5DALA

Crystal structure of human glutathione transferase pi complexed with a metalloid in the presence of glutathione
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
210
structure length
209
Chain Sequence
MPPYTVVYFPVRGRAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 209
sequence length 210
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dalA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dalA01
1GSUA 2HQTA 2DIZA 2X99A 3HCZA 3ZVJA 5CO3A 4HEA2 3D0ZA 4BVXA 4E8HA 2J9HA 3WT2A 3VK9A 1SKWB 2HXKA 4TR3A 1QXHA 4WR4A 4G0IA 4LMWA 2OE3A 4NXIA 3KP8A 1VRSD 5KN2A 2CZ3A 3KD0A 2H1GA 3TDGA 3D22A 2X8GA 1U6TA 2IJYA 2FWFA 3FW2A 3EU4A 1EP7A 3ERWA 2LNSA 3V1WA 3DVWA 3F4SA 5HR1A 4V2MA 4GSTA 4KAEA 3RAZA 2PVQA 3TJJA 4XIHA 1AQXA 3IE3A 3QMXA 1FG4A 2XPDA 1TXXA 5ECPB 4KX4A 3IXRA 3ZFLA 3IK9A 1H75A 1EEMA 3L4NA 3JCML 5FT3A 1LJRA 1JHBA 3KTBA 4NV5A 4Q5RA 4N0ZA 1T8EB 4JZQA 1THOA 2H0HA 1VF2A 1WE0A 5KEJA 4XS1A 3BOAA 2HZEB 5ID2A 1V9WA 3FK8A 3EE2A 2HSNB 4IW9A 2V6KA 2H19A 2LQOA 5DALA 2GZPA 3UL3A 1M2DA 1GH2A 1I5GA 2QC7A 2H6YA 2YCDA 2FY6A 3KJYA 2LQQA 5D9XA 2KLXA 2GSRA 2OACA 3N9JA 5IMAA 1GP1A 3AY8A 4WF5A 1ZGNA 3GUSA 2V32A 3RBTA 5IPGA 2HZFA 2XC2A 3DIEA 4OFNA 3PINA 1PA3A 2N5BA 1AIUA 3LWAA 3ED3A 2HRAA 4GSSA 4LL1B 2RM6A 3TGZA 2A2RA 2C8UA 22GSA 3QAVA 4MCUA 3D5JA 4ECIA 1XCCA 2YZUA 1SYXA 3NOFA 2OE0A 2L6DA 4HI7A 4WKWA 2IIYA 1TTZA 3KIJA 2X8HA 3HHVA 3IPZA 3IR4A 3GKNA 4ILFA 1GL8A 1QFNA 4F2IA 2DLXA 3US3A 4I2UA 2LRTA 3GA4A 5G2ZA 2BTOT 3IOSA 4PXOA 1HD2A 1WJKA 4L5LA 4J57E 4IQAA 3EURA 3APOA 5IMVA 2LJRA 5F07A 4JU5A 1GWCA 3L9UA 2QKEA 3P8WA 3L0HA 3ZITA 4N11A 2NVLA 1XZOA 4PNGA 2VLVA 3PH9A 4MP4A 1S3CA 4F82A 2GVPA 3GMFA 2ZNMA 4L5OA 3R3EA 3IDVA 2N5AA 2B7JA 3F0IA 3DGQA 1YQ1A 4DVCA 3TB2A 4POMA 2WFCA 4ZBBA 2YPMA 5ECNB 2MZCA 2IN3A 4TXOB 4KGIA 1QK8A 2YWMA 5C00A 1PX7A 4HZ2A 1Q98A 1OKTA 1VF4A 5KN3A 2VD1A 4GLTA 3TOUA 2C1YA 4PX1A 3ZTLA 2A4VA 4RUVA 1GLQA 2VCXA 3D4TA 1THXA 1FHEA 5D8IA 5JCWA 1FW1A 4GSNA 1EOGA 3IAS2 4FQUA 3EU3A 3RPNA 3UJ1A 3FR3A 2VL3A 2DBCA 3G7IA 2N5FA 1SKSB 2HNLA 2E0QA 2ALBA 2CVBA 4K1FA 2LS5A 1Z9HA 4F03A 2GTUA 3SBCA 1A2MA 4IKHA 1GRXA 1TRVA 1B9XC 5HFKA 3A5WA 3QD9A 1A24A 2O89A 4PUAA 4OCEA 1LBKA 4IHUA 2VM1A 3O6TA 3IHQA 2V1MA 5CYYA 6GSSA 3NIVA 1V98A 2GQKA 4OO5A 4ZBAA 2CQ9A 1YEPA 6GSYA 4GF0A 1TK8B 3CSHA 4YH2A 4TR1B 1Y6EA 2HLSA 1SK0A 1K0DA 2IMFA 3EC3A 2DC5A 4I5QA 3KGKA 4AF2A 4EE0A 1FB0A 1GSFA 4EL1A 2GLRA 2FWEA 2IMKA 3DYRA 4QL7A 2FWGA 3U5RE 1WPIA 2VM2A 4MJAA 1ERTA 3GL5A 1Z5YE 3VLNA 4XTSA 2K6VA 3BD2A 5EVOA 1BEDA 1TDIA 3UIWA 5J3RA 1M2BA 4MH2A 1TW9A 3GTUB 1TJDA 2B1KA 1DBYA 4EKZA 1JFUA 4TR4A 4MMMA 4O5RA 4WBJA 2ZUPA 1MDKA 2C3QA 3M0FA 3CTFA 5IOWA 1Z7RA 6GSUA 3TJFA 1LU4A 4I2TA 3LXZA 2JL4A 1PGTA 3EYTA 1X9MB 2EIQA 2AUVA 4POLA 1EV4A 2HSHA 4D73A 2JSZA 1ACVA 1F3BA 1NSWA 5IMFA 5AGYA 1M2AA 3TUEA 4TR0A 14GSA 1G7EA 2DJ0A 3ERFA 1OE7A 5LCZA 1TK0B 5HFIA 1DSBA 2H0IA 1WOUA 3UVTA 3G7YA 3UARA 2LSTA 2REMA 2R3XA 2HI7A 3GH6A 2VAFA 5JWOB 2R37A 2VOCA 4ZXGA 1M9BA 1AC1A 2K18A 3F3RA 1W89A 3TKSA 3W8JA 1XWCA 5DCGA 4ID0A 2NPBA 9GSSA 1FOVA 3E0UA 3ZL5A 4KW6A 3W6GA 4HUAA 4K2DA 1X5DA 5D9TA 1TU7A 3GFKA 3GURA 5JCGA 1S3AA 1K0BA 1EP8A 1GUMA 3F3QA 5B6MA 4K0NA 5FWGA 1GSYA 4PNFA 3M9JA 1ZMAA 1MDJA 2F51A 5DCHA 2CAIA 2I81A 1A8LA 3S9FA 4X0XA 3GIXA 3UEMA 1X9SB 2E2GA 1A0RP 3GH9A 3LYKA 1O85A 1N2AA 3ERGA 2DJ2A 3HVXA 2FGXA 5DDLA 2B3SA 2LRCA 7GSSA 4JRRA 4NHZA 3FR6A 3EWLA 5E59A 4EUYA 4V1Ap 1WMJA 3ISOA 5G5FA 2VL2C 5IMDA 1Z6MA 3A2XA 4TOPA 2C80A 1YDKA 2FHEA 5C04A 2B5YA 5B6NA 2WULA 2DJJA 1TP9A 3DWVA 2LJKA 5GAPD 3FZAA 5DAKB 1SD9A 1DE2A 3APSA 4X43A 4PQ1A 2MBTA 1YKAA 3GRXA 4TN8A 3LFLA 4IELA 2PMTA 2F8FA 5CRGA 1SYRA 2VO4A 2QSIA 5CP1A 3CMIA 3QAWA 1SL1B 4EXJA 4L0WA 1PL2A 5ELAA 1CQGA 4X1UA 2GDRA 2LUSA 5HR0A 3VPTA 2C0DA 1T7PB 4PUFC 5F8BA 4MJEA 17GSA 1JZWA 5A5KA 1EZKA 1BJXA 3M8NA 1K0NA 1OE8A 3IC8A 2NBSA 4HJMA 3QR6A 1YJ6A 3GNJA 4IP6A 4JBBA 5J9CA 3CSJA 4BVYB 2GS3A 3H93A 6GSWA 1GNEA 4AGSA 3BBYA 2H01A 2FA4A 3LEFA 2AYTA 1VF3A 4DSSB 5IQYA 1HQOA 5IO2A 1Z7PA 4KSOA 1YY7A 1GTAA 2PVOC 2R5GA 4K7NA 3P2AA 1BG5A 2G2QA 1XPVA 3HKRA 3VWUA 2OA7A 4ML6A 1XWKA 2I1UA 1XXUA 2RUEA 2XPEA 1E6BA 2HYXA 3EVIA 3J7Yk 4FYUA 3F6FA 2VCZA 1WWJA 4HU9A 4RQXA 3TJGA 1H4OA 1TI1A 1R5AA 5CNWA 1FB6A 3L9VA 4XRAA 5F0GA 4IBPA 2ON5A 3TKQA 2I4AA 4PQHA 2O8VB 1ILOA 3H8QA 2CVDA 3F6DA 1TOFA 1C72A 4TR1A 3HZ8A 1X9WB 2IWTA 1ABAA 2GZYA 5IM9A 3IV4A 2HSMB 5D9WA 3CRTA 2XBIA 1ST9A 2KP2A 4HQZA 4GXZA 1A0FA 2LKUA 1A2LA 2HT9A 1O8XA 1V58A 2MMOA 2L6CA 2DJ3A 4LLRA 4JR4A 4JEDA 4K7OA 4MZBA 1K3LA 4RI6A 2PN8A 5D96A 1NW2A 2YNXA 2R4VA 4WR5A 3TOTA 2PU9C 4F0CA 1J08A 2DJKA 5CRDA 3E9JB 2YWNA 3DVXA 3GTUA 1AW9A 5ECRB 1GUHA 4XS6A 5COHA 1ERWA 4KSMA 2JZSA 2X64A 1SD8A 3H79A 3A3TA 1E2YA 5A4WA 4EDYA 4NV2A 2G0FA 3A2VA 1T00A 2H8LA 4I8BA 1OC9B 11GSA 4KDXA 1YF1A 1YZXA 10GSA 2V41A 5EPFA 4ZB8A 5ECSA 2O85A 1TRWA 3ZLPA 2YJHA 3OR5A 5KN0A 1U87A 1RK4A 2Z9SA 1SJ6A 5J5NA 3G7JA 2IPAA 2GSTA 2HFDA 4MK3A 1QQ2A 4HOJA 3GN3A 5AIVA 1XW5A 2KOKA 5DQSA 2FUG2 4TW5A 4MABA 4IGJA 3PGTA 1NHYA 5CRHA 3Q18A 2FA8A 3VWWA 4K8MA 2E2MA 4HDEA 1GTBA 4OFTA 4POKA 1HNAA 2AV4A 3LXTA 1HYUA 3QPMA 1R26A 2VCVA 1O6JA 1VF1A 5IMZA 1AQVA 2MBSA 3KP9A 1J9BA 1ERVA 4ZL9A 3ZREA 4EVMA 1K3YA 1W4VA 3F4TA 1QGVA 3DKSA 5D9VA 1U3IA 1G0TA 4BL7B 2K8SA 1SK1A 3W8SA 4BVXB 3RDWA 1SJZA 4K6XA 2E7PA 5AISA 2B7KA 2YANA 3DD3A 5G1KA 5L71A 4F0BA 1ON4A 3BCIA 3N5OA 3Q6OA 1EOHA 2PUKC 2CX4A 6GSTA 1K0AA 3KMOA 3O3TA 1ZOFA 4KB3A 1F37A 4G0LA 4N30A 2WRTA 1KTEA 1EGRA 4KDUA 1UVZA 5H5RA 4MZWA 3KH7A 1B4QA 3I43A 4F9ZA 5DBQA 3RHCA 4ZBDA 4FYCA 1HNBA 2WZ9A 5INYA 1F3AA 5ECQB 3M1GA 5DJLA 4XCSA 1M7TA 2VLUA 3E3EA 2D2ZA 1V57A 4IP1A 2AHEA 4AJ7A 2YZHA 3HVVA 3HXSA 1GSEA 2QGVA 4E8EA 3FZ4A 3HJMA 1XOAA 4AJ6A 5B8AA 4PGTA 4TRXA 1EV9A 1GTUA 2H1BA 1G6WA 2ZCTA 3BCKA 4NAXA 4GCIA 4GQCA 1OAZA 1IYIA 1WIKA 3F63A 18GSA 4L0UA 2O7KA 4WBRD 1NM3A 1O73A 3VI7A 2V6OA 3L78A 1XWAA 4DSSA 1F2EA 1K3OA 1QMVA 4POBA 3QFAC 1ML6A 2CZ2A 1IYHA 1A8YA 5D93A 1PSQA 5B7CA 3HY2A 19GSA 4JR6A 3GV1A 2KHPA 3M9KA 2H30A 4NPBA 1OC8A 3D6IA 2HE3A 4ZB6A 2P0GA 3LORA 4LA1A 4QL9A 4MJBA 3GX0A 1F9MA 3QAGA 5KN1A 2HZEA 3DXBA 2VD0A 2AB6A 5ECKB 4TKYA 3QOUA 4GWRA 2P31A 1OYJA 3Q74A 1FO5A 1B4PA 2H75A 4H86A 5JWRB 4IJ3A 3LJRA 3TKRA 1KBNA 3DEXA 1ERUA 4Z7XA 4MH3A 1T1VA 5JCUA 4MPFA 4KUNA 2P5QA 5HR2A 1EGOA 1ZL9A 1PKZA 5H5SA 5JWQB 2WGRA 5GZZB 2OJLA 4FIWA 4EF0A 4EO3A 1B9YC 3MSZA 3IC4A 1MD3A 5CREA 2YV7A 3LG6A 1SJIA 2EIRA 1HNCA 2UZ8A 1DE1A 1X5CA 1EEJA 3FZ5A 2XBQA 2M80A 3GX8A 4NWYA 5A4UA 1TRSA 2H70A 3EMPA 5ECLB 2K9FA 3TRQA 2H6XA 1GUKA 4P3YB 3H1NA 2WJUA 1M9AA 3MWHA 1XW6A 3GHAA 2WB9A 4DSRA 4CW9A 4FH8A 2YWIA 1X0RA 3F4RA 1YEXA 1RW1A 3C71A 5ENUA 2JADA 3VPQA 2YWOA 3R2QA 2BJXA 3O76A 4ZL8A 2F3MA 1N8JA 1OC3A 4MLYA 1AQWA 1TK5B 3FZ9A 4TVEA 3C1SA 3VI5A 1JZRA 4KH7A 4K0GA 3UBLA 1T4YA 1USBA 1F6MC 3CSIA 3ME8A 2PGTA 4IJIA 1PMTA 4O92A 2WCIA 3G9BA 2YP6A 4YQMA 1VGLA 3HJOA 4KF9A 1B8XA 5J4UA 2HRNA 2J23A 3D4MA 2L5LA 1PRXA 4G0KA 4N10A 4TXOA 1M0UA 4XS4B 4MPGA 1MDIA 3HD5A 4K7IA 3VWVA 2KUCA 1UC7A 5F05A 4MF7A 1XFLA 3C73A 3IBHA 4FO5A 2BMXA 4BL7A 5EL8A 3WGEA 3IA1A 1XBSA 3CTGA 5DVBA 1GULA 2R6KA 5ECOB 3LYPA 3F8UA 5HQPA 1PN9A 1QUWA 4HQSA 3UAPA 1G6YA 3FKFA 2IMDA 1AXDA 3C7MA 5AN1A 3FR9A 1ZZYA 5ECHB 4PQIA 3TJBA 4IQ1A 3Q19A 1URMA 8GSSA 1R7HA 3CYNA 4OWYA 3F9UA 3KXOA 2NTOA 2CVKA 3VFIA 4O32A 2H73A 2IFQB 4MA9A 4D73B 2GT5A 5LD0A 1ZYQB 2L59A 3HYPA 1AUCA 2HSYA 1I9DA 2I9HA 2K8VA 2MMZA 2VL9A 2PBJA 2CX3A 2JSYA 3GYKA 4Q5FA 4L8EA 1SENA 2GGTA 3ME7A 3ZVJD 4ECJA 2F9SA 1M99A 1RQMA 2YV9A 2H71A 4ECCA 2LJAA 2KP1A 3CRUA 4YAVA 3U6VA 2MYGA 1J0FA 4LL4B 2EC4A 5ELGA 1GSQA 2H1AA 4ZL7A 4NHWA 1R4WA 4V1Ag 3MDKA 2WS2A 2TIRA 2X8CA 4FYBA 4GRFA 4ACSA 3EMXA 1JLVA 2PWJA 3APQA 1CQHA 3PPUA 4RI7A 5DQYA 5HR3A 4HS1A 2FD3A 4HU7A 1Z6NA 2RIIA 4KE3A 2LEGA 4OO4A 2L5OA 1AAZA 1K0MA 2HRKB 4V2NA 2YN1A 3I9V2 2VCWA 1G7OA 5EY6A 2JZTA 4OD7A 1K0OA 2MMAA 3ZRDA 3KH9A 4BA7A 4RQRA 3H4KA 3FY7A 2L57A 2HRFA 1Z3EA 4MZCA 3KM6A 1GSDA 4MF5A 2VIMA 12GSA 2H74A 5G5EA 2O87A 2AAWA 1GTIA 2H66A 1MD4A 2LNTA 3MAKA 1GLPA 1Q4JA 3A2WA 3P7XA 2CA8A 1GNWA 4GQFA 5LNKe 2H0GA 3LQ7A 2GZZA 1GSSA 4BWSA 2JU5A 2VCTA 2IMIA 5G30A 1JLWA 2C3NA 4YAPA 1BQ7A 1O7UA 1XWGA 1FVJA 2R2JA 4XRDA 1YKCA 2PERA 3IAM2 3ZYWA 2PPTA 2DIYA 3KCMA 1MEKA 1SL0B 3TCOA 2M72A 4QQ7A 5HFGA 3LSZA 3ZIJA 1FVKA 3D21A 1OKDA 6GSVA 2XHFA 4ISDA 1SKRB 4WEYA 2RLIA 1TU8A 1PKWA 4O7HA 4USSA 4IN0A 2H6ZA 3CBUA 1S3DA 2GQLA 2H76A 3HJPA 1PL1A 2OBIA 2IMEA 16GSA 4MJCA 2GQMA 5DJMA 3WT1A 1JZDA 4MF6A 2B5EA 1BX9A 1JZOA 3MNGA 1XVWA 3UBKA 4NMUA 5GAND 4J56E 2FWHA 4IS0A 3HZ4A 1WRYA 1KNGA 4CHSA 4EDZA 1OVNA 4JE1A 3TJKA 1A2JA 1R5PA 1V40A 2OADA 1XIYA 4IVFA 3EINA 4HZ4A 5G31A 3KTLA 3GKMA 5BMUA 3J7Yb 5IMCA 4TXVA 2C4JA 5FHIA 3GKKA 1WP0A 3DRNA 2EIOA 3GL3A 3WGXA 4Q5QA 2P5RA 5G1LA 3CXGA 1FAAA 1U3AA 3KMNA 5ID2B 2FNOA 5DAKA 3QCPA 4OCFA 2C0EA 3LGCA 3TRXA 2ON7A 5DALB 3ZMLA 2YJ7A 4V2LA 5F06A 4KCEA 4YQVA 2WDUA 3TKPA 5IO0A 2L4CA 1PX6A 3FRCA 3VURA 3I6AA 4OFMA 4XS4A 4PTSA 2FLSA 4YQUA 20GSA 1SK2A 4PURA 1MTCA 5A4VA 2GT6A 4ECBA 2I3YA 3C1RA 3UOMA 2L4QA 3UMAA 2LRNA 4BVYA 2DMMA 1XOBA 4DEJA 1O8WA 3TRPA 4XHMA 3TKSE 2H1DA 3RPPA 4AJ8A 1ZCPA 1U88A 3UVHA 5ECMB 5ABRA 2OBKA 5AIXA 3IRAA 4Q5NA 2VCQA 3GKXA 1O81A 5H5QA 3C8EA 1SU9A 2FCHA 5GSSA 4G10A 1NHOA 1TKDB 3KZQA 1TRUA 2IFQA 1DUGA 1B48A 2V2GA 2DMLA 4BPYA 5IIZA 1EWXA 3FHKA 5CAXA 1K0CA 2YOIA 4MDCA 3RHBA 4HJ2A 1YF0A 2OKAA 4LMVA 2CT6A 2CAQA 3TKSC 4N0VA 3PR8A 2DSAA 2B5XA 2JACA 2C0GA 1V2AA 4G9HA 2DJ1A 4BWQA 2B1LA 5J41A 1T4ZA 2HSMA 4KCAA 4WXTA 2TRCP 2AJQB 3I69A 6GSXA 2NDOA 2ES7A 3ZMKA 1Y25A 1PQNA 5J9BA 3WGDA 1SL2B 3WYWA 1XW9A 2JZRA 2A2SA 3NZNA 3P90A 4G19A 2RUFA 2M46A 4J2FA 3BJ5A 3HDCA 4ULXA 5IPHA 4DSQA 2HRKA 4G2EA 1T3BA 2GSQA 2H72A 2VLTA 1BYEA 2C3TA 1A23A 4I97A 5IOXA 3VWXA 3QFBC 2LTKA 5GSTA 3GSSA 4CDOA 1TI3A 1BAYA 1OC9A 1PD21 1XWBA 3ZZXA 2F8AA 3M3MA 5ECIB 3L9SA 3KEBA 13GSA 5CRWA 2LV3A 3HA9A 1XVQA 2OE1A 4K9ZA 4I6XA 3HVSA 1X5EA 1ZYEA 4WETA 4ZB9A 2CV4A 3ZIVA 4EC0A 3WD6A 3GSTA 1KEBA 4ZILA 3SWLA 5E4WA 4ZIJA 2TRXA 3FYGA 3DMLA 2IL3A 4KNDA 2VL2A 4GTUA 5D73A 1UN2A 4WF4A 3FEUA 2VUPA 3QDNA 5B8BA 3IK7A 1UA5A 4KDYA 2MMNA 2RM5A 2GSSA 4KA0A 2B6MA 3K8NA 2C0FA 4OMVA 3ZFBA 4ML1A
