5ECOB

Crystal structure of fin219-fip1 complex with ja, leu and mg
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
b'LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ligase/transferase
total genus 65
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecoB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecoB01
3KD0A 5G30A 1SK0A 4IKHA 4BL7B 3EWLA 4KH7A 2LQOA 4Q5QA 6GSYA 2C1YA 1OYJA 2MMZA 3F63A 3VI5A 1Z7RA 6GSUA 4MCUA 1GNWA 2B3SA 1I9DA 4HZ4A 4MPGA 3W8JA 3HVXA 2XBQA 3I9V2 1ST9A 2BJXA 3QDNA 1XWAA 1TTZA 2LRTA 3GKXA 5B7CA 3CSIA 1V98A 3M9JA 2FD3A 2WZ9A 1TJDA 4NV5A 3HCZA 3UEMA 3FZ5A 2IL3A 1M99A 4N10A 2YWNA 4HQZA 3KM6A 4HJ2A 1BJXA 5D9XA 4L0UA 3WT1A 1H4OA 1B9XC 1PRXA 3GL5A 1DBYA 1JZOA 5LD0A 3UBKA 4ZB6A 1JZRA 1EZKA 4FYBA 2R6KA 4PGTA 1U87A 3GUSA 2V32A 1O6JA 2WRTA 1J0FA 3GKMA 1XCCA 1S3DA 4KA0A 2H8LA 4PURA 17GSA 1A2MA 1ZOFA 2LKUA 1HD2A 4ZIJA 5IOXA 2VCXA 1LBKA 4G0LA 2WB9A 3RHCA 2YOIA 2OA7A 2GGTA 4WBJA 5DBQA 5JCWA 1M2BA 5IQYA 2DJKA 2C4JA 4NMUA 2GSQA 1GWCA 4WBRD 20GSA 1X5EA 4I2TA 4H86A 2HFDA 4Q5RA 2K18A 4ZL7A 2AJQB 1PGTA 1AQVA 2OBIA 1VF2A 1SYXA 3EU4A 4MMMA 4XRDA 3LGCA 1R4WA 2LNTA 1M7TA 3TRPA 1KTEA 5AIXA 3WYWA 1YDKA 2PMTA 1YF0A 3OR5A 3F9UA 5IMDA 3HJPA 2MBSA 1GTIA 1ACVA 4LL1B 2TRXA 2GTUA 4KDUA 2L6DA 2LV3A 3TRXA 4IBPA 3DWVA 2C0FA 5HFGA 4IELA 4DSQA 4ECIA 3MNGA 3EMPA 5H5RA 1YJ6A 5ECSA 3UARA 2WCIA 3TJJA 1XBSA 4XS4B 1PQNA 3D4TA 4GRFA 2M46A 3AY8A 5IMVA 5ECQB 4QL7A 2HI7A 2P5RA 4EDZA 4IW9A 3DXBA 5EVOA 2NTOA 2KUCA 3IOSA 1A24A 2ON7A 4MZBA 3KH7A 1W4VA 5DQYA 5B6MA 5F05A 3C1SA 1Z3EA 1GH2A 3ZVJA 2LSTA 2B1KA 3FY7A 5CO3A 1CQHA 2FUG2 1IYHA 1SD9A 1Z7PA 1M9AA 4PUAA 1AQWA 3N5OA 4I5QA 1O8XA 3IR4A 1T1VA 3WD6A 1FB6A 2HXKA 4ZB8A 4J56E 2GSRA 3GNJA 3VWWA 4PNGA 4OFNA 2JADA 2GQKA 1SKSB 5AN1A 4EE0A 3QAGA 1FO5A 3PPUA 4TXOB 4MK3A 3LXTA 1EWXA 4PTSA 2VCZA 2KHPA 2XBIA 3QOUA 2HLSA 1RK4A 1QFNA 2GDRA 4ULXA 3CYNA 1GNEA 2NVLA 2E2GA 4F82A 4LLRA 4MDCA 3GKNA 1XVQA 5GAPD 2F51A 3TJKA 3ME8A 1Z5YE 2AYTA 3QR6A 4MF7A 5LCZA 4PQHA 2ZUPA 1B48A 5DQSA 2A2SA 2VD0A 3TGZA 1PA3A 2A2RA 4WR5A 5HR1A 2L5OA 3KCMA 2FA8A 2GZPA 1KEBA 4PQIA 1YKCA 3MWHA 3GYKA 3DEXA 5ECKB 4IN0A 3TUEA 3QFAC 1SL1B 3IRAA 3APQA 2XPEA 3TDGA 1VF4A 3FR3A 4DSSA 3FZAA 1J08A 3O76A 3CTGA 2H71A 1A0FA 1SJIA 3WGEA 1K0NA 1DUGA 2WS2A 4DEJA 4X43A 2DBCA 2FGXA 2WGRA 2VL2C 3DKSA 3BD2A 5CRHA 4IS0A 2B7JA 3HZ8A 2AB6A 3IHQA 4IQAA 1GSDA 2LEGA 2HQTA 3EVIA 1SENA 1GSUA 1BG5A 4BVYA 4YAPA 3TKPA 4TW5A 4ECJA 4HUAA 4JZQA 1TRVA 3TOUA 3SWLA 2PU9C 2YZUA 4EKZA 5ECHB 1FOVA 2OJLA 3GA4A 4BVXA 1ABAA 3KTBA 5ELAA 4KSMA 3IE3A 2C3QA 4PNFA 4OCFA 5ECRB 3FZ4A 3HD5A 3NIVA 1KNGA 4ZXGA 1SK1A 1M0UA 2H01A 4JBBA 1ERUA 2V6KA 3ZFBA 1QXHA 4GSTA 4GWRA 4GXZA 3APOA 1OC8A 1MEKA 3Q74A 1ML6A 5DVBA 4EL1A 5FHIA 1F3AA 2K8VA 4TR4A 1V40A 1AW9A 3LG6A 1J9BA 3M0FA 2EIQA 2C0GA 4TR3A 5H5QA 1JLVA 1AQXA 3NOFA 5E59A 3HKRA 2R37A 2H6ZA 4TXVA 2CVBA 1R26A 2CT6A 2O89A 1S3AA 4MH2A 9GSSA 3ZFLA 2VCTA 1T4ZA 3F8UA 1WP0A 1GUMA 4FIWA 2L5LA 1QQ2A 3KP9A 4G2EA 1XWKA 5KN3A 4Q5FA 4ECBA 5ID2A 3HDCA 5E4WA 1X9WB 1V58A 4I8BA 3Q18A 1TDIA 3FHKA 2FWFA 1UVZA 1GLQA 1XWGA 3CRUA 1JFUA 3A2WA 1ZGNA 3GX8A 2CX4A 5B6NA 1XFLA 4HOJA 4G0KA 3I43A 1TKDB 3GH9A 3ZIJA 5D93A 2F3MA 1OE8A 5EY6A 3A2XA 4MLYA 4POMA 4YQUA 3TCOA 4OWYA 1YKAA 2YWIA 2IWTA 2KOKA 1PL2A 1X5DA 1OC9B 2OKAA 3ERGA 5CYYA 2XHFA 1N2AA 1FHEA 5GZZB 2F8AA 1JZWA 4OFTA 4D73A 2EC4A 2L57A 1M2AA 2HNLA 4MF5A 1T8EB 2K6VA 4AJ7A 1FVJA 3GTUA 2VLUA 1R5AA 2VL3A 4XIHA 1Q98A 4QL9A 3VK9A 4OFMA 4I6XA 1XW5A 2VLTA 5CAXA 4WR4A 2A4VA 2RUEA 3GL3A 4F2IA 4JR6A 2C8UA 1EOHA 2X8GA 2R3XA 4G0IA 3TKQA 4PX1A 3QPMA 5IM9A 2TRCP 1BYEA 2FWHA 2CAIA 1GUHA 2RIIA 3TJFA 2DIYA 4FYUA 4NHZA 2ON5A 3P8WA 2CZ3A 2IMEA 1PKWA 3C7MA 2PVQA 2HZEA 2GT5A 1GLPA 5L71A 4E8HA 1UA5A 5DALA 2N5AA 2EIRA 3IAM2 1B4PA 2MMOA 2LRCA 3CRTA 1F37A 1EV9A 4EVMA 1AAZA 3EMXA 3KH9A 3RAZA 2VOCA 4OO5A 2LJKA 5IIZA 1FG4A 2RLIA 4NPBA 4G19A 4MPFA 4K7NA 2VCWA 3FEUA 3APSA 3H8QA 4IJIA 3ISOA 2EIOA 3ZMLA 4L5LA 4ML1A 1TU8A 4K6XA 5ECMB 2HSMB 1XVWA 2HYXA 3BJ5A 2CVKA 1EV4A 4TR0A 4GTUA 2FY6A 4ILFA 3UIWA 4N0VA 2HZFA 3TKSA 2IN3A 3KJYA 4RI7A 1F3BA 2JACA 1F6MC 4K7OA 2YWMA 4GSSA 2B6MA 1XPVA 3CTFA 4XCSA 3P7XA 2FCHA 3D5JA 1HNAA 2LTKA 2H0GA 2QGVA 3KXOA 2H30A 5JCUA 5DCHA 2FLSA 2IFQB 5G5EA 1AIUA 2X8CA 4K9ZA 2WDUA 3CXGA 1WRYA 1GSYA 5JWOB 3US3A 3O3TA 2YJHA 5IMCA 2B7KA 2HRNA 1E6BA 4EF0A 1OE7A 2PPTA 4FO5A 1EEJA 2J23A 1XZOA 1B8XA 4TR1B 1XXUA 4WXTA 2FWGA 14GSA 2YWOA 4V1Ag 2VL2A 4K0GA 1JHBA 3UOMA 22GSA 4EC0A 5HQPA 1E2YA 4E8EA 3HXSA 3M1GA 3GH6A 4K7IA 2MMNA 3VFIA 3M8NA 5KEJA 4IGJA 1LU4A 1NHOA 3EINA 1Y25A 3QFBC 3UVTA 1THOA 4I97A 4O7HA 3E3EA 4LMWA 4YQMA 2B5YA 3GV1A 3PR8A 3LORA 1K3LA 4KCAA 2MYGA 4GQFA 4G10A 2HSYA 2VD1A 4OMVA 1ZZYA 3G7JA 4JE1A 2JZSA 5HFKA 3ZITA 2ZCTA 1TOFA 4HU7A 2JU5A 1A8YA 3D4MA 4KNDA 5CRDA 1RQMA 2FWEA 5G2ZA 1GRXA 2HRAA 2X64A 5IMFA 3DVXA 4JU5A 1A2LA 13GSA 3FR9A 5CRWA 2H0HA 3E0UA 5IOWA 3Q19A 3A5WA 1XWBA 3IDVA 6GSVA 1TRUA 4V1Ap 2HE3A 4L8EA 3LFLA 3CSJA 2DMMA 2HSNB 1TRSA 4ID0A 3BCKA 3IC8A 1A2JA 4LL4B 4O5RA 3HYPA 3EYTA 1V2AA 2PWJA 2IMDA 3IA1A 3H79A 2L6CA 2V41A 5G1LA 3UMAA 2ES7A 1M9BA 5G5FA 5DJLA 1GSSA 3WT2A 2B1LA 4BL7A 3MSZA 5HR0A 2OE3A 4HQSA 3TJGA 1B4QA 1X5CA 1R5PA 1XIYA 2YV7A 1XOAA 3TB2A 3KP8A 4QQ7A 4K0NA 5FT3A 5DAKB 2WFCA 3ZLPA 2CVDA 2HRKB 2H1GA 2DJ0A 3TKSE 16GSA 2DSAA 1EP7A 3VPTA 3KTLA 1SKRB 2V1MA 3LJRA 4RI6A 1OKDA 3L9UA 5BMUA 4KF9A 2NDOA 3M9KA 5CP1A 1T3BA 2IPAA 3VWVA 4MZWA 1O85A 3F6FA 4KW6A 3IC4A 2LS5A 4ZL8A 2I1UA 3RPPA 4FH8A 2E7PA 3GHAA 4MA9A 3H4KA 4NWYA 5IMAA 3C73A 1G7OA 1SJZA 2OE0A 2HZEB 3ME7A 3HVSA 4HI7A 2VUPA 2GQLA 3D0ZA 3H93A 1PKZA 2G2QA 2YANA 2C0EA 2PUKC 4V2MA 4GSNA 5B8BA 3LYPA 5CNWA 1EGOA 3ED3A 3DGQA 1MDKA 4IQ1A 2AUVA 4L5OA 3KMNA 2DJ3A 2OADA 3WGXA 4HDEA 1K0CA 2KP2A 1DSBA 2PBJA 2VM1A 4GLTA 1BAYA 1M2DA 2B5EA 3RDWA 2CQ9A 2C3TA 2YN1A 5D73A 3BOAA 7GSSA 1OVNA 5ECIB 1K0OA 1OKTA 2O85A 3UBLA 2GVPA 4PQ1A 5J4UA 1WE0A 1HQOA 1SJ6A 4MJEA 3VI7A 2NBSA 4GQCA 3G7IA 4ZBAA 2H75A 4XRAA 1GSEA 1Z6MA 4CHSA 1THXA 2I9HA 3F3QA 3VPQA 2GQMA 1XOBA 3KZQA 4WF4A 2MBTA 1DE2A 5A4VA 3EURA 2G0FA 1GSFA 2Z9SA 2ALBA 3A3TA 4JRRA 2GSSA 4GF0A 4OO4A 2YCDA 3H1NA 4F0CA 5IPHA 4DSRA 3LEFA 3ZRDA 1GP1A 4FQUA 4V2NA 4XS4A 1WOUA 1JZDA 3C71A 4HZ2A 2WJUA 4KGIA 4F9ZA 6GSTA 1HNCA 5AISA 3QAWA 2LNSA 5ENUA 1FW1A 1TI1A 1YZXA 1GTAA 3IAS2 1GSQA 1T4YA 3FK8A 3KEBA 1K0MA 1HNBA 4K1FA 1ERTA 2OACA 4EDYA 2P0GA 3IV4A 4O92A 5ECNB 4OD7A 4ZILA 1XW9A 2DJ2A 2QSIA 3VWXA 1GTBA 4KX4A 4MJAA 3BBYA 2X8HA 19GSA 4GCIA 3HY2A 3E9JB 1T7PB 3KMOA 1Q4JA 1O7UA 4MJCA 3QCPA 4JEDA 4G9HA 3RBTA 5ELGA 2XPDA 4HJMA 2N5FA 4HU9A 2O8VB 2L4CA 4MP4A 2H0IA 2L59A 4BPYA 3M3MA 4WF5A 2LJAA 1QGVA 1S3CA 4ML6A 3CSHA 3F4TA 5D9WA 4TXOA 3G9BA 1ZL9A 3HJOA 4ZBDA 3MDKA 4JR4A 1HYUA 3KIJA 3DIEA 5F06A 3KGKA 3EC3A 3DRNA 2VO4A 3ZZXA 1SKWB 2H72A 5CRGA 3I69A 4KAEA 3FRCA 4XTSA 5IO2A 2HSHA 1G6WA 2OBKA 2MZCA 5F07A 4P3YB 1A0RP 1AC1A 4EO3A 2GZZA 4ZB9A 2XC2A 5G31A 5JCGA 2VAFA 2R4VA 4CW9A 2O7KA 2F9SA 3L9VA 5CREA 4EXJA 5KN0A 1WMJA 4EUYA 1O81A 1ZYEA 2H73A 2AHEA 1NM3A 5GSSA 3J7Yk 1WIKA 2J9HA 2N5BA 4TRXA 1G7EA 3GRXA 3PGTA 4AJ6A 2LJRA 8GSSA 1EP8A 5D96A 1KBNA 1VGLA 3GIXA 4O32A 3O6TA 4F03A 1SYRA 5D9VA 2V6OA 1ZCPA 1ON4A 1TK5B 2YNXA 1FAAA 3IXRA 4J57E 3UVHA 1MD4A 5J9CA 3ZVJD 2JSYA 3ZIVA 3L0HA 2OE1A 3LQ7A 5C04A 2H76A 1SL0B 3W8SA 4OCEA 3SBCA 4KCEA 3U6VA 2YP6A 2DJ1A 1JLWA 3EE2A 1URMA 4DSSB 2IJYA 1V9WA 2H6XA 1GL8A 2BTOT 3DVWA 1ILOA 3MAKA 2MMAA 2FNOA 3F4RA 2HRFA 1OAZA 1W89A 5EL8A 4IVFA 4NXIA 3TKRA 4TKYA 4TVEA 5J9BA 1VRSD 4KDYA 2TIRA 4N0ZA 1PL1A 4XHMA 1PX7A 5A4WA 5J3RA 1QK8A 5GAND 4KE3A 3GURA 2LRNA 4BVYB 1PN9A 1NW2A 1TU7A 1YEPA 2FA4A 1XWCA 2H1DA 1O73A 1MDIA 5KN2A 3DMLA 4YAVA 4LA1A 4BVXB 2I81A 2H74A 3PINA 4RUVA 3LYKA 3F3RA 3GSTA 5ECPB 3F0IA 1AXDA 2GS3A 2H1BA 2PN8A 5AIVA 1R7HA 4KUNA 1H75A 1BQ7A 4ACSA 2P5QA 2UZ8A 1IYIA 2CZ2A 3DYRA 4YQVA 3QAVA 3GKKA 5IMZA 3TRQA 4PXOA 5G1KA 3D21A 1ZYQB 4USSA 4TOPA 2QKEA 1G6YA 2C80A 2YPMA 3WGDA 1GULA 2RM6A 2O87A 5D9TA 3NZNA 4K2DA 4BA7A 4MABA 1XW6A 4NV2A 2VL9A 4WKWA 1X0RA 1BX9A 5ID2B 3RHBA 3FKFA 4YH2A 2R2JA 1FB0A 2VIMA 2DIZA 1CQGA 1OC9A 5ECLB 1YY7A 4XS6A 1DE1A 2RUFA 2JL4A 2LUSA 3LSZA 1K0BA 1UC7A 1ERVA 2JZTA 2DC5A 4MZCA 3V1WA 4KSOA 2ZNMA 4K8MA 3N9JA 4HS1A 1X9SB 2HT9A 2YV9A 5ECOB 1RW1A 3BCIA 2JZRA 3D6IA 3ERFA 3HJMA 3LXZA 5B8AA 4BWQA 4KDXA 1PD21 3VURA 1NSWA 1QUWA 2VCVA 4WEYA 1GUKA 2L4QA 2BMXA 5HR2A 2WULA 4AGSA 4FYCA 3HA9A 3RPNA 4NAXA 4PUFC 4D73B 5LNKe 1PSQA 5ABRA 2RM5A 1U88A 1C72A 2M80A 3GTUB 2GSTA 2NPBA 1N8JA 2I3YA 3CMIA 3IPZA 3EU3A 3TKSC 2DLXA 1T00A 1MDJA 11GSA 1TRWA 3VLNA 5A4UA 1AUCA 3G7YA 6GSSA 2M72A 5DDLA 1Z6NA 2YJ7A 2VCQA 1ZMAA 1PX6A 3GSSA 3L9SA 2CAQA 5DCGA 2GT6A 1Y6EA 5J41A 4MJBA 3IK7A 4X1UA 5DALB 3U5RE 2KP1A 2IMFA 2E0QA 3QMXA 3FR6A 3HVVA 3A2VA 1MTCA 5KN1A 1TK0B 4AJ8A 3C1RA 2IMKA 2GZYA 4N11A 2HSMA 2C0DA 2JSZA 1K3OA 3CBUA 1K0AA 2FHEA 5HR3A 1K3YA 1NHYA 3FW2A 1X9MB 1YQ1A 4Q5NA 2PGTA 1VF3A 1QMVA 4L0WA 3GN3A 5COHA 6GSXA 1U3AA 2H19A 1I5GA 2QC7A 6GSWA 4Z7XA 3TOTA 3UJ1A 4IP1A 1U6TA 2AV4A 4XS1A 1TW9A 2R5GA 4POKA 4CDOA 1B9YC 5J5NA 5GSTA 1WJKA 2IFQA 3HHVA 1OC3A 3R2QA 2REMA 3ZYWA 18GSA 12GSA 4HEA2 3ERWA 4POLA 1TXXA 2D2ZA 2X99A 4TR1A 2I4AA 5INYA 1EOGA 1U3IA 1BEDA 2F8FA 2CA8A 1YF1A 4BWSA 1WWJA 4TN8A 3FZ9A 1UN2A 3ZMKA 3L4NA 3HZ4A 1O8WA 4LMVA 5D8IA 4J2FA 3DD3A 4ZL9A 1G0TA 10GSA 1SK2A 4RQXA 2V2GA 3F4SA 2C3NA 1A23A 2H66A 1SD8A 1EEMA 4V2LA 4MH3A 1SL2B 4KB3A 4POBA 3GX0A 2PERA 3IBHA 1A8LA 2CX3A 3J7Yb 2H1AA 2P31A 4AF2A 2K8SA 3UL3A 2K9FA 2VLVA 5FWGA 1GTUA 1V57A 4WETA 3JCML 1YEXA 4ZBBA 1SU9A 5F8BA 4ECCA 3VWUA 3GFKA 3W6GA 4N30A 5JWQB 4MF6A 3ZL5A 1USBA 2B5XA 2IIYA 2VM2A 4ISDA 2H6YA 3C8EA 1LJRA 1F2EA 3K8NA 3GMFA 3TJBA 3PH9A 3ZTLA 3F6DA 3IK9A 4X0XA 5IPGA 3S9FA 4F0BA 3R3EA 5A5KA 4NHWA 2H70A 3D22A 2YZHA 1Z9HA 5F0GA 2LQQA 1F9MA 4IJ3A 3LWAA 4IP6A 1TK8B 2E2MA 1ERWA 3I6AA 2PVOC 2AAWA 4RQRA 1FVKA 2GLRA 5AGYA 2DJJA 3UAPA 5DAKA 5HFIA 2IMIA 4DVCA 5IO0A 3P90A 2HRKA 1WPIA 3L78A 3FYGA 5C00A 1EGRA 5JWRB 3QD9A 1K0DA 1MD3A 3ZREA 5DJMA 4I2UA 1VF1A 1TP9A 2DMLA 3P2AA 5EPFA 5H5SA 2KLXA 1PMTA 1TI3A 3Q6OA 4IHUA 2CV4A
