1HNCA

Crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVFGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase(glutathione)
total genus 68
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1hncA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1hncA01
1F3AA 3LWAA 1GSDA 3KM6A 4IELA 5DJLA 4PNGA 1E2YA 2EIOA 4FYCA 5F8BA 4RQRA 4QL9A 1XW5A 2R4VA 4GTUA 4TN8A 2K8SA 3WGXA 4KDUA 5J41A 2HSNB 3G9BA 4OCFA 4MH3A 4OFMA 1UN2A 4G2EA 4IGJA 2PUKC 4DSQA 3OR5A 1XFLA 1M9BA 1EV4A 2PGTA 2VUPA 2F8AA 5IMFA 2H1DA 4TXOA 14GSA 2JZTA 2HNLA 1VRSD 3Q74A 3FYGA 3KEBA 3ZVJD 4TR3A 5DAKB 4ZL9A 5GSTA 4BL7A 6GSYA 2AJQB 3CTGA 4KCEA 3L9VA 2N5BA 5J5NA 4N11A 1ZL9A 1FG4A 2VLTA 2H0IA 1ZCPA 2E2GA 4MZCA 2DC5A 3KP9A 2H6YA 2IMDA 4LL4B 1TK0B 4OWYA 3HVVA 3QFAC 1TI3A 2WS2A 3MAKA 4H86A 4FYBA 4KDXA 2XC2A 4K7NA 1NHOA 5IIZA 2EC4A 1F9MA 1GSEA 2JZSA 1RQMA 3TJFA 3N5OA 3GRXA 2H74A 4EDZA 4EE0A 2LJKA 2MYGA 4N30A 1EOGA 1YKAA 1XOBA 4K9ZA 1JLWA 4IBPA 19GSA 3LSZA 3I9V2 1OYJA 2FY6A 1OKDA 1T3BA 3ZZXA 4HZ4A 5HFKA 1W89A 1O8WA 4EL1A 4JBBA 1YEPA 1K0OA 5HR2A 5E4WA 3S9FA 1V98A 1EWXA 3BD2A 2B5XA 3RHBA 1YKCA 2GZPA 1DE2A 4V1Ap 4D73B 2CAIA 3V1WA 5HR3A 4MJEA 4TRXA 2H01A 4G0KA 1U88A 4K7OA 4K0GA 2C3NA 5EVOA 4DEJA 4NV2A 2RUFA 1S3AA 2FGXA 4L5OA 4ZBBA 1SYXA 5J4UA 2XPEA 4HDEA 1FW1A 1K0MA 2LRNA 3H1NA 1FHEA 3EWLA 3NOFA 3IHQA 2L6DA 1M7TA 1KEBA 2HLSA 3D0ZA 1AIUA 3GKKA 2LQQA 1ERTA 2QGVA 2L5OA 2GT6A 1SYRA 1ERWA 5B8BA 2H6XA 3N9JA 2GGTA 3CYNA 4GWRA 2VL9A 2P31A 3TKRA 3ZRDA 2GLRA 1ZYQB 2V2GA 3HVXA 1OC8A 3HD5A 2OACA 3KMNA 3A2XA 4IN0A 1BQ7A 3MSZA 1X5EA 3IC4A 2QSIA 5H5RA 1GRXA 1M0UA 3H4KA 3KXOA 18GSA 2PBJA 1TRUA 3KP8A 4JU5A 1IYHA 4MJAA 4ZXGA 2H6ZA 2HSYA 1OE8A 3GL3A 4RI6A 1S3CA 3DVXA 2C3QA 1AAZA 1AW9A 1H75A 3PR8A 1T4YA 3G7YA 3ZTLA 4JR4A 5ECHB 2H73A 2P5QA 4AF2A 3ZFLA 3APQA 2AB6A 3CMIA 3US3A 2DIYA 2H0GA 4BWQA 4TXVA 3IXRA 2C1YA 4YQMA 2GQLA 2A2SA 2IMEA 3UBLA 5ECPB 2X64A 3AY8A 1SENA 2HI7A 2LEGA 2GT5A 1I9DA 4HU9A 3Q6OA 3NIVA 3HZ4A 2GQMA 5ECRB 4POLA 3IRAA 1FVJA 1XW6A 2EIRA 3LXTA 4DSSB 1M2DA 1EOHA 5J9BA 5JWRB 2CVDA 3LYKA 3KMOA 2V32A 3F3QA 1R7HA 5IO2A 6GSTA 3F63A 1XOAA 4FYUA 2YZHA 2HRKB 1T7PB 4PQHA 2NVLA 4F0BA 2R6KA 2LJAA 2RIIA 2M46A 1A24A 3J7Yk 4WBJA 5KEJA 3GH9A 2JU5A 2HZFA 3SBCA 5GAPD 2O87A 3TKSA 2GSQA 2GZYA 1QXHA 4GLTA 5FHIA 2KLXA 1TRSA 3IK9A 4X1UA 4USSA 3H79A 3A2VA 3DEXA 3TKPA 6GSSA 4G0LA 2VD1A 1G6YA 2NPBA 1C72A 4G9HA 4J57E 3ZMLA 1GL8A 4TVEA 2OADA 5IOXA 3UVHA 1SL1B 4PTSA 1GP1A 5A5KA 1WE0A 3GX8A 3FEUA 1GSSA 3L0HA 1XWBA 4L5LA 5DQYA 3UARA 3ZL5A 4L0UA 4F03A 3WYWA 3LYPA 3TKQA 2REMA 4ZB8A 2YWNA 1ST9A 2LTKA 1JHBA 3TJBA 1KTEA 3IK7A 4HOJA 1ERUA 5DVBA 5HQPA 2B7JA 4MCUA 2DMMA 1Y25A 2KHPA 1SK0A 2MMNA 1N8JA 3L78A 1GUMA 4LMVA 4MJCA 4TR0A 3UBKA 2PPTA 3LXZA 3ED3A 2H75A 1GUKA 1FVKA 2B3SA 1K0BA 2X99A 2ZCTA 2IWTA 4HU7A 1U3AA 4DVCA 2WDUA 2JL4A 1URMA 4EC0A 6GSXA 2TRXA 1TU8A 3M0FA 3GSTA 1PKWA 2XPDA 2VCWA 1PQNA 1RW1A 4F0CA 3O6TA 4AJ7A 3P90A 4XS1A 3TKSE 1G6WA 3TJGA 4PXOA 1OC9B 3KTBA 5IMDA 2CZ3A 1CQHA 2IMIA 3H93A 2RLIA 4Z7XA 3IC8A 3VLNA 1EGOA 1TU7A 3GYKA 1U87A 4TW5A 1ZYEA 4POKA 4KA0A 1ZOFA 3GHAA 1A8LA 4XRDA 5CRDA 4HQZA 2B5YA 2HRAA 3HDCA 4HZ2A 2O8VB 2GQKA 2AYTA 3JCML 3SWLA 2VLUA 4IVFA 3QPMA 1PX6A 2L4CA 5ECSA 4QL7A 1Z9HA 3TOTA 1TKDB 4ML1A 4K7IA 2YPMA 2DSAA 3PGTA 1U6TA 5CAXA 3VWXA 3EC3A 4EVMA 1YDKA 2FLSA 3C1SA 2FHEA 1A2MA 3LORA 3EMPA 4BVXA 4LMWA 4XRAA 4MLYA 2C80A 1SD9A 1ILOA 2GTUA 4PX1A 2YN1A 3P7XA 1WWJA 1XBSA 1B4PA 2AAWA 5G5EA 4L0WA 3TKSC 2N5FA 2FNOA 11GSA 4GQCA 4KH7A 5LCZA 3TUEA 2H8LA 1YF0A 2YOIA 2MBSA 4MPFA 4TOPA 4JRRA 2I3YA 5HFGA 8GSSA 1NM3A 3CSHA 4OFTA 3EVIA 1A8YA 2B1KA 4ZILA 1IYIA 1F3BA 1PL2A 5AGYA 5JWOB 5ECNB 3GA4A 4V2MA 3KZQA 3GKMA 3FZ9A 2ES7A 2RM6A 1H4OA 3E0UA 1MDIA 4WKWA 3A5WA 4F9ZA 2ON7A 3GTUA 1ML6A 3MDKA 2VCZA 1FB6A 2AHEA 4GCIA 3WD6A 1GSQA 1MD4A 3K8NA 2C0FA 4AJ8A 2CZ2A 2MMAA 2FWFA 2H1AA 2L6CA 2RM5A 1JZWA 2HE3A 3GX0A 4NMUA 4GRFA 1J9BA 5LD0A 1R4WA 2H19A 2PWJA 3QOUA 2HYXA 1HQOA 4TXOB 4GSNA 2CVKA 2K6VA 3TJKA 1DBYA 2J23A 3BBYA 2YWIA 3VWWA 2VOCA 4ISDA 