  1Z3E A;  2WW2 A;  1IYH A;  2H72 A;  4L5L A;  5DBQ A;  2KUC A;  3HJP A;  2YZH A;  4G0I A;  1GSS A;  2VCV A;  5J4U A;  1TRU A;  5D96 A;  4WF5 A;  3UBK A;  1SYR A;  1YKA A;  5FWG A;  1SK2 A;  1URM A;  1VF1 A;  2JZR A;  3KXO A;  3DXB A;  2WUL A;  2FWG A;  2EFH A;  3VPT A;  4TR0 A;  1K0A A;  3PPU A;  14GS A;  1ST9 A;  1T7P B;  2V1M A;  1SJZ A;  2L57 A;  1HD2 A;  5EVO A;  3GKN A;  5D93 A;  1WIK A;  3LJR A;  1WPI A;  3JCM L;  17GS A;  3D4T A;  3HCZ A;  4V1A g;  4LL1 B;  3Q18 A;  2FWE A;  3TB2 A;  2R3X A;  4BWS A;  1V57 A;  2GVP A;  4OWY A;  2GSQ A;  1XWK A;  3HY2 A;  3GSS A;  1SVM A;  3ZYW A;  1K0O A;  3SBC A;  5DJM A;  2WW1 A;  2JL4 A;  1GTU A;  2EIO A;  5IO2 A;  3NIV A;  1EP7 A;  4GST A;  1TI3 A;  4MDC A;  4KX4 A;  2QA1 A;  3VWX A;  1SD9 A;  2VM1 A;  1EGR A;  1A2M A;  2K8S A;  1OC9 A;  3A2X A;  5G1K A;  2L6D A;  1K3L A;  2YJH A;  1A0R P;  1HYU A;  1KBN A;  1WJK A;  1EEM A;  3QAV A;  3KM6 A;  2R5G A;  2MMZ A;  4KCE A;  4J56 E;  5J47 A;  3UBL A;  4MP4 A;  1V58 A;  2GQL A; 
#chains in the Genus database with same CATH homology
 3EU4 A;  2FLS A;  3MNG A;  2C0G A;  4EF0 A;  2AJQ B;  2IME A;  4ZB7 A;  1GSU A;  3GUR A;  3TDG A;  4XS6 A;  3KJY A;  2R37 A;  1AAZ A;  4IW9 A;  3DVW A;  2LRT A;  1Z9H A;  5FT3 A;  1U3A A;  3HVS A;  1BYE A;  5ABR A;  4XS4 A;  4G9H A;  4GXZ A;  4AJ7 A;  2JSZ A;  3IBH A;  1YKC A;  3LYK A;  5DDL A;  4O5R A;  3FEU A;  3KH9 A;  4TW5 A;  3FRC A;  3ERF A;  2OE1 A;  1MDK A;  1USB A;  4CHS A;  3DD3 A;  5CRE A;  3W8S A;  5AIX A;  5C04 A;  2HZF A;  1A2J A;  2PU9 C;  4XCS A;  1YF0 A;  4GCI A;  3WD6 A;  1PRX A;  4F2I A;  1K0B A;  2P5Q A;  2GDR A;  3U6V A;  5LNK e;  2H0G A;  2JAD A;  2V32 A;  4XHM A;  3DEX A;  1JLW A;  1ZGN A;  2VUP A;  3LW9 A;  4ZIJ A;  2KLX A;  5G1L A;  4DSS A;  2DJ1 A;  2CA8 A;  4ECJ A;  2CAI A;  4F0B A;  2O89 A;  2XBI A;  3EIN A;  3P8W A;  2F9S A;  1W89 A;  4IP6 A;  1QMV A;  3C73 A;  1OE7 A;  3CTG A;  4YKG A;  1TRW A;  1ZYP A;  5F05 A;  2B1K A;  4A5P A;  1PX6 A;  5A4U A;  1A24 A;  1M2A A;  2QC7 A;  