chains in the Genus database with same CATH superfamily
3KD0A 5G30A 1SK0A 4IKHA 4BL7B 3EWLA 4KH7A 2LQOA 4Q5QA 1TXUA 6GSYA 2C1YA 1OYJA 2MMZA 3F63A 3VI5A 1Z7RA 6GSUA 4MCUA 1GNWA 2B3SA 1I9DA 4HZ4A 4MPGA 3W8JA 3HVXA 2XBQA 3I9V2 1ST9A 2BJXA 3QDNA 1XWAA 1TTZA 2LRTA 3GKXA 5B7CA 3CSIA 1V98A 3M9JA 2FD3A 5BMUB 2WZ9A 1TJDA 4NV5A 1S4BP 3HCZA 3UEMA 3FZ5A 2IL3A 1M99A 4N10A 2YWNA 4HQZA 4CY8A 3KM6A 4HJ2A 1BJXA 5D9XA 4L0UA 3WT1A 1H4OA 1B9XC 1PRXA 3GL5A 1DBYA 1JZOA 5LD0A 5A5HB 3UBKA 4ZB6A 1JZRA 1EZKA 4FYBA 2R6KA 4PGTA 1U87A 3GUSA 2V32A 1O6JA 2WRTA 1J0FA 3GKMA 2X49A 1XCCA 2QA2A 1S3DA 4KA0A 2H8LA 4PURA 17GSA 1A2MA 1ZOFA 2LKUA 4K5RA 1HD2A 4ZIJA 5IOXA 2VCXA 5KOXA 1LBKA 4G0LA 3LW9A 2WB9A 3RHCA 2YOIA 2OA7A 2GGTA 4WBJA 5DBQA 5JCWA 1M2BA 5IQYA 2DJKA 2C4JA 4NMUA 2GSQA 1GWCA 4WBRD 20GSA 1X5EA 4I2TA 4H86A 2HFDA 4Q5RA 2K18A 4ZL7A 2AJQB 1PGTA 1AQVA 2OBIA 1VF2A 1SYXA 3EU4A 4MMMA 4XRDA 2R0CA 2WW1A 3LGCA 1R4WA 2LNTA 1M7TA 3TRPA 1KTEA 5AIXA 3WYWA 4PI0C 1YDKA 2PMTA 1YF0A 3OR5A 3F9UA 4YKGA 5IMDA 3HJPA 2MBSA 1GTIA 1ACVA 4LL1B 2TRXA 2GTUA 4KDUA 2L6DA 4QMKA 2LV3A 3TRXA 4IBPA 3DWVA 2C0FA 5HFGA 4IELA 4DSQA 4ECIA 3MNGA 3EMPA 5H5RA 1YJ6A 5ECSA 3UARA 2WCIA 3TJJA 1XBSA 4XS4B 1PQNA 2R0PA 3D4TA 4GRFA 2M46A 3AY8A 5IMVA 5ECQB 4QL7A 2HI7A 2P5RA 4EDZA 4IW9A 3DXBA 5EVOA 2NTOA 2KUCA 3IOSA 1A24A 2H1LA 2ON7A 4X4JA 4MZBA 3KH7A 1W4VA 5DQYA 5B6MA 5F05A 4GDFA 3C1SA 3MYDA 1Z3EA 1GH2A 3ZVJA 2LSTA 2B1KA 3FY7A 5CO3A 1CQHA 2FUG2 1IYHA 1SD9A 1Z7PA 1M9AA 4PUAA 1AQWA 3N5OA 4I5QA 1O8XA 3HVNA 2UV8G 3IR4A 1T1VA 3WD6A 1FB6A 2HXKA 4PHZC 4ZB8A 4J56E 2GSRA 3GNJA 3VWWA 4PNGA 4OFNA 2JADA 2GQKA 1SKSB 5AN1A 4EE0A 3QAGA 1FO5A 3PPUA 4TXOB 4MK3A 3LXTA 1EWXA 4PTSA 2VCZA 2KHPA 2XBIA 3QOUA 2HLSA 1RK4A 1QFNA 2GDRA 4ULXA 3CYNA 1GNEA 2NVLA 2E2GA 4F82A 4LLRA 4MDCA 3GKNA 1XVQA 5GAPD 5J47A 3TU3B 2F51A 3TJKA 3ME8A 1Z5YE 2AYTA 3QR6A 4MF7A 5LCZA 4PQHA 2ZUPA 1B48A 5DQSA 2A2SA 2VD0A 3TGZA 1PA3A 2A2RA 4WR5A 5HR1A 2L5OA 3KCMA 2FA8A 2GZPA 1KEBA 4PQIA 1YKCA 3MWHA 2O36A 3GYKA 3DEXA 5ECKB 4IN0A 3TUEA 3QFAC 1SL1B 3IRAA 3APQA 2XPEA 3TDGA 4EIQA 1VF4A 3FR3A 4DSSA 3FZAA 1J08A 3O76A 3MIXA 3CTGA 2H71A 1A0FA 1SJIA 3WGEA 1K0NA 1DUGA 2WS2A 4DEJA 4X43A 2DBCA 2FGXA 2WGRA 2VL2C 3DKSA 4G01A 3BD2A 5CRHA 4IS0A 5J4YA 2B7JA 3HZ8A 2AB6A 1ZYNA 3IHQA 4IQAA 1GSDA 2LEGA 2HQTA 3EVIA 1SENA 1GSUA 1BG5A 4BVYA 2WW0A 4YAPA 3TKPA 4TW5A 4ECJA 4HUAA 4JZQA 1TRVA 3TOUA 3SWLA 2PU9C 2YZUA 1PN0A 4EKZA 5ECHB 1FOVA 2OJLA 3GA4A 4BVXA 1ABAA 3KTBA 5ELAA 3HMJG 4KSMA 3IE3A 2WW3A 2C3QA 4PNFA 4OCFA 5ECRB 3FZ4A 3HD5A 3NIVA 1KNGA 4ZXGA 1SK1A 1M0UA 2H01A 4JBBA 1ERUA 4E68A 2V6KA 3ZFBA 1QXHA 4GSTA 4GWRA 4GXZA 3APOA 1OC8A 1MEKA 3Q74A 1ML6A 5DVBA 4EL1A 5FHIA 1F3AA 5A1NB 2K8VA 4TR4A 1V40A 1AW9A 3LG6A 1J9BA 1XG8A 3M0FA 2EIQA 2C0GA 4TR3A 5H5QA 1JLVA 1AQXA 3NOFA 5E59A 3HKRA 2R37A 2H6ZA 4TXVA 2CVBA 4AKIA 1R26A 2CT6A 2O89A 2VKZG 1S3AA 4MH2A 9GSSA 3ZFLA 2VCTA 1T4ZA 3F8UA 1WP0A 1GUMA 4FIWA 3CWGA 2L5LA 1QQ2A 3KP9A 4O5QA 4G2EA 1XWKA 5KN3A 4Q5FA 4ECBA 5ID2A 3HDCA 5E4WA 1X9WB 1V58A 4I8BA 3Q18A 1TDIA 3FHKA 2FWFA 1UVZA 1GLQA 1XWGA 3CRUA 1JFUA 5J40A 3A2WA 1ZGNA 3GX8A 2CX4A 5B6NA 1XFLA 4HOJA 4G0KA 3I43A 1TKDB 3GH9A 3ZIJA 5D93A 2F3MA 1OE8A 5EY6A 3A2XA 4MLYA 4POMA 4YQUA 3TCOA 4OWYA 1YKAA 2A2PA 2YWIA 2IWTA 2KOKA 1PL2A 1X5DA 1OC9B 2OKAA 3ERGA 5CYYA 2XHFA 1N2AA 1FHEA 5GZZB 2F8AA 1JZWA 4OFTA 4D73A 2EC4A 2L57A 1M2AA 2HNLA 4MF5A 1T8EB 2K6VA 4AJ7A 1FVJA 3GTUA 2VLUA 1R5AA 2VL3A 4XIHA 1Q98A 4QL9A 3VK9A 4OFMA 4I6XA 1XW5A 2VLTA 5CAXA 4WR4A 2A4VA 2RUEA 3GL3A 4N3ZA 4F2IA 4JR6A 2C8UA 1EOHA 2X8GA 2R3XA 4G0IA 3TKQA 4PX1A 4PI2C 3QPMA 5IM9A 2TRCP 1BYEA 2FWHA 2CAIA 1GUHA 2RIIA 3TJFA 2DIYA 4FYUA 4NHZA 3EPTA 2ON5A 3P8WA 2CZ3A 2IMEA 1PKWA 3C7MA 2PVQA 2HZEA 2GT5A 1GLPA 5L71A 4E8HA 3FMWA 3CHXC 1UA5A 5DALA 2N5AA 2EIRA 3IAM2 4Z2TA 1B4PA 2MMOA 2LRCA 3CRTA 1F37A 1EV9A 4EVMA 1AAZA 3EMXA 3KH9A 3RAZA 2VOCA 4OO5A 2LJKA 5IIZA 1FG4A 2RLIA 4NPBA 4G19A 4MPFA 4K7NA 2VCWA 3FEUA 3APSA 3H8QA 4IJIA 3ISOA 2EIOA 3ZMLA 1M3IA 4L5LA 4ML1A 1TU8A 4K6XA 5ECMB 2HSMB 1XVWA 2HYXA 3BJ5A 2CVKA 1EV4A 4TR0A 4GTUA 2FY6A 4ILFA 3UIWA 4N0VA 2HZFA 3TKSA 2DKHA 2IN3A 1Y1UA 3KJYA 4RI7A 1F3BA 2JACA 1F6MC 4K7OA 2YWMA 4GSSA 2B6MA 1XPVA 3CTFA 4XCSA 3P7XA 2FCHA 3D5JA 1HNAA 2LTKA 2H0GA 2QGVA 3KXOA 2WVXA 2H30A 5JCUA 5DCHA 2FLSA 2IFQB 5G5EA 1AIUA 2X8CA 4K9ZA 2WDUA 3CXGA 1WRYA 1GSYA 5JWOB 3US3A 3O3TA 1ZYPA 2YJHA 5IMCA 2B7KA 2HRNA 1E6BA 4EF0A 1OE7A 2PPTA 4FO5A 1EEJA 2J23A 1XZOA 1B8XA 4TR1B 1XXUA 4WXTA 2DKIA 2FWGA 3A5IA 14GSA 2YWOA 4V1Ag 2VL2A 4K0GA 1PFOA 1JHBA 3UOMA 22GSA 4EC0A 5HQPA 1E2YA 4E8EA 3HXSA 3M1GA 3GH6A 2MMNA 4K7IA 1BF5A 3VFIA 3M8NA 5KEJA 4IGJA 1LU4A 1NHOA 3EINA 1Y25A 3QFBC 3IHGA 3UVTA 1THOA 4I97A 4O7HA 3E3EA 4LMWA 4YQMA 2B5YA 3GV1A 3PR8A 3LORA 1K3LA 4KCAA 2MYGA 4GQFA 4G10A 2HSYA 2VD1A 4OMVA 1ZZYA 3G7JA 4JE1A 2JZSA 5HFKA 3ZITA 2ZCTA 1TOFA 4HU7A 2JU5A 1A8YA 3D4MA 4KNDA 5CRDA 1N25A 1RQMA 2FWEA 5G2ZA 1GRXA 1SVOA 2HRAA 2X64A 5IMFA 3DVXA 4JU5A 1A2LA 13GSA 3FR9A 5CRWA 2H0HA 3E0UA 5IOWA 3Q19A 3A5WA 1XWBA 3IDVA 6GSVA 1TRUA 4V1Ap 2HE3A 4L8EA 3LFLA 3CSJA 2DMMA 2HSNB 1TRSA 4ID0A 3BCKA 3IC8A 1A2JA 4LL4B 4O5RA 3HYPA 3EYTA 1V2AA 2PWJA 2IMDA 3IA1A 3H79A 2L6CA 2V41A 5G1LA 3UMAA 2ES7A 1M9BA 3RFRC 5A34B 5G5FA 5DJLA 1GSSA 3WT2A 2B1LA 4BL7A 3MSZA 5HR0A 2OE3A 4HQSA 3TJGA 1B4QA 1X5CA 1R5PA 1XIYA 2EFCA 2YV7A 1XOAA 3TB2A 3KP8A 4QQ7A 4K0NA 5FT3A 5DAKB 2WFCA 3ZLPA 2CVDA 2HRKB 2H1GA 4BIKA 2DJ0A 3TKSE 16GSA 2DSAA 1EP7A 3VPTA 3KTLA 1SKRB 2V1MA 3LJRA 4RI6A 1OKDA 3L9UA 5BMUA 4KF9A 2NDOA 3M9KA 5CP1A 1T3BA 4AKGA 2A4HA 2IPAA 3VWVA 4MZWA 1O85A 3F6FA 4KW6A 3IC4A 2LS5A 4ZL8A 2I1UA 3RPPA 4FH8A 2E7PA 3GHAA 4MA9A 2WVZA 3H4KA 4NWYA 5IMAA 3C73A 5A5HA 1G7OA 1SJZA 2OE0A 5BRTA 2HZEB 3ME7A 3HVSA 4HI7A 2VUPA 2GQLA 3D0ZA 3H93A 1PKZA 2G2QA 2YANA 2C0EA 2PUKC 4V2MA 4GSNA 5B8BA 3LYPA 5CNWA 1EGOA 3ED3A 4AI6A 3DGQA 1MDKA 4IQ1A 2AUVA 4L5OA 3KMNA 2DJ3A 1SVLA 2OADA 3WGXA 4HDEA 1K0CA 2KP2A 1DSBA 2PBJA 2VM1A 4GLTA 4FXYP 1BAYA 1M2DA 2B5EA 3RDWA 2CQ9A 2C3TA 2YN1A 5D73A 3BOAA 7GSSA 1OVNA 5ECIB 1K0OA 1OKTA 2O85A 3UBLA 2GVPA 4PQ1A 5J4UA 1WE0A 1HQOA 1SJ6A 4MJEA 3VI7A 2NBSA 4GQCA 3G7IA 4ZBAA 2H75A 4XRAA 1GSEA 1Z6MA 4CHSA 1THXA 2I9HA 3F3QA 3VPQA 2GQMA 1XOBA 1SVMA 3KZQA 4WF4A 2MBTA 1DE2A 5A4VA 3EURA 4ICYA 2G0FA 1GSFA 4K2XA 2Z9SA 2ALBA 3A3TA 4JRRA 2GSSA 4GF0A 4OO4A 2YCDA 3H1NA 4F0CA 5IPHA 4DSRA 3LEFA 3ZRDA 1GP1A 2EFDA 4FQUA 4V2NA 4XS4A 5J4VA 1WOUA 1JZDA 3C71A 4HZ2A 2WJUA 4KGIA 4F9ZA 6GSTA 1HNCA 5AISA 3QAWA 2LNSA 5ENUA 1FW1A 1TI1A 1YZXA 1GTAA 3IAS2 1GSQA 1T4YA 3FK8A 3KEBA 1K0MA 1HNBA 4K1FA 2EFEA 1ERTA 2OACA 4EDYA 4AKXB 2OT3A 2P0GA 3IV4A 4O92A 5ECNB 4OD7A 4ZILA 1XW9A 2DJ2A 2R0GA 2QSIA 3VWXA 1GTBA 2QA1A 4KX4A 4MJAA 3BBYA 2X8HA 19GSA 4GCIA 3HY2A 3E9JB 1T7PB 3KMOA 1Q4JA 1O7UA 4MJCA 3QCPA 4JEDA 4G9HA 3RBTA 5ELGA 2XPDA 4HJMA 2N5FA 4HU9A 2O8VB 2L4CA 4MP4A 2H0IA 2L59A 4BPYA 3M3MA 4WF5A 2LJAA 1QGVA 1S3CA 4ML6A 3CSHA 3F4TA 5D9WA 4TXOA 3G9BA 1ZL9A 3HJOA 4ZBDA 3MDKA 4JR4A 1HYUA 3KIJA 3DIEA 5F06A 3KGKA 3EC3A 3DRNA 2VO4A 3ZZXA 1SKWB 2H72A 5CRGA 3I69A 4KAEA 3FRCA 4XTSA 5IO2A 2HSHA 1G6WA 2OBKA 4ZB7A 2MZCA 5F07A 4P3YB 1A0RP 1AC1A 4EO3A 2GZZA 4ZB9A 2XC2A 5G31A 5JCGA 2VAFA 2R4VA 4CW9A 2O7KA 2F9SA 3L9VA 5CREA 4EXJA 5KN0A 1WMJA 4EUYA 1O81A 1ZYEA 2H73A 2AHEA 1NM3A 5GSSA 3J7Yk 1WIKA 2J9HA 2N5BA 4TRXA 1G7EA 3GRXA 3PGTA 4AJ6A 2LJRA 8GSSA 1EP8A 5D96A 1KBNA 1VGLA 3GIXA 4O32A 3O6TA 4F03A 1SYRA 5D9VA 2V6OA 1ZCPA 1ON4A 1TK5B 1I1IP 2YNXA 1FAAA 3IXRA 4J57E 3UVHA 1MD4A 5J9CA 1M3JA 3ZVJD 2JSYA 3ZIVA 3L0HA 2OE1A 3LQ7A 5C04A 2H76A 1SL0B 3W8SA 4OCEA 3SBCA 4KCEA 3U6VA 4EIPA 2YP6A 2DJ1A 1YEWC 1JLWA 3EE2A 1URMA 4DSSB 2IJYA 1V9WA 4K5SA 2H6XA 1GL8A 2BTOT 2EFHA 3DVWA 1ILOA 3MAKA 2MMAA 2FNOA 3F4RA 2HRFA 1OAZA 1W89A 5EL8A 4IVFA 4NXIA 3TKRA 4TKYA 4TVEA 5J9BA 4HSCX 1VRSD 4KDYA 2TIRA 4N0ZA 1PL1A 4XHMA 1PX7A 5A4WA 5J3RA 2X4AA 1QK8A 5GAND 4KE3A 4CY6A 3GURA 2LRNA 4BVYB 1PN9A 5A1NA 1TU7A 1NW2A 1YEPA 2FA4A 1XWCA 2H1DA 1O73A 4Z2RA 1MDIA 5KN2A 3DMLA 4YAVA 4LA1A 4BVXB 2I81A 2H74A 4O5UA 3PINA 4MNNA 4RUVA 3LYKA 2WZSA 3F3RA 3GSTA 2O5VA 5ECPB 3F0IA 1AXDA 2GS3A 2WVYA 2H1BA 2PN8A 5AIVA 1R7HA 4KUNA 1H75A 1BQ7A 4ACSA 2P5QA 2UZ8A 1IYIA 2CZ2A 3DYRA 4YKFA 4YQVA 3QAVA 3GKKA 5IMZA 3TRQA 4PXOA 5G1KA 3D21A 1ZYQB 4USSA 4TOPA 2QKEA 1G6YA 2C80A 2YPMA 3WGDA 1GULA 2RM6A 2O87A 5D9TA 4A5PA 3NZNA 4K2DA 2WW2A 4BA7A 4MABA 1XW6A 4NV2A 2VL9A 4WKWA 1X0RA 1BX9A 5ID2B 3RHBA 3FKFA 4YH2A 2R2JA 1FB0A 2VIMA 2DIZA 1CQGA 1OC9A 5ECLB 1YY7A 4XS6A 1DE1A 2RUFA 2JL4A 2LUSA 3LSZA 1K0BA 1UC7A 1ERVA 2JZTA 2DC5A 4MZCA 3V1WA 4KSOA 2ZNMA 4K8MA 3N9JA 4HS1A 1X9SB 2HT9A 2YV9A 5ECOB 1RW1A 3BCIA 2JZRA 3D6IA 3ERFA 3HJMA 3LXZA 5B8AA 4BWQA 4KDXA 1PD21 3VURA 1NSWA 1QUWA 3CQFA 2VCVA 4WEYA 1GUKA 2L4QA 2BMXA 5HR2A 2WULA 4AGSA 4FYCA 4Z2UA 3HA9A 3RPNA 4NAXA 4PUFC 4D73B 5LNKe 1PSQA 5ABRA 2RM5A 1U88A 1C72A 2M80A 1YVLA 3GTUB 2GSTA 2NPBA 5KOWA 1N8JA 2I3YA 3CMIA 3IPZA 3EU3A 3TKSC 2DLXA 1T00A 1MDJA 11GSA 1TRWA 3VLNA 5A4UA 1AUCA 3G7YA 6GSSA 2M72A 5DDLA 1Z6NA 2YJ7A 2VCQA 1ZMAA 1PX6A 3GSSA 3L9SA 2CAQA 5DCGA 2GT6A 1Y6EA 5J41A 4MJBA 3IK7A 4X1UA 5DALB 3U5RE 2KP1A 2IMFA 2E0QA 3QMXA 3FR6A 3HVVA 3A2VA 1MTCA 5KN1A 1TK0B 4AJ8A 3C1RA 2IMKA 2GZYA 4N11A 2HSMA 2C0DA 2JSZA 1K3OA 3CBUA 1K0AA 2FHEA 5HR3A 1K3YA 1NHYA 3FW2A 1X9MB 1YQ1A 4Q5NA 2PGTA 1VF3A 1QMVA 4L0WA 3GN3A 5COHA 6GSXA 1U3AA 2H19A 1I5GA 2QC7A 6GSWA 4Z7XA 3TOTA 3UJ1A 4IP1A 1U6TA 2AV4A 4XS1A 1TW9A 2R5GA 4POKA 4CDOA 1B9YC 5J5NA 5GSTA 1WJKA 2IFQA 3HHVA 1OC3A 3R2QA 2REMA 3ZYWA 18GSA 12GSA 4HEA2 3ERWA 4POLA 1TXXA 2D2ZA 3RGBC 2X99A 4TR1A 2O3EA 2I4AA 5INYA 1EOGA 1U3IA 1BEDA 2F8FA 2CA8A 1YF1A 4BWSA 1FOHA 1WWJA 4TN8A 2WVXB 3FZ9A 1UN2A 3ZMKA 3L4NA 3HZ4A 1O8WA 4LMVA 5D8IA 4J2FA 3DD3A 4ZL9A 1G0TA 10GSA 1SK2A 4RQXA 2V2GA 3F4SA 2C3NA 1A23A 2H66A 1SD8A 1EEMA 4V2LA 4MH3A 1SL2B 4KB3A 4POBA 3GX0A 2PERA 3IBHA 1A8LA 2CX3A 3J7Yb 4W66A 2H1AA 2P31A 4AF2A 2K8SA 3UL3A 2K9FA 2VLVA 5FWGA 1GTUA 4AKHA 1V57A 4WETA 3JCML 1YEXA 4ZBBA 1SU9A 5F8BA 4ECCA 3VWUA 3GFKA 3W6GA 4N30A 5JWQB 4MF6A 3ZL5A 1USBA 2B5XA 2IIYA 2VM2A 4ISDA 2HSNA 2H6YA 3C8EA 1LJRA 1F2EA 3K8NA 3GMFA 3TJBA 3PH9A 3ZTLA 3IK9A 3F6DA 4X0XA 5IPGA 3S9FA 4F0BA 3R3EA 5A5KA 4NHWA 2H70A 3D22A 2YZHA 1Z9HA 5F0GA 2LQQA 5A34A 1F9MA 4IJ3A 3LWAA 4IP6A 1TK8B 2E2MA 1ERWA 3I6AA 2PVOC 2AAWA 4RQRA 1FVKA 2GLRA 5AGYA 2DJJA 3UAPA 5DAKA 5HFIA 2IMIA 4DVCA 5IO0A 3P90A 2HRKA 1WPIA 3L78A 3FYGA 5C00A 1EGRA 1BG1A 5JWRB 3QD9A 1K0DA 1MD3A 3ZREA 5DJMA 1S3RA 4I2UA 1VF1A 1TP9A 2DMLA 3P2AA 5EPFA 5H5SA 2KLXA 1PMTA 1TI3A 3Q6OA 4IHUA 2CV4A