4BL7B 3LG6A 1MDJA 3ZREA 1TI1A 4JEDA 4MABA 3PINA 4BVYA 4YQUA 5F06A 1AUCA 2OA7A 3GH6A 5ELGA 4DSRA 3TB2A 1BX9A 3VK9A 1AXDA 2XHFA 4HEA2 3ISOA 5COHA 3I43A 1TXXA 2I81A 3ZLPA 1A2LA 5GSSA 2WZ9A 5D9TA 1THOA 3GKXA 4XS4A 1DSBA 2LNTA 3TCOA 5CRHA 4K8MA 4ZBDA 4IKHA 3FR3A 1M2BA 4AGSA 4HJMA 3UVTA 1GSFA 2WCIA 3DIEA 4CDOA 2OE1A 1O81A 2IL3A 3R3EA 17GSA 4GSTA 3DYRA 1PN9A 3F3RA 3G7IA 2B5EA 2JADA 4Q5NA 1AQWA 1KBNA 2E0QA 1HNAA 5INYA 1GLPA 1SJIA 2FUG2 4O32A 4ZBAA 3IAM2 3LJRA 4PGTA 1X5CA 5ECKB 3LQ7A 3RHCA 2YNXA 4KF9A 4ZL7A 2P0GA 1OKTA 4NPBA 2MZCA 2YZUA 3F6FA 1GTUA 3EINA 5EY6A 4EKZA 3IAS2 1CQGA 3W8JA 4F82A 4I8BA 1TK8B 2F51A 1GLQA 5CNWA 1XVWA 5ECIB 5HR0A 5A4WA 5LNKe 4MF5A 1XXUA 4NWYA 2B1LA 1BJXA 4O92A 3IV4A 1EEMA 2GVPA 3DVWA 2C0DA 3UJ1A 2CA8A 5ECQB 4TR4A 3TDGA 4I5QA 2VL3A 3ZMKA 4I6XA 1ZMAA 1EZKA 5H5QA 4Q5QA 1NSWA 4TR1A 22GSA 3DMLA 4WBRD 2GSSA 3CBUA 3EU3A 3HZ8A 2OE0A 3BCIA 4NHWA 4POMA 1PGTA 3M8NA 4IW9A 2YWMA 4O5RA 4ACSA 3FRCA 3ZFBA 3CSJA 1M9AA 4EXJA 3G7JA 4ZB6A 4ZL8A 1QFNA 1X9SB 1NHYA 1W4VA 2R3XA 3HVSA 2PVOC 4FH8A 3UMAA 6GSVA 3Q18A 5ID2A 1V40A 5KN3A 4XHMA 3F9UA 1BEDA 2BJXA 5GAND 3QR6A 3WGEA 4ZB9A 1AC1A 6GSUA 3QAGA 3RDWA 1Z7PA 2NTOA 3CRUA 4KDYA 1SKRB 1QGVA 5C00A 4MMMA 4YQVA 5HFIA 1Z3EA 3GV1A 1PD21 3GFKA 3CRTA 5D93A 5GZZB 2LRCA 1HYUA 1WJKA 1TW9A 4OFNA 3KGKA 1G0TA 4KAEA 2AV4A 2O85A 2N5AA 1ON4A 1WMJA 4EUYA 5CREA 3IDVA 2OJLA 3TRXA 3ERGA 3QAVA 4OO5A 2CQ9A 1Y6EA 4EO3A 5D9VA 3ZVJA 2VD0A 1HD2A 5CRGA 1HNCA 1PKZA 2A4VA 3QMXA 4PNFA 3APSA 2ALBA 1O85A 3KH9A 5B6MA 3HXSA 1Z5YE 2FCHA 3M3MA 3VI5A 4IS0A 1B48A 1XWAA 2O7KA 5JCGA 4ECIA 3GUSA 1Z7RA 1GNWA 7GSSA 4FO5A 4WF4A 5G2ZA 4X43A 5AISA 4ECJA 2DJKA 2HZEA 2YV7A 4G10A 2UZ8A 1GTAA 4XS6A 4BA7A 2VCQA 2HSMA 1ABAA 5H5SA 2H72A 5KN0A 1K0NA 2H0HA 4FQUA 2XBQA 2JACA 5F05A 1XWCA 2V1MA 1YJ6A 4WR5A 1F37A 2O89A 5JWQB 4POBA 2L57A 3VURA 1O8XA 3PH9A 1PSQA 1HNBA 2IFQA 1B9XC 5DALA 2FWGA 1O7UA 3NZNA 1FO5A 4HQSA 1K3YA 4OMVA 1GWCA 3GSSA 3BJ5A 2YANA 5IMAA 5ECLB 5L71A 3TRQA 1GSYA 3CTFA 5CRWA 1WOUA 3HCZA 5DCHA 2I9HA 3C73A 1VGLA 2X8HA 2JSZA 4MH2A 3FZAA 1F2EA 3C71A 5BMUA 3EU4A 3FY7A 4IP1A 3UOMA 2DJ0A 2HQTA 3RPPA 3D4TA 1MDKA 1F6MC 3TJJA 1VF2A 3UL3A 2LS5A 3EYTA 5A4UA 4MF6A 4YAPA 2KP1A 2VM1A 3F8UA 1T00A 2V41A 1JZDA 1A23A 2WJUA 2ZNMA 3IOSA 1ZZYA 3PPUA 5IOWA 4MF7A 2HRNA 1Z6MA 3GN3A 4KUNA 2EIQA 5DCGA 1THXA 2DJ3A 2R2JA 4KNDA 2IN3A 2WB9A 3L4NA 5IO0A 2JSYA 2VL2A 2QC7A 1M99A 3KD0A 2M72A 2JZRA 4J56E 1OVNA 1TK5B 2Z9SA 3U5RE 3M1GA 2OBKA 3C8EA 4E8HA 4XTSA 2H1BA 3QAWA 3HKRA 4K2DA 3D21A 2H66A 1Q4JA 1SU9A 3HYPA 5G5FA 9GSSA 5CP1A 1UC7A 1RK4A 5ELAA 1QK8A 1SJZA 3RBTA 4I2TA 4KW6A 4GQFA 5ECOB 2V6OA 4MPGA 4ZIJA 2D2ZA 5EPFA 5FWGA 1UVZA 4KX4A 1SJ6A 4EDYA 3E3EA 2H70A 2KUCA 1SL2B 3RPNA 1X9MB 2E2MA 3GMFA 4K0NA 2LRTA 1SK1A 3H8QA 3J7Yb 1ERVA 2DMLA 2J9HA 1Z6NA 4BVXB 4L8EA 1N2AA 3BOAA 5B6NA 1GUHA 2YCDA 1AQVA 4OCEA 2DIZA 4XIHA 4WR4A 2FWEA 20GSA 5KN2A 2I1UA 5AIXA 4MZWA 3EMXA 3C7MA 1MEKA 1USBA 2B7KA 4ULXA 1OE7A 2B6MA 5D96A 2GS3A 5A4VA 3KJYA 4MP4A 2WULA 2LKUA 1X0RA 2MMOA 5DDLA 1U3IA 5J3RA 1GH2A 1JZRA 4OO4A 2C0GA 4G19A 2MBTA 3KH7A 2VCXA 3MWHA 2H30A 1V58A 5DAKA 1TJDA 3IA1A 3GURA 2BTOT 2XBIA 3LFLA 1WIKA 2VIMA 1FOVA 5IQYA 3D22A 4GSSA 1K0AA 2PU9C 3F4SA 4I97A 4IJ3A 3C1RA 4Q5RA 3R2QA 5F07A 3FZ4A 2H1GA 2FA4A 1JLVA 5D73A 1FB0A 3GTUB 4ID0A 4IQAA 2L4QA 1BG5A 2BMXA 4LL1B 3UAPA 2G0FA 5DQSA 1PMTA 1O73A 4RQXA 5C04A 3U6VA 3HJOA 5DJMA 2DBCA 1QMVA 2PERA 5J9CA 2VCTA 2CV4A 3ERFA 2LUSA 2DJJA 3DKSA 3BCKA 1GTIA 3KIJA 1PA3A 2A2RA 3QCPA 4I2UA 3FHKA 5B7CA 3TOUA 4XCSA 5HR1A 3D5JA 2QKEA 2PMTA 2DJ1A 1G7OA 4BVYB 4WF5A 4P3YB 5ECMB 4NHZA 3WGDA 3FZ5A 3VWVA 3F6DA 2OE3A 1X5DA 1J0FA 4KB3A 2VL2C 1B9YC 3F4TA 3HHVA 2M80A 4Q5FA 2AUVA 4D73A 4E8EA 1YY7A 1JZOA 2VAFA 4RUVA 4IHUA 2HRFA 1SKWB 4XS4B 4N0ZA 1T4ZA 1UA5A 4LA1A 1EP7A 4ECCA 2FWHA 16GSA 4V2LA 3QD9A 3L9UA 4KCAA 1YQ1A 4G0IA 1TRVA 2PN8A 1EV9A 5G1LA 3LEFA 1A2JA 3ZYWA 1EP8A 2C0EA 2ZUPA 3ERWA 1WP0A 4ILFA 5IPHA 4EF0A 4ECBA 1VF3A 5B8AA 1QQ2A 3QFBC 1K3OA 2DJ2A 4MJBA 4WXTA 4X0XA 2LV3A 4AJ6A 3CSIA 