5DALA

Crystal structure of human glutathione transferase pi complexed with a metalloid in the presence of glutathione
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
210
structure length
209
Chain Sequence
MPPYTVVYFPVRGRAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
total genus 78
structure length 209
sequence length 210
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dalA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dalA01
1G6YA 3IOSA 1FHEA 3O6TA 5A4WA 3FEUA 1ZYEA 4LMWA 5CREA 4PNFA 1TOFA 4YQUA 2HRAA 2WJUA 5CP1A 3ZLPA 4NHZA 3KM6A 3RPNA 4RI7A 4XS1A 3J7Yk 1F3AA 2AB6A 2H0HA 3C71A 5HQPA 3CMIA 2L57A 2R4VA 3ZFLA 3GNJA 2VIMA 3LWAA 1SJ6A 3ERWA 4BL7A 3GTUA 3VK9A 1SYRA 4BVXA 1M99A 2AAWA 2VLUA 5JCGA 1AC1A 2GLRA 3KMOA 3KZQA 5HR0A 1PX7A 4NPBA 3IC8A 2OBKA 2C3QA 2L4CA 1K3YA 2JL4A 1A2LA 5H5QA 1H4OA 2IMFA 4O5RA 5B6NA 1U3AA 4L5LA 1YQ1A 4NHWA 4ZL7A 4IGJA 3M9KA 4HOJA 5DCHA 2CZ2A 4OFTA 4RQRA 1O8XA 2DC5A 1M2DA 2HSMB 1EOHA 3ZL5A 3GKMA 3TDGA 2XHFA 3N9JA 2GZYA 1QK8A 3SBCA 4N0ZA 4KGIA 2V2GA 1TW9A 3QAVA 4WR4A 3GX8A 2LJAA 5A4VA 3R2QA 3I69A 4EKZA 4ZB8A 2PWJA 4WF4A 1A2JA 2REMA 4BWSA 2CAIA 2VD0A 3WGEA 2R37A 4MF6A 1A0RP 2LNTA 5IMCA 3HY2A 1XWAA 1NHYA 4G0KA 1A8LA 4POKA 2H66A 1GTBA 1ZOFA 3ZZXA 2MMZA 2GQMA 2HSNB 3GKKA 2O85A 1AAZA 1UVZA 1U87A 3L9SA 4ZL8A 1QXHA 3US3A 2XPDA 1O8WA 2IL3A 4ECCA 1SK0A 5EVOA 1GSDA 2C4JA 1HD2A 3GH9A 1HNCA 2B3SA 1LU4A 1SKRB 2C0FA 5G30A 4O7HA 2BJXA 3IDVA 1K0BA 2R2JA 3BCKA 4HJMA 5EPFA 3ISOA 2HRFA 1YKCA 2XPEA 2C80A 1OE7A 2NVLA 2HRKA 2FWFA 2C0GA 3EVIA 4IQAA 1F3BA 5COHA 4K0GA 4EDYA 1AQXA 2JZRA 3GL3A 2F8AA 1TRVA 1H75A 2F3MA 5H5RA 4PQHA 3IK7A 4PX1A 4POMA 3QAGA 3LQ7A 5C00A 4MJBA 2VCVA 2I81A 3D4MA 5DJMA 2V6OA 5EL8A 4PXOA 4RQXA 1AUCA 2PBJA 17GSA 2K6VA 1KBNA 3Q19A 1WE0A 2FCHA 10GSA 1CQHA 2CQ9A 1WWJA 2L59A 4ZBDA 3F4SA 8GSSA 2AUVA 1PL1A 5IMVA 2RUEA 3EYTA 3OR5A 3I6AA 4TXVA 1WRYA 2J23A 4TW5A 1DUGA 3F9UA 2NBSA 3KEBA 3PPUA 1OC9B 4L0WA 3C1RA 2OE1A 1X9MB 2LQQA 2PPTA 2WS2A 3ZFBA 1EWXA 3ZIVA 1B9YC 3FZ9A 2LJKA 5ECPB 2RM6A 1GLPA 2LRNA 4CDOA 1X9WB 4J2FA 2GSSA 1K3LA 2AYTA 3H79A 1YEXA 2E0QA 2YV7A 4PTSA 4QQ7A 3TRQA 4PUFC 4OFNA 3D6IA 5HFKA 1EZKA 2PERA 3G7JA 4HJ2A 1MDIA 4I5QA 5F8BA 3HJPA 2FWGA 5AN1A 1N8JA 1QUWA 4XS6A 4WBJA 4FIWA 1XCCA 4N10A 4WKWA 2LEGA 1T4YA 4BWQA 2H30A 1QMVA 4GSTA 4KH7A 3GX0A 2OJLA 3WGDA 4PURA 5ENUA 4NV5A 3TOTA 3L4NA 1T8EB 3NIVA 3D0ZA 2FA8A 3KMNA 5IPHA 1USBA 5GAPD 2GZPA 1GTUA 13GSA 1WP0A 4V1Ap 1SENA 4ZIJA 2R3XA 20GSA 2IJYA 3HD5A 4OMVA 2WZ9A 4LL1B 3BJ5A 5IMDA 1Z9HA 4N11A 4N0VA 1QGVA 1KNGA 3IXRA 2G0FA 2DLXA 2FA4A 1WOUA 4OCFA 3P2AA 3IBHA 4MH3A 2HNLA 2EIRA 1SJZA 4MLYA 4AJ8A 3F63A 1S3DA 1XW9A 3RAZA 4NWYA 2VAFA 5JCUA 1F9MA 3U5RE 2PN8A 5HR1A 2B1LA 5J4UA 4MZBA 5J9CA 4K2DA 3IHQA 5J3RA 1T7PB 2DMMA 5CO3A 3GV1A 4MABA 1YZXA 1I9DA 4MK3A 1EV4A 1OKDA 3HVSA 5DQYA 4YQVA 2FUG2 1AQWA 2A2SA 3IC4A 2X8CA 5LNKe 2YOIA 1ML6A 6GSYA 3ZREA 3FYGA 2CVDA 2E2MA 4PGTA 3KD0A 22GSA 3IAM2 4FQUA 2VCWA 4TKYA 4KA0A 1SL2B 4MF5A 1X5DA 2FNOA 1TK8B 4F82A 5B6MA 4IELA 4POBA 1NHOA 1SK1A 4DSRA 5AIVA 9GSSA 4V2NA 3TKPA 4PNGA 2QGVA 3UOMA 4EC0A 4HU7A 3IK9A 1Z7PA 2H71A 3TKSE 2B7JA 3UBLA 3HZ4A 2GS3A 1M9BA 4TR1B 3ZVJA 2JACA 3ME8A 4WF5A 3UMAA 1XWBA 3F6FA 4AGSA 2P5QA 5CNWA 2N5FA 4TXOB 1ZZYA 4MH2A 2H6ZA 4E8EA 4XS4B 2YWMA 1X5CA 3VURA 3U6VA 1SYXA 1ERUA 1G6WA 5ELGA 5HFGA 18GSA 3LFLA 3HVXA 4MPFA 4F0BA 5D9TA 4N30A 4KAEA 4XTSA 2DJJA 2H76A 3LGCA 1SD8A 2GDRA 3RHBA 4NMUA 2M80A 2H1DA 5DALB 3TKRA 2HSMA 2E2GA 3TB2A 1O85A 2C3TA 4MA9A 2RUFA 1XW6A 2GQLA 2HQTA 2D2ZA 4ILFA 3RPPA 2OBIA 4HZ2A 3EWLA 3O76A 4XIHA 5FT3A 2NDOA 1GSFA 4ZXGA 1B9XC 4Q5RA 1S3CA 2C0EA 1GWCA 1IYHA 1EP7A 1B4QA 2WDUA 2PMTA 3ZMLA 1O6JA 5D93A 2UZ8A 4IP6A 4ML1A 3PGTA 5ECMB 3I9V2 1ILOA 1A2MA 5ECSA 1YY7A 4G2EA 1VF3A 1ST9A 5LD0A 1TP9A 3DWVA 3M8NA 3GSSA 4KF9A 5F06A 4GXZA 4GCIA 2YCDA 1EP8A 5E59A 2VCTA 3VWUA 1ACVA 4J56E 2F8FA 2EIOA 1PX6A 3J7Yb 3D4TA 4KE3A 1M0UA 6GSXA 2VCQA 1MD4A 3TJGA 3DRNA 3FZAA 2H73A 2TRXA 1SKWB 3WYWA 2B5EA 3ZYWA 2DJ0A 5ELAA 4NAXA 2C8UA 3GUSA 2OE3A 1TXXA 2VCXA 2HYXA 4JR4A 2VOCA 5D8IA 2VM1A 4OD7A 4MF7A 5AGYA 2L4QA 1JZDA 3LORA 1VGLA 2O8VB 5CYYA 2LS5A 1YEPA 4ZB6A 2I3YA 2JADA 1TU7A 4EE0A 2B5YA 3HHVA 1M7TA 3UL3A 4F0CA 3W8JA 3ERGA 4ACSA 3NOFA 3D21A 1XWKA 4OO4A 2CVKA 2VLTA 2X8HA 3IPZA 2GQKA 3DVWA 3TGZA 1K0DA 4XCSA 2AJQB 2V6KA 4D73B 4WBRD 2XC2A 3TRPA 3NZNA 19GSA 3VWXA 2YZUA 4ZBBA 1T3BA 1BEDA 1Z3EA 5G2ZA 1XXUA 2G2QA 4F9ZA 1XPVA 1EOGA 3TJKA 4G9HA 1N2AA 3K8NA 4FO5A 3KTBA 3CRUA 3DXBA 1FW1A 2H74A 3FHKA 5DDLA 3F3QA 1XOAA 2LQOA 3QD9A 1PA3A 1THXA 1ZCPA 2TRCP 1VF4A 4ZB9A 1GP1A 3QFAC 4V1Ag 4KUNA 4MPGA 2IFQA 1VF1A 2DJKA 1OKTA 1MDJA 5ECIB 1PQNA 3KTLA 2NPBA 5HR3A 3QAWA 2CV4A 2DMLA 3C1SA 1ERTA 4RI6A 2ZUPA 2HE3A 3FW2A 3DEXA 4Q5NA 1F37A 5DVBA 1XWGA 1XVQA 2FWHA 2WB9A 2MMOA 2ALBA 2KOKA 2RM5A 1GNWA 5INYA 2IIYA 5G1LA 3GRXA 2MYGA 3KH9A 3VI7A 4E8HA 2AHEA 3MSZA 1DSBA 2QC7A 3BBYA 2H75A 1NM3A 4K7NA 4KCAA 4IHUA 1GSSA 4YAPA 3Q18A 4GTUA 2OADA 2YWNA 3H8QA 3HA9A 3GIXA 1J9BA 2PVQA 2YWOA 1ZMAA 1SJIA 4J57E 1HNBA 2OE0A 1XVWA 2GZZA 1TI3A 1EGRA 2K8VA 3A3TA 3HXSA 2LV3A 1U6TA 2N5BA 1YF1A 3CSJA 3Q74A 2KHPA 5DQSA 1A0FA 4TR3A 3GMFA 2HZFA 2R5GA 2KUCA 3VWVA 4IKHA 2GTUA 4O32A 2KP2A 2MBTA 5IQYA 1A24A 5ECLB 2P5RA 1I5GA 3LSZA 2ON7A 4GLTA 3TKSC 1WIKA 2DBCA 4DEJA 2CX4A 1TU8A 12GSA 4XHMA 1G7EA 5ID2B 1GTAA 1OAZA 4ULXA 5G31A 3FKFA 3ZTLA 1HYUA 2GT6A 5KN3A 4OCEA 3HCZA 2B6MA 3QDNA 1OC3A 3CYNA 1WPIA 2WCIA 4GQFA 2DIZA 2H1BA 3VWWA 4QL7A 1ERWA 2HI7A 5KN2A 1BAYA 3M3MA 4EXJA 1NSWA 2IPAA 5A5KA 5IOWA 2MMAA 4JRRA 1B48A 3QFBC 4USSA 2F9SA 3ZRDA 1JZOA 2M46A 3IA1A 4YH2A 4TXOA 3PH9A 4G10A 1V58A 1TKDB 4XS4A 4K1FA 4K0NA 1PRXA 4K9ZA 4KCEA 3L9UA 3VFIA 4LL4B 1YF0A 5AIXA 4MJEA 1SL0B 2YV9A 3IRAA 1QQ2A 3V1WA 2DIYA 2VLVA 1K0MA 4WR5A 3GKNA 3LYPA 5DALA 2FY6A 4FYBA 4IN0A 2PUKC 2HZEA 4JU5A 2GGTA 3D5JA 2FLSA 1G0TA 3EE2A 3QOUA 3APQA 6GSWA 5DJLA 5CRHA 4Q5FA 4K8MA 5L71A 2YWIA 3GH6A 4OO5A 2FWEA 3M0FA 3UIWA 4PQ1A 4MZCA 6GSUA 3H93A 4WEYA 1R5PA 3MNGA 1SKSB 2RIIA 5KN1A 4O92A 3QMXA 2IMKA 3HJMA 2HLSA 2JZSA 1K3OA 2JZTA 4HDEA 1VRSD 1TDIA 3I43A 2GVPA 3RBTA 3TJFA 4MZWA 3APOA 1FO5A 2BMXA 6GSSA 3ZIJA 3KIJA 2ZNMA 3ZVJD 3BOAA 1ZGNA 4HUAA 3HDCA 2GSQA 1Z7RA 1PGTA 2BTOT 5ABRA 3CXGA 2KP1A 2GT5A 3CTFA 1T4ZA 5G5EA 2X8GA 2L6CA 3PINA 3A2VA 1FB6A 3UEMA 3FR6A 4ID0A 1A23A 1FG4A 1UA5A 1PD21 2L6DA 3KCMA 1B4PA 4G19A 2YANA 1B8XA 5F05A 4CW9A 5CAXA 2V41A 3GURA 2LTKA 4PQIA 1V57A 2H72A 3DVXA 3S9FA 1R26A 4FYCA 1PMTA 1LBKA 3G9BA 4L5OA 3SWLA 3P7XA 5GSTA 3DD3A 1TRUA 1KEBA 2QKEA 1K0CA 4HZ4A 4I2TA 1XOBA 2MBSA 5JWOB 3IAS2 2MZCA 2FHEA 3CTGA 5IOXA 1Q4JA 3RDWA 1K0OA 3LJRA 2H70A 2C0DA 4IJ3A 2RLIA 3KJYA 4IQ1A 1WMJA 1AXDA 2K18A 1Q98A 3EURA 3ME7A 2ON5A 2M72A 2WRTA 4CHSA 4KDUA 1GLQA 3IE3A 4JBBA 5DAKB 1EEMA 2X64A 4NV2A 1RK4A 2I9HA 4IW9A 3A5WA 1FAAA 1V2AA 2CA8A 1HNAA 4ECIA 2H6XA 6GSVA 4K7IA 5JCWA 3FZ5A 1GSEA 5CRDA 1V40A 1VF2A 4ECJA 4X1UA 1GUHA 2OA7A 2E7PA 4IP1A 2CZ3A 14GSA 4YQMA 1MD3A 4AF2A 4I8BA 1E6BA 2IN3A 1YJ6A 4QL9A 3KP8A 11GSA 3TJJA 5H5SA 2VL2A 1AW9A 4RUVA 2ES7A 1TJDA 2K9FA 1GNEA 2H19A 3WGXA 5IM9A 1JHBA 2TIRA 5A4UA 2L5OA 5IMZA 3PR8A 3GHAA 2ZCTA 1Z6MA 2GSRA 2JU5A 5ECKB 2KLXA 4KB3A 3R3EA 1FVKA 1Z5YE 1XIYA 1O73A 1JLVA 3DMLA 2YNXA 2H1AA 3C8EA 4KW6A 3KGKA 4BVYB 1F2EA 5LCZA 3GKXA 4TVEA 3UBKA 2HT9A 4KSMA 1JZRA 2WGRA 3LYKA 4GF0A 4DSSB 1GUKA 1WJKA 3TUEA 1TK0B 4DVCA 1DE1A 4F03A 3L0HA 5JWRB 4KNDA 2HSHA 5GZZB 4AJ7A 4JZQA 1URMA 3WD6A 1MDKA 3FZ4A 1GH2A 3N5OA 3P8WA 4HU9A 4LLRA 4L0UA 1OC9A 2C1YA 2XBQA 3ZITA 2C3NA 3Q6OA 4ISDA 3EU3A 3MAKA 2Z9SA 1AQVA 2XBIA 2DJ1A 3DIEA 2H6YA 1GSUA 2CX3A 1Y6EA 1THOA 2A4VA 1GULA 3L78A 5ID2A 3QPMA 1TTZA 5IMAA 1FVJA 1TRWA 1J0FA 1NW2A 1X9SB 2IMEA 1AIUA 1EV9A 4ZILA 3W6GA 2B5XA 1T1VA 1GUMA 3MDKA 7GSSA 3G7YA 4I6XA 4V2MA 5IO0A 5CRWA 1ZL9A 1R4WA 2DJ3A 5ECHB 4EO3A 3D22A 3QCPA 2V1MA 5J41A 1YKAA 1TI1A 2P31A 5HFIA 1XW5A 4LMVA 1LJRA 3FR3A 2EIQA 1DBYA 2H0GA 2A2RA 1F6MC 5D9WA 2V32A 1Y25A 3AY8A 2R6KA 2H0IA 3VPTA 5BMUA 3TKQA 2VL9A 1PKWA 3VI5A 1ZYQB 4KSOA 5IO2A 5B7CA 1V9WA 4TR4A 1DE2A 1OC8A 4BL7B 3HJOA 3GTUB 3M1GA 4OWYA 4EVMA 3WT2A 4BVXB 5G5FA 2YP6A 1PKZA 3UJ1A 1RW1A 3F0IA 1TRSA 3HZ8A 4TRXA 5D73A 1OVNA 4ECBA 3M9JA 3MWHA 2PU9C 5IMFA 4ML6A 2VO4A 1C72A 3L9VA 3GA4A 5JWQB 2O89A 1JFUA 5F07A 2CT6A 3W8SA 5DBQA 4TN8A 3LG6A 4MDCA 1QFNA 3KXOA 1OYJA 4Q5QA 4LA1A 1UN2A 2P0GA 3VPQA 2WULA 2O87A 4IS0A 2J9HA 1GSQA 1SD9A 3BD2A 5ECOB 4K6XA 1SL1B 1XFLA 2NTOA 2DJ2A 1GRXA 2LKUA 3E3EA 2IMIA 4MCUA 4ZL9A 5EY6A 3DGQA 4PUAA 2OACA 5GAND 1OE8A 4MJCA 5B8AA 1BJXA 2H1GA 2LUSA 5ECRB 1SK2A 4K7OA 4IJIA 1ABAA 2B1KA 3E9JB 4H86A 1GTIA 1BQ7A 2VM2A 3GL5A 3GFKA 1M2BA 5ECQB 4I2UA 4MMMA 1PL2A 3VLNA 3ZMKA 2IFQB 3TRXA 5C04A 4TR1A 3EU4A 3TKSA 1PSQA 1E2YA 2CAQA 3JCML 1W89A 2F51A 1K0NA 3C7MA 5G1KA 2YPMA 1SU9A 2GSTA 4IVFA 4X0XA 1YDKA 4HQSA 3UAPA 1EGOA 1ERVA 4ZBAA 5CRGA 3H4KA 2IWTA 4FH8A 5KN0A 4OFMA 2HRKB 1XWCA 3C73A 3UVTA 3BCIA 3F6DA 3DYRA 4G0IA 4FYUA 3KH7A 5IPGA 2VUPA 1MTCA 3WT1A 3P90A 2H8LA 3FY7A 2I4AA 3A2WA 4GWRA 2H01A 1M9AA 1XZOA 3HKRA 5FHIA 3IR4A 4G0LA 6GSTA 2LSTA 16GSA 3EMXA 3EC3A 2HRNA 3GN3A 5GSSA 4GQCA 2MMNA 3O3TA 3CSIA 4GSNA 4JEDA 1KTEA 3GSTA 3F4TA 4L8EA 2YN1A 5DAKA 1U88A 2HSYA 5KEJA 4HQZA 2QSIA 3EINA 4EUYA 2YJHA 4HEA2 3APSA 2I1UA 1CQGA 3TJBA 1X0RA 2L5LA 4TOPA 4IBPA 5J5NA 4NXIA 2AV4A 4Z7XA 4EDZA 1GL8A 2YJ7A 3A2XA 3DKSA 5F0GA 4P3YB 3LXZA 5E4WA 2JSZA 3RHCA 1JZWA 2JSYA 2IMDA 2VD1A 5DCGA 5J9BA 3ED3A 4DSQA 1PN9A 1G7OA 2DSAA 4GSSA 1W4VA 4XRAA 3F3RA 1A8YA 4X43A 2YZHA 1BX9A 3EMPA 1BG5A 1K0AA 4V2LA 2VL3A 4KX4A 3FR9A 4WETA 2LRCA 4EF0A 4F2IA 2WFCA 1O81A 1M2AA 3G7IA 3UARA 4BPYA 1GSYA 4XRDA 2FD3A 3F4RA 4POLA 5D96A 2HFDA 2OKAA 2PGTA 1R7HA 1FB0A 2LJRA 1MEKA 1FOVA 1RQMA 1V98A 3CRTA 4KDXA 2PVOC 5D9XA 4BVYA 2N5AA 4TR0A 2LNSA 5ECNB 5B8BA 3F8UA 1TK5B 3CSHA 3LEFA 1EEJA 1S3AA 2B7KA 4DSSA 4BA7A 4JR6A 3TCOA 3TOUA 3QR6A 4D73A 3UVHA 2X99A 2LRTA 2O7KA 4WXTA 1U3IA 2FGXA 5AISA 4AJ6A 2EC4A 1JLWA 5FWGA 3HVVA 2HXKA 2CVBA 4JE1A 2HZEB 5HR2A 4MP4A 3IV4A 1HQOA 3KP9A 3H1NA 4HI7A 1J08A 1O7UA 4HS1A 1BYEA 1UC7A 5IIZA 1Z6NA 2VL2C 4GRFA 1ON4A 1X5EA 5D9VA 3ERFA 4EL1A 4YAVA 1T00A 4MJAA 2K8SA 3GYKA 3CBUA 1XBSA 3HYPA 4I97A 4KDYA 2VCZA 1R5AA 3LXTA 3FK8A 1IYIA 3E0UA 3FRCA