chains in the Genus database with same CATH superfamily
1GSUA 2HQTA 2DIZA 2X99A 3HCZA 3ZVJA 5CO3A 4HEA2 4GDFA 3D0ZA 4BVXA 4E8HA 2J9HA 3WT2A 3VK9A 1SKWB 2HXKA 2R0PA 4TR3A 1QXHA 4WR4A 4G0IA 4LMWA 2OE3A 4NXIA 3KP8A 1VRSD 5KN2A 2CZ3A 3KD0A 2H1GA 3TDGA 3D22A 2QA2A 2X8GA 1U6TA 2IJYA 2FWFA 4AKIA 3FW2A 3EU4A 1EP7A 3ERWA 2LNSA 3V1WA 3DVWA 3F4SA 5HR1A 4V2MA 4GSTA 4KAEA 3RAZA 2PVQA 3TJJA 4XIHA 1AQXA 3IE3A 3QMXA 1FG4A 2XPDA 1TXXA 5ECPB 4KX4A 3IXRA 3ZFLA 3IK9A 1H75A 1EEMA 3L4NA 3JCML 5FT3A 1I1IP 1LJRA 1JHBA 3KTBA 4NV5A 4Q5RA 4N0ZA 1T8EB 4JZQA 1THOA 2H0HA 1VF2A 1WE0A 5KEJA 3EPTA 4XS1A 3BOAA 2HZEB 5ID2A 2UV8G 1V9WA 3FK8A 3EE2A 2HSNB 4IW9A 2V6KA 2H19A 2LQOA 5DALA 2GZPA 3UL3A 1M2DA 1GH2A 1I5GA 2QC7A 2H6YA 2YCDA 2FY6A 3KJYA 2LQQA 5D9XA 2KLXA 2GSRA 1FOHA 2OACA 3N9JA 5IMAA 1GP1A 3AY8A 1SVMA 4WF5A 1ZGNA 3GUSA 2V32A 3RBTA 5IPGA 2HZFA 2XC2A 3DIEA 4OFNA 3PINA 1PA3A 2N5BA 1AIUA 3LWAA 3ED3A 2HRAA 4GSSA 4LL1B 2RM6A 3TGZA 2A2RA 2C8UA 22GSA 3QAVA 4PI0C 4MCUA 3D5JA 4ECIA 1XCCA 4CY6A 2YZUA 1SYXA 3NOFA 2OE0A 2L6DA 2WVXB 3IHGA 4HI7A 4WKWA 2IIYA 1TTZA 3KIJA 2X8HA 3HHVA 3IPZA 3IR4A 3GKNA 5J4YA 4ILFA 1GL8A 1QFNA 4F2IA 2DLXA 3US3A 4I2UA 2LRTA 3GA4A 5G2ZA 2BTOT 3IOSA 4PXOA 1HD2A 1WJKA 4L5LA 4J57E 4IQAA 3EURA 3APOA 2O3EA 5IMVA 2LJRA 5F07A 4JU5A 1GWCA 3L9UA 2QKEA 3P8WA 3L0HA 3ZITA 4N11A 2NVLA 1XZOA 4PNGA 2VLVA 3PH9A 4MP4A 1S3CA 4F82A 2GVPA 3GMFA 2ZNMA 4L5OA 3R3EA 3IDVA 3F0IA 2B7JA 2N5AA 3DGQA 1YQ1A 4DVCA 3TB2A 4POMA 2WFCA 4ZBBA 2YPMA 5ECNB 2MZCA 2IN3A 4TXOB 4KGIA 1QK8A 2YWMA 5C00A 1PX7A 4HZ2A 1Q98A 1OKTA 1VF4A 5KN3A 2VD1A 4GLTA 3TOUA 2C1YA 4PX1A 1S3RA 3LW9A 3ZTLA 2A4VA 4RUVA 1GLQA 2VCXA 3D4TA 1THXA 1FHEA 5D8IA 5JCWA 1FW1A 2O36A 4GSNA 1EOGA 3IAS2 4FQUA 3EU3A 3RPNA 3TU3B 3UJ1A 3FR3A 2VL3A 2DBCA 4HSCX 3G7IA 2N5FA 1SKSB 2HNLA 2E0QA 2ALBA 2CVBA 4K1FA 2LS5A 1Z9HA 4F03A 2GTUA 3SBCA 4PI2C 1A2MA 4IKHA 1GRXA 1TRVA 1B9XC 5HFKA 3A5WA 3QD9A 1A24A 2O89A 4PUAA 5A5HB 4OCEA 1LBKA 4IHUA 2VM1A 3O6TA 3IHQA 2V1MA 4FXYP 6GSSA 5CYYA 3NIVA 1V98A 4AKGA 2GQKA 4OO5A 4ZBAA 2CQ9A 1YEPA 6GSYA 4GF0A 1TK8B 3CSHA 4YH2A 4TR1B 1Y6EA 2HLSA 1SK0A 1K0DA 2IMFA 2R0GA 3EC3A 5BRTA 2DC5A 4I5QA 3KGKA 4AF2A 4EE0A 1FB0A 1GSFA 4EL1A 2GLRA 2FWEA 2IMKA 3DYRA 4QL7A 2FWGA 3U5RE 1WPIA 2VM2A 4MJAA 1ERTA 3GL5A 1Z5YE 3VLNA 4XTSA 2K6VA 3BD2A 5EVOA 1BEDA 1TDIA 3UIWA 5J3RA 1M2BA 4MH2A 1TW9A 3GTUB 1TJDA 2B1KA 1DBYA 4EKZA 1JFUA 4TR4A 4MMMA 4O5RA 4WBJA 2ZUPA 1MDKA 2C3QA 3M0FA 3CTFA 5IOWA 2H1LA 1Z7RA 6GSUA 3TJFA 1LU4A 4I2TA 3LXZA 2JL4A 1PGTA 3EYTA 1X9MB 2EIQA 2AUVA 4POLA 1EV4A 2HSHA 4D73A 2JSZA 1ACVA 1F3BA 1NSWA 5IMFA 5AGYA 1M2AA 3TUEA 4TR0A 14GSA 1G7EA 2DJ0A 3ERFA 1OE7A 5LCZA 1TK0B 5HFIA 1DSBA 2H0IA 1WOUA 2WVYA 3UVTA 3G7YA 3UARA 2LSTA 2REMA 2HSNA 2R3XA 2HI7A 3GH6A 2VAFA 4X4JA 5JWOB 2R37A 2VOCA 4ZXGA 1M9BA 1AC1A 2K18A 3F3RA 1W89A 3TKSA 3W8JA 1XWCA 5DCGA 4ID0A 2NPBA 9GSSA 1FOVA 3E0UA 3ZL5A 4KW6A 3W6GA 3HVNA 4HUAA 4K2DA 1X5DA 5D9TA 1TU7A 3GFKA 1M3JA 3GURA 5JCGA 1S3AA 4E68A 1K0BA 5J4VA 1EP8A 1GUMA 3F3QA 5B6MA 4K0NA 5FWGA 1GSYA 4PNFA 2A4HA 3M9JA 1ZMAA 1MDJA 2F51A 2DKIA 5DCHA 2CAIA 2I81A 1A8LA 4BIKA 3S9FA 1PN0A 4Z2TA 4X0XA 3GIXA 3UEMA 1X9SB 2E2GA 1A0RP 3GH9A 3LYKA 1O85A 1N2AA 3ERGA 2DJ2A 3HVXA 2FGXA 5DDLA 2B3SA 2LRCA 7GSSA 4JRRA 4NHZA 3FR6A 3EWLA 5E59A 4EUYA 4V1Ap 1WMJA 3ISOA 5G5FA 2VL2C 2EFHA 5IMDA 4A5PA 1Z6MA 5BMUB 3A2XA 4TOPA 2C80A 1YDKA 2FHEA 5C04A 2B5YA 5B6NA 2WULA 2DJJA 1TP9A 3DWVA 2LJKA 5GAPD 3FZAA 5DAKB 1SD9A 1DE2A 3APSA 4X43A 4PQ1A 2MBTA 1YKAA 3GRXA 4TN8A 3LFLA 4IELA 2PMTA 2F8FA 5CRGA 1SYRA 2VO4A 2QSIA 5CP1A 3CMIA 3QAWA 1SL1B 4EXJA 4L0WA 3CWGA 1PL2A 5ELAA 3RFRC 1CQGA 4X1UA 2GDRA 2LUSA 5HR0A 3VPTA 1PFOA 2C0DA 1T7PB 4PUFC 5F8BA 4MJEA 17GSA 1JZWA 5J40A 5A5KA 2O5VA 1EZKA 1BJXA 3M8NA 1K0NA 1OE8A 3IC8A 2NBSA 4HJMA 3QR6A 1YJ6A 3GNJA 4IP6A 4JBBA 5J9CA 3CSJA 4BVYB 2GS3A 3H93A 6GSWA 1GNEA 4AGSA 3BBYA 2H01A 2FA4A 3LEFA 2AYTA 1VF3A 4DSSB 1S4BP 5IQYA 1HQOA 5IO2A 1Z7PA 4KSOA 1YY7A 1GTAA 2PVOC 2R5GA 4K7NA 3P2AA 1BG5A 2G2QA 1XPVA 3HKRA 3VWUA 2OA7A 4ML6A 1XWKA 2I1UA 1XXUA 2RUEA 2A2PA 2XPEA 1E6BA 5A5HA 2HYXA 3EVIA 3J7Yk 4FYUA 3F6FA 2VCZA 1WWJA 4HU9A 4RQXA 3TJGA 1H4OA 1TI1A 1R5AA 5CNWA 1FB6A 3L9VA 4W66A 4XRAA 5F0GA 4IBPA 2ON5A 3TKQA 2I4AA 4PQHA 2O8VB 1ILOA 3H8QA 2CVDA 3F6DA 1TOFA 1C72A 4TR1A 3HZ8A 1X9WB 2IWTA 1ABAA 2GZYA 5IM9A 3IV4A 2HSMB 5D9WA 3CRTA 2WZSA 2XBIA 1ST9A 2KP2A 4HQZA 4GXZA 1A0FA 2LKUA 1A2LA 2HT9A 1O8XA 1V58A 2MMOA 2L6CA 2DJ3A 4LLRA 4JR4A 4JEDA 4K7OA 4MZBA 1K3LA 4RI6A 2PN8A 5D96A 1NW2A 2YNXA 2R4VA 4WR5A 3TOTA 2PU9C 4F0CA 1J08A 2DJKA 2R0CA 5CRDA 3E9JB 2YWNA 3DVXA 3GTUA 1AW9A 5ECRB 1GUHA 4XS6A 5COHA 1ERWA 4KSMA 2JZSA 2X64A 1SD8A 3H79A 3A3TA 1E2YA 5A4WA 4EDYA 4NV2A 2G0FA 3A2VA 1T00A 2H8LA 4I8BA 1OC9B 11GSA 4KDXA 1YF1A 1YZXA 10GSA 2V41A 5EPFA 4ZB8A 5ECSA 2O85A 1TRWA 3ZLPA 2YJHA 3OR5A 5KN0A 1U87A 1RK4A 2Z9SA 1SJ6A 5J5NA 3G7JA 2IPAA 2GSTA 2HFDA 4MK3A 1QQ2A 4HOJA 3GN3A 5AIVA 1XW5A 2KOKA 5DQSA 2FUG2 4TW5A 4MABA 4IGJA 3PGTA 1NHYA 5CRHA 3Q18A 2FA8A 3VWWA 4K8MA 5A1NA 2E2MA 4HDEA 1GTBA 4OFTA 4POKA 1HNAA 2AV4A 3LXTA 1HYUA 3QPMA 1R26A 2VCVA 1O6JA 1VF1A 5IMZA 1AQVA 2MBSA 3KP9A 1J9BA 1ERVA 4ZL9A 3ZREA 4EVMA 1K3YA 1W4VA 3F4TA 1QGVA 3DKSA 5D9VA 1U3IA 1G0TA 4BL7B 2K8SA 1SK1A 3W8SA 4BVXB 3RDWA 1SJZA 4K6XA 2E7PA 5AISA 2B7KA 2YANA 3DD3A 4G01A 5G1KA 5L71A 4F0BA 1ON4A 3BCIA 3N5OA 3Q6OA 1EOHA 2PUKC 2CX4A 6GSTA 1K0AA 3KMOA 3O3TA 1ZOFA 4KB3A 1F37A 4G0LA 4N30A 2WRTA 1KTEA 1EGRA 4KDUA 1UVZA 5H5RA 4MZWA 3KH7A 1B4QA 3I43A 4F9ZA 5DBQA 3MYDA 3RHCA 4ZBDA 4FYCA 1HNBA 2WZ9A 5INYA 1F3AA 5ECQB 3M1GA 5DJLA 4XCSA 1M7TA 2VLUA 3E3EA 2D2ZA 1V57A 4IP1A 4PHZC 2AHEA 4AJ7A 2YZHA 3HVVA 3HXSA 1GSEA 2QGVA 4E8EA 3FZ4A 3HJMA 1XOAA 4AJ6A 1ZYPA 5B8AA 4PGTA 4TRXA 1EV9A 1GTUA 2H1BA 1G6WA 2ZCTA 5KOXA 1SVOA 3BCKA 4NAXA 4GCIA 4GQCA 1OAZA 1IYIA 1WIKA 3F63A 18GSA 4L0UA 2O7KA 4WBRD 1NM3A 1O73A 3VI7A 4EIQA 2V6OA 3L78A 1XWAA 4DSSA 1F2EA 1K3OA 1QMVA 4POBA 3QFAC 1ML6A 2CZ2A 1IYHA 1A8YA 5D93A 4AKHA 1PSQA 1YEWC 5B7CA 3HY2A 19GSA 4JR6A 3GV1A 2KHPA 3A5IA 3M9KA 4O5QA 2H30A 4NPBA 1OC8A 3D6IA 2HE3A 4ZB6A 2P0GA 3LORA 4LA1A 4QL9A 4MJBA 3GX0A 1F9MA 3QAGA 5KN1A 2HZEA 3DXBA 2VD0A 2AB6A 5ECKB 4TKYA 3QOUA 4GWRA 2P31A 1OYJA 3Q74A 1FO5A 1B4PA 2H75A 2X49A 4H86A 5JWRB 4IJ3A 3LJRA 3TKRA 1KBNA 3DEXA 1ERUA 4Z7XA 4MH3A 1T1VA 5JCUA 4MPFA 4KUNA 2P5QA 5HR2A 1EGOA 1ZL9A 1PKZA 5H5SA 5JWQB 1BF5A 2WGRA 5GZZB 5A34B 2OJLA 4FIWA 4EF0A 4EO3A 1B9YC 3MSZA 3IC4A 1MD3A 5CREA 3HMJG 2YV7A 3LG6A 1SJIA 2EIRA 1HNCA 2UZ8A 1DE1A 1X5CA 1EEJA 3FZ5A 2XBQA 2WVXA 2M80A 3GX8A 1YVLA 4NWYA 5A4UA 1TRSA 2H70A 4CY8A 3EMPA 5ECLB 2K9FA 1ZYNA 3TRQA 2H6XA 1GUKA 4P3YB 3H1NA 2WJUA 1TXUA 1M9AA 2EFDA 3MWHA 1XW6A 3GHAA 2WB9A 3CQFA 4DSRA 4CW9A 4QMKA 4FH8A 2YWIA 4EIPA 1X0RA 3F4RA 1YEXA 1RW1A 3C71A 5ENUA 2JADA 3VPQA 2YWOA 3R2QA 2BJXA 3O76A 4ZL8A 2F3MA 1N8JA 1OC3A 4MLYA 1AQWA 1TK5B 3FZ9A 4TVEA 3C1SA 4Z2RA 3VI5A 1JZRA 4KH7A 4K0GA 3UBLA 1T4YA 1USBA 1F6MC 3CSIA 3ME8A 2PGTA 4IJIA 1PMTA 4O92A 2WCIA 3G9BA 2YP6A 4YQMA 1VGLA 3HJOA 4KF9A 2OT3A 1B8XA 5J4UA 2HRNA 2J23A 1XG8A 3D4MA 2L5LA 1PRXA 4G0KA 4N10A 4TXOA 1M0UA 4XS4B 4MPGA 1MDIA 3HD5A 4K7IA 3VWVA 2KUCA 1UC7A 5F05A 4MF7A 1XFLA 3C73A 3IBHA 4FO5A 2BMXA 4BL7A 5EL8A 3WGEA 3IA1A 1XBSA 3CTGA 5DVBA 1GULA 2R6KA 5ECOB 3LYPA 3F8UA 5HQPA 1PN9A 2DKHA 1QUWA 4HQSA 3UAPA 1G6YA 3FKFA 2IMDA 1AXDA 3C7MA 5AN1A 3FR9A 1ZZYA 3RGBC 4K2XA 5ECHB 4PQIA 3TJBA 4IQ1A 3Q19A 1URMA 2WVZA 8GSSA 1R7HA 3CYNA 4OWYA 3F9UA 3KXOA 2NTOA 2CVKA 3VFIA 4O32A 2H73A 2IFQB 4MA9A 4D73B 2GT5A 5LD0A 1ZYQB 2L59A 3HYPA 1AUCA 2HSYA 1I9DA 2I9HA 2K8VA 2MMZA 2VL9A 2PBJA 2CX3A 2JSYA 3GYKA 4Q5FA 4L8EA 1SENA 1N25A 2GGTA 3ME7A 3ZVJD 4ECJA 2F9SA 1BG1A 1M99A 1RQMA 4MNNA 2YV9A 5KOWA 2H71A 4ECCA 2LJAA 2KP1A 3CRUA 4YAVA 3U6VA 2MYGA 1J0FA 4LL4B 2EC4A 5ELGA 1GSQA 2H1AA 4ZL7A 4NHWA 1R4WA 4V1Ag 3MDKA 2WS2A 2TIRA 2X8CA 4FYBA 4GRFA 4ACSA 3EMXA 1JLVA 2PWJA 3APQA 1CQHA 3PPUA 2WW3A 4RI7A 5DQYA 5HR3A 4HS1A 2FD3A 4HU7A 1Z6NA 2RIIA 4AKXB 4KE3A 2LEGA 4OO4A 3MIXA 2L5OA 1AAZA 1K0MA 2HRKB 4V2NA 2YN1A 3I9V2 2WW0A 4Z2UA 2VCWA 1G7OA 5EY6A 2JZTA 4OD7A 1K0OA 4N3ZA 2MMAA 3ZRDA 3KH9A 4BA7A 4RQRA 3H4KA 3FY7A 2L57A 2HRFA 1Z3EA 4ICYA 4MZCA 3KM6A 1GSDA 4MF5A 2VIMA 12GSA 2H74A 5G5EA 2O87A 2AAWA 1GTIA 2H66A 1MD4A 2LNTA 3MAKA 1GLPA 1Q4JA 3A2WA 3P7XA 2CA8A 1GNWA 4GQFA 5LNKe 2H0GA 2WW2A 3LQ7A 2GZZA 1GSSA 4BWSA 2JU5A 2VCTA 2IMIA 5G30A 1JLWA 2C3NA 4YAPA 1BQ7A 1O7UA 1XWGA 1FVJA 2R2JA 4XRDA 1YKCA 3FMWA 2PERA 4O5UA 3IAM2 3ZYWA 2PPTA 2DIYA 3KCMA 4YKGA 1MEKA 1SL0B 3TCOA 2M72A 4QQ7A 5HFGA 3LSZA 3ZIJA 1FVKA 3D21A 5A34A 1OKDA 2EFCA 6GSVA 2VKZG 2XHFA 4ISDA 1M3IA 1SKRB 3CHXC 2RLIA 4WEYA 1TU8A 1PKWA 4O7HA 4USSA 4IN0A 2H6ZA 3CBUA 1S3DA 2GQLA 2H76A 3HJPA 1PL1A 2OBIA 2IMEA 16GSA 4MJCA 5J47A 2GQMA 5DJMA 3WT1A 1JZDA 4MF6A 2B5EA 1BX9A 1JZOA 3MNGA 1XVWA 2EFEA 3UBKA 4NMUA 5GAND 4J56E 2FWHA 4IS0A 3HZ4A 1WRYA 1KNGA 4CHSA 4EDZA 1OVNA 4JE1A 3TJKA 1A2JA 1R5PA 1V40A 2OADA 1XIYA 4IVFA 3EINA 4HZ4A 5G31A 3KTLA 3GKMA 5BMUA 3J7Yb 5IMCA 4TXVA 2C4JA 5FHIA 3GKKA 1WP0A 3DRNA 2EIOA 3GL3A 3WGXA 4Q5QA 2P5RA 5G1LA 3CXGA 1FAAA 1U3AA 