1Q98A 2X8CA 3CXGA 1B4QA 2DLXA 4PQ1A 4HS1A 2IMFA 2F8FA 1KNGA 3HJPA 4F2IA 5KN1A 2C4JA 3WT2A 3DXBA 1K3LA 1E6BA 2RUEA 13GSA 3TGZA 1X9WB 3RAZA 5CYYA 3ME8A 4BWSA 1A0FA 2IMKA 4WETA 1SL0B 1M2AA 4PQIA 3LGCA 5E59A 1GSUA 4IJIA 4TR1B 3F0IA 3HY2A 1LJRA 4K6XA 3WT1A 2IJYA 5IMVA 4N0VA 5IPGA 4V2NA 2F9SA 1WRYA 2K9FA 3F4RA 1V57A 2LQOA 2X8GA 4TKYA 2NBSA 1WPIA 4DSSA 3GL5A 12GSA 3EE2A 1B8XA 1VF4A 4QQ7A 5JCUA 2P5RA 2V6KA 4KGIA 2HT9A 2LSTA 5ID2B 4RI7A 2TRCP 3FR6A 2HRKA 2MMZA 2FD3A 1I5GA 2H71A 3GKNA 3FW2A 4KSOA 1TTZA 1XZOA 1FAAA 4MK3A 2VCVA 2ON5A 2OBIA 2CAQA 3D4MA 2YP6A 2C8UA 4JE1A 2GSRA 4KE3A 3HA9A 3GNJA 3FR9A 1T8EB 1TOFA 5AIVA 1MD3A 3GIXA 5ENUA 1SKSB 3Q19A 4FIWA 5G30A 2HFDA 1OC3A 1XIYA 3IPZA 5CO3A 2I4AA 3W8SA 3A2WA 3KTLA 5D9XA 1R26A 4PUAA 4NAXA 3KCMA 3VFIA 2YWOA 1DUGA 5F0GA 4MDCA 4BPYA 1OAZA 1GTBA 5D8IA 1S3DA 1XPVA 1ACVA 3P2AA 2L59A 4MZBA 1ZGNA 2GZZA 4WEYA 2CT6A 3DD3A 2K18A 2E7PA 4CHSA 1XWGA 1J08A 1SD8A 5IMCA 5DBQA 2HZEB 4IQ1A 1EEJA 2HSHA 1XVQA 4PUFC 1TDIA 1G7EA 2HSMB 3MNGA 4CW9A 2F3MA 2WFCA 2LJRA 1V2AA 4NV5A 2IIYA 4PURA 3VPQA 2IPAA 1TRWA 2HXKA 3ME7A 1EGRA 4HJ2A 5JCWA 3I69A 1JFUA 3M9JA 2IFQB 1BAYA 2R5GA 3EURA 1LU4A 1PX7A 5DALB 2VO4A 4K1FA 4KSMA 2L5LA 3DWVA 1PL1A 1TP9A 4MA9A 3VPTA 4JR6A 5ABRA 4NXIA 1R5PA 5FT3A 1T1VA 1OC9A 1VF1A 1R5AA 1YZXA 1O6JA 1GNEA 2WRTA 3ZITA 2FA8A 3UEMA 5G31A 1DE1A 3M9KA 3QDNA 2KP2A 2LNSA 3O3TA 1SK2A 1AQXA 3FK8A 3VI7A 4YH2A 1QUWA 1XW9A 1XWKA 2KOKA 4J2FA 1GULA 1V9WA 1XCCA 2GSTA 3A3TA 3ZIVA 1BYEA 1A0RP 2H76A 5IM9A 3P8WA 3ZIJA 3O76A 6GSWA 4N10A 4GXZA 3HJMA 3I6AA 2NDOA 3APOA 2CX4A 1MTCA 2CVBA 2OKAA 4LLRA 2WGRA 3DGQA 2YJHA 5G1KA 1K0DA 2YV9A 2C3TA 4O7HA 1NW2A 4JZQA 4YAVA 4GF0A 3IR4A 2PVQA 3E9JB 2TIRA 1LBKA 3L9SA 4HUAA 5AN1A 5D9WA 1PRXA 2G2QA 2VLVA 4V1Ag 1YF1A 3IE3A 3FKFA 2R37A 3D6IA 4HI7A 10GSA 2GDRA 1YEXA 4ML6A 5IMZA 2K8VA 2VM2A 3VWUA 3TRPA 3DRNA 4OD7A 2YJ7A 3IBHA 2CX3A 3W6GA 5EL8A 4IP6A 3UIWA 1K0CA
chains in the Genus database with same CATH superfamily
1F3AA 3LWAA 1GSDA 5KOWA 3KM6A 4IELA 5DJLA 4PNGA 1E2YA 2EIOA 4FYCA 5F8BA 4RQRA 4QL9A 1XW5A 2R4VA 4GTUA 4TN8A 2K8SA 3WGXA 4KDUA 5J41A 2HSNB 3G9BA 4OCFA 4N3ZA 4MH3A 4OFMA 1UN2A 4G2EA 4IGJA 2PUKC 4DSQA 3OR5A 2VKZG 1XFLA 1M9BA 1EV4A 2PGTA 2VUPA 2F8AA 5IMFA 2H1DA 1SVMA 4TXOA 14GSA 2JZTA 2HNLA 1VRSD 3Q74A 3FYGA 3KEBA 3ZVJD 4TR3A 5DAKB 4ZL9A 3LW9A 5GSTA 4BL7A 6GSYA 2AJQB 3CTGA 4KCEA 4ZB7A 3L9VA 2N5BA 5J5NA 4N11A 1ZL9A 1S4BP 1FG4A 2VLTA 2H0IA 1ZCPA 2E2GA 4MZCA 2DC5A 3KP9A 2H6YA 2IMDA 4LL4B 5J4VA 1TK0B 4OWYA 3HVVA 3QFAC 2O5VA 1TI3A 2WS2A 2WVXB 3MAKA 4H86A 4FYBA 4KDXA 2XC2A 4K7NA 1NHOA 5IIZA 2EC4A 1F9MA 1GSEA 2JZSA 1RQMA 3TJFA 3N5OA 3GRXA 2H74A 4EDZA 4EE0A 2LJKA 2MYGA 4N30A 1EOGA 1YKAA 1XOBA 4K9ZA 1JLWA 4IBPA 19GSA 3LSZA 3I9V2 1OYJA 2FY6A 1OKDA 1T3BA 3ZZXA 4HZ4A 5HFKA 1W89A 1O8WA 4EL1A 4JBBA 1YEPA 1K0OA 5HR2A 5E4WA 3S9FA 1V98A 1EWXA 3BD2A 2B5XA 3RHBA 1YKCA 2GZPA 1DE2A 2WW1A 4V1Ap 4D73B 2CAIA 3V1WA 5HR3A 4MJEA 4TRXA 2H01A 4G0KA 1U88A 4K7OA 4K0GA 2C3NA 5EVOA 4DEJA 4NV2A 2RUFA 1S3AA 2FGXA 4L5OA 4ZBBA 1SYXA 5J4UA 2XPEA 5J47A 4HDEA 1FW1A 1K0MA 2LRNA 3H1NA 1FHEA 3EWLA 3NOFA 3IHQA 2L6DA 1M7TA 1KEBA 2HLSA 3D0ZA 2EFEA 1AIUA 3GKKA 2LQQA 1ERTA 2QGVA 2L5OA 2GT6A 1SYRA 1ERWA 5B8BA 2H6XA 3N9JA 2GGTA 3CYNA 4GWRA 2VL9A 2P31A 3TKRA 3ZRDA 2GLRA 1ZYQB 2V2GA 3HVXA 1OC8A 3HD5A 2OACA 3KMNA 3A2XA 5A5HB 4IN0A 1BQ7A 3MSZA 1X5EA 3IC4A 2QSIA 5H5RA 1GRXA 1M0UA 3H4KA 3KXOA 18GSA 2PBJA 1TRUA 3KP8A 4JU5A 1IYHA 4MJAA 4ZXGA 2H6ZA 2HSYA 1OE8A 3GL3A 4RI6A 1S3CA 3DVXA 2C3QA 2A4HA 1AAZA 1AW9A 1H75A 3PR8A 1T4YA 3G7YA 3ZTLA 4JR4A 1ZYNA 5ECHB 2H73A 3A5IA 2P5QA 4AF2A 3ZFLA 3APQA 2AB6A 3CMIA 3US3A 2DIYA 2H0GA 4BWQA 4TXVA 3IXRA 2C1YA 4YQMA 2GQLA 2A2SA 2IMEA 5A1NB 3UBLA 5ECPB 2X64A 3AY8A 1SENA 2HI7A 2LEGA 2GT5A 1I9DA 4HU9A 3Q6OA 3NIVA 3HZ4A 2GQMA 5ECRB 4POLA 3IRAA 1FVJA 1XW6A 2EIRA 3LXTA 1PN0A 4DSSB 1M2DA 1EOHA 5J9BA 5JWRB 2CVDA 3LYKA 3KMOA 4E68A 2V32A 3F3QA 1R7HA 5IO2A 6GSTA 3CHXC 3F63A 1XOAA 4FYUA 2YZHA 2HRKB 1T7PB 4PQHA 2NVLA 4F0BA 2R6KA 2LJAA 2RIIA 