chains in the Genus database with same CATH superfamily
1G6YA 2EFDA 3IOSA 1FHEA 3O6TA 5A4WA 3FEUA 1ZYEA 4LMWA 5CREA 4PNFA 1TOFA 4YQUA 2HRAA 2WJUA 2WVXB 2R0GA 5CP1A 3ZLPA 4NHZA 3KM6A 3RPNA 4RI7A 4XS1A 3J7Yk 1F3AA 2AB6A 2H0HA 3C71A 5HQPA 3CMIA 2L57A 2R4VA 3ZFLA 3GNJA 2VIMA 3LWAA 1SJ6A 3ERWA 4BL7A 3GTUA 3VK9A 1SYRA 2WZSA 4BVXA 5A5HA 1M99A 2AAWA 5A1NB 2VLUA 2OT3A 1AC1A 5JCGA 4GDFA 2GLRA 3KMOA 3KZQA 5HR0A 1PX7A 4NPBA 3IC8A 2OBKA 2C3QA 2L4CA 1K3YA 2JL4A 1A2LA 5H5QA 1H4OA 2IMFA 4O5RA 5B6NA 2O3EA 1U3AA 4L5LA 1YQ1A 4NHWA 4ZL7A 4IGJA 3M9KA 4HOJA 4AKGA 5DCHA 2CZ2A 4OFTA 2A4HA 4RQRA 1O8XA 2DC5A 1M2DA 2HSMB 1EOHA 2O5VA 3ZL5A 3GKMA 3TDGA 2XHFA 3N9JA 2GZYA 1QK8A 3SBCA 4N0ZA 4KGIA 2V2GA 1TW9A 3QAVA 4WR4A 3GX8A 2LJAA 5A4VA 3R2QA 3I69A 4EKZA 4ZB8A 2PWJA 4WF4A 1A2JA 2REMA 4BWSA 2CAIA 2VD0A 3WGEA 2R37A 4MF6A 1A0RP 2LNTA 2VKZG 5IMCA 3HY2A 1XWAA 1NHYA 4G0KA 1A8LA 4POKA 2H66A 1GTBA 1ZOFA 3ZZXA 2MMZA 2GQMA 2HSNB 3GKKA 2O85A 1AAZA 1UVZA 1U87A 3L9SA 4ZL8A 1QXHA 3US3A 2XPDA 1O8WA 2IL3A 4ECCA 1SK0A 5EVOA 1GSDA 2C4JA 1HD2A 5KOXA 3GH9A 1HNCA 2B3SA 1LU4A 1SKRB 2C0FA 5G30A 4O7HA 2BJXA 3IDVA 1K0BA 2R2JA 3BCKA 4HJMA 5EPFA 3ISOA 2HRFA 1YKCA 2XPEA 2C80A 1OE7A 2NVLA 2HRKA 2FWFA 2C0GA 3EVIA 4IQAA 1F3BA 5COHA 4K0GA 4EDYA 1AQXA 2JZRA 3GL3A 2F8AA 1TRVA 1H75A 2F3MA 5H5RA 4PQHA 3IK7A 4PX1A 4POMA 3QAGA 3LQ7A 5C00A 4MJBA 2VCVA 2I81A 3D4MA 5DJMA 2V6OA 5EL8A 4PXOA 4RQXA 1AUCA 2PBJA 17GSA 2K6VA 1KBNA 3Q19A 1WE0A 2FCHA 10GSA 1CQHA 2CQ9A 1WWJA 2L59A 4ZBDA 3F4SA 8GSSA 2AUVA 1PL1A 3CQFA 5IMVA 2RUEA 3EYTA 3OR5A 3I6AA 4TXVA 1WRYA 2J23A 4TW5A 1DUGA 3F9UA 2NBSA 3KEBA 3PPUA 1OC9B 4L0WA 3C1RA 2OE1A 1X9MB 2LQQA 2PPTA 2WS2A 3ZFBA 1EWXA 3ZIVA 3FZ9A 1B9YC 2LJKA 5ECPB 2RM6A 1GLPA 2LRNA 4CDOA 1X9WB 4J2FA 2GSSA 1K3LA 2AYTA 3H79A 1YEXA 2E0QA 2YV7A 4PTSA 4QQ7A 3TRQA 2R0PA 4PUFC 4OFNA 2WW1A 3D6IA 2A2PA 1FOHA 5HFKA 1EZKA 2PERA 3G7JA 4HJ2A 1MDIA 4I5QA 5F8BA 3HJPA 2FWGA 5AN1A 1N8JA 1QUWA 4XS6A 4WBJA 4FIWA 1XCCA 4N10A 4WKWA 2LEGA 1T4YA 4BWQA 2H30A 1QMVA 4GSTA 4KH7A 3GX0A 2UV8G 2OJLA 3WGDA 4PURA 5ENUA 4NV5A 3TOTA 3L4NA 1T8EB 3NIVA 3D0ZA 2FA8A 3KMNA 5IPHA 1USBA 5GAPD 2GZPA 1GTUA 13GSA 1S4BP 5J40A 1WP0A 4V1Ap 1SENA 4ZIJA 2R3XA 20GSA 2IJYA 3HD5A 4OMVA 2WZ9A 4LL1B 3BJ5A 4AI6A 5IMDA 4N3ZA 1Z9HA 4N11A 4N0VA 1QGVA 1KNGA 3IXRA 2G0FA 1M3JA 2DLXA 2FA4A 1WOUA 4OCFA 3P2AA 3IBHA 4MH3A 2HNLA 2EIRA 1SJZA 4MLYA 4AJ8A 3F63A 1S3DA 1XW9A 3RAZA 4NWYA 2VAFA 5JCUA 1F9MA 3U5RE 2PN8A 5HR1A 2B1LA 5J4UA 4MZBA 5J9CA 4K2DA 3IHQA 5J3RA 1T7PB 2DMMA 5CO3A 3GV1A 1YEWC 4MABA 1YZXA 1I9DA 4MK3A 1EV4A 1OKDA 3HVSA 5DQYA 4YQVA 2FUG2 1AQWA 2A2SA 3IC4A 2X8CA 5LNKe 2YOIA 1ML6A 6GSYA 3ZREA 3FYGA 2CVDA 2E2MA 4PGTA 3KD0A 22GSA 3IAM2 4FQUA 2VCWA 4TKYA 4KA0A 1SL2B 4MF5A 1X5DA 2FNOA 1TK8B 4F82A 5B6MA 4IELA 4POBA 1NHOA 1SK1A 4DSRA 5AIVA 9GSSA 4V2NA 3TKPA 4PNGA 2QGVA 2WVXA 3UOMA 4EC0A 4HU7A 3IK9A 1Z7PA 2H71A 3TKSE 2B7JA 1N25A 3UBLA 3HZ4A 2GS3A 1M9BA 4TR1B 3ZVJA 5BRTA 2JACA 3ME8A 4WF5A 3UMAA 4PHZC 1XWBA 3F6FA 4AGSA 2P5QA 5A1NA 5CNWA 2N5FA 4CY8A 4TXOB 1ZZYA 4MH2A 2H6ZA 4E8EA 4XS4B 2YWMA 1X5CA 3VURA 3U6VA 1SYXA 1ERUA 1G6WA 5ELGA 5HFGA 18GSA 3LFLA 3HVXA 4MPFA 4F0BA 5D9TA 4N30A 4KAEA 4XTSA 2DJJA 2H76A 3LGCA 1SD8A 2GDRA 3RHBA 4NMUA 2M80A 4G01A 2H1DA 5DALB 3TKRA 2HSMA 2E2GA 3TB2A 1O85A 2C3TA 4MA9A 2RUFA 1XW6A 2GQLA 2HQTA 2D2ZA 4ILFA 3RPPA 2OBIA 4HZ2A 3EWLA 3O76A 4XIHA 5FT3A 2NDOA 1GSFA 4ZXGA 1B9XC 4Q5RA 1S3CA 4K2XA 4EIPA 2C0EA 1GWCA 1IYHA 1EP7A 1B4QA 2WDUA 2PMTA 3ZMLA 1O6JA 3LW9A 5D93A 2UZ8A 4A5PA 4IP6A 1XG8A 4ML1A 3PGTA 5ECMB 3I9V2 1ILOA 1A2MA 5ECSA 2X4AA 1YY7A 4G2EA 1VF3A 1ST9A 5LD0A 1TP9A 3DWVA 3M8NA 3GSSA 4KF9A 5F06A 2WVZA 4GXZA 4GCIA 2YCDA 1EP8A 5E59A 2VCTA 3VWUA 1ACVA 4J56E 2F8FA 2EIOA 1PX6A 3J7Yb 3D4TA 4KE3A 1M0UA 6GSXA 2VCQA 1MD4A 3TJGA 3DRNA 3FZAA 2H73A 2TRXA 1SKWB 3WYWA 2B5EA 3ZYWA 2DJ0A 5ELAA 4NAXA 2C8UA 3GUSA 2OE3A 1I1IP 1TXXA 2VCXA 2HYXA 4JR4A 2VOCA 5D8IA 2VM1A 4OD7A 4MF7A 5AGYA 4O5UA 2L4QA 1JZDA 3LORA 1VGLA 2O8VB 5CYYA 2LS5A 1YEPA 4ZB6A 2I3YA 2JADA 1TU7A 4EE0A 5A34B 2B5YA 3HHVA 1M7TA 3UL3A 4F0CA 4FXYP 3ERGA 3W8JA 4ACSA 3NOFA 3D21A 1XWKA 4OO4A 2CVKA 2VLTA 2X8HA 3IPZA 2GQKA 3DVWA 3TGZA 1K0DA 4XCSA 2AJQB 2V6KA 4D73B 4WBRD 2XC2A 3TRPA 3NZNA 19GSA 3VWXA 2YZUA 4ZBBA 1T3BA 1BEDA 1Z3EA 5G2ZA 1XXUA 2G2QA 4F9ZA 1XPVA 1EOGA 3TJKA 4G9HA 1N2AA 3K8NA 4FO5A 3KTBA 3CRUA 3DXBA 4YKGA 1FW1A 2H74A 3FHKA 5DDLA 3F3QA 1XOAA 2LQOA 4ZB7A 3QD9A 1PA3A 1THXA 1ZCPA 2TRCP 1SVOA 1VF4A 4ZB9A 1GP1A 3QFAC 4V1Ag 4KUNA 4MPGA 2IFQA 1VF1A 2DJKA 1OKTA 1MDJA 5ECIB 1PQNA 3KTLA 2NPBA 5HR3A 3QAWA 2CV4A 2DMLA 3C1SA 1ERTA 4RI6A 2ZUPA 2HE3A 1BG1A 3FW2A 3DEXA 1ZYNA 3HMJG 4Q5NA 1F37A 5DVBA 1XWGA 1XVQA 2FWHA 2WB9A 2MMOA 2ALBA 2KOKA 2RM5A 1GNWA 5INYA 2IIYA 5G1LA 3GRXA 2MYGA 3KH9A 3VI7A 4E8HA 2AHEA 3MSZA 1DSBA 2QC7A 2R0CA 3BBYA 2H75A 1NM3A 4K7NA 4KCAA 4IHUA 1GSSA 4YAPA 3Q18A 2X49A 4GTUA 2OADA 2YWNA 3H8QA 3HA9A 3GIXA 1J9BA 1M3IA 2PVQA 2YWOA 1ZMAA 1SJIA 4J57E 1HNBA 2OE0A 1XVWA 2GZZA 1TI3A 1EGRA 4YKFA 2K8VA 3A3TA 3HXSA 2LV3A 1U6TA 2N5BA 1YF1A 3CSJA 3Q74A 2KHPA 5DQSA 1A0FA 4CY6A 4TR3A 3GMFA 2HZFA 2R5GA 2KUCA 2DKIA 3VWVA 4IKHA 2GTUA 4O32A 4X4JA 1S3RA 2KP2A 2MBTA 5IQYA 4K5RA 1A24A 5ECLB 2P5RA 1I5GA 3LSZA 2ON7A 4GLTA 3TKSC 1WIKA 2DBCA 4DEJA 2CX4A 1TU8A 12GSA 4XHMA 1G7EA 5ID2B 1GTAA 1OAZA 4ULXA 5G31A 3FKFA 3ZTLA 1HYUA 2GT6A 4Z2UA 5KN3A 4OCEA 3HCZA 2B6MA 3QDNA 3RGBC 1OC3A 3CYNA 1WPIA 2WCIA 4GQFA 2DIZA 2H1BA 3VWWA 4QL7A 1ERWA 2HI7A 5KN2A 1BAYA 3M3MA 4EXJA 1NSWA 2IPAA 5A5KA 5IOWA 2MMAA 4JRRA 1B48A 3QFBC 4USSA 2F9SA 3ZRDA 1JZOA 2H1LA 2M46A 3IA1A 4YH2A 5BMUB 4TXOA 3PH9A 4G10A 1V58A 1TKDB 4XS4A 4K1FA 4K0NA 1PRXA 4K9ZA 4KCEA 4O5QA 4AKHA 3L9UA 3VFIA 4LL4B 3CHXC 1YF0A 5AIXA 4MJEA 1SL0B 2YV9A 3IRAA 1QQ2A 3V1WA 2DIYA 4PI2C 2VLVA 1K0MA 4WR5A 3GKNA 3LYPA 5DALA 2FY6A 4FYBA 4IN0A 2PUKC 2HZEA 4HSCX 4JU5A 4MNNA 2GGTA 3D5JA 2FLSA 1G0TA 3EE2A 3QOUA 3APQA 6GSWA 5DJLA 5CRHA 4Q5FA 4K8MA 5L71A 2YWIA 3GH6A 4OO5A 2FWEA 3M0FA 3UIWA 4PQ1A 4MZCA 6GSUA 3H93A 4WEYA 1R5PA 3MNGA 1SKSB 2RIIA 5KN1A 4O92A 3QMXA 2IMKA 3HJMA 2HLSA 2JZSA 1K3OA 3TU3B 2JZTA 4HDEA 1VRSD 3A5IA 1TDIA 2WW3A 3I43A 2GVPA 3RBTA 3TJFA 4MZWA 3APOA 1FO5A 2BMXA 6GSSA 3ZIJA 3KIJA 2ZNMA 3ZVJD 3BOAA 1ZGNA 4HUAA 3HDCA 2GSQA 1Z7RA 1PGTA 2BTOT 5ABRA 3CXGA 2KP1A 2GT5A 3CTFA 1T4ZA 5G5EA 3FMWA 2X8GA 2L6CA 5J47A 3A2VA 3PINA 1FB6A 3UEMA 3FR6A 4ID0A 1A23A 1FG4A 1UA5A 1PD21 2L6DA 3KCMA 1B4PA 4G19A 2YANA 1B8XA 5F05A 4CW9A 5CAXA 2V41A 3GURA 2LTKA 4PQIA 1V57A 2H72A 3DVXA 3S9FA 1R26A 4FYCA 3HVNA 1PMTA 5A34A 1LBKA 3G9BA 4E68A 4L5OA 3SWLA 3P7XA 5GSTA 3DD3A 1TRUA 1KEBA 2QKEA 1K0CA 4HZ4A 4I2TA 1XOBA 2MBSA 5JWOB 3IAS2 2MZCA 2FHEA 3CTGA 5IOXA 1Q4JA 2QA1A 3RDWA 1K0OA 3LJRA 2H70A 2C0DA 4IJ3A 2RLIA 3KJYA 4IQ1A 1WMJA 1AXDA 2K18A 1Q98A 3EURA 2ON5A 3ME7A 2M72A 2WRTA 4CHSA 4KDUA 1GLQA 4Z2TA 3IE3A 4JBBA 5DAKB 1EEMA 2X64A 3CWGA 4NV2A 1RK4A 2I9HA 4IW9A 3A5WA 1FAAA 1V2AA 2CA8A 1HNAA 4ECIA 2H6XA 6GSVA 4K7IA 5JCWA 4W66A 3FZ5A 2HSNA 1GSEA 5CRDA 1V40A 1VF2A 4ECJA 4X1UA 1GUHA 2OA7A 2E7PA 4IP1A 2CZ3A 14GSA 4YQMA 1MD3A 4AF2A 4I8BA 1E6BA 2WVYA 2IN3A 1YJ6A 4QL9A 3RFRC 3KP8A 11GSA 3TJJA 5H5SA 2VL2A 1AW9A 4RUVA 3IHGA 2ES7A 1TJDA 2K9FA 1GNEA 2H19A 3WGXA 5IM9A 1JHBA 2TIRA 5A4UA 2L5OA 5IMZA 3PR8A 3GHAA 2ZCTA 1Z6MA 4PI0C 2GSRA 2JU5A 5ECKB 2KLXA 4KB3A 3R3EA 1FVKA 1Z5YE 1XIYA 1O73A 1JLVA 3DMLA 2YNXA 2H1AA 3C8EA 4KW6A 3KGKA 4BVYB 1F2EA 5LCZA 3GKXA 4TVEA 3UBKA 2HT9A 4KSMA 1JZRA 2WGRA 3LYKA 4GF0A 4DSSB 1GUKA 1WJKA 3TUEA 1TK0B 1ZYPA 4DVCA 1DE1A 4F03A 3L0HA 5JWRB 4KNDA 2HSHA 5GZZB 4AJ7A 4JZQA 1URMA 3WD6A 1MDKA 3MIXA 3FZ4A 1GH2A 3N5OA 3P8WA 4HU9A 4LLRA 4L0UA 1OC9A 2C1YA 2XBQA 3ZITA 2C3NA 3Q6OA 4ISDA 3EU3A 1TXUA 3MAKA 2Z9SA 1AQVA 2XBIA 2DJ1A 3DIEA 2H6YA 1GSUA 2CX3A 5J4YA 1Y6EA 1THOA 2A4VA 1GULA 3L78A 5ID2A 3MYDA 3QPMA 1TTZA 5IMAA 1FVJA 1TRWA 1J0FA 2WW2A 1NW2A 1X9SB 2O36A 2IMEA 1AIUA 1EV9A 4ZILA 3W6GA 2B5XA 1T1VA 1GUMA 3MDKA 7GSSA 3G7YA 4I6XA 4V2MA 5IO0A 5CRWA 1ZL9A 1PN0A 1R4WA 2DJ3A 5ECHB 4EO3A 3D22A 3QCPA 2V1MA 4Z2RA 1SVMA 5J41A 1YKAA 1TI1A 2P31A 5HFIA 1XW5A 4LMVA 1LJRA 3FR3A 2EIQA 1DBYA 2H0GA 2A2RA 1F6MC 5D9WA 2V32A 1Y25A 3AY8A 2R6KA 2H0IA 3VPTA 5BMUA 3TKQA 2VL9A 1PKWA 3VI5A 1ZYQB 4KSOA 5IO2A 5B7CA 1V9WA 4TR4A 1DE2A 1OC8A 4BL7B 3HJOA 3GTUB 3M1GA 4OWYA 4EVMA 3WT2A 4BVXB 5G5FA 2YP6A 5A5HB 1PKZA 3UJ1A 1RW1A 3F0IA 1TRSA 3HZ8A 4TRXA 5D73A 1OVNA 4ECBA 3M9JA 3MWHA 2PU9C 5IMFA 4ML6A 2VO4A 1C72A 3L9VA 3GA4A 1BF5A 5JWQB 2O89A 1JFUA 5F07A 2CT6A 3W8SA 2QA2A 5DBQA 4TN8A 3LG6A 4MDCA 1QFNA 3KXOA 1OYJA 4Q5QA 4LA1A 1UN2A 2P0GA 3VPQA 2WULA 2O87A 4IS0A 2J9HA 1GSQA 1SD9A 3BD2A 5ECOB 4K6XA 1SL1B 1XFLA 2NTOA 2DJ2A 1GRXA 2LKUA 3E3EA 2IMIA 4MCUA 4ZL9A 5EY6A 4K5SA 3DGQA 4PUAA 2OACA 5GAND 1OE8A 4MJCA 2DKHA 5B8AA 1BJXA 2H1GA 2LUSA 5ECRB 1SK2A 4K7OA 4IJIA 1ABAA 2B1KA 3E9JB 4H86A 1GTIA 1BQ7A 2VM2A 4BIKA 3GL5A 3GFKA 1M2BA 5ECQB 4I2UA 4MMMA 1PL2A 3VLNA 3ZMKA 2IFQB 3TRXA 5C04A 4TR1A 3EU4A 3TKSA 1PSQA 1E2YA 2CAQA 3JCML 1W89A 2F51A 1K0NA 3C7MA 5G1KA 2YPMA 1SU9A 2GSTA 4IVFA 4X0XA 1YDKA 3EPTA 4HQSA 3UAPA 