chains in the Genus database with same CATH topology
3KD0A 5G30A 1SK0A 4IKHA 4BL7B 3EWLA 4KH7A 2LQOA 4Q5QA 1TXUA 6GSYA 2C1YA 1OYJA 2MMZA 3F63A 3VI5A 1Z7RA 6GSUA 4MCUA 1GNWA 2B3SA 1I9DA 4HZ4A 4MPGA 3W8JA 3HVXA 2XBQA 3I9V2 1ST9A 2BJXA 3QDNA 1XWAA 1TTZA 2LRTA 3GKXA 5B7CA 3CSIA 1V98A 3M9JA 2FD3A 5BMUB 2WZ9A 1TJDA 4NV5A 3HCZA 3UEMA 3FZ5A 2IL3A 1M99A 4N10A 2YWNA 4HQZA 4CY8A 3KM6A 4HJ2A 1BJXA 5D9XA 4L0UA 3WT1A 1H4OA 1B9XC 1PRXA 3GL5A 1DBYA 1JZOA 5LD0A 5A5HB 3UBKA 4ZB6A 1JZRA 1EZKA 4FYBA 2R6KA 4PGTA 1U87A 3GUSA 2V32A 1O6JA 2WRTA 1J0FA 3GKMA 2X49A 1XCCA 2QA2A 1S3DA 4KA0A 2H8LA 4PURA 17GSA 1A2MA 1ZOFA 2LKUA 4K5RA 1HD2A 4ZIJA 5IOXA 2VCXA 5KOXA 1LBKA 4G0LA 3LW9A 2WB9A 3RHCA 2YOIA 2OA7A 2GGTA 4WBJA 5DBQA 5JCWA 1M2BA 5IQYA 2DJKA 2C4JA 4NMUA 2GSQA 1GWCA 4WBRD 20GSA 1X5EA 4I2TA 4H86A 2HFDA 4Q5RA 2K18A 4ZL7A 2AJQB 1PGTA 1AQVA 2OBIA 1VF2A 1SYXA 3EU4A 4MMMA 4XRDA 2R0CA 3LGCA 1R4WA 2LNTA 1M7TA 3TRPA 1KTEA 5AIXA 3WYWA 1YDKA 2PMTA 1YF0A 3OR5A 3F9UA 4YKGA 5IMDA 3HJPA 2MBSA 1GTIA 1ACVA 4LL1B 2TRXA 2GTUA 4KDUA 2L6DA 4QMKA 2LV3A 3TRXA 4IBPA 3DWVA 2C0FA 5HFGA 4IELA 4DSQA 4ECIA 3MNGA 3EMPA 5H5RA 1YJ6A 5ECSA 3UARA 2WCIA 3TJJA 1XBSA 4XS4B 1PQNA 2R0PA 3D4TA 4GRFA 2M46A 3AY8A 5IMVA 5ECQB 4QL7A 2HI7A 2P5RA 4EDZA 4IW9A 3DXBA 5EVOA 2NTOA 2KUCA 3IOSA 1A24A 2H1LA 2ON7A 4X4JA 4MZBA 3KH7A 1W4VA 5DQYA 5B6MA 5F05A 4GDFA 3C1SA 3MYDA 1Z3EA 1GH2A 3ZVJA 2LSTA 2B1KA 3FY7A 5CO3A 1CQHA 2FUG2 1IYHA 1SD9A 1Z7PA 1M9AA 4PUAA 1AQWA 3N5OA 4I5QA 1O8XA 2UV8G 3IR4A 1T1VA 3WD6A 1FB6A 2HXKA 4ZB8A 4J56E 2GSRA 3GNJA 3VWWA 4PNGA 4OFNA 2JADA 2GQKA 1SKSB 5AN1A 4EE0A 3QAGA 1FO5A 3PPUA 4TXOB 4MK3A 3LXTA 1EWXA 4PTSA 2VCZA 2KHPA 2XBIA 3QOUA 2HLSA 1RK4A 1QFNA 2GDRA 4ULXA 3CYNA 1GNEA 2NVLA 2E2GA 4F82A 4LLRA 4MDCA 3GKNA 1XVQA 5GAPD 5J47A 3TU3B 2F51A 3TJKA 3ME8A 1Z5YE 2AYTA 3QR6A 4MF7A 5LCZA 4PQHA 2ZUPA 1B48A 5DQSA 2A2SA 2VD0A 3TGZA 1PA3A 2A2RA 4WR5A 5HR1A 2L5OA 3KCMA 2FA8A 2GZPA 1KEBA 4PQIA 1YKCA 3MWHA 3GYKA 3DEXA 5ECKB 4IN0A 3TUEA 3QFAC 1SL1B 3IRAA 3APQA 2XPEA 3TDGA 4EIQA 1VF4A 3FR3A 4DSSA 3FZAA 1J08A 3O76A 3MIXA 3CTGA 2H71A 1A0FA 1SJIA 3WGEA 1K0NA 1DUGA 2WS2A 4DEJA 4X43A 2DBCA 2FGXA 2WGRA 2VL2C 3DKSA 4G01A 3BD2A 5CRHA 4IS0A 5J4YA 2B7JA 3HZ8A 2AB6A 1ZYNA 3IHQA 4IQAA 1GSDA 2LEGA 2HQTA 3EVIA 1SENA 1GSUA 1BG5A 4BVYA 4YAPA 3TKPA 4TW5A 4ECJA 4HUAA 4JZQA 1TRVA 3TOUA 3SWLA 2PU9C 2YZUA 1PN0A 4EKZA 5ECHB 1FOVA 2OJLA 3GA4A 4BVXA 1ABAA 3KTBA 5ELAA 3HMJG 4KSMA 3IE3A 2C3QA 4PNFA 4OCFA 5ECRB 3FZ4A 3HD5A 3NIVA 1KNGA 4ZXGA 1SK1A 1M0UA 2H01A 4JBBA 1ERUA 4E68A 2V6KA 3ZFBA 1QXHA 4GSTA 4GWRA 4GXZA 3APOA 1OC8A 1MEKA 3Q74A 1ML6A 5DVBA 4EL1A 5FHIA 1F3AA 5A1NB 2K8VA 4TR4A 1V40A 1AW9A 3LG6A 1J9BA 3M0FA 2EIQA 2C0GA 4TR3A 5H5QA 1JLVA 1AQXA 3NOFA 5E59A 3HKRA 2R37A 2H6ZA 4TXVA 2CVBA 4AKIA 1R26A 2CT6A 2O89A 2VKZG 1S3AA 4MH2A 9GSSA 3ZFLA 2VCTA 1T4ZA 3F8UA 1WP0A 1GUMA 4FIWA 3CWGA 2L5LA 1QQ2A 3KP9A 4O5QA 4G2EA 1XWKA 5KN3A 4Q5FA 4ECBA 5ID2A 3HDCA 5E4WA 1X9WB 1V58A 4I8BA 3Q18A 1TDIA 3FHKA 2FWFA 1UVZA 1GLQA 1XWGA 3CRUA 1JFUA 5J40A 3A2WA 1ZGNA 3GX8A 2CX4A 5B6NA 1XFLA 4HOJA 4G0KA 3I43A 1TKDB 3GH9A 3ZIJA 5D93A 2F3MA 1OE8A 5EY6A 3A2XA 4MLYA 4POMA 4YQUA 3TCOA 4OWYA 1YKAA 2A2PA 2YWIA 2IWTA 2KOKA 1PL2A 1X5DA 1OC9B 2OKAA 3ERGA 5CYYA 2XHFA 1N2AA 1FHEA 5GZZB 2F8AA 1JZWA 4OFTA 4D73A 2EC4A 2L57A 1M2AA 2HNLA 4MF5A 1T8EB 2K6VA 4AJ7A 1FVJA 3GTUA 2VLUA 1R5AA 2VL3A 4XIHA 1Q98A 4QL9A 3VK9A 4OFMA 4I6XA 1XW5A 2VLTA 5CAXA 4WR4A 2A4VA 2RUEA 3GL3A 4N3ZA 4F2IA 4JR6A 2C8UA 1EOHA 2X8GA 2R3XA 4G0IA 3TKQA 4PX1A 3QPMA 5IM9A 2TRCP 1BYEA 2FWHA 2CAIA 1GUHA 2RIIA 3TJFA 2DIYA 4FYUA 4NHZA 3EPTA 2ON5A 3P8WA 2CZ3A 2IMEA 1PKWA 3C7MA 2PVQA 2HZEA 2GT5A 1GLPA 5L71A 4E8HA 3FMWA 1UA5A 5DALA 2N5AA 2EIRA 3IAM2 4Z2TA 1B4PA 2MMOA 2LRCA 3CRTA 1F37A 1EV9A 4EVMA 1AAZA 3EMXA 3KH9A 3RAZA 2VOCA 4OO5A 2LJKA 5IIZA 1FG4A 2RLIA 4NPBA 4G19A 4MPFA 4K7NA 2VCWA 3FEUA 3APSA 3H8QA 4IJIA 3ISOA 2EIOA 3ZMLA 4L5LA 4ML1A 1TU8A 4K6XA 5ECMB 2HSMB 1XVWA 2HYXA 3BJ5A 2CVKA 1EV4A 4TR0A 4GTUA 2FY6A 4ILFA 3UIWA 4N0VA 2HZFA 3TKSA 2DKHA 2IN3A 1Y1UA 3KJYA 4RI7A 1F3BA 2JACA 1F6MC 4K7OA 2YWMA 4GSSA 2B6MA 1XPVA 3CTFA 4XCSA 3P7XA 2FCHA 3D5JA 1HNAA 2LTKA 2H0GA 2QGVA 3KXOA 2H30A 5JCUA 5DCHA 2FLSA 2IFQB 5G5EA 1AIUA 2X8CA 4K9ZA 2WDUA 3CXGA 1WRYA 1GSYA 5JWOB 3US3A 3O3TA 1ZYPA 2YJHA 5IMCA 2B7KA 2HRNA 1E6BA 4EF0A 1OE7A 2PPTA 4FO5A 1EEJA 2J23A 1XZOA 1B8XA 4TR1B 1XXUA 4WXTA 2DKIA 2FWGA 3A5IA 14GSA 2YWOA 4V1Ag 2VL2A 4K0GA 1JHBA 3UOMA 22GSA 4EC0A 5HQPA 1E2YA 4E8EA 3HXSA 3M1GA 3GH6A 2MMNA 4K7IA 1BF5A 3VFIA 3M8NA 5KEJA 4IGJA 1LU4A 1NHOA 3EINA 1Y25A 3QFBC 3IHGA 3UVTA 1THOA 4I97A 4O7HA 3E3EA 4LMWA 4YQMA 2B5YA 3GV1A 3PR8A 3LORA 1K3LA 4KCAA 2MYGA 4GQFA 4G10A 2HSYA 2VD1A 4OMVA 1ZZYA 3G7JA 4JE1A 2JZSA 5HFKA 3ZITA 2ZCTA 1TOFA 4HU7A 2JU5A 1A8YA 3D4MA 4KNDA 5CRDA 1N25A 1RQMA 2FWEA 5G2ZA 1GRXA 1SVOA 2HRAA 2X64A 5IMFA 3DVXA 4JU5A 1A2LA 13GSA 3FR9A 5CRWA 2H0HA 3E0UA 5IOWA 3Q19A 3A5WA 1XWBA 3IDVA 6GSVA 1TRUA 4V1Ap 2HE3A 4L8EA 3LFLA 3CSJA 2DMMA 2HSNB 1TRSA 4ID0A 3BCKA 3IC8A 1A2JA 4LL4B 4O5RA 3HYPA 3EYTA 1V2AA 2PWJA 2IMDA 3IA1A 3H79A 2L6CA 2V41A 5G1LA 3UMAA 2ES7A 1M9BA 5A34B 5G5FA 5DJLA 1GSSA 3WT2A 2B1LA 4BL7A 3MSZA 5HR0A 2OE3A 4HQSA 3TJGA 1B4QA 1X5CA 1R5PA 1XIYA 2EFCA 2YV7A 1XOAA 3TB2A 3KP8A 4QQ7A 4K0NA 5FT3A 5DAKB 2WFCA 3ZLPA 2CVDA 2HRKB 2H1GA 2DJ0A 3TKSE 16GSA 2DSAA 1EP7A 3VPTA 3KTLA 1SKRB 2V1MA 3LJRA 4RI6A 1OKDA 3L9UA 5BMUA 4KF9A 2NDOA 3M9KA 5CP1A 1T3BA 4AKGA 2A4HA 2IPAA 3VWVA 4MZWA 1O85A 3F6FA 4KW6A 3IC4A 2LS5A 4ZL8A 2I1UA 3RPPA 4FH8A 2E7PA 3GHAA 4MA9A 3H4KA 4NWYA 5IMAA 3C73A 5A5HA 1G7OA 1SJZA 2OE0A 5BRTA 2HZEB 3ME7A 3HVSA 4HI7A 2VUPA 2GQLA 3D0ZA 3H93A 1PKZA 2G2QA 2YANA 2C0EA 2PUKC 4V2MA 4GSNA 5B8BA 3LYPA 5CNWA 1EGOA 3ED3A 4AI6A 3DGQA 1MDKA 4IQ1A 2AUVA 4L5OA 3KMNA 2DJ3A 1SVLA 2OADA 3WGXA 4HDEA 1K0CA 2KP2A 1DSBA 2PBJA 2VM1A 4GLTA 1BAYA 1M2DA 2B5EA 3RDWA 2CQ9A 2C3TA 2YN1A 5D73A 3BOAA 7GSSA 1OVNA 5ECIB 1K0OA 1OKTA 2O85A 3UBLA 2GVPA 4PQ1A 5J4UA 1WE0A 1HQOA 1SJ6A 4MJEA 3VI7A 2NBSA 4GQCA 3G7IA 4ZBAA 2H75A 4XRAA 1GSEA 1Z6MA 4CHSA 1THXA 2I9HA 3F3QA 3VPQA 2GQMA 1XOBA 1SVMA 3KZQA 4WF4A 2MBTA 1DE2A 5A4VA 3EURA 4ICYA 2G0FA 1GSFA 4K2XA 2Z9SA 2ALBA 3A3TA 4JRRA 2GSSA 4GF0A 4OO4A 2YCDA 3H1NA 4F0CA 5IPHA 4DSRA 3LEFA 3ZRDA 1GP1A 2EFDA 4FQUA 4V2NA 4XS4A 5J4VA 1WOUA 1JZDA 3C71A 4HZ2A 2WJUA 4KGIA 4F9ZA 6GSTA 1HNCA 5AISA 3QAWA 2LNSA 5ENUA 1FW1A 1TI1A 1YZXA 1GTAA 3IAS2 1GSQA 1T4YA 3FK8A 3KEBA 1K0MA 1HNBA 4K1FA 2EFEA 1ERTA 2OACA 4EDYA 4AKXB 2OT3A 2P0GA 3IV4A 4O92A 5ECNB 4OD7A 4ZILA 1XW9A 2DJ2A 2R0GA 2QSIA 3VWXA 1GTBA 2QA1A 4KX4A 4MJAA 3BBYA 2X8HA 19GSA 4GCIA 3HY2A 3E9JB 1T7PB 3KMOA 1Q4JA 1O7UA 4MJCA 3QCPA 4JEDA 4G9HA 3RBTA 5ELGA 2XPDA 4HJMA 2N5FA 4HU9A 2O8VB 2L4CA 4MP4A 2H0IA 2L59A 4BPYA 3M3MA 4WF5A 2LJAA 1QGVA 1S3CA 4ML6A 3CSHA 3F4TA 5D9WA 4TXOA 3G9BA 1ZL9A 3HJOA 4ZBDA 3MDKA 4JR4A 1HYUA 3KIJA 3DIEA 5F06A 3KGKA 3EC3A 3DRNA 2VO4A 3ZZXA 1SKWB 2H72A 5CRGA 3I69A 4KAEA 3FRCA 4XTSA 5IO2A 2HSHA 1G6WA 2OBKA 4ZB7A 2MZCA 5F07A 4P3YB 1A0RP 1AC1A 4EO3A 2GZZA 4ZB9A 2XC2A 5G31A 5JCGA 2VAFA 2R4VA 4CW9A 2O7KA 2F9SA 3L9VA 5CREA 4EXJA 5KN0A 1WMJA 4EUYA 1O81A 1ZYEA 2H73A 2AHEA 1NM3A 5GSSA 3J7Yk 1WIKA 2J9HA 2N5BA 4TRXA 1G7EA 3GRXA 3PGTA 4AJ6A 2LJRA 8GSSA 1EP8A 5D96A 1KBNA 1VGLA 3GIXA 4O32A 3O6TA 4F03A 1SYRA 5D9VA 2V6OA 1ZCPA 1ON4A 1TK5B 2YNXA 1FAAA 3IXRA 4J57E 3UVHA 1MD4A 5J9CA 3ZVJD 2JSYA 3ZIVA 3L0HA 2OE1A 3LQ7A 5C04A 2H76A 1SL0B 3W8SA 4OCEA 3SBCA 4KCEA 3U6VA 4EIPA 2YP6A 2DJ1A 1JLWA 3EE2A 1URMA 4DSSB 2IJYA 1V9WA 4K5SA 2H6XA 1GL8A 2BTOT 2EFHA 3DVWA 1ILOA 3MAKA 2MMAA 2FNOA 3F4RA 2HRFA 1OAZA 1W89A 5EL8A 4IVFA 4NXIA 3TKRA 4TKYA 4TVEA 5J9BA 1VRSD 4KDYA 2TIRA 4N0ZA 1PL1A 4XHMA 1PX7A 5A4WA 5J3RA 2X4AA 1QK8A 5GAND 4KE3A 4CY6A 3GURA 2LRNA 4BVYB 1PN9A 5A1NA 1TU7A 1NW2A 1YEPA 2FA4A 1XWCA 2H1DA 1O73A 4Z2RA 1MDIA 5KN2A 3DMLA 4YAVA 4LA1A 4BVXB 2I81A 2H74A 4O5UA 3PINA 4MNNA 4RUVA 3LYKA 3F3RA 3GSTA 2O5VA 5ECPB 3F0IA 1AXDA 2GS3A 2H1BA 2PN8A 5AIVA 1R7HA 4KUNA 1H75A 1BQ7A 4ACSA 2P5QA 2UZ8A 1IYIA 2CZ2A 3DYRA 4YKFA 4YQVA 3QAVA 3GKKA 5IMZA 3TRQA 4PXOA 5G1KA 3D21A 1ZYQB 4USSA 4TOPA 2QKEA 1G6YA 2C80A 2YPMA 3WGDA 1GULA 2RM6A 2O87A 5D9TA 4A5PA 3NZNA 4K2DA 4BA7A 4MABA 1XW6A 4NV2A 2VL9A 4WKWA 1X0RA 