4MP4A

Crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
212
structure length
198
Chain Sequence
b'EYFKLYTDSQFLSPYAFTVFVGLHEKQIPFEIAAIDLLTAKVPVLEHNDFALSESSAILEYLEELYPDTAIYPKDIQARARARQIQAWLRSDLVALRTERPTDVIFIQPKSTPLSEEGKKAAEKLFFVAEKLLASDAEFLFGSWSIVDAELALMLQRLIQNGDAVSERLKNYALQQWQRPSVQKWLALRHKAENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystal structure of a glutathione transferase family member from Acinetobacter baumannii, Target EFI-501785, apo structure
rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
total genus 69
structure length 198
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mp4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mp4A01
2VL3A 2FD3A 2O87A 4N0ZA 2LJAA 5HR1A 4G10A 2LJRA 1X9MB 5DAKB 3L9VA 1EV9A 1XZOA 2GZYA 1N8JA 3KMOA 3NZNA 2DJ0A 3I43A 4MH3A 2VUPA 4KGIA 5D8IA 3H4KA 1K3OA 4OO4A 3CTFA 2FWHA 4OCFA 2MMOA 5G1KA 2K18A 1OKDA 3GNJA 2CVDA 1WMJA 3UBLA 2E2GA 5LNKe 4KAEA 4Q5FA 2X99A 2CAQA 1QMVA 1XWAA 4I2UA 3FKFA 4PURA 4K1FA 2YWMA 3QD9A 2A4VA 1A8LA 1GTUA 4D73A 1TDIA 4MK3A 1ZOFA 1M7TA 2YPMA 1URMA 4KDYA 4ZBAA 3GN3A 3QPMA 5J5NA 4YQVA 1EEJA 1JZDA 1GNEA 2AUVA 2FHEA 2K9FA 4WETA 2DSAA 3HD5A 3UVTA 5CYYA 4GQFA 3IPZA 1TK8B 1H75A 1AQVA 1FHEA 2R37A 3KH7A 1YEXA 3W8SA 4LMVA 5LD0A 2KOKA 1FW1A 1XBSA 4YAVA 4ML6A 4V1Ap 4EC0A 5A4WA 1KEBA 3P8WA 3ZIVA 5F07A 4TR4A 5G5FA 4OMVA 2HE3A 3GRXA 2NBSA 3A2VA 3UEMA 20GSA 6GSYA 2QKEA 3CRUA 2RM6A 6GSWA 2WDUA 3D4TA 2B1LA 4IP6A 2KP1A 5CRDA 1CQGA 1G6WA 2C4JA 1GTIA 1SK1A 2IMIA 1V98A 4KSMA 2JU5A 2CV4A 2KUCA 3FR6A 5EPFA 2VLVA 2XPDA 5ECMB 3KMNA 4I97A 1R4WA 2JADA 4HQZA 1LJRA 3GKMA 10GSA 3IA1A 4TXOB 2LEGA 2DLXA 4NHZA 4F0BA 4RI6A 2O8VB 2TIRA 4L5OA 2PWJA 3IV4A 5FWGA 3HJMA 1Z9HA 4OFMA 2HSNB 1FO5A 3GKNA 2K8SA 4FIWA 4MJBA 6GSUA 2YJ7A 1KNGA 5IM9A 5JCGA 3VWUA 2GVPA 3GKXA 2H1AA 3O3TA 1X9SB 4TN8A 1LBKA 1TRWA 2VL2C 14GSA 1TJDA 5A4VA 4LLRA 5DQYA 2IN3A 2QSIA 5CREA 3N9JA 1DBYA 1V40A 3UIWA 1E6BA 4V2MA 2DJ1A 1U6TA 4LL1B 5HQPA 3VPTA 2GQLA 2H73A 5ABRA 2GT5A 4OD7A 5KN2A 3TKSC 3EMXA 4TKYA 1WRYA 1XXUA 2ON5A 4AJ6A 4IS0A 2X8HA 3L0HA 1A0RP 2H1DA 3KGKA 2H75A 2L57A 2C80A 2XBQA 4QL7A 3TJKA 3SBCA 4O7HA 2PN8A 1ON4A 2MMZA 2C1YA 3F6FA 1XWCA 5GSSA 5J41A 3H93A 5KN1A 1EP8A 1U3IA 2XC2A 1ZCPA 1FB6A 1I9DA 2HZEA 4MJCA 1T00A 2GGTA 2VCZA 1A23A 5IMFA 4MA9A 4P3YB 3U6VA 4YAPA 1J9BA 2IMEA 3IC8A 3M9KA 5E4WA 3M0FA 4WKWA 3M1GA 1GLPA 4DVCA 5KN3A 1TKDB 2VD0A 3P90A 2RLIA 3UOMA 2Z9SA 4QQ7A 1SYXA 2LQQA 5ID2A 2GLRA 3GTUB 3ME8A 1T4YA 3DGQA 4LL4B 5CRWA 2V6KA 1TTZA 2NDOA 2GT6A 3HDCA 3VI5A 3RDWA 1SENA 2IMDA 2YN1A 2LQOA 4OO5A 2H74A 5A4UA 4F2IA 4L8EA 4MLYA 1RK4A 3MNGA 2D2ZA 3V1WA 1T3BA 1VF2A 1SKSB 1O6JA 1MEKA 3EURA 4Q5RA 4KB3A 3HY2A 1CQHA 3VWWA 3KTBA 4MPGA 2AB6A 5G1LA 3QFAC 4O32A 3A2WA 4E8HA 5DVBA 3F63A 2CT6A 5IO2A 1UVZA 3NIVA 2EIQA 5KEJA 2HT9A 1EP7A 4G0IA 3GL5A 2B6MA 1OYJA 1GSEA 1B4QA 1PL2A 3F6DA 4ZILA 4JE1A 4JRRA 5D9WA 4G2EA 3DEXA 3IXRA 3A3TA 4KF9A 1WIKA 3TKQA 1QUWA 3FHKA 1LU4A 5BMUA 4EDZA 1BG5A 1NW2A 1V2AA 1J08A 4WF5A 3GKKA 4OFNA 4IBPA 2WFCA 3LXZA 4FH8A 4KX4A 2RM5A 4NAXA 1WE0A 2ES7A 2A2SA 2FGXA 3O6TA 3H8QA 1QQ2A 2EC4A 5J9CA 3HA9A 2YWOA 1DUGA 4G19A 1NHOA 3IE3A 2J9HA 3L9SA 2LRCA 1SJIA 1DE1A 2LUSA 1Y6EA 3GL3A 1ZYQB 4K7IA 3IRAA 3MSZA 2IMKA 2HYXA 5ECIB 3UARA 2QGVA 2OACA 2EIRA 1XIYA 1K0MA 3QR6A 5G31A 4D73B 2MMNA 1O81A 5DBQA 2FNOA 4ZXGA 2R4VA 4ZBDA 2PMTA 4NMUA 5HR3A 4AGSA 1OC9A 2DMMA 3VWXA 2F51A 5IQYA 1OE8A 4RI7A 3GYKA 7GSSA 2H30A 1JLVA 1T7PB 1Z7RA 18GSA 2VLUA 2N5AA 4IHUA 3OR5A 1TU7A 1T8EB 2C3TA 1K0DA 3F4RA 2JZRA 3CBUA 4RQRA 2K6VA 1MTCA 1ZMAA 4MABA 2P5QA 1SJ6A 1GWCA 4FYBA 5G30A 2HXKA 1AIUA 2HFDA 1G0TA 4YQUA 1GSSA 5HFIA 3F4SA 1SD9A 2HSMA 1EZKA 2IL3A 4ZIJA 1KBNA 1THOA 4POMA 1TOFA 2WCIA 1BX9A 1GSUA 2H70A 4TR1B 3APSA 2F3MA 3F9UA 1DE2A 4BA7A 2F8FA 4KSOA 2CVKA 5IMDA 3UAPA 5H5SA 2P5RA 2V41A 2LNTA 3CMIA 3HKRA 1A2JA 1WWJA 2PPTA 5JCWA 1G6YA 3FYGA 1GUMA 3TCOA 1NHYA 4MJAA 4Q5QA 3EC3A 2GDRA 1JLWA 2CX4A 4ILFA 2VCXA 1GLQA 1B9YC 5ECPB 4BVXA 1MD3A 1O85A 5DQSA 4GLTA 3LJRA 1XOAA 3G7YA 3RPNA 2RUEA 4HUAA 4IQAA 1GUKA 2H1BA 1FB0A 4JZQA 3DVXA 4N11A 2OE1A 1HNAA 1Q4JA 4QL9A 1S3CA 2YP6A 5JWQB 5CNWA 4NV2A 5J3RA 2UZ8A 1TRSA 4DSSB 1ST9A 3VI7A 3Q74A 1VRSD 4MJEA 4MP4A 3IBHA 1UA5A 2WS2A 1Z3EA 1PX7A 3HXSA 2N5BA 1PN9A 4O92A 1ZZYA 4GWRA 1VF3A 3ME7A 2HRAA 3HVXA 5CAXA 1QFNA 4ECJA 1YQ1A 3F8UA 5D9VA 4KCEA 2P31A 2BMXA 4HU7A 4J56E 4EXJA 5GZZB 1ACVA 1F2EA 3EWLA 2FWGA 2KP2A 5ELAA 3SWLA 3QAVA 4XCSA 1K0OA 1JZOA 1TW9A 2YCDA 4BVYB 3FZ9A 2GS3A 2AYTA 1SK0A 5ECSA 4MDCA 2JSZA 3GX8A 1U87A 3PINA 2CAIA 4GSTA 3APOA 3L9UA 3KXOA 4ZB9A 2IJYA 4L0UA 4CHSA 1SL0B 2HZEB 3C8EA 3MDKA 4KNDA 3UVHA 2PGTA 4TR3A 3IK9A 1SD8A 5GSTA 1VGLA 3J7Yk 5D9XA 5J9BA 1A0FA 2CZ2A 4TR1A 3I6AA 5IOXA 4GTUA 2HI7A 3TRXA 1PRXA 1QXHA 2H76A 1EV4A 3KJYA 5AGYA 2VLTA 2VL2A 3ZRDA 4F82A 3DXBA 3IK7A 3PH9A 3D22A 4BWQA 5IPGA 3F3RA 2MYGA 5ID2B 4XS4A 4MZCA 5HR0A 1K0BA 4V2LA 5C04A 2ON7A 2WB9A 3GX0A 4LA1A 2J23A 2H1GA 4ULXA 3TKSA 1X9WB 2VO4A 4IJIA 3ZFLA 2HZFA 2O7KA 4BPYA 3TRPA 1GNWA 4BL7A 1T4ZA 1GH2A 2JACA 3ZMLA 5J4UA 1XWBA 2FWEA 4RQXA 4DSSA 4X1UA 1ABAA 2R6KA 2IWTA 2L59A 1IYIA 3DMLA 2X8CA 2C0DA 2GQMA 5B7CA 2WZ9A 5COHA 4I6XA 1M2BA 2H8LA 5GAND 1AAZA 2IIYA 2H0IA 1AUCA 2QC7A 5CRGA 3FY7A 4OWYA 4HZ4A 3IC4A 1SL2B 2LRTA 1PQNA 2VIMA 4MZWA 1BYEA 2N5FA 2M80A 4ZL9A 1X0RA 1J0FA 2V32A 4XS1A 2GSRA 3Q19A 4ECCA 3LWAA 2I1UA 2TRXA 4KUNA 3CSJA 1N2AA 4I5QA 3D0ZA 1OKTA 4BVYA 2BJXA 2VD1A 1HNCA 1Z5YE 2HRNA 2KHPA 2KLXA 3I9V2 1PGTA 1Z6MA 4POLA 2PU9C 4FYCA 5C00A 5FT3A 2FY6A 3LYPA 4EL1A 1A8YA 13GSA 2IMFA 2GQKA 4FO5A 5F8BA 2GSTA 1YEPA 3GSTA 2C0FA 4YQMA 4I2TA 5CO3A 4PQ1A 4L0WA 4K8MA 4O5RA 1ZGNA 4HU9A 2YZUA 3VK9A 1TU8A 1JZRA 3E9JB 3GSSA 1OC9B 3UBKA 2OE0A 1YF1A 3HVSA 2VCWA 4LMWA 5B8AA 4HJMA 3WYWA 1OC8A 3TKSE 1FG4A 5ECOB 1M9AA 1V57A 4POBA 5H5QA 5B6MA 4F0CA 3TKRA 3KH9A 3GMFA 3C1RA 4TXVA 2R5GA 1EGOA 3IHQA 2EIOA 2JZSA 3WT1A 1ZYEA 1M9BA 5H5RA 1Z7PA 3GIXA 2HSMB 2MZCA 1BAYA 4V2NA 1B9XC 2I4AA 4JBBA 2O85A 5HR2A 2V1MA 3BCKA 3BCIA 4WR5A 2H72A 2LS5A 1O73A 3HVVA 4KH7A 2DIZA 3ZITA 1VF4A 5DJLA 1ERVA 5G2ZA 11GSA 2RUFA 3GHAA 4H86A 5ENUA 3HCZA 1BJXA 5IIZA 3VWVA 1RW1A 5INYA 4V1Ag 1QK8A 5AISA 5JWRB 3GFKA 22GSA 1BQ7A 5FHIA 2FCHA 3E3EA 4BVXB 2LKUA 1OC3A 4OCEA 5IOWA 2FWFA 1B4PA 1SL1B 5D73A 3LYKA 1F37A 3GV1A 3TB2A 2C3QA 1K3YA 3EU4A 1M0UA 4IVFA 1PX6A 2CX3A 3FZAA 4GF0A 17GSA 3QMXA 1T1VA 2VCTA 4Z7XA 3PGTA 2AJQB 3ZLPA 1BEDA 1HD2A 4HS1A 4IW9A 1XOBA 1OE7A 5DCHA 3BBYA 2OA7A 4X43A 2A2RA 4PNGA 4XS6A 3DVWA 2G2QA 4PX1A 4HJ2A 1MDIA 2BTOT 3QFBC 1G7OA 4XRDA 2DBCA 3TJGA 5F05A 3ZIJA 1SKWB 4G9HA 1XW9A 3D4MA 3HZ8A 2V2GA 1NM3A 3TRQA 2AV4A 4WXTA 3CSIA 3EU3A 1YY7A 1U88A 4MH2A 1W4VA 4MPFA 1XPVA 4AF2A 3TDGA 1M2DA 3A5WA 3KCMA 4FYUA 5G5EA 1XVQA 1GL8A 5AIXA 5AN1A 2C3NA 4N30A 2L5OA 3ZVJD 1SYRA 3LORA 4I8BA 5EVOA 2HSYA 4MF7A 3C1SA 1XCCA 1HYUA 1USBA 1K0AA 2NTOA 2B3SA 3LGCA 4K7NA 3ED3A 4WBJA 1TRUA 4G0LA 4IQ1A 5IMAA 3R2QA 3P7XA 2PUKC 3LFLA 2LRNA 3RHBA 3WGEA 3ERGA 2TRCP 3FR3A 3LSZA 1IYHA 1TP9A 4ZB8A 1EEMA 4K2DA 1ERUA 1O8WA 4GCIA 2H6ZA 2I3YA 2L4CA 5B8BA 4ID0A 3CRTA 4USSA 4ISDA 3KEBA 3I69A 2VOCA 3ERWA 2REMA 5B6NA 4IP1A 1YZXA 1TI1A 1TK0B 4JR6A 3U5RE 3FW2A 3CSHA 1FVJA 4ECBA 1MD4A 4XS4B 3PPUA 5ECQB 4WF4A 2HNLA 3HYPA 3S9FA 1RQMA 3R3EA 4FQUA 2C0GA 1F6MC 3E0UA 2CZ3A 1PSQA 2OBIA 5KN0A 3M8NA 1YDKA 5HFKA 4BL7B 3DYRA 1S3DA 2LV3A 2P0GA 1EGRA 1R5AA 4TW5A 3RHCA 2VL9A 3RBTA 2NVLA 3DIEA 4TRXA 1E2YA 2FUG2 1M2AA 1G7EA 3F3QA 1PD21 2H6XA 4BWSA 1A2MA 1WPIA 3BJ5A 1X5CA 3EE2A 4WEYA 5AIVA 3LG6A 1EOHA 4AJ8A 3L4NA 4EF0A 2YV9A 3IAS2 4DEJA 1ERWA 3KTLA 4NHWA 5EL8A 1PKWA 8GSSA 2JSYA 5DDLA 4XRAA 2H0GA 4HOJA 2G0FA 12GSA 5DALB 1ERTA 3C71A 3QOUA 4PUFC 1EWXA 3G7JA 3RAZA 2XHFA 3FRCA 3ISOA 1WOUA 4KA0A 4EE0A 2YZHA 2VCVA 5IO0A 4EKZA 1XVWA 1GRXA 4K0NA 2PVOC 4TVEA 3EMPA 2B7JA 2MMAA 4MMMA 3Q6OA 2DIYA 1R7HA 3GH6A 3ZTLA 1GSFA 3F0IA 4DSQA 3D5JA 2HLSA 4IN0A 3ZMKA 3US3A 1DSBA 2K8VA 2H19A 5JWOB 4KDXA 3JCML 5F06A 1ZL9A 2IPAA 9GSSA 3GA4A 4XIHA 2WJUA 1AQWA 3WD6A 1THXA 4XTSA 1XWGA 4J2FA 1SKRB 2CVBA 2F9SA 4HDEA 16GSA 2LSTA 1F3BA 1B8XA 2DMLA 3FEUA 1XW5A 1B48A 4X0XA 1YJ6A 1YF0A 5L71A 1ILOA 3IOSA 4YH2A 2IFQA 1FVKA 1K0CA 1GP1A 1GULA 2XPEA 3LEFA 1NSWA 4PNFA 3EYTA 4AJ7A 1W89A 3AY8A 2DJ2A 1MDJA 1Z6NA 1V9WA 4MZBA 1GTBA 1TXXA 3NOFA 2B1KA 2GSSA 2VM1A 5DAKA 3D6IA 2M72A 5ECKB 5D9TA 3FR9A 3ERFA 5IPHA 5ECRB 4PGTA 3QDNA 3IR4A 1Y25A 3M3MA 2OE3A 1O7UA 1QGVA 1VF1A 3HZ4A 1HQOA 3TUEA 2GSQA 3TJJA 5ECHB 6GSXA 2XBIA 1JZWA 4RUVA 2H71A 2HRKB 4PUAA 4G0KA 2E0QA 3CYNA 5GAPD 4PXOA 1H4OA 5LCZA 4ZL8A 1GSDA 5EY6A 6GSTA 3KM6A 2VCQA 2LNSA 1SK2A 2OADA 1YKCA 4TOPA 3L78A 3HJOA 2M46A 5DALA 2C0EA 2V6OA 2C8UA 3FZ4A 2DJKA 1ML6A 4ZB6A 3EVIA 6GSSA 1WJKA 4TR0A 2ALBA 2HRFA 5IMVA 1GUHA 2FA8A 3Q18A 2O89A 1YKAA 5DCGA 4K9ZA 2DC5A 4IGJA 3FZ5A 1O8XA 2GZZA 5CRHA 1EOGA 3KIJA 1WP0A 3D21A 1AC1A 1GTAA 2WULA 3VLNA 4E8EA 3WGDA 4WR4A 2H6YA 3TGZA 4DSRA 2ZUPA 3C73A 4HI7A 2YANA 5IMCA 3TJFA 4NPBA 5ECNB 2JL4A 2OKAA 1K0NA 5ECLB 4EVMA 1XFLA 2HSHA 1GSYA 3RPPA 5D96A 1TK5B 1X5EA 3UJ1A 1JHBA 5DJMA 2MBTA 4HQSA 4POKA 3GUSA 2VAFA 3WT2A 4WBRD 3LXTA 3J7Yb 1F9MA 2X8GA 2I9HA 1FOVA 3GH9A 1C72A 2YWNA 1MDKA 5E59A 2H0HA 4IJ3A 2L4QA 1V58A 4IKHA 1K3LA 2LTKA 2YWIA 2FA4A 3APQA 1A2LA 3ZL5A 1F3AA 2PBJA 4Q5NA 1UC7A 4XHMA 1OAZA 2LJKA 2B5YA 2HQTA 4KCAA 1SU9A 4ML1A 4PQHA 3H1NA 4N10A 2I81A 2GTUA 2X64A 2L5LA 2L6DA 1HNBA 4TXOA 5D93A 1I5GA 1S3AA 4CDOA 4JR4A 4GQCA 3N5OA 2YV7A 1R5PA 2CA8A 2YOIA 5HFGA 3ZFBA 5F0GA 3H79A 2HRKA 2B7KA 3DRNA 3UL3A 3ZVJA 4N0VA 3VPQA 2VM2A 3IAM2 2PERA 4MCUA 4EO3A 2R3XA 3ZREA 4ACSA 1AXDA 3EINA 3GURA 1U3AA 2OJLA 3KD0A 4K0GA 3M9JA 3W6GA 3MAKA 2JZTA 1JFUA 2WRTA 2E7PA 1R26A 4F03A 1XWKA 3KP9A 1AW9A 4JEDA 4PQIA 1GSQA 2DJ3A 2B5XA 2DJJA 2ZNMA 4J57E 3QAWA 3G7IA 2R2JA 3QCPA 3F4TA 2MBSA 3BOAA 4NXIA 3C7MA 4CW9A 1A24A 3KZQA 4PTSA 4ECIA 4JU5A 2H01A 3TOUA 4GXZA 1Q98A 4NWYA 1PMTA 1XW6A 2E2MA 1PKZA 1TI3A 1PA3A 4HEA2 3ZZXA 2F8AA 3HHVA 4KE3A 2AAWA 3K8NA 1PL1A 4K7OA 3DKSA 4OFTA 3O76A 4K6XA 5CP1A 2FLSA 4KDUA 3CTGA 3IDVA 3GTUA 2H66A 2YJHA 1UN2A 3MWHA 4GSNA 3UMAA 3A2XA 1OVNA 2AHEA 2ZCTA 3BD2A 3LQ7A 3TJBA 3VURA 2YNXA 2NPBA 4GSSA 4L5LA 5A5KA 2GZPA 3DD3A 1AQXA 4NV5A 3VFIA 2PVQA 2L6CA 3DWVA 5JCUA 2B5EA 3TKPA 6GSVA 4IELA 3QAGA 1TRVA 4ZL7A 5IMZA 3PR8A 3CXGA 3ZYWA 3G9BA 3FK8A 4KW6A 1FAAA 2RIIA 1M99A 4HZ2A 5ELGA 1X5DA 2WGRA 3KP8A 3WGXA 19GSA 4F9ZA 2CQ9A 4MF6A 4GRFA 2IFQB 1SJZA 4ZBBA 4EUYA 3TOTA 1KTEA 4MF5A 2OBKA 3HJPA 4EDYA 3P2AA 3W8JA