3KMNA 5ID2B 2FNOA 5DAKA 3QCPA 4OCFA 2C0EA 3LGCA 3TRXA 2ON7A 5DALB 4AI6A 3ZMLA 2YJ7A 4V2LA 5F06A 2X4AA 4KCEA 4YQVA 2WDUA 3TKPA 5IO0A 2L4CA 1PX6A 3FRCA 1SVLA 3VURA 3I6AA 4OFMA 4XS4A 4PTSA 2FLSA 4YQUA 20GSA 1SK2A 4PURA 1MTCA 5A4VA 2GT6A 4ECBA 2I3YA 3C1RA 3UOMA 2L4QA 3UMAA 2LRNA 4BVYA 2DMMA 1XOBA 4DEJA 1O8WA 3TRPA 4XHMA 3TKSE 2H1DA 3RPPA 4AJ8A 1ZCPA 1U88A 3UVHA 5ECMB 5ABRA 2OBKA 5AIXA 3IRAA 4Q5NA 2VCQA 3GKXA 1O81A 5H5QA 3C8EA 1SU9A 2FCHA 5GSSA 4G10A 1NHOA 1TKDB 3KZQA 1TRUA 2IFQA 1DUGA 1B48A 2V2GA 2DMLA 4BPYA 5IIZA 1EWXA 3FHKA 5CAXA 1K0CA 2YOIA 4MDCA 3RHBA 4HJ2A 1YF0A 2OKAA 4LMVA 2CT6A 2CAQA 3TKSC 4N0VA 3PR8A 2DSAA 2B5XA 2JACA 2C0GA 1V2AA 4G9HA 2DJ1A 4BWQA 2B1LA 5J41A 4ZB7A 1T4ZA 2HSMA 4KCAA 4WXTA 2TRCP 5A1NB 3I69A 2AJQB 6GSXA 2NDOA 2ES7A 3ZMKA 1Y25A 1PQNA 5J9BA 3WGDA 1SL2B 3WYWA 1XW9A 2JZRA 2A2SA 3NZNA 3P90A 4G19A 2RUFA 2M46A 4J2FA 3BJ5A 3HDCA 4ULXA 2QA1A 5IPHA 4DSQA 4K5SA 2HRKA 4G2EA 1T3BA 2GSQA 2H72A 2VLTA 1BYEA 2C3TA 4K5RA 1A23A 4I97A 5IOXA 3VWXA 3QFBC 2LTKA 5GSTA 3GSSA 4CDOA 1TI3A 1BAYA 1OC9A 1PD21 4YKFA 1XWBA 3ZZXA 2F8AA 3M3MA 5ECIB 3L9SA 3KEBA 13GSA 5CRWA 2LV3A 2WW1A 3HA9A 1XVQA 2OE1A 4K9ZA 4I6XA 3HVSA 1X5EA 1ZYEA 4WETA 4ZB9A 2CV4A 3ZIVA 4EC0A 3WD6A 3GSTA 1Y1UA 1KEBA 4ZILA 3SWLA 5E4WA 4ZIJA 2TRXA 3FYGA 3DMLA 2IL3A 4KNDA 2VL2A 4GTUA 5D73A 1UN2A 4WF4A 3FEUA 2VUPA 3QDNA 5B8BA 3IK7A 1UA5A 4KDYA 2MMNA 2RM5A 2GSSA 4KA0A 2B6MA 3K8NA 2C0FA 4OMVA 3ZFBA 4ML1A
chains in the Genus database with same CATH topology
1GSUA 2HQTA 2DIZA 2X99A 3HCZA 3ZVJA 5CO3A 4HEA2 4GDFA 3D0ZA 4BVXA 4E8HA 2J9HA 3WT2A 3VK9A 1SKWB 2HXKA 2R0PA 4TR3A 1QXHA 4WR4A 4G0IA 4LMWA 2OE3A 4NXIA 3KP8A 1VRSD 5KN2A 2CZ3A 3KD0A 2H1GA 3TDGA 3D22A 2QA2A 2X8GA 1U6TA 2IJYA 2FWFA 4AKIA 3FW2A 3EU4A 1EP7A 3ERWA 2LNSA 3V1WA 3DVWA 3F4SA 5HR1A 4V2MA 4GSTA 4KAEA 3RAZA 2PVQA 3TJJA 4XIHA 1AQXA 3IE3A 3QMXA 1FG4A 2XPDA 1TXXA 5ECPB 4KX4A 3IXRA 3ZFLA 3IK9A 1H75A 1EEMA 3L4NA 3JCML 5FT3A 1LJRA 1JHBA 3KTBA 4NV5A 4Q5RA 4N0ZA 1T8EB 4JZQA 1THOA 2H0HA 1VF2A 1WE0A 5KEJA 3EPTA 4XS1A 3BOAA 2HZEB 5ID2A 2UV8G 1V9WA 3FK8A 3EE2A 2HSNB 4IW9A 2V6KA 2H19A 2LQOA 5DALA 2GZPA 3UL3A 1M2DA 1GH2A 1I5GA 2QC7A 2H6YA 2YCDA 2FY6A 3KJYA 2LQQA 5D9XA 2KLXA 2GSRA 1FOHA 2OACA 3N9JA 5IMAA 1GP1A 3AY8A 1SVMA 4WF5A 1ZGNA 3GUSA 2V32A 3RBTA 5IPGA 2HZFA 2XC2A 3DIEA 4OFNA 3PINA 1PA3A 2N5BA 1AIUA 3LWAA 3ED3A 2HRAA 4GSSA 4LL1B 2RM6A 3TGZA 2A2RA 2C8UA 22GSA 3QAVA 4MCUA 3D5JA 4ECIA 1XCCA 4CY6A 2YZUA 1SYXA 3NOFA 2OE0A 2L6DA 3IHGA 4HI7A 4WKWA 2IIYA 1TTZA 3KIJA 2X8HA 3HHVA 3IPZA 3IR4A 3GKNA 5J4YA 4ILFA 1GL8A 1QFNA 4F2IA 2DLXA 3US3A 4I2UA 2LRTA 3GA4A 5G2ZA 2BTOT 3IOSA 4PXOA 1HD2A 1WJKA 4L5LA 4J57E 4IQAA 3EURA 3APOA 5IMVA 2LJRA 5F07A 4JU5A 1GWCA 3L9UA 2QKEA 3P8WA 3L0HA 3ZITA 4N11A 2NVLA 1XZOA 4PNGA 2VLVA 3PH9A 4MP4A 1S3CA 4F82A 2GVPA 3GMFA 2ZNMA 4L5OA 3R3EA 3IDVA 3F0IA 2B7JA 2N5AA 3DGQA 1YQ1A 4DVCA 3TB2A 4POMA 2WFCA 4ZBBA 2YPMA 5ECNB 2MZCA 2IN3A 4TXOB 4KGIA 1QK8A 2YWMA 5C00A 1PX7A 4HZ2A 1Q98A 1OKTA 1VF4A 5KN3A 2VD1A 4GLTA 3TOUA 2C1YA 4PX1A 3LW9A 3ZTLA 2A4VA 4RUVA 1GLQA 2VCXA 3D4TA 1THXA 1FHEA 5D8IA 5JCWA 1FW1A 4GSNA 1EOGA 3IAS2 4FQUA 3EU3A 3RPNA 3TU3B 3UJ1A 3FR3A 2VL3A 2DBCA 3G7IA 2N5FA 1SKSB 2HNLA 2E0QA 2ALBA 2CVBA 4K1FA 2LS5A 1Z9HA 4F03A 2GTUA 3SBCA 1A2MA 4IKHA 1GRXA 1TRVA 1B9XC 5HFKA 3A5WA 3QD9A 1A24A 2O89A 4PUAA 5A5HB 4OCEA 1LBKA 4IHUA 2VM1A 3O6TA 3IHQA 2V1MA 5CYYA 6GSSA 3NIVA 1V98A 4AKGA 2GQKA 4OO5A 4ZBAA 2CQ9A 1YEPA 6GSYA 4GF0A 1TK8B 3CSHA 4YH2A 4TR1B 1Y6EA 2HLSA 1SK0A 1K0DA 2IMFA 2R0GA 3EC3A 5BRTA 2DC5A 4I5QA 3KGKA 4AF2A 4EE0A 1FB0A 1GSFA 4EL1A 2GLRA 2FWEA 2IMKA 3DYRA 4QL7A 2FWGA 3U5RE 1WPIA 2VM2A 4MJAA 1ERTA 3GL5A 1Z5YE 3VLNA 4XTSA 2K6VA 3BD2A 5EVOA 1BEDA 1TDIA 3UIWA 5J3RA 1M2BA 4MH2A 1TW9A 3GTUB 1TJDA 2B1KA 1DBYA 4EKZA 1JFUA 4TR4A 4MMMA 4O5RA 4WBJA 2ZUPA 1MDKA 2C3QA 3M0FA 3CTFA 5IOWA 2H1LA 1Z7RA 6GSUA 3TJFA 1LU4A 4I2TA 3LXZA 2JL4A 1PGTA 3EYTA 1X9MB 2EIQA 2AUVA 4POLA 1EV4A 2HSHA 4D73A 2JSZA 1ACVA 1F3BA 1NSWA 5IMFA 5AGYA 1M2AA 3TUEA 4TR0A 14GSA 1G7EA 2DJ0A 3ERFA 1OE7A 5LCZA 1TK0B 5HFIA 1DSBA 2H0IA 1WOUA 3UVTA 3G7YA 3UARA 2LSTA 2REMA 2HSNA 2R3XA 2HI7A 3GH6A 2VAFA 4X4JA 5JWOB 2R37A 2VOCA 4ZXGA 1M9BA 1AC1A 2K18A 3F3RA 1W89A 3TKSA 3W8JA 1XWCA 5DCGA 4ID0A 2NPBA 9GSSA 1FOVA 3E0UA 3ZL5A 4KW6A 3W6GA 4HUAA 4K2DA 1X5DA 5D9TA 1TU7A 3GFKA 3GURA 5JCGA 1S3AA 4E68A 1K0BA 5J4VA 1EP8A 1GUMA 3F3QA 5B6MA 4K0NA 5FWGA 1GSYA 4PNFA 2A4HA 3M9JA 1ZMAA 1MDJA 2F51A 2DKIA 5DCHA 2CAIA 2I81A 1A8LA 3S9FA 1PN0A 4Z2TA 4X0XA 3GIXA 3UEMA 1X9SB 2E2GA 1A0RP 3GH9A 3LYKA 1O85A 1N2AA 3ERGA 2DJ2A 3HVXA 2FGXA 5DDLA 2B3SA 2LRCA 7GSSA 4JRRA 4NHZA 3FR6A 3EWLA 5E59A 4EUYA 4V1Ap 1WMJA 3ISOA 5G5FA 2VL2C 2EFHA 5IMDA 4A5PA 1Z6MA 5BMUB 3A2XA 4TOPA 2C80A 1YDKA 2FHEA 5C04A 2B5YA 5B6NA 2WULA 2DJJA 1TP9A 3DWVA 2LJKA 5GAPD 3FZAA 5DAKB 1SD9A 1DE2A 3APSA 4X43A 4PQ1A 2MBTA 1YKAA 3GRXA 4TN8A 3LFLA 4IELA 2PMTA 2F8FA 5CRGA 1SYRA 2VO4A 2QSIA 5CP1A 3CMIA 3QAWA 1SL1B 4EXJA 4L0WA 3CWGA 1PL2A 5ELAA 1CQGA 4X1UA 2GDRA 2LUSA 5HR0A 3VPTA 2C0DA 1T7PB 4PUFC 5F8BA 4MJEA 17GSA 1JZWA 5J40A 5A5KA 2O5VA 1EZKA 1BJXA 3M8NA 1K0NA 1OE8A 3IC8A 2NBSA 4HJMA 3QR6A 1YJ6A 3GNJA 4IP6A 4JBBA 5J9CA 3CSJA 4BVYB 2GS3A 3H93A 6GSWA 1GNEA 4AGSA 3BBYA 2H01A 2FA4A 3LEFA 2AYTA 1VF3A 4DSSB 5IQYA 1HQOA 5IO2A 1Z7PA 4KSOA 1YY7A 1GTAA 2PVOC 2R5GA 4K7NA 3P2AA 1BG5A 2G2QA 1XPVA 3HKRA 3VWUA 2OA7A 4ML6A 1XWKA 2I1UA 1XXUA 2RUEA 2A2PA 2XPEA 1E6BA 5A5HA 2HYXA 3EVIA 3J7Yk 4FYUA 3F6FA 2VCZA 1WWJA 4HU9A 4RQXA 3TJGA 1H4OA 1TI1A 1R5AA 5CNWA 1FB6A 3L9VA 4W66A 4XRAA 5F0GA 4IBPA 2ON5A 3TKQA 2I4AA 4PQHA 2O8VB 1ILOA 3H8QA 2CVDA 3F6DA 1TOFA 1C72A 4TR1A 3HZ8A 1X9WB 2IWTA 1ABAA 2GZYA 5IM9A 3IV4A 2HSMB 5D9WA 3CRTA 2XBIA 1ST9A 2KP2A 4HQZA 4GXZA 1A0FA 2LKUA 1A2LA 2HT9A 1O8XA 1V58A 2MMOA 2L6CA 2DJ3A 4LLRA 4JR4A 4JEDA 4K7OA 4MZBA 1K3LA 4RI6A 2PN8A 5D96A 1NW2A 2YNXA 2R4VA 4WR5A 3TOTA 2PU9C 4F0CA 1J08A 2DJKA 2R0CA 5CRDA 3E9JB 2YWNA 3DVXA 3GTUA 1AW9A 5ECRB 1GUHA 4XS6A 5COHA 1ERWA 4KSMA 2JZSA 2X64A 1SD8A 3H79A 3A3TA 1E2YA 5A4WA 4EDYA 4NV2A 2G0FA 3A2VA 1T00A 2H8LA 4I8BA 1OC9B 11GSA 4KDXA 1YF1A 1YZXA 10GSA 2V41A 5EPFA 4ZB8A 5ECSA 2O85A 1TRWA 3ZLPA 2YJHA 3OR5A 5KN0A 1U87A 1RK4A 2Z9SA 1SJ6A 5J5NA 3G7JA 2IPAA 2GSTA 2HFDA 4MK3A 1QQ2A 4HOJA 3GN3A 5AIVA 1XW5A 2KOKA 5DQSA 2FUG2 4TW5A 4MABA 4IGJA 3PGTA 1NHYA 5CRHA 3Q18A 2FA8A 3VWWA 4K8MA 5A1NA 2E2MA 4HDEA 1GTBA 4OFTA 4POKA 1HNAA 2AV4A 3LXTA 1HYUA 3QPMA 1R26A 2VCVA 1O6JA 1VF1A 5IMZA 1AQVA 2MBSA 3KP9A 1J9BA 1ERVA 4ZL9A 3ZREA 4EVMA 1K3YA 1W4VA 3F4TA 1QGVA 3DKSA 5D9VA 1U3IA 1G0TA 4BL7B 2K8SA 1SK1A 3W8SA 4BVXB 3RDWA 1SJZA 4K6XA 2E7PA 5AISA 2B7KA 2YANA 3DD3A 4G01A 5G1KA 5L71A 4F0BA 1ON4A 3BCIA 3N5OA 3Q6OA 1EOHA 2PUKC 2CX4A 6GSTA 1K0AA 3KMOA 3O3TA 1ZOFA 4KB3A 1F37A 4G0LA 4N30A 2WRTA 1KTEA 1EGRA 4KDUA 1UVZA 5H5RA 4MZWA 3KH7A 1B4QA 3I43A 4F9ZA 5DBQA 3MYDA 3RHCA 4ZBDA 4FYCA 1HNBA 2WZ9A 5INYA 1F3AA 5ECQB 3M1GA 5DJLA 4XCSA 1M7TA 2VLUA 3E3EA 2D2ZA 1V57A 4IP1A 2AHEA 4AJ7A 2YZHA 3HVVA 3HXSA 1GSEA 2QGVA 4E8EA 3FZ4A 3HJMA 1XOAA 4AJ6A 1ZYPA 5B8AA 4PGTA 4TRXA 1EV9A 1GTUA 2H1BA 1G6WA 2ZCTA 5KOXA 1SVOA 3BCKA 4NAXA 4GCIA 4GQCA 1OAZA 1IYIA 1WIKA 3F63A 18GSA 4L0UA 2O7KA 4WBRD 1NM3A 1O73A 3VI7A 4EIQA 2V6OA 3L78A 1XWAA 4DSSA 1F2EA 1K3OA 1QMVA 4POBA 3QFAC 1ML6A 2CZ2A 1IYHA 1A8YA 5D93A 4AKHA 1PSQA 5B7CA 3HY2A 19GSA 4JR6A 3GV1A 2KHPA 3A5IA 3M9KA 4O5QA 2H30A 4NPBA 1OC8A 3D6IA 2HE3A 4ZB6A 2P0GA 3LORA 4LA1A 4QL9A 4MJBA 3GX0A 1F9MA 3QAGA 5KN1A 2HZEA 3DXBA 2VD0A 2AB6A 5ECKB 4TKYA 3QOUA 4GWRA 2P31A 1OYJA 3Q74A 1FO5A 1B4PA 2H75A 2X49A 4H86A 5JWRB 4IJ3A 3LJRA 3TKRA 1KBNA 3DEXA 1ERUA 4Z7XA 4MH3A 1T1VA 5JCUA 4MPFA 4KUNA 2P5QA 5HR2A 1EGOA 1ZL9A 1PKZA 5H5SA 5JWQB 1BF5A 2WGRA 5GZZB 5A34B 2OJLA 4FIWA 4EF0A 4EO3A 1B9YC 3MSZA 3IC4A 1MD3A 5CREA 3HMJG 2YV7A 3LG6A 1SJIA 2EIRA 1HNCA 2UZ8A 1DE1A 1X5CA 1EEJA 3FZ5A 2XBQA 2M80A 3GX8A 1YVLA 4NWYA 5A4UA 1TRSA 2H70A 4CY8A 3EMPA 5ECLB 2K9FA 1ZYNA 3TRQA 2H6XA 1GUKA 4P3YB 3H1NA 2WJUA 1TXUA 1M9AA 2EFDA 3MWHA 1XW6A 3GHAA 2WB9A 4DSRA 4CW9A 4QMKA 4FH8A 2YWIA 4EIPA 1X0RA 3F4RA 1YEXA 1RW1A 3C71A 5ENUA 2JADA 3VPQA 2YWOA 3R2QA 2BJXA 3O76A 4ZL8A 2F3MA 1N8JA 1OC3A 4MLYA 1AQWA 1TK5B 3FZ9A 4TVEA 3C1SA 4Z2RA 3VI5A 1JZRA 4KH7A 4K0GA 3UBLA 1T4YA 1USBA 1F6MC 3CSIA 3ME8A 2PGTA 4IJIA 1PMTA 4O92A 2WCIA 3G9BA 2YP6A 4YQMA 1VGLA 3HJOA 4KF9A 2OT3A 1B8XA 5J4UA 2HRNA 2J23A 3D4MA 2L5LA 1PRXA 4G0KA 4N10A 4TXOA 1M0UA 4XS4B 4MPGA 1MDIA 3HD5A 4K7IA 3VWVA 2KUCA 1UC7A 5F05A 4MF7A 1XFLA 3C73A 3IBHA 4FO5A 2BMXA 4BL7A 5EL8A 3WGEA 3IA1A 1XBSA 3CTGA 5DVBA 1GULA 2R6KA 5ECOB 3LYPA 3F8UA 5HQPA 1PN9A 2DKHA 1QUWA 4HQSA 3UAPA 1G6YA 3FKFA 2IMDA 1AXDA 3C7MA 5AN1A 3FR9A 1ZZYA 4K2XA 5ECHB 4PQIA 3TJBA 4IQ1A 3Q19A 1URMA 8GSSA 1R7HA 3CYNA 4OWYA 3F9UA 3KXOA 2NTOA 2CVKA 3VFIA 4O32A 2H73A 2IFQB 4MA9A 4D73B 2GT5A 5LD0A 1ZYQB 2L59A 3HYPA 1AUCA 2HSYA 1I9DA 2I9HA 2K8VA 2MMZA 2VL9A 2PBJA 2CX3A 2JSYA 3GYKA 4Q5FA 4L8EA 1SENA 1N25A 2GGTA 3ME7A 3ZVJD 4ECJA 2F9SA 1BG1A 1M99A 1RQMA 4MNNA 2YV9A 5KOWA 2H71A 4ECCA 2LJAA 2KP1A 3CRUA 4YAVA 3U6VA 2MYGA 1J0FA 4LL4B 2EC4A 5ELGA 1GSQA 2H1AA 4ZL7A 4NHWA 1R4WA 4V1Ag 3MDKA 2WS2A 2TIRA 2X8CA 4FYBA 4GRFA 4ACSA 3EMXA 1JLVA 2PWJA 3APQA 1CQHA 3PPUA 4RI7A 5DQYA 5HR3A 4HS1A 2FD3A 4HU7A 1Z6NA 2RIIA 4AKXB 4KE3A 2LEGA 4OO4A 3MIXA 2L5OA 1AAZA 1K0MA 2HRKB 4V2NA 2YN1A 3I9V2 4Z2UA 2VCWA 1G7OA 5EY6A 2JZTA 4OD7A 1K0OA 4N3ZA 2MMAA 3ZRDA 3KH9A 4BA7A 4RQRA 3H4KA 3FY7A 2L57A 2HRFA 1Z3EA 4ICYA 4MZCA 3KM6A 1GSDA 4MF5A 2VIMA 12GSA 2H74A 5G5EA 2O87A 2AAWA 1GTIA 2H66A 1MD4A 2LNTA 3MAKA 1GLPA 1Q4JA 3A2WA 3P7XA 2CA8A 1GNWA 4GQFA 5LNKe 2H0GA 3LQ7A 2GZZA 1GSSA 4BWSA 