1BX9A 5ID2B 3RHBA 3FKFA 4YH2A 2R2JA 1FB0A 2VIMA 2DIZA 1CQGA 1OC9A 5ECLB 1YY7A 4XS6A 1DE1A 2RUFA 2JL4A 2LUSA 3LSZA 1K0BA 1UC7A 1ERVA 2JZTA 2DC5A 4MZCA 3V1WA 4KSOA 2ZNMA 4K8MA 3N9JA 4HS1A 1X9SB 2HT9A 2YV9A 5ECOB 1RW1A 3BCIA 2JZRA 3D6IA 3ERFA 3HJMA 3LXZA 5B8AA 4BWQA 4KDXA 1PD21 3VURA 1NSWA 1QUWA 2VCVA 4WEYA 1GUKA 2L4QA 2BMXA 5HR2A 2WULA 4AGSA 4FYCA 4Z2UA 3HA9A 3RPNA 4NAXA 4PUFC 4D73B 5LNKe 1PSQA 5ABRA 2RM5A 1U88A 1C72A 2M80A 1YVLA 3GTUB 2GSTA 2NPBA 5KOWA 1N8JA 2I3YA 3CMIA 3IPZA 3EU3A 3TKSC 2DLXA 1T00A 1MDJA 11GSA 1TRWA 3VLNA 5A4UA 1AUCA 3G7YA 6GSSA 2M72A 5DDLA 1Z6NA 2YJ7A 2VCQA 1ZMAA 1PX6A 3GSSA 3L9SA 2CAQA 5DCGA 2GT6A 1Y6EA 5J41A 4MJBA 3IK7A 4X1UA 5DALB 3U5RE 2KP1A 2IMFA 2E0QA 3QMXA 3FR6A 3HVVA 3A2VA 1MTCA 5KN1A 1TK0B 4AJ8A 3C1RA 2IMKA 2GZYA 4N11A 2HSMA 2C0DA 2JSZA 1K3OA 3CBUA 1K0AA 2FHEA 5HR3A 1K3YA 1NHYA 3FW2A 1X9MB 1YQ1A 4Q5NA 2PGTA 1VF3A 1QMVA 4L0WA 3GN3A 5COHA 6GSXA 1U3AA 2H19A 1I5GA 2QC7A 6GSWA 4Z7XA 3TOTA 3UJ1A 4IP1A 1U6TA 2AV4A 4XS1A 1TW9A 2R5GA 4POKA 4CDOA 1B9YC 5J5NA 5GSTA 1WJKA 2IFQA 3HHVA 1OC3A 3R2QA 2REMA 3ZYWA 18GSA 12GSA 4HEA2 3ERWA 4POLA 1TXXA 2D2ZA 2X99A 4TR1A 2I4AA 5INYA 1EOGA 1U3IA 1BEDA 2F8FA 2CA8A 1YF1A 4BWSA 1FOHA 1WWJA 4TN8A 3FZ9A 1UN2A 3ZMKA 3L4NA 3HZ4A 1O8WA 4LMVA 5D8IA 4J2FA 3DD3A 4ZL9A 1G0TA 10GSA 1SK2A 4RQXA 2V2GA 3F4SA 2C3NA 1A23A 2H66A 1SD8A 1EEMA 4V2LA 4MH3A 1SL2B 4KB3A 4POBA 3GX0A 2PERA 3IBHA 1A8LA 2CX3A 3J7Yb 4W66A 2H1AA 2P31A 4AF2A 2K8SA 3UL3A 2K9FA 2VLVA 5FWGA 1GTUA 4AKHA 1V57A 4WETA 3JCML 1YEXA 4ZBBA 1SU9A 5F8BA 4ECCA 3VWUA 3GFKA 3W6GA 4N30A 5JWQB 4MF6A 3ZL5A 1USBA 2B5XA 2IIYA 2VM2A 4ISDA 2HSNA 2H6YA 3C8EA 1LJRA 1F2EA 3K8NA 3GMFA 3TJBA 3PH9A 3ZTLA 3F6DA 3IK9A 4X0XA 5IPGA 3S9FA 4F0BA 3R3EA 5A5KA 4NHWA 2H70A 3D22A 2YZHA 1Z9HA 5F0GA 2LQQA 5A34A 1F9MA 4IJ3A 3LWAA 4IP6A 1TK8B 2E2MA 1ERWA 3I6AA 2PVOC 2AAWA 4RQRA 1FVKA 2GLRA 5AGYA 2DJJA 3UAPA 5DAKA 5HFIA 2IMIA 4DVCA 5IO0A 3P90A 2HRKA 1WPIA 3L78A 3FYGA 5C00A 1EGRA 1BG1A 5JWRB 3QD9A 1K0DA 1MD3A 3ZREA 5DJMA 4I2UA 1VF1A 1TP9A 2DMLA 3P2AA 5EPFA 5H5SA 2KLXA 1PMTA 1TI3A 3Q6OA 4IHUA 2CV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KD0 A;  5G30 A;  1SK0 A;  4IKH A;  4BL7 B;  3EWL A;  4KH7 A;  2LQO A;  4Q5Q A;  6GSY A;  2C1Y A;  1OYJ A;  2MMZ A;  3F63 A;  3VI5 A;  1Z7R A;  6GSU A;  4MCU A;  1GNW A;  2B3S A;  1I9D A;  4HZ4 A;  4MPG A;  3W8J A;  3HVX A;  2XBQ A;  3I9V 2;  1ST9 A;  2BJX A;  3QDN A;  1XWA A;  1TTZ A;  2LRT A;  3GKX A;  5B7C A;  3CSI A;  1V98 A;  3M9J A;  2FD3 A;  2WZ9 A;  1TJD A;  4NV5 A;  3HCZ A;  3UEM A;  3FZ5 A;  2IL3 A;  1M99 A;  4N10 A;  2YWN A;  4HQZ A;  3KM6 A;  4HJ2 A;  1BJX A;  5D9X A;  4L0U A;  3WT1 A;  1H4O A;  1B9X C;  1PRX A;  3GL5 A;  1DBY A;  1JZO A;  5LD0 A;  3UBK A;  4ZB6 A;  1JZR A;  1EZK A;  4FYB A;  2R6K A;  4PGT A;  1U87 A;  3GUS A;  2V32 A;  1O6J A;  2WRT A;  1J0F A;  3GKM A;  1XCC A;  1S3D A;  4KA0 A;  2H8L A;  4PUR A;  17GS A;  1A2M A;  1ZOF A;  2LKU A;  1HD2 A;  4ZIJ A;  5IOX A;  2VCX A;  1LBK A;  4G0L A;  2WB9 A;  3RHC A;  2YOI A;  2OA7 A;  2GGT A;  4WBJ A;  5DBQ A;  5JCW A;  1M2B A;  5IQY A;  2DJK A;  2C4J A;  4NMU A;  2GSQ A;  1GWC A;  4WBR D;  20GS A;  1X5E A;  4I2T A;  4H86 A;  2HFD A;  4Q5R A;  2K18 A;  4ZL7 A;  2AJQ B;  1PGT A;  1AQV A;  2OBI A;  1VF2 A;  1SYX A;  3EU4 A;  4MMM A;  4XRD A;  3LGC A;  1R4W A;  2LNT A;  1M7T A;  3TRP A;  1KTE A;  5AIX A;  3WYW A;  1YDK A;  2PMT A;  1YF0 A;  3OR5 A;  3F9U A;  5IMD A;  3HJP A;  2MBS A;  1GTI A;  1ACV A;  4LL1 B;  2TRX A;  2GTU A;  4KDU A;  2L6D A;  2LV3 A;  3TRX A;  4IBP A;  3DWV A;  2C0F A;  5HFG A;  4IEL A;  4DSQ A;  4ECI A;  3MNG A;  3EMP A;  5H5R A;  1YJ6 A;  5ECS A;  3UAR A;  2WCI A;  3TJJ A;  1XBS A;  4XS4 B;  1PQN A;  3D4T A;  4GRF A;  2M46 A;  3AY8 A;  5IMV A;  5ECQ B;  4QL7 A;  2HI7 A;  2P5R A;  4EDZ A;  4IW9 A;  3DXB A;  5EVO A;  2NTO A;  2KUC A;  3IOS A;  1A24 A;  2ON7 A;  4MZB A;  3KH7 A;  1W4V A;  5DQY A;  5B6M A;  5F05 A;  3C1S A;  1Z3E A;  1GH2 A;  3ZVJ A;  2LST A;  2B1K A;  3FY7 A;  5CO3 A;  1CQH A;  2FUG 2;  1IYH A;  1SD9 A;  1Z7P A;  1M9A A;  4PUA A;  1AQW A;  3N5O A;  4I5Q A;  1O8X A;  3IR4 A;  1T1V A;  3WD6 A;  1FB6 A;  2HXK A;  4ZB8 A;  4J56 E;  2GSR A;  3GNJ A;  3VWW A;  4PNG A;  4OFN A;  2JAD A;  2GQK A;  1SKS B;  5AN1 A;  4EE0 A;  3QAG A;  1FO5 A;  3PPU A;  4TXO B;  4MK3 A;  3LXT A;  1EWX A;  4PTS A;  2VCZ A;  2KHP A;  2XBI A;  3QOU A;  2HLS A;  1RK4 A;  1QFN A;  2GDR A;  4ULX A;  3CYN A;  1GNE A;  2NVL A;  2E2G A;  4F82 A;  4LLR A;  4MDC A;  3GKN A;  1XVQ A;  5GAP D;  2F51 A;  3TJK A;  3ME8 A;  1Z5Y E;  2AYT A;  3QR6 A;  4MF7 A;  5LCZ A;  4PQH A;  2ZUP A;  1B48 A;  5DQS A;  2A2S A;  2VD0 A;  3TGZ A;  1PA3 A;  2A2R A;  4WR5 A;  5HR1 A;  2L5O A;  3KCM A;  2FA8 A;  2GZP A;  1KEB A;  4PQI A;  1YKC A;  3MWH A;  3GYK A;  3DEX A;  5ECK B;  4IN0 A;  3TUE A;  3QFA C;  1SL1 B;  3IRA A;  3APQ A;  2XPE A;  3TDG A;  1VF4 A;  3FR3 A;  4DSS A;  3FZA A;  1J08 A;  3O76 A;  3CTG A;  2H71 A;  1A0F A;  1SJI A;  3WGE A;  1K0N A;  1DUG A;  2WS2 A;  4DEJ A;  4X43 A;  2DBC A;  2FGX A;  2WGR A;  2VL2 C;  3DKS A;  3BD2 A;  5CRH A;  4IS0 A;  2B7J A;  3HZ8 A;  2AB6 A;  3IHQ A;  4IQA A;  1GSD A;  2LEG A;  2HQT A;  3EVI A;  1SEN A;  1GSU A;  1BG5 A;  4BVY A;  4YAP A;  3TKP A;  4TW5 A;  4ECJ A;  4HUA A;  4JZQ A;  1TRV A;  3TOU A;  3SWL A;  2PU9 C;  2YZU A;  4EKZ A;  5ECH B;  1FOV A;  2OJL A;  3GA4 A;  4BVX A;  1ABA A;  3KTB A;  5ELA A;  4KSM A;  3IE3 A;  2C3Q A;  4PNF A;  4OCF A;  5ECR B;  3FZ4 A;  3HD5 A;  3NIV A;  1KNG A;  4ZXG A;  1SK1 A;  1M0U A;  2H01 A;  4JBB A;  1ERU A;  2V6K A;  3ZFB A;  1QXH A;  4GST A;  4GWR A;  4GXZ A;  3APO A;  1OC8 A;  1MEK A;  3Q74 A;  1ML6 A;  5DVB A;  4EL1 A;  5FHI A;  1F3A A;  2K8V A;  4TR4 A;  1V40 A;  1AW9 A;  3LG6 A;  1J9B A;  3M0F A;  2EIQ A;  2C0G A;  4TR3 A;  5H5Q A;  1JLV A;  1AQX A;  3NOF A;  5E59 A;  3HKR A;  2R37 A;  2H6Z A;  4TXV A;  2CVB A;  1R26 A;  2CT6 A;  2O89 A;  1S3A A;  4MH2 A;  9GSS A;  3ZFL A;  2VCT A;  1T4Z A;  3F8U A;  1WP0 A;  1GUM A;  4FIW A;  2L5L A;  1QQ2 A;  3KP9 A;  4G2E A;  1XWK A;  5KN3 A;  4Q5F A;  4ECB A;  5ID2 A;  3HDC A;  5E4W A;  1X9W B;  1V58 A;  4I8B A;  3Q18 A;  1TDI A;  3FHK A;  2FWF A;  1UVZ A;  1GLQ A;  1XWG A;  3CRU A;  1JFU A;  3A2W A;  1ZGN A;  3GX8 A;  2CX4 A;  5B6N A;  1XFL A;  4HOJ A;  4G0K A;  3I43 A;  1TKD B;  3GH9 A;  3ZIJ A;  5D93 A;  2F3M A;  1OE8 A;  5EY6 A;  3A2X A;  4MLY A;  4POM A;  4YQU A;  3TCO A;  4OWY A;  1YKA A;  2YWI A;  2IWT A;  2KOK A;  1PL2 A;  1X5D A;  1OC9 B;  2OKA A;  3ERG A;  5CYY A;  2XHF A;  1N2A A;  1FHE A;  5GZZ B;  2F8A A;  1JZW A;  4OFT A;  4D73 A;  2EC4 A;  2L57 A;  1M2A A;  2HNL A;  4MF5 A;  1T8E B;  2K6V A;  4AJ7 A;  1FVJ A;  3GTU A;  2VLU A;  1R5A A;  2VL3 A;  4XIH A;  1Q98 A;  4QL9 A;  3VK9 A;  4OFM A;  4I6X A;  1XW5 A;  2VLT A;  5CAX A;  4WR4 A;  2A4V A;  2RUE A;  3GL3 A;  4F2I A;  4JR6 A;  2C8U A;  1EOH A;  2X8G A;  2R3X A;  4G0I A;  3TKQ A;  4PX1 A;  3QPM A;  5IM9 A;  2TRC P;  1BYE A;  2FWH A;  2CAI A;  1GUH A;  2RII A;  3TJF A;  2DIY A;  4FYU A;  4NHZ A;  2ON5 A;  3P8W A;  2CZ3 A;  2IME A;  1PKW A;  3C7M A;  2PVQ A;  2HZE A;  2GT5 A;  1GLP A;  5L71 A;  4E8H A;  1UA5 A;  5DAL A;  2N5A A;  2EIR A;  3IAM 2;  1B4P A;  2MMO A;  2LRC A;  3CRT A;  1F37 A;  1EV9 A;  4EVM A;  1AAZ A;  3EMX A;  3KH9 A;  3RAZ A;  2VOC A;  4OO5 A;  2LJK A;  5IIZ A;  1FG4 A;  2RLI A;  4NPB A;  4G19 A;  4MPF A;  4K7N A;  2VCW A;  3FEU A;  3APS A;  3H8Q A;  4IJI A;  3ISO A;  2EIO A;  3ZML A;  4L5L A;  4ML1 A;  1TU8 A;  4K6X A;  5ECM B;  2HSM B;  1XVW A;  2HYX A;  3BJ5 A;  2CVK A;  1EV4 A;  4TR0 A;  4GTU A;  2FY6 A;  4ILF A;  3UIW A;  4N0V A;  2HZF A;  3TKS A;  2IN3 A;  3KJY A;  4RI7 A;  1F3B A;  2JAC A;  1F6M C;  4K7O A;  2YWM A;  4GSS A;  2B6M A;  1XPV A;  3CTF A;  4XCS A;  3P7X A;  2FCH A;  3D5J A;  1HNA A;  2LTK A;  2H0G A;  2QGV A;  3KXO A;  2H30 A;  5JCU A;  5DCH A;  2FLS A;  2IFQ B;  5G5E A;  1AIU A;  2X8C A;  4K9Z A;  2WDU A;  3CXG A;  1WRY A;  1GSY A;  5JWO B;  3US3 A;  3O3T A;  2YJH A;  5IMC A;  2B7K A;  2HRN A;  1E6B A;  4EF0 A;  1OE7 A;  2PPT A;  4FO5 A;  1EEJ A;  2J23 A;  1XZO A;  1B8X A;  4TR1 B;  1XXU A;  4WXT A;  2FWG A;  14GS A;  2YWO A;  4V1A g;  2VL2 A;  4K0G A;  1JHB A;  3UOM A;  22GS A;  4EC0 A;  5HQP A;  1E2Y A;  4E8E A;  3HXS A;  3M1G A;  3GH6 A;  4K7I A;  2MMN A;  3VFI A;  3M8N A;  5KEJ A;  4IGJ A;  1LU4 A;  1NHO A;  3EIN A;  1Y25 A;  3QFB C;  3UVT A;  1THO A;  4I97 A;  4O7H A;  3E3E A;  4LMW A;  4YQM A;  2B5Y A;  3GV1 A;  3PR8 A;  3LOR A;  1K3L A;  4KCA A;  2MYG A;  4GQF A;  4G10 A;  2HSY A;  2VD1 A;  4OMV A;  1ZZY A;  3G7J A;  4JE1 A;  2JZS A;  5HFK A;  3ZIT A;  2ZCT A;  1TOF A;  4HU7 A;  2JU5 A;  1A8Y A;  3D4M A;  4KND A;  5CRD A;  1RQM A;  2FWE A;  5G2Z A;  1GRX A;  2HRA A;  2X64 A;  5IMF A;  3DVX A;  4JU5 A;  1A2L A;  13GS A;  3FR9 A;  5CRW A;  2H0H A;  3E0U A;  5IOW A;  3Q19 A;  3A5W A;  1XWB A;  3IDV A;  6GSV A;  1TRU A;  4V1A p;  2HE3 A;  4L8E A;  3LFL A;  3CSJ A;  2DMM A;  2HSN B;  1TRS A;  4ID0 A;  3BCK A;  3IC8 A;  1A2J A;  4LL4 B;  4O5R A;  3HYP A;  3EYT A;  1V2A A;  2PWJ A;  2IMD A;  3IA1 A;  3H79 A;  2L6C A;  2V41 A;  5G1L A;  3UMA A;  2ES7 A;  1M9B A;  5G5F A;  5DJL A;  1GSS A;  3WT2 A;  2B1L A;  4BL7 A;  3MSZ A;  5HR0 A;  2OE3 A;  4HQS A;  3TJG A;  1B4Q A;  1X5C A;  1R5P A;  1XIY A;  2YV7 A;  1XOA A;  3TB2 A;  3KP8 A;  4QQ7 A;  4K0N A;  5FT3 A;  5DAK B;  2WFC A;  3ZLP A;  2CVD A;  2HRK B;  2H1G A;  2DJ0 A;  3TKS E;  