5ECOB

Crystal structure of fin219-fip1 complex with ja, leu and mg
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transferase
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 65
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecoB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecoB01
1SK0A 2HSYA 1EEJA 3FR3A 2REMA 4V2NA 5G1KA 3H8QA 3LYPA 1U3AA 3ME8A 1AW9A 2GGTA 2YJHA 3RBTA 2H1BA 3VFIA 4EKZA 4GSSA 1QK8A 3K8NA 3IBHA 2F8AA 17GSA 3LEFA 1GSFA 4RI6A 3IDVA 5J5NA 3VURA 5B8AA 3LQ7A 3FZAA 5CRWA 3EURA 3W6GA 5G2ZA 1LBKA 2GQMA 2N5BA 3VPQA 1H75A 3TKRA 1BX9A 1XWGA 5IOXA 3FY7A 1ZOFA 3KJYA 4PX1A 2ZCTA 3Q19A 2KUCA 4WR5A 4ECCA 3QMXA 1R4WA 4EF0A 1ZYQB 4OD7A 4RUVA 2CVDA 1C72A 2NPBA 1OVNA 4MJCA 3IA1A 2GZZA 1GSSA 4MCUA 1AAZA 3UBKA 2P31A 3DVXA 1W89A 1TRVA 2CX4A 1HNBA 4QQ7A 3LGCA 3M9JA 3G9BA 3KP9A 6GSVA 2LRTA 4OO4A 2EC4A 2JU5A 4NPBA 3ZMKA 5CREA 2YWMA 1LJRA 2YWIA 3G7IA 5L71A 3PPUA 1TK8B 2KP1A 4LL4B 1EV9A 3TJBA 4WKWA 5HFKA 2HRNA 1NHYA 4MZCA 3VI5A 3DEXA 5CYYA 1PA3A 3ME7A 4GSTA 2I1UA 1J9BA 1XBSA 4KH7A 4F0CA 1FAAA 4ACSA 4BPYA 3GKMA 4JBBA 3HHVA 4EUYA 3OR5A 4ZXGA 3ZFBA 2IFQB 1KTEA 3ZRDA 3TRXA 5GAND 2FLSA 3M1GA 3DIEA 1U88A 5D9WA 3F63A 3P2AA 4ID0A 4G0IA 5J4UA 1FG4A 4F03A 3IV4A 1XW6A 1F6MC 4HZ4A 1M2DA 2H6ZA 1XVWA 5DALA 4L0UA 3GV1A 4YAPA 1V57A 1X5EA 5JWQB 3FKFA 2X64A 4WXTA 4KAEA 4KCEA 1YF0A 3D4MA 1TOFA 1OC9A 2RUFA 4MJEA 5FHIA 5EPFA 3C71A 2O8VB 5D8IA 2HQTA 5ECLB 3CSJA 4P3YB 3P90A 4Q5FA 3QR6A 1K0NA 2J23A 3US3A 1UVZA 2IPAA 4WF4A 3TJGA 2L59A 2AUVA 5AGYA 4KDUA 2L5OA 3GYKA 4MLYA 2B6MA 4KSMA 1RQMA 1A23A 2HZEB 2G2QA 5DDLA 1IYHA 3WD6A 2CAIA 2KHPA 3QAWA 1GSYA 5D9TA 5ID2B 2MMAA 1AQWA 2BMXA 1M9AA 3GX8A 3R2QA 1EGRA 10GSA 3M8NA 1PL2A 4HQZA 3ZVJD 1S3CA 2K8SA 5JWRB 1WPIA 4Q5NA 1WIKA 4PTSA 1Q98A 4FO5A 2FHEA 5IMCA 2YANA 3FR9A 3HD5A 4TVEA 4ECIA 3IK7A 2F8FA 2H1GA 2H74A 1OKTA 2XC2A 4J57E 4EE0A 3MAKA 1MD4A 2WJUA 1JHBA 12GSA 4ML1A 1VF4A 5F05A 1Z9HA 3VWUA 1GNWA 2HT9A 1USBA 1J0FA 5D73A 2GSTA 4HUAA 4X1UA 2H1DA 2VD0A 1SK2A 5F8BA 2H0HA 3IE3A 4GLTA 2LNSA 4POBA 4CW9A 1FVKA 1ON4A 4JU5A 4BVYB 2MZCA 1SD8A 2JZTA 5HR1A 1CQGA 2OBKA 5B7CA 4G10A 1UC7A 1TJDA 14GSA 1RK4A 5INYA 2PU9C 4RQXA 2VL3A 3TUEA 3F4TA 3F4SA 1TU7A 3WGXA 2K8VA 3CTGA 4LL1B 2EIRA 1G7OA 3ZYWA 3VK9A 5HFIA 2L57A 3VWVA 4PGTA 2B5EA 3H1NA 3LFLA 4MMMA 3CTFA 5H5RA 5B6MA 5AISA 3UIWA 2GVPA 2PPTA 2M80A 1A8YA 1NHOA 1OKDA 3L9SA 2H1AA 3UJ1A 4GXZA 1MTCA 1V2AA 3F3QA 2V1MA 1T1VA 2HSMA 2L4QA 1SJ6A 3QDNA 1WP0A 1EV4A 2RLIA 1U3IA 3KMNA 2H70A 2B5YA 4I2TA 2WGRA 5GZZB 3V1WA 8GSSA 1XPVA 3I9V2 3F8UA 4OWYA 5HFGA 3RHBA 1R5AA 3UMAA 1K0AA 2P5RA 2WFCA 1XWBA 2VM2A 4K6XA 4MZBA 2HRAA 5GSTA 5G5FA 3M9KA 4BL7B 3C73A 3J7Yb 1VF3A 4MA9A 5IPHA 1EEMA 2HFDA 1Z5YE 3J7Yk 5DJLA 2HZEA 2VCWA 1TI1A 4K7NA 2FWEA 2VCZA 5KN1A 2B5XA 3ZZXA 1OE7A 3APSA 1MDKA 2GT5A 2UZ8A 3ISOA 1G6WA 3A3TA 5ID2A 3IC8A 1SJIA 2YOIA 1AXDA 3DMLA 1TP9A 2L4CA 4D73B 2J9HA 4F0BA 4JZQA 16GSA 3ZFLA 1WOUA 2DJKA 4KW6A 1A2MA 2WULA 3C7MA 1EOHA 3LWAA 1TRSA 4DEJA 1M9BA 2YP6A 3D5JA 3HJMA 4OFNA 2PERA 3GKKA 3UL3A 2AYTA 4WBRD 1GTAA 3TKSA 2F9SA 3L4NA 2IIYA 3UARA 3IXRA 1PRXA 5ECPB 2LNTA 1T8EB 2IMIA 3HY2A 1SJZA 2QSIA 3KTLA 2R4VA 1N8JA 3RPPA 4GQCA 4BVYA 3QCPA 2OACA 1BQ7A 2FNOA 3ZLPA 3CXGA 1PSQA 3GL5A 1A2JA 3PH9A 2P5QA 5D93A 4OCEA 1H4OA 3ZTLA 5GAPD 3GHAA 4HOJA 2YNXA 1GWCA 1TRWA 7GSSA 3APQA 3F3RA 4G0KA 2NBSA 1T00A 1PD21 2V6OA 3QPMA 1THOA 2KP2A 4K7IA 4HDEA 4JR6A 3FR6A 1X9MB 4KNDA 3UVHA 1GH2A 4N0VA 3BBYA 2HI7A 2CX3A 4KA0A 2GZPA 4K7OA 2DMMA 3KXOA 3FEUA 2BTOT 3HYPA 2YWOA 2V41A 1FOVA 1JLWA 4ZIJA 2NVLA 3G7JA 3UVTA 1Z3EA 2YCDA 1WE0A 1TTZA 3GN3A 1PN9A 5LNKe 1GUKA 2HRFA 4GQFA 3C1SA 1ERVA 1TK0B 3KP8A 1WMJA 4TR0A 1TXXA 1G7EA 5IMFA 1PL1A 4LMVA 1XW9A 2A2RA 1AUCA 2C4JA 1O7UA 2E2GA 4IELA 1OAZA 2DLXA 3PGTA 1ERTA 2XPEA 2DIZA 1XIYA 2CT6A 2X8GA 2YN1A 3UOMA 2NDOA 1A0RP 4KB3A 3LJRA 11GSA 2HYXA 4IW9A 1QGVA 3IC4A 2OADA 4TR3A 2C3TA 4GWRA 2I81A 1Z7RA 1OYJA 3KTBA 5C04A 2HRKB 4GSNA 2LV3A 5J9CA 4EO3A 4D73A 1MEKA 1T4ZA 1JZWA 1YKAA 1HD2A 1GTBA 2X99A 4XS1A 3ZIVA 3LG6A 3UAPA 2MMZA 3VWWA 2XBIA 3SBCA 1YZXA 5HR3A 2I4AA 1TU8A 3D21A 2HE3A 2H8LA 5FWGA 5E4WA 5KN0A 5DAKB 5IPGA 4TW5A 5F07A 3IOSA 1A24A 4TOPA 3GKNA 3C1RA 3HVVA 3CBUA 5DVBA 2PVQA 5DQSA 5ECHB 3TJKA 3HJOA 2QKEA 1BJXA 2K18A 5ECMB 4HS1A 4XS4B 4EC0A 2LJRA 4TN8A 4ZL9A 1F3BA 1SD9A 4G2EA 1EP8A 2N5AA 1SL2B 2GZYA 4BWSA 4NXIA 4O32A 1A0FA 3EU4A 1K3YA 1ZYEA 2R2JA 4IQAA 4AF2A 3FZ5A 2PMTA 1RW1A 1YKCA 3VPTA 6GSXA 3BOAA 1JZRA 5HR2A 1ILOA 3S9FA 4Q5QA 1ZGNA 2GS3A 2C80A 1G6YA 18GSA 1ERUA 4KE3A 1BYEA 2DBCA 4POKA 1QQ2A 4MABA 6GSWA 2OE1A 3I43A 3WT1A 1PGTA 2WB9A 5J9BA 2A4VA 3U5RE 2B1LA 5ECKB 4N10A 4FYBA 2PGTA 3UEMA 2RUEA 4MDCA 3Q6OA 1G0TA 3MNGA 5JCWA 1TW9A 3I6AA 2AB6A 2ES7A 1M2BA 3TRQA 3EC3A 3RAZA 1IYIA 2F3MA 4KF9A 4L0WA 2Z9SA 4PUFC 2DJJA 4OO5A 2V32A 2OJLA 4Z7XA 2FA4A 2GLRA 3KGKA 3MWHA 3MDKA 1S3DA 3HVSA 3PR8A 4MPGA 3VLNA 3IPZA 2R37A 3AY8A 2LRCA 2H30A 2CAQA 3LORA 4USSA 2IMFA 3GURA 2DJ2A 3NZNA 2LTKA 2WS2A 2C3NA 5EL8A 2ALBA 4I5QA 2L5LA 2VUPA 4EXJA 4KDXA 4HU7A 4G19A 1M2AA 1URMA 4HI7A 6GSTA 1M99A 2IL3A 1FW1A 4IN0A 3GKXA 4ISDA 3FRCA 2IMEA 3O6TA 1QFNA 4IKHA 4WR4A 4WEYA 2HRKA 4TXOB 4ZB8A 5B8BA 2MBSA 1ZL9A 1TKDB 4MF6A 3N9JA 3WT2A 3TKQA 3TRPA 4OFTA 1HNCA 4PNGA 3TCOA 3WYWA 4EDYA 1K0CA 1K0DA 1FHEA 1GUHA 5DAKA 1UA5A 4YH2A 1F9MA 2A2SA 4MF7A 3L9VA 3R3EA 4ZBBA 5ELGA 1I5GA 2DC5A 4PQHA 3L0HA 1ST9A 2FWHA 2H75A 3TKSE 4L5LA 2LJAA 4XS4A 1YEXA 4N0ZA 5CNWA 1GNEA 4IP6A 1TK5B 4E8HA 4MJBA 3HVXA 3QFBC 2ON5A 1HNAA 3FW2A 2V6KA 1B48A 4PNFA 3HDCA 4Q5RA 3F0IA 1T7PB 5HQPA 2IFQA 1GSDA 1O85A 3EU3A 3HJPA 5IQYA 1GUMA 1SKWB 5HR0A 2LKUA 2YWNA 1UN2A 3GL3A 3VWXA 5ELAA 5CRDA 4K0NA 2QGVA 4EL1A 3ZVJA 3DYRA 1EGOA 1V58A 3FK8A 2L6CA 4GRFA 1YF1A 1Z7PA 4K1FA 1VGLA 3N5OA 1XOAA 2H6XA 4AJ7A 4N11A 2C0DA 4POMA 2V2GA 1JFUA 1F2EA 2RIIA 2XPDA 3CMIA 1K3OA 5EVOA 3RPNA 2I9HA 2DMLA 1K0OA 5A4WA 1U87A 3A5WA 1E2YA 3GH6A 1B4PA 6GSUA 2VLVA 4RQRA 3ERFA 3TOUA 2DJ1A 3GSSA 3GTUB 1CQHA 3TGZA 3HZ4A 2FD3A 4V2LA 3E3EA 4TR1B 3BCIA 1GSEA 2R3XA 5IMAA 1XVQA 1DBYA 2YZUA 2EIOA 3EE2A 2H6YA 2LEGA 1GSUA 4XHMA 1GL8A 4CDOA 2CVKA 4GCIA 4NAXA 2AHEA 5ECRB 1PQNA 4HJMA 4XS6A 5G1LA 1X9WB 2CVBA 4ZB6A 5AIXA 2IMKA 1HYUA 2JACA 2OE3A 1FO5A 2GSRA 2OA7A 5J41A 3QD9A 1ZCPA 5H5SA 2VCQA 3GH9A 4TXOA 5IO2A 4ILFA 4JR4A 1XZOA 2MBTA 2DJ0A 4X0XA 1ZMAA 4L5OA 5BMUA 5JCGA 2TIRA 4HU9A 3JCML 3D4TA 1B4QA 5DBQA 1Z6NA 4NWYA 1XXUA 3O3TA 2B3SA 3FZ9A 1ACVA 2LSTA 2GT6A 2H66A 4NHWA 4G0LA 3GIXA 1XW5A 4QL9A 5C00A 4MK3A 1X5CA 1WJKA 1KNGA 1OC3A 2FUG2 2OBIA 1JLVA 3GSTA 2QC7A 2YV7A 3TKPA 5ENUA 4ZL8A 1M0UA 4MH2A 2PVOC 2CV4A 2VL2C 1MDJA 2FWGA 3SWLA 1V9WA 2OE0A 1XWAA 1GTUA 5KN2A 3APOA 3LSZA 1O8XA 2GDRA 5A5KA 5DALB 3LXZA 2H19A 4HZ2A 5G5EA 1EZKA 3EMPA 1S3AA 2GSQA 4DSRA 4RI7A 2B7KA 1ABAA 4ZBAA 5J3RA 3F4RA 1OC9B 2AJQB 2JSYA 2L6DA 4ZILA 2IMDA 3KD0A 1V98A 4OMVA 5A4UA 4O5RA 2GTUA 2YZHA 4ECBA 5IM9A 5D96A 3H4KA 3EWLA 3DRNA 3GX0A 2CQ9A 1SK1A 5G30A 1GTIA 1F3AA 3FHKA 4WF5A 1MDIA 3WGDA 2RM6A 3DVWA 4BL7A 5IOWA 4V1Ag 1PMTA 3ZL5A 2KLXA 2VIMA 2C3QA 3GTUA 1OC8A 1PX7A 4F82A 4TR1A 4I97A 2MYGA 3MSZA 3M0FA 3F6DA 3Q74A 1W4VA 2KOKA 1GRXA 2WZ9A 3L9UA 1E6BA 3HXSA 3CSHA 4EDZA 3M3MA 3E9JB 4N30A 1Q4JA 4OFMA 3CYNA 2LQOA 1THXA 19GSA 4PQIA 1GP1A 3HKRA 4K8MA 1BEDA 9GSSA 4O92A 4IP1A 5DQYA 2JL4A 2AAWA 3P8WA 4XRDA 1SYRA 4ULXA 4IBPA 2X8HA 1NM3A 4MH3A 2VCXA 1PKZA 3QOUA 1VF1A 2YJ7A 2CA8A 1YY7A 4FIWA 1XCCA 3IAS2 4MJAA 2MMNA 1T4YA 1FB6A 1SKSB 4F2IA 4J2FA 5ECSA 1ML6A 2H76A 3IHQA 3KIJA 3EINA 1GLPA 3QFAC 2HLSA 2IWTA 1A2LA 4PXOA 4XCSA 4LLRA 4MP4A 3D6IA 4MPFA 2E2MA 1DSBA 1Z6MA 3TOTA 5EY6A 4HEA2 1XWCA 1N2AA 1ZZYA 1O6JA 2GQLA 2ON7A 4TRXA 3D22A 3IR4A 2FWFA 4NMUA 4BVXB 1YJ6A 4O7HA 4NHZA 3A2VA 5E59A 4LMWA 3KEBA 4FQUA 1YEPA 5DCGA 2R5GA 2DSAA 1Y25A 1I9DA 5JCUA 2AV4A 2E7PA 2HSMB 3ZMLA 5D9VA 22GSA 2HXKA 1O73A 1WRYA 3IRAA 2H01A 1AC1A 4JRRA 1NSWA 4IJIA 5D9XA 5JWOB 4HQSA 2M46A 5ABRA 4ECJA 1F37A 3KM6A 2N5FA 3LXTA 5IO0A 4IQ1A 4J56E 3BJ5A 2VLTA 1DUGA 3RDWA 1XFLA 1DE2A 3TB2A 5IMZA 5COHA 3TDGA 2MMOA 6GSYA 3DKSA 2EIQA 4HJ2A 3KZQA 4K2DA 2ZUPA 2B7JA 1DE1A 2C8UA 3FYGA 1SU9A 1PKWA 3H93A 4DSQA 2VCTA 2DJ3A 2C0FA 1FVJA 5F06A 2VL9A 5GSSA 4PQ1A 1WWJA 2PWJA 2WRTA 5IMVA 2X8CA 2WDUA 1X0RA 3HZ8A 4GF0A 3A2XA 2GSSA 1O8WA 3KCMA 2C0GA 4K0GA 2CZ2A 1MD3A 3C8EA 1XOBA 4POLA 2VOCA 3G7YA 4G9HA 4FH8A 1OE8A 3NIVA 3WGEA 4IVFA 4XTSA 6GSSA 3DXBA 2O7KA 4IS0A 3ERGA 4I2UA 3TJFA 5DJMA 1B9XC 2FCHA 2PUKC 3BCKA 3O76A 4DVCA 2LUSA 1KBNA 5H5QA 1SENA 4PURA 4NV5A 4BA7A 5IMDA 2LQQA 4TXVA 2HNLA 3QAVA 5CP1A 4V2MA 2B1KA 3KMOA 4WETA 4L8EA 1QMVA 3Q18A 1QXHA 3A2WA 1VF2A 3IK9A 2VLUA 1R7HA 4JE1A 5B6NA 2JSZA 4ZB9A 3I69A 1K3LA 2PBJA 5CAXA 13GSA 3EVIA 1A8LA 3ED3A 3BD2A 2ZNMA 1TDIA 1X5DA 5AIVA 1BAYA 5FT3A 5CO3A 3DD3A 4FYUA 3VI7A 3P7XA 5F0GA 1AQVA 3F9UA 5KN3A 5ECOB 1O81A 1GLQA 4MZWA 1SL0B 1R5PA 4BWQA 3W8SA 2DIYA 1JZDA 4DSSB 3U6VA 4KCAA 2LJKA 1K0MA 3D0ZA 2JZRA 2XHFA 4BVXA 3RHCA 4IGJA 4GTUA 2R6KA 3DGQA 2F51A 4OCFA 5AN1A 2K6VA 2O87A 4TKYA 4KX4A 4I6XA 3TJJA 5A4VA 3HCZA 3ZITA 4MF5A 4AGSA 5KEJA 1BG5A 3IAM2 3KH7A 2JZSA 3CSIA 3EYTA 1Y6EA 2FGXA 2LRNA 2M72A 4AJ8A 1SKRB 1V40A 4FYCA 1B9YC 3CRTA 5ECNB 2O85A 2VM1A 4ML6A 4I8BA 4TR4A 1SL1B 5LCZA 2RM5A 2H0IA 1GSQA 3CRUA 5CRGA 4NV2A 2TRXA 3GUSA 4F9ZA 1VRSD 2BJXA 4KUNA 3H79A 4IHUA 3GNJA 1AQXA 5LD0A 4KSOA 4YQVA 4KDYA 2G0FA 2HZFA 5DCHA 2VD1A 2H72A 1PX6A 2VO4A 1AIUA 2O89A 3ERWA 1GULA 3ZIJA 2CZ3A 3W8JA 2LS5A 1TI3A 4YQMA 1K0BA 2IN3A 3F6FA 3TKSC 3QAGA 2PN8A 2H73A 2P0GA 1R26A 3L78A 5ECQB 4E8EA 4AJ6A 4H86A 2D2ZA 2VCVA 3ZREA 1QUWA 2H71A 2C1YA 3DWVA 4EVMA 4QL7A 3GMFA 1FB0A 5CRHA 2TRCP 4KGIA 1SYXA 2I3YA 1X9SB 3FZ4A 1YQ1A 3PINA 1HQOA 4YAVA 1ERWA 1J08A 4IJ3A 1U6TA 1LU4A 2XBQA 4V1Ap 3HA9A 1KEBA 3KH9A 3UBLA 3GFKA 1T3BA 3GA4A 5IIZA 4CHSA 3NOFA 2FA8A 2FY6A 3EMXA 1EWXA 4XRAA 4YQUA 1NW2A 4WBJA 2HSHA 2K9FA 2YV9A 5ECIB 5G31A 2VAFA 3LYKA 1JZOA 4ZBDA 3E0UA 2WCIA 4K9ZA 2YPMA 4X43A 20GSA 1M7TA 2JADA 1B8XA 1TRUA 2HSNB 4PUAA 4DSSA 2VL2A 2C0EA 2OKAA 4JEDA 1XWKA 3GRXA 2H0GA 2IJYA 1YDKA 2GQKA 1EOGA 2E0QA 4LA1A 4XIHA 4ZL7A 1EP7A 2NTOA