1EGOA 1ERVA 4ZBAA 5CRGA 3H4KA 2IWTA 4FH8A 5KN0A 4OFMA 2HRKB 1XWCA 3C73A 3UVTA 3BCIA 3F6DA 3DYRA 4G0IA 4FYUA 3KH7A 5IPGA 2VUPA 1MTCA 3WT1A 3P90A 2H8LA 3FY7A 2I4AA 1PFOA 3A2WA 4GWRA 4ICYA 2H01A 1M9AA 1XZOA 3HKRA 5FHIA 3IR4A 4G0LA 6GSTA 2LSTA 16GSA 3EMXA 3EC3A 2HRNA 3GN3A 5GSSA 4GQCA 2MMNA 3O3TA 3CSIA 4GSNA 4JEDA 1KTEA 3GSTA 3F4TA 4L8EA 2YN1A 5DAKA 1U88A 2HSYA 5KEJA 4HQZA 2QSIA 3EINA 4EUYA 2YJHA 4HEA2 3APSA 2I1UA 1CQGA 3TJBA 1X0RA 2L5LA 4TOPA 4IBPA 5J5NA 4NXIA 1SVLA 2AV4A 4Z7XA 4EDZA 1GL8A 2YJ7A 2EFEA 3A2XA 3DKSA 5F0GA 4P3YB 3LXZA 5E4WA 2JSZA 3RHCA 1JZWA 1YVLA 2JSYA 2IMDA 2VD1A 5DCGA 5J9BA 3ED3A 4DSQA 1PN9A 1G7OA 2DSAA 4GSSA 1W4VA 4XRAA 3F3RA 2EFHA 1A8YA 4X43A 2YZHA 1BX9A 3EMPA 1BG5A 1K0AA 4V2LA 2VL3A 4KX4A 3FR9A 4WETA 2LRCA 4EF0A 4F2IA 2WFCA 5KOWA 1O81A 1M2AA 3G7IA 1Y1UA 3UARA 4BPYA 1GSYA 4XRDA 2FD3A 3F4RA 4POLA 5D96A 2HFDA 2OKAA 2PGTA 1R7HA 1FB0A 2LJRA 1MEKA 1FOVA 1RQMA 1V98A 3CRTA 4KDXA 2PVOC 5D9XA 4BVYA 2N5AA 4TR0A 2LNSA 5ECNB 5B8BA 3F8UA 1TK5B 4AKXB 3CSHA 3LEFA 1EEJA 1S3AA 2B7KA 4DSSA 4BA7A 4JR6A 3TCOA 3TOUA 5J4VA 3QR6A 4D73A 3UVHA 2X99A 2LRTA 2O7KA 4QMKA 4WXTA 1U3IA 2FGXA 5AISA 4AJ6A 2EC4A 1JLWA 5FWGA 3HVVA 2HXKA 2CVBA 4JE1A 2HZEB 5HR2A 4MP4A 4EIQA 3IV4A 1HQOA 3KP9A 3H1NA 4HI7A 1J08A 1O7UA 4AKIA 2EFCA 4HS1A 1BYEA 1UC7A 5IIZA 1Z6NA 2WW0A 2VL2C 4GRFA 1ON4A 1X5EA 5D9VA 3ERFA 4EL1A 4YAVA 1T00A 4MJAA 2K8SA 3GYKA 3CBUA 1XBSA 3HYPA 4I97A 4KDYA 2VCZA 1R5AA 3LXTA 3FK8A 1IYIA 3E0UA 3FRCA
chains in the Genus database with same CATH topology
1G6YA 2EFDA 3IOSA 1FHEA 3O6TA 5A4WA 3FEUA 1ZYEA 4LMWA 5CREA 4PNFA 1TOFA 4YQUA 2HRAA 2WJUA 2R0GA 5CP1A 3ZLPA 4NHZA 3KM6A 3RPNA 4RI7A 4XS1A 3J7Yk 1F3AA 2AB6A 2H0HA 3C71A 5HQPA 3CMIA 2L57A 2R4VA 3ZFLA 3GNJA 2VIMA 3LWAA 1SJ6A 3ERWA 4BL7A 3GTUA 3VK9A 1SYRA 4BVXA 5A5HA 1M99A 2AAWA 5A1NB 2VLUA 2OT3A 1AC1A 5JCGA 4GDFA 2GLRA 3KMOA 3KZQA 5HR0A 1PX7A 4NPBA 3IC8A 2OBKA 2C3QA 2L4CA 1K3YA 2JL4A 1A2LA 5H5QA 1H4OA 2IMFA 4O5RA 5B6NA 1U3AA 4L5LA 1YQ1A 4NHWA 4ZL7A 4IGJA 3M9KA 4HOJA 4AKGA 5DCHA 2CZ2A 4OFTA 2A4HA 4RQRA 1O8XA 2DC5A 1M2DA 2HSMB 1EOHA 2O5VA 3ZL5A 3GKMA 3TDGA 2XHFA 3N9JA 2GZYA 1QK8A 3SBCA 4N0ZA 4KGIA 2V2GA 1TW9A 3QAVA 4WR4A 3GX8A 2LJAA 5A4VA 3R2QA 3I69A 4EKZA 4ZB8A 2PWJA 4WF4A 1A2JA 2REMA 4BWSA 2CAIA 2VD0A 3WGEA 2R37A 4MF6A 1A0RP 2LNTA 2VKZG 5IMCA 3HY2A 1XWAA 1NHYA 4G0KA 1A8LA 4POKA 2H66A 1GTBA 1ZOFA 3ZZXA 2MMZA 2GQMA 2HSNB 3GKKA 2O85A 1AAZA 1UVZA 1U87A 3L9SA 4ZL8A 1QXHA 3US3A 2XPDA 1O8WA 2IL3A 4ECCA 1SK0A 5EVOA 1GSDA 2C4JA 1HD2A 5KOXA 3GH9A 1HNCA 2B3SA 1LU4A 1SKRB 2C0FA 5G30A 4O7HA 2BJXA 3IDVA 1K0BA 2R2JA 3BCKA 4HJMA 5EPFA 3ISOA 2HRFA 1YKCA 2XPEA 2C80A 1OE7A 2NVLA 2HRKA 2FWFA 2C0GA 3EVIA 4IQAA 1F3BA 5COHA 4K0GA 4EDYA 1AQXA 2JZRA 3GL3A 2F8AA 1TRVA 1H75A 2F3MA 5H5RA 4PQHA 3IK7A 4PX1A 4POMA 3QAGA 3LQ7A 5C00A 4MJBA 2VCVA 2I81A 3D4MA 5DJMA 2V6OA 5EL8A 4PXOA 4RQXA 1AUCA 2PBJA 17GSA 2K6VA 1KBNA 3Q19A 1WE0A 2FCHA 10GSA 1CQHA 2CQ9A 1WWJA 2L59A 4ZBDA 3F4SA 8GSSA 2AUVA 1PL1A 5IMVA 2RUEA 3EYTA 3OR5A 3I6AA 4TXVA 1WRYA 2J23A 4TW5A 1DUGA 3F9UA 2NBSA 3KEBA 3PPUA 1OC9B 4L0WA 3C1RA 2OE1A 1X9MB 2LQQA 2PPTA 2WS2A 3ZFBA 1EWXA 3ZIVA 3FZ9A 1B9YC 2LJKA 5ECPB 2RM6A 1GLPA 2LRNA 4CDOA 1X9WB 4J2FA 2GSSA 1K3LA 2AYTA 3H79A 1YEXA 2E0QA 2YV7A 4PTSA 4QQ7A 3TRQA 2R0PA 4PUFC 4OFNA 3D6IA 2A2PA 1FOHA 5HFKA 1EZKA 2PERA 3G7JA 4HJ2A 1MDIA 4I5QA 5F8BA 3HJPA 2FWGA 5AN1A 1N8JA 1QUWA 4XS6A 4WBJA 4FIWA 1XCCA 4N10A 4WKWA 2LEGA 1T4YA 4BWQA 2H30A 1QMVA 4GSTA 4KH7A 3GX0A 2UV8G 2OJLA 3WGDA 4PURA 5ENUA 4NV5A 3TOTA 3L4NA 1T8EB 3NIVA 3D0ZA 2FA8A 3KMNA 5IPHA 1USBA 5GAPD 2GZPA 1GTUA 13GSA 5J40A 1WP0A 4V1Ap 1SENA 4ZIJA 2R3XA 20GSA 2IJYA 3HD5A 4OMVA 2WZ9A 4LL1B 3BJ5A 4AI6A 5IMDA 4N3ZA 1Z9HA 4N11A 4N0VA 1QGVA 1KNGA 3IXRA 2G0FA 2DLXA 2FA4A 1WOUA 4OCFA 3P2AA 3IBHA 4MH3A 2HNLA 2EIRA 1SJZA 4MLYA 4AJ8A 3F63A 1S3DA 1XW9A 3RAZA 4NWYA 2VAFA 5JCUA 1F9MA 3U5RE 2PN8A 5HR1A 2B1LA 5J4UA 4MZBA 5J9CA 4K2DA 3IHQA 5J3RA 1T7PB 2DMMA 5CO3A 3GV1A 4MABA 1YZXA 1I9DA 4MK3A 1EV4A 1OKDA 3HVSA 5DQYA 4YQVA 2FUG2 1AQWA 2A2SA 3IC4A 2X8CA 5LNKe 2YOIA 1ML6A 6GSYA 3ZREA 3FYGA 2CVDA 2E2MA 4PGTA 3KD0A 22GSA 3IAM2 4FQUA 2VCWA 4TKYA 4KA0A 1SL2B 4MF5A 1X5DA 2FNOA 1TK8B 4F82A 5B6MA 4IELA 4POBA 1NHOA 1SK1A 4DSRA 5AIVA 9GSSA 4V2NA 3TKPA 4PNGA 2QGVA 3UOMA 4EC0A 4HU7A 3IK9A 1Z7PA 2H71A 3TKSE 2B7JA 1N25A 3UBLA 3HZ4A 2GS3A 1M9BA 4TR1B 3ZVJA 5BRTA 2JACA 3ME8A 4WF5A 3UMAA 1XWBA 3F6FA 4AGSA 2P5QA 5A1NA 5CNWA 2N5FA 4CY8A 4TXOB 1ZZYA 4MH2A 2H6ZA 4E8EA 4XS4B 2YWMA 1X5CA 3VURA 3U6VA 1SYXA 1ERUA 1G6WA 5ELGA 5HFGA 18GSA 3LFLA 3HVXA 4MPFA 4F0BA 5D9TA 4N30A 4KAEA 4XTSA 2DJJA 2H76A 3LGCA 1SD8A 2GDRA 3RHBA 4NMUA 2M80A 4G01A 2H1DA 5DALB 3TKRA 2HSMA 2E2GA 3TB2A 1O85A 2C3TA 4MA9A 2RUFA 1XW6A 2GQLA 2HQTA 2D2ZA 4ILFA 3RPPA 2OBIA 4HZ2A 3EWLA 3O76A 4XIHA 5FT3A 2NDOA 1GSFA 4ZXGA 1B9XC 4Q5RA 1S3CA 4K2XA 4EIPA 2C0EA 1GWCA 1IYHA 1EP7A 1B4QA 2WDUA 2PMTA 3ZMLA 1O6JA 3LW9A 5D93A 2UZ8A 4A5PA 4IP6A 4ML1A 3PGTA 5ECMB 3I9V2 1ILOA 1A2MA 5ECSA 2X4AA 1YY7A 4G2EA 1VF3A 1ST9A 5LD0A 1TP9A 3DWVA 3M8NA 3GSSA 4KF9A 5F06A 4GXZA 4GCIA 2YCDA 1EP8A 5E59A 2VCTA 3VWUA 1ACVA 4J56E 2F8FA 2EIOA 1PX6A 3J7Yb 3D4TA 4KE3A 1M0UA 6GSXA 2VCQA 1MD4A 3TJGA 3DRNA 3FZAA 2H73A 2TRXA 1SKWB 3WYWA 2B5EA 3ZYWA 2DJ0A 5ELAA 4NAXA 2C8UA 3GUSA 2OE3A 1TXXA 2VCXA 2HYXA 4JR4A 2VOCA 5D8IA 2VM1A 4OD7A 4MF7A 5AGYA 4O5UA 2L4QA 1JZDA 3LORA 1VGLA 2O8VB 5CYYA 2LS5A 1YEPA 4ZB6A 2I3YA 2JADA 1TU7A 4EE0A 5A34B 2B5YA 3HHVA 1M7TA 3UL3A 4F0CA 3W8JA 3ERGA 4ACSA 3NOFA 3D21A 1XWKA 4OO4A 2CVKA 2VLTA 2X8HA 3IPZA 2GQKA 3DVWA 3TGZA 1K0DA 4XCSA 2AJQB 2V6KA 4D73B 4WBRD 2XC2A 3TRPA 3NZNA 19GSA 3VWXA 2YZUA 4ZBBA 1T3BA 1BEDA 1Z3EA 5G2ZA 1XXUA 2G2QA 4F9ZA 1XPVA 1EOGA 3TJKA 4G9HA 1N2AA 3K8NA 4FO5A 3KTBA 3CRUA 3DXBA 4YKGA 1FW1A 2H74A 3FHKA 5DDLA 3F3QA 1XOAA 2LQOA 4ZB7A 3QD9A 1PA3A 1THXA 1ZCPA 2TRCP 1SVOA 1VF4A 4ZB9A 1GP1A 3QFAC 4V1Ag 4KUNA 4MPGA 2IFQA 1VF1A 2DJKA 1OKTA 1MDJA 5ECIB 1PQNA 3KTLA 2NPBA 5HR3A 3QAWA 2CV4A 2DMLA 3C1SA 1ERTA 4RI6A 2ZUPA 2HE3A 1BG1A 3FW2A 3DEXA 1ZYNA 3HMJG 4Q5NA 1F37A 5DVBA 1XWGA 1XVQA 2FWHA 2WB9A 2MMOA 2ALBA 2KOKA 2RM5A 1GNWA 5INYA 2IIYA 5G1LA 3GRXA 2MYGA 3KH9A 3VI7A 4E8HA 2AHEA 3MSZA 1DSBA 2QC7A 2R0CA 3BBYA 2H75A 1NM3A 4K7NA 4KCAA 4IHUA 1GSSA 4YAPA 3Q18A 2X49A 4GTUA 2OADA 2YWNA 3H8QA 3HA9A 3GIXA 1J9BA 2PVQA 2YWOA 1ZMAA 1SJIA 4J57E 1HNBA 2OE0A 1XVWA 2GZZA 1TI3A 1EGRA 4YKFA 2K8VA 3A3TA 3HXSA 2LV3A 1U6TA 2N5BA 1YF1A 3CSJA 3Q74A 2KHPA 5DQSA 1A0FA 4CY6A 4TR3A 3GMFA 2HZFA 2R5GA 2KUCA 2DKIA 3VWVA 4IKHA 2GTUA 4O32A 4X4JA 2KP2A 2MBTA 5IQYA 4K5RA 1A24A 5ECLB 2P5RA 1I5GA 3LSZA 2ON7A 4GLTA 3TKSC 1WIKA 2DBCA 4DEJA 2CX4A 1TU8A 12GSA 4XHMA 1G7EA 5ID2B 1GTAA 1OAZA 4ULXA 5G31A 3FKFA 3ZTLA 1HYUA 2GT6A 4Z2UA 5KN3A 4OCEA 3HCZA 2B6MA 3QDNA 1OC3A 3CYNA 1WPIA 2WCIA 4GQFA 2DIZA 2H1BA 3VWWA 4QL7A 1ERWA 2HI7A 5KN2A 1BAYA 3M3MA 4EXJA 1NSWA 2IPAA 5A5KA 5IOWA 2MMAA 4JRRA 1B48A 3QFBC 4USSA 2F9SA 3ZRDA 1JZOA 2H1LA 2M46A 3IA1A 4YH2A 5BMUB 4TXOA 3PH9A 4G10A 1V58A 1TKDB 4XS4A 4K1FA 4K0NA 1PRXA 4K9ZA 4KCEA 4O5QA 4AKHA 3L9UA 3VFIA 4LL4B 1YF0A 5AIXA 4MJEA 1SL0B 2YV9A 3IRAA 1QQ2A 3V1WA 2DIYA 2VLVA 1K0MA 4WR5A 3GKNA 3LYPA 5DALA 2FY6A 4FYBA 4IN0A 2PUKC 2HZEA 4JU5A 4MNNA 2GGTA 3D5JA 2FLSA 1G0TA 3EE2A 3QOUA 3APQA 6GSWA 5DJLA 5CRHA 4Q5FA 4K8MA 5L71A 2YWIA 3GH6A 4OO5A 2FWEA 3M0FA 3UIWA 4PQ1A 4MZCA 6GSUA 3H93A 4WEYA 1R5PA 3MNGA 1SKSB 2RIIA 5KN1A 4O92A 3QMXA 2IMKA 3HJMA 2HLSA 2JZSA 1K3OA 3TU3B 2JZTA 4HDEA 1VRSD 3A5IA 1TDIA 3I43A 2GVPA 3RBTA 3TJFA 4MZWA 3APOA 1FO5A 2BMXA 6GSSA 3ZIJA 3KIJA 2ZNMA 3ZVJD 3BOAA 1ZGNA 4HUAA 3HDCA 2GSQA 1Z7RA 1PGTA 2BTOT 5ABRA 3CXGA 2KP1A 2GT5A 3CTFA 1T4ZA 5G5EA 3FMWA 2X8GA 2L6CA 5J47A 3A2VA 3PINA 1FB6A 3UEMA 3FR6A 4ID0A 1A23A 1FG4A 1UA5A 1PD21 2L6DA 3KCMA 1B4PA 4G19A 2YANA 1B8XA 5F05A 4CW9A 5CAXA 2V41A 3GURA 2LTKA 4PQIA 1V57A 2H72A 3DVXA 3S9FA 1R26A 4FYCA 1PMTA 5A34A 1LBKA 3G9BA 4E68A 4L5OA 3SWLA 3P7XA 5GSTA 3DD3A 1TRUA 1KEBA 2QKEA 1K0CA 4HZ4A 4I2TA 1XOBA 2MBSA 5JWOB 3IAS2 2MZCA 2FHEA 3CTGA 5IOXA 1Q4JA 2QA1A 3RDWA 1K0OA 3LJRA 2H70A 2C0DA 4IJ3A 2RLIA 3KJYA 4IQ1A 1WMJA 1AXDA 2K18A 1Q98A 3EURA 3ME7A 2ON5A 2M72A 2WRTA 4CHSA 4KDUA 1GLQA 4Z2TA 3IE3A 4JBBA 5DAKB 1EEMA 2X64A 3CWGA 4NV2A 1RK4A 2I9HA 4IW9A 3A5WA 1FAAA 1V2AA 2CA8A 1HNAA 4ECIA 2H6XA 6GSVA 4K7IA 5JCWA 4W66A 3FZ5A 2HSNA 1GSEA 5CRDA 1V40A 1VF2A 4ECJA 4X1UA 1GUHA 2OA7A 2E7PA 4IP1A 2CZ3A 14GSA 4YQMA 1MD3A 4AF2A 4I8BA 1E6BA 2IN3A 1YJ6A 4QL9A 3KP8A 11GSA 3TJJA 5H5SA 2VL2A 1AW9A 4RUVA 3IHGA 2ES7A 1TJDA 2K9FA 1GNEA 2H19A 3WGXA 5IM9A 1JHBA 2TIRA 5A4UA 2L5OA 5IMZA 3PR8A 3GHAA 2ZCTA 1Z6MA 2GSRA 2JU5A 5ECKB 2KLXA 4KB3A 3R3EA 1FVKA 1Z5YE 1XIYA 1O73A 1JLVA 3DMLA 2YNXA 2H1AA 3C8EA 4KW6A 3KGKA 4BVYB 1F2EA 5LCZA 3GKXA 4TVEA 3UBKA 2HT9A 4KSMA 1JZRA 2WGRA 3LYKA 4GF0A 4DSSB 1GUKA 1WJKA 3TUEA 1TK0B 1ZYPA 4DVCA 1DE1A 4F03A 3L0HA 5JWRB 4KNDA 2HSHA 5GZZB 4AJ7A 4JZQA 1URMA 3WD6A 1MDKA 3MIXA 3FZ4A 1GH2A 3N5OA 3P8WA 4HU9A 4LLRA 4L0UA 1OC9A 2C1YA 2XBQA 3ZITA 2C3NA 3Q6OA 4ISDA 3EU3A 1TXUA 3MAKA 2Z9SA 1AQVA 2XBIA 2DJ1A 3DIEA 2H6YA 1GSUA 2CX3A 5J4YA 1Y6EA 1THOA 2A4VA 1GULA 3L78A 5ID2A 3MYDA 3QPMA 1TTZA 5IMAA 1FVJA 1TRWA 1J0FA 1NW2A 1X9SB 2IMEA 1AIUA 1EV9A 4ZILA 3W6GA 2B5XA 1T1VA 1GUMA 3MDKA 7GSSA 3G7YA 4I6XA 4V2MA 5IO0A 5CRWA 1ZL9A 1PN0A 1R4WA 2DJ3A 5ECHB 4EO3A 3D22A 3QCPA 2V1MA 4Z2RA 1SVMA 5J41A 1YKAA 1TI1A 2P31A 5HFIA 1XW5A 4LMVA 1LJRA 3FR3A 2EIQA 1DBYA 2H0GA 2A2RA 1F6MC 5D9WA 2V32A 1Y25A 3AY8A 2R6KA 2H0IA 3VPTA 5BMUA 3TKQA 2VL9A 1PKWA 3VI5A 1ZYQB 4KSOA 5IO2A 5B7CA 1V9WA 4TR4A 1DE2A 1OC8A 4BL7B 3HJOA 3GTUB 3M1GA 4OWYA 4EVMA 3WT2A 4BVXB 5G5FA 2YP6A 5A5HB 1PKZA 