16GS A;  2DSA A;  1EP7 A;  3VPT A;  3KTL A;  1SKR B;  2V1M A;  3LJR A;  4RI6 A;  1OKD A;  3L9U A;  5BMU A;  4KF9 A;  2NDO A;  3M9K A;  5CP1 A;  1T3B A;  2IPA A;  3VWV A;  4MZW A;  1O85 A;  3F6F A;  4KW6 A;  3IC4 A;  2LS5 A;  4ZL8 A;  2I1U A;  3RPP A;  4FH8 A;  2E7P A;  3GHA A;  4MA9 A;  3H4K A;  4NWY A;  5IMA A;  3C73 A;  1G7O A;  1SJZ A;  2OE0 A;  2HZE B;  3ME7 A;  3HVS A;  4HI7 A;  2VUP A;  2GQL A;  3D0Z A;  3H93 A;  1PKZ A;  2G2Q A;  2YAN A;  2C0E A;  2PUK C;  4V2M A;  4GSN A;  5B8B A;  3LYP A;  5CNW A;  1EGO A;  3ED3 A;  3DGQ A;  1MDK A;  4IQ1 A;  2AUV A;  4L5O A;  3KMN A;  2DJ3 A;  2OAD A;  3WGX A;  4HDE A;  1K0C A;  2KP2 A;  1DSB A;  2PBJ A;  2VM1 A;  4GLT A;  1BAY A;  1M2D A;  2B5E A;  3RDW A;  2CQ9 A;  2C3T A;  2YN1 A;  5D73 A;  3BOA A;  7GSS A;  1OVN A;  5ECI B;  1K0O A;  1OKT A;  2O85 A;  3UBL A;  2GVP A;  4PQ1 A;  5J4U A;  1WE0 A;  1HQO A;  1SJ6 A;  4MJE A;  3VI7 A;  2NBS A;  4GQC A;  3G7I A;  4ZBA A;  2H75 A;  4XRA A;  1GSE A;  1Z6M A;  4CHS A;  1THX A;  2I9H A;  3F3Q A;  3VPQ A;  2GQM A;  1XOB A;  3KZQ A;  4WF4 A;  2MBT A;  1DE2 A;  5A4V A;  3EUR A;  2G0F A;  1GSF A;  2Z9S A;  2ALB A;  3A3T A;  4JRR A;  2GSS A;  4GF0 A;  4OO4 A;  2YCD A;  3H1N A;  4F0C A;  5IPH A;  4DSR A;  3LEF A;  3ZRD A;  1GP1 A;  4FQU A;  4V2N A;  4XS4 A;  1WOU A;  1JZD A;  3C71 A;  4HZ2 A;  2WJU A;  4KGI A;  4F9Z A;  6GST A;  1HNC A;  5AIS A;  3QAW A;  2LNS A;  5ENU A;  1FW1 A;  1TI1 A;  1YZX A;  1GTA A;  3IAS 2;  1GSQ A;  1T4Y A;  3FK8 A;  3KEB A;  1K0M A;  1HNB A;  4K1F A;  1ERT A;  2OAC A;  4EDY A;  2P0G A;  3IV4 A;  4O92 A;  5ECN B;  4OD7 A;  4ZIL A;  1XW9 A;  2DJ2 A;  2QSI A;  3VWX A;  1GTB A;  4KX4 A;  4MJA A;  3BBY A;  2X8H A;  19GS A;  4GCI A;  3HY2 A;  3E9J B;  1T7P B;  3KMO A;  1Q4J A;  1O7U A;  4MJC A;  3QCP A;  4JED A;  4G9H A;  3RBT A;  5ELG A;  2XPD A;  4HJM A;  2N5F A;  4HU9 A;  2O8V B;  2L4C A;  4MP4 A;  2H0I A;  2L59 A;  4BPY A;  3M3M A;  4WF5 A;  2LJA A;  1QGV A;  1S3C A;  4ML6 A;  3CSH A;  3F4T A;  5D9W A;  4TXO A;  3G9B A;  1ZL9 A;  3HJO A;  4ZBD A;  3MDK A;  4JR4 A;  1HYU A;  3KIJ A;  3DIE A;  5F06 A;  3KGK A;  3EC3 A;  3DRN A;  2VO4 A;  3ZZX A;  1SKW B;  2H72 A;  5CRG A;  3I69 A;  4KAE A;  3FRC A;  4XTS A;  5IO2 A;  2HSH A;  1G6W A;  2OBK A;  2MZC A;  5F07 A;  4P3Y B;  1A0R P;  1AC1 A;  4EO3 A;  2GZZ A;  4ZB9 A;  2XC2 A;  5G31 A;  5JCG A;  2VAF A;  2R4V A;  4CW9 A;  2O7K A;  2F9S A;  3L9V A;  5CRE A;  4EXJ A;  5KN0 A;  1WMJ A;  4EUY A;  1O81 A;  1ZYE A;  2H73 A;  2AHE A;  1NM3 A;  5GSS A;  3J7Y k;  1WIK A;  2J9H A;  2N5B A;  4TRX A;  1G7E A;  3GRX A;  3PGT A;  4AJ6 A;  2LJR A;  8GSS A;  1EP8 A;  5D96 A;  1KBN A;  1VGL A;  3GIX A;  4O32 A;  3O6T A;  4F03 A;  1SYR A;  5D9V A;  2V6O A;  1ZCP A;  1ON4 A;  1TK5 B;  2YNX A;  1FAA A;  3IXR A;  4J57 E;  3UVH A;  1MD4 A;  5J9C A;  3ZVJ D;  2JSY A;  3ZIV A;  3L0H A;  2OE1 A;  3LQ7 A;  5C04 A;  2H76 A;  1SL0 B;  3W8S A;  4OCE A;  3SBC A;  4KCE A;  3U6V A;  2YP6 A;  2DJ1 A;  1JLW A;  3EE2 A;  1URM A;  4DSS B;  2IJY A;  1V9W A;  2H6X A;  1GL8 A;  2BTO T;  3DVW A;  1ILO A;  3MAK A;  2MMA A;  2FNO A;  3F4R A;  2HRF A;  1OAZ A;  1W89 A;  5EL8 A;  4IVF A;  4NXI A;  3TKR A;  4TKY A;  4TVE A;  5J9B A;  1VRS D;  4KDY A;  2TIR A;  4N0Z A;  1PL1 A;  4XHM A;  1PX7 A;  5A4W A;  5J3R A;  1QK8 A;  5GAN D;  4KE3 A;  3GUR A;  2LRN A;  4BVY B;  1PN9 A;  1NW2 A;  1TU7 A;  1YEP A;  2FA4 A;  1XWC A;  2H1D A;  1O73 A;  1MDI A;  5KN2 A;  3DML A;  4YAV A;  4LA1 A;  4BVX B;  2I81 A;  2H74 A;  3PIN A;  4RUV A;  3LYK A;  3F3R A;  3GST A;  5ECP B;  3F0I A;  1AXD A;  2GS3 A;  2H1B A;  2PN8 A;  5AIV A;  1R7H A;  4KUN A;  1H75 A;  1BQ7 A;  4ACS A;  2P5Q A;  2UZ8 A;  1IYI A;  2CZ2 A;  3DYR A;  4YQV A;  3QAV A;  3GKK A;  5IMZ A;  3TRQ A;  4PXO A;  5G1K A;  3D21 A;  1ZYQ B;  4USS A;  4TOP A;  2QKE A;  1G6Y A;  2C80 A;  2YPM A;  3WGD A;  1GUL A;  2RM6 A;  2O87 A;  5D9T A;  3NZN A;  4K2D A;  4BA7 A;  4MAB A;  1XW6 A;  4NV2 A;  2VL9 A;  4WKW A;  1X0R A;  1BX9 A;  5ID2 B;  3RHB A;  3FKF A;  4YH2 A;  2R2J A;  1FB0 A;  2VIM A;  2DIZ A;  1CQG A;  1OC9 A;  5ECL B;  1YY7 A;  4XS6 A;  1DE1 A;  2RUF A;  2JL4 A;  2LUS A;  3LSZ A;  1K0B A;  1UC7 A;  1ERV A;  2JZT A;  2DC5 A;  4MZC A;  3V1W A;  4KSO A;  2ZNM A;  4K8M A;  3N9J A;  4HS1 A;  1X9S B;  2HT9 A;  2YV9 A;  5ECO B;  1RW1 A;  3BCI A;  2JZR A;  3D6I A;  3ERF A;  3HJM A;  3LXZ A;  5B8A A;  4BWQ A;  4KDX A;  1PD2 1;  3VUR A;  1NSW A;  1QUW A;  2VCV A;  4WEY A;  1GUK A;  2L4Q A;  2BMX A;  5HR2 A;  2WUL A;  4AGS A;  4FYC A;  3HA9 A;  3RPN A;  4NAX A;  4PUF C;  4D73 B;  5LNK e;  1PSQ A;  5ABR A;  2RM5 A;  1U88 A;  1C72 A;  2M80 A;  3GTU B;  2GST A;  2NPB A;  1N8J A;  2I3Y A;  3CMI A;  3IPZ A;  3EU3 A;  3TKS C;  2DLX A;  1T00 A;  1MDJ A;  11GS A;  1TRW A;  3VLN A;  5A4U A;  1AUC A;  3G7Y A;  6GSS A;  2M72 A;  5DDL A;  1Z6N A;  2YJ7 A;  2VCQ A;  1ZMA A;  1PX6 A;  3GSS A;  3L9S A;  2CAQ A;  5DCG A;  2GT6 A;  1Y6E A;  5J41 A;  4MJB A;  3IK7 A;  4X1U A;  5DAL B;  3U5R E;  2KP1 A;  2IMF A;  2E0Q A;  3QMX A;  3FR6 A;  3HVV A;  3A2V A;  1MTC A;  5KN1 A;  1TK0 B;  4AJ8 A;  3C1R A;  2IMK A;  2GZY A;  4N11 A;  2HSM A;  2C0D A;  2JSZ A;  1K3O A;  3CBU A;  1K0A A;  2FHE A;  5HR3 A;  1K3Y A;  1NHY A;  3FW2 A;  1X9M B;  1YQ1 A;  4Q5N A;  2PGT A;  1VF3 A;  1QMV A;  4L0W A;  3GN3 A;  5COH A;  6GSX A;  1U3A A;  2H19 A;  1I5G A;  2QC7 A;  6GSW A;  4Z7X A;  3TOT A;  3UJ1 A;  4IP1 A;  1U6T A;  2AV4 A;  4XS1 A;  1TW9 A;  2R5G A;  4POK A;  4CDO A;  1B9Y C;  5J5N A;  5GST A;  1WJK A;  2IFQ A;  3HHV A;  1OC3 A;  3R2Q A;  2REM A;  3ZYW A;  18GS A;  12GS A;  4HEA 2;  3ERW A;  4POL A;  1TXX A;  2D2Z A;  2X99 A;  4TR1 A;  2I4A A;  5INY A;  1EOG A;  1U3I A;  1BED A;  2F8F A;  2CA8 A;  1YF1 A;  4BWS A;  1WWJ A;  4TN8 A;  3FZ9 A;  1UN2 A;  3ZMK A;  3L4N A;  3HZ4 A;  1O8W A;  4LMV A;  5D8I A;  4J2F A;  3DD3 A;  4ZL9 A;  1G0T A;  10GS A;  1SK2 A;  4RQX A;  2V2G A;  3F4S A;  2C3N A;  1A23 A;  2H66 A;  1SD8 A;  1EEM A;  4V2L A;  4MH3 A;  1SL2 B;  4KB3 A;  4POB A;  3GX0 A;  2PER A;  3IBH A;  1A8L A;  2CX3 A;  3J7Y b;  2H1A A;  2P31 A;  4AF2 A;  2K8S A;  3UL3 A;  2K9F A;  2VLV A;  5FWG A;  1GTU A;  1V57 A;  4WET A;  3JCM L;  1YEX A;  4ZBB A;  1SU9 A;  5F8B A;  4ECC A;  3VWU A;  3GFK A;  3W6G A;  4N30 A;  5JWQ B;  4MF6 A;  3ZL5 A;  1USB A;  2B5X A;  2IIY A;  2VM2 A;  4ISD A;  2H6Y A;  3C8E A;  1LJR A;  1F2E A;  3K8N A;  3GMF A;  3TJB A;  3PH9 A;  3ZTL A;  3F6D A;  3IK9 A;  4X0X A;  5IPG A;  3S9F A;  4F0B A;  3R3E A;  5A5K A;  4NHW A;  2H70 A;  3D22 A;  2YZH A;  1Z9H A;  5F0G A;  2LQQ A;  1F9M A;  4IJ3 A;  3LWA A;  4IP6 A;  1TK8 B;  2E2M A;  1ERW A;  3I6A A;  2PVO C;  2AAW A;  4RQR A;  1FVK A;  2GLR A;  5AGY A;  2DJJ A;  3UAP A;  5DAK A;  5HFI A;  2IMI A;  4DVC A;  5IO0 A;  3P90 A;  2HRK A;  1WPI A;  3L78 A;  3FYG A;  5C00 A;  1EGR A;  5JWR B;  3QD9 A;  1K0D A;  1MD3 A;  3ZRE A;  5DJM A;  4I2U A;  1VF1 A;  1TP9 A;  2DML A;  3P2A A;  5EPF A;  5H5S A;  2KLX A;  1PMT A;  1TI3 A;  3Q6O A;  4IHU A;  2CV4 A; 
#chains in the Genus database with same CATH topology
 3KD0 A;  5G30 A;  1SK0 A;  4IKH A;  4BL7 B;  3EWL A;  4KH7 A;  2LQO A;  4Q5Q A;  1TXU A;  6GSY A;  2C1Y A;  1OYJ A;  2MMZ A;  3F63 A;  3VI5 A;  1Z7R A;  6GSU A;  4MCU A;  1GNW A;  2B3S A;  1I9D A;  4HZ4 A;  4MPG A;  3W8J A;  3HVX A;  2XBQ A;  3I9V 2;  1ST9 A;  2BJX A;  3QDN A;  1XWA A;  1TTZ A;  2LRT A;  3GKX A;  5B7C A;  3CSI A;  1V98 A;  3M9J A;  2FD3 A;  5BMU B;  2WZ9 A;  1TJD A;  4NV5 A;  1S4B P;  3HCZ A;  3UEM A;  3FZ5 A;  2IL3 A;  1M99 A;  4N10 A;  2YWN A;  4HQZ A;  4CY8 A;  3KM6 A;  4HJ2 A;  1BJX A;  5D9X A;  4L0U A;  3WT1 A;  1H4O A;  1B9X C;  1PRX A;  3GL5 A;  1DBY A;  1JZO A;  5LD0 A;  5A5H B;  3UBK A;  4ZB6 A;  1JZR A;  1EZK A;  4FYB A;  2R6K A;  4PGT A;  1U87 A;  3GUS A;  2V32 A;  1O6J A;  2WRT A;  1J0F A;  3GKM A;  2X49 A;  1XCC A;  2QA2 A;  1S3D A;  4KA0 A;  2H8L A;  4PUR A;  17GS A;  1A2M A;  1ZOF A;  2LKU A;  4K5R A;  1HD2 A;  4ZIJ A;  5IOX A;  2VCX A;  5KOX A;  1LBK A;  4G0L A;  3LW9 A;  2WB9 A;  3RHC A;  2YOI A;  2OA7 A;  2GGT A;  4WBJ A;  5DBQ A;  5JCW A;  1M2B A;  5IQY A;  2DJK A;  2C4J A;  4NMU A;  2GSQ A;  1GWC A;  4WBR D;  20GS A;  1X5E A;  4I2T A;  4H86 A;  2HFD A;  4Q5R A;  2K18 A;  4ZL7 A;  2AJQ B;  1PGT A;  1AQV A;  2OBI A;  1VF2 A;  1SYX A;  3EU4 A;  4MMM A;  4XRD A;  2R0C A;  2WW1 A;  3LGC A;  1R4W A;  2LNT A;  1M7T A;  3TRP A;  1KTE A;  5AIX A;  3WYW A;  4PI0 C;  1YDK A;  2PMT A;  1YF0 A;  3OR5 A;  3F9U A;  4YKG A;  5IMD A;  3HJP A;  2MBS A;  1GTI A;  1ACV A;  4LL1 B;  2TRX A;  2GTU A;  4KDU A;  2L6D A;  4QMK A;  2LV3 A;  3TRX A;  4IBP A;  3DWV A;  2C0F A;  5HFG A;  4IEL A;  4DSQ A;  4ECI A;  3MNG A;  3EMP A;  5H5R A;  1YJ6 A;  5ECS A;  3UAR A;  2WCI A;  3TJJ A;  1XBS A;  4XS4 B;  1PQN A;  2R0P A;  3D4T A;  4GRF A;  2M46 A;  3AY8 A;  5IMV A;  5ECQ B;  4QL7 A;  2HI7 A;  2P5R A;  4EDZ A;  4IW9 A;  3DXB A;  5EVO A;  2NTO A;  2KUC A;  3IOS A;  1A24 A;  2H1L A;  2ON7 A;  4X4J A;  4MZB A;  3KH7 A;  1W4V A;  5DQY A;  5B6M A;  5F05 A;  4GDF A;  3C1S A;  3MYD A;  1Z3E A;  1GH2 A;  3ZVJ A;  2LST A;  2B1K A;  3FY7 A;  5CO3 A;  1CQH A;  2FUG 2;  1IYH A;  1SD9 A;  1Z7P A;  1M9A A;  4PUA A;  1AQW A;  3N5O A;  4I5Q A;  1O8X A;  3HVN A;  2UV8 G;  3IR4 A;  1T1V A;  3WD6 A;  1FB6 A;  2HXK A;  4PHZ C;  4ZB8 A;  4J56 E;  2GSR A;  3GNJ A;  3VWW A;  4PNG A;  4OFN A;  2JAD A;  2GQK A;  1SKS B;  5AN1 A;  4EE0 A;  3QAG A;  1FO5 A;  