chains in the Genus database with same CATH superfamily
1SK0A 2HSYA 1EEJA 3FR3A 2REMA 4V2NA 5G1KA 3H8QA 3LYPA 1U3AA 4CY6A 3ME8A 1AW9A 2GGTA 2YJHA 3RBTA 2H1BA 3VFIA 4EKZA 4GSSA 4PI0C 1QK8A 3K8NA 3IBHA 2F8AA 17GSA 3LEFA 1GSFA 4RI6A 3IDVA 5J5NA 3VURA 5B8AA 3LQ7A 3FZAA 5CRWA 3EURA 3W6GA 1SVOA 5G2ZA 1LBKA 2GQMA 2N5BA 4Z2RA 3VPQA 1H75A 3TKRA 1BX9A 1XWGA 5IOXA 3FY7A 1ZOFA 3KJYA 4PX1A 2ZCTA 3Q19A 2KUCA 4WR5A 4ECCA 3QMXA 1R4WA 4EF0A 1ZYQB 4OD7A 4RUVA 2CVDA 1C72A 2NPBA 1OVNA 4MJCA 3IA1A 2GZZA 1GSSA 4MCUA 1AAZA 5J4VA 3UBKA 2P31A 3DVXA 1W89A 1TRVA 2CX4A 1HNBA 4QQ7A 3LGCA 3M9JA 3G9BA 3KP9A 3TU3B 6GSVA 2LRTA 4OO4A 2EC4A 2JU5A 3CWGA 4NPBA 3ZMKA 5CREA 2YWMA 1LJRA 2YWIA 2WW1A 3G7IA 5L71A 3PPUA 1TK8B 2KP1A 4LL4B 1EV9A 3TJBA 4WKWA 5HFKA 2HRNA 1NHYA 4MZCA 2EFEA 3VI5A 3DEXA 5CYYA 1PA3A 3ME7A 4GSTA 2I1UA 1J9BA 1XBSA 4KH7A 4F0CA 1FAAA 4ACSA 4BPYA 3GKMA 4JBBA 3HHVA 4EUYA 3OR5A 4ZXGA 3ZFBA 2IFQB 4K2XA 4A5PA 1KTEA 3ZRDA 3TRXA 5GAND 2FLSA 3M1GA 3DIEA 1U88A 5D9WA 3CHXC 3F63A 3P2AA 4ID0A 4G0IA 2EFDA 5J4UA 1FG4A 4F03A 3IV4A 1XW6A 1F6MC 2WW2A 5A5HB 4HZ4A 1M2DA 2H6ZA 1XVWA 5DALA 4L0UA 3GV1A 4YAPA 1V57A 4ICYA 4MNNA 1X5EA 5JWQB 3FKFA 2X64A 4WXTA 4KAEA 4KCEA 1YF0A 3D4MA 1TOFA 1OC9A 2HSNA 2RUFA 4MJEA 5FHIA 5EPFA 3C71A 2O8VB 5D8IA 2HQTA 5ECLB 3CSJA 4P3YB 3P90A 4Q5FA 3QR6A 1K0NA 2J23A 3US3A 1UVZA 4O5QA 2IPAA 4WF4A 3TJGA 2L59A 2AUVA 5AGYA 4KDUA 2L5OA 3GYKA 4MLYA 2B6MA 4KSMA 1RQMA 1A23A 2HZEB 2G2QA 5DDLA 1IYHA 3WD6A 2CAIA 2KHPA 3QAWA 1GSYA 5D9TA 5ID2B 2MMAA 1AQWA 2BMXA 1M9AA 3GX8A 3R2QA 1EGRA 10GSA 3M8NA 1PL2A 4HQZA 3ZVJD 1S3CA 2K8SA 5JWRB 4YKGA 1WPIA 4Q5NA 1WIKA 4PTSA 1Q98A 4FO5A 2FHEA 5IMCA 2YANA 3FR9A 3HD5A 4TVEA 4ECIA 3IK7A 2F8FA 2H1GA 2H74A 1OKTA 2XC2A 4J57E 4AKHA 4EE0A 3MAKA 1MD4A 2WJUA 1JHBA 12GSA 4ML1A 1VF4A 5F05A 1Z9HA 3VWUA 1GNWA 2HT9A 1USBA 1J0FA 5D73A 2GSTA 4HUAA 4X1UA 1S3RA 2H1DA 2VD0A 1SK2A 5F8BA 2H0HA 3IE3A 4GLTA 2LNSA 4POBA 4CW9A 4E68A 1FVKA 1ON4A 4JU5A 4BVYB 2MZCA 1SD8A 2JZTA 5HR1A 1CQGA 2OBKA 5B7CA 4G10A 1UC7A 1TJDA 14GSA 1RK4A 4AKIA 5INYA 2PU9C 4RQXA 2VL3A 3TUEA 3F4TA 3F4SA 1TU7A 3WGXA 2K8VA 3CTGA 4LL1B 2EIRA 1G7OA 3ZYWA 3VK9A 5HFIA 2L57A 3VWVA 4PGTA 2B5EA 3H1NA 3LFLA 4MMMA 3CTFA 5H5RA 5A5HA 5B6MA 4FXYP 5AISA 3UIWA 2GVPA 2PPTA 2M80A 1A8YA 1NHOA 1OKDA 3L9SA 2H1AA 3UJ1A 4GXZA 1MTCA 1V2AA 3F3QA 2V1MA 1T1VA 2HSMA 2L4QA 1SJ6A 3QDNA 1WP0A 1EV4A 2RLIA 1U3IA 3KMNA 2H70A 2B5YA 4I2TA 2WGRA 5GZZB 3V1WA 8GSSA 1XPVA 3I9V2 3F8UA 4OWYA 2WW3A 5HFGA 3RHBA 1R5AA 3UMAA 1K0AA 2P5RA 2WFCA 1XWBA 2VM2A 4K6XA 4MZBA 2HRAA 5GSTA 5G5FA 3M9KA 4BL7B 3C73A 3J7Yb 1VF3A 4MA9A 5IPHA 1EEMA 1BF5A 2HFDA 1Z5YE 3J7Yk 5DJLA 2HZEA 2VCWA 1TI1A 4K7NA 2FWEA 2VCZA 5KN1A 2B5XA 3ZZXA 1OE7A 3APSA 1MDKA 2GT5A 2R0GA 2UZ8A 3ISOA 1G6WA 3A3TA 5ID2A 3IC8A 1SJIA 2YOIA 1AXDA 3DMLA 1TP9A 2L4CA 4D73B 2J9HA 4F0BA 4JZQA 16GSA 3ZFLA 1WOUA 2DJKA 4KW6A 1A2MA 2WULA 3C7MA 1EOHA 3LWAA 1TRSA 4DEJA 2O5VA 1M9BA 3IHGA 2YP6A 3D5JA 3HJMA 4OFNA 2PERA 4K5SA 3GKKA 3UL3A 2AYTA 4WBRD 1GTAA 3TKSA 2F9SA 3L4NA 2IIYA 3UARA 3IXRA 1PRXA 5ECPB 2LNTA 1T8EB 2IMIA 3HY2A 1SJZA 2QSIA 3KTLA 2R4VA 1N8JA 3RPPA 4GQCA 4BVYA 3QCPA 2OACA 1BQ7A 2FNOA 2A4HA 3ZLPA 3CXGA 1PSQA 3GL5A 1A2JA 3PH9A 2P5QA 4K5RA 5D93A 4OCEA 1H4OA 3ZTLA 5GAPD 3GHAA 4HOJA 2YNXA 1GWCA 1TRWA 7GSSA 3APQA 3F3RA 4G0KA 2NBSA 1T00A 1PD21 2V6OA 3QPMA 1THOA 2KP2A 4K7IA 4HDEA 4JR6A 3FR6A 1X9MB 4KNDA 3UVHA 1GH2A 4N0VA 3BBYA 2HI7A 2CX3A 4KA0A 2GZPA 4K7OA 2DMMA 3KXOA 3FEUA 2BTOT 3HYPA 2YWOA 2V41A 1FOVA 1JLWA 4ZIJA 2NVLA 3G7JA 3UVTA 4AI6A 1Z3EA 2YCDA 3RFRC 1WE0A 1TTZA 3GN3A 1PN9A 5LNKe 1GUKA 2HRFA 4GQFA 3C1SA 1ERVA 4PI2C 1TK0B 3KP8A 1WMJA 4TR0A 1TXXA 1G7EA 5IMFA 4AKGA 1PL1A 4LMVA 1XW9A 2A2RA 1AUCA 2C4JA 1O7UA 2E2GA 4IELA 1OAZA 2DLXA 4EIPA 3PGTA 1ERTA 2XPEA 2DIZA 1XIYA 2CT6A 2X8GA 2YN1A 3UOMA 2NDOA 1A0RP 4KB3A 1TXUA 3LJRA 4YKFA 11GSA 2HYXA 4IW9A 1QGVA 3IC4A 2OADA 4TR3A 2C3TA 4GWRA 2I81A 1Z7RA 1OYJA 3KTBA 5C04A 2HRKB 4GSNA 2LV3A 5J9CA 4EO3A 4D73A 1MEKA 1T4ZA 1JZWA 1YKAA 1HD2A 1GTBA 2X99A 4XS1A 3ZIVA 3LG6A 3UAPA 2MMZA 3VWWA 2XBIA 3SBCA 1YZXA 5HR3A 2I4AA 1TU8A 3D21A 2HE3A 2H8LA 3HVNA 5FWGA 5E4WA 5KN0A 5DAKB 1XG8A 5IPGA 4TW5A 5F07A 3IOSA 1A24A 4TOPA 3GKNA 3C1RA 3HVVA 3CBUA 5DVBA 2PVQA 5DQSA 5ECHB 3TJKA 3HJOA 2QKEA 1BJXA 2K18A 5ECMB 4HS1A 4XS4B 4EC0A 2LJRA 4TN8A 4ZL9A 1F3BA 1SD9A 4G2EA 1EP8A 2N5AA 1SL2B 2GZYA 4BWSA 4NXIA 4O32A 1A0FA 3EU4A 1K3YA 1ZYEA 2R2JA 4IQAA 4AF2A 3FZ5A 2PMTA 1RW1A 1YKCA 3VPTA 6GSXA 3BOAA 1JZRA 2EFHA 5HR2A 3RGBC 1ILOA 3S9FA 4Q5QA 1ZGNA 2GS3A 2C80A 1G6YA 18GSA 1ERUA 4KE3A 1BYEA 2DBCA 4POKA 1QQ2A 4MABA 6GSWA 2OE1A 3I43A 3WT1A 1PGTA 2WB9A 5J9BA 2A4VA 3U5RE 2B1LA 3MIXA 5ECKB 4N10A 4FYBA 2PGTA 3UEMA 2RUEA 4MDCA 5KOXA 3Q6OA 1G0TA 3MNGA 5JCWA 1TW9A 3I6AA 2AB6A 2ES7A 1M2BA 3TRQA 3EC3A 3RAZA 1IYIA 2F3MA 4KF9A 4L0WA 2Z9SA 4PUFC 2DJJA 4OO5A 2V32A 2OJLA 4Z7XA 2FA4A 2GLRA 3KGKA 3MWHA 3MDKA 1S3DA 3HVSA 3PR8A 4MPGA 3VLNA 3IPZA 2R37A 3AY8A 2LRCA 4Z2TA 2H30A 2CAQA 3LORA 4USSA 2IMFA 3GURA 2DJ2A 3NZNA 2LTKA 2WS2A 2C3NA 5EL8A 2VKZG 2ALBA 4I5QA 2L5LA 5J4YA 2UV8G 2VUPA 4EXJA 4KDXA 4HU7A 4G19A 1M2AA 1URMA 4HI7A 6GSTA 1M99A 2IL3A 1FW1A 4IN0A 2X49A 3GKXA 4ISDA 3FRCA 2IMEA 3O6TA 1QFNA 4IKHA 2WVYA 4WR4A 4WEYA 2HRKA 4TXOB 4ZB8A 5B8BA 2MBSA 1ZL9A 1TKDB 2R0CA 4MF6A 3N9JA 3WT2A 3TKQA 3TRPA 4OFTA 1HNCA 5BMUB 4PNGA 3TCOA 3WYWA 4EDYA 1K0CA 1K0DA 1FHEA 1GUHA 5DAKA 1UA5A 4YH2A 1F9MA 2A2SA 4MF7A 3L9VA 3R3EA 4ZBBA 5ELGA 1I5GA 2DC5A 4PQHA 3L0HA 1ST9A 2FWHA 4BIKA 2H75A 3TKSE 4L5LA 2LJAA 4XS4A 1YEXA 4N0ZA 5CNWA 1GNEA 1ZYPA 4IP6A 1TK5B 4E8HA 4MJBA 3HVXA 3QFBC 2ON5A 1HNAA 3FW2A 1FOHA 2V6KA 1B48A 4PNFA 3HDCA 2O36A 4Q5RA 3F0IA 1T7PB 5HQPA 2IFQA 2QA1A 1GSDA 1O85A 3EU3A 3HJPA 5IQYA 1GUMA 3A5IA 1SKWB 5HR0A 4N3ZA 2A2PA 3LW9A 2LKUA 2WVXB 2YWNA 1UN2A 3GL3A 3VWXA 5ELAA 5CRDA 4K0NA 2QGVA 4EL1A 3ZVJA 3DYRA 1EGOA 1V58A 3FK8A 2L6CA 4GRFA 1YF1A 1Z7PA 4K1FA 1VGLA 3N5OA 1XOAA 2H6XA 4AJ7A 4N11A 2C0DA 4POMA 2V2GA 1JFUA 1F2EA 2RIIA 5KOWA 4ZB7A 2XPDA 3CMIA 1K3OA 5EVOA 3RPNA 2I9HA 2DMLA 1K0OA 5A4WA 1U87A 3A5WA 1E2YA 3GH6A 1PN0A 1B4PA 6GSUA 2VLVA 4RQRA 3ERFA 3TOUA 2DJ1A 3GSSA 3GTUB 1CQHA 5A1NB 3TGZA 3HZ4A 2FD3A 4V2LA 3E3EA 4TR1B 3BCIA 1GSEA 1Y1UA 2R3XA 5IMAA 1XVQA 1DBYA 2YZUA 2EIOA 3EE2A 2H6YA 2LEGA 1GSUA 4XHMA 1GL8A 4CDOA 2CVKA 4GCIA 4NAXA 4PHZC 2AHEA 5ECRB 1PQNA 1YVLA 4HJMA 4XS6A 5G1LA 1X9WB 2CVBA 4ZB6A 5AIXA 2IMKA 1HYUA 2OE3A 2WW0A 2JACA 1FO5A 2GSRA 2OA7A 5J41A 3QD9A 1ZCPA 5H5SA 2VCQA 3GH9A 4TXOA 5IO2A 4ILFA 4JR4A 1XZOA 2MBTA 2DJ0A 4EIQA 4X0XA 1ZMAA 4L5OA 5BMUA 5JCGA 2TIRA 4HU9A 3JCML 3D4TA 1B4QA 1I1IP 5DBQA 1Z6NA 4NWYA 1XXUA 3O3TA 2B3SA 3FZ9A 1ACVA 2LSTA 2GT6A 2H66A 4NHWA 4G0LA 3GIXA 1XW5A 4QL9A 3CQFA 5C00A 4MK3A 1X5CA 1WJKA 1KNGA 1OC3A 2FUG2 2OBIA 1JLVA 3GSTA 2QC7A 1SVMA 2YV7A 3TKPA 5ENUA 4ZL8A 1M0UA 4X4JA 1BG1A 4MH2A 2PVOC 2CV4A 2VL2C 1MDJA 4G01A 2FWGA 3SWLA 1V9WA 2OE0A 1XWAA 1GTUA 4AKXB 5KN2A 3APOA 3LSZA 1O8XA 2GDRA 2WVXA 5A5KA 5DALB 3LXZA 2H19A 4HZ2A 5G5EA 1EZKA 3EMPA 1S3AA 5BRTA 2GSQA 4DSRA 4RI7A 2B7KA 1ABAA 4ZBAA 5J3RA 3F4RA 1OC9B 2AJQB 2JSYA 2L6DA 4ZILA 1ZYNA 2IMDA 3KD0A 1V98A 4OMVA 5A4UA 4O5RA 2GTUA 2YZHA 4ECBA 2DKHA 5IM9A 5D96A 3H4KA 3EWLA 3DRNA 3GX0A 2CQ9A 1SK1A 5G30A 1GTIA 1F3AA 3FHKA 4WF5A 1MDIA 3WGDA 2RM6A 3DVWA 4BL7A 5IOWA 4V1Ag 1PMTA 3ZL5A 2KLXA 2VIMA 2C3QA 3GTUA 1OC8A 1PX7A 4F82A 5A1NA 4TR1A 4I97A 2MYGA 3MSZA 3M0FA 3F6DA 3Q74A 1W4VA 2KOKA 1GRXA 2WZ9A 3L9UA 1E6BA 3HXSA 3CSHA 4EDZA 3M3MA 3E9JB 4N30A 1Q4JA 2O3EA 4OFMA 3CYNA 2LQOA 1THXA 19GSA 4PQIA 1GP1A 3HKRA 4K8MA 1BEDA 9GSSA 1SVLA 4O92A 4IP1A 2WZSA 5DQYA 2JL4A 2AAWA 3P8WA 4XRDA 1SYRA 4ULXA 4IBPA 2X8HA 1NM3A 4MH3A 2VCXA 1PKZA 2QA2A 3QOUA 1VF1A 2YJ7A 2CA8A 1YY7A 5J47A 4FIWA 1XCCA 3IAS2 4MJAA 2MMNA 1T4YA 1FB6A 1SKSB 3EPTA 4F2IA 4J2FA 5ECSA 1ML6A 2H76A 3IHQA 3KIJA 3EINA 1GLPA 3QFAC 2HLSA 2IWTA 1M3IA 1A2LA 4PXOA 4XCSA 4LLRA 4MP4A 3D6IA 4MPFA 2E2MA 1DSBA 1Z6MA 3TOTA 5EY6A 4HEA2 1XWCA 1N2AA 1ZZYA 1O6JA 2GQLA 2ON7A 4TRXA 3D22A 3IR4A 2FWFA 4NMUA 4BVXB 1YJ6A 4O7HA 4NHZA 3A2VA 5E59A 4LMWA 3KEBA 4FQUA 1YEPA 1YEWC 5DCGA 2R5GA 2DSAA 1Y25A 1I9DA 5JCUA 2AV4A 2E7PA 2HSMB 3ZMLA 5D9VA 22GSA 2HXKA 2EFCA 1O73A 1WRYA 3IRAA 2H01A 1AC1A 4JRRA 3HMJG 1NSWA 4IJIA 5D9XA 5JWOB 4HQSA 2M46A 5ABRA 4ECJA 1F37A 3KM6A 2N5FA 3LXTA 5IO0A 4IQ1A 4O5UA 4J56E 3BJ5A 1S4BP 2VLTA 1DUGA 3RDWA 1XFLA 1DE2A 3TB2A 5IMZA 5COHA 3TDGA 2MMOA 6GSYA 3DKSA 2DKIA 2EIQA 4HJ2A 3KZQA 4K2DA 2ZUPA 2B7JA 1DE1A 2C8UA 3FYGA 1SU9A 1PKWA 3H93A 4DSQA 2VCTA 2DJ3A 2C0FA 1FVJA 5F06A 2VL9A 5GSSA 4PQ1A 1WWJA 4W66A 2PWJA 2WRTA 5IMVA 2X8CA 2WDUA 1X0RA 3HZ8A 4GF0A 3A2XA 2GSSA 1O8WA 3KCMA 2C0GA 4K0GA 2CZ2A 1MD3A 3C8EA 4GDFA 1XOBA 4POLA 2VOCA 3G7YA 4G9HA 4FH8A 1N25A 1OE8A 3NIVA 3WGEA 4IVFA 4XTSA 6GSSA 3DXBA 2O7KA 4IS0A 3ERGA 4I2UA 3TJFA 5DJMA 1B9XC 2FCHA 2PUKC 3BCKA 1M3JA 3O76A 4DVCA 2LUSA 1KBNA 5H5QA 1SENA 4PURA 5A34B 4NV5A 4BA7A 5IMDA 2LQQA 4TXVA 2HNLA 3QAVA 5CP1A 4V2MA 2B1KA 3KMOA 4WETA 4L8EA 1QMVA 3Q18A 1QXHA 3A2WA 1VF2A 3IK9A 2VLUA 1R7HA 4JE1A 2R0PA 5B6NA 2JSZA 4ZB9A 3I69A 1K3LA 2PBJA 5CAXA 13GSA 3EVIA 1A8LA 3ED3A 3BD2A 2ZNMA 1TDIA 1X5DA 5AIVA 1BAYA 5FT3A 5CO3A 4Z2UA 3DD3A 2H1LA 4FYUA 3VI7A 3P7XA 5F0GA 1AQVA 3F9UA 5KN3A 5ECOB 1O81A 1GLQA 4MZWA 1SL0B 1R5PA 4BWQA 3W8SA 2DIYA 1JZDA 4DSSB 3U6VA 4KCAA 2LJKA 1K0MA 3D0ZA 2JZRA 2XHFA 4BVXA 3RHCA 4IGJA 4GTUA 2R6KA 3DGQA 2F51A 4OCFA 5AN1A 2K6VA 2O87A 4QMKA 4TKYA 4KX4A 4I6XA 5J40A 3TJJA 5A4VA 3HCZA 3ZITA 4MF5A 4AGSA 5KEJA 3IAM2 1BG5A 3KH7A 2JZSA 3CSIA 3EYTA 1Y6EA 2FGXA 2LRNA 2M72A 4AJ8A 1SKRB 1PFOA 1V40A 2OT3A 4FYCA 1B9YC 3CRTA 5ECNB 2O85A 2VM1A 4ML6A 4I8BA 4TR4A 1SL1B 5LCZA 2RM5A 2H0IA 1GSQA 3CRUA 3FMWA 5CRGA 4NV2A 2TRXA 3GUSA 4F9ZA 1VRSD 2BJXA 4KUNA 3H79A 4IHUA 3GNJA 1AQXA 5LD0A 4KSOA 4YQVA 4KDYA 2G0FA 2HZFA 5DCHA 2VD1A 2H72A 2X4AA 1PX6A 2VO4A 1AIUA 2O89A 3ERWA 1GULA 3ZIJA 2CZ3A 3W8JA 2LS5A 1TI3A 4YQMA 1K0BA 2IN3A 3F6FA 3TKSC 3QAGA 2PN8A 2H73A 2P0GA 1R26A 3L78A 5ECQB 4E8EA 4AJ6A 4H86A 2D2ZA 2VCVA 3ZREA 1QUWA 2H71A 2C1YA 3DWVA 4CY8A 4EVMA 4QL7A 3GMFA 1FB0A 5CRHA 2TRCP 4KGIA 4HSCX 1SYXA 5A34A 2I3YA 1X9SB 3FZ4A 1YQ1A 3PINA 1HQOA 4YAVA 1ERWA 1J08A 1U6TA 1LU4A 2XBQA 4IJ3A 4V1Ap 3HA9A 1KEBA 3KH9A 3UBLA 3GFKA 1T3BA 3GA4A 5IIZA 4CHSA 3NOFA 2FA8A 2FY6A 2WVZA 1EWXA 3EMXA 4XRAA 4YQUA 1NW2A 4WBJA 2HSHA 2K9FA 2YV9A 5ECIB 5G31A 2VAFA 3LYKA 1JZOA 4ZBDA 3E0UA 2WCIA 4K9ZA 2YPMA 4X43A 20GSA 1M7TA 2JADA 1B8XA 1TRUA 2HSNB 4PUAA 4DSSA 2VL2A 3MYDA 2C0EA 2OKAA 4JEDA 1XWKA 3GRXA 2H0GA 2IJYA 1YDKA 2GQKA 1EOGA 2E0QA 4LA1A 4XIHA 4ZL7A 1EP7A 2NTOA