2HRK B;  1XZO A;  2F8A A;  3KTB A;  3Q6O A;  4F82 A;  5HFG A;  4MZW A;  1DUG A;  3ZIJ A;  2MBS A;  4KB3 A;  1PKZ A;  2LV3 A;  4XS4 B;  3VK9 A;  1ZOF A;  2V41 A;  3ME8 A;  4QQ7 A;  3NOF A;  4EL1 A;  2C3N A;  4EO3 A;  4KAE A;  3ERG A;  2IN3 A;  3ZFL A;  2HYX A;  5KN2 A;  5CRG A;  4HEA 2;  5IQY A;  1R7H A;  3TJG A;  2LST A;  2EFD A;  5JWQ B;  2B6M A;  3QFA C;  4KW6 A;  4MJA A;  4CY8 A;  4IQ1 A;  4Q5N A;  3P7X A;  6GSS A;  3KIJ A;  4K9Z A;  4KGI A;  6GSW A;  4ULX A;  1Y6E A;  5HR2 A;  1OC3 A;  1RQM A;  3CSJ A;  1Z7P A;  3IV4 A;  3IC8 A;  4DSS B;  5DQS A;  5DCH A;  3RHC A;  4FYB A;  4TXO A;  4I6X A;  1ML6 A;  2YV7 A;  4OO5 A;  1EP8 A;  2X8C A;  1PD2 1;  3FKF A;  3L9V A;  1PA3 A;  2CZ3 A;  3ZZX A;  2OA7 A;  1JZW A;  1MD3 A;  4KF9 A;  1ERU A;  2HZE A;  4MH2 A;  1B4P A;  2X4A A;  3FW2 A;  3D0Z A;  5ELG A;  2FD3 A;  2NVL A;  2C0E A;  1A8L A;  1WRY A;  4CY6 A;  1G7O A;  4LL4 B;  3CRT A;  3F4R A;  4FYC A;  1EV9 A;  2DSA A;  5F06 A;  4TR3 A;  3IHQ A;  2DJJ A;  1BG1 A;  2H75 A;  1BG5 A;  2CT6 A;  4PTS A;  5KOX A;  4KDY A;  5ECM B;  3ME7 A;  1ACV A;  3HHV A;  4OFN A;  2YN1 A;  5GZZ B;  2DKH A;  2HSY A;  1YEP A;  2YP6 A;  1O73 A;  2GST A;  2EIR A;  5D8I A;  2H0H A;  2HI7 A;  3VWV A;  3GNJ A;  5IO0 A;  3UJ1 A;  2JAC A;  2V2G A;  4ISD A;  3F8U A;  1THO A;  3QMX A;  4G0K A;  3GRX A;  1J08 A;  3VWW A;  6GSY A;  4AF2 A;  1XVQ A;  1JHB A;  3ZTL A;  5DCG A;  3E0U A;  4NV5 A;  5CRW A;  3GX0 A;  2YWI A;  2GQK A;  2HLS A;  2YV9 A;  16GS A;  4IHU A;  1GNE A;  1QGV A;  1THX A;  1YEX A;  1UA5 A;  2RLI A;  4XRD A;  4JED A;  2HZE B;  1FW1 A;  3MDK A;  2HSN A;  3ERW A;  1XW6 A;  4WXT A;  3BCI A;  1T8E B;  3ZL5 A;  4HOJ A;  2WB9 A;  1TI1 A;  3IAM 2;  2HSM A;  5ECR B;  3GV1 A;  1PN0 A;  5BMU A;  2F3M A;  1GRX A;  1JFU A;  4ILF A;  4J57 E;  3RPN A;  3C8E A;  4PNG A;  1WOU A;  4IKH A;  2H70 A;  3G9B A;  3IR4 A;  4MPG A;  4V2N A;  2V6O A;  4ZL7 A;  7GSS A;  3ED3 A;  1A8Y A;  3QCP A;  3I69 A;  2KHP A;  5IOX A;  5IM9 A;  1PQN A;  4O92 A;  1JZR A;  6GSV A;  1XW9 