chains in the Genus database with same CATH superfamily
2VL3A 2FD3A 2O87A 4N0ZA 2LJAA 5HR1A 4G10A 2LJRA 1X9MB 5DAKB 3L9VA 1EV9A 1XZOA 2GZYA 3TU3B 1N8JA 3KMOA 3NZNA 2DJ0A 3I43A 4MH3A 2VUPA 4KGIA 5D8IA 3H4KA 1K3OA 4OO4A 2EFHA 3CTFA 5A1NA 5J4YA 2FWHA 4OCFA 2MMOA 5G1KA 1PN0A 2K18A 1OKDA 3GNJA 5J40A 2CVDA 1WMJA 3UBLA 2E2GA 5LNKe 4KAEA 4Q5FA 2X99A 2CAQA 1QMVA 1XWAA 2QA1A 4I2UA 3FKFA 4PURA 4K1FA 2YWMA 3QD9A 2A4VA 1A8LA 1GTUA 4D73A 1TDIA 4MK3A 1ZOFA 1M7TA 2YPMA 1URMA 4KDYA 4ZBAA 3GN3A 3QPMA 5J5NA 4YQVA 1EEJA 1JZDA 1GNEA 1I1IP 2AUVA 2FHEA 2K9FA 4WETA 2DSAA 3HD5A 3UVTA 5CYYA 4GQFA 3IPZA 1TK8B 1H75A 5BRTA 1AQVA 1FHEA 2R37A 3KH7A 1YEXA 3W8SA 4LMVA 5LD0A 2KOKA 1FW1A 1XBSA 4YAVA 4ML6A 4V1Ap 4EC0A 5A4WA 1KEBA 3P8WA 3ZIVA 5F07A 4TR4A 5G5FA 4OMVA 2HE3A 2VKZG 3GRXA 2NBSA 3A2VA 3UEMA 20GSA 6GSYA 2QKEA 3CRUA 2RM6A 6GSWA 2WDUA 3D4TA 2B1LA 4IP6A 2KP1A 5CRDA 1CQGA 1G6WA 2C4JA 1GTIA 1SK1A 2IMIA 1V98A 4KSMA 2JU5A 2CV4A 2KUCA 3FR6A 5EPFA 2VLVA 4FXYP 2XPDA 5ECMB 3KMNA 4I97A 1R4WA 2JADA 4HQZA 1LJRA 3GKMA 10GSA 3IA1A 4TXOB 2LEGA 2DLXA 4NHZA 4F0BA 4RI6A 2O8VB 2TIRA 4L5OA 2PWJA 3IV4A 5FWGA 3HJMA 1Z9HA 4OFMA 2HSNB 1FO5A 3GKNA 2K8SA 4FIWA 4MJBA 6GSUA 2YJ7A 1KNGA 5IM9A 2O36A 5JCGA 3VWUA 2GVPA 3GKXA 2H1AA 3O3TA 1X9SB 4TN8A 1LBKA 1TRWA 2VL2C 14GSA 1TJDA 5A4VA 4LLRA 5DQYA 2IN3A 2QSIA 5CREA 3N9JA 1DBYA 1V40A 3UIWA 1E6BA 4V2MA 2DJ1A 1U6TA 4LL1B 5HQPA 3VPTA 2GQLA 2H73A 5ABRA 2GT5A 4OD7A 5KN2A 3TKSC 3EMXA 4TKYA 1M3JA 1WRYA 1XXUA 2ON5A 4AJ6A 4IS0A 2X8HA 3L0HA 1A0RP 2H1DA 3KGKA 2H75A 2L57A 2C80A 2XBQA 4QL7A 3TJKA 3SBCA 4O7HA 2PN8A 1ON4A 2MMZA 2C1YA 3F6FA 1XWCA 5GSSA 5J41A 3H93A 5KN1A 1EP8A 1U3IA 2XC2A 1ZCPA 1FB6A 1I9DA 2HZEA 4MJCA 1T00A 2GGTA 2VCZA 1A23A 5IMFA 4MA9A 4P3YB 3U6VA 4YAPA 1J9BA 2IMEA 2R0PA 4AI6A 3IC8A 3M9KA 5E4WA 3M0FA 4WKWA 3M1GA 1GLPA 4DVCA 4Z2RA 5KOWA 5KN3A 1TKDB 2VD0A 3P90A 2RLIA 3UOMA 2Z9SA 4QQ7A 1Y1UA 1SYXA 2LQQA 5ID2A 2GLRA 3GTUB 3ME8A 1T4YA 3DGQA 4LL4B 5CRWA 2V6KA 1TTZA 2NDOA 2GT6A 3HDCA 3VI5A 3RDWA 1SENA 2IMDA 2YN1A 2LQOA 4OO5A 2H74A 5A4UA 4F2IA 4L8EA 4MLYA 1RK4A 3MNGA 2D2ZA 3V1WA 1T3BA 1VF2A 1SKSB 1O6JA 1MEKA 3EURA 4Q5RA 4KB3A 3HY2A 1CQHA 3VWWA 3KTBA 4MPGA 2AB6A 5G1LA 3QFAC 4O32A 4AKHA 3A2WA 4E8HA 5DVBA 3CHXC 3F63A 2CT6A 5IO2A 1UVZA 3NIVA 2EFCA 2EIQA 5KEJA 2HT9A 1EP7A 5J4VA 4G0IA 3GL5A 2B6MA 1OYJA 1GSEA 1B4QA 1PL2A 4AKIA 3F6DA 4ZILA 4JE1A 4JRRA 5D9WA 4G2EA 3DEXA 3IXRA 3A3TA 4KF9A 1WIKA 3TKQA 1QUWA 3FHKA 1LU4A 5BMUA 4EDZA 1BG5A 1NW2A 1V2AA 1J08A 4WF5A 3GKKA 4OFNA 4IBPA 2WFCA 4O5UA 3LXZA 4FH8A 4KX4A 5A1NB 2RM5A 4NAXA 1WE0A 2ES7A 2A2SA 2FGXA 3O6TA 3H8QA 1QQ2A 2EC4A 5J9CA 3HA9A 2YWOA 1DUGA 4G19A 1NHOA 3IE3A 2J9HA 3L9SA 2LRCA 1SJIA 1DE1A 2LUSA 1Y6EA 3GL3A 1ZYQB 4K7IA 3IRAA 3MSZA 2IMKA 2HYXA 5ECIB 3UARA 2QGVA 2OACA 2EIRA 1XIYA 1K0MA 3QR6A 1M3IA 5G31A 4D73B 2MMNA 1O81A 5DBQA 2FNOA 4ZXGA 2R4VA 4ZBDA 2PMTA 4NMUA 5HR3A 4AGSA 1OC9A 2DMMA 3VWXA 2F51A 5IQYA 1OE8A 4RI7A 3GYKA 7GSSA 2H30A 1JLVA 1T7PB 1Z7RA 18GSA 4ZB7A 2VLUA 2N5AA 4IHUA 3OR5A 1TU7A 1T8EB 2C3TA 1K0DA 3F4RA 2JZRA 3CBUA 4RQRA 2K6VA 1MTCA 1ZMAA 4MABA 2P5QA 1SJ6A 1GWCA 4FYBA 5G30A 2HXKA 1AIUA 2HFDA 4Z2TA 1G0TA 4YQUA 1GSSA 5HFIA 3F4SA 1SD9A 2HSMA 1EZKA 2IL3A 4ZIJA 3CWGA 1KBNA 1THOA 4POMA 1TOFA 2WCIA 1BX9A 1GSUA 2H70A 4TR1B 3APSA 2F3MA 3F9UA 1DE2A 4BA7A 2F8FA 4KSOA 4YKGA 2CVKA 5IMDA 3UAPA 5H5SA 2P5RA 2V41A 2LNTA 3CMIA 3HKRA 1A2JA 1WWJA 2PPTA 1TXUA 5JCWA 1G6YA 3FYGA 1GUMA 3TCOA 1NHYA 4MJAA 4Q5QA 3EC3A 2GDRA 1JLWA 2CX4A 1ZYPA 4ILFA 2VCXA 1GLQA 1B9YC 5ECPB 4BVXA 1MD3A 1O85A 5DQSA 4GLTA 3LJRA 1XOAA 3G7YA 3RPNA 2RUEA 4HUAA 4IQAA 4K5SA 1GUKA 2H1BA 1FB0A 4JZQA 3DVXA 4N11A 2OE1A 1HNAA 1Q4JA 4QL9A 1S3CA 2YP6A 5JWQB 5CNWA 4NV2A 2WVXA 5J3RA 2UZ8A 1TRSA 4DSSB 1ST9A 3VI7A 3Q74A 1VRSD 4MJEA 4MP4A 3IBHA 1UA5A 2WS2A 1Z3EA 1PX7A 3HXSA 2N5BA 1PN9A 4O92A 1ZZYA 4GWRA 1VF3A 3ME7A 2HRAA 3HVXA 5CAXA 1QFNA 4ECJA 1YQ1A 3F8UA 5D9VA 4KCEA 2P31A 2BMXA 4HU7A 4J56E 4EXJA 5GZZB 1ACVA 1F2EA 3EWLA 2FWGA 2KP2A 5ELAA 3SWLA 3QAVA 4O5QA 4XCSA 1K0OA 1JZOA 1TW9A 2YCDA 4BVYB 3FZ9A 2GS3A 2AYTA 4E68A 1SK0A 5ECSA 1YVLA 4MDCA 3IHGA 2JSZA 3GX8A 1U87A 3PINA 2CAIA 2R0GA 4GSTA 3APOA 3L9UA 3KXOA 4ZB9A 2IJYA 4L0UA 4CHSA 1SL0B 2HZEB 3C8EA 3MDKA 4KNDA 3UVHA 2PGTA 4TR3A 3IK9A 1SD8A 5GSTA 1VGLA 3J7Yk 5D9XA 5J9BA 4X4JA 1A0FA 2CZ2A 4TR1A 2OT3A 4CY6A 3I6AA 5IOXA 4GTUA 2HI7A 3TRXA 1PRXA 1QXHA 2H76A 1EV4A 3KJYA 3MIXA 5AGYA 2VLTA 2VL2A 3ZRDA 4F82A 3DXBA 3IK7A 3PH9A 3D22A 4BWQA 5IPGA 3F3RA 1S3RA 2O5VA 2MYGA 5ID2B 4XS4A 4MZCA 1PFOA 5HR0A 1K0BA 4V2LA 5C04A 2EFDA 2ON7A 2WB9A 3GX0A 4LA1A 2J23A 2H1GA 4ULXA 3TKSA 1X9WB 2VO4A 4IJIA 3ZFLA 2HZFA 2O7KA 4BPYA 3TRPA 1GNWA 4BL7A 1T4ZA 1GH2A 2JACA 3ZMLA 5J4UA 4CY8A 1XWBA 2FWEA 4RQXA 4DSSA 4X1UA 1ABAA 2R6KA 2IWTA 2L59A 1IYIA 1FOHA 3DMLA 2X8CA 2C0DA 2GQMA 4N3ZA 5B7CA 2WZ9A 5COHA 4I6XA 1M2BA 2H8LA 5GAND 1AAZA 2IIYA 2H0IA 1AUCA 2QC7A 5CRGA 3FY7A 4OWYA 2A4HA 4HZ4A 3IC4A 1SL2B 2LRTA 1PQNA 2VIMA 4MZWA 1BYEA 2N5FA 2M80A 4ZL9A 1X0RA 1J0FA 2V32A 4XS1A 2GSRA 3Q19A 4ECCA 3LWAA 2I1UA 2TRXA 4KUNA 3CSJA 5BMUB 1N2AA 3D0ZA 4I5QA 1OKTA 4BVYA 2BJXA 2VD1A 1HNCA 1Z5YE 2HRNA 2KHPA 2KLXA 3I9V2 1PGTA 1Z6MA 4POLA 2PU9C 4FYCA 5C00A 5FT3A 2FY6A 3LYPA 4EL1A 1A8YA 13GSA 4PI0C 2GQKA 5A5HB 2IMFA 4FO5A 5F8BA 2GSTA 1YEPA 3GSTA 2C0FA 4YQMA 4I2TA 5CO3A 3HMJG 4PQ1A 4L0WA 4K8MA 4O5RA 1ZGNA 4HU9A 2YZUA 3VK9A 1TU8A 1JZRA 3E9JB 3GSSA 1OC9B 3UBKA 2OE0A 1YF1A 3HVSA 2VCWA 4LMWA 5B8AA 4HJMA 3WYWA 1OC8A 3TKSE 1FG4A 5ECOB 1M9AA 1V57A 4POBA 5H5QA 1SVLA 5B6MA 4F0CA 3TKRA 3KH9A 3GMFA 3C1RA 4BIKA 4TXVA 2R5GA 1EGOA 3IHQA 2EIOA 2DKHA 2JZSA 3WT1A 1ZYEA 2WVZA 1M9BA 5H5RA 1Z7PA 3GIXA 2HSMB 2MZCA 1BAYA 4V2NA 5A34A 1B9XC 2I4AA 4JBBA 2O85A 5HR2A 2V1MA 3BCKA 3BCIA 4WR5A 2H72A 2LS5A 1O73A 3HVVA 4KH7A 2DIZA 3ZITA 1VF4A 5DJLA 1ERVA 5G2ZA 11GSA 2RUFA 3GHAA 4H86A 5ENUA 3HCZA 1BJXA 5IIZA 3VWVA 1RW1A 5INYA 1BG1A 4V1Ag 1QK8A 5AISA 2QA2A 4MNNA 4K2XA 5JWRB 1ZYNA 3GFKA 22GSA 1BQ7A 5FHIA 2FCHA 3E3EA 4BVXB 2LKUA 1OC3A 4OCEA 5IOWA 2FWFA 1B4PA 1SL1B 5D73A 3LYKA 1F37A 3GV1A 3TB2A 2C3QA 1K3YA 3EU4A 1M0UA 4IVFA 1PX6A 2CX3A 3FZAA 4GF0A 17GSA 1N25A 3QMXA 1T1VA 2VCTA 2WVXB 4Z7XA 3PGTA 2AJQB 3ZLPA 1BEDA 1HD2A 4HS1A 4IW9A 1XOBA 1OE7A 5A5HA 5DCHA 3BBYA 2OA7A 4X43A 2A2RA 4PNGA 4XS6A 3DVWA 2G2QA 4PX1A 4HJ2A 1MDIA 2BTOT 3QFBC 1G7OA 4XRDA 2DBCA 3TJGA 5F05A 3ZIJA 1SKWB 4G9HA 1XW9A 3D4MA 1SVMA 3HZ8A 2V2GA 1NM3A 3TRQA 2AV4A 4WXTA 3CSIA 3EU3A 1YY7A 1U88A 4MH2A 1W4VA 4MPFA 1XPVA 4AF2A 3TDGA 1M2DA 2X4AA 3A5WA 3KCMA 4FYUA 5G5EA 1XVQA 1GL8A 3EPTA 5AIXA 5AN1A 2C3NA 4N30A 2L5OA 3ZVJD 1SYRA 3LORA 4I8BA 5EVOA 2HSYA 4MF7A 3C1SA 1XCCA 1HYUA 1USBA 1K0AA 2NTOA 2WW1A 2B3SA 3LGCA 4K7NA 3ED3A 4WBJA 1TRUA 4G0LA 4IQ1A 5IMAA 3R2QA 3P7XA 2PUKC 3LFLA 2LRNA 3RHBA 3WGEA 3ERGA 2TRCP 1BF5A 2WW2A 3FR3A 3LSZA 1IYHA 1TP9A 4ZB8A 1EEMA 4K2DA 1ERUA 1O8WA 4GCIA 2H6ZA 2I3YA 2L4CA 5B8BA 4ID0A 3CRTA 4USSA 4ISDA 3KEBA 3I69A 2VOCA 3ERWA 2REMA 5B6NA 4IP1A 1YZXA 1TI1A 4W66A 4JR6A 1TK0B 3U5RE 3FW2A 3CSHA 1FVJA 4ECBA 1MD4A 4XS4B 3PPUA 5ECQB 4WF4A 2HNLA 3HYPA 3CQFA 3S9FA 1RQMA 3R3EA 4FQUA 2C0GA 4PI2C 1F6MC 3E0UA 2CZ3A 1PSQA 2OBIA 5KN0A 3M8NA 1YDKA 5HFKA 4BL7B 3DYRA 1S3DA 2LV3A 2P0GA 1EGRA 1R5AA 4TW5A 3RHCA 2WW3A 2X49A 2VL9A 3RBTA 2NVLA 3DIEA 4TRXA 1E2YA 2FUG2 1M2AA 1G7EA 3F3QA 1PD21 2H6XA 4BWSA 1A2MA 1WPIA 3BJ5A 1X5CA 3EE2A 4WEYA 5AIVA 3LG6A 1EOHA 4AJ8A 3L4NA 4EF0A 2YV9A 3IAS2 4DEJA 1ERWA 3KTLA 4NHWA 5EL8A 1PKWA 8GSSA 2JSYA 5DDLA 4XRAA 2H0GA 4HOJA 2G0FA 12GSA 5DALB 2DKIA 1ERTA 3C71A 3QOUA 4PUFC 1EWXA 3G7JA 3RAZA 2XHFA 3FRCA 3ISOA 1WOUA 4KA0A 4EE0A 2YZHA 2VCVA 5IO0A 4EKZA 1XVWA 1GRXA 4K0NA 4G01A 2PVOC 4TVEA 3EMPA 2B7JA 2MMAA 4MMMA 3Q6OA 2DIYA 1R7HA 3GH6A 3ZTLA 1GSFA 3F0IA 4DSQA 3D5JA 2HLSA 4IN0A 3ZMKA 3US3A 1DSBA 2K8VA 2H19A 5JWOB 4KDXA 3JCML 5F06A 4EIQA 1ZL9A 2IPAA 9GSSA 3GA4A 4XIHA 2WJUA 1AQWA 3WD6A 1THXA 4XTSA 1XWGA 4J2FA 1SKRB 2CVBA 2F9SA 16GSA 4HDEA 5J47A 2LSTA 1F3BA 1B8XA 2DMLA 3FEUA 1XW5A 1B48A 4X0XA 2WW0A 1YJ6A 4YKFA 1YF0A 5L71A 1ILOA 3IOSA 4YH2A 2IFQA 1FVKA 1K0CA 1GP1A 1GULA 2XPEA 3LEFA 1NSWA 4PNFA 3LW9A 3EYTA 4AJ7A 1W89A 3AY8A 2DJ2A 1MDJA 1Z6NA 1V9WA 4MZBA 1GTBA 1TXXA 3NOFA 2B1KA 2GSSA 2VM1A 5DAKA 3D6IA 3MYDA 2M72A 5ECKB 5D9TA 3FR9A 3ERFA 5IPHA 5ECRB 4PGTA 3QDNA 3IR4A 5A34B 1Y25A 3M3MA 2OE3A 1O7UA 1QGVA 4GDFA 1VF1A 3RGBC 3HZ4A 1HQOA 3TUEA 2GSQA 3TJJA 5ECHB 6GSXA 2XBIA 5KOXA 4Z2UA 1JZWA 4RUVA 2H71A 2HRKB 4PUAA 4G0KA 2E0QA 3CYNA 5GAPD 4PXOA 1H4OA 5LCZA 4ZL8A 1GSDA 5EY6A 6GSTA 3KM6A 2VCQA 2LNSA 1SK2A 2OADA 1YKCA 4TOPA 3L78A 3HJOA 2M46A 5DALA 2C0EA 2V6OA 2C8UA 3FZ4A 2DJKA 1ML6A 4ZB6A 3EVIA 6GSSA 1WJKA 1YEWC 4TR0A 2ALBA 2HRFA 5IMVA 1GUHA 2FA8A 3Q18A 2O89A 2O3EA 1YKAA 5DCGA 4K9ZA 2DC5A 4IGJA 3FZ5A 1O8XA 4AKXB 2GZZA 5CRHA 1EOGA 3KIJA 1WP0A 4AKGA 3D21A 1AC1A 4HSCX 1GTAA 2WULA 3VLNA 4E8EA 3WGDA 4WR4A 2H6YA 3TGZA 4DSRA 2ZUPA 3C73A 4HI7A 2YANA 