chains in the Genus database with same CATH topology
1SK0A 2HSYA 1EEJA 3FR3A 2REMA 4V2NA 5G1KA 3H8QA 3LYPA 1U3AA 4CY6A 3ME8A 1AW9A 2GGTA 2YJHA 3RBTA 2H1BA 3VFIA 4EKZA 4GSSA 1QK8A 3K8NA 3IBHA 2F8AA 17GSA 3LEFA 1GSFA 4RI6A 3IDVA 5J5NA 3VURA 5B8AA 3LQ7A 3FZAA 5CRWA 3EURA 3W6GA 1SVOA 5G2ZA 1LBKA 2GQMA 2N5BA 4Z2RA 3VPQA 1H75A 3TKRA 1BX9A 1XWGA 5IOXA 3FY7A 1ZOFA 3KJYA 4PX1A 2ZCTA 3Q19A 2KUCA 4WR5A 4ECCA 3QMXA 1R4WA 4EF0A 1ZYQB 4OD7A 4RUVA 2CVDA 1C72A 2NPBA 1OVNA 4MJCA 3IA1A 2GZZA 1GSSA 4MCUA 1AAZA 5J4VA 3UBKA 2P31A 3DVXA 1W89A 1TRVA 2CX4A 1HNBA 4QQ7A 3LGCA 3M9JA 3G9BA 3KP9A 3TU3B 6GSVA 2LRTA 4OO4A 2EC4A 2JU5A 3CWGA 4NPBA 3ZMKA 5CREA 2YWMA 1LJRA 2YWIA 3G7IA 5L71A 3PPUA 1TK8B 2KP1A 4LL4B 1EV9A 3TJBA 4WKWA 5HFKA 2HRNA 1NHYA 4MZCA 2EFEA 3VI5A 3DEXA 5CYYA 1PA3A 3ME7A 4GSTA 2I1UA 1J9BA 1XBSA 4KH7A 4F0CA 1FAAA 4ACSA 4BPYA 3GKMA 4JBBA 3HHVA 4EUYA 3OR5A 4ZXGA 3ZFBA 2IFQB 4K2XA 4A5PA 1KTEA 3ZRDA 3TRXA 5GAND 2FLSA 3M1GA 3DIEA 1U88A 5D9WA 3F63A 3P2AA 4ID0A 4G0IA 2EFDA 5J4UA 1FG4A 4F03A 3IV4A 1XW6A 1F6MC 5A5HB 4HZ4A 1M2DA 2H6ZA 1XVWA 5DALA 4L0UA 3GV1A 4YAPA 1V57A 4ICYA 4MNNA 1X5EA 5JWQB 3FKFA 2X64A 4WXTA 4KAEA 4KCEA 1YF0A 3D4MA 1TOFA 1OC9A 2HSNA 2RUFA 4MJEA 5FHIA 5EPFA 3C71A 2O8VB 5D8IA 2HQTA 5ECLB 3CSJA 4P3YB 3P90A 4Q5FA 3QR6A 1K0NA 2J23A 3US3A 1UVZA 4O5QA 2IPAA 4WF4A 3TJGA 2L59A 2AUVA 5AGYA 4KDUA 2L5OA 3GYKA 4MLYA 2B6MA 4KSMA 1RQMA 1A23A 2HZEB 2G2QA 5DDLA 1IYHA 3WD6A 2CAIA 2KHPA 3QAWA 1GSYA 5D9TA 5ID2B 2MMAA 1AQWA 2BMXA 1M9AA 3GX8A 3R2QA 1EGRA 10GSA 3M8NA 1PL2A 4HQZA 3ZVJD 1S3CA 2K8SA 5JWRB 4YKGA 1WPIA 4Q5NA 1WIKA 4PTSA 1Q98A 4FO5A 2FHEA 5IMCA 2YANA 3FR9A 3HD5A 4TVEA 4ECIA 3IK7A 2F8FA 2H1GA 2H74A 1OKTA 2XC2A 4J57E 4AKHA 4EE0A 3MAKA 1MD4A 2WJUA 1JHBA 12GSA 4ML1A 1VF4A 5F05A 1Z9HA 3VWUA 1GNWA 2HT9A 1USBA 1J0FA 5D73A 2GSTA 4HUAA 4X1UA 2H1DA 2VD0A 1SK2A 5F8BA 2H0HA 3IE3A 4GLTA 2LNSA 4POBA 4CW9A 4E68A 1FVKA 1ON4A 4JU5A 4BVYB 2MZCA 1SD8A 2JZTA 5HR1A 1CQGA 2OBKA 5B7CA 4G10A 1UC7A 1TJDA 14GSA 1RK4A 4AKIA 5INYA 2PU9C 4RQXA 2VL3A 3TUEA 3F4TA 3F4SA 1TU7A 3WGXA 2K8VA 3CTGA 4LL1B 2EIRA 1G7OA 3ZYWA 3VK9A 5HFIA 2L57A 3VWVA 4PGTA 2B5EA 3H1NA 3LFLA 4MMMA 3CTFA 5H5RA 5A5HA 5B6MA 5AISA 3UIWA 2GVPA 2PPTA 2M80A 1A8YA 1NHOA 1OKDA 3L9SA 2H1AA 3UJ1A 4GXZA 1MTCA 1V2AA 3F3QA 2V1MA 1T1VA 2HSMA 2L4QA 1SJ6A 3QDNA 1WP0A 1EV4A 2RLIA 1U3IA 3KMNA 2H70A 2B5YA 4I2TA 2WGRA 5GZZB 3V1WA 8GSSA 1XPVA 3I9V2 3F8UA 4OWYA 5HFGA 3RHBA 1R5AA 3UMAA 1K0AA 2P5RA 2WFCA 1XWBA 2VM2A 4K6XA 4MZBA 2HRAA 5GSTA 5G5FA 3M9KA 4BL7B 3C73A 3J7Yb 1VF3A 4MA9A 5IPHA 1EEMA 1BF5A 2HFDA 1Z5YE 3J7Yk 5DJLA 2HZEA 2VCWA 1TI1A 4K7NA 2FWEA 2VCZA 5KN1A 2B5XA 3ZZXA 1OE7A 3APSA 1MDKA 2GT5A 2R0GA 2UZ8A 3ISOA 1G6WA 3A3TA 5ID2A 3IC8A 1SJIA 2YOIA 1AXDA 3DMLA 1TP9A 2L4CA 4D73B 2J9HA 4F0BA 4JZQA 16GSA 3ZFLA 1WOUA 2DJKA 4KW6A 1A2MA 2WULA 3C7MA 1EOHA 3LWAA 1TRSA 4DEJA 2O5VA 1M9BA 3IHGA 2YP6A 3D5JA 3HJMA 4OFNA 2PERA 4K5SA 3GKKA 3UL3A 2AYTA 4WBRD 1GTAA 3TKSA 2F9SA 3L4NA 2IIYA 3UARA 3IXRA 1PRXA 5ECPB 2LNTA 1T8EB 2IMIA 3HY2A 1SJZA 2QSIA 3KTLA 2R4VA 1N8JA 3RPPA 4GQCA 4BVYA 3QCPA 2OACA 1BQ7A 2FNOA 2A4HA 3ZLPA 3CXGA 1PSQA 3GL5A 1A2JA 3PH9A 2P5QA 4K5RA 5D93A 4OCEA 1H4OA 3ZTLA 5GAPD 3GHAA 4HOJA 2YNXA 1GWCA 1TRWA 7GSSA 3APQA 3F3RA 4G0KA 2NBSA 1T00A 1PD21 2V6OA 3QPMA 1THOA 2KP2A 4K7IA 4HDEA 4JR6A 3FR6A 1X9MB 4KNDA 3UVHA 1GH2A 4N0VA 3BBYA 2HI7A 2CX3A 4KA0A 2GZPA 4K7OA 2DMMA 3KXOA 3FEUA 2BTOT 3HYPA 2YWOA 2V41A 1FOVA 1JLWA 4ZIJA 2NVLA 3G7JA 3UVTA 4AI6A 1Z3EA 2YCDA 1WE0A 1TTZA 3GN3A 1PN9A 5LNKe 1GUKA 2HRFA 4GQFA 3C1SA 1ERVA 1TK0B 3KP8A 1WMJA 4TR0A 1TXXA 1G7EA 5IMFA 4AKGA 1PL1A 4LMVA 1XW9A 2A2RA 1AUCA 2C4JA 1O7UA 2E2GA 4IELA 1OAZA 2DLXA 4EIPA 3PGTA 1ERTA 2XPEA 2DIZA 1XIYA 2CT6A 2X8GA 2YN1A 3UOMA 2NDOA 1A0RP 4KB3A 1TXUA 3LJRA 4YKFA 11GSA 2HYXA 4IW9A 1QGVA 3IC4A 2OADA 4TR3A 2C3TA 4GWRA 2I81A 1Z7RA 1OYJA 3KTBA 5C04A 2HRKB 4GSNA 2LV3A 5J9CA 4EO3A 4D73A 1MEKA 1T4ZA 1JZWA 1YKAA 1HD2A 1GTBA 2X99A 4XS1A 3ZIVA 3LG6A 3UAPA 2MMZA 3VWWA 2XBIA 3SBCA 1YZXA 5HR3A 2I4AA 1TU8A 3D21A 2HE3A 2H8LA 5FWGA 5E4WA 5KN0A 5DAKB 5IPGA 4TW5A 5F07A 3IOSA 1A24A 4TOPA 3GKNA 3C1RA 3HVVA 3CBUA 5DVBA 2PVQA 5DQSA 5ECHB 3TJKA 3HJOA 2QKEA 1BJXA 2K18A 5ECMB 4HS1A 4XS4B 4EC0A 2LJRA 4TN8A 4ZL9A 1F3BA 1SD9A 4G2EA 1EP8A 2N5AA 1SL2B 2GZYA 4BWSA 4NXIA 4O32A 1A0FA 3EU4A 1K3YA 1ZYEA 2R2JA 4IQAA 4AF2A 3FZ5A 2PMTA 1RW1A 1YKCA 3VPTA 6GSXA 3BOAA 1JZRA 2EFHA 5HR2A 1ILOA 3S9FA 4Q5QA 1ZGNA 2GS3A 2C80A 1G6YA 18GSA 1ERUA 4KE3A 1BYEA 2DBCA 4POKA 1QQ2A 4MABA 6GSWA 2OE1A 3I43A 3WT1A 1PGTA 2WB9A 5J9BA 2A4VA 3U5RE 2B1LA 3MIXA 5ECKB 4N10A 4FYBA 2PGTA 3UEMA 2RUEA 4MDCA 5KOXA 3Q6OA 1G0TA 3MNGA 5JCWA 1TW9A 3I6AA 2AB6A 2ES7A 1M2BA 3TRQA 3EC3A 3RAZA 1IYIA 2F3MA 4KF9A 4L0WA 2Z9SA 4PUFC 2DJJA 4OO5A 2V32A 2OJLA 4Z7XA 2FA4A 2GLRA 3KGKA 3MWHA 3MDKA 1S3DA 3HVSA 3PR8A 4MPGA 3VLNA 3IPZA 2R37A 3AY8A 2LRCA 4Z2TA 2H30A 2CAQA 3LORA 4USSA 2IMFA 3GURA 2DJ2A 3NZNA 2LTKA 2WS2A 2C3NA 5EL8A 2VKZG 2ALBA 4I5QA 2L5LA 5J4YA 2UV8G 2VUPA 4EXJA 4KDXA 4HU7A 4G19A 1M2AA 1URMA 4HI7A 6GSTA 1M99A 2IL3A 1FW1A 4IN0A 2X49A 3GKXA 4ISDA 3FRCA 2IMEA 3O6TA 1QFNA 4IKHA 4WR4A 4WEYA 2HRKA 4TXOB 4ZB8A 5B8BA 2MBSA 1ZL9A 1TKDB 2R0CA 4MF6A 3N9JA 3WT2A 3TKQA 3TRPA 4OFTA 1HNCA 5BMUB 4PNGA 3TCOA 3WYWA 4EDYA 1K0CA 1K0DA 1FHEA 1GUHA 5DAKA 1UA5A 4YH2A 1F9MA 2A2SA 4MF7A 3L9VA 3R3EA 4ZBBA 5ELGA 1I5GA 2DC5A 4PQHA 3L0HA 1ST9A 2FWHA 2H75A 3TKSE 4L5LA 2LJAA 4XS4A 1YEXA 4N0ZA 5CNWA 1GNEA 1ZYPA 4IP6A 1TK5B 4E8HA 4MJBA 3HVXA 3QFBC 2ON5A 1HNAA 3FW2A 1FOHA 2V6KA 1B48A 4PNFA 3HDCA 4Q5RA 3F0IA 1T7PB 5HQPA 2IFQA 2QA1A 1GSDA 1O85A 3EU3A 3HJPA 5IQYA 1GUMA 3A5IA 1SKWB 5HR0A 4N3ZA 2A2PA 3LW9A 2LKUA 2YWNA 1UN2A 3GL3A 3VWXA 5ELAA 5CRDA 4K0NA 2QGVA 4EL1A 3ZVJA 3DYRA 1EGOA 1V58A 3FK8A 2L6CA 4GRFA 1YF1A 1Z7PA 4K1FA 1VGLA 3N5OA 1XOAA 2H6XA 4AJ7A 4N11A 2C0DA 4POMA 2V2GA 1JFUA 1F2EA 2RIIA 5KOWA 4ZB7A 2XPDA 3CMIA 1K3OA 5EVOA 3RPNA 2I9HA 2DMLA 1K0OA 5A4WA 1U87A 3A5WA 1E2YA 3GH6A 1PN0A 1B4PA 6GSUA 2VLVA 4RQRA 3ERFA 3TOUA 2DJ1A 3GSSA 3GTUB 1CQHA 5A1NB 3TGZA 3HZ4A 2FD3A 4V2LA 3E3EA 4TR1B 3BCIA 1GSEA 1Y1UA 2R3XA 5IMAA 1XVQA 1DBYA 2YZUA 2EIOA 3EE2A 2H6YA 2LEGA 1GSUA 4XHMA 1GL8A 4CDOA 2CVKA 4GCIA 4NAXA 2AHEA 5ECRB 1PQNA 1YVLA 4HJMA 4XS6A 5G1LA 1X9WB 2CVBA 4ZB6A 5AIXA 2IMKA 1HYUA 2JACA 2OE3A 1FO5A 2GSRA 2OA7A 5J41A 3QD9A 1ZCPA 5H5SA 2VCQA 3GH9A 4TXOA 5IO2A 4ILFA 4JR4A 1XZOA 2MBTA 2DJ0A 4EIQA 4X0XA 1ZMAA 4L5OA 5BMUA 5JCGA 2TIRA 4HU9A 3JCML 3D4TA 1B4QA 5DBQA 1Z6NA 4NWYA 1XXUA 3O3TA 2B3SA 3FZ9A 1ACVA 2LSTA 2GT6A 2H66A 4NHWA 4G0LA 3GIXA 1XW5A 4QL9A 5C00A 4MK3A 1X5CA 1WJKA 1KNGA 1OC3A 2FUG2 2OBIA 1JLVA 3GSTA 2QC7A 1SVMA 2YV7A 3TKPA 5ENUA 4ZL8A 1M0UA 4X4JA 1BG1A 4MH2A 2PVOC 2CV4A 2VL2C 1MDJA 4G01A 2FWGA 3SWLA 1V9WA 2OE0A 1XWAA 1GTUA 4AKXB 5KN2A 3APOA 3LSZA 1O8XA 2GDRA 5A5KA 5DALB 3LXZA 2H19A 4HZ2A 5G5EA 1EZKA 3EMPA 1S3AA 5BRTA 2GSQA 4DSRA 4RI7A 2B7KA 1ABAA 4ZBAA 5J3RA 3F4RA 1OC9B 2AJQB 2JSYA 2L6DA 4ZILA 1ZYNA 2IMDA 3KD0A 1V98A 4OMVA 5A4UA 4O5RA 2GTUA 2YZHA 4ECBA 2DKHA 5IM9A 5D96A 3H4KA 3EWLA 3DRNA 3GX0A 2CQ9A 1SK1A 5G30A 1GTIA 1F3AA 3FHKA 4WF5A 1MDIA 3WGDA 2RM6A 3DVWA 4BL7A 5IOWA 4V1Ag 1PMTA 3ZL5A 2KLXA 2VIMA 2C3QA 3GTUA 1OC8A 1PX7A 4F82A 5A1NA 4TR1A 4I97A 2MYGA 3MSZA 3M0FA 3F6DA 3Q74A 1W4VA 2KOKA 1GRXA 2WZ9A 3L9UA 1E6BA 3HXSA 3CSHA 4EDZA 3M3MA 3E9JB 4N30A 1Q4JA 4OFMA 3CYNA 2LQOA 1THXA 19GSA 4PQIA 1GP1A 3HKRA 4K8MA 1BEDA 9GSSA 1SVLA 4O92A 4IP1A 5DQYA 2JL4A 2AAWA 3P8WA 4XRDA 1SYRA 4ULXA 4IBPA 2X8HA 1NM3A 4MH3A 2VCXA 1PKZA 2QA2A 3QOUA 1VF1A 2YJ7A 2CA8A 1YY7A 5J47A 4FIWA 1XCCA 3IAS2 4MJAA 2MMNA 1T4YA 1FB6A 1SKSB 3EPTA 4F2IA 4J2FA 5ECSA 1ML6A 2H76A 3IHQA 3KIJA 3EINA 1GLPA 3QFAC 2HLSA 2IWTA 1A2LA 4PXOA 4XCSA 4LLRA 4MP4A 3D6IA 4MPFA 2E2MA 1DSBA 1Z6MA 3TOTA 5EY6A 4HEA2 1XWCA 1N2AA 1ZZYA 1O6JA 2GQLA 2ON7A 4TRXA 3D22A 3IR4A 2FWFA 4NMUA 4BVXB 1YJ6A 4O7HA 4NHZA 3A2VA 5E59A 4LMWA 3KEBA 4FQUA 1YEPA 5DCGA 2R5GA 2DSAA 1Y25A 1I9DA 5JCUA 2AV4A 2E7PA 2HSMB 3ZMLA 5D9VA 22GSA 2HXKA 2EFCA 1O73A 1WRYA 3IRAA 2H01A 1AC1A 4JRRA 3HMJG 1NSWA 4IJIA 5D9XA 5JWOB 4HQSA 2M46A 5ABRA 4ECJA 1F37A 3KM6A 2N5FA 3LXTA 5IO0A 4IQ1A 4O5UA 4J56E 3BJ5A 2VLTA 1DUGA 3RDWA 1XFLA 1DE2A 3TB2A 5IMZA 5COHA 3TDGA 2MMOA 6GSYA 3DKSA 2DKIA 2EIQA 4HJ2A 3KZQA 