A;  4D73 A;  4ZB9 A;  4GLT A;  4IJI A;  1XFL A;  1J0F A;  3F4T A;  2A4V A;  2DJ0 A;  2H8L A;  4ZB6 A;  2CAQ A;  2CZ2 A;  3TGZ A;  3TJB A;  2PGT A;  3DGQ A;  1QQ2 A;  2CVK A;  3GHA A;  1F37 A;  1B4Q A;  1SEN A;  3H79 A;  2WDU A;  1GL8 A;  2VD0 A;  4Z2T A;  3A2W A;  1VF4 A;  3APS A;  5B8B A;  2PMT A;  3PIN A;  1FO5 A;  12GS A;  3A2V A;  2M80 A;  3UMA A;  2MZC A;  2MYG A;  4K6X A;  4NAX A;  4K2X A;  2IPA A;  2HSM B;  3TOU A;  2NDO A;  4PNF A;  4NPB A;  4HZ2 A;  5G5E A;  1N25 A;  5BMU B;  5E59 A;  3LOR A;  4EKZ A;  1GLQ A;  5ECS A;  1G6W A;  2YJ7 A;  5A1N A;  3EWL A;  5A4W A;  1GUM A;  2H73 A;  5A4V A;  1AQX A;  2Z9S A;  5J41 A;  3WYW A;  2C1Y A;  4G19 A;  2DLX A;  2C4J A;  2VL2 C;  1M2D A;  1FB6 A;  4D73 B;  2CVB A;  4K7I A;  1ERV A;  1GUK A;  1O6J A;  2ON7 A;  1M0U A;  3FHK A;  2HE3 A;  3LQ7 A;  3GH9 A;  1X9M B;  5DAK A;  1Z6N A;  3KCM A;  5F0G A;  2NTO A;  3MIX A;  2FWH A;  3DKS A;  2C3T A;  2GZP A;  3F4S A;  3WGE A;  3LGC A;  4GDF A;  1H75 A;  4EDZ A;  3IA1 A;  2ALB A;  3TOT A;  1LBK A;  5IMC A;  1HNA A;  1ZZY A;  1R5P A;  18GS A;  5JWR B;  4EIP A;  2V6K A;  4IVF A;  3O6T A;  3US3 A;  4Z2R A;  5GSS A;  5H5Q A;  1MTC A;  4N30 A;  1BAY A;  3APO A;  4F03 A;  2LRC A;  3KZQ A;  5J9C A;  6GST A;  3LEF A;  1OAZ A;  3LXZ A;  5A1N B;  2VIM A;  2GT5 A;  3R2Q A;  2B5E A;  4BVX B;  3D22 A;  1Z7R A;  8GSS A;  2H74 A;  19GS A;  1FHE A;  5DAL A;  2FUG 2;  4BL7 A;  3GYK A;  3U5R E;  1V98 A;  2F51 A;  4OO4 A;  5EY6 A;  3GL5 A;  1O8W A;  4KND A;  2YNX A;  3CSI A;  5J5N A;  4J2F A;  2QSI A;  5DAK B;  1OE8 A;  3C7M A;  2BTO T;  2O87 A;  2HFD A;  4OCE A;  5F07 A;  3QDN A;  1G7E A;  1MD4 A;  4K2D A;  5AGY A;  4JBB A;  3HYP A;  4PUA A;  4PUF C;  4N10 A;  3N9J A;  1M9B A;  4I2T A;  1LU4 A;  5ID2 A;  4MJC A;  4ZBA A;  2X64 A;  3ZIV A;  4HQZ A;  2VAF A;  1SKW B;  4HQS A;  2VO4 A;  4MPF A;  2VD1 A;  1AXD A;  2LKU A;  5J4V A;  2LNS A;  1S3A A;  3CTF A;  4K7O A;  3K8N A;  1BJX A;  3M3M A;  5FHI A;  3L9U A;  5ECN B;  1F6M C;  2GT6 A;  3C71 A;  2E7P