5IMCA 3TJFA 4NPBA 5ECNB 2JL4A 2OKAA 1K0NA 5ECLB 4EVMA 1XFLA 2HSHA 1GSYA 3RPPA 5D96A 1TK5B 1X5EA 3UJ1A 3RFRC 1JHBA 5DJMA 2MBTA 4HQSA 4POKA 3GUSA 2VAFA 3WT2A 4WBRD 3LXTA 3J7Yb 1F9MA 2X8GA 2I9HA 1FOVA 2A2PA 3GH9A 1C72A 2YWNA 1MDKA 5E59A 2H0HA 4IJ3A 2L4QA 4A5PA 1V58A 4IKHA 1K3LA 2LTKA 4K5RA 2YWIA 2FA4A 1S4BP 3APQA 1A2LA 3ZL5A 1F3AA 2PBJA 4Q5NA 1UC7A 4XHMA 1OAZA 2LJKA 2B5YA 2EFEA 2HQTA 4KCAA 1SU9A 4ML1A 4PQHA 3H1NA 3A5IA 4N10A 2I81A 2GTUA 2X64A 2L5LA 2L6DA 1HNBA 4TXOA 5D93A 1I5GA 1S3AA 4CDOA 3HVNA 4JR4A 4GQCA 3N5OA 2YV7A 1R5PA 2CA8A 2YOIA 5HFGA 3ZFBA 5F0GA 3H79A 1XG8A 2HRKA 2B7KA 3DRNA 2HSNA 3UL3A 3ZVJA 4N0VA 3VPQA 2VM2A 3IAM2 2PERA 4PHZC 4MCUA 4EO3A 2R3XA 3ZREA 4ACSA 1AXDA 3EINA 3GURA 1U3AA 2OJLA 3KD0A 4K0GA 3M9JA 3W6GA 3MAKA 2JZTA 1JFUA 4ICYA 2WRTA 4QMKA 2WVYA 2E7PA 1R26A 4F03A 1XWKA 3KP9A 1AW9A 4JEDA 4PQIA 1GSQA 2DJ3A 2B5XA 2DJJA 2ZNMA 4J57E 3QAWA 3G7IA 2R2JA 3F4TA 3QCPA 2MBSA 3BOAA 4NXIA 3C7MA 4CW9A 1A24A 3KZQA 4PTSA 4ECIA 4JU5A 2H01A 3TOUA 4GXZA 3FMWA 1Q98A 4NWYA 1PMTA 1XW6A 2E2MA 1PKZA 1TI3A 1PA3A 4HEA2 3ZZXA 2F8AA 3HHVA 2H1LA 2UV8G 4KE3A 2AAWA 3K8NA 1PL1A 4K7OA 3DKSA 4OFTA 3O76A 4K6XA 5CP1A 2FLSA 4KDUA 1SVOA 3CTGA 3IDVA 3GTUA 2H66A 2YJHA 1UN2A 2WZSA 3MWHA 4GSNA 3UMAA 3A2XA 1OVNA 2AHEA 2ZCTA 3BD2A 3LQ7A 3TJBA 3VURA 2YNXA 2NPBA 4GSSA 4L5LA 5A5KA 2GZPA 3DD3A 1AQXA 4NV5A 3VFIA 2PVQA 2L6CA 3DWVA 5JCUA 2B5EA 3TKPA 2R0CA 6GSVA 4IELA 3QAGA 1TRVA 4ZL7A 5IMZA 3PR8A 4EIPA 3CXGA 3ZYWA 3G9BA 3FK8A 4KW6A 1FAAA 2RIIA 1M99A 4HZ2A 5ELGA 1X5DA 2WGRA 3KP8A 3WGXA 19GSA 4F9ZA 2CQ9A 4MF6A 4GRFA 2IFQB 1SJZA 4ZBBA 4EUYA 3TOTA 1KTEA 4MF5A 2OBKA 3HJPA 4EDYA 3P2AA 3W8JA
chains in the Genus database with same CATH topology
2VL3A 2FD3A 2O87A 4N0ZA 2LJAA 5HR1A 4G10A 2LJRA 1X9MB 5DAKB 3L9VA 1EV9A 1XZOA 2GZYA 3TU3B 1N8JA 3KMOA 3NZNA 2DJ0A 3I43A 4MH3A 2VUPA 4KGIA 5D8IA 3H4KA 1K3OA 4OO4A 2EFHA 3CTFA 5A1NA 5J4YA 2FWHA 4OCFA 2MMOA 5G1KA 1PN0A 2K18A 1OKDA 3GNJA 5J40A 2CVDA 1WMJA 3UBLA 2E2GA 5LNKe 4KAEA 4Q5FA 2X99A 2CAQA 1QMVA 1XWAA 2QA1A 4I2UA 3FKFA 4PURA 4K1FA 2YWMA 3QD9A 2A4VA 1A8LA 1GTUA 4D73A 1TDIA 4MK3A 1ZOFA 1M7TA 2YPMA 1URMA 4KDYA 4ZBAA 3GN3A 3QPMA 5J5NA 4YQVA 1EEJA 1JZDA 1GNEA 2AUVA 2FHEA 2K9FA 4WETA 2DSAA 3HD5A 3UVTA 5CYYA 4GQFA 3IPZA 1TK8B 1H75A 5BRTA 1AQVA 1FHEA 2R37A 3KH7A 1YEXA 3W8SA 4LMVA 5LD0A 2KOKA 1FW1A 1XBSA 4YAVA 4ML6A 4V1Ap 4EC0A 5A4WA 1KEBA 3P8WA 3ZIVA 5F07A 4TR4A 5G5FA 4OMVA 2HE3A 2VKZG 3GRXA 2NBSA 3A2VA 3UEMA 20GSA 6GSYA 2QKEA 3CRUA 2RM6A 6GSWA 2WDUA 3D4TA 2B1LA 4IP6A 2KP1A 5CRDA 1CQGA 1G6WA 2C4JA 1GTIA 1SK1A 2IMIA 1V98A 4KSMA 2JU5A 2CV4A 2KUCA 3FR6A 5EPFA 2VLVA 2XPDA 5ECMB 3KMNA 4I97A 1R4WA 2JADA 4HQZA 1LJRA 3GKMA 10GSA 3IA1A 4TXOB 2LEGA 2DLXA 4NHZA 4F0BA 4RI6A 2O8VB 2TIRA 4L5OA 2PWJA 3IV4A 5FWGA 3HJMA 1Z9HA 4OFMA 2HSNB 1FO5A 3GKNA 2K8SA 4FIWA 4MJBA 6GSUA 2YJ7A 1KNGA 5IM9A 5JCGA 3VWUA 2GVPA 3GKXA 2H1AA 3O3TA 1X9SB 4TN8A 1LBKA 1TRWA 2VL2C 14GSA 1TJDA 5A4VA 4LLRA 5DQYA 2IN3A 2QSIA 5CREA 3N9JA 1DBYA 1V40A 3UIWA 1E6BA 4V2MA 2DJ1A 1U6TA 4LL1B 5HQPA 3VPTA 2GQLA 2H73A 5ABRA 2GT5A 4OD7A 5KN2A 3TKSC 3EMXA 4TKYA 1WRYA 1XXUA 2ON5A 4AJ6A 4IS0A 2X8HA 3L0HA 1A0RP 2H1DA 3KGKA 2H75A 2L57A 2C80A 2XBQA 4QL7A 3TJKA 3SBCA 4O7HA 2PN8A 1ON4A 2MMZA 2C1YA 3F6FA 1XWCA 5GSSA 5J41A 3H93A 5KN1A 1EP8A 1U3IA 2XC2A 1ZCPA 1FB6A 1I9DA 2HZEA 4MJCA 1T00A 2GGTA 2VCZA 1A23A 5IMFA 4MA9A 4P3YB 3U6VA 4YAPA 1J9BA 2IMEA 2R0PA 4AI6A 3IC8A 3M9KA 5E4WA 3M0FA 4WKWA 3M1GA 1GLPA 4DVCA 4Z2RA 5KOWA 5KN3A 1TKDB 2VD0A 3P90A 2RLIA 3UOMA 2Z9SA 4QQ7A 1Y1UA 1SYXA 2LQQA 5ID2A 2GLRA 3GTUB 3ME8A 1T4YA 3DGQA 4LL4B 5CRWA 2V6KA 1TTZA 2NDOA 2GT6A 3HDCA 3VI5A 3RDWA 1SENA 2IMDA 2YN1A 2LQOA 4OO5A 2H74A 5A4UA 4F2IA 4L8EA 4MLYA 1RK4A 3MNGA 2D2ZA 3V1WA 1T3BA 1VF2A 1SKSB 1O6JA 1MEKA 3EURA 4Q5RA 4KB3A 3HY2A 1CQHA 3VWWA 3KTBA 4MPGA 2AB6A 5G1LA 3QFAC 4O32A 4AKHA 3A2WA 4E8HA 5DVBA 3F63A 2CT6A 5IO2A 1UVZA 3NIVA 2EFCA 2EIQA 5KEJA 2HT9A 1EP7A 5J4VA 4G0IA 3GL5A 2B6MA 1OYJA 1GSEA 1B4QA 1PL2A 4AKIA 3F6DA 4ZILA 4JE1A 4JRRA 5D9WA 4G2EA 3DEXA 3IXRA 3A3TA 4KF9A 1WIKA 3TKQA 1QUWA 3FHKA 1LU4A 5BMUA 4EDZA 1BG5A 1NW2A 1V2AA 1J08A 4WF5A 3GKKA 4OFNA 4IBPA 2WFCA 4O5UA 3LXZA 4FH8A 4KX4A 5A1NB 2RM5A 4NAXA 1WE0A 2ES7A 2A2SA 2FGXA 3O6TA 3H8QA 1QQ2A 2EC4A 5J9CA 3HA9A 2YWOA 1DUGA 4G19A 1NHOA 3IE3A 2J9HA 3L9SA 2LRCA 1SJIA 1DE1A 2LUSA 1Y6EA 3GL3A 1ZYQB 4K7IA 3IRAA 3MSZA 2IMKA 2HYXA 5ECIB 3UARA 2QGVA 2OACA 2EIRA 1XIYA 1K0MA 3QR6A 5G31A 4D73B 2MMNA 1O81A 5DBQA 2FNOA 4ZXGA 2R4VA 4ZBDA 2PMTA 4NMUA 5HR3A 4AGSA 1OC9A 2DMMA 3VWXA 2F51A 5IQYA 1OE8A 4RI7A 3GYKA 7GSSA 2H30A 1JLVA 1T7PB 1Z7RA 18GSA 4ZB7A 2VLUA 2N5AA 4IHUA 3OR5A 1TU7A 1T8EB 2C3TA 1K0DA 3F4RA 2JZRA 3CBUA 4RQRA 2K6VA 1MTCA 1ZMAA 4MABA 2P5QA 1SJ6A 1GWCA 4FYBA 5G30A 2HXKA 1AIUA 2HFDA 4Z2TA 1G0TA 4YQUA 1GSSA 5HFIA 3F4SA 1SD9A 2HSMA 1EZKA 2IL3A 4ZIJA 3CWGA 1KBNA 1THOA 4POMA 1TOFA 2WCIA 1BX9A 1GSUA 2H70A 4TR1B 3APSA 2F3MA 3F9UA 1DE2A 4BA7A 2F8FA 4KSOA 4YKGA 2CVKA 5IMDA 3UAPA 5H5SA 2P5RA 2V41A 2LNTA 3CMIA 3HKRA 1A2JA 1WWJA 2PPTA 1TXUA 5JCWA 1G6YA 3FYGA 1GUMA 3TCOA 1NHYA 4MJAA 4Q5QA 3EC3A 2GDRA 1JLWA 2CX4A 1ZYPA 4ILFA 2VCXA 1GLQA 1B9YC 5ECPB 4BVXA 1MD3A 1O85A 5DQSA 4GLTA 3LJRA 1XOAA 3G7YA 3RPNA 2RUEA 4HUAA 4IQAA 4K5SA 1GUKA 2H1BA 1FB0A 4JZQA 3DVXA 4N11A 2OE1A 1HNAA 1Q4JA 4QL9A 1S3CA 2YP6A 5JWQB 5CNWA 4NV2A 5J3RA 2UZ8A 1TRSA 4DSSB 1ST9A 3VI7A 3Q74A 1VRSD 4MJEA 4MP4A 3IBHA 1UA5A 2WS2A 1Z3EA 1PX7A 3HXSA 2N5BA 1PN9A 4O92A 1ZZYA 4GWRA 1VF3A 3ME7A 2HRAA 3HVXA 5CAXA 1QFNA 4ECJA 1YQ1A 3F8UA 5D9VA 4KCEA 2P31A 2BMXA 4HU7A 4J56E 4EXJA 5GZZB 1ACVA 1F2EA 3EWLA 2FWGA 2KP2A 5ELAA 3SWLA 3QAVA 4O5QA 4XCSA 1K0OA 1JZOA 1TW9A 2YCDA 4BVYB 3FZ9A 2GS3A 2AYTA 4E68A 1SK0A 5ECSA 1YVLA 4MDCA 3IHGA 2JSZA 3GX8A 1U87A 3PINA 2CAIA 2R0GA 4GSTA 3APOA 3L9UA 3KXOA 4ZB9A 2IJYA 4L0UA 4CHSA 1SL0B 2HZEB 3C8EA 3MDKA 4KNDA 3UVHA 2PGTA 4TR3A 3IK9A 1SD8A 5GSTA 1VGLA 3J7Yk 5D9XA 5J9BA 4X4JA 1A0FA 2CZ2A 4TR1A 2OT3A 4CY6A 3I6AA 5IOXA 4GTUA 2HI7A 3TRXA 1PRXA 1QXHA 2H76A 1EV4A 3KJYA 3MIXA 5AGYA 2VLTA 2VL2A 3ZRDA 4F82A 3DXBA 3IK7A 3PH9A 3D22A 4BWQA 5IPGA 3F3RA 2O5VA 2MYGA 5ID2B 4XS4A 4MZCA 5HR0A 1K0BA 4V2LA 5C04A 2EFDA 2ON7A 2WB9A 3GX0A 4LA1A 2J23A 2H1GA 4ULXA 3TKSA 1X9WB 2VO4A 4IJIA 3ZFLA 2HZFA 2O7KA 4BPYA 3TRPA 1GNWA 4BL7A 1T4ZA 1GH2A 2JACA 3ZMLA 5J4UA 4CY8A 1XWBA 2FWEA 4RQXA 4DSSA 4X1UA 1ABAA 2R6KA 2IWTA 2L59A 1IYIA 1FOHA 3DMLA 2X8CA 2C0DA 2GQMA 4N3ZA 5B7CA 2WZ9A 5COHA 4I6XA 1M2BA 2H8LA 5GAND 1AAZA 2IIYA 2H0IA 1AUCA 2QC7A 5CRGA 3FY7A 4OWYA 2A4HA 4HZ4A 3IC4A 1SL2B 2LRTA 1PQNA 2VIMA 4MZWA 1BYEA 2N5FA 2M80A 4ZL9A 1X0RA 1J0FA 2V32A 4XS1A 2GSRA 3Q19A 4ECCA 3LWAA 2I1UA 2TRXA 4KUNA 3CSJA 5BMUB 1N2AA 3D0ZA 4I5QA 1OKTA 4BVYA 2BJXA 2VD1A 1HNCA 1Z5YE 2HRNA 2KHPA 2KLXA 3I9V2 1PGTA 1Z6MA 4POLA 2PU9C 4FYCA 5C00A 5FT3A 2FY6A 3LYPA 4EL1A 1A8YA 13GSA 2IMFA 2GQKA 5A5HB 4FO5A 5F8BA 2GSTA 1YEPA 3GSTA 2C0FA 4YQMA 4I2TA 5CO3A 3HMJG 4PQ1A 4L0WA 4K8MA 4O5RA 1ZGNA 4HU9A 2YZUA 3VK9A 1TU8A 1JZRA 3E9JB 3GSSA 1OC9B 3UBKA 2OE0A 1YF1A 3HVSA 2VCWA 4LMWA 5B8AA 4HJMA 3WYWA 1OC8A 3TKSE 1FG4A 5ECOB 1M9AA 1V57A 4POBA 5H5QA 1SVLA 5B6MA 4F0CA 3TKRA 3KH9A 3GMFA 3C1RA 4TXVA 2R5GA 1EGOA 3IHQA 2EIOA 2DKHA 2JZSA 3WT1A 1ZYEA 1M9BA 5H5RA 1Z7PA 3GIXA 2HSMB 2MZCA 1BAYA 4V2NA 5A34A 1B9XC 2I4AA 4JBBA 2O85A 5HR2A 2V1MA 3BCKA 3BCIA 4WR5A 2H72A 2LS5A 1O73A 3HVVA 4KH7A 2DIZA 3ZITA 1VF4A 5DJLA 1ERVA 5G2ZA 11GSA 2RUFA 3GHAA 4H86A 5ENUA 3HCZA 1BJXA 5IIZA 3VWVA 1RW1A 5INYA 1BG1A 4V1Ag 1QK8A 5AISA 2QA2A 4MNNA 4K2XA 5JWRB 1ZYNA 3GFKA 22GSA 1BQ7A 5FHIA 2FCHA 3E3EA 4BVXB 2LKUA 1OC3A 4OCEA 5IOWA 2FWFA 1B4PA 1SL1B 5D73A 3LYKA 1F37A 3GV1A 3TB2A 2C3QA 1K3YA 3EU4A 1M0UA 4IVFA 1PX6A 2CX3A 3FZAA 4GF0A 17GSA 1N25A 3QMXA 1T1VA 2VCTA 4Z7XA 3PGTA 2AJQB 3ZLPA 1BEDA 1HD2A 4HS1A 4IW9A 1XOBA 1OE7A 5A5HA 5DCHA 3BBYA 2OA7A 4X43A 2A2RA 4PNGA 4XS6A 3DVWA 2G2QA 4PX1A 4HJ2A 1MDIA 2BTOT 3QFBC 1G7OA 4XRDA 2DBCA 3TJGA 5F05A 3ZIJA 1SKWB 4G9HA 1XW9A 3D4MA 1SVMA 3HZ8A 2V2GA 1NM3A 3TRQA 2AV4A 4WXTA 3CSIA 3EU3A 1YY7A 1U88A 4MH2A 1W4VA 4MPFA 1XPVA 4AF2A 3TDGA 1M2DA 2X4AA 3A5WA 3KCMA 4FYUA 5G5EA 1XVQA 1GL8A 3EPTA 5AIXA 5AN1A 2C3NA 4N30A 2L5OA 3ZVJD 1SYRA 3LORA 4I8BA 5EVOA 2HSYA 4MF7A 3C1SA 1XCCA 1HYUA 1USBA 1K0AA 2NTOA 2B3SA 3LGCA 4K7NA 3ED3A 4WBJA 1TRUA 4G0LA 4IQ1A 5IMAA 3R2QA 3P7XA 2PUKC 3LFLA 2LRNA 3RHBA 3WGEA 3ERGA 2TRCP 1BF5A 3FR3A 3LSZA 1IYHA 1TP9A 4ZB8A 1EEMA 4K2DA 1ERUA 1O8WA 4GCIA 2H6ZA 2I3YA 2L4CA 5B8BA 4ID0A 3CRTA 4USSA 4ISDA 3KEBA 3I69A 2VOCA 3ERWA 2REMA 5B6NA 4IP1A 1YZXA 1TI1A 4W66A 4JR6A 1TK0B 3U5RE 3FW2A 3CSHA 1FVJA 4ECBA 1MD4A 4XS4B 3PPUA 5ECQB 4WF4A 2HNLA 3HYPA 3S9FA 1RQMA 3R3EA 4FQUA 2C0GA 1F6MC 3E0UA 2CZ3A 1PSQA 2OBIA 5KN0A 3M8NA 1YDKA 5HFKA 4BL7B 3DYRA 1S3DA 2LV3A 2P0GA 1EGRA 1R5AA 4TW5A 3RHCA 2X49A 2VL9A 3RBTA 2NVLA 3DIEA 4TRXA 1E2YA 2FUG2 1M2AA 1G7EA 3F3QA 1PD21 2H6XA 4BWSA 1A2MA 1WPIA 3BJ5A 1X5CA 3EE2A 4WEYA 5AIVA 3LG6A 1EOHA 4AJ8A 3L4NA 4EF0A 2YV9A 3IAS2 4DEJA 1ERWA 3KTLA 4NHWA 5EL8A 1PKWA 8GSSA 2JSYA 5DDLA 4XRAA 2H0GA 4HOJA 2G0FA 12GSA 5DALB 2DKIA 1ERTA 3C71A 3QOUA 4PUFC 1EWXA 3G7JA 3RAZA 2XHFA 3FRCA 3ISOA 1WOUA 4KA0A 4EE0A 2YZHA 2VCVA 5IO0A 4EKZA 1XVWA 1GRXA 4K0NA 4G01A 2PVOC 4TVEA 3EMPA 2B7JA 2MMAA 4MMMA 3Q6OA 2DIYA 1R7HA 3GH6A 3ZTLA 1GSFA 3F0IA 4DSQA 3D5JA 2HLSA 4IN0A 3ZMKA 3US3A 1DSBA 2K8VA 2H19A 5JWOB 4KDXA 3JCML 5F06A 4EIQA 1ZL9A 2IPAA 9GSSA 3GA4A 4XIHA 2WJUA 1AQWA 3WD6A 1THXA 4XTSA 1XWGA 4J2FA 1SKRB 2CVBA 2F9SA 16GSA 4HDEA 5J47A 2LSTA 1F3BA 1B8XA 2DMLA 3FEUA 1XW5A 1B48A 4X0XA 1YJ6A 4YKFA 1YF0A 5L71A 1ILOA 3IOSA 4YH2A 2IFQA 1FVKA 1K0CA 1GP1A 1GULA 2XPEA 3LEFA 1NSWA 4PNFA 3LW9A 3EYTA 4AJ7A 1W89A 3AY8A 2DJ2A 1MDJA 