4K2DA 2ZUPA 2B7JA 1DE1A 2C8UA 3FYGA 1SU9A 1PKWA 3H93A 4DSQA 2VCTA 2DJ3A 2C0FA 1FVJA 5F06A 2VL9A 5GSSA 4PQ1A 1WWJA 4W66A 2PWJA 2WRTA 5IMVA 2X8CA 2WDUA 1X0RA 3HZ8A 4GF0A 3A2XA 2GSSA 1O8WA 3KCMA 2C0GA 4K0GA 2CZ2A 1MD3A 3C8EA 4GDFA 1XOBA 4POLA 2VOCA 3G7YA 4G9HA 4FH8A 1N25A 1OE8A 3NIVA 3WGEA 4IVFA 4XTSA 6GSSA 3DXBA 2O7KA 4IS0A 3ERGA 4I2UA 3TJFA 5DJMA 1B9XC 2FCHA 2PUKC 3BCKA 3O76A 4DVCA 2LUSA 1KBNA 5H5QA 1SENA 4PURA 5A34B 4NV5A 4BA7A 5IMDA 2LQQA 4TXVA 2HNLA 3QAVA 5CP1A 4V2MA 2B1KA 3KMOA 4WETA 4L8EA 1QMVA 3Q18A 1QXHA 3A2WA 1VF2A 3IK9A 2VLUA 1R7HA 4JE1A 2R0PA 5B6NA 2JSZA 4ZB9A 3I69A 1K3LA 2PBJA 5CAXA 13GSA 3EVIA 1A8LA 3ED3A 3BD2A 2ZNMA 1TDIA 1X5DA 5AIVA 1BAYA 5FT3A 5CO3A 4Z2UA 3DD3A 2H1LA 4FYUA 3VI7A 3P7XA 5F0GA 1AQVA 3F9UA 5KN3A 5ECOB 1O81A 1GLQA 4MZWA 1SL0B 1R5PA 4BWQA 3W8SA 2DIYA 1JZDA 4DSSB 3U6VA 4KCAA 2LJKA 1K0MA 3D0ZA 2JZRA 2XHFA 4BVXA 3RHCA 4IGJA 4GTUA 2R6KA 3DGQA 2F51A 4OCFA 5AN1A 2K6VA 2O87A 4QMKA 4TKYA 4KX4A 4I6XA 5J40A 3TJJA 5A4VA 3HCZA 3ZITA 4MF5A 4AGSA 5KEJA 3IAM2 1BG5A 3KH7A 2JZSA 3CSIA 3EYTA 1Y6EA 2FGXA 2LRNA 2M72A 4AJ8A 1SKRB 1V40A 2OT3A 4FYCA 1B9YC 3CRTA 5ECNB 2O85A 2VM1A 4ML6A 4I8BA 4TR4A 1SL1B 5LCZA 2RM5A 2H0IA 1GSQA 3CRUA 3FMWA 5CRGA 4NV2A 2TRXA 3GUSA 4F9ZA 1VRSD 2BJXA 4KUNA 3H79A 4IHUA 3GNJA 1AQXA 5LD0A 4KSOA 4YQVA 4KDYA 2G0FA 2HZFA 5DCHA 2VD1A 2H72A 2X4AA 1PX6A 2VO4A 1AIUA 2O89A 3ERWA 1GULA 3ZIJA 2CZ3A 3W8JA 2LS5A 1TI3A 4YQMA 1K0BA 2IN3A 3F6FA 3TKSC 3QAGA 2PN8A 2H73A 2P0GA 1R26A 3L78A 5ECQB 4E8EA 4AJ6A 4H86A 2D2ZA 2VCVA 3ZREA 1QUWA 2H71A 2C1YA 3DWVA 4CY8A 4EVMA 4QL7A 3GMFA 1FB0A 5CRHA 2TRCP 4KGIA 1SYXA 5A34A 2I3YA 1X9SB 3FZ4A 1YQ1A 3PINA 1HQOA 4YAVA 1ERWA 1J08A 1U6TA 1LU4A 2XBQA 4IJ3A 4V1Ap 3HA9A 1KEBA 3KH9A 3UBLA 3GFKA 1T3BA 3GA4A 5IIZA 4CHSA 3NOFA 2FA8A 2FY6A 3EMXA 1EWXA 4XRAA 4YQUA 1NW2A 4WBJA 2HSHA 2K9FA 2YV9A 5ECIB 5G31A 2VAFA 3LYKA 1JZOA 4ZBDA 3E0UA 2WCIA 4K9ZA 2YPMA 4X43A 20GSA 1M7TA 2JADA 1B8XA 1TRUA 2HSNB 4PUAA 4DSSA 2VL2A 3MYDA 2C0EA 2OKAA 4JEDA 1XWKA 3GRXA 2H0GA 2IJYA 1YDKA 2GQKA 1EOGA 2E0QA 4LA1A 4XIHA 4ZL7A 1EP7A 2NTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SK0 A;  2HSY A;  1EEJ A;  3FR3 A;  2REM A;  4V2N A;  5G1K A;  3H8Q A;  3LYP A;  1U3A A;  3ME8 A;  1AW9 A;  2GGT A;  2YJH A;  3RBT A;  2H1B A;  3VFI A;  4EKZ A;  4GSS A;  1QK8 A;  3K8N A;  3IBH A;  2F8A A;  17GS A;  3LEF A;  1GSF A;  4RI6 A;  3IDV A;  5J5N A;  3VUR A;  5B8A A;  3LQ7 A;  3FZA A;  5CRW A;  3EUR A;  3W6G A;  5G2Z A;  1LBK A;  2GQM A;  2N5B A;  3VPQ A;  1H75 A;  3TKR A;  1BX9 A;  1XWG A;  5IOX A;  3FY7 A;  1ZOF A;  3KJY A;  4PX1 A;  2ZCT A;  3Q19 A;  2KUC A;  4WR5 A;  4ECC A;  3QMX A;  1R4W A;  4EF0 A;  1ZYQ B;  4OD7 A;  4RUV A;  2CVD A;  1C72 A;  2NPB A;  1OVN A;  4MJC A;  3IA1 A;  2GZZ A;  1GSS A;  4MCU A;  1AAZ A;  3UBK A;  2P31 A;  3DVX A;  1W89 A;  1TRV A;  2CX4 A;  1HNB A;  4QQ7 A;  3LGC A;  3M9J A;  3G9B A;  3KP9 A;  6GSV A;  2LRT A;  4OO4 A;  2EC4 A;  2JU5 A;  4NPB A;  3ZMK A;  5CRE A;  2YWM A;  1LJR A;  2YWI A;  3G7I A;  5L71 A;  3PPU A;  1TK8 B;  2KP1 A;  4LL4 B;  1EV9 A;  3TJB A;  4WKW A;  5HFK A;  2HRN A;  1NHY A;  4MZC A;  3VI5 A;  3DEX A;  5CYY A;  1PA3 A;  3ME7 A;  4GST A;  2I1U A;  1J9B A;  1XBS A;  4KH7 A;  4F0C A;  1FAA A;  4ACS A;  4BPY A;  3GKM A;  4JBB A;  3HHV A;  4EUY A;  3OR5 A;  4ZXG A;  3ZFB A;  2IFQ B;  1KTE A;  3ZRD A;  3TRX A;  5GAN D;  2FLS A;  3M1G A;  3DIE A;  1U88 A;  5D9W A;  3F63 A;  3P2A A;  4ID0 A;  4G0I A;  5J4U A;  1FG4 A;  4F03 A;  3IV4 A;  1XW6 A;  1F6M C;  4HZ4 A;  1M2D A;  2H6Z A;  1XVW A;  5DAL A;  4L0U A;  3GV1 A;  4YAP A;  1V57 A;  1X5E A;  5JWQ B;  3FKF A;  2X64 A;  4WXT A;  4KAE A;  4KCE A;  1YF0 A;  3D4M A;  1TOF A;  1OC9 A;  2RUF A;  4MJE A;  5FHI A;  5EPF A;  3C71 A;  2O8V B;  5D8I A;  2HQT A;  5ECL B;  3CSJ A;  4P3Y B;  3P90 A;  4Q5F A;  3QR6 A;  1K0N A;  2J23 A;  3US3 A;  1UVZ A;  2IPA A;  4WF4 A;  3TJG A;  2L59 A;  2AUV A;  5AGY A;  4KDU A;  2L5O A;  3GYK A;  4MLY A;  2B6M A;  4KSM A;  1RQM A;  1A23 A;  2HZE B;  2G2Q A;  5DDL A;  1IYH A;  3WD6 A;  2CAI A;  2KHP A;  3QAW A;  1GSY A;  5D9T A;  5ID2 B;  2MMA A;  1AQW A;  2BMX A;  1M9A A;  3GX8 A;  3R2Q A;  1EGR A;  10GS A;  3M8N A;  1PL2 A;  4HQZ A;  3ZVJ D;  1S3C A;  2K8S A;  5JWR B;  1WPI A;  4Q5N A;  1WIK A;  4PTS A;  1Q98 A;  4FO5 A;  2FHE A;  5IMC A;  2YAN A;  3FR9 A;  3HD5 A;  4TVE A;  4ECI A;  3IK7 A;  2F8F A;  2H1G A;  2H74 A;  1OKT A;  2XC2 A;  4J57 E;  4EE0 A;  3MAK A;  1MD4 A;  2WJU A;  1JHB A;  12GS A;  4ML1 A;  1VF4 A;  5F05 A;  1Z9H A;  3VWU A;  1GNW A;  2HT9 A;  1USB A;  1J0F A;  5D73 A;  2GST A;  4HUA A;  4X1U A;  2H1D A;  2VD0 A;  1SK2 A;  5F8B A;  2H0H A;  3IE3 A;  4GLT A;  2LNS A;  4POB A;  4CW9 A;  1FVK A;  1ON4 A;  4JU5 A;  4BVY B;  2MZC A;  1SD8 A;  2JZT A;  5HR1 A;  1CQG A;  2OBK A;  5B7C A;  4G10 A;  1UC7 A;  1TJD A;  14GS A;  1RK4 A;  5INY A;  2PU9 C;  4RQX A;  2VL3 A;  3TUE A;  3F4T A;  3F4S A;  1TU7 A;  3WGX A;  2K8V A;  3CTG A;  4LL1 B;  2EIR A;  1G7O A;  3ZYW A;  3VK9 A;  5HFI A;  2L57 A;  3VWV A;  4PGT A;  2B5E A;  3H1N A;  3LFL A;  4MMM A;  3CTF A;  5H5R A;  5B6M A;  5AIS A;  3UIW A;  2GVP A;  2PPT A;  2M80 A;  1A8Y A;  1NHO A;  1OKD A;  3L9S A;  2H1A A;  3UJ1 A;  4GXZ A;  1MTC A;  1V2A A;  3F3Q A;  2V1M A;  1T1V A;  2HSM A;  2L4Q A;  1SJ6 A;  3QDN A;  1WP0 A;  1EV4 A;  2RLI A;  1U3I A;  3KMN A;  2H70 A;  2B5Y A;  4I2T A;  2WGR A;  5GZZ B;  3V1W A;  8GSS A;  1XPV A;  3I9V 2;  3F8U A;  4OWY A;  5HFG A;  3RHB A;  1R5A A;  3UMA A;  1K0A A;  2P5R A;  2WFC A;  1XWB A;  2VM2 A;  4K6X A;  4MZB A;  2HRA A;  5GST A;  5G5F A;  3M9K A;  4BL7 B;  3C73 A;  3J7Y b;  1VF3 A;  4MA9 A;  5IPH A;  1EEM A;  2HFD A;  1Z5Y E;  3J7Y k;  5DJL A;  2HZE A;  2VCW A;  1TI1 A;  4K7N A;  2FWE A;  2VCZ A;  5KN1 A;  2B5X A;  3ZZX A;  1OE7 A;  3APS A;  1MDK A;  2GT5 A;  2UZ8 A;  3ISO A;  1G6W A;  3A3T A;  5ID2 A;  3IC8 A;  1SJI A;  2YOI A;  1AXD A;  3DML A;  1TP9 A;  2L4C A;  4D73 B;  2J9H A;  4F0B A;  4JZQ A;  16GS A;  3ZFL A;  1WOU A;  2DJK A;  4KW6 A;  1A2M A;  2WUL A;  3C7M A;  1EOH A;  3LWA A;  1TRS A;  4DEJ A;  1M9B A;  2YP6 A;  3D5J A;  3HJM A;  4OFN A;  2PER A;  3GKK A;  3UL3 A;  2AYT A;  4WBR D;  1GTA A;  3TKS A;  2F9S A;  3L4N A;  2IIY A;  3UAR A;  3IXR A;  1PRX A;  5ECP B;  2LNT A;  1T8E B;  2IMI A;  3HY2 A;  1SJZ A;  2QSI A;  3KTL A;  2R4V A;  1N8J A;  3RPP A;  4GQC A;  4BVY A;  3QCP A;  2OAC A;  1BQ7 A;  2FNO A;  3ZLP A;  3CXG A;  1PSQ A;  3GL5 A;  1A2J A;  3PH9 A;  2P5Q A;  5D93 A;  4OCE A;  1H4O A;  3ZTL A;  5GAP D;  3GHA A;  4HOJ A;  2YNX A;  1GWC A;  1TRW A;  7GSS A;  3APQ A;  3F3R A;  4G0K A;  2NBS A;  1T00 A;  1PD2 1;  2V6O A;  3QPM A;  1THO A;  2KP2 A;  4K7I A;  4HDE A;  4JR6 A;  3FR6 A;  1X9M B;  4KND A;  3UVH A;  1GH2 A;  4N0V A;  3BBY A;  2HI7 A;  2CX3 A;  4KA0 A;  2GZP A;  4K7O A;  2DMM A;  3KXO A;  3FEU A;  2BTO T;  3HYP A;  2YWO A;  2V41 A;  1FOV A;  1JLW A;  4ZIJ A;  2NVL A;  3G7J A;  3UVT A;  1Z3E A;  2YCD A;  1WE0 A;  1TTZ A;  3GN3 A;  1PN9 A;  5LNK e;  1GUK A;  2HRF A;  4GQF A;  3C1S A;  1ERV A;  1TK0 B;  3KP8 A;  1WMJ A;  4TR0 A;  1TXX A;  1G7E A;  5IMF A;  1PL1 A;  4LMV A;  1XW9 A;  2A2R A;  1AUC A;  2C4J A;  1O7U A;  2E2G A;  4IEL A;  1OAZ A;  2DLX A;  3PGT A;  1ERT A;  2XPE A;  2DIZ A;  1XIY A;  2CT6 A;  2X8G A;  2YN1 A;  3UOM A;  2NDO A;  1A0R P;  4KB3 A;  3LJR A;  11GS A;  2HYX A;  4IW9 A;  1QGV A;  3IC4 A;  2OAD A;  4TR3 A;  2C3T A;  4GWR A;  2I81 A;  1Z7R A;  1OYJ A;  3KTB A;  5C04 A;  2HRK B;  4GSN A;  2LV3 A;  5J9C A;  4EO3 A;  4D73 A;  1MEK A;  1T4Z A;  1JZW A;  1YKA A;  1HD2 A;  1GTB A;  2X99 A;  4XS1 A;  3ZIV A;  3LG6 A;  3UAP A;  2MMZ A;  3VWW A;  2XBI A;  3SBC A;  1YZX A;  5HR3 A;  2I4A A;  1TU8 A;  3D21 A;  2HE3 A;  2H8L A;  5FWG A;  5E4W A;  5KN0 A;  5DAK B;  5IPG A;  4TW5 A;  5F07 A;  3IOS A;  1A24 A;  4TOP A;  3GKN A;  3C1R A;  3HVV A;  3CBU A;  5DVB A;  2PVQ A;  5DQS A;  5ECH B;  3TJK A;  3HJO A;  2QKE A;  1BJX A;  2K18 A;  5ECM B;  4HS1 A;  4XS4 B;  4EC0 A;  2LJR A;  4TN8 A;  4ZL9 A;  1F3B A;  1SD9 A;  4G2E A;  1EP8 A;  2N5A A;  1SL2 B;  2GZY A;  4BWS A;  4NXI A;  4O32 A;  1A0F A;  3EU4 A;  1K3Y A;  1ZYE A;  2R2J A;  4IQA A;  4AF2 A;  3FZ5 A;  2PMT A;  1RW1 A;  1YKC A;  3VPT A;  6GSX A;  3BOA A;  1JZR A;  5HR2 A;  1ILO A;  3S9F A;  4Q5Q A;  1ZGN A;  2GS3 A;  2C80 A;  1G6Y A;  18GS A;  1ERU A;  4KE3 A;  1BYE A;  2DBC A;  4POK A;  1QQ2 A;  4MAB A;  6GSW A;  2OE1 A;  3I43 A;  3WT1 A;  1PGT A;  2WB9 A;  5J9B A;  2A4V A;  3U5R E;  2B1L A;  5ECK B;  4N10 A;  4FYB A;  2PGT A;  3UEM A;  2RUE A;  4MDC A;  3Q6O A;  1G0T A;  3MNG A;  5JCW A;  1TW9 A;  3I6A A;  2AB6 A;  2ES7 A;  1M2B A;  3TRQ A;  3EC3 A;  3RAZ A;  1IYI A;  2F3M A;  4KF9 A;  4L0W A;  2Z9S A;  4PUF C;  2DJJ A;  4OO5 A;  2V32 A;  2OJL A;  4Z7X A;  2FA4 A;  2GLR A;  3KGK A;  3MWH A;  3MDK A;  1S3D A;  3HVS A;  3PR8 A;  4MPG A;  3VLN A;  3IPZ A;  2R37 A;  3AY8 A;  2LRC A;  2H30 A;  2CAQ A;  3LOR A;  4USS A;  2IMF A;  3GUR A;  2DJ2 A;  3NZN A;  2LTK A;  2WS2 A;  2C3N A;  5EL8 A;  2ALB A;  4I5Q A;  2L5L A;  2VUP A;  4EXJ A;  4KDX A;  4HU7 A;  4G19 A;  1M2A A;  1URM A;  4HI7 A;  6GST A;  1M99 A;  2IL3 A;  1FW1 A;  4IN0 A;  3GKX A;  4ISD A;  3FRC A;  2IME A;  3O6T A;  1QFN A;  4IKH A;  4WR4 A;  4WEY A;  2HRK A;  4TXO B;  4ZB8 A;  5B8B A;  2MBS A;  1ZL9 A;  1TKD B;  4MF6 A;  3N9J A;  3WT2 A;  3TKQ A;  3TRP A;  4OFT A;  1HNC A;  4PNG A;  3TCO A;  3WYW A;  4EDY A;  1K0C A;  1K0D A;  1FHE A;  1GUH A;  5DAK