A;  5IMZ A;  4KDX A;  2RM6 A;  3UEM A;  3IRA A;  20GS A;  4BVY A;  2E0Q A;  4I5Q A;  5CO3 A;  1TU8 A;  3IK9 A;  4EDY A;  2PER A;  4MK3 A;  2VLT A;  3W8J A;  4AKG A;  5DAL B;  2NBS A;  4BL7 B;  3ZML A;  3G7J A;  22GS A;  1BX9 A;  1ZYE A;  2I3Y A;  1O81 A;  4KDU A;  3IPZ A;  4XS1 A;  4LA1 A;  1EOH A;  1U6T A;  1YVL A;  4O5Q A;  1OC9 B;  3HDC A;  3KP8 A;  4GRF A;  1HQO A;  4E68 A;  2X49 A;  1TW9 A;  2QKE A;  3HD5 A;  2HQT A;  2VCX A;  4O7H A;  1X0R A;  3OR5 A;  2H1D A;  3F3R A;  4YQU A;  1PN9 A;  1LJR A;  1MDI A;  3RDW A;  5ID2 B;  5D9V A;  5KOW A;  4POM A;  5COH A;  5L71 A;  3EE2 A;  2OJL A;  2CQ9 A;  1VGL A;  2WCI A;  4ML6 A;  3L9S A;  1F3B A;  4AKH A;  3LWA A;  2HXK A;  2YCD A;  4HUA A;  2OBI A;  1U88 A;  2O8V B;  3EVI A;  4I8B A;  2I9H A;  4IGJ A;  4YAV A;  3HVX A;  2P0G A;  3TU3 B;  4IP1 A;  3KH7 A;  3TRQ A;  1UN2 A;  2GTU A;  4JZQ A;  3ZMK A;  4BVY B;  1XWB A;  3C1S A;  4ZB8 A;  5IPH A;  3GL3 A;  1GUH A;  2E2M A;  5CRD A;  2LQQ A;  2FNO A;  1BQ7 A;  5JWO B;  2I81 A;  2VCZ A;  4IS0 A;  4QMK A;  2OBK A;  4X4J A;  1PGT A;  4L8E A;  5D9X A;  4K1F A;  1PL1 A;  13GS A;  3RHB A;  3DYR A;  1V40 A;  1TTZ A;  2IWT A;  3TKS E;  4POK A;  3R3E A;  1RW1 A;  4XTS A;  2WFC A;  4NWY A;  4TKY A;  1ZL9 A;  5EL8 A;  2VKZ G;  4PQH A;  2A2S A;  3QAG A;  2P5R A;  3UAP A;  4E8H A;  5ENU A;  2A2R A;  3VI7 A;  2DBC A;  1GSY A;  4ACS A;  4DEJ A;  1T00 A;  3TKS A;  9GSS A;  1NHY A;  1EOG A;  3I43 A;  3AY8 A;  4RI7 A;  1FG4 A;  2EC4 A;  2A2P A;  4N11 A;  3KTL A;  2IFQ A;  4MLY A;  1GSE A;  4HZ4 A;  5IMA A;  5KN1 A;  1XWC A;  1X5D A;  2PVQ A;  1E2Y A;  3D4M A;  2QGV A;  5J9B A;  2OAD A;  1SYX A;  3FR9 A;  4QL7 A;  4TN8 A;  1GTI A;  4MH3 A;  2H01 A;  1EV4 A;  1OYJ A;  4KSO A;  4RUV A;  4YH2 A;  2JZS A;  5G5F A;  3MSZ A;  2I1U A;  4W66 A;  2DMM A;  2KOK A;  3I6A A;  1VRS D;  2MMN A;  1T3B A;  5BRT A;  1PKW A;  3HXS A;  2VL9 A;  2F8F A;  4GQC A;  4ECB A;  5DJL A;  3J7Y k;  3LG6 A;  1T1V A;  2FWF A;  2ZCT A;  4TOP A;  2H6X A;  1SJ6 A;  1SD8 A;  3TJJ A;  