3UJ1A 1RW1A 3F0IA 1TRSA 3HZ8A 4TRXA 5D73A 1OVNA 4ECBA 3M9JA 3MWHA 2PU9C 5IMFA 4ML6A 2VO4A 1C72A 3L9VA 3GA4A 1BF5A 5JWQB 2O89A 1JFUA 5F07A 2CT6A 3W8SA 2QA2A 5DBQA 4TN8A 3LG6A 4MDCA 1QFNA 3KXOA 1OYJA 4Q5QA 4LA1A 1UN2A 2P0GA 3VPQA 2WULA 2O87A 4IS0A 2J9HA 1GSQA 1SD9A 3BD2A 5ECOB 4K6XA 1SL1B 1XFLA 2NTOA 2DJ2A 1GRXA 2LKUA 3E3EA 2IMIA 4MCUA 4ZL9A 5EY6A 4K5SA 3DGQA 4PUAA 2OACA 5GAND 1OE8A 4MJCA 2DKHA 5B8AA 1BJXA 2H1GA 2LUSA 5ECRB 1SK2A 4K7OA 4IJIA 1ABAA 2B1KA 3E9JB 4H86A 1GTIA 1BQ7A 2VM2A 3GL5A 3GFKA 1M2BA 5ECQB 4I2UA 4MMMA 1PL2A 3VLNA 3ZMKA 2IFQB 3TRXA 5C04A 4TR1A 3EU4A 3TKSA 1PSQA 1E2YA 2CAQA 3JCML 1W89A 2F51A 1K0NA 3C7MA 5G1KA 2YPMA 1SU9A 2GSTA 4IVFA 4X0XA 1YDKA 3EPTA 4HQSA 3UAPA 1EGOA 1ERVA 4ZBAA 5CRGA 3H4KA 2IWTA 4FH8A 5KN0A 4OFMA 2HRKB 1XWCA 3C73A 3UVTA 3BCIA 3F6DA 3DYRA 4G0IA 4FYUA 3KH7A 5IPGA 2VUPA 1MTCA 3WT1A 3P90A 2H8LA 3FY7A 2I4AA 3A2WA 4GWRA 4ICYA 2H01A 1M9AA 1XZOA 3HKRA 5FHIA 3IR4A 4G0LA 6GSTA 2LSTA 16GSA 3EMXA 3EC3A 2HRNA 3GN3A 5GSSA 4GQCA 2MMNA 3O3TA 3CSIA 4GSNA 4JEDA 1KTEA 3GSTA 3F4TA 4L8EA 2YN1A 5DAKA 1U88A 2HSYA 5KEJA 4HQZA 2QSIA 3EINA 4EUYA 2YJHA 4HEA2 3APSA 2I1UA 1CQGA 3TJBA 1X0RA 2L5LA 4TOPA 4IBPA 5J5NA 4NXIA 1SVLA 2AV4A 4Z7XA 4EDZA 1GL8A 2YJ7A 2EFEA 3A2XA 3DKSA 5F0GA 4P3YB 3LXZA 5E4WA 2JSZA 3RHCA 1JZWA 1YVLA 2JSYA 2IMDA 2VD1A 5DCGA 5J9BA 3ED3A 4DSQA 1PN9A 1G7OA 2DSAA 4GSSA 1W4VA 4XRAA 3F3RA 2EFHA 1A8YA 4X43A 2YZHA 1BX9A 3EMPA 1BG5A 1K0AA 4V2LA 2VL3A 4KX4A 3FR9A 4WETA 2LRCA 4EF0A 4F2IA 2WFCA 5KOWA 1O81A 1M2AA 3G7IA 1Y1UA 3UARA 4BPYA 1GSYA 4XRDA 2FD3A 3F4RA 4POLA 5D96A 2HFDA 2OKAA 2PGTA 1R7HA 1FB0A 2LJRA 1MEKA 1FOVA 1RQMA 1V98A 3CRTA 4KDXA 2PVOC 5D9XA 4BVYA 2N5AA 4TR0A 2LNSA 5ECNB 5B8BA 3F8UA 1TK5B 4AKXB 3CSHA 3LEFA 1EEJA 1S3AA 2B7KA 4DSSA 4BA7A 4JR6A 3TCOA 3TOUA 5J4VA 3QR6A 4D73A 3UVHA 2X99A 2LRTA 2O7KA 4QMKA 4WXTA 1U3IA 2FGXA 5AISA 4AJ6A 2EC4A 1JLWA 5FWGA 3HVVA 2HXKA 2CVBA 4JE1A 2HZEB 5HR2A 4MP4A 4EIQA 3IV4A 1HQOA 3KP9A 3H1NA 4HI7A 1J08A 1O7UA 4AKIA 2EFCA 4HS1A 1BYEA 1UC7A 5IIZA 1Z6NA 2VL2C 4GRFA 1ON4A 1X5EA 5D9VA 3ERFA 4EL1A 4YAVA 1T00A 4MJAA 2K8SA 3GYKA 3CBUA 1XBSA 3HYPA 4I97A 4KDYA 2VCZA 1R5AA 3LXTA 3FK8A 1IYIA 3E0UA 3FRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6Y A;  3IOS A;  1FHE A;  3O6T A;  5A4W A;  3FEU A;  1ZYE A;  4LMW A;  5CRE A;  4PNF A;  1TOF A;  4YQU A;  2HRA A;  2WJU A;  5CP1 A;  3ZLP A;  4NHZ A;  3KM6 A;  3RPN A;  4RI7 A;  4XS1 A;  3J7Y k;  1F3A A;  2AB6 A;  2H0H A;  3C71 A;  5HQP A;  3CMI A;  2L57 A;  2R4V A;  3ZFL A;  3GNJ A;  2VIM A;  3LWA A;  1SJ6 A;  3ERW A;  4BL7 A;  3GTU A;  3VK9 A;  1SYR A;  4BVX A;  1M99 A;  2AAW A;  2VLU A;  5JCG A;  1AC1 A;  2GLR A;  3KMO A;  3KZQ A;  5HR0 A;  1PX7 A;  4NPB A;  3IC8 A;  2OBK A;  2C3Q A;  2L4C A;  1K3Y A;  2JL4 A;  1A2L A;  5H5Q A;  1H4O A;  2IMF A;  4O5R A;  5B6N A;  1U3A A;  4L5L A;  1YQ1 A;  4NHW A;  4ZL7 A;  4IGJ A;  3M9K A;  4HOJ A;  5DCH A;  2CZ2 A;  4OFT A;  4RQR A;  1O8X A;  2DC5 A;  1M2D A;  2HSM B;  1EOH A;  3ZL5 A;  3GKM A;  3TDG A;  2XHF A;  3N9J A;  2GZY A;  1QK8 A;  3SBC A;  4N0Z A;  4KGI A;  2V2G A;  1TW9 A;  3QAV A;  4WR4 A;  3GX8 A;  2LJA A;  5A4V A;  3R2Q A;  3I69 A;  4EKZ A;  4ZB8 A;  2PWJ A;  4WF4 A;  1A2J A;  2REM A;  4BWS A;  2CAI A;  2VD0 A;  3WGE A;  2R37 A;  4MF6 A;  1A0R P;  2LNT A;  5IMC A;  3HY2 A;  1XWA A;  1NHY A;  4G0K A;  1A8L A;  4POK A;  2H66 A;  1GTB A;  1ZOF A;  3ZZX A;  2MMZ A;  2GQM A;  2HSN B;  3GKK A;  2O85 A;  1AAZ A;  1UVZ A;  1U87 A;  3L9S A;  4ZL8 A;  1QXH A;  3US3 A;  2XPD A;  1O8W A;  2IL3 A;  4ECC A;  1SK0 A;  5EVO A;  1GSD A;  2C4J A;  1HD2 A;  3GH9 A;  1HNC A;  2B3S A;  1LU4 A;  1SKR B;  2C0F A;  5G30 A;  4O7H A;  2BJX A;  3IDV A;  1K0B A;  2R2J A;  3BCK A;  4HJM A;  5EPF A;  3ISO A;  2HRF A;  1YKC A;  2XPE A;  2C80 A;  1OE7 A;  2NVL A;  2HRK A;  2FWF A;  2C0G A;  3EVI A;  4IQA A;  1F3B A;  5COH A;  4K0G A;  4EDY A;  1AQX A;  2JZR A;  3GL3 A;  2F8A A;  1TRV A;  1H75 A;  2F3M A;  5H5R A;  4PQH A;  3IK7 A;  4PX1 A;  4POM A;  3QAG A;  3LQ7 A;  5C00 A;  4MJB A;  2VCV A;  2I81 A;  3D4M A;  5DJM A;  2V6O A;  5EL8 A;  4PXO A;  4RQX A;  1AUC A;  2PBJ A;  17GS A;  2K6V A;  1KBN A;  3Q19 A;  1WE0 A;  2FCH A;  10GS A;  1CQH A;  2CQ9 A;  1WWJ A;  2L59 A;  4ZBD A;  3F4S A;  8GSS A;  2AUV A;  1PL1 A;  5IMV A;  2RUE A;  3EYT A;  3OR5 A;  3I6A A;  4TXV A;  1WRY A;  2J23 A;  4TW5 A;  1DUG A;  3F9U A;  2NBS A;  3KEB A;  3PPU A;  1OC9 B;  4L0W A;  3C1R A;  2OE1 A;  1X9M B;  2LQQ A;  2PPT A;  2WS2 A;  3ZFB A;  1EWX A;  3ZIV A;  1B9Y C;  3FZ9 A;  2LJK A;  5ECP B;  2RM6 A;  1GLP A;  2LRN A;  4CDO A;  1X9W B;  4J2F A;  2GSS A;  1K3L A;  2AYT A;  3H79 A;  1YEX A;  2E0Q A;  2YV7 A;  4PTS A;  4QQ7 A;  3TRQ A;  4PUF C;  4OFN A;  3D6I A;  5HFK A;  1EZK A;  2PER A;  3G7J A;  4HJ2 A;  1MDI A;  4I5Q A;  5F8B A;  3HJP A;  2FWG A;  5AN1 A;  1N8J A;  1QUW A;  4XS6 A;  4WBJ A;  4FIW A;  1XCC A;  4N10 A;  4WKW A;  2LEG A;  1T4Y A;  4BWQ A;  2H30 A;  1QMV A;  4GST A;  4KH7 A;  3GX0 A;  2OJL A;  3WGD A;  4PUR A;  5ENU A;  4NV5 A;  3TOT A;  3L4N A;  1T8E B;  3NIV A;  3D0Z A;  2FA8 A;  3KMN A;  5IPH A;  1USB A;  5GAP D;  2GZP A;  1GTU A;  13GS A;  1WP0 A;  4V1A p;  1SEN A;  4ZIJ A;  2R3X A;  20GS A;  2IJY A;  3HD5 A;  4OMV A;  2WZ9 A;  4LL1 B;  3BJ5 A;  5IMD A;  1Z9H A;  4N11 A;  4N0V A;  1QGV A;  1KNG A;  3IXR A;  2G0F A;  2DLX A;  2FA4 A;  1WOU A;  4OCF A;  3P2A A;  3IBH A;  4MH3 A;  2HNL A;  2EIR A;  1SJZ A;  4MLY A;  4AJ8 A;  3F63 A;  1S3D A;  1XW9 A;  3RAZ A;  4NWY A;  2VAF A;  5JCU A;  1F9M A;  3U5R E;  2PN8 A;  5HR1 A;  2B1L A;  5J4U A;  4MZB A;  5J9C A;  4K2D A;  3IHQ A;  5J3R A;  1T7P B;  2DMM A;  5CO3 A;  3GV1 A;  4MAB A;  1YZX A;  1I9D A;  4MK3 A;  1EV4 A;  1OKD A;  3HVS A;  5DQY A;  4YQV A;  2FUG 2;  1AQW A;  2A2S A;  3IC4 A;  2X8C A;  5LNK e;  2YOI A;  1ML6 A;  6GSY A;  3ZRE A;  3FYG A;  2CVD A;  2E2M A;  4PGT A;  3KD0 A;  22GS A;  3IAM 2;  4FQU A;  2VCW A;  4TKY A;  4KA0 A;  1SL2 B;  4MF5 A;  1X5D A;  2FNO A;  1TK8 B;  4F82 A;  5B6M A;  4IEL A;  4POB A;  1NHO A;  1SK1 A;  4DSR A;  5AIV A;  9GSS A;  4V2N A;  3TKP A;  4PNG A;  2QGV A;  3UOM A;  4EC0 A;  4HU7 A;  3IK9 A;  1Z7P A;  2H71 A;  3TKS E;  2B7J A;  3UBL A;  3HZ4 A;  2GS3 A;  1M9B A;  4TR1 B;  3ZVJ A;  2JAC A;  3ME8 A;  4WF5 A;  3UMA A;  1XWB A;  3F6F A;  4AGS A;  2P5Q A;  5CNW A;  2N5F A;  4TXO B;  1ZZY A;  4MH2 A;  2H6Z A;  4E8E A;  4XS4 B;  2YWM A;  1X5C A;  3VUR A;  3U6V A;  1SYX A;  1ERU A;  1G6W A;  5ELG A;  5HFG A;  18GS A;  3LFL A;  3HVX A;  4MPF A;  4F0B A;  5D9T A;  4N30 A;  4KAE A;  4XTS A;  2DJJ A;  2H76 A;  3LGC A;  1SD8 A;  2GDR A;  3RHB A;  4NMU A;  2M80 A;  2H1D A;  5DAL B;  3TKR A;  2HSM A;  2E2G A;  3TB2 A;  1O85 A;  2C3T A;  4MA9 A;  2RUF A;  1XW6 A;  2GQL A;  2HQT A;  2D2Z A;  4ILF A;  3RPP A;  2OBI A;  4HZ2 A;  3EWL A;  3O76 A;  4XIH A;  5FT3 A;  2NDO A;  1GSF A;  4ZXG A;  1B9X C;  4Q5R A;  1S3C A;  2C0E A;  1GWC A;  1IYH A;  1EP7 A;  1B4Q A;  2WDU A;  2PMT A;  3ZML A;  1O6J A;  5D93 A;  2UZ8 A;  4IP6 A;  4ML1 A;  3PGT A;  5ECM B;  3I9V 2;  1ILO A;  1A2M A;  5ECS A;  1YY7 A;  4G2E A;  1VF3 A;  1ST9 A;  5LD0 A;  1TP9 A;  3DWV A;  3M8N A;  3GSS A;  4KF9 A;  5F06 A;  4GXZ A;  4GCI A;  2YCD A;  1EP8 A;  5E59 A;  2VCT A;  3VWU A;  1ACV A;  4J56 E;  2F8F A;  2EIO A;  1PX6 A;  3J7Y b;  3D4T A;  4KE3 A;  1M0U A;  6GSX A;  2VCQ A;  1MD4 A;  3TJG A;  3DRN A;  3FZA A;  2H73 A;  2TRX A;  1SKW B;  3WYW A;  2B5E A;  3ZYW A;  2DJ0 A;  5ELA A;  4NAX A;  2C8U A;  3GUS A;  2OE3 A;  1TXX A;  2VCX A;  2HYX A;  4JR4 A;  2VOC A;  5D8I A;  2VM1 A;  4OD7 A;  4MF7 A;  5AGY A;  2L4Q A;  1JZD A;  3LOR A;  1VGL A;  2O8V B;  5CYY A;  2LS5 A;  1YEP A;  4ZB6 A;  2I3Y A;  2JAD A;  1TU7 A;  4EE0 A;  2B5Y A;  3HHV A;  1M7T A;  3UL3 A;  4F0C A;  3W8J A;  3ERG A;  4ACS A;  3NOF A;  3D21 A;  1XWK A;  4OO4 A;  2CVK A;  2VLT A;  2X8H A;  3IPZ A;  2GQK A;  3DVW A;  3TGZ A;  1K0D A;  4XCS A;  2AJQ B;  2V6K A;  4D73 B;  4WBR D;  2XC2 A;  3TRP A;  3NZN A;  19GS A;  3VWX A;  2YZU A;  4ZBB A;  1T3B A;  1BED A;  1Z3E A;  5G2Z A;  1XXU A;  2G2Q A;  4F9Z A;  1XPV A;  1EOG A;  3TJK A;  4G9H A;  1N2A A;  3K8N A;  4FO5 A;  3KTB A;  3CRU A;  3DXB A;  1FW1 A;  2H74 A;  3FHK A;  5DDL A;  3F3Q A;  1XOA A;  2LQO A;  3QD9 A;  1PA3 A;  1THX A;  1ZCP A;  2TRC P;  1VF4 A;  4ZB9 A;  1GP1 A;  3QFA C;  4V1A g;  4KUN A;  4MPG A;  2IFQ A;  1VF1 A;  2DJK A;  1OKT A;  1MDJ A;  5ECI B;  1PQN A;  3KTL A;  2NPB A;  5HR3 A;  3QAW A;  2CV4 A;  2DML A;  3C1S A;  1ERT A;  4RI6 A;  2ZUP A;  2HE3 A;  3FW2 A;  3DEX A;  4Q5N A;  1F37 A;  5DVB A;  1XWG A;  1XVQ A;  2FWH A;  2WB9 A;  2MMO A;  2ALB A;  2KOK A;  2RM5 A;  1GNW A;  5INY A;  2IIY A;  5G1L A;  3GRX A;  2MYG A;  3KH9 A;  3VI7 A;  4E8H A;  2AHE A;  3MSZ A;  1DSB A;  2QC7 A;  3BBY A;  2H75 A;  1NM3 A;  4K7N A;  4KCA A;  4IHU A;  1GSS A;  4YAP A;  3Q18 A;  4GTU A;  2OAD A;  2YWN A;  3H8Q A;  3HA9 A;  3GIX A;  1J9B A;  2PVQ A;  2YWO A;  1ZMA A;  1SJI A;  4J57 E;  1HNB A;  2OE0 A;  1XVW A;  2GZZ A;  1TI3 A;  1EGR A;  2K8V A;  3A3T A;  3HXS A;  2LV3 A;  1U6T A;  2N5B A;  1YF1 A;  3CSJ A;  3Q74 A;  2KHP A;  5DQS A;  1A0F A;  4TR3 A;  3GMF A;  2HZF A;  2R5G A;  2KUC A;  3VWV A;  4IKH A;  2GTU A;  4O32 A;  2KP2 A;  2MBT A;  5IQY A;  1A24 A;  5ECL B;  2P5R A;  1I5G A;  3LSZ A;  2ON7 A;  4GLT A;  3TKS C;  1WIK A;  2DBC A;  4DEJ A;  2CX4 A;  1TU8 A;  12GS A;  4XHM A;  1G7E A;  5ID2 B;  1GTA A;  1OAZ A;  4ULX A;  5G31 A;  3FKF A;  3ZTL A;  1HYU A;  2GT6 A;  5KN3 A;  