A;  1UA5 A;  4YH2 A;  1F9M A;  2A2S A;  4MF7 A;  3L9V A;  3R3E A;  4ZBB A;  5ELG A;  1I5G A;  2DC5 A;  4PQH A;  3L0H A;  1ST9 A;  2FWH A;  2H75 A;  3TKS E;  4L5L A;  2LJA A;  4XS4 A;  1YEX A;  4N0Z A;  5CNW A;  1GNE A;  4IP6 A;  1TK5 B;  4E8H A;  4MJB A;  3HVX A;  3QFB C;  2ON5 A;  1HNA A;  3FW2 A;  2V6K A;  1B48 A;  4PNF A;  3HDC A;  4Q5R A;  3F0I A;  1T7P B;  5HQP A;  2IFQ A;  1GSD A;  1O85 A;  3EU3 A;  3HJP A;  5IQY A;  1GUM A;  1SKW B;  5HR0 A;  2LKU A;  2YWN A;  1UN2 A;  3GL3 A;  3VWX A;  5ELA A;  5CRD A;  4K0N A;  2QGV A;  4EL1 A;  3ZVJ A;  3DYR A;  1EGO A;  1V58 A;  3FK8 A;  2L6C A;  4GRF A;  1YF1 A;  1Z7P A;  4K1F A;  1VGL A;  3N5O A;  1XOA A;  2H6X A;  4AJ7 A;  4N11 A;  2C0D A;  4POM A;  2V2G A;  1JFU A;  1F2E A;  2RII A;  2XPD A;  3CMI A;  1K3O A;  5EVO A;  3RPN A;  2I9H A;  2DML A;  1K0O A;  5A4W A;  1U87 A;  3A5W A;  1E2Y A;  3GH6 A;  1B4P A;  6GSU A;  2VLV A;  4RQR A;  3ERF A;  3TOU A;  2DJ1 A;  3GSS A;  3GTU B;  1CQH A;  3TGZ A;  3HZ4 A;  2FD3 A;  4V2L A;  3E3E A;  4TR1 B;  3BCI A;  1GSE A;  2R3X A;  5IMA A;  1XVQ A;  1DBY A;  2YZU A;  2EIO A;  3EE2 A;  2H6Y A;  2LEG A;  1GSU A;  4XHM A;  1GL8 A;  4CDO A;  2CVK A;  4GCI A;  4NAX A;  2AHE A;  5ECR B;  1PQN A;  4HJM A;  4XS6 A;  5G1L A;  1X9W B;  2CVB A;  4ZB6 A;  5AIX A;  2IMK A;  1HYU A;  2JAC A;  2OE3 A;  1FO5 A;  2GSR A;  2OA7 A;  5J41 A;  3QD9 A;  1ZCP A;  5H5S A;  2VCQ A;  3GH9 A;  4TXO A;  5IO2 A;  4ILF A;  4JR4 A;  1XZO A;  2MBT A;  2DJ0 A;  4X0X A;  1ZMA A;  4L5O A;  5BMU A;  5JCG A;  2TIR A;  4HU9 A;  3JCM L;  3D4T A;  1B4Q A;  5DBQ A;  1Z6N A;  4NWY A;  1XXU A;  3O3T A;  2B3S A;  3FZ9 A;  1ACV A;  2LST A;  2GT6 A;  2H66 A;  4NHW A;  4G0L A;  3GIX A;  1XW5 A;  4QL9 A;  5C00 A;  4MK3 A;  1X5C A;  1WJK A;  1KNG A;  1OC3 A;  2FUG 2;  2OBI A;  1JLV A;  3GST A;  2QC7 A;  2YV7 A;  3TKP A;  5ENU A;  4ZL8 A;  1M0U A;  4MH2 A;  2PVO C;  2CV4 A;  2VL2 C;  1MDJ A;  2FWG A;  3SWL A;  1V9W A;  2OE0 A;  1XWA A;  1GTU A;  5KN2 A;  3APO A;  3LSZ A;  1O8X A;  2GDR A;  5A5K A;  5DAL B;  3LXZ A;  2H19 A;  4HZ2 A;  5G5E A;  1EZK A;  3EMP A;  1S3A A;  2GSQ A;  4DSR A;  4RI7 A;  2B7K A;  1ABA A;  4ZBA A;  5J3R A;  3F4R A;  1OC9 B;  2AJQ B;  2JSY A;  2L6D A;  4ZIL A;  2IMD A;  3KD0 A;  1V98 A;  4OMV A;  5A4U A;  4O5R A;  2GTU A;  2YZH A;  4ECB A;  5IM9 A;  5D96 A;  3H4K A;  3EWL A;  3DRN A;  3GX0 A;  2CQ9 A;  1SK1 A;  5G30 A;  1GTI A;  1F3A A;  3FHK A;  4WF5 A;  1MDI A;  3WGD A;  2RM6 A;  3DVW A;  4BL7 A;  5IOW A;  4V1A g;  1PMT A;  3ZL5 A;  2KLX A;  2VIM A;  2C3Q A;  3GTU A;  1OC8 A;  1PX7 A;  4F82 A;  4TR1 A;  4I97 A;  2MYG A;  3MSZ A;  3M0F A;  3F6D A;  3Q74 A;  1W4V A;  2KOK A;  1GRX A;  2WZ9 A;  3L9U A;  1E6B A;  3HXS A;  3CSH A;  4EDZ A;  3M3M A;  3E9J B;  4N30 A;  1Q4J A;  4OFM A;  3CYN A;  2LQO A;  1THX A;  19GS A;  4PQI A;  1GP1 A;  3HKR A;  4K8M A;  1BED A;  9GSS A;  4O92 A;  4IP1 A;  5DQY A;  2JL4 A;  2AAW A;  3P8W A;  4XRD A;  1SYR A;  4ULX A;  4IBP A;  2X8H A;  1NM3 A;  4MH3 A;  2VCX A;  1PKZ A;  3QOU A;  1VF1 A;  2YJ7 A;  2CA8 A;  1YY7 A;  4FIW A;  1XCC A;  3IAS 2;  4MJA A;  2MMN A;  1T4Y A;  1FB6 A;  1SKS B;  4F2I A;  4J2F A;  5ECS A;  1ML6 A;  2H76 A;  3IHQ A;  3KIJ A;  3EIN A;  1GLP A;  3QFA C;  2HLS A;  2IWT A;  1A2L A;  4PXO A;  4XCS A;  4LLR A;  4MP4 A;  3D6I A;  4MPF A;  2E2M A;  1DSB A;  1Z6M A;  3TOT A;  5EY6 A;  4HEA 2;  1XWC A;  1N2A A;  1ZZY A;  1O6J A;  2GQL A;  2ON7 A;  4TRX A;  3D22 A;  3IR4 A;  2FWF A;  4NMU A;  4BVX B;  1YJ6 A;  4O7H A;  4NHZ A;  3A2V A;  5E59 A;  4LMW A;  3KEB A;  4FQU A;  1YEP A;  5DCG A;  2R5G A;  2DSA A;  1Y25 A;  1I9D A;  5JCU A;  2AV4 A;  2E7P A;  2HSM B;  3ZML A;  5D9V A;  22GS A;  2HXK A;  1O73 A;  1WRY A;  3IRA A;  2H01 A;  1AC1 A;  4JRR A;  1NSW A;  4IJI A;  5D9X A;  5JWO B;  4HQS A;  2M46 A;  5ABR A;  4ECJ A;  1F37 A;  3KM6 A;  2N5F A;  3LXT A;  5IO0 A;  4IQ1 A;  4J56 E;  3BJ5 A;  2VLT A;  1DUG A;  3RDW A;  1XFL A;  1DE2 A;  3TB2 A;  5IMZ A;  5COH A;  3TDG A;  2MMO A;  6GSY A;  3DKS A;  2EIQ A;  4HJ2 A;  3KZQ A;  4K2D A;  2ZUP A;  2B7J A;  1DE1 A;  2C8U A;  3FYG A;  1SU9 A;  1PKW A;  3H93 A;  4DSQ A;  2VCT A;  2DJ3 A;  2C0F A;  1FVJ A;  5F06 A;  2VL9 A;  5GSS A;  4PQ1 A;  1WWJ A;  2PWJ A;  2WRT A;  5IMV A;  2X8C A;  2WDU A;  1X0R A;  3HZ8 A;  4GF0 A;  3A2X A;  2GSS A;  1O8W A;  3KCM A;  2C0G A;  4K0G A;  2CZ2 A;  1MD3 A;  3C8E A;  1XOB A;  4POL A;  2VOC A;  3G7Y A;  4G9H A;  4FH8 A;  1OE8 A;  3NIV A;  3WGE A;  4IVF A;  4XTS A;  6GSS A;  3DXB A;  2O7K A;  4IS0 A;  3ERG A;  4I2U A;  3TJF A;  5DJM A;  1B9X C;  2FCH A;  2PUK C;  3BCK A;  3O76 A;  4DVC A;  2LUS A;  1KBN A;  5H5Q A;  1SEN A;  4PUR A;  4NV5 A;  4BA7 A;  5IMD A;  2LQQ A;  4TXV A;  2HNL A;  3QAV A;  5CP1 A;  4V2M A;  2B1K A;  3KMO A;  4WET A;  4L8E A;  1QMV A;  3Q18 A;  1QXH A;  3A2W A;  1VF2 A;  3IK9 A;  2VLU A;  1R7H A;  4JE1 A;  5B6N A;  2JSZ A;  4ZB9 A;  3I69 A;  1K3L A;  2PBJ A;  5CAX A;  13GS A;  3EVI A;  1A8L A;  3ED3 A;  3BD2 A;  2ZNM A;  1TDI A;  1X5D A;  5AIV A;  1BAY A;  5FT3 A;  5CO3 A;  3DD3 A;  4FYU A;  3VI7 A;  3P7X A;  5F0G A;  1AQV A;  3F9U A;  5KN3 A;  5ECO B;  1O81 A;  1GLQ A;  4MZW A;  1SL0 B;  1R5P A;  4BWQ A;  3W8S A;  2DIY A;  1JZD A;  4DSS B;  3U6V A;  4KCA A;  2LJK A;  1K0M A;  3D0Z A;  2JZR A;  2XHF A;  4BVX A;  3RHC A;  4IGJ A;  4GTU A;  2R6K A;  3DGQ A;  2F51 A;  4OCF A;  5AN1 A;  2K6V A;  2O87 A;  4TKY A;  4KX4 A;  4I6X A;  3TJJ A;  5A4V A;  3HCZ A;  3ZIT A;  4MF5 A;  4AGS A;  5KEJ A;  1BG5 A;  3IAM 2;  3KH7 A;  2JZS A;  3CSI A;  3EYT A;  1Y6E A;  2FGX A;  2LRN A;  2M72 A;  4AJ8 A;  1SKR B;  1V40 A;  4FYC A;  1B9Y C;  3CRT A;  5ECN B;  2O85 A;  2VM1 A;  4ML6 A;  4I8B A;  4TR4 A;  1SL1 B;  5LCZ A;  2RM5 A;  2H0I A;  1GSQ A;  3CRU A;  5CRG A;  4NV2 A;  2TRX A;  3GUS A;  4F9Z A;  1VRS D;  2BJX A;  4KUN A;  3H79 A;  4IHU A;  3GNJ A;  1AQX A;  5LD0 A;  4KSO A;  4YQV A;  4KDY A;  2G0F A;  2HZF A;  5DCH A;  2VD1 A;  2H72 A;  1PX6 A;  2VO4 A;  1AIU A;  2O89 A;  3ERW A;  1GUL A;  3ZIJ A;  2CZ3 A;  3W8J A;  2LS5 A;  1TI3 A;  4YQM A;  1K0B A;  2IN3 A;  3F6F A;  3TKS C;  3QAG A;  2PN8 A;  2H73 A;  2P0G A;  1R26 A;  3L78 A;  5ECQ B;  4E8E A;  4AJ6 A;  4H86 A;  2D2Z A;  2VCV A;  3ZRE A;  1QUW A;  2H71 A;  2C1Y A;  3DWV A;  4EVM A;  4QL7 A;  3GMF A;  1FB0 A;  5CRH A;  2TRC P;  4KGI A;  1SYX A;  2I3Y A;  1X9S B;  3FZ4 A;  1YQ1 A;  3PIN A;  1HQO A;  4YAV A;  1ERW A;  1J08 A;  4IJ3 A;  1U6T A;  1LU4 A;  2XBQ A;  4V1A p;  3HA9 A;  1KEB A;  3KH9 A;  3UBL A;  3GFK A;  1T3B A;  3GA4 A;  5IIZ A;  4CHS A;  3NOF A;  2FA8 A;  2FY6 A;  3EMX A;  1EWX A;  4XRA A;  4YQU A;  1NW2 A;  4WBJ A;  2HSH A;  2K9F A;  2YV9 A;  5ECI B;  5G31 A;  2VAF A;  3LYK A;  1JZO A;  4ZBD A;  3E0U A;  2WCI A;  4K9Z A;  2YPM A;  4X43 A;  20GS A;  1M7T A;  2JAD A;  1B8X A;  1TRU A;  2HSN B;  4PUA A;  4DSS A;  2VL2 A;  2C0E A;  2OKA A;  4JED A;  1XWK A;  3GRX A;  2H0G A;  2IJY A;  1YDK A;  2GQK A;  1EOG A;  2E0Q A;  4LA1 A;  4XIH A;  4ZL7 A;  1EP7 A;  2NTO A; 
#chains in the Genus database with same CATH topology
 1SK0 A;  2HSY A;  1EEJ A;  3FR3 A;  2REM A;  4V2N A;  5G1K A;  3H8Q A;  3LYP A;  1U3A A;  4CY6 A;  3ME8 A;  1AW9 A;  2GGT A;  2YJH A;  3RBT A;  2H1B A;  3VFI A;  4EKZ A;  4GSS A;  4PI0 C;  1QK8 A;  3K8N A;  3IBH A;  2F8A A;  17GS A;  3LEF A;  1GSF A;  4RI6 A;  3IDV A;  5J5N A;  3VUR A;  5B8A A;  3LQ7 A;  3FZA A;  5CRW A;  3EUR A;  3W6G A;  1SVO A;  5G2Z A;  1LBK A;  2GQM A;  2N5B A;  4Z2R A;  3VPQ A;  1H75 A;  3TKR A;  1BX9 A;  1XWG A;  5IOX A;  3FY7 A;  1ZOF A;  3KJY A;  4PX1 A;  2ZCT A;  3Q19 A;  2KUC A;  4WR5 A;  4ECC A;  3QMX A;  1R4W A;  4EF0 A;  1ZYQ B;  4OD7 A;  4RUV A;  2CVD A;  1C72 A;  2NPB A;  1OVN A;  4MJC A;  3IA1 A;  2GZZ A;  1GSS A;  4MCU A;  1AAZ A;  5J4V A;  3UBK A;  2P31 A;  3DVX A;  1W89 A;  1TRV A;  2CX4 A;  1HNB A;  4QQ7 A;  3LGC A;  3M9J A;  3G9B A;  3KP9 A;  3TU3 B;  6GSV A;  2LRT A;  4OO4 A;  2EC4 A;  2JU5 A;  3CWG A;  4NPB A;  3ZMK A;  5CRE A;  2YWM A;  1LJR A;  2YWI A;  2WW1 A;  3G7I A;  5L71 A;  3PPU A;  1TK8 B;  2KP1 A;  4LL4 B;  1EV9 A;  3TJB A;  4WKW A;  5HFK A;  2HRN A;  1NHY A;  4MZC A;  2EFE A;  3VI5 A;  3DEX A;  5CYY A;  1PA3 A;  3ME7 A;  4GST A;  2I1U A;  1J9B A;  1XBS A;  4KH7 A;  4F0C A;  1FAA A;  4ACS A;  4BPY A;  3GKM A;  4JBB A;  3HHV A;  4EUY A;  3OR5 A;  4ZXG A;  3ZFB A;  2IFQ B;  4K2X A;  4A5P A;  1KTE A;  3ZRD A;  3TRX A;  5GAN D;  2FLS A;  3M1G A;  3DIE A;  1U88 A;  5D9W A;  3CHX C;  3F63 A;  3P2A A;  4ID0 A;  4G0I A;  2EFD A;  5J4U A;  1FG4 A;  4F03 A;  3IV4 A;  1XW6 A;  1F6M C;  2WW2 A;  5A5H B;  4HZ4 A;  1M2D A;  2H6Z A;  1XVW A;  5DAL A;  4L0U A;  3GV1 A;  4YAP A;  1V57 A;  4ICY A;  4MNN A;  1X5E A;  5JWQ B;  3FKF A;  2X64 A;  4WXT A;  4KAE A;  4KCE A;  1YF0 A;  3D4M A;  1TOF A;  1OC9 A;  2HSN A;  2RUF A;  4MJE A;  5FHI A;  5EPF A;  3C71 A;  2O8V B;  5D8I A;  2HQT A;  5ECL B;  3CSJ A;  4P3Y B;  3P90 A;  4Q5F A;  3QR6 A;  1K0N A;  2J23 A;  3US3 A;  1UVZ A;  4O5Q A;  2IPA A;  4WF4 A;  3TJG A;  2L59 A;  2AUV A;  5AGY A;  4KDU A;  2L5O A;  3GYK A;  4MLY A;  2B6M A;  4KSM A;  1RQM A;  1A23 A;  2HZE B;  2G2Q A;  5DDL A;  1IYH A;  3WD6 A;  2CAI A;  2KHP A;  3QAW A;  1GSY A;  5D9T A;  5ID2 B;  2MMA A;  1AQW A;  2BMX A;  1M9A A;  3GX8 A;  3R2Q A;  1EGR A;  10GS A;  3M8N A;  1PL2 A;  4HQZ A;  3ZVJ D;  1S3C A;  2K8S A;  5JWR B;  4YKG A;  1WPI A;  4Q5N A;  1WIK A;  4PTS A;  1Q98 A;  4FO5 A;  2FHE A;  5IMC A;  