3PPU A;  4TXO B;  4MK3 A;  3LXT A;  1EWX A;  4PTS A;  2VCZ A;  2KHP A;  2XBI A;  3QOU A;  2HLS A;  1RK4 A;  1QFN A;  2GDR A;  4ULX A;  3CYN A;  1GNE A;  2NVL A;  2E2G A;  4F82 A;  4LLR A;  4MDC A;  3GKN A;  1XVQ A;  5GAP D;  5J47 A;  3TU3 B;  2F51 A;  3TJK A;  3ME8 A;  1Z5Y E;  2AYT A;  3QR6 A;  4MF7 A;  5LCZ A;  4PQH A;  2ZUP A;  1B48 A;  5DQS A;  2A2S A;  2VD0 A;  3TGZ A;  1PA3 A;  2A2R A;  4WR5 A;  5HR1 A;  2L5O A;  3KCM A;  2FA8 A;  2GZP A;  1KEB A;  4PQI A;  1YKC A;  3MWH A;  2O36 A;  3GYK A;  3DEX A;  5ECK B;  4IN0 A;  3TUE A;  3QFA C;  1SL1 B;  3IRA A;  3APQ A;  2XPE A;  3TDG A;  4EIQ A;  1VF4 A;  3FR3 A;  4DSS A;  3FZA A;  1J08 A;  3O76 A;  3MIX A;  3CTG A;  2H71 A;  1A0F A;  1SJI A;  3WGE A;  1K0N A;  1DUG A;  2WS2 A;  4DEJ A;  4X43 A;  2DBC A;  2FGX A;  2WGR A;  2VL2 C;  3DKS A;  4G01 A;  3BD2 A;  5CRH A;  4IS0 A;  5J4Y A;  2B7J A;  3HZ8 A;  2AB6 A;  1ZYN A;  3IHQ A;  4IQA A;  1GSD A;  2LEG A;  2HQT A;  3EVI A;  1SEN A;  1GSU A;  1BG5 A;  4BVY A;  2WW0 A;  4YAP A;  3TKP A;  4TW5 A;  4ECJ A;  4HUA A;  4JZQ A;  1TRV A;  3TOU A;  3SWL A;  2PU9 C;  2YZU A;  1PN0 A;  4EKZ A;  5ECH B;  1FOV A;  2OJL A;  3GA4 A;  4BVX A;  1ABA A;  3KTB A;  5ELA A;  3HMJ G;  4KSM A;  3IE3 A;  2WW3 A;  2C3Q A;  4PNF A;  4OCF A;  5ECR B;  3FZ4 A;  3HD5 A;  3NIV A;  1KNG A;  4ZXG A;  1SK1 A;  1M0U A;  2H01 A;  4JBB A;  1ERU A;  4E68 A;  2V6K A;  3ZFB A;  1QXH A;  4GST A;  4GWR A;  4GXZ A;  3APO A;  1OC8 A;  1MEK A;  3Q74 A;  1ML6 A;  5DVB A;  4EL1 A;  5FHI A;  1F3A A;  5A1N B;  2K8V A;  4TR4 A;  1V40 A;  1AW9 A;  3LG6 A;  1J9B A;  1XG8 A;  3M0F A;  2EIQ A;  2C0G A;  4TR3 A;  5H5Q A;  1JLV A;  1AQX A;  3NOF A;  5E59 A;  3HKR A;  2R37 A;  2H6Z A;  4TXV A;  2CVB A;  4AKI A;  1R26 A;  2CT6 A;  2O89 A;  2VKZ G;  1S3A A;  4MH2 A;  9GSS A;  3ZFL A;  2VCT A;  1T4Z A;  3F8U A;  1WP0 A;  1GUM A;  4FIW A;  3CWG A;  2L5L A;  1QQ2 A;  3KP9 A;  4O5Q A;  4G2E A;  1XWK A;  5KN3 A;  4Q5F A;  4ECB A;  5ID2 A;  3HDC A;  5E4W A;  1X9W B;  1V58 A;  4I8B A;  3Q18 A;  1TDI A;  3FHK A;  2FWF A;  1UVZ A;  1GLQ A;  1XWG A;  3CRU A;  1JFU A;  5J40 A;  3A2W A;  1ZGN A;  3GX8 A;  2CX4 A;  5B6N A;  1XFL A;  4HOJ A;  4G0K A;  3I43 A;  1TKD B;  3GH9 A;  3ZIJ A;  5D93 A;  2F3M A;  1OE8 A;  5EY6 A;  3A2X A;  4MLY A;  4POM A;  4YQU A;  3TCO A;  4OWY A;  1YKA A;  2A2P A;  2YWI A;  2IWT A;  2KOK A;  1PL2 A;  1X5D A;  1OC9 B;  2OKA A;  3ERG A;  5CYY A;  2XHF A;  1N2A A;  1FHE A;  5GZZ B;  2F8A A;  1JZW A;  4OFT A;  4D73 A;  2EC4 A;  2L57 A;  1M2A A;  2HNL A;  4MF5 A;  1T8E B;  2K6V A;  4AJ7 A;  1FVJ A;  3GTU A;  2VLU A;  1R5A A;  2VL3 A;  4XIH A;  1Q98 A;  4QL9 A;  3VK9 A;  4OFM A;  4I6X A;  1XW5 A;  2VLT A;  5CAX A;  4WR4 A;  2A4V A;  2RUE A;  3GL3 A;  4N3Z A;  4F2I A;  4JR6 A;  2C8U A;  1EOH A;  2X8G A;  2R3X A;  4G0I A;  3TKQ A;  4PX1 A;  4PI2 C;  3QPM A;  5IM9 A;  2TRC P;  1BYE A;  2FWH A;  2CAI A;  1GUH A;  2RII A;  3TJF A;  2DIY A;  4FYU A;  4NHZ A;  3EPT A;  2ON5 A;  3P8W A;  2CZ3 A;  2IME A;  1PKW A;  3C7M A;  2PVQ A;  2HZE A;  2GT5 A;  1GLP A;  5L71 A;  4E8H A;  3FMW A;  3CHX C;  1UA5 A;  5DAL A;  2N5A A;  2EIR A;  3IAM 2;  4Z2T A;  1B4P A;  2MMO A;  2LRC A;  3CRT A;  1F37 A;  1EV9 A;  4EVM A;  1AAZ A;  3EMX A;  3KH9 A;  3RAZ A;  2VOC A;  4OO5 A;  2LJK A;  5IIZ A;  1FG4 A;  2RLI A;  4NPB A;  4G19 A;  4MPF A;  4K7N A;  2VCW A;  3FEU A;  3APS A;  3H8Q A;  4IJI A;  3ISO A;  2EIO A;  3ZML A;  1M3I A;  4L5L A;  4ML1 A;  1TU8 A;  4K6X A;  5ECM B;  2HSM B;  1XVW A;  2HYX A;  3BJ5 A;  2CVK A;  1EV4 A;  4TR0 A;  4GTU A;  2FY6 A;  4ILF A;  3UIW A;  4N0V A;  2HZF A;  3TKS A;  2DKH A;  2IN3 A;  1Y1U A;  3KJY A;  4RI7 A;  1F3B A;  2JAC A;  1F6M C;  4K7O A;  2YWM A;  4GSS A;  2B6M A;  1XPV A;  3CTF A;  4XCS A;  3P7X A;  2FCH A;  3D5J A;  1HNA A;  2LTK A;  2H0G A;  2QGV A;  3KXO A;  2WVX A;  2H30 A;  5JCU A;  5DCH A;  2FLS A;  2IFQ B;  5G5E A;  1AIU A;  2X8C A;  4K9Z A;  2WDU A;  3CXG A;  1WRY A;  1GSY A;  5JWO B;  3US3 A;  3O3T A;  1ZYP A;  2YJH A;  5IMC A;  2B7K A;  2HRN A;  1E6B A;  4EF0 A;  1OE7 A;  2PPT A;  4FO5 A;  1EEJ A;  2J23 A;  1XZO A;  1B8X A;  4TR1 B;  1XXU A;  4WXT A;  2DKI A;  2FWG A;  3A5I A;  14GS A;  2YWO A;  4V1A g;  2VL2 A;  4K0G A;  1PFO A;  1JHB A;  3UOM A;  22GS A;  4EC0 A;  5HQP A;  1E2Y A;  4E8E A;  3HXS A;  3M1G A;  3GH6 A;  2MMN A;  4K7I A;  1BF5 A;  3VFI A;  3M8N A;  5KEJ A;  4IGJ A;  1LU4 A;  1NHO A;  3EIN A;  1Y25 A;  3QFB C;  3IHG A;  3UVT A;  1THO A;  4I97 A;  4O7H A;  3E3E A;  4LMW A;  4YQM A;  2B5Y A;  3GV1 A;  3PR8 A;  3LOR A;  1K3L A;  4KCA A;  2MYG A;  4GQF A;  4G10 A;  2HSY A;  2VD1 A;  4OMV A;  1ZZY A;  3G7J A;  4JE1 A;  2JZS A;  5HFK A;  3ZIT A;  2ZCT A;  1TOF A;  4HU7 A;  2JU5 A;  1A8Y A;  3D4M A;  4KND A;  5CRD A;  1N25 A;  1RQM A;  2FWE A;  5G2Z A;  1GRX A;  1SVO A;  2HRA A;  2X64 A;  5IMF A;  3DVX A;  4JU5 A;  1A2L A;  13GS A;  3FR9 A;  5CRW A;  2H0H A;  3E0U A;  5IOW A;  3Q19 A;  3A5W A;  1XWB A;  3IDV A;  6GSV A;  1TRU A;  4V1A p;  2HE3 A;  4L8E A;  3LFL A;  3CSJ A;  2DMM A;  2HSN B;  1TRS A;  4ID0 A;  3BCK A;  3IC8 A;  1A2J A;  4LL4 B;  4O5R A;  3HYP A;  3EYT A;  1V2A A;  2PWJ A;  2IMD A;  3IA1 A;  3H79 A;  2L6C A;  2V41 A;  5G1L A;  3UMA A;  2ES7 A;  1M9B A;  3RFR C;  5A34 B;  5G5F A;  5DJL A;  1GSS A;  3WT2 A;  2B1L A;  4BL7 A;  3MSZ A;  5HR0 A;  2OE3 A;  4HQS A;  3TJG A;  1B4Q A;  1X5C A;  1R5P A;  1XIY A;  2EFC A;  2YV7 A;  1XOA A;  3TB2 A;  3KP8 A;  4QQ7 A;  4K0N A;  5FT3 A;  5DAK B;  2WFC A;  3ZLP A;  2CVD A;  2HRK B;  2H1G A;  4BIK A;  2DJ0 A;  3TKS E;  16GS A;  2DSA A;  1EP7 A;  3VPT A;  3KTL A;  1SKR B;  2V1M A;  3LJR A;  4RI6 A;  1OKD A;  3L9U A;  5BMU A;  4KF9 A;  2NDO A;  3M9K A;  5CP1 A;  1T3B A;  4AKG A;  2A4H A;  2IPA A;  3VWV A;  4MZW A;  1O85 A;  3F6F A;  4KW6 A;  3IC4 A;  2LS5 A;  4ZL8 A;  2I1U A;  3RPP A;  4FH8 A;  2E7P A;  3GHA A;  4MA9 A;  2WVZ A;  3H4K A;  4NWY A;  5IMA A;  3C73 A;  5A5H A;  1G7O A;  1SJZ A;  2OE0 A;  5BRT A;  2HZE B;  3ME7 A;  3HVS A;  4HI7 A;  2VUP A;  2GQL A;  3D0Z A;  3H93 A;  1PKZ A;  2G2Q A;  2YAN A;  2C0E A;  2PUK C;  4V2M A;  4GSN A;  5B8B A;  3LYP A;  5CNW A;  1EGO A;  3ED3 A;  4AI6 A;  3DGQ A;  1MDK A;  4IQ1 A;  2AUV A;  4L5O A;  3KMN A;  2DJ3 A;  1SVL A;  2OAD A;  3WGX A;  4HDE A;  1K0C A;  2KP2 A;  1DSB A;  2PBJ A;  2VM1 A;  4GLT A;  4FXY P;  1BAY A;  1M2D A;  2B5E A;  3RDW A;  2CQ9 A;  2C3T A;  2YN1 A;  5D73 A;  3BOA A;  7GSS A;  1OVN A;  5ECI B;  1K0O A;  1OKT A;  2O85 A;  3UBL A;  2GVP A;  4PQ1 A;  5J4U A;  1WE0 A;  1HQO A;  1SJ6 A;  4MJE A;  3VI7 A;  2NBS A;  4GQC A;  3G7I A;  4ZBA A;  2H75 A;  4XRA A;  1GSE A;  1Z6M A;  4CHS A;  1THX A;  2I9H A;  3F3Q A;  3VPQ A;  2GQM A;  1XOB A;  1SVM A;  3KZQ A;  4WF4 A;  2MBT A;  1DE2 A;  5A4V A;  3EUR A;  4ICY A;  2G0F A;  1GSF A;  4K2X A;  2Z9S A;  2ALB A;  3A3T A;  4JRR A;  2GSS A;  4GF0 A;  4OO4 A;  2YCD A;  3H1N A;  4F0C A;  5IPH A;  4DSR A;  3LEF A;  3ZRD A;  1GP1 A;  2EFD A;  4FQU A;  4V2N A;  4XS4 A;  5J4V A;  1WOU A;  1JZD A;  3C71 A;  4HZ2 A;  2WJU A;  4KGI A;  4F9Z A;  6GST A;  1HNC A;  5AIS A;  3QAW A;  2LNS A;  5ENU A;  1FW1 A;  1TI1 A;  1YZX A;  1GTA A;  3IAS 2;  1GSQ A;  1T4Y A;  3FK8 A;  3KEB A;  1K0M A;  1HNB A;  4K1F A;  2EFE A;  1ERT A;  2OAC A;  4EDY A;  4AKX B;  2OT3 A;  2P0G A;  3IV4 A;  4O92 A;  5ECN B;  4OD7 A;  4ZIL A;  1XW9 A;  2DJ2 A;  2R0G A;  2QSI A;  3VWX A;  1GTB A;  2QA1 A;  4KX4 A;  4MJA A;  3BBY A;  2X8H A;  19GS A;  4GCI A;  3HY2 A;  3E9J B;  1T7P B;  3KMO A;  1Q4J A;  1O7U A;  4MJC A;  3QCP A;  4JED A;  4G9H A;  3RBT A;  5ELG A;  2XPD A;  4HJM A;  2N5F A;  4HU9 A;  2O8V B;  2L4C A;  4MP4 A;  2H0I A;  2L59 A;  4BPY A;  3M3M A;  4WF5 A;  2LJA A;  1QGV A;  1S3C A;  4ML6 A;  3CSH A;  3F4T A;  5D9W A;  4TXO A;  3G9B A;  1ZL9 A;  3HJO A;  4ZBD A;  3MDK A;  4JR4 A;  1HYU A;  3KIJ A;  3DIE A;  5F06 A;  3KGK A;  3EC3 A;  3DRN A;  2VO4 A;  3ZZX A;  1SKW B;  2H72 A;  5CRG A;  3I69 A;  4KAE A;  3FRC A;  4XTS A;  5IO2 A;  2HSH A;  1G6W A;  2OBK A;  4ZB7 A;  2MZC A;  5F07 A;  4P3Y B;  1A0R P;  1AC1 A;  4EO3 A;  2GZZ A;  4ZB9 A;  2XC2 A;  5G31 A;  5JCG A;  2VAF A;  2R4V A;  4CW9 A;  2O7K A;  2F9S A;  3L9V A;  5CRE A;  4EXJ A;  5KN0 A;  1WMJ A;  4EUY A;  1O81 A;  1ZYE A;  2H73 A;  2AHE A;  1NM3 A;  5GSS A;  3J7Y k;  1WIK A;  2J9H A;  2N5B A;  4TRX A;  1G7E A;  3GRX A;  3PGT A;  4AJ6 A;  2LJR A;  8GSS A;  1EP8 A;  5D96 A;  1KBN A;  1VGL A;  3GIX A;  4O32 A;  3O6T A;  4F03 A;  1SYR A;  5D9V A;  2V6O A;  1ZCP A;  1ON4 A;  1TK5 B;  1I1I P;  2YNX A;  1FAA A;  3IXR A;  4J57 E;  3UVH A;  1MD4 A;  5J9C A;  1M3J A;  3ZVJ D;  2JSY A;  3ZIV A;  3L0H A;  2OE1 A;  3LQ7 A;  5C04 A;  2H76 A;  1SL0 B;  3W8S A;  4OCE A;  3SBC A;  4KCE A;  3U6V A;  4EIP A;  2YP6 A;  2DJ1 A;  1YEW C;  1JLW A;  3EE2 A;  1URM A;  4DSS B;  2IJY A;  1V9W A;  4K5S A;  2H6X A;  1GL8 A;  2BTO T;  2EFH A;  3DVW A;  1ILO A;  3MAK A;  2MMA A;  2FNO A;  3F4R A;  2HRF A;  1OAZ A;  1W89 A;  5EL8 A;  4IVF A;  4NXI A;  3TKR A;  4TKY A;  4TVE A;  5J9B A;  4HSC X;  1VRS D;  4KDY A;  2TIR A;  4N0Z A;  1PL1 A;  4XHM A;  1PX7 A;  5A4W A;  5J3R A;  2X4A A;  1QK8 A;  5GAN D;  4KE3 A;  4CY6 A;  3GUR A;  2LRN A;  4BVY B;  1PN9 A;  5A1N A;  1TU7 A;  1NW2 A;  1YEP A;  2FA4 A;  1XWC A;  2H1D A;  1O73 A;  4Z2R A;  1MDI A;  5KN2 A;  3DML A;  4YAV A;  4LA1 A;  4BVX B;  2I81 A;  2H74 A;  4O5U A;  3PIN A;  4MNN A;  4RUV A;  3LYK A;  2WZS A;  3F3R A;  3GST A;  2O5V A;  5ECP