1Z6NA 1V9WA 4MZBA 1GTBA 1TXXA 3NOFA 2B1KA 2GSSA 2VM1A 5DAKA 3D6IA 3MYDA 2M72A 5ECKB 5D9TA 3FR9A 3ERFA 5IPHA 5ECRB 4PGTA 3QDNA 3IR4A 5A34B 1Y25A 3M3MA 2OE3A 1O7UA 1QGVA 4GDFA 1VF1A 3HZ4A 1HQOA 3TUEA 2GSQA 3TJJA 5ECHB 6GSXA 2XBIA 5KOXA 4Z2UA 1JZWA 4RUVA 2H71A 2HRKB 4PUAA 4G0KA 2E0QA 3CYNA 5GAPD 4PXOA 1H4OA 5LCZA 4ZL8A 1GSDA 5EY6A 6GSTA 3KM6A 2VCQA 2LNSA 1SK2A 2OADA 1YKCA 4TOPA 3L78A 3HJOA 2M46A 5DALA 2C0EA 2V6OA 2C8UA 3FZ4A 2DJKA 1ML6A 4ZB6A 3EVIA 6GSSA 1WJKA 4TR0A 2ALBA 2HRFA 5IMVA 1GUHA 2FA8A 3Q18A 2O89A 1YKAA 5DCGA 4K9ZA 2DC5A 4IGJA 3FZ5A 1O8XA 4AKXB 2GZZA 5CRHA 1EOGA 3KIJA 1WP0A 4AKGA 3D21A 1AC1A 1GTAA 2WULA 3VLNA 4E8EA 3WGDA 4WR4A 2H6YA 3TGZA 4DSRA 2ZUPA 3C73A 4HI7A 2YANA 5IMCA 3TJFA 4NPBA 5ECNB 2JL4A 2OKAA 1K0NA 5ECLB 4EVMA 1XFLA 2HSHA 1GSYA 3RPPA 5D96A 1TK5B 1X5EA 3UJ1A 1JHBA 5DJMA 2MBTA 4HQSA 4POKA 3GUSA 2VAFA 3WT2A 4WBRD 3LXTA 3J7Yb 1F9MA 2X8GA 2I9HA 1FOVA 2A2PA 3GH9A 1C72A 2YWNA 1MDKA 5E59A 2H0HA 4IJ3A 2L4QA 4A5PA 1V58A 4IKHA 1K3LA 2LTKA 4K5RA 2YWIA 2FA4A 3APQA 1A2LA 3ZL5A 1F3AA 2PBJA 4Q5NA 1UC7A 4XHMA 1OAZA 2LJKA 2B5YA 2EFEA 2HQTA 4KCAA 1SU9A 4ML1A 4PQHA 3H1NA 3A5IA 4N10A 2I81A 2GTUA 2X64A 2L5LA 2L6DA 1HNBA 4TXOA 5D93A 1I5GA 1S3AA 4CDOA 4JR4A 4GQCA 3N5OA 2YV7A 1R5PA 2CA8A 2YOIA 5HFGA 3ZFBA 5F0GA 3H79A 2HRKA 2B7KA 3DRNA 2HSNA 3UL3A 3ZVJA 4N0VA 3VPQA 2VM2A 3IAM2 2PERA 4MCUA 4EO3A 2R3XA 3ZREA 4ACSA 1AXDA 3EINA 3GURA 1U3AA 2OJLA 3KD0A 4K0GA 3M9JA 3W6GA 3MAKA 2JZTA 1JFUA 4ICYA 2WRTA 4QMKA 2E7PA 1R26A 4F03A 1XWKA 3KP9A 1AW9A 4JEDA 4PQIA 1GSQA 2DJ3A 2B5XA 2DJJA 2ZNMA 4J57E 3QAWA 3G7IA 2R2JA 3F4TA 3QCPA 2MBSA 3BOAA 4NXIA 3C7MA 4CW9A 1A24A 3KZQA 4PTSA 4ECIA 4JU5A 2H01A 3TOUA 4GXZA 3FMWA 1Q98A 4NWYA 1PMTA 1XW6A 2E2MA 1PKZA 1TI3A 1PA3A 4HEA2 3ZZXA 2F8AA 3HHVA 2H1LA 2UV8G 4KE3A 2AAWA 3K8NA 1PL1A 4K7OA 3DKSA 4OFTA 3O76A 4K6XA 5CP1A 2FLSA 4KDUA 1SVOA 3CTGA 3IDVA 3GTUA 2H66A 2YJHA 1UN2A 3MWHA 4GSNA 3UMAA 3A2XA 1OVNA 2AHEA 2ZCTA 3BD2A 3LQ7A 3TJBA 3VURA 2YNXA 2NPBA 4GSSA 4L5LA 5A5KA 2GZPA 3DD3A 1AQXA 4NV5A 3VFIA 2PVQA 2L6CA 3DWVA 5JCUA 2B5EA 3TKPA 2R0CA 6GSVA 4IELA 3QAGA 1TRVA 4ZL7A 5IMZA 3PR8A 4EIPA 3CXGA 3ZYWA 3G9BA 3FK8A 4KW6A 1FAAA 2RIIA 1M99A 4HZ2A 5ELGA 1X5DA 2WGRA 3KP8A 3WGXA 19GSA 4F9ZA 2CQ9A 4MF6A 4GRFA 2IFQB 1SJZA 4ZBBA 4EUYA 3TOTA 1KTEA 4MF5A 2OBKA 3HJPA 4EDYA 3P2AA 3W8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL3 A;  2FD3 A;  2O87 A;  4N0Z A;  2LJA A;  5HR1 A;  4G10 A;  2LJR A;  1X9M B;  5DAK B;  3L9V A;  1EV9 A;  1XZO A;  2GZY A;  1N8J A;  3KMO A;  3NZN A;  2DJ0 A;  3I43 A;  4MH3 A;  2VUP A;  4KGI A;  5D8I A;  3H4K A;  1K3O A;  4OO4 A;  3CTF A;  2FWH A;  4OCF A;  2MMO A;  5G1K A;  2K18 A;  1OKD A;  3GNJ A;  2CVD A;  1WMJ A;  3UBL A;  2E2G A;  5LNK e;  4KAE A;  4Q5F A;  2X99 A;  2CAQ A;  1QMV A;  1XWA A;  4I2U A;  3FKF A;  4PUR A;  4K1F A;  2YWM A;  3QD9 A;  2A4V A;  1A8L A;  1GTU A;  4D73 A;  1TDI A;  4MK3 A;  1ZOF A;  1M7T A;  2YPM A;  1URM A;  4KDY A;  4ZBA A;  3GN3 A;  3QPM A;  5J5N A;  4YQV A;  1EEJ A;  1JZD A;  1GNE A;  2AUV A;  2FHE A;  2K9F A;  4WET A;  2DSA A;  3HD5 A;  3UVT A;  5CYY A;  4GQF A;  3IPZ A;  1TK8 B;  1H75 A;  1AQV A;  1FHE A;  2R37 A;  3KH7 A;  1YEX A;  3W8S A;  4LMV A;  5LD0 A;  2KOK A;  1FW1 A;  1XBS A;  4YAV A;  4ML6 A;  4V1A p;  4EC0 A;  5A4W A;  1KEB A;  3P8W A;  3ZIV A;  5F07 A;  4TR4 A;  5G5F A;  4OMV A;  2HE3 A;  3GRX A;  2NBS A;  3A2V A;  3UEM A;  20GS A;  6GSY A;  2QKE A;  3CRU A;  2RM6 A;  6GSW A;  2WDU A;  3D4T A;  2B1L A;  4IP6 A;  2KP1 A;  5CRD A;  1CQG A;  1G6W A;  2C4J A;  1GTI A;  1SK1 A;  2IMI A;  1V98 A;  4KSM A;  2JU5 A;  2CV4 A;  2KUC A;  3FR6 A;  5EPF A;  2VLV A;  2XPD A;  5ECM B;  3KMN A;  4I97 A;  1R4W A;  2JAD A;  4HQZ A;  1LJR A;  3GKM A;  10GS A;  3IA1 A;  4TXO B;  2LEG A;  2DLX A;  4NHZ A;  4F0B A;  4RI6 A;  2O8V B;  2TIR A;  4L5O A;  2PWJ A;  3IV4 A;  5FWG A;  3HJM A;  1Z9H A;  4OFM A;  2HSN B;  1FO5 A;  3GKN A;  2K8S A;  4FIW A;  4MJB A;  6GSU A;  2YJ7 A;  1KNG A;  5IM9 A;  5JCG A;  3VWU A;  2GVP A;  3GKX A;  2H1A A;  3O3T A;  1X9S B;  4TN8 A;  1LBK A;  1TRW A;  2VL2 C;  14GS A;  1TJD A;  5A4V A;  4LLR A;  5DQY A;  2IN3 A;  2QSI A;  5CRE A;  3N9J A;  1DBY A;  1V40 A;  3UIW A;  1E6B A;  4V2M A;  2DJ1 A;  1U6T A;  4LL1 B;  5HQP A;  3VPT A;  2GQL A;  2H73 A;  5ABR A;  2GT5 A;  4OD7 A;  5KN2 A;  3TKS C;  3EMX A;  4TKY A;  1WRY A;  1XXU A;  2ON5 A;  4AJ6 A;  4IS0 A;  2X8H A;  3L0H A;  1A0R P;  2H1D A;  3KGK A;  2H75 A;  2L57 A;  2C80 A;  2XBQ A;  4QL7 A;  3TJK A;  3SBC A;  4O7H A;  2PN8 A;  1ON4 A;  2MMZ A;  2C1Y A;  3F6F A;  1XWC A;  5GSS A;  5J41 A;  3H93 A;  5KN1 A;  1EP8 A;  1U3I A;  2XC2 A;  1ZCP A;  1FB6 A;  1I9D A;  2HZE A;  4MJC A;  1T00 A;  2GGT A;  2VCZ A;  1A23 A;  5IMF A;  4MA9 A;  4P3Y B;  3U6V A;  4YAP A;  1J9B A;  2IME A;  3IC8 A;  3M9K A;  5E4W A;  3M0F A;  4WKW A;  3M1G A;  1GLP A;  4DVC A;  5KN3 A;  1TKD B;  2VD0 A;  3P90 A;  2RLI A;  3UOM A;  2Z9S A;  4QQ7 A;  1SYX A;  2LQQ A;  5ID2 A;  2GLR A;  3GTU B;  3ME8 A;  1T4Y A;  3DGQ A;  4LL4 B;  5CRW A;  2V6K A;  1TTZ A;  2NDO A;  2GT6 A;  3HDC A;  3VI5 A;  3RDW A;  1SEN A;  2IMD A;  2YN1 A;  2LQO A;  4OO5 A;  2H74 A;  5A4U A;  4F2I A;  4L8E A;  4MLY A;  1RK4 A;  3MNG A;  2D2Z A;  3V1W A;  1T3B A;  1VF2 A;  1SKS B;  1O6J A;  1MEK A;  3EUR A;  4Q5R A;  4KB3 A;  3HY2 A;  1CQH A;  3VWW A;  3KTB A;  4MPG A;  2AB6 A;  5G1L A;  3QFA C;  4O32 A;  3A2W A;  4E8H A;  5DVB A;  3F63 A;  2CT6 A;  5IO2 A;  1UVZ A;  3NIV A;  2EIQ A;  5KEJ A;  2HT9 A;  1EP7 A;  4G0I A;  3GL5 A;  2B6M A;  1OYJ A;  1GSE A;  1B4Q A;  1PL2 A;  3F6D A;  4ZIL A;  4JE1 A;  4JRR A;  5D9W A;  4G2E A;  3DEX A;  3IXR A;  3A3T A;  4KF9 A;  1WIK A;  3TKQ A;  1QUW A;  3FHK A;  1LU4 A;  5BMU A;  4EDZ A;  1BG5 A;  1NW2 A;  1V2A A;  1J08 A;  4WF5 A;  3GKK A;  4OFN A;  4IBP A;  2WFC A;  3LXZ A;  4FH8 A;  4KX4 A;  2RM5 A;  4NAX A;  1WE0 A;  2ES7 A;  2A2S A;  2FGX A;  3O6T A;  3H8Q A;  1QQ2 A;  2EC4 A;  5J9C A;  3HA9 A;  2YWO A;  1DUG A;  4G19 A;  1NHO A;  3IE3 A;  2J9H A;  3L9S A;  2LRC A;  1SJI A;  1DE1 A;  2LUS A;  1Y6E A;  3GL3 A;  1ZYQ B;  4K7I A;  3IRA A;  3MSZ A;  2IMK A;  2HYX A;  5ECI B;  3UAR A;  2QGV A;  2OAC A;  2EIR A;  1XIY A;  1K0M A;  3QR6 A;  5G31 A;  4D73 B;  2MMN A;  1O81 A;  5DBQ A;  2FNO A;  4ZXG A;  2R4V A;  4ZBD A;  2PMT A;  4NMU A;  5HR3 A;  4AGS A;  1OC9 A;  2DMM A;  3VWX A;  2F51 A;  5IQY A;  1OE8 A;  4RI7 A;  3GYK A;  7GSS A;  2H30 A;  1JLV A;  1T7P B;  1Z7R A;  18GS A;  2VLU A;  2N5A A;  4IHU A;  3OR5 A;  1TU7 A;  1T8E B;  2C3T A;  1K0D A;  3F4R A;  2JZR A;  3CBU A;  4RQR A;  2K6V A;  1MTC A;  1ZMA A;  4MAB A;  2P5Q A;  1SJ6 A;  1GWC A;  4FYB A;  5G30 A;  2HXK A;  1AIU A;  2HFD A;  1G0T A;  4YQU A;  1GSS A;  5HFI A;  3F4S A;  1SD9 A;  2HSM A;  1EZK A;  2IL3 A;  4ZIJ A;  1KBN A;  1THO A;  4POM A;  1TOF A;  2WCI A;  1BX9 A;  1GSU A;  2H70 A;  4TR1 B;  3APS A;  2F3M A;  3F9U A;  1DE2 A;  4BA7 A;  2F8F A;  4KSO A;  2CVK A;  5IMD A;  3UAP A;  5H5S A;  2P5R A;  2V41 A;  2LNT A;  3CMI A;  3HKR A;  1A2J A;  1WWJ A;  2PPT A;  5JCW A;  1G6Y A;  3FYG A;  1GUM A;  3TCO A;  1NHY A;  4MJA A;  4Q5Q A;  3EC3 A;  2GDR A;  1JLW A;  2CX4 A;  4ILF A;  2VCX A;  1GLQ A;  1B9Y C;  5ECP B;  4BVX A;  1MD3 A;  1O85 A;  5DQS A;  4GLT A;  3LJR A;  1XOA A;  3G7Y A;  3RPN A;  2RUE A;  4HUA A;  4IQA A;  1GUK A;  2H1B A;  1FB0 A;  4JZQ A;  3DVX A;  4N11 A;  2OE1 A;  1HNA A;  1Q4J A;  4QL9 A;  1S3C A;  2YP6 A;  5JWQ B;  5CNW A;  4NV2 A;  5J3R A;  2UZ8 A;  1TRS A;  4DSS B;  1ST9 A;  3VI7 A;  3Q74 A;  1VRS D;  4MJE A;  4MP4 A;  3IBH A;  1UA5 A;  2WS2 A;  1Z3E A;  1PX7 A;  3HXS A;  2N5B A;  1PN9 A;  4O92 A;  1ZZY A;  4GWR A;  1VF3 A;  3ME7 A;  2HRA A;  3HVX A;  5CAX A;  1QFN A;  4ECJ A;  1YQ1 A;  3F8U A;  5D9V A;  4KCE A;  2P31 A;  2BMX A;  4HU7 A;  4J56 E;  4EXJ A;  5GZZ B;  1ACV A;  1F2E A;  3EWL A;  2FWG A;  2KP2 A;  5ELA A;  3SWL A;  3QAV A;  4XCS A;  1K0O A;  1JZO A;  1TW9 A;  2YCD A;  4BVY B;  3FZ9 A;  2GS3 A;  2AYT A;  1SK0 A;  5ECS A;  4MDC A;  2JSZ A;  3GX8 A;  1U87 A;  3PIN A;  2CAI A;  4GST A;  3APO A;  3L9U A;  3KXO A;  4ZB9 A;  2IJY A;  4L0U A;  4CHS A;  1SL0 B;  2HZE B;  3C8E A;  3MDK A;  4KND A;  3UVH A;  2PGT A;  4TR3 A;  3IK9 A;  1SD8 A;  5GST A;  1VGL A;  3J7Y k;  5D9X A;  5J9B A;  1A0F A;  2CZ2 A;  4TR1 A;  3I6A A;  5IOX A;  4GTU A;  2HI7 A;  3TRX A;  1PRX A;  1QXH A;  2H76 A;  1EV4 A;  3KJY A;  5AGY A;  2VLT A;  2VL2 A;  3ZRD A;  4F82 A;  3DXB A;  3IK7 A;  3PH9 A;  3D22 A;  4BWQ A;  5IPG A;  3F3R A;  2MYG A;  5ID2 B;  4XS4 A;  4MZC A;  5HR0 A;  1K0B A;  4V2L A;  5C04 A;  2ON7 A;  2WB9 A;  3GX0 A;  4LA1 A;  2J23 A;  2H1G A;  4ULX A;  3TKS A;  1X9W B;  2VO4 A;  4IJI A;  3ZFL A;  2HZF A;  2O7K A;  4BPY A;  3TRP A;  1GNW A;  4BL7 A;  1T4Z A;  1GH2 A;  2JAC A;  3ZML A;  5J4U A;  1XWB A;  2FWE A;  4RQX A;  4DSS A;  4X1U A;  1ABA A;  2R6K A;  2IWT A;  2L59 A;  1IYI A;  3DML A;  2X8C A;  2C0D A;  2GQM A;  5B7C A;  2WZ9 A;  5COH A;  4I6X A;  1M2B A;  2H8L A;  5GAN D;  1AAZ A;  2IIY A;  2H0I A;  1AUC A;  2QC7 A;  5CRG A;  3FY7 A;  4OWY A;  4HZ4 A;  3IC4 A;  1SL2 B;  2LRT A;  1PQN A;  2VIM A;  4MZW A;  1BYE A;  2N5F A;  2M80 A;  4ZL9 A;  1X0R A;  1J0F A;  2V32 A;  4XS1 A;  2GSR A;  3Q19 A;  4ECC A;  3LWA A;  2I1U A;  2TRX A;  4KUN A;  3CSJ A;  1N2A A;  4I5Q A;  3D0Z A;  1OKT A;  4BVY A;  2BJX A;  2VD1 A;  1HNC A;  1Z5Y E;  2HRN A;  2KHP A;  2KLX A;  3I9V 2;  1PGT A;  1Z6M A;  4POL A;  2PU9 C;  4FYC A;  5C00 A;  5FT3 A;  2FY6 A;  3LYP A;  4EL1 A;  1A8Y A;  13GS A;  2IMF