2YAN A;  3FR9 A;  3HD5 A;  4TVE A;  4ECI A;  3IK7 A;  2F8F A;  2H1G A;  2H74 A;  1OKT A;  2XC2 A;  4J57 E;  4AKH A;  4EE0 A;  3MAK A;  1MD4 A;  2WJU A;  1JHB A;  12GS A;  4ML1 A;  1VF4 A;  5F05 A;  1Z9H A;  3VWU A;  1GNW A;  2HT9 A;  1USB A;  1J0F A;  5D73 A;  2GST A;  4HUA A;  4X1U A;  1S3R A;  2H1D A;  2VD0 A;  1SK2 A;  5F8B A;  2H0H A;  3IE3 A;  4GLT A;  2LNS A;  4POB A;  4CW9 A;  4E68 A;  1FVK A;  1ON4 A;  4JU5 A;  4BVY B;  2MZC A;  1SD8 A;  2JZT A;  5HR1 A;  1CQG A;  2OBK A;  5B7C A;  4G10 A;  1UC7 A;  1TJD A;  14GS A;  1RK4 A;  4AKI A;  5INY A;  2PU9 C;  4RQX A;  2VL3 A;  3TUE A;  3F4T A;  3F4S A;  1TU7 A;  3WGX A;  2K8V A;  3CTG A;  4LL1 B;  2EIR A;  1G7O A;  3ZYW A;  3VK9 A;  5HFI A;  2L57 A;  3VWV A;  4PGT A;  2B5E A;  3H1N A;  3LFL A;  4MMM A;  3CTF A;  5H5R A;  5A5H A;  5B6M A;  4FXY P;  5AIS A;  3UIW A;  2GVP A;  2PPT A;  2M80 A;  1A8Y A;  1NHO A;  1OKD A;  3L9S A;  2H1A A;  3UJ1 A;  4GXZ A;  1MTC A;  1V2A A;  3F3Q A;  2V1M A;  1T1V A;  2HSM A;  2L4Q A;  1SJ6 A;  3QDN A;  1WP0 A;  1EV4 A;  2RLI A;  1U3I A;  3KMN A;  2H70 A;  2B5Y A;  4I2T A;  2WGR A;  5GZZ B;  3V1W A;  8GSS A;  1XPV A;  3I9V 2;  3F8U A;  4OWY A;  2WW3 A;  5HFG A;  3RHB A;  1R5A A;  3UMA A;  1K0A A;  2P5R A;  2WFC A;  1XWB A;  2VM2 A;  4K6X A;  4MZB A;  2HRA A;  5GST A;  5G5F A;  3M9K A;  4BL7 B;  3C73 A;  3J7Y b;  1VF3 A;  4MA9 A;  5IPH A;  1EEM A;  1BF5 A;  2HFD A;  1Z5Y E;  3J7Y k;  5DJL A;  2HZE A;  2VCW A;  1TI1 A;  4K7N A;  2FWE A;  2VCZ A;  5KN1 A;  2B5X A;  3ZZX A;  1OE7 A;  3APS A;  1MDK A;  2GT5 A;  2R0G A;  2UZ8 A;  3ISO A;  1G6W A;  3A3T A;  5ID2 A;  3IC8 A;  1SJI A;  2YOI A;  1AXD A;  3DML A;  1TP9 A;  2L4C A;  4D73 B;  2J9H A;  4F0B A;  4JZQ A;  16GS A;  3ZFL A;  1WOU A;  2DJK A;  4KW6 A;  1A2M A;  2WUL A;  3C7M A;  1EOH A;  3LWA A;  1TRS A;  4DEJ A;  2O5V A;  1M9B A;  3IHG A;  2YP6 A;  3D5J A;  3HJM A;  4OFN A;  2PER A;  4K5S A;  3GKK A;  3UL3 A;  2AYT A;  4WBR D;  1GTA A;  3TKS A;  2F9S A;  3L4N A;  2IIY A;  3UAR A;  3IXR A;  1PRX A;  5ECP B;  2LNT A;  1T8E B;  2IMI A;  3HY2 A;  1SJZ A;  2QSI A;  3KTL A;  2R4V A;  1N8J A;  3RPP A;  4GQC A;  4BVY A;  3QCP A;  2OAC A;  1BQ7 A;  2FNO A;  2A4H A;  3ZLP A;  3CXG A;  1PSQ A;  3GL5 A;  1A2J A;  3PH9 A;  2P5Q A;  4K5R A;  5D93 A;  4OCE A;  1H4O A;  3ZTL A;  5GAP D;  3GHA A;  4HOJ A;  2YNX A;  1GWC A;  1TRW A;  7GSS A;  3APQ A;  3F3R A;  4G0K A;  2NBS A;  1T00 A;  1PD2 1;  2V6O A;  3QPM A;  1THO A;  2KP2 A;  4K7I A;  4HDE A;  4JR6 A;  3FR6 A;  1X9M B;  4KND A;  3UVH A;  1GH2 A;  4N0V A;  3BBY A;  2HI7 A;  2CX3 A;  4KA0 A;  2GZP A;  4K7O A;  2DMM A;  3KXO A;  3FEU A;  2BTO T;  3HYP A;  2YWO A;  2V41 A;  1FOV A;  1JLW A;  4ZIJ A;  2NVL A;  3G7J A;  3UVT A;  4AI6 A;  1Z3E A;  2YCD A;  3RFR C;  1WE0 A;  1TTZ A;  3GN3 A;  1PN9 A;  5LNK e;  1GUK A;  2HRF A;  4GQF A;  3C1S A;  1ERV A;  4PI2 C;  1TK0 B;  3KP8 A;  1WMJ A;  4TR0 A;  1TXX A;  1G7E A;  5IMF A;  4AKG A;  1PL1 A;  4LMV A;  1XW9 A;  2A2R A;  1AUC A;  2C4J A;  1O7U A;  2E2G A;  4IEL A;  1OAZ A;  2DLX A;  4EIP A;  3PGT A;  1ERT A;  2XPE A;  2DIZ A;  1XIY A;  2CT6 A;  2X8G A;  2YN1 A;  3UOM A;  2NDO A;  1A0R P;  4KB3 A;  1TXU A;  3LJR A;  4YKF A;  11GS A;  2HYX A;  4IW9 A;  1QGV A;  3IC4 A;  2OAD A;  4TR3 A;  2C3T A;  4GWR A;  2I81 A;  1Z7R A;  1OYJ A;  3KTB A;  5C04 A;  2HRK B;  4GSN A;  2LV3 A;  5J9C A;  4EO3 A;  4D73 A;  1MEK A;  1T4Z A;  1JZW A;  1YKA A;  1HD2 A;  1GTB A;  2X99 A;  4XS1 A;  3ZIV A;  3LG6 A;  3UAP A;  2MMZ A;  3VWW A;  2XBI A;  3SBC A;  1YZX A;  5HR3 A;  2I4A A;  1TU8 A;  3D21 A;  2HE3 A;  2H8L A;  3HVN A;  5FWG A;  5E4W A;  5KN0 A;  5DAK B;  1XG8 A;  5IPG A;  4TW5 A;  5F07 A;  3IOS A;  1A24 A;  4TOP A;  3GKN A;  3C1R A;  3HVV A;  3CBU A;  5DVB A;  2PVQ A;  5DQS A;  5ECH B;  3TJK A;  3HJO A;  2QKE A;  1BJX A;  2K18 A;  5ECM B;  4HS1 A;  4XS4 B;  4EC0 A;  2LJR A;  4TN8 A;  4ZL9 A;  1F3B A;  1SD9 A;  4G2E A;  1EP8 A;  2N5A A;  1SL2 B;  2GZY A;  4BWS A;  4NXI A;  4O32 A;  1A0F A;  3EU4 A;  1K3Y A;  1ZYE A;  2R2J A;  4IQA A;  4AF2 A;  3FZ5 A;  2PMT A;  1RW1 A;  1YKC A;  3VPT A;  6GSX A;  3BOA A;  1JZR A;  2EFH A;  5HR2 A;  3RGB C;  1ILO A;  3S9F A;  4Q5Q A;  1ZGN A;  2GS3 A;  2C80 A;  1G6Y A;  18GS A;  1ERU A;  4KE3 A;  1BYE A;  2DBC A;  4POK A;  1QQ2 A;  4MAB A;  6GSW A;  2OE1 A;  3I43 A;  3WT1 A;  1PGT A;  2WB9 A;  5J9B A;  2A4V A;  3U5R E;  2B1L A;  3MIX A;  5ECK B;  4N10 A;  4FYB A;  2PGT A;  3UEM A;  2RUE A;  4MDC A;  5KOX A;  3Q6O A;  1G0T A;  3MNG A;  5JCW A;  1TW9 A;  3I6A A;  2AB6 A;  2ES7 A;  1M2B A;  3TRQ A;  3EC3 A;  3RAZ A;  1IYI A;  2F3M A;  4KF9 A;  4L0W A;  2Z9S A;  4PUF C;  2DJJ A;  4OO5 A;  2V32 A;  2OJL A;  4Z7X A;  2FA4 A;  2GLR A;  3KGK A;  3MWH A;  3MDK A;  1S3D A;  3HVS A;  3PR8 A;  4MPG A;  3VLN A;  3IPZ A;  2R37 A;  3AY8 A;  2LRC A;  4Z2T A;  2H30 A;  2CAQ A;  3LOR A;  4USS A;  2IMF A;  3GUR A;  2DJ2 A;  3NZN A;  2LTK A;  2WS2 A;  2C3N A;  5EL8 A;  2VKZ G;  2ALB A;  4I5Q A;  2L5L A;  5J4Y A;  2UV8 G;  2VUP A;  4EXJ A;  4KDX A;  4HU7 A;  4G19 A;  1M2A A;  1URM A;  4HI7 A;  6GST A;  1M99 A;  2IL3 A;  1FW1 A;  4IN0 A;  2X49 A;  3GKX A;  4ISD A;  3FRC A;  2IME A;  3O6T A;  1QFN A;  4IKH A;  2WVY A;  4WR4 A;  4WEY A;  2HRK A;  4TXO B;  4ZB8 A;  5B8B A;  2MBS A;  1ZL9 A;  1TKD B;  2R0C A;  4MF6 A;  3N9J A;  3WT2 A;  3TKQ A;  3TRP A;  4OFT A;  1HNC A;  5BMU B;  4PNG A;  3TCO A;  3WYW A;  4EDY A;  1K0C A;  1K0D A;  1FHE A;  1GUH A;  5DAK A;  1UA5 A;  4YH2 A;  1F9M A;  2A2S A;  4MF7 A;  3L9V A;  3R3E A;  4ZBB A;  5ELG A;  1I5G A;  2DC5 A;  4PQH A;  3L0H A;  1ST9 A;  2FWH A;  4BIK A;  2H75 A;  3TKS E;  4L5L A;  2LJA A;  4XS4 A;  1YEX A;  4N0Z A;  5CNW A;  1GNE A;  1ZYP A;  4IP6 A;  1TK5 B;  4E8H A;  4MJB A;  3HVX A;  3QFB C;  2ON5 A;  1HNA A;  3FW2 A;  1FOH A;  2V6K A;  1B48 A;  4PNF A;  3HDC A;  2O36 A;  4Q5R A;  3F0I A;  1T7P B;  5HQP A;  2IFQ A;  2QA1 A;  1GSD A;  1O85 A;  3EU3 A;  3HJP A;  5IQY A;  1GUM A;  3A5I A;  1SKW B;  5HR0 A;  4N3Z A;  2A2P A;  3LW9 A;  2LKU A;  2WVX B;  2YWN A;  1UN2 A;  3GL3 A;  3VWX A;  5ELA A;  5CRD A;  4K0N A;  2QGV A;  4EL1 A;  3ZVJ A;  3DYR A;  1EGO A;  1V58 A;  3FK8 A;  2L6C A;  4GRF A;  1YF1 A;  1Z7P A;  4K1F A;  1VGL A;  3N5O A;  1XOA A;  2H6X A;  4AJ7 A;  4N11 A;  2C0D A;  4POM A;  2V2G A;  1JFU A;  1F2E A;  2RII A;  5KOW A;  4ZB7 A;  2XPD A;  3CMI A;  1K3O A;  5EVO A;  3RPN A;  2I9H A;  2DML A;  1K0O A;  5A4W A;  1U87 A;  3A5W A;  1E2Y A;  3GH6 A;  1PN0 A;  1B4P A;  6GSU A;  2VLV A;  4RQR A;  3ERF A;  3TOU A;  2DJ1 A;  3GSS A;  3GTU B;  1CQH A;  5A1N B;  3TGZ A;  3HZ4 A;  2FD3 A;  4V2L A;  3E3E A;  4TR1 B;  3BCI A;  1GSE A;  1Y1U A;  2R3X A;  5IMA A;  1XVQ A;  1DBY A;  2YZU A;  2EIO A;  3EE2 A;  2H6Y A;  2LEG A;  1GSU A;  4XHM A;  1GL8 A;  4CDO A;  2CVK A;  4GCI A;  4NAX A;  4PHZ C;  2AHE A;  5ECR B;  1PQN A;  1YVL A;  4HJM A;  4XS6 A;  5G1L A;  1X9W B;  2CVB A;  4ZB6 A;  5AIX A;  2IMK A;  1HYU A;  2OE3 A;  2WW0 A;  2JAC A;  1FO5 A;  2GSR A;  2OA7 A;  5J41 A;  3QD9 A;  1ZCP A;  5H5S A;  2VCQ A;  3GH9 A;  4TXO A;  5IO2 A;  4ILF A;  4JR4 A;  1XZO A;  2MBT A;  2DJ0 A;  4EIQ A;  4X0X A;  1ZMA A;  4L5O A;  5BMU A;  5JCG A;  2TIR A;  4HU9 A;  3JCM L;  3D4T A;  1B4Q A;  1I1I P;  5DBQ A;  1Z6N A;  4NWY A;  1XXU A;  3O3T A;  2B3S A;  3FZ9 A;  1ACV A;  2LST A;  2GT6 A;  2H66 A;  4NHW A;  4G0L A;  3GIX A;  1XW5 A;  4QL9 A;  3CQF A;  5C00 A;  4MK3 A;  1X5C A;  1WJK A;  1KNG A;  1OC3 A;  2FUG 2;  2OBI A;  1JLV A;  3GST A;  2QC7 A;  1SVM A;  2YV7 A;  3TKP A;  5ENU A;  4ZL8 A;  1M0U A;  4X4J A;  1BG1 A;  4MH2 A;  2PVO C;  2CV4 A;  2VL2 C;  1MDJ A;  4G01 A;  2FWG A;  3SWL A;  1V9W A;  2OE0 A;  1XWA A;  1GTU A;  4AKX B;  5KN2 A;  3APO A;  3LSZ A;  1O8X A;  2GDR A;  2WVX A;  5A5K A;  5DAL B;  3LXZ A;  2H19 A;  4HZ2 A;  5G5E A;  1EZK A;  3EMP A;  1S3A A;  5BRT A;  2GSQ A;  4DSR A;  4RI7 A;  2B7K A;  1ABA A;  4ZBA A;  5J3R A;  3F4R A;  1OC9 B;  2AJQ B;  2JSY A;  2L6D A;  4ZIL A;  1ZYN A;  2IMD A;  3KD0 A;  1V98 A;  4OMV A;  5A4U A;  4O5R A;  2GTU A;  2YZH A;  4ECB A;  2DKH A;  5IM9 A;  5D96 A;  3H4K A;  3EWL A;  3DRN A;  3GX0 A;  2CQ9 A;  1SK1 A;  5G30 A;  1GTI A;  1F3A A;  3FHK A;  4WF5 A;  1MDI A;  3WGD A;  2RM6 A;  3DVW A;  4BL7 A;  5IOW A;  4V1A g;  1PMT A;  3ZL5 A;  2KLX A;  2VIM A;  2C3Q A;  3GTU A;  1OC8 A;  1PX7 A;  4F82 A;  5A1N A;  4TR1 A;  4I97 A;  2MYG A;  3MSZ A;  3M0F A;  3F6D A;  3Q74 A;  1W4V A;  2KOK A;  1GRX A;  2WZ9 A;  3L9U A;  1E6B A;  3HXS A;  3CSH A;  4EDZ A;  3M3M A;  3E9J B;  4N30 A;  1Q4J A;  2O3E A;  4OFM A;  3CYN A;  2LQO A;  1THX A;  19GS A;  4PQI A;  1GP1 A;  3HKR A;  4K8M A;  1BED A;  9GSS A;  1SVL A;  4O92 A;  4IP1 A;  2WZS A;  5DQY A;  2JL4 A;  2AAW A;  3P8W A;  4XRD A;  1SYR A;  4ULX A;  4IBP A;  2X8H A;  1NM3 A;  4MH3 A;  2VCX A;  1PKZ A;  2QA2 A;  3QOU A;  1VF1 A;  2YJ7 A;  2CA8 A;  1YY7 A;  5J47 A;  4FIW A;  1XCC A;  3IAS 2;  4MJA A;  2MMN A;  1T4Y A;  1FB6 A;  1SKS B;  3EPT A;  4F2I A;  4J2F A;  5ECS A;  1ML6 A;  2H76 A;  3IHQ A;  3KIJ A;  3EIN A;  1GLP A;  3QFA C;  2HLS A;  2IWT A;  1M3I A;  1A2L A;  4PXO A;  4XCS A;  4LLR A;  4MP4 A;  3D6I A;  4MPF A;  2E2M A;  1DSB A;  1Z6M A;  3TOT A;  5EY6 A;  4HEA 2;  1XWC A;  1N2A A;  1ZZY A;  1O6J A;  2GQL A;  2ON7 A;  4TRX A;  3D22 A;  3IR4 A;  2FWF A;  4NMU A;  4BVX B;  1YJ6 A;  4O7H A;  4NHZ A;  3A2V A;  5E59 A;  4LMW A;  3KEB A;  4FQU A;  1YEP A;  1YEW C;  5DCG A;  2R5G A;  2DSA A;  