4OCE A;  3HCZ A;  2B6M A;  3QDN A;  1OC3 A;  3CYN A;  1WPI A;  2WCI A;  4GQF A;  2DIZ A;  2H1B A;  3VWW A;  4QL7 A;  1ERW A;  2HI7 A;  5KN2 A;  1BAY A;  3M3M A;  4EXJ A;  1NSW A;  2IPA A;  5A5K A;  5IOW A;  2MMA A;  4JRR A;  1B48 A;  3QFB C;  4USS A;  2F9S A;  3ZRD A;  1JZO A;  2M46 A;  3IA1 A;  4YH2 A;  4TXO A;  3PH9 A;  4G10 A;  1V58 A;  1TKD B;  4XS4 A;  4K1F A;  4K0N A;  1PRX A;  4K9Z A;  4KCE A;  3L9U A;  3VFI A;  4LL4 B;  1YF0 A;  5AIX A;  4MJE A;  1SL0 B;  2YV9 A;  3IRA A;  1QQ2 A;  3V1W A;  2DIY A;  2VLV A;  1K0M A;  4WR5 A;  3GKN A;  3LYP A;  5DAL A;  2FY6 A;  4FYB A;  4IN0 A;  2PUK C;  2HZE A;  4JU5 A;  2GGT A;  3D5J A;  2FLS A;  1G0T A;  3EE2 A;  3QOU A;  3APQ A;  6GSW A;  5DJL A;  5CRH A;  4Q5F A;  4K8M A;  5L71 A;  2YWI A;  3GH6 A;  4OO5 A;  2FWE A;  3M0F A;  3UIW A;  4PQ1 A;  4MZC A;  6GSU A;  3H93 A;  4WEY A;  1R5P A;  3MNG A;  1SKS B;  2RII A;  5KN1 A;  4O92 A;  3QMX A;  2IMK A;  3HJM A;  2HLS A;  2JZS A;  1K3O A;  2JZT A;  4HDE A;  1VRS D;  1TDI A;  3I43 A;  2GVP A;  3RBT A;  3TJF A;  4MZW A;  3APO A;  1FO5 A;  2BMX A;  6GSS A;  3ZIJ A;  3KIJ A;  2ZNM A;  3ZVJ D;  3BOA A;  1ZGN A;  4HUA A;  3HDC A;  2GSQ A;  1Z7R A;  1PGT A;  2BTO T;  5ABR A;  3CXG A;  2KP1 A;  2GT5 A;  3CTF A;  1T4Z A;  5G5E A;  2X8G A;  2L6C A;  3PIN A;  3A2V A;  1FB6 A;  3UEM A;  3FR6 A;  4ID0 A;  1A23 A;  1FG4 A;  1UA5 A;  1PD2 1;  2L6D A;  3KCM A;  1B4P A;  4G19 A;  2YAN A;  1B8X A;  5F05 A;  4CW9 A;  5CAX A;  2V41 A;  3GUR A;  2LTK A;  4PQI A;  1V57 A;  2H72 A;  3DVX A;  3S9F A;  1R26 A;  4FYC A;  1PMT A;  1LBK A;  3G9B A;  4L5O A;  3SWL A;  3P7X A;  5GST A;  3DD3 A;  1TRU A;  1KEB A;  2QKE A;  1K0C A;  4HZ4 A;  4I2T A;  1XOB A;  2MBS A;  5JWO B;  3IAS 2;  2MZC A;  2FHE A;  3CTG A;  5IOX A;  1Q4J A;  3RDW A;  1K0O A;  3LJR A;  2H70 A;  2C0D A;  4IJ3 A;  2RLI A;  3KJY A;  4IQ1 A;  1WMJ A;  1AXD A;  2K18 A;  1Q98 A;  3EUR A;  3ME7 A;  2ON5 A;  2M72 A;  2WRT A;  4CHS A;  4KDU A;  1GLQ A;  3IE3 A;  4JBB A;  5DAK B;  1EEM A;  2X64 A;  4NV2 A;  1RK4 A;  2I9H A;  4IW9 A;  3A5W A;  1FAA A;  1V2A A;  2CA8 A;  1HNA A;  4ECI A;  2H6X A;  6GSV A;  4K7I A;  5JCW A;  3FZ5 A;  1GSE A;  5CRD A;  1V40 A;  1VF2 A;  4ECJ A;  4X1U A;  1GUH A;  2OA7 A;  2E7P A;  4IP1 A;  2CZ3 A;  14GS A;  4YQM A;  1MD3 A;  4AF2 A;  4I8B A;  1E6B A;  2IN3 A;  1YJ6 A;  4QL9 A;  3KP8 A;  11GS A;  3TJJ A;  5H5S A;  2VL2 A;  1AW9 A;  4RUV A;  2ES7 A;  1TJD A;  2K9F A;  1GNE A;  2H19 A;  3WGX A;  5IM9 A;  1JHB A;  2TIR A;  5A4U A;  2L5O A;  5IMZ A;  3PR8 A;  3GHA A;  2ZCT A;  1Z6M A;  2GSR A;  2JU5 A;  5ECK B;  2KLX A;  4KB3 A;  3R3E A;  1FVK A;  1Z5Y E;  1XIY A;  1O73 A;  1JLV A;  3DML A;  2YNX A;  2H1A A;  3C8E A;  4KW6 A;  3KGK A;  4BVY B;  1F2E A;  5LCZ A;  3GKX A;  4TVE A;  3UBK A;  2HT9 A;  4KSM A;  1JZR A;  2WGR A;  3LYK A;  4GF0 A;  4DSS B;  1GUK A;  1WJK A;  3TUE A;  1TK0 B;  4DVC A;  1DE1 A;  4F03 A;  3L0H A;  5JWR B;  4KND A;  2HSH A;  5GZZ B;  4AJ7 A;  4JZQ A;  1URM A;  3WD6 A;  1MDK A;  3FZ4 A;  1GH2 A;  3N5O A;  3P8W A;  4HU9 A;  4LLR A;  4L0U A;  1OC9 A;  2C1Y A;  2XBQ A;  3ZIT A;  2C3N A;  3Q6O A;  4ISD A;  3EU3 A;  3MAK A;  2Z9S A;  1AQV A;  2XBI A;  2DJ1 A;  3DIE A;  2H6Y A;  1GSU A;  2CX3 A;  1Y6E A;  1THO A;  2A4V A;  1GUL A;  3L78 A;  5ID2 A;  3QPM A;  1TTZ A;  5IMA A;  1FVJ A;  1TRW A;  1J0F A;  1NW2 A;  1X9S B;  2IME A;  1AIU A;  1EV9 A;  4ZIL A;  3W6G A;  2B5X A;  1T1V A;  1GUM A;  3MDK A;  7GSS A;  3G7Y A;  4I6X A;  4V2M A;  5IO0 A;  5CRW A;  1ZL9 A;  1R4W A;  2DJ3 A;  5ECH B;  4EO3 A;  3D22 A;  3QCP A;  2V1M A;  5J41 A;  1YKA A;  1TI1 A;  2P31 A;  5HFI A;  1XW5 A;  4LMV A;  1LJR A;  3FR3 A;  2EIQ A;  1DBY A;  2H0G A;  2A2R A;  1F6M C;  5D9W A;  2V32 A;  1Y25 A;  3AY8 A;  2R6K A;  2H0I A;  3VPT A;  5BMU A;  3TKQ A;  2VL9 A;  1PKW A;  3VI5 A;  1ZYQ B;  4KSO A;  5IO2 A;  5B7C A;  1V9W A;  4TR4 A;  1DE2 A;  1OC8 A;  4BL7 B;  3HJO A;  3GTU B;  3M1G A;  4OWY A;  4EVM A;  3WT2 A;  4BVX B;  5G5F A;  2YP6 A;  1PKZ A;  3UJ1 A;  1RW1 A;  3F0I A;  1TRS A;  3HZ8 A;  4TRX A;  5D73 A;  1OVN A;  4ECB A;  3M9J A;  3MWH A;  2PU9 C;  5IMF A;  4ML6 A;  2VO4 A;  1C72 A;  3L9V A;  3GA4 A;  5JWQ B;  2O89 A;  1JFU A;  5F07 A;  2CT6 A;  3W8S A;  5DBQ A;  4TN8 A;  3LG6 A;  4MDC A;  1QFN A;  3KXO A;  1OYJ A;  4Q5Q A;  4LA1 A;  1UN2 A;  2P0G A;  3VPQ A;  2WUL A;  2O87 A;  4IS0 A;  2J9H A;  1GSQ A;  1SD9 A;  3BD2 A;  5ECO B;  4K6X A;  1SL1 B;  1XFL A;  2NTO A;  2DJ2 A;  1GRX A;  2LKU A;  3E3E A;  2IMI A;  4MCU A;  4ZL9 A;  5EY6 A;  3DGQ A;  4PUA A;  2OAC A;  5GAN D;  1OE8 A;  4MJC A;  5B8A A;  1BJX A;  2H1G A;  2LUS A;  5ECR B;  1SK2 A;  4K7O A;  4IJI A;  1ABA A;  2B1K A;  3E9J B;  4H86 A;  1GTI A;  1BQ7 A;  2VM2 A;  3GL5 A;  3GFK A;  1M2B A;  5ECQ B;  4I2U A;  4MMM A;  1PL2 A;  3VLN A;  3ZMK A;  2IFQ B;  3TRX A;  5C04 A;  4TR1 A;  3EU4 A;  3TKS A;  1PSQ A;  1E2Y A;  2CAQ A;  3JCM L;  1W89 A;  2F51 A;  1K0N A;  3C7M A;  5G1K A;  2YPM A;  1SU9 A;  2GST A;  4IVF A;  4X0X A;  1YDK A;  4HQS A;  3UAP A;  1EGO A;  1ERV A;  4ZBA A;  5CRG A;  3H4K A;  2IWT A;  4FH8 A;  5KN0 A;  4OFM A;  2HRK B;  1XWC A;  3C73 A;  3UVT A;  3BCI A;  3F6D A;  3DYR A;  4G0I A;  4FYU A;  3KH7 A;  5IPG A;  2VUP A;  1MTC A;  3WT1 A;  3P90 A;  2H8L A;  3FY7 A;  2I4A A;  3A2W A;  4GWR A;  2H01 A;  1M9A A;  1XZO A;  3HKR A;  5FHI A;  3IR4 A;  4G0L A;  6GST A;  2LST A;  16GS A;  3EMX A;  3EC3 A;  2HRN A;  3GN3 A;  5GSS A;  4GQC A;  2MMN A;  3O3T A;  3CSI A;  4GSN A;  4JED A;  1KTE A;  3GST A;  3F4T A;  4L8E A;  2YN1 A;  5DAK A;  1U88 A;  2HSY A;  5KEJ A;  4HQZ A;  2QSI A;  3EIN A;  4EUY A;  2YJH A;  4HEA 2;  3APS A;  2I1U A;  1CQG A;  3TJB A;  1X0R A;  2L5L A;  4TOP A;  4IBP A;  5J5N A;  4NXI A;  2AV4 A;  4Z7X A;  4EDZ A;  1GL8 A;  2YJ7 A;  3A2X A;  3DKS A;  5F0G A;  4P3Y B;  3LXZ A;  5E4W A;  2JSZ A;  3RHC A;  1JZW A;  2JSY A;  2IMD A;  2VD1 A;  5DCG A;  5J9B A;  3ED3 A;  4DSQ A;  1PN9 A;  1G7O A;  2DSA A;  4GSS A;  1W4V A;  4XRA A;  3F3R A;  1A8Y A;  4X43 A;  2YZH A;  1BX9 A;  3EMP A;  1BG5 A;  1K0A A;  4V2L A;  2VL3 A;  4KX4 A;  3FR9 A;  4WET A;  2LRC A;  4EF0 A;  4F2I A;  2WFC A;  1O81 A;  1M2A A;  3G7I A;  3UAR A;  4BPY A;  1GSY A;  4XRD A;  2FD3 A;  3F4R A;  4POL A;  5D96 A;  2HFD A;  2OKA A;  2PGT A;  1R7H A;  1FB0 A;  2LJR A;  1MEK A;  1FOV A;  1RQM A;  1V98 A;  3CRT A;  4KDX A;  2PVO C;  5D9X A;  4BVY A;  2N5A A;  4TR0 A;  2LNS A;  5ECN B;  5B8B A;  3F8U A;  1TK5 B;  3CSH A;  3LEF A;  1EEJ A;  1S3A A;  2B7K A;  4DSS A;  4BA7 A;  4JR6 A;  3TCO A;  3TOU A;  3QR6 A;  4D73 A;  3UVH A;  2X99 A;  2LRT A;  2O7K A;  4WXT A;  1U3I A;  2FGX A;  5AIS A;  4AJ6 A;  2EC4 A;  1JLW A;  5FWG A;  3HVV A;  2HXK A;  2CVB A;  4JE1 A;  2HZE B;  5HR2 A;  4MP4 A;  3IV4 A;  1HQO A;  3KP9 A;  3H1N A;  4HI7 A;  1J08 A;  1O7U A;  4HS1 A;  1BYE A;  1UC7 A;  5IIZ A;  1Z6N A;  2VL2 C;  4GRF A;  1ON4 A;  1X5E A;  5D9V A;  3ERF A;  4EL1 A;  4YAV A;  1T00 A;  4MJA A;  2K8S A;  3GYK A;  3CBU A;  1XBS A;  3HYP A;  4I97 A;  4KDY A;  2VCZ A;  1R5A A;  3LXT A;  3FK8 A;  1IYI A;  3E0U A;  3FRC A; 
#chains in the Genus database with same CATH topology
 1G6Y A;  2EFD A;  3IOS A;  1FHE A;  3O6T A;  5A4W A;  3FEU A;  1ZYE A;  4LMW A;  5CRE A;  4PNF A;  1TOF A;  4YQU A;  2HRA A;  2WJU A;  2WVX B;  2R0G A;  5CP1 A;  3ZLP A;  4NHZ A;  3KM6 A;  3RPN A;  4RI7 A;  4XS1 A;  3J7Y k;  1F3A A;  2AB6 A;  2H0H A;  3C71 A;  5HQP A;  3CMI A;  2L57 A;  2R4V A;  3ZFL A;  3GNJ A;  2VIM A;  3LWA A;  1SJ6 A;  3ERW A;  4BL7 A;  3GTU A;  3VK9 A;  1SYR A;  2WZS A;  4BVX A;  5A5H A;  1M99 A;  2AAW A;  5A1N B;  2VLU A;  2OT3 A;  1AC1 A;  5JCG A;  4GDF A;  2GLR A;  3KMO A;  3KZQ A;  5HR0 A;  1PX7 A;  4NPB A;  3IC8 A;  2OBK A;  2C3Q A;  2L4C A;  1K3Y A;  2JL4 A;  1A2L A;  5H5Q A;  1H4O A;  2IMF A;  4O5R A;  5B6N A;  2O3E A;  1U3A A;  4L5L A;  1YQ1 A;  4NHW A;  4ZL7 A;  4IGJ A;  3M9K A;  4HOJ A;  4AKG A;  5DCH A;  2CZ2 A;  4OFT A;  2A4H A;  4RQR A;  1O8X A;  2DC5 A;  1M2D A;  2HSM B;  1EOH A;  2O5V A;  3ZL5 A;  3GKM A;  3TDG A;  2XHF A;  3N9J A;  2GZY A;  1QK8 A;  3SBC A;  4N0Z A;  4KGI A;  2V2G A;  1TW9 A;  3QAV A;  4WR4 A;  3GX8 A;  2LJA A;  5A4V A;  3R2Q A;  3I69 A;  4EKZ A;  4ZB8 A;  2PWJ A;  4WF4 A;  1A2J A;  2REM A;  4BWS A;  2CAI A;  2VD0 A;  3WGE A;  2R37 A;  4MF6 A;  1A0R P;  2LNT A;  2VKZ G;  5IMC A;  3HY2 A;  1XWA A;  1NHY A;  4G0K A;  1A8L A;  4POK A;  2H66 A;  1GTB A;  1ZOF A;  3ZZX A;  2MMZ A;  2GQM A;  2HSN B;  3GKK A;  2O85 A;  1AAZ A;  1UVZ A;  1U87 A;  3L9S A;  4ZL8 A;  1QXH A;  3US3 A;  2XPD A;  1O8W A;  2IL3 A;  4ECC A;  1SK0 A;  5EVO A;  1GSD A;  2C4J A;  1HD2 A;  5KOX A;  3GH9 A;  1HNC A;  2B3S A;  1LU4 A;  1SKR B;  2C0F A;  5G30 A;  4O7H A;  2BJX A;  3IDV A;  1K0B A;  2R2J A;  3BCK A;  4HJM A;  5EPF A;  3ISO A;  2HRF A;  1YKC A;  2XPE A;  2C80 A;  1OE7 A;  2NVL A;  2HRK A;  2FWF A;  2C0G A;  3EVI A;  4IQA A;  1F3B A;  5COH A;  4K0G A;  4EDY A;  1AQX A;  2JZR A;  3GL3 A;  2F8A A;  1TRV A;  1H75 A;  2F3M A;  5H5R A;  4PQH A;  3IK7 A;  4PX1 A;  4POM A;  3QAG A;  3LQ7 A;  5C00 A;  4MJB A;  2VCV A;  2I81 A;  3D4M A;  5DJM A;  2V6O A;  5EL8 A;  4PXO A;  4RQX A;  1AUC A;  2PBJ A;  17GS A;  2K6V A;  1KBN A;  3Q19 A;  1WE0 A;  2FCH A;  10GS A;  1CQH A;  2CQ9 A;  1WWJ A;  2L59 A;  4ZBD A;  3F4S A;  8GSS A;  2AUV A;  1PL1 A;  3CQF A;  5IMV A;  2RUE A;  3EYT A;  3OR5 A;  3I6A A;  4TXV A;  1WRY A;  2J23 A;  4TW5 A;  1DUG A;  3F9U A;  2NBS A;  3KEB A;  3PPU A;  