2JU5A 2VCTA 2IMIA 5G30A 1JLWA 2C3NA 4YAPA 1BQ7A 1O7UA 1XWGA 1FVJA 2R2JA 4XRDA 1YKCA 3FMWA 2PERA 4O5UA 3IAM2 3ZYWA 2PPTA 2DIYA 3KCMA 4YKGA 1MEKA 1SL0B 3TCOA 2M72A 4QQ7A 5HFGA 3LSZA 3ZIJA 1FVKA 3D21A 5A34A 1OKDA 2EFCA 6GSVA 2VKZG 2XHFA 4ISDA 1SKRB 4WEYA 2RLIA 1TU8A 1PKWA 4O7HA 4USSA 4IN0A 2H6ZA 3CBUA 1S3DA 2GQLA 2H76A 3HJPA 1PL1A 2OBIA 2IMEA 16GSA 4MJCA 5J47A 2GQMA 5DJMA 3WT1A 1JZDA 4MF6A 2B5EA 1BX9A 1JZOA 3MNGA 1XVWA 2EFEA 3UBKA 4NMUA 5GAND 4J56E 2FWHA 4IS0A 3HZ4A 1WRYA 1KNGA 4CHSA 4EDZA 1OVNA 4JE1A 3TJKA 1A2JA 1R5PA 1V40A 2OADA 1XIYA 4IVFA 3EINA 4HZ4A 5G31A 3KTLA 3GKMA 5BMUA 3J7Yb 5IMCA 4TXVA 2C4JA 5FHIA 3GKKA 1WP0A 3DRNA 2EIOA 3GL3A 3WGXA 4Q5QA 2P5RA 5G1LA 3CXGA 1FAAA 1U3AA 3KMNA 5ID2B 2FNOA 5DAKA 3QCPA 4OCFA 2C0EA 3LGCA 3TRXA 2ON7A 5DALB 4AI6A 3ZMLA 2YJ7A 4V2LA 5F06A 2X4AA 4KCEA 4YQVA 2WDUA 3TKPA 5IO0A 2L4CA 1PX6A 3FRCA 1SVLA 3VURA 3I6AA 4OFMA 4XS4A 4PTSA 2FLSA 4YQUA 20GSA 1SK2A 4PURA 1MTCA 5A4VA 2GT6A 4ECBA 2I3YA 3C1RA 3UOMA 2L4QA 3UMAA 2LRNA 4BVYA 2DMMA 1XOBA 4DEJA 1O8WA 3TRPA 4XHMA 3TKSE 2H1DA 3RPPA 4AJ8A 1ZCPA 1U88A 3UVHA 5ECMB 5ABRA 2OBKA 5AIXA 3IRAA 4Q5NA 2VCQA 3GKXA 1O81A 5H5QA 3C8EA 1SU9A 2FCHA 5GSSA 4G10A 1NHOA 1TKDB 3KZQA 1TRUA 2IFQA 1DUGA 1B48A 2V2GA 2DMLA 4BPYA 5IIZA 1EWXA 3FHKA 5CAXA 1K0CA 2YOIA 4MDCA 3RHBA 4HJ2A 1YF0A 2OKAA 4LMVA 2CT6A 2CAQA 3TKSC 4N0VA 3PR8A 2DSAA 2B5XA 2JACA 2C0GA 1V2AA 4G9HA 2DJ1A 4BWQA 2B1LA 5J41A 4ZB7A 1T4ZA 2HSMA 4KCAA 4WXTA 2TRCP 5A1NB 3I69A 2AJQB 6GSXA 2NDOA 2ES7A 3ZMKA 1Y25A 1PQNA 5J9BA 3WGDA 1SL2B 3WYWA 1XW9A 2JZRA 2A2SA 3NZNA 3P90A 4G19A 2RUFA 2M46A 4J2FA 3BJ5A 3HDCA 4ULXA 2QA1A 5IPHA 4DSQA 4K5SA 2HRKA 4G2EA 1T3BA 2GSQA 2H72A 2VLTA 1BYEA 2C3TA 4K5RA 1A23A 4I97A 5IOXA 3VWXA 3QFBC 2LTKA 5GSTA 3GSSA 4CDOA 1TI3A 1BAYA 1OC9A 1PD21 4YKFA 1XWBA 3ZZXA 2F8AA 3M3MA 5ECIB 3L9SA 3KEBA 13GSA 5CRWA 2LV3A 3HA9A 1XVQA 2OE1A 4K9ZA 4I6XA 3HVSA 1X5EA 1ZYEA 4WETA 4ZB9A 2CV4A 3ZIVA 4EC0A 3WD6A 3GSTA 1Y1UA 1KEBA 4ZILA 3SWLA 5E4WA 4ZIJA 2TRXA 3FYGA 3DMLA 2IL3A 4KNDA 2VL2A 4GTUA 5D73A 1UN2A 4WF4A 3FEUA 2VUPA 3QDNA 5B8BA 3IK7A 1UA5A 4KDYA 2MMNA 2RM5A 2GSSA 4KA0A 2B6MA 3K8NA 2C0FA 4OMVA 3ZFBA 4ML1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSU A;  2HQT A;  2DIZ A;  2X99 A;  3HCZ A;  3ZVJ A;  5CO3 A;  4HEA 2;  3D0Z A;  4BVX A;  4E8H A;  2J9H A;  3WT2 A;  3VK9 A;  1SKW B;  2HXK A;  4TR3 A;  1QXH A;  4WR4 A;  4G0I A;  4LMW A;  2OE3 A;  4NXI A;  3KP8 A;  1VRS D;  5KN2 A;  2CZ3 A;  3KD0 A;  2H1G A;  3TDG A;  3D22 A;  2X8G A;  1U6T A;  2IJY A;  2FWF A;  3FW2 A;  3EU4 A;  1EP7 A;  3ERW A;  2LNS A;  3V1W A;  3DVW A;  3F4S A;  5HR1 A;  4V2M A;  4GST A;  4KAE A;  3RAZ A;  2PVQ A;  3TJJ A;  4XIH A;  1AQX A;  3IE3 A;  3QMX A;  1FG4 A;  2XPD A;  1TXX A;  5ECP B;  4KX4 A;  3IXR A;  3ZFL A;  3IK9 A;  1H75 A;  1EEM A;  3L4N A;  3JCM L;  5FT3 A;  1LJR A;  1JHB A;  3KTB A;  4NV5 A;  4Q5R A;  4N0Z A;  1T8E B;  4JZQ A;  1THO A;  2H0H A;  1VF2 A;  1WE0 A;  5KEJ A;  4XS1 A;  3BOA A;  2HZE B;  5ID2 A;  1V9W A;  3FK8 A;  3EE2 A;  2HSN B;  4IW9 A;  2V6K A;  2H19 A;  2LQO A;  5DAL A;  2GZP A;  3UL3 A;  1M2D A;  1GH2 A;  1I5G A;  2QC7 A;  2H6Y A;  2YCD A;  2FY6 A;  3KJY A;  2LQQ A;  5D9X A;  2KLX A;  2GSR A;  2OAC A;  3N9J A;  5IMA A;  1GP1 A;  3AY8 A;  4WF5 A;  1ZGN A;  3GUS A;  2V32 A;  3RBT A;  5IPG A;  2HZF A;  2XC2 A;  3DIE A;  4OFN A;  3PIN A;  1PA3 A;  2N5B A;  1AIU A;  3LWA A;  3ED3 A;  2HRA A;  4GSS A;  4LL1 B;  2RM6 A;  3TGZ A;  2A2R A;  2C8U A;  22GS A;  3QAV A;  4MCU A;  3D5J A;  4ECI A;  1XCC A;  2YZU A;  1SYX A;  3NOF A;  2OE0 A;  2L6D A;  4HI7 A;  4WKW A;  2IIY A;  1TTZ A;  3KIJ A;  2X8H A;  3HHV A;  3IPZ A;  3IR4 A;  3GKN A;  4ILF A;  1GL8 A;  1QFN A;  4F2I A;  2DLX A;  3US3 A;  4I2U A;  2LRT A;  3GA4 A;  5G2Z A;  2BTO T;  3IOS A;  4PXO A;  1HD2 A;  1WJK A;  4L5L A;  4J57 E;  4IQA A;  3EUR A;  3APO A;  5IMV A;  2LJR A;  5F07 A;  4JU5 A;  1GWC A;  3L9U A;  2QKE A;  3P8W A;  3L0H A;  3ZIT A;  4N11 A;  2NVL A;  1XZO A;  4PNG A;  2VLV A;  3PH9 A;  4MP4 A;  1S3C A;  4F82 A;  2GVP A;  3GMF A;  2ZNM A;  4L5O A;  3R3E A;  3IDV A;  2N5A A;  2B7J A;  3F0I A;  3DGQ A;  1YQ1 A;  4DVC A;  3TB2 A;  4POM A;  2WFC A;  4ZBB A;  2YPM A;  5ECN B;  2MZC A;  2IN3 A;  4TXO B;  4KGI A;  1QK8 A;  2YWM A;  5C00 A;  1PX7 A;  4HZ2 A;  1Q98 A;  1OKT A;  1VF4 A;  5KN3 A;  2VD1 A;  4GLT A;  3TOU A;  2C1Y A;  4PX1 A;  3ZTL A;  2A4V A;  4RUV A;  1GLQ A;  2VCX A;  3D4T A;  1THX A;  1FHE A;  5D8I A;  5JCW A;  1FW1 A;  4GSN A;  1EOG A;  3IAS 2;  4FQU A;  3EU3 A;  3RPN A;  3UJ1 A;  3FR3 A;  2VL3 A;  2DBC A;  3G7I A;  2N5F A;  1SKS B;  2HNL A;  2E0Q A;  2ALB A;  2CVB A;  4K1F A;  2LS5 A;  1Z9H A;  4F03 A;  2GTU A;  3SBC A;  1A2M A;  4IKH A;  1GRX A;  1TRV A;  1B9X C;  5HFK A;  3A5W A;  3QD9 A;  1A24 A;  2O89 A;  4PUA A;  4OCE A;  1LBK A;  4IHU A;  2VM1 A;  3O6T A;  3IHQ A;  2V1M A;  5CYY A;  6GSS A;  3NIV A;  1V98 A;  2GQK A;  4OO5 A;  4ZBA A;  2CQ9 A;  1YEP A;  6GSY A;  4GF0 A;  1TK8 B;  3CSH A;  4YH2 A;  4TR1 B;  1Y6E A;  2HLS A;  1SK0 A;  1K0D A;  2IMF A;  3EC3 A;  2DC5 A;  4I5Q A;  3KGK A;  4AF2 A;  4EE0 A;  1FB0 A;  1GSF A;  4EL1 A;  2GLR A;  2FWE A;  2IMK A;  3DYR A;  4QL7 A;  2FWG A;  3U5R E;  1WPI A;  2VM2 A;  4MJA A;  1ERT A;  3GL5 A;  1Z5Y E;  3VLN A;  4XTS A;  2K6V A;  3BD2 A;  5EVO A;  1BED A;  1TDI A;  3UIW A;  5J3R A;  1M2B A;  4MH2 A;  1TW9 A;  3GTU B;  1TJD A;  2B1K A;  1DBY A;  4EKZ A;  1JFU A;  4TR4 A;  4MMM A;  4O5R A;  4WBJ A;  2ZUP A;  1MDK A;  2C3Q A;  3M0F A;  3CTF A;  5IOW A;  1Z7R A;  6GSU A;  3TJF A;  1LU4 A;  4I2T A;  3LXZ A;  2JL4 A;  1PGT A;  3EYT A;  1X9M B;  2EIQ A;  2AUV A;  4POL A;  1EV4 A;  2HSH A;  4D73 A;  2JSZ A;  1ACV A;  1F3B A;  1NSW A;  5IMF A;  5AGY A;  1M2A A;  3TUE A;  4TR0 A;  14GS A;  1G7E A;  2DJ0 A;  3ERF A;  1OE7 A;  5LCZ A;  1TK0 B;  5HFI A;  1DSB A;  2H0I A;  1WOU A;  3UVT A;  3G7Y A;  3UAR A;  2LST A;  2REM A;  2R3X A;  2HI7 A;  3GH6 A;  2VAF A;  5JWO B;  2R37 A;  2VOC A;  4ZXG A;  1M9B A;  1AC1 A;  2K18 A;  3F3R A;  1W89 A;  3TKS A;  3W8J A;  1XWC A;  5DCG A;  4ID0 A;  2NPB A;  9GSS A;  1FOV A;  3E0U A;  3ZL5 A;  4KW6 A;  3W6G A;  4HUA A;  4K2D A;  1X5D A;  5D9T A;  1TU7 A;  3GFK A;  3GUR A;  5JCG A;  1S3A A;  1K0B A;  1EP8 A;  1GUM A;  3F3Q A;  5B6M A;  4K0N A;  5FWG A;  1GSY A;  4PNF A;  3M9J A;  1ZMA A;  1MDJ A;  2F51 A;  5DCH A;  2CAI A;  2I81 A;  1A8L A;  3S9F A;  4X0X A;  3GIX A;  3UEM A;  1X9S B;  2E2G A;  1A0R P;  3GH9 A;  3LYK A;  1O85 A;  1N2A A;  3ERG A;  2DJ2 A;  3HVX A;  2FGX A;  5DDL A;  2B3S A;  2LRC A;  7GSS A;  4JRR A;  4NHZ A;  3FR6 A;  3EWL A;  5E59 A;  4EUY A;  4V1A p;  1WMJ A;  3ISO A;  5G5F A;  2VL2 C;  5IMD A;  1Z6M A;  3A2X A;  4TOP A;  2C80 A;  1YDK A;  2FHE A;  5C04 A;  2B5Y A;  5B6N A;  2WUL A;  2DJJ A;  1TP9 A;  3DWV A;  2LJK A;  5GAP D;  3FZA A;  5DAK B;  1SD9 A;  1DE2 A;  3APS A;  4X43 A;  4PQ1 A;  2MBT A;  1YKA A;  3GRX A;  4TN8 A;  3LFL A;  4IEL A;  2PMT A;  2F8F A;  5CRG A;  1SYR A;  2VO4 A;  2QSI A;  5CP1 A;  3CMI A;  3QAW A;  1SL1 B;  4EXJ A;  4L0W A;  1PL2 A;  5ELA A;  1CQG A;  4X1U A;  2GDR A;  2LUS A;  5HR0 A;  3VPT A;  2C0D A;  1T7P B;  4PUF C;  5F8B A;  4MJE A;  17GS A;  1JZW A;  5A5K A;  1EZK A;  1BJX A;  3M8N A;  1K0N A;  1OE8 A;  3IC8 A;  2NBS A;  4HJM A;  3QR6 A;  1YJ6 A;  3GNJ A;  4IP6 A;  4JBB A;  5J9C A;  3CSJ A;  4BVY B;  2GS3 A;  3H93 A;  6GSW A;  1GNE A;  4AGS A;  3BBY A;  2H01 A;  2FA4 A;  3LEF A;  2AYT A;  1VF3 A;  4DSS B;  5IQY A;  1HQO A;  5IO2 A;  1Z7P A;  4KSO A;  1YY7 A;  1GTA A;  2PVO C;  2R5G A;  4K7N A;  3P2A A;  1BG5 A;  2G2Q A;  1XPV A;  3HKR A;  3VWU A;  2OA7 A;  4ML6 A;  1XWK A;  2I1U A;  1XXU A;  2RUE A;  2XPE A;  1E6B A;  2HYX A;  3EVI A;  3J7Y k;  4FYU A;  3F6F A;  2VCZ A;  1WWJ A;  4HU9 A;  4RQX A;  3TJG A;  1H4O A;  1TI1 A;  1R5A A;  5CNW A;  1FB6 A;  3L9V A;  4XRA A;  5F0G A;  4IBP A;  2ON5 A;  3TKQ A;  2I4A A;  4PQH A;  2O8V B;  1ILO A;  3H8Q A;  2CVD A;  3F6D A;  1TOF A;  1C72 A;  4TR1 A;  3HZ8 A;  1X9W B;  2IWT A;  1ABA A;  2GZY A;  5IM9 A;  3IV4 A;  2HSM B;  5D9W A;  3CRT A;  2XBI A;  1ST9 A;  2KP2 A;  4HQZ A;  4GXZ A;  1A0F A;  2LKU A;  1A2L A;  2HT9 A;  1O8X A;  1V58 A;  2MMO A;  2L6C A;  2DJ3 A;  4LLR A;  4JR4 A;  4JED A;  4K7O A;  4MZB A;  1K3L A;  4RI6 A;  2PN8 A;  5D96 A;  1NW2 A;  2YNX A;  2R4V A;  4WR5 A;  3TOT A;  2PU9 C;  4F0C A;  1J08 A;  2DJK A;  5CRD A;  3E9J B;  2YWN A;  3DVX A;  3GTU A;  1AW9 A;  5ECR B;  1GUH A;  4XS6 A;  5COH A;  1ERW A;  4KSM A;  2JZS A;  2X64 A;  1SD8 A;  3H79 A;  3A3T A;  1E2Y A;  5A4W A;  4EDY A;  4NV2 A;  2G0F A;  3A2V A;  1T00 A;  2H8L A;  4I8B A;  1OC9 B;  11GS A;  4KDX A;  1YF1 A;  1YZX A;  10GS A;  2V41 A;  5EPF A;  4ZB8 A;  5ECS A;  2O85 A;  1TRW A;  3ZLP A;  2YJH A;  3OR5 A;  5KN0 A;  1U87 A;  1RK4 A;  2Z9S A;  1SJ6 A;  5J5N A;  3G7J A;  2IPA A;  2GST A;  2HFD A;  4MK3 A;  1QQ2 A;  4HOJ A;  3GN3 A;  5AIV A;  1XW5 A;  2KOK A;  5DQS A;  2FUG 2;  4TW5 A;  4MAB A;  4IGJ A;  3PGT A;  1NHY A;  5CRH A;  3Q18 A;  2FA8 A;  3VWW A;  4K8M A;  2E2M A;  4HDE A;  1GTB A;  4OFT A;  4POK A;  1HNA A;  2AV4 A;  3LXT A;  1HYU A;  3QPM A;  1R26 A;  2VCV A;  1O6J A;  1VF1 A;  5IMZ A;  1AQV A;  2MBS A;  3KP9 A;  1J9B A;  1ERV A;  4ZL9 A;  3ZRE A;  4EVM A;  1K3Y A;  1W4V A;  3F4T A;  1QGV A;  3DKS A;  5D9V A;  1U3I A;  1G0T A;  4BL7 B;  2K8S A;  1SK1 A;  3W8S A;  4BVX B;  3RDW A;  1SJZ A;  4K6X A;  2E7P A;  5AIS A;  2B7K A;  2YAN A;  3DD3 A;  5G1K A;  5L71 A;  4F0B A;  1ON4 A;  3BCI A;  