B;  3F0I A;  1AXD A;  2GS3 A;  2WVY A;  2H1B A;  2PN8 A;  5AIV A;  1R7H A;  4KUN A;  1H75 A;  1BQ7 A;  4ACS A;  2P5Q A;  2UZ8 A;  1IYI A;  2CZ2 A;  3DYR A;  4YKF A;  4YQV A;  3QAV A;  3GKK A;  5IMZ A;  3TRQ A;  4PXO A;  5G1K A;  3D21 A;  1ZYQ B;  4USS A;  4TOP A;  2QKE A;  1G6Y A;  2C80 A;  2YPM A;  3WGD A;  1GUL A;  2RM6 A;  2O87 A;  5D9T A;  4A5P A;  3NZN A;  4K2D A;  2WW2 A;  4BA7 A;  4MAB A;  1XW6 A;  4NV2 A;  2VL9 A;  4WKW A;  1X0R A;  1BX9 A;  5ID2 B;  3RHB A;  3FKF A;  4YH2 A;  2R2J A;  1FB0 A;  2VIM A;  2DIZ A;  1CQG A;  1OC9 A;  5ECL B;  1YY7 A;  4XS6 A;  1DE1 A;  2RUF A;  2JL4 A;  2LUS A;  3LSZ A;  1K0B A;  1UC7 A;  1ERV A;  2JZT A;  2DC5 A;  4MZC A;  3V1W A;  4KSO A;  2ZNM A;  4K8M A;  3N9J A;  4HS1 A;  1X9S B;  2HT9 A;  2YV9 A;  5ECO B;  1RW1 A;  3BCI A;  2JZR A;  3D6I A;  3ERF A;  3HJM A;  3LXZ A;  5B8A A;  4BWQ A;  4KDX A;  1PD2 1;  3VUR A;  1NSW A;  1QUW A;  3CQF A;  2VCV A;  4WEY A;  1GUK A;  2L4Q A;  2BMX A;  5HR2 A;  2WUL A;  4AGS A;  4FYC A;  4Z2U A;  3HA9 A;  3RPN A;  4NAX A;  4PUF C;  4D73 B;  5LNK e;  1PSQ A;  5ABR A;  2RM5 A;  1U88 A;  1C72 A;  2M80 A;  1YVL A;  3GTU B;  2GST A;  2NPB A;  5KOW A;  1N8J A;  2I3Y A;  3CMI A;  3IPZ A;  3EU3 A;  3TKS C;  2DLX A;  1T00 A;  1MDJ A;  11GS A;  1TRW A;  3VLN A;  5A4U A;  1AUC A;  3G7Y A;  6GSS A;  2M72 A;  5DDL A;  1Z6N A;  2YJ7 A;  2VCQ A;  1ZMA A;  1PX6 A;  3GSS A;  3L9S A;  2CAQ A;  5DCG A;  2GT6 A;  1Y6E A;  5J41 A;  4MJB A;  3IK7 A;  4X1U A;  5DAL B;  3U5R E;  2KP1 A;  2IMF A;  2E0Q A;  3QMX A;  3FR6 A;  3HVV A;  3A2V A;  1MTC A;  5KN1 A;  1TK0 B;  4AJ8 A;  3C1R A;  2IMK A;  2GZY A;  4N11 A;  2HSM A;  2C0D A;  2JSZ A;  1K3O A;  3CBU A;  1K0A A;  2FHE A;  5HR3 A;  1K3Y A;  1NHY A;  3FW2 A;  1X9M B;  1YQ1 A;  4Q5N A;  2PGT A;  1VF3 A;  1QMV A;  4L0W A;  3GN3 A;  5COH A;  6GSX A;  1U3A A;  2H19 A;  1I5G A;  2QC7 A;  6GSW A;  4Z7X A;  3TOT A;  3UJ1 A;  4IP1 A;  1U6T A;  2AV4 A;  4XS1 A;  1TW9 A;  2R5G A;  4POK A;  4CDO A;  1B9Y C;  5J5N A;  5GST A;  1WJK A;  2IFQ A;  3HHV A;  1OC3 A;  3R2Q A;  2REM A;  3ZYW A;  18GS A;  12GS A;  4HEA 2;  3ERW A;  4POL A;  1TXX A;  2D2Z A;  3RGB C;  2X99 A;  4TR1 A;  2O3E A;  2I4A A;  5INY A;  1EOG A;  1U3I A;  1BED A;  2F8F A;  2CA8 A;  1YF1 A;  4BWS A;  1FOH A;  1WWJ A;  4TN8 A;  2WVX B;  3FZ9 A;  1UN2 A;  3ZMK A;  3L4N A;  3HZ4 A;  1O8W A;  4LMV A;  5D8I A;  4J2F A;  3DD3 A;  4ZL9 A;  1G0T A;  10GS A;  1SK2 A;  4RQX A;  2V2G A;  3F4S A;  2C3N A;  1A23 A;  2H66 A;  1SD8 A;  1EEM A;  4V2L A;  4MH3 A;  1SL2 B;  4KB3 A;  4POB A;  3GX0 A;  2PER A;  3IBH A;  1A8L A;  2CX3 A;  3J7Y b;  4W66 A;  2H1A A;  2P31 A;  4AF2 A;  2K8S A;  3UL3 A;  2K9F A;  2VLV A;  5FWG A;  1GTU A;  4AKH A;  1V57 A;  4WET A;  3JCM L;  1YEX A;  4ZBB A;  1SU9 A;  5F8B A;  4ECC A;  3VWU A;  3GFK A;  3W6G A;  4N30 A;  5JWQ B;  4MF6 A;  3ZL5 A;  1USB A;  2B5X A;  2IIY A;  2VM2 A;  4ISD A;  2HSN A;  2H6Y A;  3C8E A;  1LJR A;  1F2E A;  3K8N A;  3GMF A;  3TJB A;  3PH9 A;  3ZTL A;  3IK9 A;  3F6D A;  4X0X A;  5IPG A;  3S9F A;  4F0B A;  3R3E A;  5A5K A;  4NHW A;  2H70 A;  3D22 A;  2YZH A;  1Z9H A;  5F0G A;  2LQQ A;  5A34 A;  1F9M A;  4IJ3 A;  3LWA A;  4IP6 A;  1TK8 B;  2E2M A;  1ERW A;  3I6A A;  2PVO C;  2AAW A;  4RQR A;  1FVK A;  2GLR A;  5AGY A;  2DJJ A;  3UAP A;  5DAK A;  5HFI A;  2IMI A;  4DVC A;  5IO0 A;  3P90 A;  2HRK A;  1WPI A;  3L78 A;  3FYG A;  5C00 A;  1EGR A;  1BG1 A;  5JWR B;  3QD9 A;  1K0D A;  1MD3 A;  3ZRE A;  5DJM A;  1S3R A;  4I2U A;  1VF1 A;  1TP9 A;  2DML A;  3P2A A;  5EPF A;  5H5S A;  2KLX A;  1PMT A;  1TI3 A;  3Q6O A;  4IHU A;  2CV4 A; 
#chains in the Genus database with same CATH homology
 3KD0 A;  5G30 A;  1SK0 A;  4IKH A;  4BL7 B;  3EWL A;  4KH7 A;  2LQO A;  4Q5Q A;  1TXU A;  6GSY A;  2C1Y A;  1OYJ A;  2MMZ A;  3F63 A;  3VI5 A;  1Z7R A;  6GSU A;  4MCU A;  1GNW A;  2B3S A;  1I9D A;  4HZ4 A;  4MPG A;  3W8J A;  3HVX A;  2XBQ A;  3I9V 2;  1ST9 A;  2BJX A;  3QDN A;  1XWA A;  1TTZ A;  2LRT A;  3GKX A;  5B7C A;  3CSI A;  1V98 A;  3M9J A;  2FD3 A;  5BMU B;  2WZ9 A;  1TJD A;  4NV5 A;  3HCZ A;  3UEM A;  3FZ5 A;  2IL3 A;  1M99 A;  4N10 A;  2YWN A;  4HQZ A;  4CY8 A;  3KM6 A;  4HJ2 A;  1BJX A;  5D9X A;  4L0U A;  3WT1 A;  1H4O A;  1B9X C;  1PRX A;  3GL5 A;  1DBY A;  1JZO A;  5LD0 A;  5A5H B;  3UBK A;  4ZB6 A;  1JZR A;  1EZK A;  4FYB A;  2R6K A;  4PGT A;  1U87 A;  3GUS A;  2V32 A;  1O6J A;  2WRT A;  1J0F A;  3GKM A;  2X49 A;  1XCC A;  2QA2 A;  1S3D A;  4KA0 A;  2H8L A;  4PUR A;  17GS A;  1A2M A;  1ZOF A;  2LKU A;  4K5R A;  1HD2 A;  4ZIJ A;  5IOX A;  2VCX A;  5KOX A;  1LBK A;  4G0L A;  3LW9 A;  2WB9 A;  3RHC A;  2YOI A;  2OA7 A;  2GGT A;  4WBJ A;  5DBQ A;  5JCW A;  1M2B A;  5IQY A;  2DJK A;  2C4J A;  4NMU A;  2GSQ A;  1GWC A;  4WBR D;  20GS A;  1X5E A;  4I2T A;  4H86 A;  2HFD A;  4Q5R A;  2K18 A;  4ZL7 A;  2AJQ B;  1PGT A;  1AQV A;  2OBI A;  1VF2 A;  1SYX A;  3EU4 A;  4MMM A;  4XRD A;  2R0C A;  3LGC A;  1R4W A;  2LNT A;  1M7T A;  3TRP A;  1KTE A;  5AIX A;  3WYW A;  1YDK A;  2PMT A;  1YF0 A;  3OR5 A;  3F9U A;  4YKG A;  5IMD A;  3HJP A;  2MBS A;  1GTI A;  1ACV A;  4LL1 B;  2TRX A;  2GTU A;  4KDU A;  2L6D A;  4QMK A;  2LV3 A;  3TRX A;  4IBP A;  3DWV A;  2C0F A;  5HFG A;  4IEL A;  4DSQ A;  4ECI A;  3MNG A;  3EMP A;  5H5R A;  1YJ6 A;  5ECS A;  3UAR A;  2WCI A;  3TJJ A;  1XBS A;  4XS4 B;  1PQN A;  2R0P A;  3D4T A;  4GRF A;  2M46 A;  3AY8 A;  5IMV A;  5ECQ B;  4QL7 A;  2HI7 A;  2P5R A;  4EDZ A;  4IW9 A;  3DXB A;  5EVO A;  2NTO A;  2KUC A;  3IOS A;  1A24 A;  2H1L A;  2ON7 A;  4X4J A;  4MZB A;  3KH7 A;  1W4V A;  5DQY A;  5B6M A;  5F05 A;  4GDF A;  3C1S A;  3MYD A;  1Z3E A;  1GH2 A;  3ZVJ A;  2LST A;  2B1K A;  3FY7 A;  5CO3 A;  1CQH A;  2FUG 2;  1IYH A;  1SD9 A;  1Z7P A;  1M9A A;  4PUA A;  1AQW A;  3N5O A;  4I5Q A;  1O8X A;  2UV8 G;  3IR4 A;  1T1V A;  3WD6 A;  1FB6 A;  2HXK A;  4ZB8 A;  4J56 E;  2GSR A;  3GNJ A;  3VWW A;  4PNG A;  4OFN A;  2JAD A;  2GQK A;  1SKS B;  5AN1 A;  4EE0 A;  3QAG A;  1FO5 A;  3PPU A;  4TXO B;  4MK3 A;  3LXT A;  1EWX A;  4PTS A;  2VCZ A;  2KHP A;  2XBI A;  3QOU A;  2HLS A;  1RK4 A;  1QFN A;  2GDR A;  4ULX A;  3CYN A;  1GNE A;  2NVL A;  2E2G A;  4F82 A;  4LLR A;  4MDC A;  3GKN A;  1XVQ A;  5GAP D;  5J47 A;  3TU3 B;  2F51 A;  3TJK A;  3ME8 A;  1Z5Y E;  2AYT A;  3QR6 A;  4MF7 A;  5LCZ A;  4PQH A;  2ZUP A;  1B48 A;  5DQS A;  2A2S A;  2VD0 A;  3TGZ A;  1PA3 A;  2A2R A;  4WR5 A;  5HR1 A;  2L5O A;  3KCM A;  2FA8 A;  2GZP A;  1KEB A;  4PQI A;  1YKC A;  3MWH A;  3GYK A;  3DEX A;  5ECK B;  4IN0 A;  3TUE A;  3QFA C;  1SL1 B;  3IRA A;  3APQ A;  2XPE A;  3TDG A;  4EIQ A;  1VF4 A;  3FR3 A;  4DSS A;  3FZA A;  1J08 A;  3O76 A;  3MIX A;  3CTG A;  2H71 A;  1A0F A;  1SJI A;  3WGE A;  1K0N A;  1DUG A;  2WS2 A;  4DEJ A;  4X43 A;  2DBC A;  2FGX A;  2WGR A;  2VL2 C;  3DKS A;  4G01 A;  3BD2 A;  5CRH A;  4IS0 A;  5J4Y A;  2B7J A;  3HZ8 A;  2AB6 A;  1ZYN A;  3IHQ A;  4IQA A;  1GSD A;  2LEG A;  2HQT A;  3EVI A;  1SEN A;  1GSU A;  1BG5 A;  4BVY A;  4YAP A;  3TKP A;  4TW5 A;  4ECJ A;  4HUA A;  4JZQ A;  1TRV A;  3TOU A;  3SWL A;  2PU9 C;  2YZU A;  1PN0 A;  4EKZ A;  5ECH B;  1FOV A;  2OJL A;  3GA4 A;  4BVX A;  1ABA A;  3KTB A;  5ELA A;  3HMJ G;  4KSM A;  3IE3 A;  2C3Q A;  4PNF A;  4OCF A;  5ECR B;  3FZ4 A;  3HD5 A;  3NIV A;  1KNG A;  4ZXG A;  1SK1 A;  1M0U A;  2H01 A;  4JBB A;  1ERU A;  4E68 A;  2V6K A;  3ZFB A;  1QXH A;  4GST A;  4GWR A;  4GXZ A;  3APO A;  1OC8 A;  1MEK A;  3Q74 A;  1ML6 A;  5DVB A;  4EL1 A;  5FHI A;  1F3A A;  5A1N B;  2K8V A;  4TR4 A;  1V40 A;  1AW9 A;  3LG6 A;  1J9B A;  3M0F A;  2EIQ A;  2C0G A;  4TR3 A;  5H5Q A;  1JLV A;  1AQX A;  3NOF A;  5E59 A;  3HKR A;  2R37 A;  2H6Z A;  4TXV A;  2CVB A;  4AKI A;  1R26 A;  2CT6 A;  2O89 A;  2VKZ G;  1S3A A;  4MH2 A;  9GSS A;  3ZFL A;  2VCT A;  1T4Z A;  3F8U A;  1WP0 A;  1GUM A;  4FIW A;  3CWG A;  2L5L A;  1QQ2 A;  3KP9 A;  4O5Q A;  4G2E A;  1XWK A;  5KN3 A;  4Q5F A;  4ECB A;  5ID2 A;  3HDC A;  5E4W A;  1X9W B;  1V58 A;  4I8B A;  3Q18 A;  1TDI A;  3FHK A;  2FWF A;  1UVZ A;  1GLQ A;  1XWG A;  3CRU A;  1JFU A;  5J40 A;  3A2W A;  1ZGN A;  3GX8 A;  2CX4 A;  5B6N A;  1XFL A;  4HOJ A;  4G0K A;  3I43 A;  1TKD B;  3GH9 A;  3ZIJ A;  5D93 A;  2F3M A;  1OE8 A;  5EY6 A;  3A2X A;  4MLY A;  4POM A;  4YQU A;  3TCO A;  4OWY A;  1YKA A;  2A2P A;  2YWI A;  2IWT A;  2KOK A;  1PL2 A;  1X5D A;  1OC9 B;  2OKA A;  3ERG A;  5CYY A;  2XHF A;  1N2A A;  1FHE A;  5GZZ B;  2F8A A;  1JZW A;  4OFT A;  4D73 A;  2EC4 A;  2L57 A;  1M2A A;  2HNL A;  4MF5 A;  1T8E B;  2K6V A;  4AJ7 A;  1FVJ A;  3GTU A;  2VLU A;  1R5A A;  2VL3 A;  4XIH A;  1Q98 A;  4QL9 A;  3VK9 A;  4OFM A;  4I6X A;  1XW5 A;  2VLT A;  5CAX A;  4WR4 A;  2A4V A;  2RUE A;  3GL3 A;  4N3Z A;  4F2I A;  4JR6 A;  2C8U A;  1EOH A;  2X8G A;  2R3X A;  4G0I A;  3TKQ A;  4PX1 A;  3QPM A;  5IM9 A;  2TRC P;  1BYE A;  2FWH A;  2CAI A;  1GUH A;  2RII A;  3TJF A;  2DIY A;  4FYU A;  4NHZ A;  3EPT A;  2ON5 A;  3P8W A;  2CZ3 A;  2IME A;  1PKW A;  3C7M A;  2PVQ A;  2HZE A;  2GT5 A;  1GLP A;  5L71 A;  4E8H A;  3FMW A;  1UA5 A;  5DAL A;  2N5A A;  2EIR A;  3IAM 2;  4Z2T A;  1B4P A;  2MMO A;  2LRC A;  3CRT A;  1F37 A;  1EV9 A;  4EVM A;  1AAZ A;  3EMX A;  3KH9 A;  3RAZ A;  2VOC A;  4OO5 A;  2LJK A;  5IIZ A;  1FG4 A;  2RLI A;  4NPB A;  4G19 A;  4MPF A;  4K7N A;  2VCW A;  3FEU A;  3APS A;  3H8Q A;  4IJI A;  3ISO A;  2EIO A;  3ZML A;  4L5L A;  4ML1 A;  1TU8 A;  4K6X A;  5ECM B;  2HSM B;  1XVW