1OC9 B;  4L0W A;  3C1R A;  2OE1 A;  1X9M B;  2LQQ A;  2PPT A;  2WS2 A;  3ZFB A;  1EWX A;  3ZIV A;  3FZ9 A;  1B9Y C;  2LJK A;  5ECP B;  2RM6 A;  1GLP A;  2LRN A;  4CDO A;  1X9W B;  4J2F A;  2GSS A;  1K3L A;  2AYT A;  3H79 A;  1YEX A;  2E0Q A;  2YV7 A;  4PTS A;  4QQ7 A;  3TRQ A;  2R0P A;  4PUF C;  4OFN A;  2WW1 A;  3D6I A;  2A2P A;  1FOH A;  5HFK A;  1EZK A;  2PER A;  3G7J A;  4HJ2 A;  1MDI A;  4I5Q A;  5F8B A;  3HJP A;  2FWG A;  5AN1 A;  1N8J A;  1QUW A;  4XS6 A;  4WBJ A;  4FIW A;  1XCC A;  4N10 A;  4WKW A;  2LEG A;  1T4Y A;  4BWQ A;  2H30 A;  1QMV A;  4GST A;  4KH7 A;  3GX0 A;  2UV8 G;  2OJL A;  3WGD A;  4PUR A;  5ENU A;  4NV5 A;  3TOT A;  3L4N A;  1T8E B;  3NIV A;  3D0Z A;  2FA8 A;  3KMN A;  5IPH A;  1USB A;  5GAP D;  2GZP A;  1GTU A;  13GS A;  1S4B P;  5J40 A;  1WP0 A;  4V1A p;  1SEN A;  4ZIJ A;  2R3X A;  20GS A;  2IJY A;  3HD5 A;  4OMV A;  2WZ9 A;  4LL1 B;  3BJ5 A;  4AI6 A;  5IMD A;  4N3Z A;  1Z9H A;  4N11 A;  4N0V A;  1QGV A;  1KNG A;  3IXR A;  2G0F A;  1M3J A;  2DLX A;  2FA4 A;  1WOU A;  4OCF A;  3P2A A;  3IBH A;  4MH3 A;  2HNL A;  2EIR A;  1SJZ A;  4MLY A;  4AJ8 A;  3F63 A;  1S3D A;  1XW9 A;  3RAZ A;  4NWY A;  2VAF A;  5JCU A;  1F9M A;  3U5R E;  2PN8 A;  5HR1 A;  2B1L A;  5J4U A;  4MZB A;  5J9C A;  4K2D A;  3IHQ A;  5J3R A;  1T7P B;  2DMM A;  5CO3 A;  3GV1 A;  1YEW C;  4MAB A;  1YZX A;  1I9D A;  4MK3 A;  1EV4 A;  1OKD A;  3HVS A;  5DQY A;  4YQV A;  2FUG 2;  1AQW A;  2A2S A;  3IC4 A;  2X8C A;  5LNK e;  2YOI A;  1ML6 A;  6GSY A;  3ZRE A;  3FYG A;  2CVD A;  2E2M A;  4PGT A;  3KD0 A;  22GS A;  3IAM 2;  4FQU A;  2VCW A;  4TKY A;  4KA0 A;  1SL2 B;  4MF5 A;  1X5D A;  2FNO A;  1TK8 B;  4F82 A;  5B6M A;  4IEL A;  4POB A;  1NHO A;  1SK1 A;  4DSR A;  5AIV A;  9GSS A;  4V2N A;  3TKP A;  4PNG A;  2QGV A;  2WVX A;  3UOM A;  4EC0 A;  4HU7 A;  3IK9 A;  1Z7P A;  2H71 A;  3TKS E;  2B7J A;  1N25 A;  3UBL A;  3HZ4 A;  2GS3 A;  1M9B A;  4TR1 B;  3ZVJ A;  5BRT A;  2JAC A;  3ME8 A;  4WF5 A;  3UMA A;  4PHZ C;  1XWB A;  3F6F A;  4AGS A;  2P5Q A;  5A1N A;  5CNW A;  2N5F A;  4CY8 A;  4TXO B;  1ZZY A;  4MH2 A;  2H6Z A;  4E8E A;  4XS4 B;  2YWM A;  1X5C A;  3VUR A;  3U6V A;  1SYX A;  1ERU A;  1G6W A;  5ELG A;  5HFG A;  18GS A;  3LFL A;  3HVX A;  4MPF A;  4F0B A;  5D9T A;  4N30 A;  4KAE A;  4XTS A;  2DJJ A;  2H76 A;  3LGC A;  1SD8 A;  2GDR A;  3RHB A;  4NMU A;  2M80 A;  4G01 A;  2H1D A;  5DAL B;  3TKR A;  2HSM A;  2E2G A;  3TB2 A;  1O85 A;  2C3T A;  4MA9 A;  2RUF A;  1XW6 A;  2GQL A;  2HQT A;  2D2Z A;  4ILF A;  3RPP A;  2OBI A;  4HZ2 A;  3EWL A;  3O76 A;  4XIH A;  5FT3 A;  2NDO A;  1GSF A;  4ZXG A;  1B9X C;  4Q5R A;  1S3C A;  4K2X A;  4EIP A;  2C0E A;  1GWC A;  1IYH A;  1EP7 A;  1B4Q A;  2WDU A;  2PMT A;  3ZML A;  1O6J A;  3LW9 A;  5D93 A;  2UZ8 A;  4A5P A;  4IP6 A;  1XG8 A;  4ML1 A;  3PGT A;  5ECM B;  3I9V 2;  1ILO A;  1A2M A;  5ECS A;  2X4A A;  1YY7 A;  4G2E A;  1VF3 A;  1ST9 A;  5LD0 A;  1TP9 A;  3DWV A;  3M8N A;  3GSS A;  4KF9 A;  5F06 A;  2WVZ A;  4GXZ A;  4GCI A;  2YCD A;  1EP8 A;  5E59 A;  2VCT A;  3VWU A;  1ACV A;  4J56 E;  2F8F A;  2EIO A;  1PX6 A;  3J7Y b;  3D4T A;  4KE3 A;  1M0U A;  6GSX A;  2VCQ A;  1MD4 A;  3TJG A;  3DRN A;  3FZA A;  2H73 A;  2TRX A;  1SKW B;  3WYW A;  2B5E A;  3ZYW A;  2DJ0 A;  5ELA A;  4NAX A;  2C8U A;  3GUS A;  2OE3 A;  1I1I P;  1TXX A;  2VCX A;  2HYX A;  4JR4 A;  2VOC A;  5D8I A;  2VM1 A;  4OD7 A;  4MF7 A;  5AGY A;  4O5U A;  2L4Q A;  1JZD A;  3LOR A;  1VGL A;  2O8V B;  5CYY A;  2LS5 A;  1YEP A;  4ZB6 A;  2I3Y A;  2JAD A;  1TU7 A;  4EE0 A;  5A34 B;  2B5Y A;  3HHV A;  1M7T A;  3UL3 A;  4F0C A;  4FXY P;  3ERG A;  3W8J A;  4ACS A;  3NOF A;  3D21 A;  1XWK A;  4OO4 A;  2CVK A;  2VLT A;  2X8H A;  3IPZ A;  2GQK A;  3DVW A;  3TGZ A;  1K0D A;  4XCS A;  2AJQ B;  2V6K A;  4D73 B;  4WBR D;  2XC2 A;  3TRP A;  3NZN A;  19GS A;  3VWX A;  2YZU A;  4ZBB A;  1T3B A;  1BED A;  1Z3E A;  5G2Z A;  1XXU A;  2G2Q A;  4F9Z A;  1XPV A;  1EOG A;  3TJK A;  4G9H A;  1N2A A;  3K8N A;  4FO5 A;  3KTB A;  3CRU A;  3DXB A;  4YKG A;  1FW1 A;  2H74 A;  3FHK A;  5DDL A;  3F3Q A;  1XOA A;  2LQO A;  4ZB7 A;  3QD9 A;  1PA3 A;  1THX A;  1ZCP A;  2TRC P;  1SVO A;  1VF4 A;  4ZB9 A;  1GP1 A;  3QFA C;  4V1A g;  4KUN A;  4MPG A;  2IFQ A;  1VF1 A;  2DJK A;  1OKT A;  1MDJ A;  5ECI B;  1PQN A;  3KTL A;  2NPB A;  5HR3 A;  3QAW A;  2CV4 A;  2DML A;  3C1S A;  1ERT A;  4RI6 A;  2ZUP A;  2HE3 A;  1BG1 A;  3FW2 A;  3DEX A;  1ZYN A;  3HMJ G;  4Q5N A;  1F37 A;  5DVB A;  1XWG A;  1XVQ A;  2FWH A;  2WB9 A;  2MMO A;  2ALB A;  2KOK A;  2RM5 A;  1GNW A;  5INY A;  2IIY A;  5G1L A;  3GRX A;  2MYG A;  3KH9 A;  3VI7 A;  4E8H A;  2AHE A;  3MSZ A;  1DSB A;  2QC7 A;  2R0C A;  3BBY A;  2H75 A;  1NM3 A;  4K7N A;  4KCA A;  4IHU A;  1GSS A;  4YAP A;  3Q18 A;  2X49 A;  4GTU A;  2OAD A;  2YWN A;  3H8Q A;  3HA9 A;  3GIX A;  1J9B A;  1M3I A;  2PVQ A;  2YWO A;  1ZMA A;  1SJI A;  4J57 E;  1HNB A;  2OE0 A;  1XVW A;  2GZZ A;  1TI3 A;  1EGR A;  4YKF A;  2K8V A;  3A3T A;  3HXS A;  2LV3 A;  1U6T A;  2N5B A;  1YF1 A;  3CSJ A;  3Q74 A;  2KHP A;  5DQS A;  1A0F A;  4CY6 A;  4TR3 A;  3GMF A;  2HZF A;  2R5G A;  2KUC A;  2DKI A;  3VWV A;  4IKH A;  2GTU A;  4O32 A;  4X4J A;  1S3R A;  2KP2 A;  2MBT A;  5IQY A;  4K5R A;  1A24 A;  5ECL B;  2P5R A;  1I5G A;  3LSZ A;  2ON7 A;  4GLT A;  3TKS C;  1WIK A;  2DBC A;  4DEJ A;  2CX4 A;  1TU8 A;  12GS A;  4XHM A;  1G7E A;  5ID2 B;  1GTA A;  1OAZ A;  4ULX A;  5G31 A;  3FKF A;  3ZTL A;  1HYU A;  2GT6 A;  4Z2U A;  5KN3 A;  4OCE A;  3HCZ A;  2B6M A;  3QDN A;  3RGB C;  1OC3 A;  3CYN A;  1WPI A;  2WCI A;  4GQF A;  2DIZ A;  2H1B A;  3VWW A;  4QL7 A;  1ERW A;  2HI7 A;  5KN2 A;  1BAY A;  3M3M A;  4EXJ A;  1NSW A;  2IPA A;  5A5K A;  5IOW A;  2MMA A;  4JRR A;  1B48 A;  3QFB C;  4USS A;  2F9S A;  3ZRD A;  1JZO A;  2H1L A;  2M46 A;  3IA1 A;  4YH2 A;  5BMU B;  4TXO A;  3PH9 A;  4G10 A;  1V58 A;  1TKD B;  4XS4 A;  4K1F A;  4K0N A;  1PRX A;  4K9Z A;  4KCE A;  4O5Q A;  4AKH A;  3L9U A;  3VFI A;  4LL4 B;  3CHX C;  1YF0 A;  5AIX A;  4MJE A;  1SL0 B;  2YV9 A;  3IRA A;  1QQ2 A;  3V1W A;  2DIY A;  4PI2 C;  2VLV A;  1K0M A;  4WR5 A;  3GKN A;  3LYP A;  5DAL A;  2FY6 A;  4FYB A;  4IN0 A;  2PUK C;  2HZE A;  4HSC X;  4JU5 A;  4MNN A;  2GGT A;  3D5J A;  2FLS A;  1G0T A;  3EE2 A;  3QOU A;  3APQ A;  6GSW A;  5DJL A;  5CRH A;  4Q5F A;  4K8M A;  5L71 A;  2YWI A;  3GH6 A;  4OO5 A;  2FWE A;  3M0F A;  3UIW A;  4PQ1 A;  4MZC A;  6GSU A;  3H93 A;  4WEY A;  1R5P A;  3MNG A;  1SKS B;  2RII A;  5KN1 A;  4O92 A;  3QMX A;  2IMK A;  3HJM A;  2HLS A;  2JZS A;  1K3O A;  3TU3 B;  2JZT A;  4HDE A;  1VRS D;  3A5I A;  1TDI A;  2WW3 A;  3I43 A;  2GVP A;  3RBT A;  3TJF A;  4MZW A;  3APO A;  1FO5 A;  2BMX A;  6GSS A;  3ZIJ A;  3KIJ A;  2ZNM A;  3ZVJ D;  3BOA A;  1ZGN A;  4HUA A;  3HDC A;  2GSQ A;  1Z7R A;  1PGT A;  2BTO T;  5ABR A;  3CXG A;  2KP1 A;  2GT5 A;  3CTF A;  1T4Z A;  5G5E A;  3FMW A;  2X8G A;  2L6C A;  5J47 A;  3A2V A;  3PIN A;  1FB6 A;  3UEM A;  3FR6 A;  4ID0 A;  1A23 A;  1FG4 A;  1UA5 A;  1PD2 1;  2L6D A;  3KCM A;  1B4P A;  4G19 A;  2YAN A;  1B8X A;  5F05 A;  4CW9 A;  5CAX A;  2V41 A;  3GUR A;  2LTK A;  4PQI A;  1V57 A;  2H72 A;  3DVX A;  3S9F A;  1R26 A;  4FYC A;  3HVN A;  1PMT A;  5A34 A;  1LBK A;  3G9B A;  4E68 A;  4L5O A;  3SWL A;  3P7X A;  5GST A;  3DD3 A;  1TRU A;  1KEB A;  2QKE A;  1K0C A;  4HZ4 A;  4I2T A;  1XOB A;  2MBS A;  5JWO B;  3IAS 2;  2MZC A;  2FHE A;  3CTG A;  5IOX A;  1Q4J A;  2QA1 A;  3RDW A;  1K0O A;  3LJR A;  2H70 A;  2C0D A;  4IJ3 A;  2RLI A;  3KJY A;  4IQ1 A;  1WMJ A;  1AXD A;  2K18 A;  1Q98 A;  3EUR A;  2ON5 A;  3ME7 A;  2M72 A;  2WRT A;  4CHS A;  4KDU A;  1GLQ A;  4Z2T A;  3IE3 A;  4JBB A;  5DAK B;  1EEM A;  2X64 A;  3CWG A;  4NV2 A;  1RK4 A;  2I9H A;  4IW9 A;  3A5W A;  1FAA A;  1V2A A;  2CA8 A;  1HNA A;  4ECI A;  2H6X A;  6GSV A;  4K7I A;  5JCW A;  4W66 A;  3FZ5 A;  2HSN A;  1GSE A;  5CRD A;  1V40 A;  1VF2 A;  4ECJ A;  4X1U A;  1GUH A;  2OA7 A;  2E7P A;  4IP1 A;  2CZ3 A;  14GS A;  4YQM A;  1MD3 A;  4AF2 A;  4I8B A;  1E6B A;  2WVY A;  2IN3 A;  1YJ6 A;  4QL9 A;  3RFR C;  3KP8 A;  11GS A;  3TJJ A;  5H5S A;  2VL2 A;  1AW9 A;  4RUV A;  3IHG A;  2ES7 A;  1TJD A;  2K9F A;  1GNE A;  2H19 A;  3WGX A;  5IM9 A;  1JHB A;  2TIR A;  5A4U A;  2L5O A;  5IMZ A;  3PR8 A;  3GHA A;  2ZCT A;  1Z6M A;  4PI0 C;  2GSR A;  2JU5 A;  5ECK B;  2KLX A;  4KB3 A;  3R3E A;  1FVK A;  1Z5Y E;  1XIY A;  1O73 A;  1JLV A;  3DML A;  2YNX A;  2H1A A;  3C8E A;  4KW6 A;  3KGK A;  4BVY B;  1F2E A;  5LCZ A;  3GKX A;  4TVE A;  3UBK A;  2HT9 A;  4KSM A;  1JZR A;  2WGR A;  3LYK A;  4GF0 A;  4DSS B;  1GUK A;  1WJK A;  3TUE A;  1TK0 B;  1ZYP A;  4DVC A;  1DE1 A;  4F03 A;  3L0H A;  5JWR B;  4KND A;  2HSH A;  5GZZ B;  4AJ7 A;  4JZQ A;  1URM A;  3WD6 A;  1MDK A;  3MIX A;  3FZ4 A;  1GH2 A;  3N5O A;  3P8W A;  4HU9 A;  4LLR A;  4L0U A;  1OC9 A;  2C1Y A;  2XBQ A;  3ZIT A;  2C3N A;  3Q6O A;  4ISD A;  3EU3 A;  1TXU A;  3MAK A;  2Z9S A;  1AQV A;  2XBI A;  2DJ1 A;  3DIE A;  2H6Y A;  1GSU A;  2CX3 A;  5J4Y A;  1Y6E A;  1THO A;  2A4V A;  1GUL A;  3L78 A;  5ID2 A;  3MYD A;  3QPM A;  1TTZ A;  5IMA A;  1FVJ A;  1TRW A;  1J0F A;  2WW2 A;  1NW2 A;  1X9S B;  2O36 A;  2IME A;  1AIU A;  1EV9 A;  4ZIL A;  3W6G A;  2B5X A;  1T1V A;  1GUM A;  3MDK A;  7GSS A;  3G7Y A;  4I6X A;  4V2M A;  5IO0 A;  5CRW A;  1ZL9 A;  1PN0 A;  1R4W A;  2DJ3 A;  5ECH B;  4EO3 A;  3D22 A;  3QCP A;  2V1M A;  4Z2R A;  1SVM A;  5J41 A;  1YKA A;  1TI1 A;  2P31 A;  5HFI A;  