A;  2GQK A;  4FO5 A;  5F8B A;  2GST A;  1YEP A;  3GST A;  2C0F A;  4YQM A;  4I2T A;  5CO3 A;  4PQ1 A;  4L0W A;  4K8M A;  4O5R A;  1ZGN A;  4HU9 A;  2YZU A;  3VK9 A;  1TU8 A;  1JZR A;  3E9J B;  3GSS A;  1OC9 B;  3UBK A;  2OE0 A;  1YF1 A;  3HVS A;  2VCW A;  4LMW A;  5B8A A;  4HJM A;  3WYW A;  1OC8 A;  3TKS E;  1FG4 A;  5ECO B;  1M9A A;  1V57 A;  4POB A;  5H5Q A;  5B6M A;  4F0C A;  3TKR A;  3KH9 A;  3GMF A;  3C1R A;  4TXV A;  2R5G A;  1EGO A;  3IHQ A;  2EIO A;  2JZS A;  3WT1 A;  1ZYE A;  1M9B A;  5H5R A;  1Z7P A;  3GIX A;  2HSM B;  2MZC A;  1BAY A;  4V2N A;  1B9X C;  2I4A A;  4JBB A;  2O85 A;  5HR2 A;  2V1M A;  3BCK A;  3BCI A;  4WR5 A;  2H72 A;  2LS5 A;  1O73 A;  3HVV A;  4KH7 A;  2DIZ A;  3ZIT A;  1VF4 A;  5DJL A;  1ERV A;  5G2Z A;  11GS A;  2RUF A;  3GHA A;  4H86 A;  5ENU A;  3HCZ A;  1BJX A;  5IIZ A;  3VWV A;  1RW1 A;  5INY A;  4V1A g;  1QK8 A;  5AIS A;  5JWR B;  3GFK A;  22GS A;  1BQ7 A;  5FHI A;  2FCH A;  3E3E A;  4BVX B;  2LKU A;  1OC3 A;  4OCE A;  5IOW A;  2FWF A;  1B4P A;  1SL1 B;  5D73 A;  3LYK A;  1F37 A;  3GV1 A;  3TB2 A;  2C3Q A;  1K3Y A;  3EU4 A;  1M0U A;  4IVF A;  1PX6 A;  2CX3 A;  3FZA A;  4GF0 A;  17GS A;  3QMX A;  1T1V A;  2VCT A;  4Z7X A;  3PGT A;  2AJQ B;  3ZLP A;  1BED A;  1HD2 A;  4HS1 A;  4IW9 A;  1XOB A;  1OE7 A;  5DCH A;  3BBY A;  2OA7 A;  4X43 A;  2A2R A;  4PNG A;  4XS6 A;  3DVW A;  2G2Q A;  4PX1 A;  4HJ2 A;  1MDI A;  2BTO T;  3QFB C;  1G7O A;  4XRD A;  2DBC A;  3TJG A;  5F05 A;  3ZIJ A;  1SKW B;  4G9H A;  1XW9 A;  3D4M A;  3HZ8 A;  2V2G A;  1NM3 A;  3TRQ A;  2AV4 A;  4WXT A;  3CSI A;  3EU3 A;  1YY7 A;  1U88 A;  4MH2 A;  1W4V A;  4MPF A;  1XPV A;  4AF2 A;  3TDG A;  1M2D A;  3A5W A;  3KCM A;  4FYU A;  5G5E A;  1XVQ A;  1GL8 A;  5AIX A;  5AN1 A;  2C3N A;  4N30 A;  2L5O A;  3ZVJ D;  1SYR A;  3LOR A;  4I8B A;  5EVO A;  2HSY A;  4MF7 A;  3C1S A;  1XCC A;  1HYU A;  1USB A;  1K0A A;  2NTO A;  2B3S A;  3LGC A;  4K7N A;  3ED3 A;  4WBJ A;  1TRU A;  4G0L A;  4IQ1 A;  5IMA A;  3R2Q A;  3P7X A;  2PUK C;  3LFL A;  2LRN A;  3RHB A;  3WGE A;  3ERG A;  2TRC P;  3FR3 A;  3LSZ A;  1IYH A;  1TP9 A;  4ZB8 A;  1EEM A;  4K2D A;  1ERU A;  1O8W A;  4GCI A;  2H6Z A;  2I3Y A;  2L4C A;  5B8B A;  4ID0 A;  3CRT A;  4USS A;  4ISD A;  3KEB A;  3I69 A;  2VOC A;  3ERW A;  2REM A;  5B6N A;  4IP1 A;  1YZX A;  1TI1 A;  1TK0 B;  4JR6 A;  3U5R E;  3FW2 A;  3CSH A;  1FVJ A;  4ECB A;  1MD4 A;  4XS4 B;  3PPU A;  5ECQ B;  4WF4 A;  2HNL A;  3HYP A;  3S9F A;  1RQM A;  3R3E A;  4FQU A;  2C0G A;  1F6M C;  3E0U A;  2CZ3 A;  1PSQ A;  2OBI A;  5KN0 A;  3M8N A;  1YDK A;  5HFK A;  4BL7 B;  3DYR A;  1S3D A;  2LV3 A;  2P0G A;  1EGR A;  1R5A A;  4TW5 A;  3RHC A;  2VL9 A;  3RBT A;  2NVL A;  3DIE A;  4TRX A;  1E2Y A;  2FUG 2;  1M2A A;  1G7E A;  3F3Q A;  1PD2 1;  2H6X A;  4BWS A;  1A2M A;  1WPI A;  3BJ5 A;  1X5C A;  3EE2 A;  4WEY A;  5AIV A;  3LG6 A;  1EOH A;  4AJ8 A;  3L4N A;  4EF0 A;  2YV9 A;  3IAS 2;  4DEJ A;  1ERW A;  3KTL A;  4NHW A;  5EL8 A;  1PKW A;  8GSS A;  2JSY A;  5DDL A;  4XRA A;  2H0G A;  4HOJ A;  2G0F A;  12GS A;  5DAL B;  1ERT A;  3C71 A;  3QOU A;  4PUF C;  1EWX A;  3G7J A;  3RAZ A;  2XHF A;  3FRC A;  3ISO A;  1WOU A;  4KA0 A;  4EE0 A;  2YZH A;  2VCV A;  5IO0 A;  4EKZ A;  1XVW A;  1GRX A;  4K0N A;  2PVO C;  4TVE A;  3EMP A;  2B7J A;  2MMA A;  4MMM A;  3Q6O A;  2DIY A;  1R7H A;  3GH6 A;  3ZTL A;  1GSF A;  3F0I A;  4DSQ A;  3D5J A;  2HLS A;  4IN0 A;  3ZMK A;  3US3 A;  1DSB A;  2K8V A;  2H19 A;  5JWO B;  4KDX A;  3JCM L;  5F06 A;  1ZL9 A;  2IPA A;  9GSS A;  3GA4 A;  4XIH A;  2WJU A;  1AQW A;  3WD6 A;  1THX A;  4XTS A;  1XWG A;  4J2F A;  1SKR B;  2CVB A;  2F9S A;  4HDE A;  16GS A;  2LST A;  1F3B A;  1B8X A;  2DML A;  3FEU A;  1XW5 A;  1B48 A;  4X0X A;  1YJ6 A;  1YF0 A;  5L71 A;  1ILO A;  3IOS A;  4YH2 A;  2IFQ A;  1FVK A;  1K0C A;  1GP1 A;  1GUL A;  2XPE A;  3LEF A;  1NSW A;  4PNF A;  3EYT A;  4AJ7 A;  1W89 A;  3AY8 A;  2DJ2 A;  1MDJ A;  1Z6N A;  1V9W A;  4MZB A;  1GTB A;  1TXX A;  3NOF A;  2B1K A;  2GSS A;  2VM1 A;  5DAK A;  3D6I A;  2M72 A;  5ECK B;  5D9T A;  3FR9 A;  3ERF A;  5IPH A;  5ECR B;  4PGT A;  3QDN A;  3IR4 A;  1Y25 A;  3M3M A;  2OE3 A;  1O7U A;  1QGV A;  1VF1 A;  3HZ4 A;  1HQO A;  3TUE A;  2GSQ A;  3TJJ A;  5ECH B;  6GSX A;  2XBI A;  1JZW A;  4RUV A;  2H71 A;  2HRK B;  4PUA A;  4G0K A;  2E0Q A;  3CYN A;  5GAP D;  4PXO A;  1H4O A;  5LCZ A;  4ZL8 A;  1GSD A;  5EY6 A;  6GST A;  3KM6 A;  2VCQ A;  2LNS A;  1SK2 A;  2OAD A;  1YKC A;  4TOP A;  3L78 A;  3HJO A;  2M46 A;  5DAL A;  2C0E A;  2V6O A;  2C8U A;  3FZ4 A;  2DJK A;  1ML6 A;  4ZB6 A;  3EVI A;  6GSS A;  1WJK A;  4TR0 A;  2ALB A;  2HRF A;  5IMV A;  1GUH A;  2FA8 A;  3Q18 A;  2O89 A;  1YKA A;  5DCG A;  4K9Z A;  2DC5 A;  4IGJ A;  3FZ5 A;  1O8X A;  2GZZ A;  5CRH A;  1EOG A;  3KIJ A;  1WP0 A;  3D21 A;  1AC1 A;  1GTA A;  2WUL A;  3VLN A;  4E8E A;  3WGD A;  4WR4 A;  2H6Y A;  3TGZ A;  4DSR A;  2ZUP A;  3C73 A;  4HI7 A;  2YAN A;  5IMC A;  3TJF A;  4NPB A;  5ECN B;  2JL4 A;  2OKA A;  1K0N A;  5ECL B;  4EVM A;  1XFL A;  2HSH A;  1GSY A;  3RPP A;  5D96 A;  1TK5 B;  1X5E A;  3UJ1 A;  1JHB A;  5DJM A;  2MBT A;  4HQS A;  4POK A;  3GUS A;  2VAF A;  3WT2 A;  4WBR D;  3LXT A;  3J7Y b;  1F9M A;  2X8G A;  2I9H A;  1FOV A;  3GH9 A;  1C72 A;  2YWN A;  1MDK A;  5E59 A;  2H0H A;  4IJ3 A;  2L4Q A;  1V58 A;  4IKH A;  1K3L A;  2LTK A;  2YWI A;  2FA4 A;  3APQ A;  1A2L A;  3ZL5 A;  1F3A A;  2PBJ A;  4Q5N A;  1UC7 A;  4XHM A;  1OAZ A;  2LJK A;  2B5Y A;  2HQT A;  4KCA A;  1SU9 A;  4ML1 A;  4PQH A;  3H1N A;  4N10 A;  2I81 A;  2GTU A;  2X64 A;  2L5L A;  2L6D A;  1HNB A;  4TXO A;  5D93 A;  1I5G A;  1S3A A;  4CDO A;  4JR4 A;  4GQC A;  3N5O A;  2YV7 A;  1R5P A;  2CA8 A;  2YOI A;  5HFG A;  3ZFB A;  5F0G A;  3H79 A;  2HRK A;  2B7K A;  3DRN A;  3UL3 A;  3ZVJ A;  4N0V A;  3VPQ A;  2VM2 A;  3IAM 2;  2PER A;  4MCU A;  4EO3 A;  2R3X A;  3ZRE A;  4ACS A;  1AXD A;  3EIN A;  3GUR A;  1U3A A;  2OJL A;  3KD0 A;  4K0G A;  3M9J A;  3W6G A;  3MAK A;  2JZT A;  1JFU A;  2WRT A;  2E7P A;  1R26 A;  4F03 A;  1XWK A;  3KP9 A;  1AW9 A;  4JED A;  4PQI A;  1GSQ A;  2DJ3 A;  2B5X A;  2DJJ A;  2ZNM A;  4J57 E;  3QAW A;  3G7I A;  2R2J A;  3QCP A;  3F4T A;  2MBS A;  3BOA A;  4NXI A;  3C7M A;  4CW9 A;  1A24 A;  3KZQ A;  4PTS A;  4ECI A;  4JU5 A;  2H01 A;  3TOU A;  4GXZ A;  1Q98 A;  4NWY A;  1PMT A;  1XW6 A;  2E2M A;  1PKZ A;  1TI3 A;  1PA3 A;  4HEA 2;  3ZZX A;  2F8A A;  3HHV A;  4KE3 A;  2AAW A;  3K8N A;  1PL1 A;  4K7O A;  3DKS A;  4OFT A;  3O76 A;  4K6X A;  5CP1 A;  2FLS A;  4KDU A;  3CTG A;  3IDV A;  3GTU A;  2H66 A;  2YJH A;  1UN2 A;  3MWH A;  4GSN A;  3UMA A;  3A2X A;  1OVN A;  2AHE A;  2ZCT A;  3BD2 A;  3LQ7 A;  3TJB A;  3VUR A;  2YNX A;  2NPB A;  4GSS A;  4L5L A;  5A5K A;  2GZP A;  3DD3 A;  1AQX A;  4NV5 A;  3VFI A;  2PVQ A;  2L6C A;  3DWV A;  5JCU A;  2B5E A;  3TKP A;  6GSV A;  4IEL A;  3QAG A;  1TRV A;  4ZL7 A;  5IMZ A;  3PR8 A;  3CXG A;  3ZYW A;  3G9B A;  3FK8 A;  4KW6 A;  1FAA A;  2RII A;  1M99 A;  4HZ2 A;  5ELG A;  1X5D A;  2WGR A;  3KP8 A;  3WGX A;  19GS A;  4F9Z A;  2CQ9 A;  4MF6 A;  4GRF A;  2IFQ B;  1SJZ A;  4ZBB A;  4EUY A;  3TOT A;  1KTE A;  4MF5 A;  2OBK A;  3HJP A;  4EDY A;  3P2A A;  3W8J A; 
#chains in the Genus database with same CATH topology
 2VL3 A;  2FD3 A;  2O87 A;  4N0Z A;  2LJA A;  5HR1 A;  4G10 A;  2LJR A;  1X9M B;  5DAK B;  3L9V A;  1EV9 A;  1XZO A;  2GZY A;  3TU3 B;  1N8J A;  3KMO A;  3NZN A;  2DJ0 A;  3I43 A;  4MH3 A;  2VUP A;  4KGI A;  5D8I A;  3H4K A;  1K3O A;  4OO4 A;  2EFH A;  3CTF A;  5A1N A;  5J4Y A;  2FWH A;  4OCF A;  2MMO A;  5G1K A;  1PN0 A;  2K18 A;  1OKD A;  3GNJ A;  5J40 A;  2CVD A;  1WMJ A;  3UBL A;  2E2G A;  5LNK e;  4KAE A;  4Q5F A;  2X99 A;  2CAQ A;  1QMV A;  1XWA A;  2QA1 A;  4I2U A;  3FKF A;  4PUR A;  4K1F A;  2YWM A;  3QD9 A;  2A4V A;  1A8L A;  1GTU A;  4D73 A;  1TDI A;  4MK3 A;  1ZOF A;  1M7T A;  2YPM A;  1URM A;  4KDY A;  4ZBA A;  3GN3 A;  3QPM A;  5J5N A;  4YQV A;  1EEJ A;  1JZD A;  1GNE A;  1I1I P;  2AUV A;  2FHE A;  2K9F A;  4WET A;  2DSA A;  3HD5 A;  3UVT A;  5CYY A;  4GQF A;  3IPZ A;  1TK8 B;  1H75 A;  5BRT A;  1AQV A;  1FHE A;  2R37 A;  3KH7 A;  1YEX A;  3W8S A;  4LMV A;  5LD0 A;  2KOK A;  1FW1 A;  1XBS A;  4YAV A;  4ML6 A;  4V1A p;  4EC0 A;  5A4W A;  1KEB A;  3P8W A;  3ZIV A;  5F07 A;  4TR4 A;  5G5F A;  4OMV A;  2HE3 A;  2VKZ G;  3GRX A;  2NBS A;  3A2V A;  3UEM A;  20GS A;  6GSY A;  2QKE A;  3CRU A;  2RM6 A;  6GSW A;  2WDU A;  3D4T A;  2B1L A;  4IP6 A;  2KP1 A;  5CRD A;  1CQG A;  1G6W A;  2C4J A;  1GTI A;  1SK1 A;  2IMI A;  1V98 A;  4KSM A;  2JU5 A;  2CV4 A;  2KUC A;  3FR6 A;  5EPF A;  2VLV A;  4FXY P;  2XPD A;  5ECM B;  3KMN A;  4I97 A;  1R4W A;  2JAD A;  4HQZ A;  1LJR A;  3GKM A;  10GS A;  3IA1 A;  4TXO B;  2LEG A;  2DLX A;  4NHZ A;  4F0B A;  4RI6 A;  2O8V B;  2TIR A;  4L5O A;  2PWJ A;  3IV4 A;  5FWG A;  3HJM A;  1Z9H A;  4OFM A;  2HSN B;  1FO5 A;  3GKN A;  2K8S A;  4FIW A;  4MJB A;  6GSU A;  2YJ7 A;  1KNG A;  5IM9 A;  2O36 A;  5JCG A;  3VWU A;  2GVP A;  3GKX A;  2H1A A;  3O3T A;  1X9S B;  4TN8 A;  1LBK A;  1TRW A;  2VL2 C;  14GS A;  1TJD A;  5A4V A;  4LLR A;  5DQY A;  2IN3 A;  2QSI A;  5CRE A;  3N9J A;  1DBY A;  1V40 A;  3UIW A;  1E6B A;  4V2M A;  2DJ1 A;  1U6T A;  4LL1 B;  5HQP A;  3VPT A;  2GQL A;  2H73 A;  5ABR A;  2GT5 A;  4OD7 A;  5KN2 A;  3TKS C;  3EMX A;  4TKY A;  1M3J A;  1WRY A;  1XXU A;  2ON5 A;  4AJ6 A;  4IS0 A;  2X8H A;  3L0H A;  1A0R P;  2H1D A;  3KGK A;  2H75 A;  2L57 A;  2C80 A;  2XBQ A;  4QL7 