4WBJ A;  4WBR D;  2WGR A;  4POL A;  3H4K A;  1SK0 A;  2N5A A;  2PVO C;  5CAX A;  1I5G A;  3FMW A;  2WZ9 A;  2H6Z A;  1AC1 A;  1GWC A;  1XBS A;  3BJ5 A;  3G7Y A;  2PPT A;  1PX7 A;  4IEL A;  4TXO B;  5IMV A;  5D73 A;  3RBT A;  5B6N A;  2GZY A;  3VLN A;  2WJU A;  2LQO A;  2CVD A;  4FYU A;  4OFM A;  2ZNM A;  4USS A;  2L6C A;  6GSX A;  4Q5F A;  4EVM A;  1XIY A;  2IFQ B;  3F0I A;  1EGO A;  4K7N A;  3IC4 A;  3WGD A;  3GMF A;  5AN1 A;  2R0P A;  4RQX A;  2GGT A;  2AHE A;  4MCU A;  2PN8 A;  3F6F A;  4WR4 A;  4FIW A;  4JE1 A;  1NW2 A;  2IIY A;  3CYN A;  4K5S A;  2CX3 A;  1KEB A;  2X8H A;  1TKD B;  1TXU A;  2GS3 A;  2H1L A;  3D21 A;  5HQP A;  4V2M A;  2YWO A;  2FA8 A;  1Q98 A;  2CX4 A;  2HRN A;  3NZN A;  4G10 A;  3H8Q A;  4L5O A;  5G30 A;  3I9V 2;  3MAK A;  4RI6 A;  5ECH B;  2B5Y A;  4EIQ A;  2BMX A;  4MA9 A;  1X9W B;  1XPV A;  4Q5Q A;  2IMI A;  3FZ4 A;  3CMI A;  4BWQ A;  3ZVJ A;  1WWJ A;  4AKX B;  4GQF A;  2L59 A;  1PSQ A;  3WT2 A;  3E3E A;  1QFN A;  4WKW A;  2G0F A;  4GSN A;  4HU9 A;  2WS2 A;  2LUS A;  4F9Z A;  1AQW A;  4N0V A;  4OD7 A;  1TK5 B;  1PMT A;  4AKI A;  4BA7 A;  3TCO A;  3DIE A;  1B8X A;  2IMK A;  4HU7 A;  2H30 A;  4NV2 A;  1KNG A;  4NMU A;  2HSN B;  5J4Y A;  1XWG A;  5B7C A;  2YWN A;  3QOU A;  1S3D A;  5AIS A;  2PBJ A;  1GP1 A;  2HT9 A;  2K9F A;  4V2L A;  3GIX A;  2HRF A;  2VCW A;  2CV4 A;  3VPQ A;  3KD0 A;  5EPF A;  3DML A;  1SL1 B;  1X5E A;  4O5U A;  2VOC A;  4N0Z A;  2N5B A;  5IOW A;  4ECC A;  1AUC A;  1FVJ A;  3TUE A;  3FR3 A;  2RII A;  1YQ1 A;  1NSW A;  2O85 A;  4NHW A;  4EXJ A;  5GAN D;  4PX1 A;  2UV8 G;  4PXO A;  2B7J A;  1UC7 A;  4ID0 A;  4G01 A;  2DIZ A;  2VCQ A;  2DC5 A;  3UL3 A;  1WMJ A;  2DJ3 A;  4GTU A;  3DRN A;  3RPP A;  4FH8 A;  2OE0 A;  3FYG A;  2H1B A;  2RUE A;  4ZBD A;  5ELA A;  2R4V A;  2GQM A;  1R26 A;  5KN3 A;  2FA4 A;  1ZYQ B;  3GX8 A;  4TR1 A;  3FY7 A;  1AIU A;  5E4W A;  3IHG A;  3E9J B;  2C8U A;  2EFC A;  4PUR A;  4TR4 A;  4IJ3 A;  2J9H A;  4JRR A;  1WP0 A;  5D9W A;  4EUY A;  5ECL B;  4ML1 A;  3UAR