2M46A 1A24A 3J7Yk 4WBJA 5KEJA 3GH9A 4O5QA 2JU5A 2HZFA 3SBCA 5GAPD 2O87A 3TKSA 2GSQA 2GZYA 1QXHA 4GLTA 5FHIA 2KLXA 1TRSA 3IK9A 4X1UA 3EPTA 4USSA 3H79A 3A2VA 3DEXA 3TKPA 6GSSA 4G0LA 2VD1A 1G6YA 2NPBA 1C72A 4G9HA 4J57E 3ZMLA 1GL8A 4TVEA 2OADA 5IOXA 3UVHA 1SL1B 4PTSA 1GP1A 5A5KA 1WE0A 3GX8A 3FEUA 1GSSA 3L0HA 1XWBA 4L5LA 5DQYA 3UARA 3ZL5A 4L0UA 4F03A 3WYWA 3LYPA 3TKQA 2REMA 4ZB8A 2YWNA 1ST9A 3FMWA 2LTKA 1JHBA 3TJBA 1KTEA 3IK7A 4HOJA 1ERUA 5DVBA 5HQPA 2B7JA 4MCUA 2DMMA 1Y25A 2KHPA 1SK0A 2MMNA 1N8JA 3L78A 1GUMA 4LMVA 4MJCA 4TR0A 3UBKA 2PPTA 2UV8G 3LXZA 3ED3A 2H75A 1GUKA 1FVKA 2B3SA 1K0BA 2X99A 2ZCTA 2IWTA 4HU7A 1U3AA 4DVCA 2WDUA 2JL4A 1URMA 4EC0A 6GSXA 4Z2RA 2TRXA 1TU8A 3M0FA 1S3RA 3GSTA 1PKWA 2XPDA 2VCWA 1PQNA 1RW1A 4F0CA 3O6TA 4AJ7A 3P90A 2R0CA 4XS1A 3TKSE 1G6WA 3TJGA 4PXOA 1OC9B 3KTBA 5IMDA 2CZ3A 1CQHA 2WVZA 2IMIA 3H93A 2RLIA 4Z7XA 3IC8A 3VLNA 1EGOA 1TU7A 3GYKA 1U87A 4TW5A 1ZYEA 4POKA 4KA0A 1ZOFA 3GHAA 1A8LA 2O3EA 4XRDA 5CRDA 4HQZA 2B5YA 2HRAA 3HDCA 4HZ2A 2O8VB 2GQKA 2AYTA 3JCML 3SWLA 2VLUA 4IVFA 3QPMA 1PX6A 2L4CA 5ECSA 4QL7A 1Z9HA 3TOTA 1TKDB 4ML1A 4K7IA 2YPMA 2DSAA 3PGTA 1U6TA 5KOXA 5CAXA 3VWXA 3EC3A 4EVMA 4CY8A 1YDKA 2FLSA 3C1SA 2FHEA 1A2MA 3LORA 3EMPA 4BVXA 4LMWA 4XRAA 4MLYA 2C80A 1SD9A 1ILOA 2GTUA 4PX1A 2YN1A 3P7XA 1WWJA 1XBSA 1B4PA 2AAWA 5G5EA 4L0WA 3TKSC 2N5FA 2FNOA 11GSA 4GQCA 4KH7A 5LCZA 3TUEA 2H8LA 1YF0A 2YOIA 2MBSA 4MPFA 4TOPA 4G01A 4JRRA 2I3YA 5HFGA 8GSSA 1NM3A 3CSHA 4OFTA 3EVIA 1A8YA 2B1KA 4K5RA 4ZILA 1IYIA 1F3BA 4QMKA 1PL2A 5AGYA 5JWOB 5ECNB 3GA4A 4V2MA 3KZQA 3GKMA 3FZ9A 2ES7A 2RM6A 1H4OA 3E0UA 1MDIA 4WKWA 3A5WA 4F9ZA 2ON7A 4Z2UA 3GTUA 1ML6A 3MDKA 2VCZA 1FB6A 2AHEA 4GCIA 3WD6A 1GSQA 1MD4A 3K8NA 2C0FA 4AJ8A 2CZ2A 2MMAA 2FWFA 2H1AA 2L6CA 2RM5A 1JZWA 2HE3A 4AKIA 3GX0A 4NMUA 4AKXB 5A34A 4GRFA 1J9BA 5LD0A 1R4WA 2H19A 2PWJA 3QOUA 2HYXA 1HQOA 4TXOB 4GSNA 2CVKA 2K6VA 3TJKA 1DBYA 2J23A 3BBYA 2YWIA 3VWWA 2VOCA 4ISDA 4BL7B 3LG6A 1MDJA 4GDFA 1SVOA 3ZREA 1TI1A 4JEDA 4MABA 3PINA 4BVYA 4YQUA 5F06A 1YEWC 1AUCA 2OA7A 3GH6A 5ELGA 4DSRA 3TB2A 1BX9A 3VK9A 1AXDA 2XHFA 4HEA2 3ISOA 5COHA 3I43A 1TXXA 2I81A 3ZLPA 1A2LA 5GSSA 2WZ9A 2EFDA 5D9TA 1THOA 3GKXA 4XS4A 1DSBA 2LNTA 3TCOA 5CRHA 4K8MA 4ZBDA 4IKHA 3FR3A 1M2BA 4AGSA 4ICYA 4HJMA 2DKIA 3UVTA 1GSFA 2WCIA 1YVLA 3DIEA 4CDOA 2OE1A 1O81A 2IL3A 3R3EA 17GSA 4GSTA 3DYRA 1PN9A 3F3RA 3G7IA 2B5EA 4PI2C 2JADA 4Q5NA 1AQWA 4AKGA 4EIQA 1KBNA 2E0QA 1HNAA 5INYA 1GLPA 1SJIA 2FUG2 4O32A 4ZBAA 3IAM2 3LJRA 4PGTA 1X5CA 5ECKB 3LQ7A 3RHCA 2YNXA 4KF9A 4ZL7A 2P0GA 1OKTA 1Y1UA 4NPBA 2MZCA 2YZUA 3F6FA 1GTUA 3EINA 5EY6A 4EKZA 3IAS2 1CQGA 3W8JA 4F82A 4I8BA 1TK8B 2F51A 1GLQA 5CNWA 1XVWA 5ECIB 5HR0A 5A4WA 5LNKe 4MF5A 1XXUA 4NWYA 2B1LA 1BJXA 4O92A 3IV4A 1EEMA 1M3IA 2GVPA 3DVWA 2C0DA 3UJ1A 2CA8A 5ECQB 3MYDA 4TR4A 3TDGA 4I5QA 2R0GA 2VL3A 3ZMKA 4I6XA 1ZMAA 1EZKA 5H5QA 4Q5QA 1NSWA 4TR1A 1BG1A 22GSA 3DMLA 4WBRD 2GSSA 3CBUA 3EU3A 3HZ8A 2OE0A 3BCIA 4NHWA 4POMA 1PGTA 3M8NA 4IW9A 2YWMA 4O5RA 4ACSA 3FRCA 3ZFBA 3CSJA 1M9AA 4EXJA 3G7JA 4ZB6A 4ZL8A 1QFNA 1X9SB 1NHYA 1W4VA 2R3XA 3HVSA 2PVOC 4FH8A 3UMAA 6GSVA 3Q18A 5ID2A 1V40A 5KN3A 4XHMA 3F9UA 1BEDA 2BJXA 5GAND 3QR6A 3WGEA 4ZB9A 1M3JA 1AC1A 4AI6A 6GSUA 3QAGA 3RDWA 1Z7PA 2NTOA 3CRUA 4KDYA 1SKRB 1QGVA 5C00A 4MMMA 4YQVA 5HFIA 1Z3EA 3GV1A 1PD21 3GFKA 3CRTA 5D93A 5GZZB 2LRCA 1HYUA 1WJKA 1TW9A 4OFNA 3KGKA 1G0TA 4KAEA 2AV4A 2O85A 2N5AA 1ON4A 1WMJA 4EUYA 5CREA 3IDVA 2OJLA 3TRXA 3ERGA 3QAVA 4OO5A 2CQ9A 1Y6EA 4EO3A 5D9VA 3ZVJA 2VD0A 1HD2A 5CRGA 1HNCA 1PKZA 2A4VA 3QMXA 4PNFA 3APSA 2ALBA 1O85A 3KH9A 5B6MA 3HXSA 1Z5YE 2A2PA 2FCHA 2H1LA 3M3MA 3VI5A 4IS0A 1N25A 3HVNA 1B48A 1XWAA 2O7KA 5JCGA 4ECIA 3GUSA 1Z7RA 1GNWA 7GSSA 4FO5A 4WF4A 5G2ZA 4X43A 5AISA 4ECJA 2DJKA 2HZEA 2YV7A 4G10A 2EFHA 2UZ8A 1GTAA 4XS6A 4BA7A 2VCQA 2HSMA 1ABAA 5H5SA 2H72A 5KN0A 1K0NA 2H0HA 4FQUA 2XBQA 2JACA 5F05A 1XWCA 2V1MA 1YJ6A 2O36A 4WR5A 1F37A 2O89A 5JWQB 4POBA 2L57A 3VURA 1O8XA 3PH9A 1PSQA 1HNBA 2IFQA 4MNNA 1B9XC 5DALA 2FWGA 1O7UA 3NZNA 1FO5A 