A;  3TJK A;  3SBC A;  4O7H A;  2PN8 A;  1ON4 A;  2MMZ A;  2C1Y A;  3F6F A;  1XWC A;  5GSS A;  5J41 A;  3H93 A;  5KN1 A;  1EP8 A;  1U3I A;  2XC2 A;  1ZCP A;  1FB6 A;  1I9D A;  2HZE A;  4MJC A;  1T00 A;  2GGT A;  2VCZ A;  1A23 A;  5IMF A;  4MA9 A;  4P3Y B;  3U6V A;  4YAP A;  1J9B A;  2IME A;  2R0P A;  4AI6 A;  3IC8 A;  3M9K A;  5E4W A;  3M0F A;  4WKW A;  3M1G A;  1GLP A;  4DVC A;  4Z2R A;  5KOW A;  5KN3 A;  1TKD B;  2VD0 A;  3P90 A;  2RLI A;  3UOM A;  2Z9S A;  4QQ7 A;  1Y1U A;  1SYX A;  2LQQ A;  5ID2 A;  2GLR A;  3GTU B;  3ME8 A;  1T4Y A;  3DGQ A;  4LL4 B;  5CRW A;  2V6K A;  1TTZ A;  2NDO A;  2GT6 A;  3HDC A;  3VI5 A;  3RDW A;  1SEN A;  2IMD A;  2YN1 A;  2LQO A;  4OO5 A;  2H74 A;  5A4U A;  4F2I A;  4L8E A;  4MLY A;  1RK4 A;  3MNG A;  2D2Z A;  3V1W A;  1T3B A;  1VF2 A;  1SKS B;  1O6J A;  1MEK A;  3EUR A;  4Q5R A;  4KB3 A;  3HY2 A;  1CQH A;  3VWW A;  3KTB A;  4MPG A;  2AB6 A;  5G1L A;  3QFA C;  4O32 A;  4AKH A;  3A2W A;  4E8H A;  5DVB A;  3CHX C;  3F63 A;  2CT6 A;  5IO2 A;  1UVZ A;  3NIV A;  2EFC A;  2EIQ A;  5KEJ A;  2HT9 A;  1EP7 A;  5J4V A;  4G0I A;  3GL5 A;  2B6M A;  1OYJ A;  1GSE A;  1B4Q A;  1PL2 A;  4AKI A;  3F6D A;  4ZIL A;  4JE1 A;  4JRR A;  5D9W A;  4G2E A;  3DEX A;  3IXR A;  3A3T A;  4KF9 A;  1WIK A;  3TKQ A;  1QUW A;  3FHK A;  1LU4 A;  5BMU A;  4EDZ A;  1BG5 A;  1NW2 A;  1V2A A;  1J08 A;  4WF5 A;  3GKK A;  4OFN A;  4IBP A;  2WFC A;  4O5U A;  3LXZ A;  4FH8 A;  4KX4 A;  5A1N B;  2RM5 A;  4NAX A;  1WE0 A;  2ES7 A;  2A2S A;  2FGX A;  3O6T A;  3H8Q A;  1QQ2 A;  2EC4 A;  5J9C A;  3HA9 A;  2YWO A;  1DUG A;  4G19 A;  1NHO A;  3IE3 A;  2J9H A;  3L9S A;  2LRC A;  1SJI A;  1DE1 A;  2LUS A;  1Y6E A;  3GL3 A;  1ZYQ B;  4K7I A;  3IRA A;  3MSZ A;  2IMK A;  2HYX A;  5ECI B;  3UAR A;  2QGV A;  2OAC A;  2EIR A;  1XIY A;  1K0M A;  3QR6 A;  1M3I A;  5G31 A;  4D73 B;  2MMN A;  1O81 A;  5DBQ A;  2FNO A;  4ZXG A;  2R4V A;  4ZBD A;  2PMT A;  4NMU A;  5HR3 A;  4AGS A;  1OC9 A;  2DMM A;  3VWX A;  2F51 A;  5IQY A;  1OE8 A;  4RI7 A;  3GYK A;  7GSS A;  2H30 A;  1JLV A;  1T7P B;  1Z7R A;  18GS A;  4ZB7 A;  2VLU A;  2N5A A;  4IHU A;  3OR5 A;  1TU7 A;  1T8E B;  2C3T A;  1K0D A;  3F4R A;  2JZR A;  3CBU A;  4RQR A;  2K6V A;  1MTC A;  1ZMA A;  4MAB A;  2P5Q A;  1SJ6 A;  1GWC A;  4FYB A;  5G30 A;  2HXK A;  1AIU A;  2HFD A;  4Z2T A;  1G0T A;  4YQU A;  1GSS A;  5HFI A;  3F4S A;  1SD9 A;  2HSM A;  1EZK A;  2IL3 A;  4ZIJ A;  3CWG A;  1KBN A;  1THO A;  4POM A;  1TOF A;  2WCI A;  1BX9 A;  1GSU A;  2H70 A;  4TR1 B;  3APS A;  2F3M A;  3F9U A;  1DE2 A;  4BA7 A;  2F8F A;  4KSO A;  4YKG A;  2CVK A;  5IMD A;  3UAP A;  5H5S A;  2P5R A;  2V41 A;  2LNT A;  3CMI A;  3HKR A;  1A2J A;  1WWJ A;  2PPT A;  1TXU A;  5JCW A;  1G6Y A;  3FYG A;  1GUM A;  3TCO A;  1NHY A;  4MJA A;  4Q5Q A;  3EC3 A;  2GDR A;  1JLW A;  2CX4 A;  1ZYP A;  4ILF A;  2VCX A;  1GLQ A;  1B9Y C;  5ECP B;  4BVX A;  1MD3 A;  1O85 A;  5DQS A;  4GLT A;  3LJR A;  1XOA A;  3G7Y A;  3RPN A;  2RUE A;  4HUA A;  4IQA A;  4K5S A;  1GUK A;  2H1B A;  1FB0 A;  4JZQ A;  3DVX A;  4N11 A;  2OE1 A;  1HNA A;  1Q4J A;  4QL9 A;  1S3C A;  2YP6 A;  5JWQ B;  5CNW A;  4NV2 A;  2WVX A;  5J3R A;  2UZ8 A;  1TRS A;  4DSS B;  1ST9 A;  3VI7 A;  3Q74 A;  1VRS D;  4MJE A;  4MP4 A;  3IBH A;  1UA5 A;  2WS2 A;  1Z3E A;  1PX7 A;  3HXS A;  2N5B A;  1PN9 A;  4O92 A;  1ZZY A;  4GWR A;  1VF3 A;  3ME7 A;  2HRA A;  3HVX A;  5CAX A;  1QFN A;  4ECJ A;  1YQ1 A;  3F8U A;  5D9V A;  4KCE A;  2P31 A;  2BMX A;  4HU7 A;  4J56 E;  4EXJ A;  5GZZ B;  1ACV A;  1F2E A;  3EWL A;  2FWG A;  2KP2 A;  5ELA A;  3SWL A;  3QAV A;  4O5Q A;  4XCS A;  1K0O A;  1JZO A;  1TW9 A;  2YCD A;  4BVY B;  3FZ9 A;  2GS3 A;  2AYT A;  4E68 A;  1SK0 A;  5ECS A;  1YVL A;  4MDC A;  3IHG A;  2JSZ A;  3GX8 A;  1U87 A;  3PIN A;  2CAI A;  2R0G A;  4GST A;  3APO A;  3L9U A;  3KXO A;  4ZB9 A;  2IJY A;  4L0U A;  4CHS A;  1SL0 B;  2HZE B;  3C8E A;  3MDK A;  4KND A;  3UVH A;  2PGT A;  4TR3 A;  3IK9 A;  1SD8 A;  5GST A;  1VGL A;  3J7Y k;  5D9X A;  5J9B A;  4X4J A;  1A0F A;  2CZ2 A;  4TR1 A;  2OT3 A;  4CY6 A;  3I6A A;  5IOX A;  4GTU A;  2HI7 A;  3TRX A;  1PRX A;  1QXH A;  2H76 A;  1EV4 A;  3KJY A;  3MIX A;  5AGY A;  2VLT A;  2VL2 A;  3ZRD A;  4F82 A;  3DXB A;  3IK7 A;  3PH9 A;  3D22 A;  4BWQ A;  5IPG A;  3F3R A;  1S3R A;  2O5V A;  2MYG A;  5ID2 B;  4XS4 A;  4MZC A;  1PFO A;  5HR0 A;  1K0B A;  4V2L A;  5C04 A;  2EFD A;  2ON7 A;  2WB9 A;  3GX0 A;  4LA1 A;  2J23 A;  2H1G A;  4ULX A;  3TKS A;  1X9W B;  2VO4 A;  4IJI A;  3ZFL A;  2HZF A;  2O7K A;  4BPY A;  3TRP A;  1GNW A;  4BL7 A;  1T4Z A;  1GH2 A;  2JAC A;  3ZML A;  5J4U A;  4CY8 A;  1XWB A;  2FWE A;  4RQX A;  4DSS A;  4X1U A;  1ABA A;  2R6K A;  2IWT A;  2L59 A;  1IYI A;  1FOH A;  3DML A;  2X8C A;  2C0D A;  2GQM A;  4N3Z A;  5B7C A;  2WZ9 A;  5COH A;  4I6X A;  1M2B A;  2H8L A;  5GAN D;  1AAZ A;  2IIY A;  2H0I A;  1AUC A;  2QC7 A;  5CRG A;  3FY7 A;  4OWY A;  2A4H A;  4HZ4 A;  3IC4 A;  1SL2 B;  2LRT A;  1PQN A;  2VIM A;  4MZW A;  1BYE A;  2N5F A;  2M80 A;  4ZL9 A;  1X0R A;  1J0F A;  2V32 A;  4XS1 A;  2GSR A;  3Q19 A;  4ECC A;  3LWA A;  2I1U A;  2TRX A;  4KUN A;  3CSJ A;  5BMU B;  1N2A A;  3D0Z A;  4I5Q A;  1OKT A;  4BVY A;  2BJX A;  2VD1 A;  1HNC A;  1Z5Y E;  2HRN A;  2KHP A;  2KLX A;  3I9V 2;  1PGT A;  1Z6M A;  4POL A;  2PU9 C;  4FYC A;  5C00 A;  5FT3 A;  2FY6 A;  3LYP A;  4EL1 A;  1A8Y A;  13GS A;  4PI0 C;  2GQK A;  5A5H B;  2IMF A;  4FO5 A;  5F8B A;  2GST A;  1YEP A;  3GST A;  2C0F A;  4YQM A;  4I2T A;  5CO3 A;  3HMJ G;  4PQ1 A;  4L0W A;  4K8M A;  4O5R A;  1ZGN A;  4HU9 A;  2YZU A;  3VK9 A;  1TU8 A;  1JZR A;  3E9J B;  3GSS A;  1OC9 B;  3UBK A;  2OE0 A;  1YF1 A;  3HVS A;  2VCW A;  4LMW A;  5B8A A;  4HJM A;  3WYW A;  1OC8 A;  3TKS E;  1FG4 A;  5ECO B;  1M9A A;  1V57 A;  4POB A;  5H5Q A;  1SVL A;  5B6M A;  4F0C A;  3TKR A;  3KH9 A;  3GMF A;  3C1R A;  4BIK A;  4TXV A;  2R5G A;  1EGO A;  3IHQ A;  2EIO A;  2DKH A;  2JZS A;  3WT1 A;  1ZYE A;  2WVZ A;  1M9B A;  5H5R A;  1Z7P A;  3GIX A;  2HSM B;  2MZC A;  1BAY A;  4V2N A;  5A34 A;  1B9X C;  2I4A A;  4JBB A;  2O85 A;  5HR2 A;  2V1M A;  3BCK A;  3BCI A;  4WR5 A;  2H72 A;  2LS5 A;  1O73 A;  3HVV A;  4KH7 A;  2DIZ A;  3ZIT A;  1VF4 A;  5DJL A;  1ERV A;  5G2Z A;  11GS A;  2RUF A;  3GHA A;  4H86 A;  5ENU A;  3HCZ A;  1BJX A;  5IIZ A;  3VWV A;  1RW1 A;  5INY A;  1BG1 A;  4V1A g;  1QK8 A;  5AIS A;  2QA2 A;  4MNN A;  4K2X A;  5JWR B;  1ZYN A;  3GFK A;  22GS A;  1BQ7 A;  5FHI A;  2FCH A;  3E3E A;  4BVX B;  2LKU A;  1OC3 A;  4OCE A;  5IOW A;  2FWF A;  1B4P A;  1SL1 B;  5D73 A;  3LYK A;  1F37 A;  3GV1 A;  3TB2 A;  2C3Q A;  1K3Y A;  3EU4 A;  1M0U A;  4IVF A;  1PX6 A;  2CX3 A;  3FZA A;  4GF0 A;  17GS A;  1N25 A;  3QMX A;  1T1V A;  2VCT A;  2WVX B;  4Z7X A;  3PGT A;  2AJQ B;  3ZLP A;  1BED A;  1HD2 A;  4HS1 A;  4IW9 A;  1XOB A;  1OE7 A;  5A5H A;  5DCH A;  3BBY A;  2OA7 A;  4X43 A;  2A2R A;  4PNG A;  4XS6 A;  3DVW A;  2G2Q A;  4PX1 A;  4HJ2 A;  1MDI A;  2BTO T;  3QFB C;  1G7O A;  4XRD A;  2DBC A;  3TJG A;  5F05 A;  3ZIJ A;  1SKW B;  4G9H A;  1XW9 A;  3D4M A;  1SVM A;  3HZ8 A;  2V2G A;  1NM3 A;  3TRQ A;  2AV4 A;  4WXT A;  3CSI A;  3EU3 A;  1YY7 A;  1U88 A;  4MH2 A;  1W4V A;  4MPF A;  1XPV A;  4AF2 A;  3TDG A;  1M2D A;  2X4A A;  3A5W A;  3KCM A;  4FYU A;  5G5E A;  1XVQ A;  1GL8 A;  3EPT A;  5AIX A;  5AN1 A;  2C3N A;  4N30 A;  2L5O A;  3ZVJ D;  1SYR A;  3LOR A;  4I8B A;  5EVO A;  2HSY A;  4MF7 A;  3C1S A;  1XCC A;  1HYU A;  1USB A;  1K0A A;  2NTO A;  2WW1 A;  2B3S A;  3LGC A;  4K7N A;  3ED3 A;  4WBJ A;  1TRU A;  4G0L A;  4IQ1 A;  5IMA A;  3R2Q A;  3P7X A;  2PUK C;  3LFL A;  2LRN A;  3RHB A;  3WGE A;  3ERG A;  2TRC P;  1BF5 A;  2WW2 A;  3FR3 A;  3LSZ A;  1IYH A;  1TP9 A;  4ZB8 A;  1EEM A;  4K2D A;  1ERU A;  1O8W A;  4GCI A;  2H6Z A;  2I3Y A;  2L4C A;  5B8B A;  4ID0 A;  3CRT A;  4USS A;  4ISD A;  3KEB A;  3I69 A;  2VOC A;  3ERW A;  2REM A;  5B6N A;  4IP1 A;  1YZX A;  1TI1 A;  4W66 A;  4JR6 A;  1TK0 B;  3U5R E;  3FW2 A;  3CSH A;  1FVJ A;  4ECB A;  1MD4 A;  4XS4 B;  3PPU A;  5ECQ B;  4WF4 A;  2HNL A;  3HYP A;  3CQF A;  3S9F A;  1RQM A;  3R3E A;  4FQU A;  2C0G A;  4PI2 C;  1F6M C;  3E0U A;  2CZ3 A;  1PSQ A;  2OBI A;  5KN0 A;  3M8N A;  1YDK A;  5HFK A;  4BL7 B;  3DYR A;  1S3D A;  2LV3 A;  2P0G A;  1EGR A;  1R5A A;  4TW5 A;  3RHC A;  2WW3 A;  2X49 A;  2VL9 A;  3RBT A;  2NVL A;  3DIE A;  4TRX A;  1E2Y A;  2FUG 2;  1M2A A;  1G7E A;  3F3Q A;  1PD2 1;  2H6X A;  4BWS A;  1A2M A;  1WPI A;  3BJ5 A;  1X5C A;  3EE2 A;  4WEY A;  5AIV A;  3LG6 A;  1EOH A;  4AJ8 A;  3L4N A;  4EF0 A;  2YV9 A;  3IAS 2;  4DEJ A;  1ERW A;  3KTL A;  4NHW A;  5EL8 A;  1PKW A;  8GSS A;  2JSY A;  5DDL A;  4XRA A;  2H0G A;  4HOJ A;  2G0F A;  12GS A;  5DAL B;  2DKI A;  1ERT A;  3C71 A;  3QOU A;  4PUF C;  1EWX A;  3G7J A;  3RAZ A;  2XHF A;  3FRC A;  3ISO A;  1WOU A;  4KA0 A;  4EE0 A;  2YZH A;  2VCV A;  5IO0 A;  4EKZ A;  1XVW A;  1GRX A;  4K0N A;  4G01 A;  2PVO C;  4TVE A;  3EMP A;  2B7J A;  2MMA A;  4MMM A;  3Q6O A;  2DIY A;  1R7H A;  3GH6 A;  3ZTL A;  1GSF A;  3F0I A;  4DSQ A;  3D5J A;  2HLS A;  4IN0 A;  3ZMK A;  3US3 A;  1DSB A;  2K8V A;  2H19 A;  5JWO B;  4KDX A;  3JCM L;  5F06 A;  4EIQ A;  1ZL9 A;  2IPA A;  9GSS A;  3GA4 A;  4XIH A;  2WJU A;  1AQW A;  3WD6 A;  1THX A;  4XTS A;  1XWG A;  4J2F A;  1SKR B;  2CVB A;  2F9S A;  16GS A;  4HDE A;  5J47 A;  2LST A;  1F3B A;  1B8X A;  2DML A;  3FEU A;  1XW5 A;  1B48 A;  4X0X A;  2WW0 A;  1YJ6 A;  4YKF A;  1YF0 A;  5L71 A;  1ILO A;  3IOS A;  4YH2 