1Y25 A;  1I9D A;  5JCU A;  2AV4 A;  2E7P A;  2HSM B;  3ZML A;  5D9V A;  22GS A;  2HXK A;  2EFC A;  1O73 A;  1WRY A;  3IRA A;  2H01 A;  1AC1 A;  4JRR A;  3HMJ G;  1NSW A;  4IJI A;  5D9X A;  5JWO B;  4HQS A;  2M46 A;  5ABR A;  4ECJ A;  1F37 A;  3KM6 A;  2N5F A;  3LXT A;  5IO0 A;  4IQ1 A;  4O5U A;  4J56 E;  3BJ5 A;  1S4B P;  2VLT A;  1DUG A;  3RDW A;  1XFL A;  1DE2 A;  3TB2 A;  5IMZ A;  5COH A;  3TDG A;  2MMO A;  6GSY A;  3DKS A;  2DKI A;  2EIQ A;  4HJ2 A;  3KZQ A;  4K2D A;  2ZUP A;  2B7J A;  1DE1 A;  2C8U A;  3FYG A;  1SU9 A;  1PKW A;  3H93 A;  4DSQ A;  2VCT A;  2DJ3 A;  2C0F A;  1FVJ A;  5F06 A;  2VL9 A;  5GSS A;  4PQ1 A;  1WWJ A;  4W66 A;  2PWJ A;  2WRT A;  5IMV A;  2X8C A;  2WDU A;  1X0R A;  3HZ8 A;  4GF0 A;  3A2X A;  2GSS A;  1O8W A;  3KCM A;  2C0G A;  4K0G A;  2CZ2 A;  1MD3 A;  3C8E A;  4GDF A;  1XOB A;  4POL A;  2VOC A;  3G7Y A;  4G9H A;  4FH8 A;  1N25 A;  1OE8 A;  3NIV A;  3WGE A;  4IVF A;  4XTS A;  6GSS A;  3DXB A;  2O7K A;  4IS0 A;  3ERG A;  4I2U A;  3TJF A;  5DJM A;  1B9X C;  2FCH A;  2PUK C;  3BCK A;  1M3J A;  3O76 A;  4DVC A;  2LUS A;  1KBN A;  5H5Q A;  1SEN A;  4PUR A;  5A34 B;  4NV5 A;  4BA7 A;  5IMD A;  2LQQ A;  4TXV A;  2HNL A;  3QAV A;  5CP1 A;  4V2M A;  2B1K A;  3KMO A;  4WET A;  4L8E A;  1QMV A;  3Q18 A;  1QXH A;  3A2W A;  1VF2 A;  3IK9 A;  2VLU A;  1R7H A;  4JE1 A;  2R0P A;  5B6N A;  2JSZ A;  4ZB9 A;  3I69 A;  1K3L A;  2PBJ A;  5CAX A;  13GS A;  3EVI A;  1A8L A;  3ED3 A;  3BD2 A;  2ZNM A;  1TDI A;  1X5D A;  5AIV A;  1BAY A;  5FT3 A;  5CO3 A;  4Z2U A;  3DD3 A;  2H1L A;  4FYU A;  3VI7 A;  3P7X A;  5F0G A;  1AQV A;  3F9U A;  5KN3 A;  5ECO B;  1O81 A;  1GLQ A;  4MZW A;  1SL0 B;  1R5P A;  4BWQ A;  3W8S A;  2DIY A;  1JZD A;  4DSS B;  3U6V A;  4KCA A;  2LJK A;  1K0M A;  3D0Z A;  2JZR A;  2XHF A;  4BVX A;  3RHC A;  4IGJ A;  4GTU A;  2R6K A;  3DGQ A;  2F51 A;  4OCF A;  5AN1 A;  2K6V A;  2O87 A;  4QMK A;  4TKY A;  4KX4 A;  4I6X A;  5J40 A;  3TJJ A;  5A4V A;  3HCZ A;  3ZIT A;  4MF5 A;  4AGS A;  5KEJ A;  3IAM 2;  1BG5 A;  3KH7 A;  2JZS A;  3CSI A;  3EYT A;  1Y6E A;  2FGX A;  2LRN A;  2M72 A;  4AJ8 A;  1SKR B;  1PFO A;  1V40 A;  2OT3 A;  4FYC A;  1B9Y C;  3CRT A;  5ECN B;  2O85 A;  2VM1 A;  4ML6 A;  4I8B A;  4TR4 A;  1SL1 B;  5LCZ A;  2RM5 A;  2H0I A;  1GSQ A;  3CRU A;  3FMW A;  5CRG A;  4NV2 A;  2TRX A;  3GUS A;  4F9Z A;  1VRS D;  2BJX A;  4KUN A;  3H79 A;  4IHU A;  3GNJ A;  1AQX A;  5LD0 A;  4KSO A;  4YQV A;  4KDY A;  2G0F A;  2HZF A;  5DCH A;  2VD1 A;  2H72 A;  2X4A A;  1PX6 A;  2VO4 A;  1AIU A;  2O89 A;  3ERW A;  1GUL A;  3ZIJ A;  2CZ3 A;  3W8J A;  2LS5 A;  1TI3 A;  4YQM A;  1K0B A;  2IN3 A;  3F6F A;  3TKS C;  3QAG A;  2PN8 A;  2H73 A;  2P0G A;  1R26 A;  3L78 A;  5ECQ B;  4E8E A;  4AJ6 A;  4H86 A;  2D2Z A;  2VCV A;  3ZRE A;  1QUW A;  2H71 A;  2C1Y A;  3DWV A;  4CY8 A;  4EVM A;  4QL7 A;  3GMF A;  1FB0 A;  5CRH A;  2TRC P;  4KGI A;  4HSC X;  1SYX A;  5A34 A;  2I3Y A;  1X9S B;  3FZ4 A;  1YQ1 A;  3PIN A;  1HQO A;  4YAV A;  1ERW A;  1J08 A;  1U6T A;  1LU4 A;  2XBQ A;  4IJ3 A;  4V1A p;  3HA9 A;  1KEB A;  3KH9 A;  3UBL A;  3GFK A;  1T3B A;  3GA4 A;  5IIZ A;  4CHS A;  3NOF A;  2FA8 A;  2FY6 A;  2WVZ A;  1EWX A;  3EMX A;  4XRA A;  4YQU A;  1NW2 A;  4WBJ A;  2HSH A;  2K9F A;  2YV9 A;  5ECI B;  5G31 A;  2VAF A;  3LYK A;  1JZO A;  4ZBD A;  3E0U A;  2WCI A;  4K9Z A;  2YPM A;  4X43 A;  20GS A;  1M7T A;  2JAD A;  1B8X A;  1TRU A;  2HSN B;  4PUA A;  4DSS A;  2VL2 A;  3MYD A;  2C0E A;  2OKA A;  4JED A;  1XWK A;  3GRX A;  2H0G A;  2IJY A;  1YDK A;  2GQK A;  1EOG A;  2E0Q A;  4LA1 A;  4XIH A;  4ZL7 A;  1EP7 A;  2NTO A; 
#chains in the Genus database with same CATH homology
 1SK0 A;  2HSY A;  1EEJ A;  3FR3 A;  2REM A;  4V2N A;  5G1K A;  3H8Q A;  3LYP A;  1U3A A;  4CY6 A;  3ME8 A;  1AW9 A;  2GGT A;  2YJH A;  3RBT A;  2H1B A;  3VFI A;  4EKZ A;  4GSS A;  1QK8 A;  3K8N A;  3IBH A;  2F8A A;  17GS A;  3LEF A;  1GSF A;  4RI6 A;  3IDV A;  5J5N A;  3VUR A;  5B8A A;  3LQ7 A;  3FZA A;  5CRW A;  3EUR A;  3W6G A;  1SVO A;  5G2Z A;  1LBK A;  2GQM A;  2N5B A;  4Z2R A;  3VPQ A;  1H75 A;  3TKR A;  1BX9 A;  1XWG A;  5IOX A;  3FY7 A;  1ZOF A;  3KJY A;  4PX1 A;  2ZCT A;  3Q19 A;  2KUC A;  4WR5 A;  4ECC A;  3QMX A;  1R4W A;  4EF0 A;  1ZYQ B;  4OD7 A;  4RUV A;  2CVD A;  1C72 A;  2NPB A;  1OVN A;  4MJC A;  3IA1 A;  2GZZ A;  1GSS A;  4MCU A;  1AAZ A;  5J4V A;  3UBK A;  2P31 A;  3DVX A;  1W89 A;  1TRV A;  2CX4 A;  1HNB A;  4QQ7 A;  3LGC A;  3M9J A;  3G9B A;  3KP9 A;  3TU3 B;  6GSV A;  2LRT A;  4OO4 A;  2EC4 A;  2JU5 A;  3CWG A;  4NPB A;  3ZMK A;  5CRE A;  2YWM A;  1LJR A;  2YWI A;  3G7I A;  5L71 A;  3PPU A;  1TK8 B;  2KP1 A;  4LL4 B;  1EV9 A;  3TJB A;  4WKW A;  5HFK A;  2HRN A;  1NHY A;  4MZC A;  2EFE A;  3VI5 A;  3DEX A;  5CYY A;  1PA3 A;  3ME7 A;  4GST A;  2I1U A;  1J9B A;  1XBS A;  4KH7 A;  4F0C A;  1FAA A;  4ACS A;  4BPY A;  3GKM A;  4JBB A;  3HHV A;  4EUY A;  3OR5 A;  4ZXG A;  3ZFB A;  2IFQ B;  4K2X A;  4A5P A;  1KTE A;  3ZRD A;  3TRX A;  5GAN D;  2FLS A;  3M1G A;  3DIE A;  1U88 A;  5D9W A;  3F63 A;  3P2A A;  4ID0 A;  4G0I A;  2EFD A;  5J4U A;  1FG4 A;  4F03 A;  3IV4 A;  1XW6 A;  1F6M C;  5A5H B;  4HZ4 A;  1M2D A;  2H6Z A;  1XVW A;  5DAL A;  4L0U A;  3GV1 A;  4YAP A;  1V57 A;  4ICY A;  4MNN A;  1X5E A;  5JWQ B;  3FKF A;  2X64 A;  4WXT A;  4KAE A;  4KCE A;  1YF0 A;  3D4M A;  1TOF A;  1OC9 A;  2HSN A;  2RUF A;  4MJE A;  5FHI A;  5EPF A;  3C71 A;  2O8V B;  5D8I A;  2HQT A;  5ECL B;  3CSJ A;  4P3Y B;  3P90 A;  4Q5F A;  3QR6 A;  1K0N A;  2J23 A;  3US3 A;  1UVZ A;  4O5Q A;  2IPA A;  4WF4 A;  3TJG A;  2L59 A;  2AUV A;  5AGY A;  4KDU A;  2L5O A;  3GYK A;  4MLY A;  2B6M A;  4KSM A;  1RQM A;  1A23 A;  2HZE B;  2G2Q A;  5DDL A;  1IYH A;  3WD6 A;  2CAI A;  2KHP A;  3QAW A;  1GSY A;  5D9T A;  5ID2 B;  2MMA A;  1AQW A;  2BMX A;  1M9A A;  3GX8 A;  3R2Q A;  1EGR A;  10GS A;  3M8N A;  1PL2 A;  4HQZ A;  3ZVJ D;  1S3C A;  2K8S A;  5JWR B;  4YKG A;  1WPI A;  4Q5N A;  1WIK A;  4PTS A;  1Q98 A;  4FO5 A;  2FHE A;  5IMC A;  2YAN A;  3FR9 A;  3HD5 A;  4TVE A;  4ECI A;  3IK7 A;  2F8F A;  2H1G A;  2H74 A;  1OKT A;  2XC2 A;  4J57 E;  4AKH A;  4EE0 A;  3MAK A;  1MD4 A;  2WJU A;  1JHB A;  12GS A;  4ML1 A;  1VF4 A;  5F05 A;  1Z9H A;  3VWU A;  1GNW A;  2HT9 A;  1USB A;  1J0F A;  5D73 A;  2GST A;  4HUA A;  4X1U A;  2H1D A;  2VD0 A;  1SK2 A;  5F8B A;  2H0H A;  3IE3 A;  4GLT A;  2LNS A;  4POB A;  4CW9 A;  4E68 A;  1FVK A;  1ON4 A;  4JU5 A;  4BVY B;  2MZC A;  1SD8 A;  2JZT A;  5HR1 A;  1CQG A;  2OBK A;  5B7C A;  4G10 A;  1UC7 A;  1TJD A;  14GS A;  1RK4 A;  4AKI A;  5INY A;  2PU9 C;  4RQX A;  2VL3 A;  3TUE A;  3F4T A;  3F4S A;  1TU7 A;  3WGX A;  2K8V A;  3CTG A;  4LL1 B;  2EIR A;  1G7O A;  3ZYW A;  3VK9 A;  5HFI A;  2L57 A;  3VWV A;  4PGT A;  2B5E A;  3H1N A;  3LFL A;  4MMM A;  3CTF A;  5H5R A;  5A5H A;  5B6M A;  5AIS A;  3UIW A;  2GVP A;  2PPT A;  2M80 A;  1A8Y A;  1NHO A;  1OKD A;  3L9S A;  2H1A A;  3UJ1 A;  4GXZ A;  1MTC A;  1V2A A;  3F3Q A;  2V1M A;  1T1V A;  2HSM A;  2L4Q A;  1SJ6 A;  3QDN A;  1WP0 A;  1EV4 A;  2RLI A;  1U3I A;  3KMN A;  2H70 A;  2B5Y A;  4I2T A;  2WGR A;  5GZZ B;  3V1W A;  8GSS A;  1XPV A;  3I9V 2;  3F8U A;  4OWY A;  5HFG A;  3RHB A;  1R5A A;  3UMA A;  1K0A A;  2P5R A;  2WFC A;  1XWB A;  2VM2 A;  4K6X A;  4MZB A;  2HRA A;  5GST A;  5G5F A;  3M9K A;  4BL7 B;  3C73 A;  3J7Y b;  1VF3 A;  4MA9 A;  5IPH A;  1EEM A;  1BF5 A;  2HFD A;  1Z5Y E;  3J7Y k;  5DJL A;  2HZE A;  2VCW A;  1TI1 A;  4K7N A;  2FWE A;  2VCZ A;  5KN1 A;  2B5X A;  3ZZX A;  1OE7 A;  3APS A;  1MDK A;  2GT5 A;  2R0G A;  2UZ8 A;  3ISO A;  1G6W A;  3A3T A;  5ID2 A;  3IC8 A;  1SJI A;  2YOI A;  1AXD A;  3DML A;  1TP9 A;  2L4C A;  4D73 B;  2J9H A;  4F0B A;  4JZQ A;  16GS A;  3ZFL A;  1WOU A;  2DJK A;  4KW6 A;  1A2M A;  2WUL A;  3C7M A;  1EOH A;  3LWA A;  1TRS A;  4DEJ A;  2O5V A;  1M9B A;  3IHG A;  2YP6 A;  3D5J A;  3HJM A;  4OFN A;  2PER A;  4K5S A;  3GKK A;  3UL3 A;  2AYT A;  4WBR D;  1GTA A;  3TKS A;  2F9S A;  3L4N A;  2IIY A;  3UAR A;  3IXR A;  1PRX A;  5ECP B;  2LNT A;  1T8E B;  2IMI A;  3HY2 A;  1SJZ A;  2QSI A;  3KTL A;  2R4V A;  1N8J A;  3RPP A;  4GQC A;  4BVY A;  3QCP A;  2OAC A;  1BQ7 A;  2FNO A;  2A4H A;  3ZLP A;  3CXG A;  1PSQ A;  3GL5 A;  1A2J A;  3PH9 A;  2P5Q A;  4K5R A;  5D93 A;  4OCE A;  1H4O A;  3ZTL A;  5GAP D;  3GHA A;  4HOJ A;  2YNX A;  1GWC A;  1TRW A;  7GSS A;  3APQ A;  3F3R A;  4G0K A;  2NBS A;  1T00 A;  1PD2 1;  2V6O A;  3QPM A;  1THO A;  2KP2 A;  4K7I A;  4HDE A;  4JR6 A;  3FR6 A;  1X9M B;  4KND A;  3UVH A;  1GH2 A;  4N0V A;  3BBY A;  2HI7 A;  2CX3 A;  4KA0 A;  2GZP A;  4K7O A;  2DMM A;  3KXO A;  3FEU A;  2BTO T;  3HYP A;  2YWO A;  2V41 A;  1FOV A;  1JLW A;  4ZIJ A;  2NVL A;  3G7J A;  3UVT A;  4AI6 A;  1Z3E A;  2YCD A;  1WE0 A;  1TTZ A;  3GN3 A;  1PN9 A;  5LNK e;  1GUK A;  2HRF A;  4GQF A;  3C1S A;  1ERV A;  1TK0 B;  3KP8 A;  1WMJ A;  4TR0 A;  1TXX A;  1G7E A;  5IMF A;  4AKG A;  1PL1 A;  4LMV A;  1XW9 A;  2A2R A;  1AUC A;  2C4J A;  1O7U A;  2E2G A;  4IEL A;  1OAZ A;  2DLX A;  4EIP A;  3PGT A;  1ERT A;  2XPE A;  2DIZ A;  1XIY A;  2CT6 A;  2X8G A;  2YN1 A;  3UOM A;  2NDO A;  1A0R P;  4KB3 A;  1TXU A;  3LJR A;  4YKF A;  11GS A;  2HYX A;  4IW9 A;  1QGV A;  3IC4 A;  2OAD A;  4TR3 A;  2C3T A;  4GWR A;  2I81 A;  1Z7R A;  1OYJ A;  3KTB A;  5C04 A;  2HRK B;  4GSN A;  2LV3 A;  5J9C A;  4EO3 A;  4D73 A;  1MEK A;  1T4Z A;  1JZW A;  1YKA A;  1HD2 A;  1GTB A;  2X99 A;  4XS1 