3N5O A;  3Q6O A;  1EOH A;  2PUK C;  2CX4 A;  6GST A;  1K0A A;  3KMO A;  3O3T A;  1ZOF A;  4KB3 A;  1F37 A;  4G0L A;  4N30 A;  2WRT A;  1KTE A;  1EGR A;  4KDU A;  1UVZ A;  5H5R A;  4MZW A;  3KH7 A;  1B4Q A;  3I43 A;  4F9Z A;  5DBQ A;  3RHC A;  4ZBD A;  4FYC A;  1HNB A;  2WZ9 A;  5INY A;  1F3A A;  5ECQ B;  3M1G A;  5DJL A;  4XCS A;  1M7T A;  2VLU A;  3E3E A;  2D2Z A;  1V57 A;  4IP1 A;  2AHE A;  4AJ7 A;  2YZH A;  3HVV A;  3HXS A;  1GSE A;  2QGV A;  4E8E A;  3FZ4 A;  3HJM A;  1XOA A;  4AJ6 A;  5B8A A;  4PGT A;  4TRX A;  1EV9 A;  1GTU A;  2H1B A;  1G6W A;  2ZCT A;  3BCK A;  4NAX A;  4GCI A;  4GQC A;  1OAZ A;  1IYI A;  1WIK A;  3F63 A;  18GS A;  4L0U A;  2O7K A;  4WBR D;  1NM3 A;  1O73 A;  3VI7 A;  2V6O A;  3L78 A;  1XWA A;  4DSS A;  1F2E A;  1K3O A;  1QMV A;  4POB A;  3QFA C;  1ML6 A;  2CZ2 A;  1IYH A;  1A8Y A;  5D93 A;  1PSQ A;  5B7C A;  3HY2 A;  19GS A;  4JR6 A;  3GV1 A;  2KHP A;  3M9K A;  2H30 A;  4NPB A;  1OC8 A;  3D6I A;  2HE3 A;  4ZB6 A;  2P0G A;  3LOR A;  4LA1 A;  4QL9 A;  4MJB A;  3GX0 A;  1F9M A;  3QAG A;  5KN1 A;  2HZE A;  3DXB A;  2VD0 A;  2AB6 A;  5ECK B;  4TKY A;  3QOU A;  4GWR A;  2P31 A;  1OYJ A;  3Q74 A;  1FO5 A;  1B4P A;  2H75 A;  4H86 A;  5JWR B;  4IJ3 A;  3LJR A;  3TKR A;  1KBN A;  3DEX A;  1ERU A;  4Z7X A;  4MH3 A;  1T1V A;  5JCU A;  4MPF A;  4KUN A;  2P5Q A;  5HR2 A;  1EGO A;  1ZL9 A;  1PKZ A;  5H5S A;  5JWQ B;  2WGR A;  5GZZ B;  2OJL A;  4FIW A;  4EF0 A;  4EO3 A;  1B9Y C;  3MSZ A;  3IC4 A;  1MD3 A;  5CRE A;  2YV7 A;  3LG6 A;  1SJI A;  2EIR A;  1HNC A;  2UZ8 A;  1DE1 A;  1X5C A;  1EEJ A;  3FZ5 A;  2XBQ A;  2M80 A;  3GX8 A;  4NWY A;  5A4U A;  1TRS A;  2H70 A;  3EMP A;  5ECL B;  2K9F A;  3TRQ A;  2H6X A;  1GUK A;  4P3Y B;  3H1N A;  2WJU A;  1M9A A;  3MWH A;  1XW6 A;  3GHA A;  2WB9 A;  4DSR A;  4CW9 A;  4FH8 A;  2YWI A;  1X0R A;  3F4R A;  1YEX A;  1RW1 A;  3C71 A;  5ENU A;  2JAD A;  3VPQ A;  2YWO A;  3R2Q A;  2BJX A;  3O76 A;  4ZL8 A;  2F3M A;  1N8J A;  1OC3 A;  4MLY A;  1AQW A;  1TK5 B;  3FZ9 A;  4TVE A;  3C1S A;  3VI5 A;  1JZR A;  4KH7 A;  4K0G A;  3UBL A;  1T4Y A;  1USB A;  1F6M C;  3CSI A;  3ME8 A;  2PGT A;  4IJI A;  1PMT A;  4O92 A;  2WCI A;  3G9B A;  2YP6 A;  4YQM A;  1VGL A;  3HJO A;  4KF9 A;  1B8X A;  5J4U A;  2HRN A;  2J23 A;  3D4M A;  2L5L A;  1PRX A;  4G0K A;  4N10 A;  4TXO A;  1M0U A;  4XS4 B;  4MPG A;  1MDI A;  3HD5 A;  4K7I A;  3VWV A;  2KUC A;  1UC7 A;  5F05 A;  4MF7 A;  1XFL A;  3C73 A;  3IBH A;  4FO5 A;  2BMX A;  4BL7 A;  5EL8 A;  3WGE A;  3IA1 A;  1XBS A;  3CTG A;  5DVB A;  1GUL A;  2R6K A;  5ECO B;  3LYP A;  3F8U A;  5HQP A;  1PN9 A;  1QUW A;  4HQS A;  3UAP A;  1G6Y A;  3FKF A;  2IMD A;  1AXD A;  3C7M A;  5AN1 A;  3FR9 A;  1ZZY A;  5ECH B;  4PQI A;  3TJB A;  4IQ1 A;  3Q19 A;  1URM A;  8GSS A;  1R7H A;  3CYN A;  4OWY A;  3F9U A;  3KXO A;  2NTO A;  2CVK A;  3VFI A;  4O32 A;  2H73 A;  2IFQ B;  4MA9 A;  4D73 B;  2GT5 A;  5LD0 A;  1ZYQ B;  2L59 A;  3HYP A;  1AUC A;  2HSY A;  1I9D A;  2I9H A;  2K8V A;  2MMZ A;  2VL9 A;  2PBJ A;  2CX3 A;  2JSY A;  3GYK A;  4Q5F A;  4L8E A;  1SEN A;  2GGT A;  3ME7 A;  3ZVJ D;  4ECJ A;  2F9S A;  1M99 A;  1RQM A;  2YV9 A;  2H71 A;  4ECC A;  2LJA A;  2KP1 A;  3CRU A;  4YAV A;  3U6V A;  2MYG A;  1J0F A;  4LL4 B;  2EC4 A;  5ELG A;  1GSQ A;  2H1A A;  4ZL7 A;  4NHW A;  1R4W A;  4V1A g;  3MDK A;  2WS2 A;  2TIR A;  2X8C A;  4FYB A;  4GRF A;  4ACS A;  3EMX A;  1JLV A;  2PWJ A;  3APQ A;  1CQH A;  3PPU A;  4RI7 A;  5DQY A;  5HR3 A;  4HS1 A;  2FD3 A;  4HU7 A;  1Z6N A;  2RII A;  4KE3 A;  2LEG A;  4OO4 A;  2L5O A;  1AAZ A;  1K0M A;  2HRK B;  4V2N A;  2YN1 A;  3I9V 2;  2VCW A;  1G7O A;  5EY6 A;  2JZT A;  4OD7 A;  1K0O A;  2MMA A;  3ZRD A;  3KH9 A;  4BA7 A;  4RQR A;  3H4K A;  3FY7 A;  2L57 A;  2HRF A;  1Z3E A;  4MZC A;  3KM6 A;  1GSD A;  4MF5 A;  2VIM A;  12GS A;  2H74 A;  5G5E A;  2O87 A;  2AAW A;  1GTI A;  2H66 A;  1MD4 A;  2LNT A;  3MAK A;  1GLP A;  1Q4J A;  3A2W A;  3P7X A;  2CA8 A;  1GNW A;  4GQF A;  5LNK e;  2H0G A;  3LQ7 A;  2GZZ A;  1GSS A;  4BWS A;  2JU5 A;  2VCT A;  2IMI A;  5G30 A;  1JLW A;  2C3N A;  4YAP A;  1BQ7 A;  1O7U A;  1XWG A;  1FVJ A;  2R2J A;  4XRD A;  1YKC A;  2PER A;  3IAM 2;  3ZYW A;  2PPT A;  2DIY A;  3KCM A;  1MEK A;  1SL0 B;  3TCO A;  2M72 A;  4QQ7 A;  5HFG A;  3LSZ A;  3ZIJ A;  1FVK A;  3D21 A;  1OKD A;  6GSV A;  2XHF A;  4ISD A;  1SKR B;  4WEY A;  2RLI A;  1TU8 A;  1PKW A;  4O7H A;  4USS A;  4IN0 A;  2H6Z A;  3CBU A;  1S3D A;  2GQL A;  2H76 A;  3HJP A;  1PL1 A;  2OBI A;  2IME A;  16GS A;  4MJC A;  2GQM A;  5DJM A;  3WT1 A;  1JZD A;  4MF6 A;  2B5E A;  1BX9 A;  1JZO A;  3MNG A;  1XVW A;  3UBK A;  4NMU A;  5GAN D;  4J56 E;  2FWH A;  4IS0 A;  3HZ4 A;  1WRY A;  1KNG A;  4CHS A;  4EDZ A;  1OVN A;  4JE1 A;  3TJK A;  1A2J A;  1R5P A;  1V40 A;  2OAD A;  1XIY A;  4IVF A;  3EIN A;  4HZ4 A;  5G31 A;  3KTL A;  3GKM A;  5BMU A;  3J7Y b;  5IMC A;  4TXV A;  2C4J A;  5FHI A;  3GKK A;  1WP0 A;  3DRN A;  2EIO A;  3GL3 A;  3WGX A;  4Q5Q A;  2P5R A;  5G1L A;  3CXG A;  1FAA A;  1U3A A;  3KMN A;  5ID2 B;  2FNO A;  5DAK A;  3QCP A;  4OCF A;  2C0E A;  3LGC A;  3TRX A;  2ON7 A;  5DAL B;  3ZML A;  2YJ7 A;  4V2L A;  5F06 A;  4KCE A;  4YQV A;  2WDU A;  3TKP A;  5IO0 A;  2L4C A;  1PX6 A;  3FRC A;  3VUR A;  3I6A A;  4OFM A;  4XS4 A;  4PTS A;  2FLS A;  4YQU A;  20GS A;  1SK2 A;  4PUR A;  1MTC A;  5A4V A;  2GT6 A;  4ECB A;  2I3Y A;  3C1R A;  3UOM A;  2L4Q A;  3UMA A;  2LRN A;  4BVY A;  2DMM A;  1XOB A;  4DEJ A;  1O8W A;  3TRP A;  4XHM A;  3TKS E;  2H1D A;  3RPP A;  4AJ8 A;  1ZCP A;  1U88 A;  3UVH A;  5ECM B;  5ABR A;  2OBK A;  5AIX A;  3IRA A;  4Q5N A;  2VCQ A;  3GKX A;  1O81 A;  5H5Q A;  3C8E A;  1SU9 A;  2FCH A;  5GSS A;  4G10 A;  1NHO A;  1TKD B;  3KZQ A;  1TRU A;  2IFQ A;  1DUG A;  1B48 A;  2V2G A;  2DML A;  4BPY A;  5IIZ A;  1EWX A;  3FHK A;  5CAX A;  1K0C A;  2YOI A;  4MDC A;  3RHB A;  4HJ2 A;  1YF0 A;  2OKA A;  4LMV A;  2CT6 A;  2CAQ A;  3TKS C;  4N0V A;  3PR8 A;  2DSA A;  2B5X A;  2JAC A;  2C0G A;  1V2A A;  4G9H A;  2DJ1 A;  4BWQ A;  2B1L A;  5J41 A;  1T4Z A;  2HSM A;  4KCA A;  4WXT A;  2TRC P;  2AJQ B;  3I69 A;  6GSX A;  2NDO A;  2ES7 A;  3ZMK A;  1Y25 A;  1PQN A;  5J9B A;  3WGD A;  1SL2 B;  3WYW A;  1XW9 A;  2JZR A;  2A2S A;  3NZN A;  3P90 A;  4G19 A;  2RUF A;  2M46 A;  4J2F A;  3BJ5 A;  3HDC A;  4ULX A;  5IPH A;  4DSQ A;  2HRK A;  4G2E A;  1T3B A;  2GSQ A;  2H72 A;  2VLT A;  1BYE A;  2C3T A;  1A23 A;  4I97 A;  5IOX A;  3VWX A;  3QFB C;  2LTK A;  5GST A;  3GSS A;  4CDO A;  1TI3 A;  1BAY A;  1OC9 A;  1PD2 1;  1XWB A;  3ZZX A;  2F8A A;  3M3M A;  5ECI B;  3L9S A;  3KEB A;  13GS A;  5CRW A;  2LV3 A;  3HA9 A;  1XVQ A;  2OE1 A;  4K9Z A;  4I6X A;  3HVS A;  1X5E A;  1ZYE A;  4WET A;  4ZB9 A;  2CV4 A;  3ZIV A;  4EC0 A;  3WD6 A;  3GST A;  1KEB A;  4ZIL A;  3SWL A;  5E4W A;  4ZIJ A;  2TRX A;  3FYG A;  3DML A;  2IL3 A;  4KND A;  2VL2 A;  4GTU A;  5D73 A;  1UN2 A;  4WF4 A;  3FEU A;  2VUP A;  3QDN A;  5B8B A;  3IK7 A;  1UA5 A;  4KDY A;  2MMN A;  2RM5 A;  2GSS A;  4KA0 A;  2B6M A;  3K8N A;  2C0F A;  4OMV A;  3ZFB A;  4ML1 A; 
#chains in the Genus database with same CATH topology
 1GSU A;  2HQT A;  2DIZ A;  2X99 A;  3HCZ A;  3ZVJ A;  5CO3 A;  4HEA 2;  4GDF A;  3D0Z A;  4BVX A;  4E8H A;  2J9H A;  3WT2 A;  3VK9 A;  1SKW B;  2HXK A;  2R0P A;  4TR3 A;  1QXH A;  4WR4 A;  4G0I A;  4LMW A;  2OE3 A;  4NXI A;  3KP8 A;  1VRS D;  5KN2 A;  2CZ3 A;  3KD0 A;  2H1G A;  3TDG A;  3D22 A;  2QA2 A;  2X8G A;  1U6T A;  2IJY A;  2FWF A;  4AKI A;  3FW2 A;  3EU4 A;  1EP7 A;  3ERW A;  2LNS A;  3V1W A;  3DVW A;  3F4S A;  5HR1 A;  4V2M A;  4GST A;  4KAE A;  3RAZ A;  2PVQ A;  3TJJ A;  4XIH A;  1AQX A;  3IE3 A;  3QMX A;  1FG4 A;  2XPD A;  1TXX A;  5ECP B;  4KX4 A;  3IXR A;  3ZFL A;  3IK9 A;  1H75 A;  1EEM A;  3L4N A;  3JCM L;  5FT3 A;  1I1I P;  1LJR A;  1JHB A;  3KTB A;  4NV5 A;  4Q5R A;  4N0Z A;  1T8E B;  4JZQ A;  1THO A;  2H0H A;  1VF2 A;  1WE0 A;  5KEJ A;  3EPT A;  4XS1 A;  3BOA A;  2HZE B;  5ID2 A;  2UV8 G;  1V9W A;  3FK8 A;  3EE2 A;  2HSN B;  4IW9 A;  2V6K A;  2H19 A;  2LQO A;  5DAL A;  2GZP A;  3UL3 A;  1M2D A;  1GH2 A;  1I5G A;  2QC7 A;  2H6Y A;  2YCD A;  2FY6 A;  3KJY A;  2LQQ A;  5D9X A;  2KLX A;  2GSR A;  1FOH A;  2OAC A;  3N9J A;  5IMA A;  1GP1 A;  3AY8 A;  1SVM A;  4WF5 A;  1ZGN A;  3GUS A;  2V32 A;  3RBT A;  5IPG A;  2HZF A;  2XC2 A;  3DIE A;  4OFN A;  3PIN A;  1PA3 A;  2N5B A;  1AIU A;  3LWA A;  3ED3 A;  2HRA A;  4GSS A;  4LL1 B;  2RM6 A;  3TGZ A;  2A2R A;  2C8U A;  22GS A;  3QAV A;  4PI0 C;  4MCU A;  3D5J A;  4ECI A;  1XCC A;  4CY6 A;  2YZU A;  1SYX A;  3NOF A;  2OE0 A;  2L6D A;  2WVX B;  3IHG A;  4HI7 A;  4WKW A;  2IIY A;  1TTZ A;  3KIJ A;  2X8H A;  3HHV A;  3IPZ A;  3IR4 A;  3GKN A;  5J4Y A;  4ILF A;  1GL8 A;  1QFN A;  4F2I A;  2DLX A;  3US3 A;  4I2U A;  2LRT A;  3GA4 A;  5G2Z A;  2BTO T;  3IOS A;  4PXO A;  1HD2 A;  1WJK A;  4L5L A;  4J57 E;  4IQA A;  3EUR A;  3APO A;  2O3E A;  5IMV A;  2LJR A;  5F07 A;  4JU5 A;  1GWC A;  3L9U A;  2QKE A;  3P8W A;  3L0H A;  3ZIT A;  4N11 A;  2NVL A;  1XZO A;  4PNG A;  2VLV A;  3PH9 A;  4MP4 A;  1S3C A;  4F82 A;  2GVP A;  3GMF A;  2ZNM A;  4L5O A;  3R3E A;  3IDV A;  3F0I A;  2B7J A;  2N5A A;  3DGQ A;  1YQ1 A;  4DVC A;  3TB2 A;  4POM A;  2WFC A;  4ZBB A;  2YPM A;  5ECN B;  2MZC A;  2IN3 A;  4TXO B;  4KGI A;  1QK8 A;  2YWM A;  5C00 A;  1PX7 A;  4HZ2 A;  1Q98 A;  1OKT A;  1VF4 A;  5KN3 A;  2VD1 A;  4GLT A;  3TOU A;  2C1Y A;  4PX1 A;  1S3R A;  3LW9 A;  3ZTL A;  2A4V