A;  2B5X A;  2C0F A;  2AB6 A;  2XBQ A;  2FY6 A;  4IQA A;  3H1N A;  1XWA A;  3ZVJ D;  4K8M A;  5HR0 A;  2LJR A;  3S9F A;  4IN0 A;  2QA2 A;  3EUR A;  5H5R A;  1VF2 A;  5A5K A;  4ZBB A;  1IYI A;  4YQM A;  5ECO B;  4POB A;  3FR6 A;  2M46 A;  2R0C A;  4Z2U A;  3EMX A;  4IBP A;  2DKI A;  4E8E A;  3V1W A;  2EIQ A;  2K8V A;  1C72 A;  3ZLP A;  4KCA A;  3O3T A;  4NXI A;  1GSQ A;  4LLR A;  4KA0 A;  4QL9 A;  3HVV A;  4KH7 A;  1KTE A;  1DE2 A;  1GLP A;  3GST A;  2OKA A;  3GA4 A;  3M9J A;  4LMW A;  2AV4 A;  4OCF A;  1F3A A;  4K5R A;  2P31 A;  1OVN A;  2C3Q A;  1W4V A;  3QAW A;  1SU9 A;  1SKS B;  3D5J A;  2HNL A;  2DJK A;  3KP9 A;  3BD2 A;  5HR3 A;  1Y25 A;  1U87 A;  1YY7 A;  1Q4J A;  2ON5 A;  3TKS C;  5DVB A;  2AUV A;  3HJM A;  5CNW A;  4TR1 B;  2EFE A;  3TKQ A;  3A3T A;  3FK8 A;  2N5F A;  2FGX A;  2IMD A;  1M99 A;  1YJ6 A;  1QUW A;  1Y1U A;  3FZA A;  4X1U A;  5A34 A;  4EE0 A;  4KE3 A;  3F9U A;  11GS A;  1N2A A;  3EU3 A;  4JR4 A;  4L0U A;  2O7K A;  1YDK A;  2X99 A;  2DIY A;  4PQI A;  4TVE A;  1HNB A;  2K6V A;  3IOS A;  3TJF A;  4AGS A;  3GH6 A;  5INY A;  2H6Y A;  1F2E A;  2OE3 A;  2LEG A;  3VFI A;  3GKK A;  4HS1 A;  3GTU A;  4X43 A;  1G0T A;  1FOH A;  4TXV A;  2ES7 A;  1SVO A;  1QXH A;  3GKM A;  3BCK A;  2HRK A;  4K0G A;  1DBY A;  3N5O A;  1B9Y C;  5ECQ B;  3PH9 A;  4RQR A;  1E6B A;  1O85 A;  1FVK A;  2H71 A;  2LTK A;  4ZL9 A;  1ERW A;  4WET A;  2VL3 A;  4ECI A;  4HDE A;  2WRT A;  3HJO A;  2G2Q A;  2H1G A;  1WE0 A;  1TDI A;  1NM3 A;  1M9A A;  5IMD A;  4MMM A;  1A0F A;  2LNT A;  2IJY A;  2VM2 A;  1J9B A;  3C1R A;  3CXG A;  4JU5 A;  2VL2 A;  2LJK A;  2J23 A;  3TKR A;  1G6Y A;  3BOA A;  1YZX A;  2TRC P;  2UZ8 A;  1DSB A;  2KP1 A;  4ZXG A;  3A5I A;  5A34 B;  3KMN A;  1H4O A;  4MF5 A;  2PWJ A;  1XXU A;  4WR5 A;  2H0I A;  3UOM A;  2BJX A;  1XVW A;  4MF7 A;  3P2A A;  3ZRE A;  2MMA A;  1JZD A;  4NHZ A;  2YAN A;  3UIW A;  2KP2 A;  2LS5 A;  2R2J A;  3GTU B;  2AAW A;  3HA9 A;  4H86 A;  1GTB A;  5A5H A;  2VLU A;  3EYT A;  1F9M A;  3MYD A;  2RUF A;  