A;  2HYX A;  3BJ5 A;  2CVK A;  1EV4 A;  4TR0 A;  4GTU A;  2FY6 A;  4ILF A;  3UIW A;  4N0V A;  2HZF A;  3TKS A;  2DKH A;  2IN3 A;  1Y1U A;  3KJY A;  4RI7 A;  1F3B A;  2JAC A;  1F6M C;  4K7O A;  2YWM A;  4GSS A;  2B6M A;  1XPV A;  3CTF A;  4XCS A;  3P7X A;  2FCH A;  3D5J A;  1HNA A;  2LTK A;  2H0G A;  2QGV A;  3KXO A;  2H30 A;  5JCU A;  5DCH A;  2FLS A;  2IFQ B;  5G5E A;  1AIU A;  2X8C A;  4K9Z A;  2WDU A;  3CXG A;  1WRY A;  1GSY A;  5JWO B;  3US3 A;  3O3T A;  1ZYP A;  2YJH A;  5IMC A;  2B7K A;  2HRN A;  1E6B A;  4EF0 A;  1OE7 A;  2PPT A;  4FO5 A;  1EEJ A;  2J23 A;  1XZO A;  1B8X A;  4TR1 B;  1XXU A;  4WXT A;  2DKI A;  2FWG A;  3A5I A;  14GS A;  2YWO A;  4V1A g;  2VL2 A;  4K0G A;  1JHB A;  3UOM A;  22GS A;  4EC0 A;  5HQP A;  1E2Y A;  4E8E A;  3HXS A;  3M1G A;  3GH6 A;  2MMN A;  4K7I A;  1BF5 A;  3VFI A;  3M8N A;  5KEJ A;  4IGJ A;  1LU4 A;  1NHO A;  3EIN A;  1Y25 A;  3QFB C;  3IHG A;  3UVT A;  1THO A;  4I97 A;  4O7H A;  3E3E A;  4LMW A;  4YQM A;  2B5Y A;  3GV1 A;  3PR8 A;  3LOR A;  1K3L A;  4KCA A;  2MYG A;  4GQF A;  4G10 A;  2HSY A;  2VD1 A;  4OMV A;  1ZZY A;  3G7J A;  4JE1 A;  2JZS A;  5HFK A;  3ZIT A;  2ZCT A;  1TOF A;  4HU7 A;  2JU5 A;  1A8Y A;  3D4M A;  4KND A;  5CRD A;  1N25 A;  1RQM A;  2FWE A;  5G2Z A;  1GRX A;  1SVO A;  2HRA A;  2X64 A;  5IMF A;  3DVX A;  4JU5 A;  1A2L A;  13GS A;  3FR9 A;  5CRW A;  2H0H A;  3E0U A;  5IOW A;  3Q19 A;  3A5W A;  1XWB A;  3IDV A;  6GSV A;  1TRU A;  4V1A p;  2HE3 A;  4L8E A;  3LFL A;  3CSJ A;  2DMM A;  2HSN B;  1TRS A;  4ID0 A;  3BCK A;  3IC8 A;  1A2J A;  4LL4 B;  4O5R A;  3HYP A;  3EYT A;  1V2A A;  2PWJ A;  2IMD A;  3IA1 A;  3H79 A;  2L6C A;  2V41 A;  5G1L A;  3UMA A;  2ES7 A;  1M9B A;  5A34 B;  5G5F A;  5DJL A;  1GSS A;  3WT2 A;  2B1L A;  4BL7 A;  3MSZ A;  5HR0 A;  2OE3 A;  4HQS A;  3TJG A;  1B4Q A;  1X5C A;  1R5P A;  1XIY A;  2EFC A;  2YV7 A;  1XOA A;  3TB2 A;  3KP8 A;  4QQ7 A;  4K0N A;  5FT3 A;  5DAK B;  2WFC A;  3ZLP A;  2CVD A;  2HRK B;  2H1G A;  2DJ0 A;  3TKS E;  16GS A;  2DSA A;  1EP7 A;  3VPT A;  3KTL A;  1SKR B;  2V1M A;  3LJR A;  4RI6 A;  1OKD A;  3L9U A;  5BMU A;  4KF9 A;  2NDO A;  3M9K A;  5CP1 A;  1T3B A;  4AKG A;  2A4H A;  2IPA A;  3VWV A;  4MZW A;  1O85 A;  3F6F A;  4KW6 A;  3IC4 A;  2LS5 A;  4ZL8 A;  2I1U A;  3RPP A;  4FH8 A;  2E7P A;  3GHA A;  4MA9 A;  3H4K A;  4NWY A;  5IMA A;  3C73 A;  5A5H A;  1G7O A;  1SJZ A;  2OE0 A;  5BRT A;  2HZE B;  3ME7 A;  3HVS A;  4HI7 A;  2VUP A;  2GQL A;  3D0Z A;  3H93 A;  1PKZ A;  2G2Q A;  2YAN A;  2C0E A;  2PUK C;  4V2M A;  4GSN A;  5B8B A;  3LYP A;  5CNW A;  1EGO A;  3ED3 A;  4AI6 A;  3DGQ A;  1MDK A;  4IQ1 A;  2AUV A;  4L5O A;  3KMN A;  2DJ3 A;  1SVL A;  2OAD A;  3WGX A;  4HDE A;  1K0C A;  2KP2 A;  1DSB A;  2PBJ A;  2VM1 A;  4GLT A;  1BAY A;  1M2D A;  2B5E A;  3RDW A;  2CQ9 A;  2C3T A;  2YN1 A;  5D73 A;  3BOA A;  7GSS A;  1OVN A;  5ECI B;  1K0O A;  1OKT A;  2O85 A;  3UBL A;  2GVP A;  4PQ1 A;  5J4U A;  1WE0 A;  1HQO A;  1SJ6 A;  4MJE A;  3VI7 A;  2NBS A;  4GQC A;  3G7I A;  4ZBA A;  2H75 A;  4XRA A;  1GSE A;  1Z6M A;  4CHS A;  1THX A;  2I9H A;  3F3Q A;  3VPQ A;  2GQM A;  1XOB A;  1SVM A;  3KZQ A;  4WF4 A;  2MBT A;  1DE2 A;  5A4V A;  3EUR A;  4ICY A;  2G0F A;  1GSF A;  4K2X A;  2Z9S A;  2ALB A;  3A3T A;  4JRR A;  2GSS A;  4GF0 A;  4OO4 A;  2YCD A;  3H1N A;  4F0C A;  5IPH A;  4DSR A;  3LEF A;  3ZRD A;  1GP1 A;  2EFD A;  4FQU A;  4V2N A;  4XS4 A;  5J4V A;  1WOU A;  1JZD A;  3C71 A;  4HZ2 A;  2WJU A;  4KGI A;  4F9Z A;  6GST A;  1HNC A;  5AIS A;  3QAW A;  2LNS A;  5ENU A;  1FW1 A;  1TI1 A;  1YZX A;  1GTA A;  3IAS 2;  1GSQ A;  1T4Y A;  3FK8 A;  3KEB A;  1K0M A;  1HNB A;  4K1F A;  2EFE A;  1ERT A;  2OAC A;  4EDY A;  4AKX B;  2OT3 A;  2P0G A;  3IV4 A;  4O92 A;  5ECN B;  4OD7 A;  4ZIL A;  1XW9 A;  2DJ2 A;  2R0G A;  2QSI A;  3VWX A;  1GTB A;  2QA1 A;  4KX4 A;  4MJA A;  3BBY A;  2X8H A;  19GS A;  4GCI A;  3HY2 A;  3E9J B;  1T7P B;  3KMO A;  1Q4J A;  1O7U A;  4MJC A;  3QCP A;  4JED A;  4G9H A;  3RBT A;  5ELG A;  2XPD A;  4HJM A;  2N5F A;  4HU9 A;  2O8V B;  2L4C A;  4MP4 A;  2H0I A;  2L59 A;  4BPY A;  3M3M A;  4WF5 A;  2LJA A;  1QGV A;  1S3C A;  4ML6 A;  3CSH A;  3F4T A;  5D9W A;  4TXO A;  3G9B A;  1ZL9 A;  3HJO A;  4ZBD A;  3MDK A;  4JR4 A;  1HYU A;  3KIJ A;  3DIE A;  5F06 A;  3KGK A;  3EC3 A;  3DRN A;  2VO4 A;  3ZZX A;  1SKW B;  2H72 A;  5CRG A;  3I69 A;  4KAE A;  3FRC A;  4XTS A;  5IO2 A;  2HSH A;  1G6W A;  2OBK A;  4ZB7 A;  2MZC A;  5F07 A;  4P3Y B;  1A0R P;  1AC1 A;  4EO3 A;  2GZZ A;  4ZB9 A;  2XC2 A;  5G31 A;  5JCG A;  2VAF A;  2R4V A;  4CW9 A;  2O7K A;  2F9S A;  3L9V A;  5CRE A;  4EXJ A;  5KN0 A;  1WMJ A;  4EUY A;  1O81 A;  1ZYE A;  2H73 A;  2AHE A;  1NM3 A;  5GSS A;  3J7Y k;  1WIK A;  2J9H A;  2N5B A;  4TRX A;  1G7E A;  3GRX A;  3PGT A;  4AJ6 A;  2LJR A;  8GSS A;  1EP8 A;  5D96 A;  1KBN A;  1VGL A;  3GIX A;  4O32 A;  3O6T A;  4F03 A;  1SYR A;  5D9V A;  2V6O A;  1ZCP A;  1ON4 A;  1TK5 B;  2YNX A;  1FAA A;  3IXR A;  4J57 E;  3UVH A;  1MD4 A;  5J9C A;  3ZVJ D;  2JSY A;  3ZIV A;  3L0H A;  2OE1 A;  3LQ7 A;  5C04 A;  2H76 A;  1SL0 B;  3W8S A;  4OCE A;  3SBC A;  4KCE A;  3U6V A;  4EIP A;  2YP6 A;  2DJ1 A;  1JLW A;  3EE2 A;  1URM A;  4DSS B;  2IJY A;  1V9W A;  4K5S A;  2H6X A;  1GL8 A;  2BTO T;  2EFH A;  3DVW A;  1ILO A;  3MAK A;  2MMA A;  2FNO A;  3F4R A;  2HRF A;  1OAZ A;  1W89 A;  5EL8 A;  4IVF A;  4NXI A;  3TKR A;  4TKY A;  4TVE A;  5J9B A;  1VRS D;  4KDY A;  2TIR A;  4N0Z A;  1PL1 A;  4XHM A;  1PX7 A;  5A4W A;  5J3R A;  2X4A A;  1QK8 A;  5GAN D;  4KE3 A;  4CY6 A;  3GUR A;  2LRN A;  4BVY B;  1PN9 A;  5A1N A;  1TU7 A;  1NW2 A;  1YEP A;  2FA4 A;  1XWC A;  2H1D A;  1O73 A;  4Z2R A;  1MDI A;  5KN2 A;  3DML A;  4YAV A;  4LA1 A;  4BVX B;  2I81 A;  2H74 A;  4O5U A;  3PIN A;  4MNN A;  4RUV A;  3LYK A;  3F3R A;  3GST A;  2O5V A;  5ECP B;  3F0I A;  1AXD A;  2GS3 A;  2H1B A;  2PN8 A;  5AIV A;  1R7H A;  4KUN A;  1H75 A;  1BQ7 A;  4ACS A;  2P5Q A;  2UZ8 A;  1IYI A;  2CZ2 A;  3DYR A;  4YKF A;  4YQV A;  3QAV A;  3GKK A;  5IMZ A;  3TRQ A;  4PXO A;  5G1K A;  3D21 A;  1ZYQ B;  4USS A;  4TOP A;  2QKE A;  1G6Y A;  2C80 A;  2YPM A;  3WGD A;  1GUL A;  2RM6 A;  2O87 A;  5D9T A;  4A5P A;  3NZN A;  4K2D A;  4BA7 A;  4MAB A;  1XW6 A;  4NV2 A;  2VL9 A;  4WKW A;  1X0R A;  1BX9 A;  5ID2 B;  3RHB A;  3FKF A;  4YH2 A;  2R2J A;  1FB0 A;  2VIM A;  2DIZ A;  1CQG A;  1OC9 A;  5ECL B;  1YY7 A;  4XS6 A;  1DE1 A;  2RUF A;  2JL4 A;  2LUS A;  3LSZ A;  1K0B A;  1UC7 A;  1ERV A;  2JZT A;  2DC5 A;  4MZC A;  3V1W A;  4KSO A;  2ZNM A;  4K8M A;  3N9J A;  4HS1 A;  1X9S B;  2HT9 A;  2YV9 A;  5ECO B;  1RW1 A;  3BCI A;  2JZR A;  3D6I A;  3ERF A;  3HJM A;  3LXZ A;  5B8A A;  4BWQ A;  4KDX A;  1PD2 1;  3VUR A;  1NSW A;  1QUW A;  2VCV A;  4WEY A;  1GUK A;  2L4Q A;  2BMX A;  5HR2 A;  2WUL A;  4AGS A;  4FYC A;  4Z2U A;  3HA9 A;  3RPN A;  4NAX A;  4PUF C;  4D73 B;  5LNK e;  1PSQ A;  5ABR A;  2RM5 A;  1U88 A;  1C72 A;  2M80 A;  1YVL A;  3GTU B;  2GST A;  2NPB A;  5KOW A;  1N8J A;  2I3Y A;  3CMI A;  3IPZ A;  3EU3 A;  3TKS C;  2DLX A;  1T00 A;  1MDJ A;  11GS A;  1TRW A;  3VLN A;  5A4U A;  1AUC A;  3G7Y A;  6GSS A;  2M72 A;  5DDL A;  1Z6N A;  2YJ7 A;  2VCQ A;  1ZMA A;  1PX6 A;  3GSS A;  3L9S A;  2CAQ A;  5DCG A;  2GT6 A;  1Y6E A;  5J41 A;  4MJB A;  3IK7 A;  4X1U A;  5DAL B;  3U5R E;  2KP1 A;  2IMF A;  2E0Q A;  3QMX A;  3FR6 A;  3HVV A;  3A2V A;  1MTC A;  5KN1 A;  1TK0 B;  4AJ8 A;  3C1R A;  2IMK A;  2GZY A;  4N11 A;  2HSM A;  2C0D A;  2JSZ A;  1K3O A;  3CBU A;  1K0A A;  2FHE A;  5HR3 A;  1K3Y A;  1NHY A;  3FW2 A;  1X9M B;  1YQ1 A;  4Q5N A;  2PGT A;  1VF3 A;  1QMV A;  4L0W A;  3GN3 A;  5COH A;  6GSX A;  1U3A A;  2H19 A;  1I5G A;  2QC7 A;  6GSW A;  4Z7X A;  3TOT A;  3UJ1 A;  4IP1 A;  1U6T A;  2AV4 A;  4XS1 A;  1TW9 A;  2R5G A;  4POK A;  4CDO A;  1B9Y C;  5J5N A;  5GST A;  1WJK A;  2IFQ A;  3HHV A;  1OC3 A;  3R2Q A;  2REM A;  3ZYW A;  18GS A;  12GS A;  4HEA 2;  3ERW A;  4POL A;  1TXX A;  2D2Z A;  2X99 A;  4TR1 A;  2I4A A;  5INY A;  1EOG A;  1U3I A;  1BED A;  2F8F A;  2CA8 A;  1YF1 A;  4BWS A;  1FOH A;  1WWJ A;  4TN8 A;  3FZ9 A;  1UN2 A;  3ZMK A;  3L4N A;  3HZ4 A;  1O8W A;  4LMV A;  5D8I A;  4J2F A;  3DD3 A;  4ZL9 A;  1G0T A;  10GS A;  1SK2 A;  4RQX A;  2V2G A;  3F4S A;  2C3N A;  1A23 A;  2H66 A;  1SD8 A;  1EEM A;  4V2L A;  4MH3 A;  1SL2 B;  4KB3 A;  4POB A;  3GX0 A;  2PER A;  3IBH A;  1A8L A;  2CX3 A;  3J7Y b;  4W66 A;  2H1A A;  2P31 A;  4AF2 A;  2K8S A;  3UL3 A;  2K9F A;  2VLV A;  5FWG A;  1GTU A;  4AKH A;  1V57 A;  4WET A;  3JCM L;  1YEX A;  4ZBB A;  1SU9 A;  5F8B A;  4ECC A;  3VWU A;  3GFK A;  3W6G A;  4N30 A;  5JWQ B;  4MF6 A;  3ZL5 A;  1USB A;  2B5X A;  2IIY A;  2VM2 A;  4ISD A;  2HSN A;  2H6Y A;  3C8E A;  1LJR A;  1F2E A;  3K8N A;  3GMF A;  3TJB A;  3PH9 A;  3ZTL A;  3F6D A;  3IK9 A;  4X0X A;  5IPG A;  3S9F A;  4F0B A;  3R3E A;  5A5K A;  4NHW A;  2H70 A;  3D22 A;  2YZH A;  1Z9H A;  5F0G A;  2LQQ A;  5A34 A;  1F9M A;  4IJ3 A;  3LWA A;  4IP6 A;  1TK8 B;  2E2M A;  1ERW A;  3I6A A;  2PVO C;  2AAW A;  4RQR A;  1FVK A;  2GLR A;  5AGY A;  2DJJ A;  3UAP A;  5DAK A;  5HFI A;  2IMI A;  4DVC A;  5IO0 A;  3P90 A;  2HRK A;  1WPI A;  3L78 A;  3FYG A;  5C00 A;  1EGR A;  1BG1 A;  5JWR B;  3QD9 A;  1K0D A;  1MD3 A;  3ZRE A;  5DJM A;  4I2U A;  1VF1 A;  1TP9 A;  2DML A;  3P2A A;  5EPF A;  5H5S A;  2KLX A;  1PMT A;  1TI3 A;  3Q6O A;  4IHU A;  2CV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...