1XW5 A;  4LMV A;  1LJR A;  3FR3 A;  2EIQ A;  1DBY A;  2H0G A;  2A2R A;  1F6M C;  5D9W A;  2V32 A;  1Y25 A;  3AY8 A;  2R6K A;  2H0I A;  3VPT A;  5BMU A;  3TKQ A;  2VL9 A;  1PKW A;  3VI5 A;  1ZYQ B;  4KSO A;  5IO2 A;  5B7C A;  1V9W A;  4TR4 A;  1DE2 A;  1OC8 A;  4BL7 B;  3HJO A;  3GTU B;  3M1G A;  4OWY A;  4EVM A;  3WT2 A;  4BVX B;  5G5F A;  2YP6 A;  5A5H B;  1PKZ A;  3UJ1 A;  1RW1 A;  3F0I A;  1TRS A;  3HZ8 A;  4TRX A;  5D73 A;  1OVN A;  4ECB A;  3M9J A;  3MWH A;  2PU9 C;  5IMF A;  4ML6 A;  2VO4 A;  1C72 A;  3L9V A;  3GA4 A;  1BF5 A;  5JWQ B;  2O89 A;  1JFU A;  5F07 A;  2CT6 A;  3W8S A;  2QA2 A;  5DBQ A;  4TN8 A;  3LG6 A;  4MDC A;  1QFN A;  3KXO A;  1OYJ A;  4Q5Q A;  4LA1 A;  1UN2 A;  2P0G A;  3VPQ A;  2WUL A;  2O87 A;  4IS0 A;  2J9H A;  1GSQ A;  1SD9 A;  3BD2 A;  5ECO B;  4K6X A;  1SL1 B;  1XFL A;  2NTO A;  2DJ2 A;  1GRX A;  2LKU A;  3E3E A;  2IMI A;  4MCU A;  4ZL9 A;  5EY6 A;  4K5S A;  3DGQ A;  4PUA A;  2OAC A;  5GAN D;  1OE8 A;  4MJC A;  2DKH A;  5B8A A;  1BJX A;  2H1G A;  2LUS A;  5ECR B;  1SK2 A;  4K7O A;  4IJI A;  1ABA A;  2B1K A;  3E9J B;  4H86 A;  1GTI A;  1BQ7 A;  2VM2 A;  4BIK A;  3GL5 A;  3GFK A;  1M2B A;  5ECQ B;  4I2U A;  4MMM A;  1PL2 A;  3VLN A;  3ZMK A;  2IFQ B;  3TRX A;  5C04 A;  4TR1 A;  3EU4 A;  3TKS A;  1PSQ A;  1E2Y A;  2CAQ A;  3JCM L;  1W89 A;  2F51 A;  1K0N A;  3C7M A;  5G1K A;  2YPM A;  1SU9 A;  2GST A;  4IVF A;  4X0X A;  1YDK A;  3EPT A;  4HQS A;  3UAP A;  1EGO A;  1ERV A;  4ZBA A;  5CRG A;  3H4K A;  2IWT A;  4FH8 A;  5KN0 A;  4OFM A;  2HRK B;  1XWC A;  3C73 A;  3UVT A;  3BCI A;  3F6D A;  3DYR A;  4G0I A;  4FYU A;  3KH7 A;  5IPG A;  2VUP A;  1MTC A;  3WT1 A;  3P90 A;  2H8L A;  3FY7 A;  2I4A A;  1PFO A;  3A2W A;  4GWR A;  4ICY A;  2H01 A;  1M9A A;  1XZO A;  3HKR A;  5FHI A;  3IR4 A;  4G0L A;  6GST A;  2LST A;  16GS A;  3EMX A;  3EC3 A;  2HRN A;  3GN3 A;  5GSS A;  4GQC A;  2MMN A;  3O3T A;  3CSI A;  4GSN A;  4JED A;  1KTE A;  3GST A;  3F4T A;  4L8E A;  2YN1 A;  5DAK A;  1U88 A;  2HSY A;  5KEJ A;  4HQZ A;  2QSI A;  3EIN A;  4EUY A;  2YJH A;  4HEA 2;  3APS A;  2I1U A;  1CQG A;  3TJB A;  1X0R A;  2L5L A;  4TOP A;  4IBP A;  5J5N A;  4NXI A;  1SVL A;  2AV4 A;  4Z7X A;  4EDZ A;  1GL8 A;  2YJ7 A;  2EFE A;  3A2X A;  3DKS A;  5F0G A;  4P3Y B;  3LXZ A;  5E4W A;  2JSZ A;  3RHC A;  1JZW A;  1YVL A;  2JSY A;  2IMD A;  2VD1 A;  5DCG A;  5J9B A;  3ED3 A;  4DSQ A;  1PN9 A;  1G7O A;  2DSA A;  4GSS A;  1W4V A;  4XRA A;  3F3R A;  2EFH A;  1A8Y A;  4X43 A;  2YZH A;  1BX9 A;  3EMP A;  1BG5 A;  1K0A A;  4V2L A;  2VL3 A;  4KX4 A;  3FR9 A;  4WET A;  2LRC A;  4EF0 A;  4F2I A;  2WFC A;  5KOW A;  1O81 A;  1M2A A;  3G7I A;  1Y1U A;  3UAR A;  4BPY A;  1GSY A;  4XRD A;  2FD3 A;  3F4R A;  4POL A;  5D96 A;  2HFD A;  2OKA A;  2PGT A;  1R7H A;  1FB0 A;  2LJR A;  1MEK A;  1FOV A;  1RQM A;  1V98 A;  3CRT A;  4KDX A;  2PVO C;  5D9X A;  4BVY A;  2N5A A;  4TR0 A;  2LNS A;  5ECN B;  5B8B A;  3F8U A;  1TK5 B;  4AKX B;  3CSH A;  3LEF A;  1EEJ A;  1S3A A;  2B7K A;  4DSS A;  4BA7 A;  4JR6 A;  3TCO A;  3TOU A;  5J4V A;  3QR6 A;  4D73 A;  3UVH A;  2X99 A;  2LRT A;  2O7K A;  4QMK A;  4WXT A;  1U3I A;  2FGX A;  5AIS A;  4AJ6 A;  2EC4 A;  1JLW A;  5FWG A;  3HVV A;  2HXK A;  2CVB A;  4JE1 A;  2HZE B;  5HR2 A;  4MP4 A;  4EIQ A;  3IV4 A;  1HQO A;  3KP9 A;  3H1N A;  4HI7 A;  1J08 A;  1O7U A;  4AKI A;  2EFC A;  4HS1 A;  1BYE A;  1UC7 A;  5IIZ A;  1Z6N A;  2WW0 A;  2VL2 C;  4GRF A;  1ON4 A;  1X5E A;  5D9V A;  3ERF A;  4EL1 A;  4YAV A;  1T00 A;  4MJA A;  2K8S A;  3GYK A;  3CBU A;  1XBS A;  3HYP A;  4I97 A;  4KDY A;  2VCZ A;  1R5A A;  3LXT A;  3FK8 A;  1IYI A;  3E0U A;  3FRC A; 
#chains in the Genus database with same CATH homology
 1G6Y A;  2EFD A;  3IOS A;  1FHE A;  3O6T A;  5A4W A;  3FEU A;  1ZYE A;  4LMW A;  5CRE A;  4PNF A;  1TOF A;  4YQU A;  2HRA A;  2WJU A;  2R0G A;  5CP1 A;  3ZLP A;  4NHZ A;  3KM6 A;  3RPN A;  4RI7 A;  4XS1 A;  3J7Y k;  1F3A A;  2AB6 A;  2H0H A;  3C71 A;  5HQP A;  3CMI A;  2L57 A;  2R4V A;  3ZFL A;  3GNJ A;  2VIM A;  3LWA A;  1SJ6 A;  3ERW A;  4BL7 A;  3GTU A;  3VK9 A;  1SYR A;  4BVX A;  5A5H A;  1M99 A;  2AAW A;  5A1N B;  2VLU A;  2OT3 A;  1AC1 A;  5JCG A;  4GDF A;  2GLR A;  3KMO A;  3KZQ A;  5HR0 A;  1PX7 A;  4NPB A;  3IC8 A;  2OBK A;  2C3Q A;  2L4C A;  1K3Y A;  2JL4 A;  1A2L A;  5H5Q A;  1H4O A;  2IMF A;  4O5R A;  5B6N A;  1U3A A;  4L5L A;  1YQ1 A;  4NHW A;  4ZL7 A;  4IGJ A;  3M9K A;  4HOJ A;  4AKG A;  5DCH A;  2CZ2 A;  4OFT A;  2A4H A;  4RQR A;  1O8X A;  2DC5 A;  1M2D A;  2HSM B;  1EOH A;  2O5V A;  3ZL5 A;  3GKM A;  3TDG A;  2XHF A;  3N9J A;  2GZY A;  1QK8 A;  3SBC A;  4N0Z A;  4KGI A;  2V2G A;  1TW9 A;  3QAV A;  4WR4 A;  3GX8 A;  2LJA A;  5A4V A;  3R2Q A;  3I69 A;  4EKZ A;  4ZB8 A;  2PWJ A;  4WF4 A;  1A2J A;  2REM A;  4BWS A;  2CAI A;  2VD0 A;  3WGE A;  2R37 A;  4MF6 A;  1A0R P;  2LNT A;  2VKZ G;  5IMC A;  3HY2 A;  1XWA A;  1NHY A;  4G0K A;  1A8L A;  4POK A;  2H66 A;  1GTB A;  1ZOF A;  3ZZX A;  2MMZ A;  2GQM A;  2HSN B;  3GKK A;  2O85 A;  1AAZ A;  1UVZ A;  1U87 A;  3L9S A;  4ZL8 A;  1QXH A;  3US3 A;  2XPD A;  1O8W A;  2IL3 A;  4ECC A;  1SK0 A;  5EVO A;  1GSD A;  2C4J A;  1HD2 A;  5KOX A;  3GH9 A;  1HNC A;  2B3S A;  1LU4 A;  1SKR B;  2C0F A;  5G30 A;  4O7H A;  2BJX A;  3IDV A;  1K0B A;  2R2J A;  3BCK A;  4HJM A;  5EPF A;  3ISO A;  2HRF A;  1YKC A;  2XPE A;  2C80 A;  1OE7 A;  2NVL A;  2HRK A;  2FWF A;  2C0G A;  3EVI A;  4IQA A;  1F3B A;  5COH A;  4K0G A;  4EDY A;  1AQX A;  2JZR A;  3GL3 A;  2F8A A;  1TRV A;  1H75 A;  2F3M A;  5H5R A;  4PQH A;  3IK7 A;  4PX1 A;  4POM A;  3QAG A;  3LQ7 A;  5C00 A;  4MJB A;  2VCV A;  2I81 A;  3D4M A;  5DJM A;  2V6O A;  5EL8 A;  4PXO A;  4RQX A;  1AUC A;  2PBJ A;  17GS A;  2K6V A;  1KBN A;  3Q19 A;  1WE0 A;  2FCH A;  10GS A;  1CQH A;  2CQ9 A;  1WWJ A;  2L59 A;  4ZBD A;  3F4S A;  8GSS A;  2AUV A;  1PL1 A;  5IMV A;  2RUE A;  3EYT A;  3OR5 A;  3I6A A;  4TXV A;  1WRY A;  2J23 A;  4TW5 A;  1DUG A;  3F9U A;  2NBS A;  3KEB A;  3PPU A;  1OC9 B;  4L0W A;  3C1R A;  2OE1 A;  1X9M B;  2LQQ A;  2PPT A;  2WS2 A;  3ZFB A;  1EWX A;  3ZIV A;  3FZ9 A;  1B9Y C;  2LJK A;  5ECP B;  2RM6 A;  1GLP A;  2LRN A;  4CDO A;  1X9W B;  4J2F A;  2GSS A;  1K3L A;  2AYT A;  3H79 A;  1YEX A;  2E0Q A;  2YV7 A;  4PTS A;  4QQ7 A;  3TRQ A;  2R0P A;  4PUF C;  4OFN A;  3D6I A;  2A2P A;  1FOH A;  5HFK A;  1EZK A;  2PER A;  3G7J A;  4HJ2 A;  1MDI A;  4I5Q A;  5F8B A;  3HJP A;  2FWG A;  5AN1 A;  1N8J A;  1QUW A;  4XS6 A;  4WBJ A;  4FIW A;  1XCC A;  4N10 A;  4WKW A;  2LEG A;  1T4Y A;  4BWQ A;  2H30 A;  1QMV A;  4GST A;  4KH7 A;  3GX0 A;  2UV8 G;  2OJL A;  3WGD A;  4PUR A;  5ENU A;  4NV5 A;  3TOT A;  3L4N A;  1T8E B;  3NIV A;  3D0Z A;  2FA8 A;  3KMN A;  5IPH A;  1USB A;  5GAP D;  2GZP A;  1GTU A;  13GS A;  5J40 A;  1WP0 A;  4V1A p;  1SEN A;  4ZIJ A;  2R3X A;  20GS A;  2IJY A;  3HD5 A;  4OMV A;  2WZ9 A;  4LL1 B;  3BJ5 A;  4AI6 A;  5IMD A;  4N3Z A;  1Z9H A;  4N11 A;  4N0V A;  1QGV A;  1KNG A;  3IXR A;  2G0F A;  2DLX A;  2FA4 A;  1WOU A;  4OCF A;  3P2A A;  3IBH A;  4MH3 A;  2HNL A;  2EIR A;  1SJZ A;  4MLY A;  4AJ8 A;  3F63 A;  1S3D A;  1XW9 A;  3RAZ A;  4NWY A;  2VAF A;  5JCU A;  1F9M A;  3U5R E;  2PN8 A;  5HR1 A;  2B1L A;  5J4U A;  4MZB A;  5J9C A;  4K2D A;  3IHQ A;  5J3R A;  1T7P B;  2DMM A;  5CO3 A;  3GV1 A;  4MAB A;  1YZX A;  1I9D A;  4MK3 A;  1EV4 A;  1OKD A;  3HVS A;  5DQY A;  4YQV A;  2FUG 2;  1AQW A;  2A2S A;  3IC4 A;  2X8C A;  5LNK e;  2YOI A;  1ML6 A;  6GSY A;  3ZRE A;  3FYG A;  2CVD A;  2E2M A;  4PGT A;  3KD0 A;  22GS A;  3IAM 2;  4FQU A;  2VCW A;  4TKY A;  4KA0 A;  1SL2 B;  4MF5 A;  1X5D A;  2FNO A;  1TK8 B;  4F82 A;  5B6M A;  4IEL A;  4POB A;  1NHO A;  1SK1 A;  4DSR A;  5AIV A;  9GSS A;  4V2N A;  3TKP A;  4PNG A;  2QGV A;  3UOM A;  4EC0 A;  4HU7 A;  3IK9 A;  1Z7P A;  2H71 A;  3TKS E;  2B7J A;  1N25 A;  3UBL A;  3HZ4 A;  2GS3 A;  1M9B A;  4TR1 B;  3ZVJ A;  5BRT A;  2JAC A;  3ME8 A;  4WF5 A;  3UMA A;  1XWB A;  3F6F A;  4AGS A;  2P5Q A;  5A1N A;  5CNW A;  2N5F A;  4CY8 A;  4TXO B;  1ZZY A;  4MH2 A;  2H6Z A;  4E8E A;  4XS4 B;  2YWM A;  1X5C A;  3VUR A;  3U6V A;  1SYX A;  1ERU A;  1G6W A;  5ELG A;  5HFG A;  18GS A;  3LFL A;  3HVX A;  4MPF A;  4F0B A;  5D9T A;  4N30 A;  4KAE A;  4XTS A;  2DJJ A;  2H76 A;  3LGC A;  1SD8 A;  2GDR A;  3RHB A;  4NMU A;  2M80 A;  4G01 A;  2H1D A;  5DAL B;  3TKR A;  2HSM A;  2E2G A;  3TB2 A;  1O85 A;  2C3T A;  4MA9 A;  2RUF A;  1XW6 A;  2GQL A;  2HQT A;  2D2Z A;  4ILF A;  3RPP A;  2OBI A;  4HZ2 A;  3EWL A;  3O76 A;  4XIH A;  5FT3 A;  2NDO A;  1GSF A;  4ZXG A;  1B9X C;  4Q5R A;  1S3C A;  4K2X A;  4EIP A;  2C0E A;  1GWC A;  1IYH A;  1EP7 A;  1B4Q A;  2WDU A;  2PMT A;  3ZML A;  1O6J A;  3LW9 A;  5D93 A;  2UZ8 A;  4A5P A;  4IP6 A;  4ML1 A;  3PGT A;  5ECM B;  3I9V 2;  1ILO A;  1A2M A;  5ECS A;  2X4A A;  1YY7 A;  4G2E A;  1VF3 A;  1ST9 A;  5LD0 A;  1TP9 A;  3DWV A;  3M8N A;  3GSS A;  4KF9 A;  5F06 A;  4GXZ A;  4GCI A;  2YCD A;  1EP8 A;  5E59 A;  2VCT A;  3VWU A;  1ACV A;  4J56 E;  2F8F A;  2EIO A;  1PX6 A;  3J7Y b;  3D4T A;  4KE3 A;  1M0U A;  6GSX A;  2VCQ A;  1MD4 A;  3TJG A;  3DRN A;  3FZA A;  2H73 A;  2TRX A;  1SKW B;  3WYW A;  2B5E A;  3ZYW A;  2DJ0 A;  5ELA A;  4NAX A;  2C8U A;  3GUS A;  2OE3 A;  1TXX A;  2VCX A;  2HYX A;  4JR4 A;  2VOC A;  5D8I A;  2VM1 A;  4OD7 A;  4MF7 A;  5AGY A;  4O5U A;  2L4Q A;  1JZD A;  3LOR A;  1VGL A;  2O8V B;  5CYY A;  2LS5 A;  1YEP A;  4ZB6 A;  2I3Y A;  2JAD A;  1TU7 A;  4EE0 