3RAZ A;  4I2U A;  3PGT A;  4Z7X A;  5ECP B;  4AJ8 A;  3TRX A;  4K0N A;  4HJM A;  1EWX A;  2IMF A;  3LYP A;  4MNN A;  4GWR A;  1TU7 A;  5F8B A;  4Q5R A;  2TIR A;  1TRS A;  1M7T A;  4KUN A;  3HKR A;  4MZB A;  3IAS 2;  4CDO A;  2RM5 A;  1ERT A;  2GZZ A;  5B8A A;  2VLV A;  4CW9 A;  4OFT A;  4X0X A;  2JSY A;  2PUK C;  3HZ4 A;  5D9T A;  3WT1 A;  3SWL A;  3FZ9 A;  1TXX A;  2DJ2 A;  2E2G A;  3ISO A;  2R6K A;  3P90 A;  5IPG A;  2K18 A;  2I4A A;  5ECI B;  3KEB A;  5IIZ A;  3D6I A;  1SJI A;  4N3Z A;  1B9X C;  1VF3 A;  2TRX A;  3LSZ A;  4ZIL A;  3GKX A;  10GS A;  1K0D A;  2FCH A;  4G2E A;  3ZFB A;  3TJK A;  2IL3 A;  1Z6M A;  2ZUP A;  3QD9 A;  5HFK A;  1R5A A;  1GSF A;  1ABA A;  5A5H B;  1Z5Y E;  2H66 A;  1RK4 A;  2GSS A;  1R4W A;  2M72 A;  3QR6 A;  1ZYN A;  1GTA A;  3EC3 A;  1XCC A;  3H93 A;  2VCT A;  4YQV A;  2MBT A;  4ICY A;  4FO5 A;  4DSR A;  4KSM A;  1TJD A;  4YAP A;  1ON4 A;  1K3O A;  3F6D A;  2HRA A;  3UVT A;  1XOA A;  4F0C A;  2B3S A;  4WF4 A;  2XPD A;  1S3C A;  1BF5 A;  1SL0 B;  2H19 A;  2JU5 A;  2A4H A;  1A23 A;  3G7I A;  5GST A;  2MMO A;  2YZU A;  1TP9 A;  1GSD A;  4EC0 A;  3PR8 A;  1BED A;  2YWM A;  3Q19 A;  1K0M A;  1TOF A;  4XIH A;  3L0H A;  5H5S A;  2L4Q A;  2LJA A;  3F3Q A;  3WGX A;  3KMO A;  3CBU A;  3M1G A;  3IE3 A;  2GSR A;  3L78 A;  2L5L A;  5CRH A;  2D2Z A;  4V1A p;  3VI5 A;  2B7K A;  2X8G A;  5JCU A;  1ILO A;  2OAC A;  1GH2 A;  4HJ2 A;  4PQ1 A;  4JR6 A;  4AJ6 A;  4TRX A;  5C00 A;  4O32 A;  3IXR A;  2HSH A;  1JZO A;  2DML A;  1O7U A;  3LFL A;  3EMP A;  4MZC A;  3ZRD A;  5GAP D;  1TK0 B;  4GSS A;  3UVH A;  1M2B A;  4FQU A;  3HMJ G;  2AYT A;  1N8J A;  2XPE A;  4I97 A;  3DVX A;  3L4N A;  3O76 A;  1V9W A;  3DWV A;  1TK8 B;  1FAA A;  1T4Z A;  1XW5 A;  2REM A;  3TRP A;  3FZ5 A;  5ECK B;  1AW9 A;  1JLV A;  1OKD A;  4AI6 A;  1K3Y A;  3M0F A;  5G31 A;  4OMV A;  1X9S B;  3BBY A;  1NHO A;  4MJB A;  2YPM A;  4P3Y B;  2L5O A;  3F63 A;  5JCW A;  1B48 A;  1FB0 A;  1XOB A;  1UVZ A;  2OT3 A;  2H1A A;  5LCZ A;  2YOI A;  3CWG A;  