4HQSA 1K3YA 4OMVA 1GWCA 3GSSA 3BJ5A 2YANA 5IMAA 5ECLB 5L71A 1TXUA 3TRQA 1GSYA 3CTFA 5CRWA 1WOUA 3HCZA 5DCHA 2I9HA 3C73A 1VGLA 2X8HA 2JSZA 4MH2A 3FZAA 1F2EA 3C71A 3CWGA 5BMUA 3EU4A 4K5SA 3FY7A 4IP1A 3UOMA 2DJ0A 2HQTA 3RPPA 3D4TA 1MDKA 1F6MC 3TJJA 1VF2A 3UL3A 2LS5A 3HMJG 3EYTA 5A4UA 4MF6A 4YAPA 2KP1A 2VM1A 3F8UA 1T00A 2V41A 1JZDA 1A23A 2WJUA 2ZNMA 3IOSA 1ZZYA 3PPUA 5IOWA 4MF7A 2HRNA 1Z6MA 3GN3A 4KUNA 2EIQA 5DCGA 1THXA 2DJ3A 2R2JA 4KNDA 2IN3A 2WB9A 3L4NA 5IO0A 2JSYA 3MIXA 2VL2A 2QC7A 1M99A 3KD0A 2M72A 2JZRA 4J56E 1OVNA 1TK5B 2Z9SA 3U5RE 3M1GA 2OBKA 3C8EA 4E8HA 4XTSA 2H1BA 3QAWA 3HKRA 4K2DA 3D21A 2H66A 1Q4JA 1SU9A 3HYPA 5G5FA 4K2XA 9GSSA 5CP1A 1UC7A 1RK4A 5ELAA 1QK8A 1SJZA 3RBTA 4I2TA 4KW6A 4GQFA 5ECOB 2V6OA 4MPGA 4ZIJA 2D2ZA 5EPFA 5FWGA 1UVZA 4KX4A 1SJ6A 4EDYA 3E3EA 2H70A 2KUCA 1SL2B 3RPNA 1X9MB 2E2MA 3GMFA 4K0NA 4Z2TA 2LRTA 1SK1A 3H8QA 2QA1A 3J7Yb 1ERVA 2HSNA 2DMLA 2WW2A 2J9HA 1Z6NA 4BVXB 4L8EA 1N2AA 3BOAA 5B6NA 1GUHA 2YCDA 1AQVA 4OCEA 2DIZA 4XIHA 4WR4A 2FWEA 20GSA 5KN2A 2WVYA 2I1UA 5AIXA 4MZWA 3EMXA 3C7MA 1MEKA 1USBA 2B7KA 4ULXA 1OE7A 2B6MA 5D96A 2GS3A 5A4VA 3KJYA 4MP4A 2WULA 2LKUA 1X0RA 2MMOA 5DDLA 1U3IA 5J3RA 1GH2A 1JZRA 4OO4A 2C0GA 4G19A 2MBTA 3KH7A 2VCXA 1BF5A 3MWHA 2H30A 1V58A 5DAKA 1TJDA 3IA1A 3GURA 2BTOT 2XBIA 3LFLA 1WIKA 2VIMA 1FOVA 5IQYA 3D22A 4GSSA 4YKFA 1K0AA 2PU9C 3F4SA 4I97A 4IJ3A 3C1RA 4Q5RA 3R2QA 5F07A 3FZ4A 2H1GA 2FA4A 1JLVA 5D73A 1FB0A 3GTUB 4ID0A 4IQAA 2L4QA 1SVLA 1BG5A 2WVXA 2BMXA 4LL1B 3UAPA 2G0FA 5DQSA 1PMTA 1O73A 4RQXA 5C04A 3U6VA 3HJOA 5DJMA 2DBCA 1QMVA 2PERA 5J9CA 5A34B 2VCTA 2CV4A 3ERFA 2LUSA 2DJJA 3DKSA 3BCKA 1GTIA 3KIJA 1PA3A 1PFOA 2A2RA 3QCPA 4I2UA 3FHKA 5B7CA 3TOUA 4XCSA 5HR1A 3D5JA 2QKEA 2PMTA 2DJ1A 1G7OA 4BVYB 4WF5A 4P3YB 3RFRC 5ECMB 4NHZA 3WGDA 3FZ5A 3VWVA 3F6DA 2OE3A 1X5DA 3CQFA 1J0FA 4KB3A 2VL2C 1B9YC 3F4TA 3HHVA 2M80A 4Q5FA 2AUVA 4D73A 4E8EA 1YY7A 1JZOA 2VAFA 4RUVA 4IHUA 2HRFA 1SKWB 4XS4B 4N0ZA 1T4ZA 1UA5A 4LA1A 1EP7A 4ECCA 2FWHA 16GSA 4V2LA 3QD9A 3L9UA 4KCAA 1YQ1A 4G0IA 1TRVA 2PN8A 1EV9A 5G1LA 3LEFA 5J40A 1A2JA 3ZYWA 1EP8A 2C0EA 2ZUPA 3ERWA 1WP0A 4ILFA 5IPHA 2X49A 4EF0A 4ECBA 1VF3A 5B8AA 1QQ2A 3QFBC 1K3OA 2DJ2A 4MJBA 4WXTA 4X0XA 2LV3A 4AJ6A 3CSIA 1Q98A 2X8CA 3CXGA 1B4QA 5A5HA 2DLXA 4W66A 4PQ1A 4HS1A 2IMFA 2F8FA 1KNGA 3HJPA 4F2IA 5KN1A 2C4JA 3WT2A 3DXBA 1ZYPA 1K3LA 1E6BA 2RUEA 13GSA 3TGZA 1X9WB 3RAZA 5CYYA 3ME8A 3IHGA 1A0FA 4BWSA 2IMKA 4WETA 2WW0A 1SL0B 1I1IP 1M2AA 4PQIA 3LGCA 5E59A 1GSUA 4IJIA 4TR1B 3F0IA 3HY2A 5A1NA 1LJRA 4K6XA 3WT1A 2IJYA 5IMVA 4N0VA 4CY6A 5IPGA 4V2NA 2F9SA 1WRYA 4AKHA 2K9FA 3F4RA 1V57A 2LQOA 2X8GA 2DKHA 4TKYA 2NBSA 1WPIA 4DSSA 3GL5A 12GSA 3EE2A 1B8XA 1XG8A 1VF4A 4QQ7A 5JCUA 2P5RA 2V6KA 4KGIA 2HT9A 2LSTA 5ID2B 4RI7A 2TRCP 1FOHA 3FR6A 2QA2A 2HRKA 2MMZA 2FD3A 1I5GA 2H71A 3GKNA 3FW2A 4KSOA 1TTZA 1XZOA 1FAAA 4MK3A 2VCVA 2ON5A 2OBIA 2CAQA 3D4MA 2YP6A 2C8UA 2GSRA 4JE1A 4KE3A 3HA9A 3GNJA 3FR9A 1T8EB 1TOFA 5AIVA 1MD3A 3GIXA 5ENUA 4O5UA 1SKSB 3Q19A 4FIWA 5J4YA 5G30A 2HFDA 1OC3A 1XIYA 3IPZA 5CO3A 2I4AA 3W8SA 3A2WA 3KTLA 5D9XA 1R26A 4PUAA 4NAXA 2WZSA 3KCMA 3VFIA 2YWOA 1DUGA 5F0GA 4MDCA 4BPYA 1OAZA 1GTBA 5D8IA 1S3DA 1XPVA 1ACVA 3P2AA 2L59A 4MZBA 1ZGNA 2GZZA 4WEYA 2CT6A 3DD3A 2K18A 4BIKA 2E7PA 4CHSA 1XWGA 1J08A 1SD8A 4A5PA 5IMCA 5DBQA 2HZEB 4IQ1A 1EEJA 3TU3B 2HSHA 1XVQA 4PUFC 1TDIA 1G7EA 4FXYP 2R0PA 2HSMB 3MNGA 4CW9A 4YKGA 3RGBC 2F3MA 2WFCA 2LJRA 1V2AA 4NV5A 2IIYA 4X4JA 4PURA 3VPQA 2IPAA 1TRWA 2HXKA 3ME7A 1EGRA 4HJ2A 5JCWA 3I69A 1JFUA 3M9JA 2IFQB 1BAYA 2R5GA 3EURA 1LU4A 1PX7A 5DALB 2VO4A 4K1FA 4KSMA 2L5LA 2WW3A 2X4AA 3DWVA 1PL1A 1TP9A 4MA9A 3VPTA 4JR6A 5ABRA 4NXIA 1R5PA 5FT3A 1T1VA 1OC9A 1VF1A 1R5AA 5BRTA 1YZXA 1O6JA 1GNEA 2WRTA 3ZITA 2EFCA 2FA8A 3UEMA 5G31A 1DE1A 3M9KA 3QDNA 2KP2A 4PI0C 2LNSA 3O3TA 1SK2A 1AQXA 5BMUB 3FK8A 4EIPA 3VI7A 4YH2A 1QUWA 2OT3A 1XW9A 1XWKA 2KOKA 4J2FA 1GULA 1V9WA 1XCCA 2GSTA 3A3TA 3ZIVA 1BYEA 1A0RP 2H76A 5IM9A 3P8WA 3ZIJA 3O76A 6GSWA 4N10A 4GXZA 3HJMA 3I6AA 2NDOA 3APOA 4PHZC 2CX4A 1MTCA 2CVBA 2OKAA 4LLRA 2WGRA 3DGQA 2YJHA 5G1KA 1K0DA 2YV9A 2C3TA 4O7HA 1NW2A 4JZQA 4YAVA 4GF0A 3IR4A 2PVQA 3E9JB 2TIRA 1LBKA 3L9SA 4HUAA 5AN1A 5D9WA 1PRXA 2G2QA 2VLVA 4V1Ag 1YF1A 3IE3A 3FKFA 2R37A 4HSCX 3D6IA 4HI7A 10GSA 2GDRA 1YEXA 4ML6A 5IMZA 2K8VA 2VM2A 3VWUA 3TRPA 3DRNA 4OD7A 2YJ7A 3IBHA 2CX3A 3W6GA 5EL8A 4IP6A 3UIWA 1K0CA