A;  2IFQ A;  1FVK A;  1K0C A;  1GP1 A;  1GUL A;  2XPE A;  3LEF A;  1NSW A;  4PNF A;  3LW9 A;  3EYT A;  4AJ7 A;  1W89 A;  3AY8 A;  2DJ2 A;  1MDJ A;  1Z6N A;  1V9W A;  4MZB A;  1GTB A;  1TXX A;  3NOF A;  2B1K A;  2GSS A;  2VM1 A;  5DAK A;  3D6I A;  3MYD A;  2M72 A;  5ECK B;  5D9T A;  3FR9 A;  3ERF A;  5IPH A;  5ECR B;  4PGT A;  3QDN A;  3IR4 A;  5A34 B;  1Y25 A;  3M3M A;  2OE3 A;  1O7U A;  1QGV A;  4GDF A;  1VF1 A;  3RGB C;  3HZ4 A;  1HQO A;  3TUE A;  2GSQ A;  3TJJ A;  5ECH B;  6GSX A;  2XBI A;  5KOX A;  4Z2U A;  1JZW A;  4RUV A;  2H71 A;  2HRK B;  4PUA A;  4G0K A;  2E0Q A;  3CYN A;  5GAP D;  4PXO A;  1H4O A;  5LCZ A;  4ZL8 A;  1GSD A;  5EY6 A;  6GST A;  3KM6 A;  2VCQ A;  2LNS A;  1SK2 A;  2OAD A;  1YKC A;  4TOP A;  3L78 A;  3HJO A;  2M46 A;  5DAL A;  2C0E A;  2V6O A;  2C8U A;  3FZ4 A;  2DJK A;  1ML6 A;  4ZB6 A;  3EVI A;  6GSS A;  1WJK A;  1YEW C;  4TR0 A;  2ALB A;  2HRF A;  5IMV A;  1GUH A;  2FA8 A;  3Q18 A;  2O89 A;  2O3E A;  1YKA A;  5DCG A;  4K9Z A;  2DC5 A;  4IGJ A;  3FZ5 A;  1O8X A;  4AKX B;  2GZZ A;  5CRH A;  1EOG A;  3KIJ A;  1WP0 A;  4AKG A;  3D21 A;  1AC1 A;  4HSC X;  1GTA A;  2WUL A;  3VLN A;  4E8E A;  3WGD A;  4WR4 A;  2H6Y A;  3TGZ A;  4DSR A;  2ZUP A;  3C73 A;  4HI7 A;  2YAN A;  5IMC A;  3TJF A;  4NPB A;  5ECN B;  2JL4 A;  2OKA A;  1K0N A;  5ECL B;  4EVM A;  1XFL A;  2HSH A;  1GSY A;  3RPP A;  5D96 A;  1TK5 B;  1X5E A;  3UJ1 A;  3RFR C;  1JHB A;  5DJM A;  2MBT A;  4HQS A;  4POK A;  3GUS A;  2VAF A;  3WT2 A;  4WBR D;  3LXT A;  3J7Y b;  1F9M A;  2X8G A;  2I9H A;  1FOV A;  2A2P A;  3GH9 A;  1C72 A;  2YWN A;  1MDK A;  5E59 A;  2H0H A;  4IJ3 A;  2L4Q A;  4A5P A;  1V58 A;  4IKH A;  1K3L A;  2LTK A;  4K5R A;  2YWI A;  2FA4 A;  1S4B P;  3APQ A;  1A2L A;  3ZL5 A;  1F3A A;  2PBJ A;  4Q5N A;  1UC7 A;  4XHM A;  1OAZ A;  2LJK A;  2B5Y A;  2EFE A;  2HQT A;  4KCA A;  1SU9 A;  4ML1 A;  4PQH A;  3H1N A;  3A5I A;  4N10 A;  2I81 A;  2GTU A;  2X64 A;  2L5L A;  2L6D A;  1HNB A;  4TXO A;  5D93 A;  1I5G A;  1S3A A;  4CDO A;  3HVN A;  4JR4 A;  4GQC A;  3N5O A;  2YV7 A;  1R5P A;  2CA8 A;  2YOI A;  5HFG A;  3ZFB A;  5F0G A;  3H79 A;  1XG8 A;  2HRK A;  2B7K A;  3DRN A;  2HSN A;  3UL3 A;  3ZVJ A;  4N0V A;  3VPQ A;  2VM2 A;  3IAM 2;  2PER A;  4PHZ C;  4MCU A;  4EO3 A;  2R3X A;  3ZRE A;  4ACS A;  1AXD A;  3EIN A;  3GUR A;  1U3A A;  2OJL A;  3KD0 A;  4K0G A;  3M9J A;  3W6G A;  3MAK A;  2JZT A;  1JFU A;  4ICY A;  2WRT A;  4QMK A;  2WVY A;  2E7P A;  1R26 A;  4F03 A;  1XWK A;  3KP9 A;  1AW9 A;  4JED A;  4PQI A;  1GSQ A;  2DJ3 A;  2B5X A;  2DJJ A;  2ZNM A;  4J57 E;  3QAW A;  3G7I A;  2R2J A;  3F4T A;  3QCP A;  2MBS A;  3BOA A;  4NXI A;  3C7M A;  4CW9 A;  1A24 A;  3KZQ A;  4PTS A;  4ECI A;  4JU5 A;  2H01 A;  3TOU A;  4GXZ A;  3FMW A;  1Q98 A;  4NWY A;  1PMT A;  1XW6 A;  2E2M A;  1PKZ A;  1TI3 A;  1PA3 A;  4HEA 2;  3ZZX A;  2F8A A;  3HHV A;  2H1L A;  2UV8 G;  4KE3 A;  2AAW A;  3K8N A;  1PL1 A;  4K7O A;  3DKS A;  4OFT A;  3O76 A;  4K6X A;  5CP1 A;  2FLS A;  4KDU A;  1SVO A;  3CTG A;  3IDV A;  3GTU A;  2H66 A;  2YJH A;  1UN2 A;  2WZS A;  3MWH A;  4GSN A;  3UMA A;  3A2X A;  1OVN A;  2AHE A;  2ZCT A;  3BD2 A;  3LQ7 A;  3TJB A;  3VUR A;  2YNX A;  2NPB A;  4GSS A;  4L5L A;  5A5K A;  2GZP A;  3DD3 A;  1AQX A;  4NV5 A;  3VFI A;  2PVQ A;  2L6C A;  3DWV A;  5JCU A;  2B5E A;  3TKP A;  2R0C A;  6GSV A;  4IEL A;  3QAG A;  1TRV A;  4ZL7 A;  5IMZ A;  3PR8 A;  4EIP A;  3CXG A;  3ZYW A;  3G9B A;  3FK8 A;  4KW6 A;  1FAA A;  2RII A;  1M99 A;  4HZ2 A;  5ELG A;  1X5D A;  2WGR A;  3KP8 A;  3WGX A;  19GS A;  4F9Z A;  2CQ9 A;  4MF6 A;  4GRF A;  2IFQ B;  1SJZ A;  4ZBB A;  4EUY A;  3TOT A;  1KTE A;  4MF5 A;  2OBK A;  3HJP A;  4EDY A;  3P2A A;  3W8J A; 
#chains in the Genus database with same CATH homology
 2VL3 A;  2FD3 A;  2O87 A;  4N0Z A;  2LJA A;  5HR1 A;  4G10 A;  2LJR A;  1X9M B;  5DAK B;  3L9V A;  1EV9 A;  1XZO A;  2GZY A;  3TU3 B;  1N8J A;  3KMO A;  3NZN A;  2DJ0 A;  3I43 A;  4MH3 A;  2VUP A;  4KGI A;  5D8I A;  3H4K A;  1K3O A;  4OO4 A;  2EFH A;  3CTF A;  5A1N A;  5J4Y A;  2FWH A;  4OCF A;  2MMO A;  5G1K A;  1PN0 A;  2K18 A;  1OKD A;  3GNJ A;  5J40 A;  2CVD A;  1WMJ A;  3UBL A;  2E2G A;  5LNK e;  4KAE A;  4Q5F A;  2X99 A;  2CAQ A;  1QMV A;  1XWA A;  2QA1 A;  4I2U A;  3FKF A;  4PUR A;  4K1F A;  2YWM A;  3QD9 A;  2A4V A;  1A8L A;  1GTU A;  4D73 A;  1TDI A;  4MK3 A;  1ZOF A;  1M7T A;  2YPM A;  1URM A;  4KDY A;  4ZBA A;  3GN3 A;  3QPM A;  5J5N A;  4YQV A;  1EEJ A;  1JZD A;  1GNE A;  2AUV A;  2FHE A;  2K9F A;  4WET A;  2DSA A;  3HD5 A;  3UVT A;  5CYY A;  4GQF A;  3IPZ A;  1TK8 B;  1H75 A;  5BRT A;  1AQV A;  1FHE A;  2R37 A;  3KH7 A;  1YEX A;  3W8S A;  4LMV A;  5LD0 A;  2KOK A;  1FW1 A;  1XBS A;  4YAV A;  4ML6 A;  4V1A p;  4EC0 A;  5A4W A;  1KEB A;  3P8W A;  3ZIV A;  5F07 A;  4TR4 A;  5G5F A;  4OMV A;  2HE3 A;  2VKZ G;  3GRX A;  2NBS A;  3A2V A;  3UEM A;  20GS A;  6GSY A;  2QKE A;  3CRU A;  2RM6 A;  6GSW A;  2WDU A;  3D4T A;  2B1L A;  4IP6 A;  2KP1 A;  5CRD A;  1CQG A;  1G6W A;  2C4J A;  1GTI A;  1SK1 A;  2IMI A;  1V98 A;  4KSM A;  2JU5 A;  2CV4 A;  2KUC A;  3FR6 A;  5EPF A;  2VLV A;  2XPD A;  5ECM B;  3KMN A;  4I97 A;  1R4W A;  2JAD A;  4HQZ A;  1LJR A;  3GKM A;  10GS A;  3IA1 A;  4TXO B;  2LEG A;  2DLX A;  4NHZ A;  4F0B A;  4RI6 A;  2O8V B;  2TIR A;  4L5O A;  2PWJ A;  3IV4 A;  5FWG A;  3HJM A;  1Z9H A;  4OFM A;  2HSN B;  1FO5 A;  3GKN A;  2K8S A;  4FIW A;  4MJB A;  6GSU A;  2YJ7 A;  1KNG A;  5IM9 A;  5JCG A;  3VWU A;  2GVP A;  3GKX A;  2H1A A;  3O3T A;  1X9S B;  4TN8 A;  1LBK A;  1TRW A;  2VL2 C;  14GS A;  1TJD A;  5A4V A;  4LLR A;  5DQY A;  2IN3 A;  2QSI A;  5CRE A;  3N9J A;  1DBY A;  1V40 A;  3UIW A;  1E6B A;  4V2M A;  2DJ1 A;  1U6T A;  4LL1 B;  5HQP A;  3VPT A;  2GQL A;  2H73 A;  5ABR A;  2GT5 A;  4OD7 A;  5KN2 A;  3TKS C;  3EMX A;  4TKY A;  1WRY A;  1XXU A;  2ON5 A;  4AJ6 A;  4IS0 A;  2X8H A;  3L0H A;  1A0R P;  2H1D A;  3KGK A;  2H75 A;  2L57 A;  2C80 A;  2XBQ A;  4QL7 A;  3TJK A;  3SBC A;  4O7H A;  2PN8 A;  1ON4 A;  2MMZ A;  2C1Y A;  3F6F A;  1XWC A;  5GSS A;  5J41 A;  3H93 A;  5KN1 A;  1EP8 A;  1U3I A;  2XC2 A;  1ZCP A;  1FB6 A;  1I9D A;  2HZE A;  4MJC A;  1T00 A;  2GGT A;  2VCZ A;  1A23 A;  5IMF A;  4MA9 A;  4P3Y B;  3U6V A;  4YAP A;  1J9B A;  2IME A;  2R0P A;  4AI6 A;  3IC8 A;  3M9K A;  5E4W A;  3M0F A;  4WKW A;  3M1G A;  1GLP A;  4DVC A;  4Z2R A;  5KOW A;  5KN3 A;  1TKD B;  2VD0 A;  3P90 A;  2RLI A;  3UOM A;  2Z9S A;  4QQ7 A;  1Y1U A;  1SYX A;  2LQQ A;  5ID2 A;  2GLR A;  3GTU B;  3ME8 A;  1T4Y A;  3DGQ A;  4LL4 B;  5CRW A;  2V6K A;  1TTZ A;  2NDO A;  2GT6 A;  3HDC A;  3VI5 A;  3RDW A;  1SEN A;  2IMD A;  2YN1 A;  2LQO A;  4OO5 A;  2H74 A;  5A4U A;  4F2I A;  4L8E A;  4MLY A;  1RK4 A;  3MNG A;  2D2Z A;  3V1W A;  1T3B A;  1VF2 A;  1SKS B;  1O6J A;  1MEK A;  3EUR A;  4Q5R A;  4KB3 A;  3HY2 A;  1CQH A;  3VWW A;  3KTB A;  4MPG A;  2AB6 A;  5G1L A;  3QFA C;  4O32 A;  4AKH A;  3A2W A;  4E8H A;  5DVB A;  3F63 A;  2CT6 A;  5IO2 A;  1UVZ A;  3NIV A;  2EFC A;  2EIQ A;  5KEJ A;  2HT9 A;  1EP7 A;  5J4V A;  4G0I A;  3GL5 A;  2B6M A;  1OYJ A;  1GSE A;  1B4Q A;  1PL2 A;  4AKI A;  3F6D A;  4ZIL A;  4JE1 A;  4JRR A;  5D9W A;  4G2E A;  3DEX A;  3IXR A;  3A3T A;  4KF9 A;  1WIK A;  3TKQ A;  1QUW A;  3FHK A;  1LU4 A;  5BMU A;  4EDZ A;  1BG5 A;  1NW2 A;  1V2A A;  1J08 A;  4WF5 A;  3GKK A;  4OFN A;  4IBP A;  2WFC A;  4O5U A;  3LXZ A;  4FH8 A;  4KX4 A;  5A1N B;  2RM5 A;  4NAX A;  1WE0 A;  2ES7 A;  2A2S A;  2FGX A;  3O6T A;  3H8Q A;  1QQ2 A;  2EC4 A;  5J9C A;  3HA9 A;  2YWO A;  1DUG A;  4G19 A;  1NHO A;  3IE3 A;  2J9H A;  3L9S A;  2LRC A;  1SJI A;  1DE1 A;  2LUS A;  1Y6E A;  3GL3 A;  1ZYQ B;  4K7I A;  3IRA A;  3MSZ A;  2IMK A;  2HYX A;  5ECI B;  3UAR A;  2QGV A;  2OAC A;  2EIR A;  1XIY A;  1K0M A;  3QR6 A;  5G31 A;  4D73 B;  2MMN A;  1O81 A;  5DBQ A;  2FNO A;  4ZXG A;  2R4V A;  4ZBD A;  2PMT A;  4NMU A;  5HR3 A;  4AGS A;  1OC9 A;  2DMM A;  3VWX A;  2F51 A;  5IQY A;  1OE8 A;  4RI7 A;  3GYK A;  7GSS A;  2H30 A;  1JLV A;  1T7P B;  1Z7R A;  18GS A;  4ZB7 A;  2VLU A;  2N5A A;  4IHU A;  3OR5 A;  1TU7 A;  1T8E B;  2C3T A;  1K0D A;  3F4R A;  2JZR A;  3CBU A;  4RQR A;  2K6V A;  1MTC A;  1ZMA A;  4MAB A;  2P5Q A;  1SJ6 A;  1GWC A;  4FYB A;  5G30 A;  2HXK A;  1AIU A;  2HFD A;  4Z2T A;  1G0T A;  4YQU A;  1GSS A;  5HFI A;  3F4S A;  1SD9 A;  2HSM A;  1EZK A;  2IL3 A;  4ZIJ A;  3CWG A;  1KBN A;  1THO A;  4POM A;  1TOF A;  2WCI A;  1BX9 A;  1GSU A;  2H70 A;  4TR1 B;  3APS A;  2F3M A;  3F9U A;  1DE2 A;  4BA7 A;  2F8F A;  4KSO A;  4YKG A;  2CVK A;  5IMD A;  3UAP A;  5H5S A;  2P5R A;  2V41 A;  2LNT A;  3CMI A;  3HKR A;  1A2J A;  1WWJ A;  2PPT A;  1TXU A;  5JCW A;  1G6Y A;  3FYG A;  1GUM A;  3TCO A;  1NHY A;  4MJA A;  4Q5Q A;  3EC3 A;  2GDR A;  1JLW A;  2CX4 A;  1ZYP A;  4ILF A;  2VCX A;  1GLQ A;  1B9Y C;  5ECP B;  4BVX A;  1MD3 A;  1O85 A;  5DQS A;  4GLT A;  3LJR A;  1XOA A;  3G7Y A;  3RPN A;  2RUE A;  4HUA A;  4IQA A;  4K5S A;  1GUK A;  2H1B A;  1FB0 A;  4JZQ A;  3DVX A;  4N11 A;  2OE1 A;  1HNA A;  1Q4J A;  4QL9 A;  1S3C A;  2YP6 A;  5JWQ B;  5CNW A;  4NV2 A;  5J3R A;  2UZ8 A;  1TRS A;  4DSS B;  1ST9 A;  3VI7 A;  3Q74 A;  1VRS D;  4MJE A;  4MP4 A;  3IBH A;  1UA5 A;  2WS2 A;  1Z3E A;  1PX7 A;  3HXS A;  2N5B A;  1PN9 A;  4O92 A;  1ZZY A;  4GWR A;  1VF3 A;  3ME7 A;  2HRA A;  3HVX A;  5CAX A;  1QFN A;  4ECJ A;  1YQ1 A;  3F8U A;  5D9V A;  4KCE A;  2P31 A;  2BMX A;  4HU7 A;  4J56 E;  4EXJ A;  5GZZ B;  1ACV A;  1F2E A;  3EWL A;  2FWG