1X5C A;  1EZK A;  5DQY A;  2XHF A;  3ZIT A;  1PL2 A;  3Q74 A;  1OKT A;  3APQ A;  4DSQ A;  2R0G A;  5J40 A;  5HFI A;  4L0W A;  3J7Y b;  5CP1 A;  2C0D A;  5B6M A;  1U3I A;  3VWU A;  2B1L A;  2GLR A;  5JCG A;  1O8X A;  1DE1 A;  1GNW A;  1V2A A;  3CSH A;  2O5V A;  2LRN A;  1MDJ A;  5KEJ A;  3GUS A;  4ZL8 A;  1CQG A;  5LD0 A;  3IDV A;  1ZCP A;  3IK7 A;  3CRU A;  2XC2 A;  3QPM A;  1EEJ A;  1FOV A;  4HI7 A;  1K0N A;  1MEK A;  4GF0 A;  3M9K A;  3GN3 A;  1HNC A;  3GFK A;  3LXT A;  4PGT A;  3MWH A;  4YKF A;  1AQV A;  4BVX A;  1SVL A;  1SKR B;  4G0L A;  1GUL A;  4WEY A;  4DVC A;  3KGK A;  5IMF A;  1CQH A;  2L4C A;  3EPT A;  6GSU A;  1TRV A;  2JZT A;  5KN0 A;  1YF1 A;  4MF6 A;  3VUR A;  1I9D A;  1K0C A;  3A5W A;  1SK1 A;  2C80 A;  5CYY A;  3TKP A;  3M8N A;  2NPB A;  5G2Z A;  3HZ8 A;  1QK8 A;  1OC8 A;  4MJE A;  4LMV A;  3QFB C;  1A2L A;  5HR1 A;  3W6G A;  1ZMA A;  1T4Y A;  4XRA A;  4MAB A;  2H76 A;  5J3R A;  4BPY A;  2FHE A;  5AIV A;  1SL2 B;  1Z3E A;  1IYH A;  2H72 A;  4L5L A;  5DBQ A;  2KUC A;  3HJP A;  2YZH A;  4G0I A;  1GSS A;  2VCV A;  5J4U A;  1TRU A;  5D96 A;  4WF5 A;  3UBK A;  1SYR A;  1YKA A;  5FWG A;  1SK2 A;  1URM A;  1VF1 A;  2JZR A;  3KXO A;  3DXB A;  2WUL A;  2FWG A;  2EFH A;  3VPT A;  4TR0 A;  1K0A A;  3PPU A;  14GS A;  1ST9 A;  1T7P B;  2V1M A;  1SJZ A;  2L57 A;  1HD2 A;  5EVO A;  3GKN A;  5D93 A;  1WIK A;  3LJR A;  1WPI A;  3JCM L;  17GS A;  3D4T A;  3HCZ A;  4V1A g;  4LL1 B;  3Q18 A;  2FWE A;  3TB2 A;  2R3X A;  4BWS A;  1V57 A;  2GVP A;  4OWY A;  2GSQ A;  1XWK A;  3HY2 A;  3GSS A;  1SVM A;  3ZYW A;  1K0O A;  3SBC A;  5DJM A;  2JL4 A;  1GTU A;  2EIO A;  5IO2 A;  3NIV A;  1EP7 A;  4GST A;  1TI3 A;  4MDC A;  4KX4 A;  2QA1 A;  3VWX A;  1SD9 A;  2VM1 A;  1EGR A;  1A2M A;  2K8S A;  1OC9 A;  3A2X A;  5G1K A;  2L6D A;  1K3L A;  2YJH A;  1A0R P;  1HYU A;  1KBN A;  1WJK A;  1EEM A;  3QAV A;  3KM6 A;  2R5G A;  2MMZ A;  4KCE A;  4J56 E;  5J47 A;  3UBL A;  4MP4 A;  1V58 A;  2GQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...