A;  5A34 B;  2B5Y A;  3HHV A;  1M7T A;  3UL3 A;  4F0C A;  3W8J A;  3ERG A;  4ACS A;  3NOF A;  3D21 A;  1XWK A;  4OO4 A;  2CVK A;  2VLT A;  2X8H A;  3IPZ A;  2GQK A;  3DVW A;  3TGZ A;  1K0D A;  4XCS A;  2AJQ B;  2V6K A;  4D73 B;  4WBR D;  2XC2 A;  3TRP A;  3NZN A;  19GS A;  3VWX A;  2YZU A;  4ZBB A;  1T3B A;  1BED A;  1Z3E A;  5G2Z A;  1XXU A;  2G2Q A;  4F9Z A;  1XPV A;  1EOG A;  3TJK A;  4G9H A;  1N2A A;  3K8N A;  4FO5 A;  3KTB A;  3CRU A;  3DXB A;  4YKG A;  1FW1 A;  2H74 A;  3FHK A;  5DDL A;  3F3Q A;  1XOA A;  2LQO A;  4ZB7 A;  3QD9 A;  1PA3 A;  1THX A;  1ZCP A;  2TRC P;  1SVO A;  1VF4 A;  4ZB9 A;  1GP1 A;  3QFA C;  4V1A g;  4KUN A;  4MPG A;  2IFQ A;  1VF1 A;  2DJK A;  1OKT A;  1MDJ A;  5ECI B;  1PQN A;  3KTL A;  2NPB A;  5HR3 A;  3QAW A;  2CV4 A;  2DML A;  3C1S A;  1ERT A;  4RI6 A;  2ZUP A;  2HE3 A;  1BG1 A;  3FW2 A;  3DEX A;  1ZYN A;  3HMJ G;  4Q5N A;  1F37 A;  5DVB A;  1XWG A;  1XVQ A;  2FWH A;  2WB9 A;  2MMO A;  2ALB A;  2KOK A;  2RM5 A;  1GNW A;  5INY A;  2IIY A;  5G1L A;  3GRX A;  2MYG A;  3KH9 A;  3VI7 A;  4E8H A;  2AHE A;  3MSZ A;  1DSB A;  2QC7 A;  2R0C A;  3BBY A;  2H75 A;  1NM3 A;  4K7N A;  4KCA A;  4IHU A;  1GSS A;  4YAP A;  3Q18 A;  2X49 A;  4GTU A;  2OAD A;  2YWN A;  3H8Q A;  3HA9 A;  3GIX A;  1J9B A;  2PVQ A;  2YWO A;  1ZMA A;  1SJI A;  4J57 E;  1HNB A;  2OE0 A;  1XVW A;  2GZZ A;  1TI3 A;  1EGR A;  4YKF A;  2K8V A;  3A3T A;  3HXS A;  2LV3 A;  1U6T A;  2N5B A;  1YF1 A;  3CSJ A;  3Q74 A;  2KHP A;  5DQS A;  1A0F A;  4CY6 A;  4TR3 A;  3GMF A;  2HZF A;  2R5G A;  2KUC A;  2DKI A;  3VWV A;  4IKH A;  2GTU A;  4O32 A;  4X4J A;  2KP2 A;  2MBT A;  5IQY A;  4K5R A;  1A24 A;  5ECL B;  2P5R A;  1I5G A;  3LSZ A;  2ON7 A;  4GLT A;  3TKS C;  1WIK A;  2DBC A;  4DEJ A;  2CX4 A;  1TU8 A;  12GS A;  4XHM A;  1G7E A;  5ID2 B;  1GTA A;  1OAZ A;  4ULX A;  5G31 A;  3FKF A;  3ZTL A;  1HYU A;  2GT6 A;  4Z2U A;  5KN3 A;  4OCE A;  3HCZ A;  2B6M A;  3QDN A;  1OC3 A;  3CYN A;  1WPI A;  2WCI A;  4GQF A;  2DIZ A;  2H1B A;  3VWW A;  4QL7 A;  1ERW A;  2HI7 A;  5KN2 A;  1BAY A;  3M3M A;  4EXJ A;  1NSW A;  2IPA A;  5A5K A;  5IOW A;  2MMA A;  4JRR A;  1B48 A;  3QFB C;  4USS A;  2F9S A;  3ZRD A;  1JZO A;  2H1L A;  2M46 A;  3IA1 A;  4YH2 A;  5BMU B;  4TXO A;  3PH9 A;  4G10 A;  1V58 A;  1TKD B;  4XS4 A;  4K1F A;  4K0N A;  1PRX A;  4K9Z A;  4KCE A;  4O5Q A;  4AKH A;  3L9U A;  3VFI A;  4LL4 B;  1YF0 A;  5AIX A;  4MJE A;  1SL0 B;  2YV9 A;  3IRA A;  1QQ2 A;  3V1W A;  2DIY A;  2VLV A;  1K0M A;  4WR5 A;  3GKN A;  3LYP A;  5DAL A;  2FY6 A;  4FYB A;  4IN0 A;  2PUK C;  2HZE A;  4JU5 A;  4MNN A;  2GGT A;  3D5J A;  2FLS A;  1G0T A;  3EE2 A;  3QOU A;  3APQ A;  6GSW A;  5DJL A;  5CRH A;  4Q5F A;  4K8M A;  5L71 A;  2YWI A;  3GH6 A;  4OO5 A;  2FWE A;  3M0F A;  3UIW A;  4PQ1 A;  4MZC A;  6GSU A;  3H93 A;  4WEY A;  1R5P A;  3MNG A;  1SKS B;  2RII A;  5KN1 A;  4O92 A;  3QMX A;  2IMK A;  3HJM A;  2HLS A;  2JZS A;  1K3O A;  3TU3 B;  2JZT A;  4HDE A;  1VRS D;  3A5I A;  1TDI A;  3I43 A;  2GVP A;  3RBT A;  3TJF A;  4MZW A;  3APO A;  1FO5 A;  2BMX A;  6GSS A;  3ZIJ A;  3KIJ A;  2ZNM A;  3ZVJ D;  3BOA A;  1ZGN A;  4HUA A;  3HDC A;  2GSQ A;  1Z7R A;  1PGT A;  2BTO T;  5ABR A;  3CXG A;  2KP1 A;  2GT5 A;  3CTF A;  1T4Z A;  5G5E A;  3FMW A;  2X8G A;  2L6C A;  5J47 A;  3A2V A;  3PIN A;  1FB6 A;  3UEM A;  3FR6 A;  4ID0 A;  1A23 A;  1FG4 A;  1UA5 A;  1PD2 1;  2L6D A;  3KCM A;  1B4P A;  4G19 A;  2YAN A;  1B8X A;  5F05 A;  4CW9 A;  5CAX A;  2V41 A;  3GUR A;  2LTK A;  4PQI A;  1V57 A;  2H72 A;  3DVX A;  3S9F A;  1R26 A;  4FYC A;  1PMT A;  5A34 A;  1LBK A;  3G9B A;  4E68 A;  4L5O A;  3SWL A;  3P7X A;  5GST A;  3DD3 A;  1TRU A;  1KEB A;  2QKE A;  1K0C A;  4HZ4 A;  4I2T A;  1XOB A;  2MBS A;  5JWO B;  3IAS 2;  2MZC A;  2FHE A;  3CTG A;  5IOX A;  1Q4J A;  2QA1 A;  3RDW A;  1K0O A;  3LJR A;  2H70 A;  2C0D A;  4IJ3 A;  2RLI A;  3KJY A;  4IQ1 A;  1WMJ A;  1AXD A;  2K18 A;  1Q98 A;  3EUR A;  3ME7 A;  2ON5 A;  2M72 A;  2WRT A;  4CHS A;  4KDU A;  1GLQ A;  4Z2T A;  3IE3 A;  4JBB A;  5DAK B;  1EEM A;  2X64 A;  3CWG A;  4NV2 A;  1RK4 A;  2I9H A;  4IW9 A;  3A5W A;  1FAA A;  1V2A A;  2CA8 A;  1HNA A;  4ECI A;  2H6X A;  6GSV A;  4K7I A;  5JCW A;  4W66 A;  3FZ5 A;  2HSN A;  1GSE A;  5CRD A;  1V40 A;  1VF2 A;  4ECJ A;  4X1U A;  1GUH A;  2OA7 A;  2E7P A;  4IP1 A;  2CZ3 A;  14GS A;  4YQM A;  1MD3 A;  4AF2 A;  4I8B A;  1E6B A;  2IN3 A;  1YJ6 A;  4QL9 A;  3KP8 A;  11GS A;  3TJJ A;  5H5S A;  2VL2 A;  1AW9 A;  4RUV A;  3IHG A;  2ES7 A;  1TJD A;  2K9F A;  1GNE A;  2H19 A;  3WGX A;  5IM9 A;  1JHB A;  2TIR A;  5A4U A;  2L5O A;  5IMZ A;  3PR8 A;  3GHA A;  2ZCT A;  1Z6M A;  2GSR A;  2JU5 A;  5ECK B;  2KLX A;  4KB3 A;  3R3E A;  1FVK A;  1Z5Y E;  1XIY A;  1O73 A;  1JLV A;  3DML A;  2YNX A;  2H1A A;  3C8E A;  4KW6 A;  3KGK A;  4BVY B;  1F2E A;  5LCZ A;  3GKX A;  4TVE A;  3UBK A;  2HT9 A;  4KSM A;  1JZR A;  2WGR A;  3LYK A;  4GF0 A;  4DSS B;  1GUK A;  1WJK A;  3TUE A;  1TK0 B;  1ZYP A;  4DVC A;  1DE1 A;  4F03 A;  3L0H A;  5JWR B;  4KND A;  2HSH A;  5GZZ B;  4AJ7 A;  4JZQ A;  1URM A;  3WD6 A;  1MDK A;  3MIX A;  3FZ4 A;  1GH2 A;  3N5O A;  3P8W A;  4HU9 A;  4LLR A;  4L0U A;  1OC9 A;  2C1Y A;  2XBQ A;  3ZIT A;  2C3N A;  3Q6O A;  4ISD A;  3EU3 A;  1TXU A;  3MAK A;  2Z9S A;  1AQV A;  2XBI A;  2DJ1 A;  3DIE A;  2H6Y A;  1GSU A;  2CX3 A;  5J4Y A;  1Y6E A;  1THO A;  2A4V A;  1GUL A;  3L78 A;  5ID2 A;  3MYD A;  3QPM A;  1TTZ A;  5IMA A;  1FVJ A;  1TRW A;  1J0F A;  1NW2 A;  1X9S B;  2IME A;  1AIU A;  1EV9 A;  4ZIL A;  3W6G A;  2B5X A;  1T1V A;  1GUM A;  3MDK A;  7GSS A;  3G7Y A;  4I6X A;  4V2M A;  5IO0 A;  5CRW A;  1ZL9 A;  1PN0 A;  1R4W A;  2DJ3 A;  5ECH B;  4EO3 A;  3D22 A;  3QCP A;  2V1M A;  4Z2R A;  1SVM A;  5J41 A;  1YKA A;  1TI1 A;  2P31 A;  5HFI A;  1XW5 A;  4LMV A;  1LJR A;  3FR3 A;  2EIQ A;  1DBY A;  2H0G A;  2A2R A;  1F6M C;  5D9W A;  2V32 A;  1Y25 A;  3AY8 A;  2R6K A;  2H0I A;  3VPT A;  5BMU A;  3TKQ A;  2VL9 A;  1PKW A;  3VI5 A;  1ZYQ B;  4KSO A;  5IO2 A;  5B7C A;  1V9W A;  4TR4 A;  1DE2 A;  1OC8 A;  4BL7 B;  3HJO A;  3GTU B;  3M1G A;  4OWY A;  4EVM A;  3WT2 A;  4BVX B;  5G5F A;  2YP6 A;  5A5H B;  1PKZ A;  3UJ1 A;  1RW1 A;  3F0I A;  1TRS A;  3HZ8 A;  4TRX A;  5D73 A;  1OVN A;  4ECB A;  3M9J A;  3MWH A;  2PU9 C;  5IMF A;  4ML6 A;  2VO4 A;  1C72 A;  3L9V A;  3GA4 A;  1BF5 A;  5JWQ B;  2O89 A;  1JFU A;  5F07 A;  2CT6 A;  3W8S A;  2QA2 A;  5DBQ A;  4TN8 A;  3LG6 A;  4MDC A;  1QFN A;  3KXO A;  1OYJ A;  4Q5Q A;  4LA1 A;  1UN2 A;  2P0G A;  3VPQ A;  2WUL A;  2O87 A;  4IS0 A;  2J9H A;  1GSQ A;  1SD9 A;  3BD2 A;  5ECO B;  4K6X A;  1SL1 B;  1XFL A;  2NTO A;  2DJ2 A;  1GRX A;  2LKU A;  3E3E A;  2IMI A;  4MCU A;  4ZL9 A;  5EY6 A;  4K5S A;  3DGQ A;  4PUA A;  2OAC A;  5GAN D;  1OE8 A;  4MJC A;  2DKH A;  5B8A A;  1BJX A;  2H1G A;  2LUS A;  5ECR B;  1SK2 A;  4K7O A;  4IJI A;  1ABA A;  2B1K A;  3E9J B;  4H86 A;  1GTI A;  1BQ7 A;  2VM2 A;  3GL5 A;  3GFK A;  1M2B A;  5ECQ B;  4I2U A;  4MMM A;  1PL2 A;  3VLN A;  3ZMK A;  2IFQ B;  3TRX A;  5C04 A;  4TR1 A;  3EU4 A;  3TKS A;  1PSQ A;  1E2Y A;  2CAQ A;  3JCM L;  1W89 A;  2F51 A;  1K0N A;  3C7M A;  5G1K A;  2YPM A;  1SU9 A;  2GST A;  4IVF A;  4X0X A;  1YDK A;  3EPT A;  4HQS A;  3UAP A;  1EGO A;  1ERV A;  4ZBA A;  5CRG A;  3H4K A;  2IWT A;  4FH8 A;  5KN0 A;  4OFM A;  2HRK B;  1XWC A;  3C73 A;  3UVT A;  3BCI A;  3F6D A;  3DYR A;  4G0I A;  4FYU A;  3KH7 A;  5IPG A;  2VUP A;  1MTC A;  3WT1 A;  3P90 A;  2H8L A;  3FY7 A;  2I4A A;  3A2W A;  4GWR A;  4ICY A;  2H01 A;  1M9A A;  1XZO A;  3HKR A;  5FHI A;  3IR4 A;  4G0L A;  6GST A;  2LST A;  16GS A;  3EMX A;  3EC3 A;  2HRN A;  3GN3 A;  5GSS A;  4GQC A;  2MMN A;  3O3T A;  3CSI A;  4GSN A;  4JED A;  1KTE A;  3GST A;  3F4T A;  4L8E A;  2YN1 A;  5DAK A;  1U88 A;  2HSY A;  5KEJ A;  4HQZ A;  2QSI A;  3EIN A;  4EUY A;  2YJH A;  4HEA 2;  3APS A;  2I1U A;  1CQG A;  3TJB A;  1X0R A;  2L5L A;  4TOP A;  4IBP A;  5J5N A;  4NXI A;  1SVL A;  2AV4 A;  4Z7X A;  4EDZ A;  1GL8 A;  2YJ7 A;  2EFE A;  3A2X A;  3DKS A;  5F0G A;  4P3Y B;  3LXZ A;  5E4W A;  2JSZ A;  3RHC A;  1JZW A;  1YVL A;  2JSY A;  2IMD A;  2VD1 A;  5DCG A;  5J9B A;  3ED3 A;  4DSQ A;  1PN9 A;  1G7O A;  2DSA A;  4GSS A;  1W4V A;  4XRA A;  3F3R A;  2EFH A;  1A8Y A;  4X43 A;  2YZH A;  1BX9 A;  3EMP A;  1BG5 A;  1K0A A;  4V2L A;  2VL3 A;  4KX4 A;  3FR9 A;  4WET A;  2LRC A;  4EF0 A;  4F2I A;  2WFC A;  5KOW A;  1O81 A;  1M2A A;  3G7I A;  1Y1U A;  3UAR A;  4BPY A;  1GSY A;  4XRD A;  2FD3 A;  3F4R A;  4POL A;  5D96 A;  2HFD A;  2OKA A;  2PGT A;  1R7H A;  1FB0 A;  2LJR A;  1MEK A;  1FOV A;  1RQM A;  1V98 A;  3CRT A;  4KDX A;  2PVO C;  5D9X A;  4BVY A;  2N5A A;  4TR0 A;  2LNS A;  5ECN B;  5B8B A;  3F8U A;  1TK5 B;  4AKX B;  3CSH A;  3LEF A;  1EEJ A;  1S3A A;  2B7K A;  4DSS A;  4BA7 A;  4JR6 A;  3TCO A;  3TOU A;  5J4V A;  3QR6 A;  4D73 A;  3UVH A;  2X99 A;  2LRT A;  2O7K A;  4QMK A;  4WXT A;  1U3I A;  2FGX A;  5AIS A;  4AJ6 A;  2EC4 A;  1JLW A;  5FWG A;  3HVV A;  2HXK A;  2CVB A;  4JE1 A;  2HZE B;  5HR2 A;  4MP4 A;  4EIQ A;  3IV4 A;  1HQO A;  3KP9 A;  3H1N A;  4HI7 A;  1J08 A;  1O7U A;  4AKI A;  2EFC A;  4HS1 A;  1BYE A;  1UC7 A;  5IIZ A;  1Z6N A;  2VL2 C;  4GRF A;  1ON4 A;  1X5E A;  5D9V A;  3ERF A;  4EL1 A;  4YAV A;  1T00 A;  4MJA A;  2K8S A;  3GYK A;  3CBU A;  1XBS A;  3HYP A;  4I97 A;  4KDY A;  2VCZ A;  1R5A A;  3LXT A;  3FK8 A;  1IYI A;  3E0U A;  3FRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...