chains in the Genus database with same CATH topology
1F3AA 3LWAA 1GSDA 5KOWA 3KM6A 4IELA 5DJLA 4PNGA 1E2YA 2EIOA 4FYCA 5F8BA 4RQRA 4QL9A 1XW5A 2R4VA 4GTUA 4TN8A 2K8SA 3WGXA 4KDUA 5J41A 2HSNB 3G9BA 4OCFA 4N3ZA 4MH3A 4OFMA 1UN2A 4G2EA 4IGJA 2PUKC 4DSQA 3OR5A 2VKZG 1XFLA 1M9BA 1EV4A 2PGTA 2VUPA 2F8AA 5IMFA 2H1DA 1SVMA 4TXOA 14GSA 2JZTA 2HNLA 1VRSD 3Q74A 3FYGA 3KEBA 3ZVJD 4TR3A 5DAKB 4ZL9A 3LW9A 5GSTA 4BL7A 6GSYA 2AJQB 3CTGA 4KCEA 4ZB7A 3L9VA 2N5BA 5J5NA 4N11A 1ZL9A 1FG4A 2VLTA 2H0IA 1ZCPA 2E2GA 4MZCA 2DC5A 3KP9A 2H6YA 2IMDA 4LL4B 5J4VA 1TK0B 4OWYA 3HVVA 3QFAC 2O5VA 1TI3A 2WS2A 3MAKA 4H86A 4FYBA 4KDXA 2XC2A 4K7NA 1NHOA 5IIZA 2EC4A 1F9MA 1GSEA 2JZSA 1RQMA 3TJFA 3N5OA 3GRXA 2H74A 4EDZA 4EE0A 2LJKA 2MYGA 4N30A 1EOGA 1YKAA 1XOBA 4K9ZA 1JLWA 4IBPA 19GSA 3LSZA 3I9V2 1OYJA 2FY6A 1OKDA 1T3BA 3ZZXA 4HZ4A 5HFKA 1W89A 1O8WA 4EL1A 4JBBA 1YEPA 1K0OA 5HR2A 5E4WA 3S9FA 1V98A 1EWXA 3BD2A 2B5XA 3RHBA 1YKCA 2GZPA 1DE2A 4V1Ap 4D73B 2CAIA 3V1WA 5HR3A 4MJEA 4TRXA 2H01A 4G0KA 1U88A 4K7OA 4K0GA 2C3NA 5EVOA 4DEJA 4NV2A 2RUFA 1S3AA 2FGXA 4L5OA 4ZBBA 1SYXA 5J4UA 2XPEA 5J47A 4HDEA 1FW1A 1K0MA 2LRNA 3H1NA 1FHEA 3EWLA 3NOFA 3IHQA 2L6DA 1M7TA 1KEBA 2HLSA 3D0ZA 2EFEA 1AIUA 3GKKA 2LQQA 1ERTA 2QGVA 2L5OA 2GT6A 1SYRA 1ERWA 5B8BA 2H6XA 3N9JA 2GGTA 3CYNA 4GWRA 2VL9A 2P31A 3TKRA 3ZRDA 2GLRA 1ZYQB 2V2GA 3HVXA 1OC8A 3HD5A 2OACA 3KMNA 3A2XA 5A5HB 4IN0A 1BQ7A 3MSZA 1X5EA 3IC4A 2QSIA 5H5RA 1GRXA 1M0UA 3H4KA 3KXOA 18GSA 2PBJA 1TRUA 3KP8A 4JU5A 1IYHA 4MJAA 4ZXGA 2H6ZA 2HSYA 1OE8A 3GL3A 4RI6A 1S3CA 3DVXA 2C3QA 2A4HA 1AAZA 1AW9A 1H75A 3PR8A 1T4YA 3G7YA 3ZTLA 4JR4A 1ZYNA 5ECHB 2H73A 3A5IA 2P5QA 4AF2A 3ZFLA 3APQA 2AB6A 3CMIA 3US3A 2DIYA 2H0GA 4BWQA 4TXVA 3IXRA 2C1YA 4YQMA 2GQLA 2A2SA 2IMEA 5A1NB 3UBLA 5ECPB 2X64A 3AY8A 1SENA 2HI7A 2LEGA 2GT5A 1I9DA 4HU9A 3Q6OA 3NIVA 3HZ4A 2GQMA 5ECRB 4POLA 3IRAA 1FVJA 1XW6A 2EIRA 3LXTA 1PN0A 4DSSB 1M2DA 1EOHA 5J9BA 5JWRB 2CVDA 3LYKA 3KMOA 4E68A 2V32A 3F3QA 1R7HA 5IO2A 6GSTA 3F63A 1XOAA 4FYUA 2YZHA 2HRKB 1T7PB 4PQHA 2NVLA 4F0BA 2R6KA 2LJAA 2RIIA 2M46A 1A24A 3J7Yk 4WBJA 5KEJA 3GH9A 4O5QA 2JU5A 2HZFA 3SBCA 5GAPD 2O87A 3TKSA 2GSQA 2GZYA 1QXHA 4GLTA 5FHIA 2KLXA 1TRSA 3IK9A 4X1UA 3EPTA 4USSA 3H79A 3A2VA 3DEXA 3TKPA 6GSSA 4G0LA 2VD1A 1G6YA 2NPBA 1C72A 4G9HA 4J57E 3ZMLA 1GL8A 4TVEA 2OADA 5IOXA 3UVHA 1SL1B 4PTSA 1GP1A 5A5KA 1WE0A 3GX8A 3FEUA 1GSSA 3L0HA 1XWBA 4L5LA 5DQYA 3UARA 3ZL5A 4L0UA 4F03A 3WYWA 3LYPA 3TKQA 2REMA 4ZB8A 2YWNA 1ST9A 3FMWA 2LTKA 1JHBA 3TJBA 1KTEA 3IK7A 4HOJA 1ERUA 5DVBA 5HQPA 2B7JA 4MCUA 2DMMA 1Y25A 2KHPA 1SK0A 2MMNA 1N8JA 3L78A 1GUMA 4LMVA 4MJCA 4TR0A 3UBKA 2PPTA 2UV8G 3LXZA 3ED3A 2H75A 1GUKA 1FVKA 2B3SA 1K0BA 2X99A 2ZCTA 2IWTA 4HU7A 1U3AA 4DVCA 2WDUA 2JL4A 1URMA 4EC0A 6GSXA 4Z2RA 2TRXA 1TU8A 3M0FA 3GSTA 1PKWA 2XPDA 2VCWA 1PQNA 1RW1A 4F0CA 3O6TA 4AJ7A 3P90A 2R0CA 4XS1A 3TKSE 1G6WA 3TJGA 4PXOA 1OC9B 3KTBA 5IMDA 2CZ3A 1CQHA 2IMIA 3H93A 2RLIA 4Z7XA 3IC8A 3VLNA 1EGOA 1TU7A 3GYKA 1U87A 4TW5A 1ZYEA 4POKA 4KA0A 1ZOFA 3GHAA 1A8LA 4XRDA 5CRDA 4HQZA 2B5YA 2HRAA 3HDCA 4HZ2A 2O8VB 2GQKA 2AYTA 3JCML 3SWLA 2VLUA 4IVFA 3QPMA 1PX6A 2L4CA 5ECSA 4QL7A 1Z9HA 3TOTA 1TKDB 4ML1A 4K7IA 2YPMA 2DSAA 3PGTA 1U6TA 5KOXA 5CAXA 3VWXA 3EC3A 4EVMA 4CY8A 1YDKA 2FLSA 3C1SA 2FHEA 1A2MA 3LORA 3EMPA 4BVXA 4LMWA 4XRAA 4MLYA 2C80A 1SD9A 1ILOA 2GTUA 4PX1A 2YN1A 3P7XA 1WWJA 1XBSA 1B4PA 2AAWA 5G5EA 4L0WA 3TKSC 2N5FA 2FNOA 11GSA 4GQCA 4KH7A 5LCZA 3TUEA 2H8LA 1YF0A 2YOIA 2MBSA 4MPFA 4TOPA 4G01A 4JRRA 2I3YA 5HFGA 8GSSA 1NM3A 3CSHA 4OFTA 3EVIA 1A8YA 2B1KA 4K5RA 4ZILA 1IYIA 1F3BA 4QMKA 1PL2A 5AGYA 5JWOB 5ECNB 3GA4A 4V2MA 3KZQA 3GKMA 3FZ9A 2ES7A 2RM6A 1H4OA 3E0UA 1MDIA 