A;  4RUV A;  1GLQ A;  2VCX A;  3D4T A;  1THX A;  1FHE A;  5D8I A;  5JCW A;  1FW1 A;  2O36 A;  4GSN A;  1EOG A;  3IAS 2;  4FQU A;  3EU3 A;  3RPN A;  3TU3 B;  3UJ1 A;  3FR3 A;  2VL3 A;  2DBC A;  4HSC X;  3G7I A;  2N5F A;  1SKS B;  2HNL A;  2E0Q A;  2ALB A;  2CVB A;  4K1F A;  2LS5 A;  1Z9H A;  4F03 A;  2GTU A;  3SBC A;  4PI2 C;  1A2M A;  4IKH A;  1GRX A;  1TRV A;  1B9X C;  5HFK A;  3A5W A;  3QD9 A;  1A24 A;  2O89 A;  4PUA A;  5A5H B;  4OCE A;  1LBK A;  4IHU A;  2VM1 A;  3O6T A;  3IHQ A;  2V1M A;  4FXY P;  6GSS A;  5CYY A;  3NIV A;  1V98 A;  4AKG A;  2GQK A;  4OO5 A;  4ZBA A;  2CQ9 A;  1YEP A;  6GSY A;  4GF0 A;  1TK8 B;  3CSH A;  4YH2 A;  4TR1 B;  1Y6E A;  2HLS A;  1SK0 A;  1K0D A;  2IMF A;  2R0G A;  3EC3 A;  5BRT A;  2DC5 A;  4I5Q A;  3KGK A;  4AF2 A;  4EE0 A;  1FB0 A;  1GSF A;  4EL1 A;  2GLR A;  2FWE A;  2IMK A;  3DYR A;  4QL7 A;  2FWG A;  3U5R E;  1WPI A;  2VM2 A;  4MJA A;  1ERT A;  3GL5 A;  1Z5Y E;  3VLN A;  4XTS A;  2K6V A;  3BD2 A;  5EVO A;  1BED A;  1TDI A;  3UIW A;  5J3R A;  1M2B A;  4MH2 A;  1TW9 A;  3GTU B;  1TJD A;  2B1K A;  1DBY A;  4EKZ A;  1JFU A;  4TR4 A;  4MMM A;  4O5R A;  4WBJ A;  2ZUP A;  1MDK A;  2C3Q A;  3M0F A;  3CTF A;  5IOW A;  2H1L A;  1Z7R A;  6GSU A;  3TJF A;  1LU4 A;  4I2T A;  3LXZ A;  2JL4 A;  1PGT A;  3EYT A;  1X9M B;  2EIQ A;  2AUV A;  4POL A;  1EV4 A;  2HSH A;  4D73 A;  2JSZ A;  1ACV A;  1F3B A;  1NSW A;  5IMF A;  5AGY A;  1M2A A;  3TUE A;  4TR0 A;  14GS A;  1G7E A;  2DJ0 A;  3ERF A;  1OE7 A;  5LCZ A;  1TK0 B;  5HFI A;  1DSB A;  2H0I A;  1WOU A;  2WVY A;  3UVT A;  3G7Y A;  3UAR A;  2LST A;  2REM A;  2HSN A;  2R3X A;  2HI7 A;  3GH6 A;  2VAF A;  4X4J A;  5JWO B;  2R37 A;  2VOC A;  4ZXG A;  1M9B A;  1AC1 A;  2K18 A;  3F3R A;  1W89 A;  3TKS A;  3W8J A;  1XWC A;  5DCG A;  4ID0 A;  2NPB A;  9GSS A;  1FOV A;  3E0U A;  3ZL5 A;  4KW6 A;  3W6G A;  3HVN A;  4HUA A;  4K2D A;  1X5D A;  5D9T A;  1TU7 A;  3GFK A;  1M3J A;  3GUR A;  5JCG A;  1S3A A;  4E68 A;  1K0B A;  5J4V A;  1EP8 A;  1GUM A;  3F3Q A;  5B6M A;  4K0N A;  5FWG A;  1GSY A;  4PNF A;  2A4H A;  3M9J A;  1ZMA A;  1MDJ A;  2F51 A;  2DKI A;  5DCH A;  2CAI A;  2I81 A;  1A8L A;  4BIK A;  3S9F A;  1PN0 A;  4Z2T A;  4X0X A;  3GIX A;  3UEM A;  1X9S B;  2E2G A;  1A0R P;  3GH9 A;  3LYK A;  1O85 A;  1N2A A;  3ERG A;  2DJ2 A;  3HVX A;  2FGX A;  5DDL A;  2B3S A;  2LRC A;  7GSS A;  4JRR A;  4NHZ A;  3FR6 A;  3EWL A;  5E59 A;  4EUY A;  4V1A p;  1WMJ A;  3ISO A;  5G5F A;  2VL2 C;  2EFH A;  5IMD A;  4A5P A;  1Z6M A;  5BMU B;  3A2X A;  4TOP A;  2C80 A;  1YDK A;  2FHE A;  5C04 A;  2B5Y A;  5B6N A;  2WUL A;  2DJJ A;  1TP9 A;  3DWV A;  2LJK A;  5GAP D;  3FZA A;  5DAK B;  1SD9 A;  1DE2 A;  3APS A;  4X43 A;  4PQ1 A;  2MBT A;  1YKA A;  3GRX A;  4TN8 A;  3LFL A;  4IEL A;  2PMT A;  2F8F A;  5CRG A;  1SYR A;  2VO4 A;  2QSI A;  5CP1 A;  3CMI A;  3QAW A;  1SL1 B;  4EXJ A;  4L0W A;  3CWG A;  1PL2 A;  5ELA A;  3RFR C;  1CQG A;  4X1U A;  2GDR A;  2LUS A;  5HR0 A;  3VPT A;  1PFO A;  2C0D A;  1T7P B;  4PUF C;  5F8B A;  4MJE A;  17GS A;  1JZW A;  5J40 A;  5A5K A;  2O5V A;  1EZK A;  1BJX A;  3M8N A;  1K0N A;  1OE8 A;  3IC8 A;  2NBS A;  4HJM A;  3QR6 A;  1YJ6 A;  3GNJ A;  4IP6 A;  4JBB A;  5J9C A;  3CSJ A;  4BVY B;  2GS3 A;  3H93 A;  6GSW A;  1GNE A;  4AGS A;  3BBY A;  2H01 A;  2FA4 A;  3LEF A;  2AYT A;  1VF3 A;  4DSS B;  1S4B P;  5IQY A;  1HQO A;  5IO2 A;  1Z7P A;  4KSO A;  1YY7 A;  1GTA A;  2PVO C;  2R5G A;  4K7N A;  3P2A A;  1BG5 A;  2G2Q A;  1XPV A;  3HKR A;  3VWU A;  2OA7 A;  4ML6 A;  1XWK A;  2I1U A;  1XXU A;  2RUE A;  2A2P A;  2XPE A;  1E6B A;  5A5H A;  2HYX A;  3EVI A;  3J7Y k;  4FYU A;  3F6F A;  2VCZ A;  1WWJ A;  4HU9 A;  4RQX A;  3TJG A;  1H4O A;  1TI1 A;  1R5A A;  5CNW A;  1FB6 A;  3L9V A;  4W66 A;  4XRA A;  5F0G A;  4IBP A;  2ON5 A;  3TKQ A;  2I4A A;  4PQH A;  2O8V B;  1ILO A;  3H8Q A;  2CVD A;  3F6D A;  1TOF A;  1C72 A;  4TR1 A;  3HZ8 A;  1X9W B;  2IWT A;  1ABA A;  2GZY A;  5IM9 A;  3IV4 A;  2HSM B;  5D9W A;  3CRT A;  2WZS A;  2XBI A;  1ST9 A;  2KP2 A;  4HQZ A;  4GXZ A;  1A0F A;  2LKU A;  1A2L A;  2HT9 A;  1O8X A;  1V58 A;  2MMO A;  2L6C A;  2DJ3 A;  4LLR A;  4JR4 A;  4JED A;  4K7O A;  4MZB A;  1K3L A;  4RI6 A;  2PN8 A;  5D96 A;  1NW2 A;  2YNX A;  2R4V A;  4WR5 A;  3TOT A;  2PU9 C;  4F0C A;  1J08 A;  2DJK A;  2R0C A;  5CRD A;  3E9J B;  2YWN A;  3DVX A;  3GTU A;  1AW9 A;  5ECR B;  1GUH A;  4XS6 A;  5COH A;  1ERW A;  4KSM A;  2JZS A;  2X64 A;  1SD8 A;  3H79 A;  3A3T A;  1E2Y A;  5A4W A;  4EDY A;  4NV2 A;  2G0F A;  3A2V A;  1T00 A;  2H8L A;  4I8B A;  1OC9 B;  11GS A;  4KDX A;  1YF1 A;  1YZX A;  10GS A;  2V41 A;  5EPF A;  4ZB8 A;  5ECS A;  2O85 A;  1TRW A;  3ZLP A;  2YJH A;  3OR5 A;  5KN0 A;  1U87 A;  1RK4 A;  2Z9S A;  1SJ6 A;  5J5N A;  3G7J A;  2IPA A;  2GST A;  2HFD A;  4MK3 A;  1QQ2 A;  4HOJ A;  3GN3 A;  5AIV A;  1XW5 A;  2KOK A;  5DQS A;  2FUG 2;  4TW5 A;  4MAB A;  4IGJ A;  3PGT A;  1NHY A;  5CRH A;  3Q18 A;  2FA8 A;  3VWW A;  4K8M A;  5A1N A;  2E2M A;  4HDE A;  1GTB A;  4OFT A;  4POK A;  1HNA A;  2AV4 A;  3LXT A;  1HYU A;  3QPM A;  1R26 A;  2VCV A;  1O6J A;  1VF1 A;  5IMZ A;  1AQV A;  2MBS A;  3KP9 A;  1J9B A;  1ERV A;  4ZL9 A;  3ZRE A;  4EVM A;  1K3Y A;  1W4V A;  3F4T A;  1QGV A;  3DKS A;  5D9V A;  1U3I A;  1G0T A;  4BL7 B;  2K8S A;  1SK1 A;  3W8S A;  4BVX B;  3RDW A;  1SJZ A;  4K6X A;  2E7P A;  5AIS A;  2B7K A;  2YAN A;  3DD3 A;  4G01 A;  5G1K A;  5L71 A;  4F0B A;  1ON4 A;  3BCI A;  3N5O A;  3Q6O A;  1EOH A;  2PUK C;  2CX4 A;  6GST A;  1K0A A;  3KMO A;  3O3T A;  1ZOF A;  4KB3 A;  1F37 A;  4G0L A;  4N30 A;  2WRT A;  1KTE A;  1EGR A;  4KDU A;  1UVZ A;  5H5R A;  4MZW A;  3KH7 A;  1B4Q A;  3I43 A;  4F9Z A;  5DBQ A;  3MYD A;  3RHC A;  4ZBD A;  4FYC A;  1HNB A;  2WZ9 A;  5INY A;  1F3A A;  5ECQ B;  3M1G A;  5DJL A;  4XCS A;  1M7T A;  2VLU A;  3E3E A;  2D2Z A;  1V57 A;  4IP1 A;  4PHZ C;  2AHE A;  4AJ7 A;  2YZH A;  3HVV A;  3HXS A;  1GSE A;  2QGV A;  4E8E A;  3FZ4 A;  3HJM A;  1XOA A;  4AJ6 A;  1ZYP A;  5B8A A;  4PGT A;  4TRX A;  1EV9 A;  1GTU A;  2H1B A;  1G6W A;  2ZCT A;  5KOX A;  1SVO A;  3BCK A;  4NAX A;  4GCI A;  4GQC A;  1OAZ A;  1IYI A;  1WIK A;  3F63 A;  18GS A;  4L0U A;  2O7K A;  4WBR D;  1NM3 A;  1O73 A;  3VI7 A;  4EIQ A;  2V6O A;  3L78 A;  1XWA A;  4DSS A;  1F2E A;  1K3O A;  1QMV A;  4POB A;  3QFA C;  1ML6 A;  2CZ2 A;  1IYH A;  1A8Y A;  5D93 A;  4AKH A;  1PSQ A;  1YEW C;  5B7C A;  3HY2 A;  19GS A;  4JR6 A;  3GV1 A;  2KHP A;  3A5I A;  3M9K A;  4O5Q A;  2H30 A;  4NPB A;  1OC8 A;  3D6I A;  2HE3 A;  4ZB6 A;  2P0G A;  3LOR A;  4LA1 A;  4QL9 A;  4MJB A;  3GX0 A;  1F9M A;  3QAG A;  5KN1 A;  2HZE A;  3DXB A;  2VD0 A;  2AB6 A;  5ECK B;  4TKY A;  3QOU A;  4GWR A;  2P31 A;  1OYJ A;  3Q74 A;  1FO5 A;  1B4P A;  2H75 A;  2X49 A;  4H86 A;  5JWR B;  4IJ3 A;  3LJR A;  3TKR A;  1KBN A;  3DEX A;  1ERU A;  4Z7X A;  4MH3 A;  1T1V A;  5JCU A;  4MPF A;  4KUN A;  2P5Q A;  5HR2 A;  1EGO A;  1ZL9 A;  1PKZ A;  5H5S A;  5JWQ B;  1BF5 A;  2WGR A;  5GZZ B;  5A34 B;  2OJL A;  4FIW A;  4EF0 A;  4EO3 A;  1B9Y C;  3MSZ A;  3IC4 A;  1MD3 A;  5CRE A;  3HMJ G;  2YV7 A;  3LG6 A;  1SJI A;  2EIR A;  1HNC A;  2UZ8 A;  1DE1 A;  1X5C A;  1EEJ A;  3FZ5 A;  2XBQ A;  2WVX A;  2M80 A;  3GX8 A;  1YVL A;  4NWY A;  5A4U A;  1TRS A;  2H70 A;  4CY8 A;  3EMP A;  5ECL B;  2K9F A;  1ZYN A;  3TRQ A;  2H6X A;  1GUK A;  4P3Y B;  3H1N A;  2WJU A;  1TXU A;  1M9A A;  2EFD A;  3MWH A;  1XW6 A;  3GHA A;  2WB9 A;  3CQF A;  4DSR A;  4CW9 A;  4QMK A;  4FH8 A;  2YWI A;  4EIP A;  1X0R A;  3F4R A;  1YEX A;  1RW1 A;  3C71 A;  5ENU A;  2JAD A;  3VPQ A;  2YWO A;  3R2Q A;  2BJX A;  3O76 A;  4ZL8 A;  2F3M A;  1N8J A;  1OC3 A;  4MLY A;  1AQW A;  1TK5 B;  3FZ9 A;  4TVE A;  3C1S A;  4Z2R A;  3VI5 A;  1JZR A;  4KH7 A;  4K0G A;  3UBL A;  1T4Y A;  1USB A;  1F6M C;  3CSI A;  3ME8 A;  2PGT A;  4IJI A;  1PMT A;  4O92 A;  2WCI A;  3G9B A;  2YP6 A;  4YQM A;  1VGL A;  3HJO A;  4KF9 A;  2OT3 A;  1B8X A;  5J4U A;  2HRN A;  2J23 A;  1XG8 A;  3D4M A;  2L5L A;  1PRX A;  4G0K A;  4N10 A;  4TXO A;  1M0U A;  4XS4 B;  4MPG A;  1MDI A;  3HD5 A;  4K7I A;  3VWV A;  2KUC A;  1UC7 A;  5F05 A;  4MF7 A;  1XFL A;  3C73 A;  3IBH A;  4FO5 A;  2BMX A;  4BL7 A;  5EL8 A;  3WGE A;  3IA1 A;  1XBS A;  3CTG A;  5DVB A;  1GUL A;  2R6K A;  5ECO B;  3LYP A;  3F8U A;  5HQP A;  1PN9 A;  2DKH A;  1QUW A;  4HQS A;  3UAP A;  1G6Y A;  3FKF A;  2IMD A;  1AXD A;  3C7M A;  5AN1 A;  3FR9 A;  1ZZY A;  3RGB C;  4K2X A;  5ECH B;  4PQI A;  3TJB A;  4IQ1 A;  3Q19 A;  1URM A;  2WVZ A;  8GSS A;  1R7H A;  3CYN A;  4OWY A;  3F9U A;  3KXO A;  2NTO A;  2CVK A;  3VFI A;  4O32 A;  2H73 A;  2IFQ B;  4MA9 A;  4D73 B;  2GT5 A;  5LD0 A;  1ZYQ B;  2L59 A;  3HYP A;  1AUC A;  2HSY A;  1I9D A;  2I9H A;  2K8V A;  2MMZ A;  2VL9 A;  2PBJ A;  2CX3 A;  2JSY A;  3GYK A;  4Q5F A;  4L8E A;  1SEN A;  1N25 A;  2GGT A;  3ME7 A;  3ZVJ D;  4ECJ A;  2F9S A;  1BG1 A;  1M99 A;  1RQM A;  4MNN A;  2YV9 A;  5KOW A;  2H71 A;  4ECC A;  2LJA A;  2KP1 A;  3CRU A;  4YAV A;  3U6V A;  2MYG A;  1J0F A;  4LL4 B;  2EC4 A;  5ELG A;  1GSQ A;  2H1A A;  4ZL7 A;  4NHW A;  1R4W A;  4V1A g;  3MDK A;  2WS2 A;  2TIR A;  2X8C A;  4FYB A;  4GRF A;  4ACS A;  3EMX A;  1JLV A;  2PWJ A;  3APQ A;  1CQH A;  3PPU A;  2WW3 A;  4RI7 A;  5DQY A;  5HR3 A;  4HS1 A;  2FD3 A;  4HU7 A;  1Z6N A;  2RII A;  4AKX B;  4KE3 A;  2LEG A;  4OO4 A;  3MIX A;  2L5O A;  1AAZ A;  1K0M A;  2HRK B;  4V2N A;  2YN1 A;  3I9V 2;  2WW0 A;  4Z2U A;  2VCW A;  1G7O A;  5EY6 A;  