A;  3ZIV A;  3LG6 A;  3UAP A;  2MMZ A;  3VWW A;  2XBI A;  3SBC A;  1YZX A;  5HR3 A;  2I4A A;  1TU8 A;  3D21 A;  2HE3 A;  2H8L A;  5FWG A;  5E4W A;  5KN0 A;  5DAK B;  5IPG A;  4TW5 A;  5F07 A;  3IOS A;  1A24 A;  4TOP A;  3GKN A;  3C1R A;  3HVV A;  3CBU A;  5DVB A;  2PVQ A;  5DQS A;  5ECH B;  3TJK A;  3HJO A;  2QKE A;  1BJX A;  2K18 A;  5ECM B;  4HS1 A;  4XS4 B;  4EC0 A;  2LJR A;  4TN8 A;  4ZL9 A;  1F3B A;  1SD9 A;  4G2E A;  1EP8 A;  2N5A A;  1SL2 B;  2GZY A;  4BWS A;  4NXI A;  4O32 A;  1A0F A;  3EU4 A;  1K3Y A;  1ZYE A;  2R2J A;  4IQA A;  4AF2 A;  3FZ5 A;  2PMT A;  1RW1 A;  1YKC A;  3VPT A;  6GSX A;  3BOA A;  1JZR A;  2EFH A;  5HR2 A;  1ILO A;  3S9F A;  4Q5Q A;  1ZGN A;  2GS3 A;  2C80 A;  1G6Y A;  18GS A;  1ERU A;  4KE3 A;  1BYE A;  2DBC A;  4POK A;  1QQ2 A;  4MAB A;  6GSW A;  2OE1 A;  3I43 A;  3WT1 A;  1PGT A;  2WB9 A;  5J9B A;  2A4V A;  3U5R E;  2B1L A;  3MIX A;  5ECK B;  4N10 A;  4FYB A;  2PGT A;  3UEM A;  2RUE A;  4MDC A;  5KOX A;  3Q6O A;  1G0T A;  3MNG A;  5JCW A;  1TW9 A;  3I6A A;  2AB6 A;  2ES7 A;  1M2B A;  3TRQ A;  3EC3 A;  3RAZ A;  1IYI A;  2F3M A;  4KF9 A;  4L0W A;  2Z9S A;  4PUF C;  2DJJ A;  4OO5 A;  2V32 A;  2OJL A;  4Z7X A;  2FA4 A;  2GLR A;  3KGK A;  3MWH A;  3MDK A;  1S3D A;  3HVS A;  3PR8 A;  4MPG A;  3VLN A;  3IPZ A;  2R37 A;  3AY8 A;  2LRC A;  4Z2T A;  2H30 A;  2CAQ A;  3LOR A;  4USS A;  2IMF A;  3GUR A;  2DJ2 A;  3NZN A;  2LTK A;  2WS2 A;  2C3N A;  5EL8 A;  2VKZ G;  2ALB A;  4I5Q A;  2L5L A;  5J4Y A;  2UV8 G;  2VUP A;  4EXJ A;  4KDX A;  4HU7 A;  4G19 A;  1M2A A;  1URM A;  4HI7 A;  6GST A;  1M99 A;  2IL3 A;  1FW1 A;  4IN0 A;  2X49 A;  3GKX A;  4ISD A;  3FRC A;  2IME A;  3O6T A;  1QFN A;  4IKH A;  4WR4 A;  4WEY A;  2HRK A;  4TXO B;  4ZB8 A;  5B8B A;  2MBS A;  1ZL9 A;  1TKD B;  2R0C A;  4MF6 A;  3N9J A;  3WT2 A;  3TKQ A;  3TRP A;  4OFT A;  1HNC A;  5BMU B;  4PNG A;  3TCO A;  3WYW A;  4EDY A;  1K0C A;  1K0D A;  1FHE A;  1GUH A;  5DAK A;  1UA5 A;  4YH2 A;  1F9M A;  2A2S A;  4MF7 A;  3L9V A;  3R3E A;  4ZBB A;  5ELG A;  1I5G A;  2DC5 A;  4PQH A;  3L0H A;  1ST9 A;  2FWH A;  2H75 A;  3TKS E;  4L5L A;  2LJA A;  4XS4 A;  1YEX A;  4N0Z A;  5CNW A;  1GNE A;  1ZYP A;  4IP6 A;  1TK5 B;  4E8H A;  4MJB A;  3HVX A;  3QFB C;  2ON5 A;  1HNA A;  3FW2 A;  1FOH A;  2V6K A;  1B48 A;  4PNF A;  3HDC A;  4Q5R A;  3F0I A;  1T7P B;  5HQP A;  2IFQ A;  2QA1 A;  1GSD A;  1O85 A;  3EU3 A;  3HJP A;  5IQY A;  1GUM A;  3A5I A;  1SKW B;  5HR0 A;  4N3Z A;  2A2P A;  3LW9 A;  2LKU A;  2YWN A;  1UN2 A;  3GL3 A;  3VWX A;  5ELA A;  5CRD A;  4K0N A;  2QGV A;  4EL1 A;  3ZVJ A;  3DYR A;  1EGO A;  1V58 A;  3FK8 A;  2L6C A;  4GRF A;  1YF1 A;  1Z7P A;  4K1F A;  1VGL A;  3N5O A;  1XOA A;  2H6X A;  4AJ7 A;  4N11 A;  2C0D A;  4POM A;  2V2G A;  1JFU A;  1F2E A;  2RII A;  5KOW A;  4ZB7 A;  2XPD A;  3CMI A;  1K3O A;  5EVO A;  3RPN A;  2I9H A;  2DML A;  1K0O A;  5A4W A;  1U87 A;  3A5W A;  1E2Y A;  3GH6 A;  1PN0 A;  1B4P A;  6GSU A;  2VLV A;  4RQR A;  3ERF A;  3TOU A;  2DJ1 A;  3GSS A;  3GTU B;  1CQH A;  5A1N B;  3TGZ A;  3HZ4 A;  2FD3 A;  4V2L A;  3E3E A;  4TR1 B;  3BCI A;  1GSE A;  1Y1U A;  2R3X A;  5IMA A;  1XVQ A;  1DBY A;  2YZU A;  2EIO A;  3EE2 A;  2H6Y A;  2LEG A;  1GSU A;  4XHM A;  1GL8 A;  4CDO A;  2CVK A;  4GCI A;  4NAX A;  2AHE A;  5ECR B;  1PQN A;  1YVL A;  4HJM A;  4XS6 A;  5G1L A;  1X9W B;  2CVB A;  4ZB6 A;  5AIX A;  2IMK A;  1HYU A;  2JAC A;  2OE3 A;  1FO5 A;  2GSR A;  2OA7 A;  5J41 A;  3QD9 A;  1ZCP A;  5H5S A;  2VCQ A;  3GH9 A;  4TXO A;  5IO2 A;  4ILF A;  4JR4 A;  1XZO A;  2MBT A;  2DJ0 A;  4EIQ A;  4X0X A;  1ZMA A;  4L5O A;  5BMU A;  5JCG A;  2TIR A;  4HU9 A;  3JCM L;  3D4T A;  1B4Q A;  5DBQ A;  1Z6N A;  4NWY A;  1XXU A;  3O3T A;  2B3S A;  3FZ9 A;  1ACV A;  2LST A;  2GT6 A;  2H66 A;  4NHW A;  4G0L A;  3GIX A;  1XW5 A;  4QL9 A;  5C00 A;  4MK3 A;  1X5C A;  1WJK A;  1KNG A;  1OC3 A;  2FUG 2;  2OBI A;  1JLV A;  3GST A;  2QC7 A;  1SVM A;  2YV7 A;  3TKP A;  5ENU A;  4ZL8 A;  1M0U A;  4X4J A;  1BG1 A;  4MH2 A;  2PVO C;  2CV4 A;  2VL2 C;  1MDJ A;  4G01 A;  2FWG A;  3SWL A;  1V9W A;  2OE0 A;  1XWA A;  1GTU A;  4AKX B;  5KN2 A;  3APO A;  3LSZ A;  1O8X A;  2GDR A;  5A5K A;  5DAL B;  3LXZ A;  2H19 A;  4HZ2 A;  5G5E A;  1EZK A;  3EMP A;  1S3A A;  5BRT A;  2GSQ A;  4DSR A;  4RI7 A;  2B7K A;  1ABA A;  4ZBA A;  5J3R A;  3F4R A;  1OC9 B;  2AJQ B;  2JSY A;  2L6D A;  4ZIL A;  1ZYN A;  2IMD A;  3KD0 A;  1V98 A;  4OMV A;  5A4U A;  4O5R A;  2GTU A;  2YZH A;  4ECB A;  2DKH A;  5IM9 A;  5D96 A;  3H4K A;  3EWL A;  3DRN A;  3GX0 A;  2CQ9 A;  1SK1 A;  5G30 A;  1GTI A;  1F3A A;  3FHK A;  4WF5 A;  1MDI A;  3WGD A;  2RM6 A;  3DVW A;  4BL7 A;  5IOW A;  4V1A g;  1PMT A;  3ZL5 A;  2KLX A;  2VIM A;  2C3Q A;  3GTU A;  1OC8 A;  1PX7 A;  4F82 A;  5A1N A;  4TR1 A;  4I97 A;  2MYG A;  3MSZ A;  3M0F A;  3F6D A;  3Q74 A;  1W4V A;  2KOK A;  1GRX A;  2WZ9 A;  3L9U A;  1E6B A;  3HXS A;  3CSH A;  4EDZ A;  3M3M A;  3E9J B;  4N30 A;  1Q4J A;  4OFM A;  3CYN A;  2LQO A;  1THX A;  19GS A;  4PQI A;  1GP1 A;  3HKR A;  4K8M A;  1BED A;  9GSS A;  1SVL A;  4O92 A;  4IP1 A;  5DQY A;  2JL4 A;  2AAW A;  3P8W A;  4XRD A;  1SYR A;  4ULX A;  4IBP A;  2X8H A;  1NM3 A;  4MH3 A;  2VCX A;  1PKZ A;  2QA2 A;  3QOU A;  1VF1 A;  2YJ7 A;  2CA8 A;  1YY7 A;  5J47 A;  4FIW A;  1XCC A;  3IAS 2;  4MJA A;  2MMN A;  1T4Y A;  1FB6 A;  1SKS B;  3EPT A;  4F2I A;  4J2F A;  5ECS A;  1ML6 A;  2H76 A;  3IHQ A;  3KIJ A;  3EIN A;  1GLP A;  3QFA C;  2HLS A;  2IWT A;  1A2L A;  4PXO A;  4XCS A;  4LLR A;  4MP4 A;  3D6I A;  4MPF A;  2E2M A;  1DSB A;  1Z6M A;  3TOT A;  5EY6 A;  4HEA 2;  1XWC A;  1N2A A;  1ZZY A;  1O6J A;  2GQL A;  2ON7 A;  4TRX A;  3D22 A;  3IR4 A;  2FWF A;  4NMU A;  4BVX B;  1YJ6 A;  4O7H A;  4NHZ A;  3A2V A;  5E59 A;  4LMW A;  3KEB A;  4FQU A;  1YEP A;  5DCG A;  2R5G A;  2DSA A;  1Y25 A;  1I9D A;  5JCU A;  2AV4 A;  2E7P A;  2HSM B;  3ZML A;  5D9V A;  22GS A;  2HXK A;  2EFC A;  1O73 A;  1WRY A;  3IRA A;  2H01 A;  1AC1 A;  4JRR A;  3HMJ G;  1NSW A;  4IJI A;  5D9X A;  5JWO B;  4HQS A;  2M46 A;  5ABR A;  4ECJ A;  1F37 A;  3KM6 A;  2N5F A;  3LXT A;  5IO0 A;  4IQ1 A;  4O5U A;  4J56 E;  3BJ5 A;  2VLT A;  1DUG A;  3RDW A;  1XFL A;  1DE2 A;  3TB2 A;  5IMZ A;  5COH A;  3TDG A;  2MMO A;  6GSY A;  3DKS A;  2DKI A;  2EIQ A;  4HJ2 A;  3KZQ A;  4K2D A;  2ZUP A;  2B7J A;  1DE1 A;  2C8U A;  3FYG A;  1SU9 A;  1PKW A;  3H93 A;  4DSQ A;  2VCT A;  2DJ3 A;  2C0F A;  1FVJ A;  5F06 A;  2VL9 A;  5GSS A;  4PQ1 A;  1WWJ A;  4W66 A;  2PWJ A;  2WRT A;  5IMV A;  2X8C A;  2WDU A;  1X0R A;  3HZ8 A;  4GF0 A;  3A2X A;  2GSS A;  1O8W A;  3KCM A;  2C0G A;  4K0G A;  2CZ2 A;  1MD3 A;  3C8E A;  4GDF A;  1XOB A;  4POL A;  2VOC A;  3G7Y A;  4G9H A;  4FH8 A;  1N25 A;  1OE8 A;  3NIV A;  3WGE A;  4IVF A;  4XTS A;  6GSS A;  3DXB A;  2O7K A;  4IS0 A;  3ERG A;  4I2U A;  3TJF A;  5DJM A;  1B9X C;  2FCH A;  2PUK C;  3BCK A;  3O76 A;  4DVC A;  2LUS A;  1KBN A;  5H5Q A;  1SEN A;  4PUR A;  5A34 B;  4NV5 A;  4BA7 A;  5IMD A;  2LQQ A;  4TXV A;  2HNL A;  3QAV A;  5CP1 A;  4V2M A;  2B1K A;  3KMO A;  4WET A;  4L8E A;  1QMV A;  3Q18 A;  1QXH A;  3A2W A;  1VF2 A;  3IK9 A;  2VLU A;  1R7H A;  4JE1 A;  2R0P A;  5B6N A;  2JSZ A;  4ZB9 A;  3I69 A;  1K3L A;  2PBJ A;  5CAX A;  13GS A;  3EVI A;  1A8L A;  3ED3 A;  3BD2 A;  2ZNM A;  1TDI A;  1X5D A;  5AIV A;  1BAY A;  5FT3 A;  5CO3 A;  4Z2U A;  3DD3 A;  2H1L A;  4FYU A;  3VI7 A;  3P7X A;  5F0G A;  1AQV A;  3F9U A;  5KN3 A;  5ECO B;  1O81 A;  1GLQ A;  4MZW A;  1SL0 B;  1R5P A;  4BWQ A;  3W8S A;  2DIY A;  1JZD A;  4DSS B;  3U6V A;  4KCA A;  2LJK A;  1K0M A;  3D0Z A;  2JZR A;  2XHF A;  4BVX A;  3RHC A;  4IGJ A;  4GTU A;  2R6K A;  3DGQ A;  2F51 A;  4OCF A;  5AN1 A;  2K6V A;  2O87 A;  4QMK A;  4TKY A;  4KX4 A;  4I6X A;  5J40 A;  3TJJ A;  5A4V A;  3HCZ A;  3ZIT A;  4MF5 A;  4AGS A;  5KEJ A;  3IAM 2;  1BG5 A;  3KH7 A;  2JZS A;  3CSI A;  3EYT A;  1Y6E A;  2FGX A;  2LRN A;  2M72 A;  4AJ8 A;  1SKR B;  1V40 A;  2OT3 A;  4FYC A;  1B9Y C;  3CRT A;  5ECN B;  2O85 A;  2VM1 A;  4ML6 A;  4I8B A;  4TR4 A;  1SL1 B;  5LCZ A;  2RM5 A;  2H0I A;  1GSQ A;  3CRU A;  3FMW A;  5CRG A;  4NV2 A;  2TRX A;  3GUS A;  4F9Z A;  1VRS D;  2BJX A;  4KUN A;  3H79 A;  4IHU A;  3GNJ A;  1AQX A;  5LD0 A;  4KSO A;  4YQV A;  4KDY A;  2G0F A;  2HZF A;  5DCH A;  2VD1 A;  2H72 A;  2X4A A;  1PX6 A;  2VO4 A;  1AIU A;  2O89 A;  3ERW A;  1GUL A;  3ZIJ A;  2CZ3 A;  3W8J A;  2LS5 A;  1TI3 A;  4YQM A;  1K0B A;  2IN3 A;  3F6F A;  3TKS C;  3QAG A;  2PN8 A;  2H73 A;  2P0G A;  1R26 A;  3L78 A;  5ECQ B;  4E8E A;  4AJ6 A;  4H86 A;  2D2Z A;  2VCV A;  3ZRE A;  1QUW A;  2H71 A;  2C1Y A;  3DWV A;  4CY8 A;  4EVM A;  4QL7 A;  3GMF A;  1FB0 A;  5CRH A;  2TRC P;  4KGI A;  1SYX A;  5A34 A;  2I3Y A;  1X9S B;  3FZ4 A;  1YQ1 A;  3PIN A;  1HQO A;  4YAV A;  1ERW A;  1J08 A;  1U6T A;  1LU4 A;  2XBQ A;  4IJ3 A;  4V1A p;  3HA9 A;  1KEB A;  3KH9 A;  3UBL A;  3GFK A;  1T3B A;  3GA4 A;  5IIZ A;  4CHS A;  3NOF A;  2FA8 A;  2FY6 A;  3EMX A;  1EWX A;  4XRA A;  4YQU A;  1NW2 A;  4WBJ A;  2HSH A;  2K9F A;  2YV9 A;  5ECI B;  5G31 A;  2VAF A;  3LYK A;  1JZO A;  4ZBD A;  3E0U A;  2WCI A;  4K9Z A;  2YPM A;  4X43 A;  20GS A;  1M7T A;  2JAD A;  1B8X A;  1TRU A;  2HSN B;  4PUA A;  4DSS A;  2VL2 A;  3MYD A;  2C0E A;  2OKA A;  4JED A;  1XWK A;  3GRX A;  2H0G A;  2IJY A;  1YDK A;  2GQK A;  1EOG A;  2E0Q A;  4LA1 A;  4XIH A;  4ZL7 A;  1EP7 A;  2NTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...