4WKWA 3A5WA 4F9ZA 2ON7A 4Z2UA 3GTUA 1ML6A 3MDKA 2VCZA 1FB6A 2AHEA 4GCIA 3WD6A 1GSQA 1MD4A 3K8NA 2C0FA 4AJ8A 2CZ2A 2MMAA 2FWFA 2H1AA 2L6CA 2RM5A 1JZWA 2HE3A 4AKIA 3GX0A 4NMUA 4AKXB 5A34A 4GRFA 1J9BA 5LD0A 1R4WA 2H19A 2PWJA 3QOUA 2HYXA 1HQOA 4TXOB 4GSNA 2CVKA 2K6VA 3TJKA 1DBYA 2J23A 3BBYA 2YWIA 3VWWA 2VOCA 4ISDA 4BL7B 3LG6A 1MDJA 4GDFA 1SVOA 3ZREA 1TI1A 4JEDA 4MABA 3PINA 4BVYA 4YQUA 5F06A 1AUCA 2OA7A 3GH6A 5ELGA 4DSRA 3TB2A 1BX9A 3VK9A 1AXDA 2XHFA 4HEA2 3ISOA 5COHA 3I43A 1TXXA 2I81A 3ZLPA 1A2LA 5GSSA 2WZ9A 2EFDA 5D9TA 1THOA 3GKXA 4XS4A 1DSBA 2LNTA 3TCOA 5CRHA 4K8MA 4ZBDA 4IKHA 3FR3A 1M2BA 4AGSA 4ICYA 4HJMA 2DKIA 3UVTA 1GSFA 2WCIA 1YVLA 3DIEA 4CDOA 2OE1A 1O81A 2IL3A 3R3EA 17GSA 4GSTA 3DYRA 1PN9A 3F3RA 3G7IA 2B5EA 2JADA 4Q5NA 1AQWA 4AKGA 4EIQA 1KBNA 2E0QA 1HNAA 5INYA 1GLPA 1SJIA 2FUG2 4O32A 4ZBAA 3IAM2 3LJRA 4PGTA 1X5CA 5ECKB 3LQ7A 3RHCA 2YNXA 4KF9A 4ZL7A 2P0GA 1OKTA 1Y1UA 4NPBA 2MZCA 2YZUA 3F6FA 1GTUA 3EINA 5EY6A 4EKZA 3IAS2 1CQGA 3W8JA 4F82A 4I8BA 1TK8B 2F51A 1GLQA 5CNWA 1XVWA 5ECIB 5HR0A 5A4WA 5LNKe 4MF5A 1XXUA 4NWYA 2B1LA 1BJXA 4O92A 3IV4A 1EEMA 2GVPA 3DVWA 2C0DA 3UJ1A 2CA8A 5ECQB 3MYDA 4TR4A 3TDGA 4I5QA 2R0GA 2VL3A 3ZMKA 4I6XA 1ZMAA 1EZKA 5H5QA 4Q5QA 1NSWA 4TR1A 1BG1A 22GSA 3DMLA 4WBRD 2GSSA 3CBUA 3EU3A 3HZ8A 2OE0A 3BCIA 4NHWA 4POMA 1PGTA 3M8NA 4IW9A 2YWMA 4O5RA 4ACSA 3FRCA 3ZFBA 3CSJA 1M9AA 4EXJA 3G7JA 4ZB6A 4ZL8A 1QFNA 1X9SB 1NHYA 1W4VA 2R3XA 3HVSA 2PVOC 4FH8A 3UMAA 6GSVA 3Q18A 5ID2A 1V40A 5KN3A 4XHMA 3F9UA 1BEDA 2BJXA 5GAND 3QR6A 3WGEA 4ZB9A 1AC1A 4AI6A 6GSUA 3QAGA 3RDWA 1Z7PA 2NTOA 3CRUA 4KDYA 1SKRB 1QGVA 5C00A 4MMMA 4YQVA 5HFIA 1Z3EA 3GV1A 1PD21 3GFKA 3CRTA 5D93A 5GZZB 2LRCA 1HYUA 1WJKA 1TW9A 4OFNA 3KGKA 1G0TA 4KAEA 2AV4A 2O85A 2N5AA 1ON4A 1WMJA 4EUYA 5CREA 3IDVA 2OJLA 3TRXA 3ERGA 3QAVA 4OO5A 2CQ9A 1Y6EA 4EO3A 5D9VA 3ZVJA 2VD0A 1HD2A 5CRGA 1HNCA 1PKZA 2A4VA 3QMXA 4PNFA 3APSA 2ALBA 1O85A 3KH9A 5B6MA 3HXSA 1Z5YE 2A2PA 2FCHA 2H1LA 3M3MA 3VI5A 4IS0A 1N25A 1B48A 1XWAA 2O7KA 5JCGA 4ECIA 3GUSA 1Z7RA 1GNWA 7GSSA 4FO5A 4WF4A 5G2ZA 4X43A 5AISA 4ECJA 2DJKA 2HZEA 2YV7A 4G10A 2EFHA 2UZ8A 1GTAA 4XS6A 4BA7A 2VCQA 2HSMA 1ABAA 5H5SA 2H72A 5KN0A 1K0NA 2H0HA 4FQUA 2XBQA 2JACA 5F05A 1XWCA 2V1MA 1YJ6A 4WR5A 1F37A 2O89A 5JWQB 4POBA 2L57A 3VURA 1O8XA 3PH9A 1PSQA 1HNBA 2IFQA 4MNNA 1B9XC 5DALA 2FWGA 1O7UA 3NZNA 1FO5A 4HQSA 1K3YA 4OMVA 1GWCA 3GSSA 3BJ5A 2YANA 5IMAA 5ECLB 5L71A 1TXUA 3TRQA 1GSYA 3CTFA 5CRWA 1WOUA 3HCZA 5DCHA 2I9HA 3C73A 1VGLA 2X8HA 2JSZA 4MH2A 3FZAA 1F2EA 3C71A 3CWGA 5BMUA 3EU4A 4K5SA 3FY7A 4IP1A 3UOMA 2DJ0A 2HQTA 3RPPA 3D4TA 1MDKA 1F6MC 3TJJA 1VF2A 3UL3A 2LS5A 3HMJG 3EYTA 5A4UA 4MF6A 4YAPA 2KP1A 2VM1A 3F8UA 1T00A 2V41A 1JZDA 1A23A 2WJUA 2ZNMA 3IOSA 1ZZYA 3PPUA 5IOWA 4MF7A 2HRNA 1Z6MA 3GN3A 4KUNA 2EIQA 5DCGA 1THXA 2DJ3A 2R2JA 4KNDA 2IN3A 2WB9A 3L4NA 5IO0A 2JSYA 3MIXA 2VL2A 2QC7A 1M99A 3KD0A 2M72A 2JZRA 4J56E 1OVNA 1TK5B 2Z9SA 3U5RE 3M1GA 2OBKA 3C8EA 4E8HA 4XTSA 2H1BA 3QAWA 3HKRA 4K2DA 3D21A 2H66A 1Q4JA 1SU9A 3HYPA 5G5FA 4K2XA 9GSSA 5CP1A 1UC7A 1RK4A 5ELAA 1QK8A 1SJZA 3RBTA 4I2TA 4KW6A 4GQFA 5ECOB 2V6OA 4MPGA 4ZIJA 2D2ZA 5EPFA 5FWGA 1UVZA 4KX4A 1SJ6A 4EDYA 3E3EA 2H70A 2KUCA 1SL2B 3RPNA 1X9MB 2E2MA 3GMFA 4K0NA 4Z2TA 2LRTA 1SK1A 3H8QA 2QA1A 3J7Yb 1ERVA 2HSNA 2DMLA 2J9HA 1Z6NA 4BVXB 4L8EA 1N2AA 3BOAA 5B6NA 1GUHA 2YCDA 1AQVA 4OCEA 2DIZA 4XIHA 4WR4A 2FWEA 20GSA 5KN2A 2I1UA 5AIXA 4MZWA 3EMXA 3C7MA 1MEKA 1USBA 2B7KA 4ULXA 1OE7A 2B6MA 5D96A 2GS3A 5A4VA 3KJYA 4MP4A 2WULA 2LKUA 1X0RA 2MMOA 5DDLA 1U3IA 5J3RA 1GH2A 1JZRA 4OO4A 2C0GA 4G19A 2MBTA 3KH7A 2VCXA 1BF5A 3MWHA 2H30A 1V58A 5DAKA 1TJDA 3IA1A 3GURA 2BTOT 2XBIA 3LFLA 1WIKA 2VIMA 1FOVA 5IQYA 3D22A 4GSSA 4YKFA 1K0AA 2PU9C 3F4SA 4I97A 4IJ3A 3C1RA 4Q5RA 3R2QA 5F07A 3FZ4A 2H1GA 2FA4A 1JLVA 5D73A 1FB0A 3GTUB 4ID0A 4IQAA 2L4QA 1SVLA 1BG5A 2BMXA 4LL1B 3UAPA 2G0FA 5DQSA 1PMTA 1O73A 4RQXA 5C04A 3U6VA 3HJOA 5DJMA 2DBCA 1QMVA 2PERA 5J9CA 5A34B 2VCTA 2CV4A 3ERFA 2LUSA 2DJJA 3DKSA 3BCKA 1GTIA 3KIJA 1PA3A 2A2RA 3QCPA 4I2UA 