2JZT A;  4OD7 A;  1K0O A;  4N3Z A;  2MMA A;  3ZRD A;  3KH9 A;  4BA7 A;  4RQR A;  3H4K A;  3FY7 A;  2L57 A;  2HRF A;  1Z3E A;  4ICY A;  4MZC A;  3KM6 A;  1GSD A;  4MF5 A;  2VIM A;  12GS A;  2H74 A;  5G5E A;  2O87 A;  2AAW A;  1GTI A;  2H66 A;  1MD4 A;  2LNT A;  3MAK A;  1GLP A;  1Q4J A;  3A2W A;  3P7X A;  2CA8 A;  1GNW A;  4GQF A;  5LNK e;  2H0G A;  2WW2 A;  3LQ7 A;  2GZZ A;  1GSS A;  4BWS A;  2JU5 A;  2VCT A;  2IMI A;  5G30 A;  1JLW A;  2C3N A;  4YAP A;  1BQ7 A;  1O7U A;  1XWG A;  1FVJ A;  2R2J A;  4XRD A;  1YKC A;  3FMW A;  2PER A;  4O5U A;  3IAM 2;  3ZYW A;  2PPT A;  2DIY A;  3KCM A;  4YKG A;  1MEK A;  1SL0 B;  3TCO A;  2M72 A;  4QQ7 A;  5HFG A;  3LSZ A;  3ZIJ A;  1FVK A;  3D21 A;  5A34 A;  1OKD A;  2EFC A;  6GSV A;  2VKZ G;  2XHF A;  4ISD A;  1M3I A;  1SKR B;  3CHX C;  2RLI A;  4WEY A;  1TU8 A;  1PKW A;  4O7H A;  4USS A;  4IN0 A;  2H6Z A;  3CBU A;  1S3D A;  2GQL A;  2H76 A;  3HJP A;  1PL1 A;  2OBI A;  2IME A;  16GS A;  4MJC A;  5J47 A;  2GQM A;  5DJM A;  3WT1 A;  1JZD A;  4MF6 A;  2B5E A;  1BX9 A;  1JZO A;  3MNG A;  1XVW A;  2EFE A;  3UBK A;  4NMU A;  5GAN D;  4J56 E;  2FWH A;  4IS0 A;  3HZ4 A;  1WRY A;  1KNG A;  4CHS A;  4EDZ A;  1OVN A;  4JE1 A;  3TJK A;  1A2J A;  1R5P A;  1V40 A;  2OAD A;  1XIY A;  4IVF A;  3EIN A;  4HZ4 A;  5G31 A;  3KTL A;  3GKM A;  5BMU A;  3J7Y b;  5IMC A;  4TXV A;  2C4J A;  5FHI A;  3GKK A;  1WP0 A;  3DRN A;  2EIO A;  3GL3 A;  3WGX A;  4Q5Q A;  2P5R A;  5G1L A;  3CXG A;  1FAA A;  1U3A A;  3KMN A;  5ID2 B;  2FNO A;  5DAK A;  3QCP A;  4OCF A;  2C0E A;  3LGC A;  3TRX A;  2ON7 A;  5DAL B;  4AI6 A;  3ZML A;  2YJ7 A;  4V2L A;  5F06 A;  2X4A A;  4KCE A;  4YQV A;  2WDU A;  3TKP A;  5IO0 A;  2L4C A;  1PX6 A;  3FRC A;  1SVL A;  3VUR A;  3I6A A;  4OFM A;  4XS4 A;  4PTS A;  2FLS A;  4YQU A;  20GS A;  1SK2 A;  4PUR A;  1MTC A;  5A4V A;  2GT6 A;  4ECB A;  2I3Y A;  3C1R A;  3UOM A;  2L4Q A;  3UMA A;  2LRN A;  4BVY A;  2DMM A;  1XOB A;  4DEJ A;  1O8W A;  3TRP A;  4XHM A;  3TKS E;  2H1D A;  3RPP A;  4AJ8 A;  1ZCP A;  1U88 A;  3UVH A;  5ECM B;  5ABR A;  2OBK A;  5AIX A;  3IRA A;  4Q5N A;  2VCQ A;  3GKX A;  1O81 A;  5H5Q A;  3C8E A;  1SU9 A;  2FCH A;  5GSS A;  4G10 A;  1NHO A;  1TKD B;  3KZQ A;  1TRU A;  2IFQ A;  1DUG A;  1B48 A;  2V2G A;  2DML A;  4BPY A;  5IIZ A;  1EWX A;  3FHK A;  5CAX A;  1K0C A;  2YOI A;  4MDC A;  3RHB A;  4HJ2 A;  1YF0 A;  2OKA A;  4LMV A;  2CT6 A;  2CAQ A;  3TKS C;  4N0V A;  3PR8 A;  2DSA A;  2B5X A;  2JAC A;  2C0G A;  1V2A A;  4G9H A;  2DJ1 A;  4BWQ A;  2B1L A;  5J41 A;  4ZB7 A;  1T4Z A;  2HSM A;  4KCA A;  4WXT A;  2TRC P;  5A1N B;  3I69 A;  2AJQ B;  6GSX A;  2NDO A;  2ES7 A;  3ZMK A;  1Y25 A;  1PQN A;  5J9B A;  3WGD A;  1SL2 B;  3WYW A;  1XW9 A;  2JZR A;  2A2S A;  3NZN A;  3P90 A;  4G19 A;  2RUF A;  2M46 A;  4J2F A;  3BJ5 A;  3HDC A;  4ULX A;  2QA1 A;  5IPH A;  4DSQ A;  4K5S A;  2HRK A;  4G2E A;  1T3B A;  2GSQ A;  2H72 A;  2VLT A;  1BYE A;  2C3T A;  4K5R A;  1A23 A;  4I97 A;  5IOX A;  3VWX A;  3QFB C;  2LTK A;  5GST A;  3GSS A;  4CDO A;  1TI3 A;  1BAY A;  1OC9 A;  1PD2 1;  4YKF A;  1XWB A;  3ZZX A;  2F8A A;  3M3M A;  5ECI B;  3L9S A;  3KEB A;  13GS A;  5CRW A;  2LV3 A;  2WW1 A;  3HA9 A;  1XVQ A;  2OE1 A;  4K9Z A;  4I6X A;  3HVS A;  1X5E A;  1ZYE A;  4WET A;  4ZB9 A;  2CV4 A;  3ZIV A;  4EC0 A;  3WD6 A;  3GST A;  1Y1U A;  1KEB A;  4ZIL A;  3SWL A;  5E4W A;  4ZIJ A;  2TRX A;  3FYG A;  3DML A;  2IL3 A;  4KND A;  2VL2 A;  4GTU A;  5D73 A;  1UN2 A;  4WF4 A;  3FEU A;  2VUP A;  3QDN A;  5B8B A;  3IK7 A;  1UA5 A;  4KDY A;  2MMN A;  2RM5 A;  2GSS A;  4KA0 A;  2B6M A;  3K8N A;  2C0F A;  4OMV A;  3ZFB A;  4ML1 A; 
#chains in the Genus database with same CATH homology
 1GSU A;  2HQT A;  2DIZ A;  2X99 A;  3HCZ A;  3ZVJ A;  5CO3 A;  4HEA 2;  4GDF A;  3D0Z A;  4BVX A;  4E8H A;  2J9H A;  3WT2 A;  3VK9 A;  1SKW B;  2HXK A;  2R0P A;  4TR3 A;  1QXH A;  4WR4 A;  4G0I A;  4LMW A;  2OE3 A;  4NXI A;  3KP8 A;  1VRS D;  5KN2 A;  2CZ3 A;  3KD0 A;  2H1G A;  3TDG A;  3D22 A;  2QA2 A;  2X8G A;  1U6T A;  2IJY A;  2FWF A;  4AKI A;  3FW2 A;  3EU4 A;  1EP7 A;  3ERW A;  2LNS A;  3V1W A;  3DVW A;  3F4S A;  5HR1 A;  4V2M A;  4GST A;  4KAE A;  3RAZ A;  2PVQ A;  3TJJ A;  4XIH A;  1AQX A;  3IE3 A;  3QMX A;  1FG4 A;  2XPD A;  1TXX A;  5ECP B;  4KX4 A;  3IXR A;  3ZFL A;  3IK9 A;  1H75 A;  1EEM A;  3L4N A;  3JCM L;  5FT3 A;  1LJR A;  1JHB A;  3KTB A;  4NV5 A;  4Q5R A;  4N0Z A;  1T8E B;  4JZQ A;  1THO A;  2H0H A;  1VF2 A;  1WE0 A;  5KEJ A;  3EPT A;  4XS1 A;  3BOA A;  2HZE B;  5ID2 A;  2UV8 G;  1V9W A;  3FK8 A;  3EE2 A;  2HSN B;  4IW9 A;  2V6K A;  2H19 A;  2LQO A;  5DAL A;  2GZP A;  3UL3 A;  1M2D A;  1GH2 A;  1I5G A;  2QC7 A;  2H6Y A;  2YCD A;  2FY6 A;  3KJY A;  2LQQ A;  5D9X A;  2KLX A;  2GSR A;  1FOH A;  2OAC A;  3N9J A;  5IMA A;  1GP1 A;  3AY8 A;  1SVM A;  4WF5 A;  1ZGN A;  3GUS A;  2V32 A;  3RBT A;  5IPG A;  2HZF A;  2XC2 A;  3DIE A;  4OFN A;  3PIN A;  1PA3 A;  2N5B A;  1AIU A;  3LWA A;  3ED3 A;  2HRA A;  4GSS A;  4LL1 B;  2RM6 A;  3TGZ A;  2A2R A;  2C8U A;  22GS A;  3QAV A;  4MCU A;  3D5J A;  4ECI A;  1XCC A;  4CY6 A;  2YZU A;  1SYX A;  3NOF A;  2OE0 A;  2L6D A;  3IHG A;  4HI7 A;  4WKW A;  2IIY A;  1TTZ A;  3KIJ A;  2X8H A;  3HHV A;  3IPZ A;  3IR4 A;  3GKN A;  5J4Y A;  4ILF A;  1GL8 A;  1QFN A;  4F2I A;  2DLX A;  3US3 A;  4I2U A;  2LRT A;  3GA4 A;  5G2Z A;  2BTO T;  3IOS A;  4PXO A;  1HD2 A;  1WJK A;  4L5L A;  4J57 E;  4IQA A;  3EUR A;  3APO A;  5IMV A;  2LJR A;  5F07 A;  4JU5 A;  1GWC A;  3L9U A;  2QKE A;  3P8W A;  3L0H A;  3ZIT A;  4N11 A;  2NVL A;  1XZO A;  4PNG A;  2VLV A;  3PH9 A;  4MP4 A;  1S3C A;  4F82 A;  2GVP A;  3GMF A;  2ZNM A;  4L5O A;  3R3E A;  3IDV A;  3F0I A;  2B7J A;  2N5A A;  3DGQ A;  1YQ1 A;  4DVC A;  3TB2 A;  4POM A;  2WFC A;  4ZBB A;  2YPM A;  5ECN B;  2MZC A;  2IN3 A;  4TXO B;  4KGI A;  1QK8 A;  2YWM A;  5C00 A;  1PX7 A;  4HZ2 A;  1Q98 A;  1OKT A;  1VF4 A;  5KN3 A;  2VD1 A;  4GLT A;  3TOU A;  2C1Y A;  4PX1 A;  3LW9 A;  3ZTL A;  2A4V A;  4RUV A;  1GLQ A;  2VCX A;  3D4T A;  1THX A;  1FHE A;  5D8I A;  5JCW A;  1FW1 A;  4GSN A;  1EOG A;  3IAS 2;  4FQU A;  3EU3 A;  3RPN A;  3TU3 B;  3UJ1 A;  3FR3 A;  2VL3 A;  2DBC A;  3G7I A;  2N5F A;  1SKS B;  2HNL A;  2E0Q A;  2ALB A;  2CVB A;  4K1F A;  2LS5 A;  1Z9H A;  4F03 A;  2GTU A;  3SBC A;  1A2M A;  4IKH A;  1GRX A;  1TRV A;  1B9X C;  5HFK A;  3A5W A;  3QD9 A;  1A24 A;  2O89 A;  4PUA A;  5A5H B;  4OCE A;  1LBK A;  4IHU A;  2VM1 A;  3O6T A;  3IHQ A;  2V1M A;  5CYY A;  6GSS A;  3NIV A;  1V98 A;  4AKG A;  2GQK A;  4OO5 A;  4ZBA A;  2CQ9 A;  1YEP A;  6GSY A;  4GF0 A;  1TK8 B;  3CSH A;  4YH2 A;  4TR1 B;  1Y6E A;  2HLS A;  1SK0 A;  1K0D A;  2IMF A;  2R0G A;  3EC3 A;  5BRT A;  2DC5 A;  4I5Q A;  3KGK A;  4AF2 A;  4EE0 A;  1FB0 A;  1GSF A;  4EL1 A;  2GLR A;  2FWE A;  2IMK A;  3DYR A;  4QL7 A;  2FWG A;  3U5R E;  1WPI A;  2VM2 A;  4MJA A;  1ERT A;  3GL5 A;  1Z5Y E;  3VLN A;  4XTS A;  2K6V A;  3BD2 A;  5EVO A;  1BED A;  1TDI A;  3UIW A;  5J3R A;  1M2B A;  4MH2 A;  1TW9 A;  3GTU B;  1TJD A;  2B1K A;  1DBY A;  4EKZ A;  1JFU A;  4TR4 A;  4MMM A;  4O5R A;  4WBJ A;  2ZUP A;  1MDK A;  2C3Q A;  3M0F A;  3CTF A;  5IOW A;  2H1L A;  1Z7R A;  6GSU A;  3TJF A;  1LU4 A;  4I2T A;  3LXZ A;  2JL4 A;  1PGT A;  3EYT A;  1X9M B;  2EIQ A;  2AUV A;  4POL A;  1EV4 A;  2HSH A;  4D73 A;  2JSZ A;  1ACV A;  1F3B A;  1NSW A;  5IMF A;  5AGY A;  1M2A A;  3TUE A;  4TR0 A;  14GS A;  1G7E A;  2DJ0 A;  3ERF A;  1OE7 A;  5LCZ A;  1TK0 B;  5HFI A;  1DSB A;  2H0I A;  1WOU A;  3UVT A;  3G7Y A;  3UAR A;  2LST A;  2REM A;  2HSN A;  2R3X A;  2HI7 A;  3GH6 A;  2VAF A;  4X4J A;  5JWO B;  2R37 A;  2VOC A;  4ZXG A;  1M9B A;  1AC1 A;  2K18 A;  3F3R A;  1W89 A;  3TKS A;  3W8J A;  1XWC A;  5DCG A;  4ID0 A;  2NPB A;  9GSS A;  1FOV A;  3E0U A;  3ZL5 A;  4KW6 A;  3W6G A;  4HUA A;  4K2D A;  1X5D A;  5D9T A;  1TU7 A;  3GFK A;  3GUR A;  5JCG A;  1S3A A;  4E68 A;  1K0B A;  5J4V A;  1EP8 A;  1GUM A;  3F3Q A;  5B6M A;  4K0N A;  5FWG A;  1GSY A;  4PNF A;  2A4H A;  3M9J A;  1ZMA A;  1MDJ A;  2F51 A;  2DKI A;  5DCH A;  2CAI A;  2I81 A;  1A8L A;  3S9F A;  1PN0 A;  4Z2T A;  4X0X A;  3GIX A;  3UEM A;  1X9S B;  2E2G A;  1A0R P;  3GH9 A;  3LYK A;  1O85 A;  1N2A A;  3ERG A;  2DJ2 A;  3HVX A;  2FGX A;  5DDL A;  2B3S A;  2LRC A;  7GSS A;  4JRR A;  4NHZ A;  3FR6 A;  3EWL A;  5E59 A;  4EUY A;  4V1A p;  1WMJ A;  3ISO A;  5G5F A;  2VL2 C;  2EFH A;  5IMD A;  4A5P A;  1Z6M A;  5BMU B;  3A2X A;  4TOP A;  2C80 A;  1YDK A;  2FHE A;  5C04 A;  2B5Y A;  5B6N A;  2WUL A;  2DJJ A;  1TP9 A;  3DWV A;  2LJK A;  5GAP D;  3FZA A;  5DAK B;  1SD9 A;  1DE2 A;  3APS A;  4X43 A;  4PQ1 A;  2MBT A;  1YKA A;  3GRX A;  4TN8 A;  3LFL A;  4IEL A;  2PMT A;  2F8F A;  5CRG A;  1SYR A;  2VO4 A;  2QSI A;  5CP1 A;  3CMI A;  3QAW A;  1SL1 B;  4EXJ A;  4L0W A;  3CWG A;  1PL2 A;  5ELA A;  1CQG A;  4X1U A;  2GDR A;  2LUS A;  5HR0 A;  3VPT A;  2C0D A;  1T7P B;  4PUF C;  5F8B A;  4MJE A;  17GS A;  1JZW A;  5J40 A;  5A5K A;  2O5V A;  1EZK A;  1BJX A;  3M8N A;  1K0N A;  1OE8 A;  3IC8 A;  2NBS A;  4HJM A;  3QR6 A;  1YJ6 A;  3GNJ A;  4IP6 A;  4JBB A;  5J9C A;  3CSJ A;  4BVY B;  2GS3 A;  3H93 A;  6GSW A;  1GNE A;  4AGS A;  3BBY A;  2H01 A;  2FA4 A;  3LEF A;  2AYT A;  1VF3 A;  4DSS B;  5IQY A;  1HQO A;  5IO2 A;  1Z7P A;  4KSO A;  1YY7 A;  1GTA A;  2PVO C;  2R5G A;  4K7N A;  3P2A A;  1BG5 A;  2G2Q A;  1XPV A;  3HKR A;  3VWU A;  2OA7 A;  4ML6 A;  1XWK A;  2I1U A;  1XXU A;  2RUE A;  