A;  2KP2 A;  5ELA A;  3SWL A;  3QAV A;  4O5Q A;  4XCS A;  1K0O A;  1JZO A;  1TW9 A;  2YCD A;  4BVY B;  3FZ9 A;  2GS3 A;  2AYT A;  4E68 A;  1SK0 A;  5ECS A;  1YVL A;  4MDC A;  3IHG A;  2JSZ A;  3GX8 A;  1U87 A;  3PIN A;  2CAI A;  2R0G A;  4GST A;  3APO A;  3L9U A;  3KXO A;  4ZB9 A;  2IJY A;  4L0U A;  4CHS A;  1SL0 B;  2HZE B;  3C8E A;  3MDK A;  4KND A;  3UVH A;  2PGT A;  4TR3 A;  3IK9 A;  1SD8 A;  5GST A;  1VGL A;  3J7Y k;  5D9X A;  5J9B A;  4X4J A;  1A0F A;  2CZ2 A;  4TR1 A;  2OT3 A;  4CY6 A;  3I6A A;  5IOX A;  4GTU A;  2HI7 A;  3TRX A;  1PRX A;  1QXH A;  2H76 A;  1EV4 A;  3KJY A;  3MIX A;  5AGY A;  2VLT A;  2VL2 A;  3ZRD A;  4F82 A;  3DXB A;  3IK7 A;  3PH9 A;  3D22 A;  4BWQ A;  5IPG A;  3F3R A;  2O5V A;  2MYG A;  5ID2 B;  4XS4 A;  4MZC A;  5HR0 A;  1K0B A;  4V2L A;  5C04 A;  2EFD A;  2ON7 A;  2WB9 A;  3GX0 A;  4LA1 A;  2J23 A;  2H1G A;  4ULX A;  3TKS A;  1X9W B;  2VO4 A;  4IJI A;  3ZFL A;  2HZF A;  2O7K A;  4BPY A;  3TRP A;  1GNW A;  4BL7 A;  1T4Z A;  1GH2 A;  2JAC A;  3ZML A;  5J4U A;  4CY8 A;  1XWB A;  2FWE A;  4RQX A;  4DSS A;  4X1U A;  1ABA A;  2R6K A;  2IWT A;  2L59 A;  1IYI A;  1FOH A;  3DML A;  2X8C A;  2C0D A;  2GQM A;  4N3Z A;  5B7C A;  2WZ9 A;  5COH A;  4I6X A;  1M2B A;  2H8L A;  5GAN D;  1AAZ A;  2IIY A;  2H0I A;  1AUC A;  2QC7 A;  5CRG A;  3FY7 A;  4OWY A;  2A4H A;  4HZ4 A;  3IC4 A;  1SL2 B;  2LRT A;  1PQN A;  2VIM A;  4MZW A;  1BYE A;  2N5F A;  2M80 A;  4ZL9 A;  1X0R A;  1J0F A;  2V32 A;  4XS1 A;  2GSR A;  3Q19 A;  4ECC A;  3LWA A;  2I1U A;  2TRX A;  4KUN A;  3CSJ A;  5BMU B;  1N2A A;  3D0Z A;  4I5Q A;  1OKT A;  4BVY A;  2BJX A;  2VD1 A;  1HNC A;  1Z5Y E;  2HRN A;  2KHP A;  2KLX A;  3I9V 2;  1PGT A;  1Z6M A;  4POL A;  2PU9 C;  4FYC A;  5C00 A;  5FT3 A;  2FY6 A;  3LYP A;  4EL1 A;  1A8Y A;  13GS A;  2IMF A;  2GQK A;  5A5H B;  4FO5 A;  5F8B A;  2GST A;  1YEP A;  3GST A;  2C0F A;  4YQM A;  4I2T A;  5CO3 A;  3HMJ G;  4PQ1 A;  4L0W A;  4K8M A;  4O5R A;  1ZGN A;  4HU9 A;  2YZU A;  3VK9 A;  1TU8 A;  1JZR A;  3E9J B;  3GSS A;  1OC9 B;  3UBK A;  2OE0 A;  1YF1 A;  3HVS A;  2VCW A;  4LMW A;  5B8A A;  4HJM A;  3WYW A;  1OC8 A;  3TKS E;  1FG4 A;  5ECO B;  1M9A A;  1V57 A;  4POB A;  5H5Q A;  1SVL A;  5B6M A;  4F0C A;  3TKR A;  3KH9 A;  3GMF A;  3C1R A;  4TXV A;  2R5G A;  1EGO A;  3IHQ A;  2EIO A;  2DKH A;  2JZS A;  3WT1 A;  1ZYE A;  1M9B A;  5H5R A;  1Z7P A;  3GIX A;  2HSM B;  2MZC A;  1BAY A;  4V2N A;  5A34 A;  1B9X C;  2I4A A;  4JBB A;  2O85 A;  5HR2 A;  2V1M A;  3BCK A;  3BCI A;  4WR5 A;  2H72 A;  2LS5 A;  1O73 A;  3HVV A;  4KH7 A;  2DIZ A;  3ZIT A;  1VF4 A;  5DJL A;  1ERV A;  5G2Z A;  11GS A;  2RUF A;  3GHA A;  4H86 A;  5ENU A;  3HCZ A;  1BJX A;  5IIZ A;  3VWV A;  1RW1 A;  5INY A;  1BG1 A;  4V1A g;  1QK8 A;  5AIS A;  2QA2 A;  4MNN A;  4K2X A;  5JWR B;  1ZYN A;  3GFK A;  22GS A;  1BQ7 A;  5FHI A;  2FCH A;  3E3E A;  4BVX B;  2LKU A;  1OC3 A;  4OCE A;  5IOW A;  2FWF A;  1B4P A;  1SL1 B;  5D73 A;  3LYK A;  1F37 A;  3GV1 A;  3TB2 A;  2C3Q A;  1K3Y A;  3EU4 A;  1M0U A;  4IVF A;  1PX6 A;  2CX3 A;  3FZA A;  4GF0 A;  17GS A;  1N25 A;  3QMX A;  1T1V A;  2VCT A;  4Z7X A;  3PGT A;  2AJQ B;  3ZLP A;  1BED A;  1HD2 A;  4HS1 A;  4IW9 A;  1XOB A;  1OE7 A;  5A5H A;  5DCH A;  3BBY A;  2OA7 A;  4X43 A;  2A2R A;  4PNG A;  4XS6 A;  3DVW A;  2G2Q A;  4PX1 A;  4HJ2 A;  1MDI A;  2BTO T;  3QFB C;  1G7O A;  4XRD A;  2DBC A;  3TJG A;  5F05 A;  3ZIJ A;  1SKW B;  4G9H A;  1XW9 A;  3D4M A;  1SVM A;  3HZ8 A;  2V2G A;  1NM3 A;  3TRQ A;  2AV4 A;  4WXT A;  3CSI A;  3EU3 A;  1YY7 A;  1U88 A;  4MH2 A;  1W4V A;  4MPF A;  1XPV A;  4AF2 A;  3TDG A;  1M2D A;  2X4A A;  3A5W A;  3KCM A;  4FYU A;  5G5E A;  1XVQ A;  1GL8 A;  3EPT A;  5AIX A;  5AN1 A;  2C3N A;  4N30 A;  2L5O A;  3ZVJ D;  1SYR A;  3LOR A;  4I8B A;  5EVO A;  2HSY A;  4MF7 A;  3C1S A;  1XCC A;  1HYU A;  1USB A;  1K0A A;  2NTO A;  2B3S A;  3LGC A;  4K7N A;  3ED3 A;  4WBJ A;  1TRU A;  4G0L A;  4IQ1 A;  5IMA A;  3R2Q A;  3P7X A;  2PUK C;  3LFL A;  2LRN A;  3RHB A;  3WGE A;  3ERG A;  2TRC P;  1BF5 A;  3FR3 A;  3LSZ A;  1IYH A;  1TP9 A;  4ZB8 A;  1EEM A;  4K2D A;  1ERU A;  1O8W A;  4GCI A;  2H6Z A;  2I3Y A;  2L4C A;  5B8B A;  4ID0 A;  3CRT A;  4USS A;  4ISD A;  3KEB A;  3I69 A;  2VOC A;  3ERW A;  2REM A;  5B6N A;  4IP1 A;  1YZX A;  1TI1 A;  4W66 A;  4JR6 A;  1TK0 B;  3U5R E;  3FW2 A;  3CSH A;  1FVJ A;  4ECB A;  1MD4 A;  4XS4 B;  3PPU A;  5ECQ B;  4WF4 A;  2HNL A;  3HYP A;  3S9F A;  1RQM A;  3R3E A;  4FQU A;  2C0G A;  1F6M C;  3E0U A;  2CZ3 A;  1PSQ A;  2OBI A;  5KN0 A;  3M8N A;  1YDK A;  5HFK A;  4BL7 B;  3DYR A;  1S3D A;  2LV3 A;  2P0G A;  1EGR A;  1R5A A;  4TW5 A;  3RHC A;  2X49 A;  2VL9 A;  3RBT A;  2NVL A;  3DIE A;  4TRX A;  1E2Y A;  2FUG 2;  1M2A A;  1G7E A;  3F3Q A;  1PD2 1;  2H6X A;  4BWS A;  1A2M A;  1WPI A;  3BJ5 A;  1X5C A;  3EE2 A;  4WEY A;  5AIV A;  3LG6 A;  1EOH A;  4AJ8 A;  3L4N A;  4EF0 A;  2YV9 A;  3IAS 2;  4DEJ A;  1ERW A;  3KTL A;  4NHW A;  5EL8 A;  1PKW A;  8GSS A;  2JSY A;  5DDL A;  4XRA A;  2H0G A;  4HOJ A;  2G0F A;  12GS A;  5DAL B;  2DKI A;  1ERT A;  3C71 A;  3QOU A;  4PUF C;  1EWX A;  3G7J A;  3RAZ A;  2XHF A;  3FRC A;  3ISO A;  1WOU A;  4KA0 A;  4EE0 A;  2YZH A;  2VCV A;  5IO0 A;  4EKZ A;  1XVW A;  1GRX A;  4K0N A;  4G01 A;  2PVO C;  4TVE A;  3EMP A;  2B7J A;  2MMA A;  4MMM A;  3Q6O A;  2DIY A;  1R7H A;  3GH6 A;  3ZTL A;  1GSF A;  3F0I A;  4DSQ A;  3D5J A;  2HLS A;  4IN0 A;  3ZMK A;  3US3 A;  1DSB A;  2K8V A;  2H19 A;  5JWO B;  4KDX A;  3JCM L;  5F06 A;  4EIQ A;  1ZL9 A;  2IPA A;  9GSS A;  3GA4 A;  4XIH A;  2WJU A;  1AQW A;  3WD6 A;  1THX A;  4XTS A;  1XWG A;  4J2F A;  1SKR B;  2CVB A;  2F9S A;  16GS A;  4HDE A;  5J47 A;  2LST A;  1F3B A;  1B8X A;  2DML A;  3FEU A;  1XW5 A;  1B48 A;  4X0X A;  1YJ6 A;  4YKF A;  1YF0 A;  5L71 A;  1ILO A;  3IOS A;  4YH2 A;  2IFQ A;  1FVK A;  1K0C A;  1GP1 A;  1GUL A;  2XPE A;  3LEF A;  1NSW A;  4PNF A;  3LW9 A;  3EYT A;  4AJ7 A;  1W89 A;  3AY8 A;  2DJ2 A;  1MDJ A;  1Z6N A;  1V9W A;  4MZB A;  1GTB A;  1TXX A;  3NOF A;  2B1K A;  2GSS A;  2VM1 A;  5DAK A;  3D6I A;  3MYD A;  2M72 A;  5ECK B;  5D9T A;  3FR9 A;  3ERF A;  5IPH A;  5ECR B;  4PGT A;  3QDN A;  3IR4 A;  5A34 B;  1Y25 A;  3M3M A;  2OE3 A;  1O7U A;  1QGV A;  4GDF A;  1VF1 A;  3HZ4 A;  1HQO A;  3TUE A;  2GSQ A;  3TJJ A;  5ECH B;  6GSX A;  2XBI A;  5KOX A;  4Z2U A;  1JZW A;  4RUV A;  2H71 A;  2HRK B;  4PUA A;  4G0K A;  2E0Q A;  3CYN A;  5GAP D;  4PXO A;  1H4O A;  5LCZ A;  4ZL8 A;  1GSD A;  5EY6 A;  6GST A;  3KM6 A;  2VCQ A;  2LNS A;  1SK2 A;  2OAD A;  1YKC A;  4TOP A;  3L78 A;  3HJO A;  2M46 A;  5DAL A;  2C0E A;  2V6O A;  2C8U A;  3FZ4 A;  2DJK A;  1ML6 A;  4ZB6 A;  3EVI A;  6GSS A;  1WJK A;  4TR0 A;  2ALB A;  2HRF A;  5IMV A;  1GUH A;  2FA8 A;  3Q18 A;  2O89 A;  1YKA A;  5DCG A;  4K9Z A;  2DC5 A;  4IGJ A;  3FZ5 A;  1O8X A;  4AKX B;  2GZZ A;  5CRH A;  1EOG A;  3KIJ A;  1WP0 A;  4AKG A;  3D21 A;  1AC1 A;  1GTA A;  2WUL A;  3VLN A;  4E8E A;  3WGD A;  4WR4 A;  2H6Y A;  3TGZ A;  4DSR A;  2ZUP A;  3C73 A;  4HI7 A;  2YAN A;  5IMC A;  3TJF A;  4NPB A;  5ECN B;  2JL4 A;  2OKA A;  1K0N A;  5ECL B;  4EVM A;  1XFL A;  2HSH A;  1GSY A;  3RPP A;  5D96 A;  1TK5 B;  1X5E A;  3UJ1 A;  1JHB A;  5DJM A;  2MBT A;  4HQS A;  4POK A;  3GUS A;  2VAF A;  3WT2 A;  4WBR D;  3LXT A;  3J7Y b;  1F9M A;  2X8G A;  2I9H A;  1FOV A;  2A2P A;  3GH9 A;  1C72 A;  2YWN A;  1MDK A;  5E59 A;  2H0H A;  4IJ3 A;  2L4Q A;  4A5P A;  1V58 A;  4IKH A;  1K3L A;  2LTK A;  4K5R A;  2YWI A;  2FA4 A;  3APQ A;  1A2L A;  3ZL5 A;  1F3A A;  2PBJ A;  4Q5N A;  1UC7 A;  4XHM A;  1OAZ A;  2LJK A;  2B5Y A;  2EFE A;  2HQT A;  4KCA A;  1SU9 A;  4ML1 A;  4PQH A;  3H1N A;  3A5I A;  4N10 A;  2I81 A;  2GTU A;  2X64 A;  2L5L A;  2L6D A;  1HNB A;  4TXO A;  5D93 A;  1I5G A;  1S3A A;  4CDO A;  4JR4 A;  4GQC A;  3N5O A;  2YV7 A;  1R5P A;  2CA8 A;  2YOI A;  5HFG A;  3ZFB A;  5F0G A;  3H79 A;  2HRK A;  2B7K A;  3DRN A;  2HSN A;  3UL3 A;  3ZVJ A;  4N0V A;  3VPQ A;  2VM2 A;  3IAM 2;  2PER A;  4MCU A;  4EO3 A;  2R3X A;  3ZRE A;  4ACS A;  1AXD A;  3EIN A;  3GUR A;  1U3A A;  2OJL A;  3KD0 A;  4K0G A;  3M9J A;  3W6G A;  3MAK A;  2JZT A;  1JFU A;  4ICY A;  2WRT A;  4QMK A;  2E7P A;  1R26 A;  4F03 A;  1XWK A;  3KP9 A;  1AW9 A;  4JED A;  4PQI A;  1GSQ A;  2DJ3 A;  2B5X A;  2DJJ A;  2ZNM A;  4J57 E;  3QAW A;  3G7I A;  2R2J A;  3F4T A;  3QCP A;  2MBS A;  3BOA A;  4NXI A;  3C7M A;  4CW9 A;  1A24 A;  3KZQ A;  4PTS A;  4ECI A;  4JU5 A;  2H01 A;  3TOU A;  4GXZ A;  3FMW A;  1Q98 A;  4NWY A;  1PMT A;  1XW6 A;  2E2M A;  1PKZ A;  1TI3 A;  1PA3 A;  4HEA 2;  3ZZX A;  2F8A A;  3HHV A;  2H1L A;  2UV8 G;  4KE3 A;  2AAW A;  3K8N A;  1PL1 A;  4K7O A;  3DKS A;  4OFT A;  3O76 A;  4K6X A;  5CP1 A;  2FLS A;  4KDU A;  1SVO A;  3CTG A;  3IDV A;  3GTU A;  2H66 A;  2YJH A;  1UN2 A;  3MWH A;  4GSN A;  3UMA A;  3A2X A;  1OVN A;  2AHE A;  2ZCT A;  3BD2 A;  3LQ7 A;  3TJB A;  3VUR A;  2YNX A;  2NPB A;  4GSS A;  4L5L A;  5A5K A;  2GZP A;  3DD3 A;  1AQX A;  4NV5 A;  3VFI A;  2PVQ A;  2L6C A;  3DWV A;  5JCU A;  2B5E A;  3TKP A;  2R0C A;  6GSV A;  4IEL A;  3QAG A;  1TRV A;  4ZL7 A;  5IMZ A;  3PR8 A;  4EIP A;  3CXG A;  3ZYW A;  3G9B A;  3FK8 A;  4KW6 A;  1FAA A;  2RII A;  1M99 A;  4HZ2 A;  5ELG A;  1X5D A;  2WGR A;  3KP8 A;  3WGX A;  19GS A;  4F9Z A;  2CQ9 A;  4MF6 A;  4GRF A;  2IFQ B;  1SJZ A;  4ZBB A;  4EUY A;  3TOT A;  1KTE A;  4MF5 A;  2OBK A;  3HJP A;  4EDY A;  3P2A A;  3W8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...