2A2P A;  2XPE A;  1E6B A;  5A5H A;  2HYX A;  3EVI A;  3J7Y k;  4FYU A;  3F6F A;  2VCZ A;  1WWJ A;  4HU9 A;  4RQX A;  3TJG A;  1H4O A;  1TI1 A;  1R5A A;  5CNW A;  1FB6 A;  3L9V A;  4W66 A;  4XRA A;  5F0G A;  4IBP A;  2ON5 A;  3TKQ A;  2I4A A;  4PQH A;  2O8V B;  1ILO A;  3H8Q A;  2CVD A;  3F6D A;  1TOF A;  1C72 A;  4TR1 A;  3HZ8 A;  1X9W B;  2IWT A;  1ABA A;  2GZY A;  5IM9 A;  3IV4 A;  2HSM B;  5D9W A;  3CRT A;  2XBI A;  1ST9 A;  2KP2 A;  4HQZ A;  4GXZ A;  1A0F A;  2LKU A;  1A2L A;  2HT9 A;  1O8X A;  1V58 A;  2MMO A;  2L6C A;  2DJ3 A;  4LLR A;  4JR4 A;  4JED A;  4K7O A;  4MZB A;  1K3L A;  4RI6 A;  2PN8 A;  5D96 A;  1NW2 A;  2YNX A;  2R4V A;  4WR5 A;  3TOT A;  2PU9 C;  4F0C A;  1J08 A;  2DJK A;  2R0C A;  5CRD A;  3E9J B;  2YWN A;  3DVX A;  3GTU A;  1AW9 A;  5ECR B;  1GUH A;  4XS6 A;  5COH A;  1ERW A;  4KSM A;  2JZS A;  2X64 A;  1SD8 A;  3H79 A;  3A3T A;  1E2Y A;  5A4W A;  4EDY A;  4NV2 A;  2G0F A;  3A2V A;  1T00 A;  2H8L A;  4I8B A;  1OC9 B;  11GS A;  4KDX A;  1YF1 A;  1YZX A;  10GS A;  2V41 A;  5EPF A;  4ZB8 A;  5ECS A;  2O85 A;  1TRW A;  3ZLP A;  2YJH A;  3OR5 A;  5KN0 A;  1U87 A;  1RK4 A;  2Z9S A;  1SJ6 A;  5J5N A;  3G7J A;  2IPA A;  2GST A;  2HFD A;  4MK3 A;  1QQ2 A;  4HOJ A;  3GN3 A;  5AIV A;  1XW5 A;  2KOK A;  5DQS A;  2FUG 2;  4TW5 A;  4MAB A;  4IGJ A;  3PGT A;  1NHY A;  5CRH A;  3Q18 A;  2FA8 A;  3VWW A;  4K8M A;  5A1N A;  2E2M A;  4HDE A;  1GTB A;  4OFT A;  4POK A;  1HNA A;  2AV4 A;  3LXT A;  1HYU A;  3QPM A;  1R26 A;  2VCV A;  1O6J A;  1VF1 A;  5IMZ A;  1AQV A;  2MBS A;  3KP9 A;  1J9B A;  1ERV A;  4ZL9 A;  3ZRE A;  4EVM A;  1K3Y A;  1W4V A;  3F4T A;  1QGV A;  3DKS A;  5D9V A;  1U3I A;  1G0T A;  4BL7 B;  2K8S A;  1SK1 A;  3W8S A;  4BVX B;  3RDW A;  1SJZ A;  4K6X A;  2E7P A;  5AIS A;  2B7K A;  2YAN A;  3DD3 A;  4G01 A;  5G1K A;  5L71 A;  4F0B A;  1ON4 A;  3BCI A;  3N5O A;  3Q6O A;  1EOH A;  2PUK C;  2CX4 A;  6GST A;  1K0A A;  3KMO A;  3O3T A;  1ZOF A;  4KB3 A;  1F37 A;  4G0L A;  4N30 A;  2WRT A;  1KTE A;  1EGR A;  4KDU A;  1UVZ A;  5H5R A;  4MZW A;  3KH7 A;  1B4Q A;  3I43 A;  4F9Z A;  5DBQ A;  3MYD A;  3RHC A;  4ZBD A;  4FYC A;  1HNB A;  2WZ9 A;  5INY A;  1F3A A;  5ECQ B;  3M1G A;  5DJL A;  4XCS A;  1M7T A;  2VLU A;  3E3E A;  2D2Z A;  1V57 A;  4IP1 A;  2AHE A;  4AJ7 A;  2YZH A;  3HVV A;  3HXS A;  1GSE A;  2QGV A;  4E8E A;  3FZ4 A;  3HJM A;  1XOA A;  4AJ6 A;  1ZYP A;  5B8A A;  4PGT A;  4TRX A;  1EV9 A;  1GTU A;  2H1B A;  1G6W A;  2ZCT A;  5KOX A;  1SVO A;  3BCK A;  4NAX A;  4GCI A;  4GQC A;  1OAZ A;  1IYI A;  1WIK A;  3F63 A;  18GS A;  4L0U A;  2O7K A;  4WBR D;  1NM3 A;  1O73 A;  3VI7 A;  4EIQ A;  2V6O A;  3L78 A;  1XWA A;  4DSS A;  1F2E A;  1K3O A;  1QMV A;  4POB A;  3QFA C;  1ML6 A;  2CZ2 A;  1IYH A;  1A8Y A;  5D93 A;  4AKH A;  1PSQ A;  5B7C A;  3HY2 A;  19GS A;  4JR6 A;  3GV1 A;  2KHP A;  3A5I A;  3M9K A;  4O5Q A;  2H30 A;  4NPB A;  1OC8 A;  3D6I A;  2HE3 A;  4ZB6 A;  2P0G A;  3LOR A;  4LA1 A;  4QL9 A;  4MJB A;  3GX0 A;  1F9M A;  3QAG A;  5KN1 A;  2HZE A;  3DXB A;  2VD0 A;  2AB6 A;  5ECK B;  4TKY A;  3QOU A;  4GWR A;  2P31 A;  1OYJ A;  3Q74 A;  1FO5 A;  1B4P A;  2H75 A;  2X49 A;  4H86 A;  5JWR B;  4IJ3 A;  3LJR A;  3TKR A;  1KBN A;  3DEX A;  1ERU A;  4Z7X A;  4MH3 A;  1T1V A;  5JCU A;  4MPF A;  4KUN A;  2P5Q A;  5HR2 A;  1EGO A;  1ZL9 A;  1PKZ A;  5H5S A;  5JWQ B;  1BF5 A;  2WGR A;  5GZZ B;  5A34 B;  2OJL A;  4FIW A;  4EF0 A;  4EO3 A;  1B9Y C;  3MSZ A;  3IC4 A;  1MD3 A;  5CRE A;  3HMJ G;  2YV7 A;  3LG6 A;  1SJI A;  2EIR A;  1HNC A;  2UZ8 A;  1DE1 A;  1X5C A;  1EEJ A;  3FZ5 A;  2XBQ A;  2M80 A;  3GX8 A;  1YVL A;  4NWY A;  5A4U A;  1TRS A;  2H70 A;  4CY8 A;  3EMP A;  5ECL B;  2K9F A;  1ZYN A;  3TRQ A;  2H6X A;  1GUK A;  4P3Y B;  3H1N A;  2WJU A;  1TXU A;  1M9A A;  2EFD A;  3MWH A;  1XW6 A;  3GHA A;  2WB9 A;  4DSR A;  4CW9 A;  4QMK A;  4FH8 A;  2YWI A;  4EIP A;  1X0R A;  3F4R A;  1YEX A;  1RW1 A;  3C71 A;  5ENU A;  2JAD A;  3VPQ A;  2YWO A;  3R2Q A;  2BJX A;  3O76 A;  4ZL8 A;  2F3M A;  1N8J A;  1OC3 A;  4MLY A;  1AQW A;  1TK5 B;  3FZ9 A;  4TVE A;  3C1S A;  4Z2R A;  3VI5 A;  1JZR A;  4KH7 A;  4K0G A;  3UBL A;  1T4Y A;  1USB A;  1F6M C;  3CSI A;  3ME8 A;  2PGT A;  4IJI A;  1PMT A;  4O92 A;  2WCI A;  3G9B A;  2YP6 A;  4YQM A;  1VGL A;  3HJO A;  4KF9 A;  2OT3 A;  1B8X A;  5J4U A;  2HRN A;  2J23 A;  3D4M A;  2L5L A;  1PRX A;  4G0K A;  4N10 A;  4TXO A;  1M0U A;  4XS4 B;  4MPG A;  1MDI A;  3HD5 A;  4K7I A;  3VWV A;  2KUC A;  1UC7 A;  5F05 A;  4MF7 A;  1XFL A;  3C73 A;  3IBH A;  4FO5 A;  2BMX A;  4BL7 A;  5EL8 A;  3WGE A;  3IA1 A;  1XBS A;  3CTG A;  5DVB A;  1GUL A;  2R6K A;  5ECO B;  3LYP A;  3F8U A;  5HQP A;  1PN9 A;  2DKH A;  1QUW A;  4HQS A;  3UAP A;  1G6Y A;  3FKF A;  2IMD A;  1AXD A;  3C7M A;  5AN1 A;  3FR9 A;  1ZZY A;  4K2X A;  5ECH B;  4PQI A;  3TJB A;  4IQ1 A;  3Q19 A;  1URM A;  8GSS A;  1R7H A;  3CYN A;  4OWY A;  3F9U A;  3KXO A;  2NTO A;  2CVK A;  3VFI A;  4O32 A;  2H73 A;  2IFQ B;  4MA9 A;  4D73 B;  2GT5 A;  5LD0 A;  1ZYQ B;  2L59 A;  3HYP A;  1AUC A;  2HSY A;  1I9D A;  2I9H A;  2K8V A;  2MMZ A;  2VL9 A;  2PBJ A;  2CX3 A;  2JSY A;  3GYK A;  4Q5F A;  4L8E A;  1SEN A;  1N25 A;  2GGT A;  3ME7 A;  3ZVJ D;  4ECJ A;  2F9S A;  1BG1 A;  1M99 A;  1RQM A;  4MNN A;  2YV9 A;  5KOW A;  2H71 A;  4ECC A;  2LJA A;  2KP1 A;  3CRU A;  4YAV A;  3U6V A;  2MYG A;  1J0F A;  4LL4 B;  2EC4 A;  5ELG A;  1GSQ A;  2H1A A;  4ZL7 A;  4NHW A;  1R4W A;  4V1A g;  3MDK A;  2WS2 A;  2TIR A;  2X8C A;  4FYB A;  4GRF A;  4ACS A;  3EMX A;  1JLV A;  2PWJ A;  3APQ A;  1CQH A;  3PPU A;  4RI7 A;  5DQY A;  5HR3 A;  4HS1 A;  2FD3 A;  4HU7 A;  1Z6N A;  2RII A;  4AKX B;  4KE3 A;  2LEG A;  4OO4 A;  3MIX A;  2L5O A;  1AAZ A;  1K0M A;  2HRK B;  4V2N A;  2YN1 A;  3I9V 2;  4Z2U A;  2VCW A;  1G7O A;  5EY6 A;  2JZT A;  4OD7 A;  1K0O A;  4N3Z A;  2MMA A;  3ZRD A;  3KH9 A;  4BA7 A;  4RQR A;  3H4K A;  3FY7 A;  2L57 A;  2HRF A;  1Z3E A;  4ICY A;  4MZC A;  3KM6 A;  1GSD A;  4MF5 A;  2VIM A;  12GS A;  2H74 A;  5G5E A;  2O87 A;  2AAW A;  1GTI A;  2H66 A;  1MD4 A;  2LNT A;  3MAK A;  1GLP A;  1Q4J A;  3A2W A;  3P7X A;  2CA8 A;  1GNW A;  4GQF A;  5LNK e;  2H0G A;  3LQ7 A;  2GZZ A;  1GSS A;  4BWS A;  2JU5 A;  2VCT A;  2IMI A;  5G30 A;  1JLW A;  2C3N A;  4YAP A;  1BQ7 A;  1O7U A;  1XWG A;  1FVJ A;  2R2J A;  4XRD A;  1YKC A;  3FMW A;  2PER A;  4O5U A;  3IAM 2;  3ZYW A;  2PPT A;  2DIY A;  3KCM A;  4YKG A;  1MEK A;  1SL0 B;  3TCO A;  2M72 A;  4QQ7 A;  5HFG A;  3LSZ A;  3ZIJ A;  1FVK A;  3D21 A;  5A34 A;  1OKD A;  2EFC A;  6GSV A;  2VKZ G;  2XHF A;  4ISD A;  1SKR B;  4WEY A;  2RLI A;  1TU8 A;  1PKW A;  4O7H A;  4USS A;  4IN0 A;  2H6Z A;  3CBU A;  1S3D A;  2GQL A;  2H76 A;  3HJP A;  1PL1 A;  2OBI A;  2IME A;  16GS A;  4MJC A;  5J47 A;  2GQM A;  5DJM A;  3WT1 A;  1JZD A;  4MF6 A;  2B5E A;  1BX9 A;  1JZO A;  3MNG A;  1XVW A;  2EFE A;  3UBK A;  4NMU A;  5GAN D;  4J56 E;  2FWH A;  4IS0 A;  3HZ4 A;  1WRY A;  1KNG A;  4CHS A;  4EDZ A;  1OVN A;  4JE1 A;  3TJK A;  1A2J A;  1R5P A;  1V40 A;  2OAD A;  1XIY A;  4IVF A;  3EIN A;  4HZ4 A;  5G31 A;  3KTL A;  3GKM A;  5BMU A;  3J7Y b;  5IMC A;  4TXV A;  2C4J A;  5FHI A;  3GKK A;  1WP0 A;  3DRN A;  2EIO A;  3GL3 A;  3WGX A;  4Q5Q A;  2P5R A;  5G1L A;  3CXG A;  1FAA A;  1U3A A;  3KMN A;  5ID2 B;  2FNO A;  5DAK A;  3QCP A;  4OCF A;  2C0E A;  3LGC A;  3TRX A;  2ON7 A;  5DAL B;  4AI6 A;  3ZML A;  2YJ7 A;  4V2L A;  5F06 A;  2X4A A;  4KCE A;  4YQV A;  2WDU A;  3TKP A;  5IO0 A;  2L4C A;  1PX6 A;  3FRC A;  1SVL A;  3VUR A;  3I6A A;  4OFM A;  4XS4 A;  4PTS A;  2FLS A;  4YQU A;  20GS A;  1SK2 A;  4PUR A;  1MTC A;  5A4V A;  2GT6 A;  4ECB A;  2I3Y A;  3C1R A;  3UOM A;  2L4Q A;  3UMA A;  2LRN A;  4BVY A;  2DMM A;  1XOB A;  4DEJ A;  1O8W A;  3TRP A;  4XHM A;  3TKS E;  2H1D A;  3RPP A;  4AJ8 A;  1ZCP A;  1U88 A;  3UVH A;  5ECM B;  5ABR A;  2OBK A;  5AIX A;  3IRA A;  4Q5N A;  2VCQ A;  3GKX A;  1O81 A;  5H5Q A;  3C8E A;  1SU9 A;  2FCH A;  5GSS A;  4G10 A;  1NHO A;  1TKD B;  3KZQ A;  1TRU A;  2IFQ A;  1DUG A;  1B48 A;  2V2G A;  2DML A;  4BPY A;  5IIZ A;  1EWX A;  3FHK A;  5CAX A;  1K0C A;  2YOI A;  4MDC A;  3RHB A;  4HJ2 A;  1YF0 A;  2OKA A;  4LMV A;  2CT6 A;  2CAQ A;  3TKS C;  4N0V A;  3PR8 A;  2DSA A;  2B5X A;  2JAC A;  2C0G A;  1V2A A;  4G9H A;  2DJ1 A;  4BWQ A;  2B1L A;  5J41 A;  4ZB7 A;  1T4Z A;  2HSM A;  4KCA A;  4WXT A;  2TRC P;  5A1N B;  3I69 A;  2AJQ B;  6GSX A;  2NDO A;  2ES7 A;  3ZMK A;  1Y25 A;  1PQN A;  5J9B A;  3WGD A;  1SL2 B;  3WYW A;  1XW9 A;  2JZR A;  2A2S A;  3NZN A;  3P90 A;  4G19 A;  2RUF A;  2M46 A;  4J2F A;  3BJ5 A;  3HDC A;  4ULX A;  2QA1 A;  5IPH A;  4DSQ A;  4K5S A;  2HRK A;  4G2E A;  1T3B A;  2GSQ A;  2H72 A;  2VLT A;  1BYE A;  2C3T A;  4K5R A;  1A23 A;  4I97 A;  5IOX A;  3VWX A;  3QFB C;  2LTK A;  5GST A;  3GSS A;  4CDO A;  1TI3 A;  1BAY A;  1OC9 A;  1PD2 1;  4YKF A;  1XWB A;  3ZZX A;  2F8A A;  3M3M A;  5ECI B;  3L9S A;  3KEB A;  13GS A;  5CRW A;  2LV3 A;  3HA9 A;  1XVQ A;  2OE1 A;  4K9Z A;  4I6X A;  3HVS A;  1X5E A;  1ZYE A;  4WET A;  4ZB9 A;  2CV4 A;  3ZIV A;  4EC0 A;  3WD6 A;  3GST A;  1Y1U A;  1KEB A;  4ZIL A;  3SWL A;  5E4W A;  4ZIJ A;  2TRX A;  3FYG A;  3DML A;  2IL3 A;  4KND A;  2VL2 A;  4GTU A;  5D73 A;  1UN2 A;  4WF4 A;  3FEU A;  2VUP A;  3QDN A;  5B8B A;  3IK7 A;  1UA5 A;  4KDY A;  2MMN A;  2RM5 A;  2GSS A;  4KA0 A;  2B6M A;  3K8N A;  2C0F A;  4OMV A;  3ZFB A;  4ML1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...