3FHKA 5B7CA 3TOUA 4XCSA 5HR1A 3D5JA 2QKEA 2PMTA 2DJ1A 1G7OA 4BVYB 4WF5A 4P3YB 5ECMB 4NHZA 3WGDA 3FZ5A 3VWVA 3F6DA 2OE3A 1X5DA 1J0FA 4KB3A 2VL2C 1B9YC 3F4TA 3HHVA 2M80A 4Q5FA 2AUVA 4D73A 4E8EA 1YY7A 1JZOA 2VAFA 4RUVA 4IHUA 2HRFA 1SKWB 4XS4B 4N0ZA 1T4ZA 1UA5A 4LA1A 1EP7A 4ECCA 2FWHA 16GSA 4V2LA 3QD9A 3L9UA 4KCAA 1YQ1A 4G0IA 1TRVA 2PN8A 1EV9A 5G1LA 3LEFA 5J40A 1A2JA 3ZYWA 1EP8A 2C0EA 2ZUPA 3ERWA 1WP0A 4ILFA 5IPHA 2X49A 4EF0A 4ECBA 1VF3A 5B8AA 1QQ2A 3QFBC 1K3OA 2DJ2A 4MJBA 4WXTA 4X0XA 2LV3A 4AJ6A 3CSIA 1Q98A 2X8CA 3CXGA 1B4QA 5A5HA 2DLXA 4W66A 4PQ1A 4HS1A 2IMFA 2F8FA 1KNGA 3HJPA 4F2IA 5KN1A 2C4JA 3WT2A 3DXBA 1ZYPA 1K3LA 1E6BA 2RUEA 13GSA 3TGZA 1X9WB 3RAZA 5CYYA 3ME8A 3IHGA 1A0FA 4BWSA 2IMKA 4WETA 1SL0B 1M2AA 4PQIA 3LGCA 5E59A 1GSUA 4IJIA 4TR1B 3F0IA 3HY2A 5A1NA 1LJRA 4K6XA 3WT1A 2IJYA 5IMVA 4N0VA 4CY6A 5IPGA 4V2NA 2F9SA 1WRYA 4AKHA 2K9FA 3F4RA 1V57A 2LQOA 2X8GA 2DKHA 4TKYA 2NBSA 1WPIA 4DSSA 3GL5A 12GSA 3EE2A 1B8XA 1VF4A 4QQ7A 5JCUA 2P5RA 2V6KA 4KGIA 2HT9A 2LSTA 5ID2B 4RI7A 2TRCP 1FOHA 3FR6A 2QA2A 2HRKA 2MMZA 2FD3A 1I5GA 2H71A 3GKNA 3FW2A 4KSOA 1TTZA 1XZOA 1FAAA 4MK3A 2VCVA 2ON5A 2OBIA 2CAQA 3D4MA 2YP6A 2C8UA 2GSRA 4JE1A 4KE3A 3HA9A 3GNJA 3FR9A 1T8EB 1TOFA 5AIVA 1MD3A 3GIXA 5ENUA 4O5UA 1SKSB 3Q19A 4FIWA 5J4YA 5G30A 2HFDA 1OC3A 1XIYA 3IPZA 5CO3A 2I4AA 3W8SA 3A2WA 3KTLA 5D9XA 1R26A 4PUAA 4NAXA 3KCMA 3VFIA 2YWOA 1DUGA 5F0GA 4MDCA 4BPYA 1OAZA 1GTBA 5D8IA 1S3DA 1XPVA 1ACVA 3P2AA 2L59A 4MZBA 1ZGNA 2GZZA 4WEYA 2CT6A 3DD3A 2K18A 2E7PA 4CHSA 1XWGA 1J08A 1SD8A 4A5PA 5IMCA 5DBQA 2HZEB 4IQ1A 1EEJA 3TU3B 2HSHA 1XVQA 4PUFC 1TDIA 1G7EA 2R0PA 2HSMB 3MNGA 4CW9A 4YKGA 2F3MA 2WFCA 2LJRA 1V2AA 4NV5A 2IIYA 4X4JA 4PURA 3VPQA 2IPAA 1TRWA 2HXKA 3ME7A 1EGRA 4HJ2A 5JCWA 3I69A 1JFUA 3M9JA 2IFQB 1BAYA 2R5GA 3EURA 1LU4A 1PX7A 5DALB 2VO4A 4K1FA 4KSMA 2L5LA 2X4AA 3DWVA 1PL1A 1TP9A 4MA9A 3VPTA 4JR6A 5ABRA 4NXIA 1R5PA 5FT3A 1T1VA 1OC9A 1VF1A 1R5AA 5BRTA 1YZXA 1O6JA 1GNEA 2WRTA 3ZITA 2EFCA 2FA8A 3UEMA 5G31A 1DE1A 3M9KA 3QDNA 2KP2A 2LNSA 3O3TA 1SK2A 1AQXA 5BMUB 3FK8A 4EIPA 3VI7A 4YH2A 1QUWA 2OT3A 1XW9A 1XWKA 2KOKA 4J2FA 1GULA 1V9WA 1XCCA 2GSTA 3A3TA 3ZIVA 1BYEA 1A0RP 2H76A 5IM9A 3P8WA 3ZIJA 3O76A 6GSWA 4N10A 4GXZA 3HJMA 3I6AA 2NDOA 3APOA 2CX4A 1MTCA 2CVBA 2OKAA 4LLRA 2WGRA 3DGQA 2YJHA 5G1KA 1K0DA 2YV9A 2C3TA 4O7HA 1NW2A 4JZQA 4YAVA 4GF0A 3IR4A 2PVQA 3E9JB 2TIRA 1LBKA 3L9SA 4HUAA 5AN1A 5D9WA 1PRXA 2G2QA 2VLVA 4V1Ag 1YF1A 3IE3A 3FKFA 2R37A 3D6IA 4HI7A 10GSA 2GDRA 1YEXA 4ML6A 5IMZA 2K8VA 2VM2A 3VWUA 3TRPA 3DRNA 4OD7A 2YJ7A 3IBHA 2CX3A 3W6GA 5EL8A 4IP6A 3UIWA 1K0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3A A;  3LWA A;  1GSD A;  3KM6 A;  4IEL A;  5DJL A;  4PNG A;  1E2Y A;  2EIO A;  4FYC A;  5F8B A;  4RQR A;  4QL9 A;  1XW5 A;  2R4V A;  4GTU A;  4TN8 A;  2K8S A;  3WGX A;  4KDU A;  5J41 A;  2HSN B;  3G9B A;  4OCF A;  4MH3 A;  4OFM A;  1UN2 A;  4G2E A;  4IGJ A;  2PUK C;  4DSQ A;  3OR5 A;  1XFL A;  1M9B A;  1EV4 A;  2PGT A;  2VUP A;  2F8A A;  5IMF A;  2H1D A;  4TXO A;  14GS A;  2JZT A;  2HNL A;  1VRS D;  3Q74 A;  3FYG A;  3KEB A;  3ZVJ D;  4TR3 A;  5DAK B;  4ZL9 A;  5GST A;  4BL7 A;  6GSY A;  2AJQ B;  3CTG A;  4KCE A;  3L9V A;  2N5B A;  5J5N A;  4N11 A;  1ZL9 A;  1FG4 A;  2VLT A;  2H0I A;  1ZCP A;  2E2G A;  4MZC A;  2DC5 A;  3KP9 A;  2H6Y A;  2IMD A;  4LL4 B;  1TK0 B;  4OWY A;  3HVV A;  3QFA C;  1TI3 A;  2WS2 A;  3MAK A;  4H86 A;  4FYB A;  4KDX A;  2XC2 A;  4K7N A;  1NHO A;  5IIZ A;  2EC4 A;  1F9M A;  1GSE A;  2JZS A;  1RQM A;  3TJF A;  3N5O A;  3GRX A;  2H74 A;  4EDZ A;  4EE0 A;  2LJK A;  2MYG A;  4N30 A;  1EOG A;  1YKA A;  1XOB A;  4K9Z A;  1JLW A;  4IBP A;  19GS A;  3LSZ A;  3I9V 2;  1OYJ A;  2FY6 A;  1OKD A;  1T3B A;  3ZZX A;  4HZ4 A;  5HFK A;  1W89 A;  1O8W A;  4EL1 A;  4JBB A;  1YEP A;  1K0O A;  5HR2 A;  5E4W A;  3S9F A;  1V98 A;  1EWX A;  3BD2 A;  2B5X A;  3RHB A;  1YKC A;  2GZP A;  1DE2 A;  4V1A p;  4D73 B;  2CAI A;  3V1W A;  5HR3 A;  4MJE A;  4TRX A;  2H01 A;  4G0K A;  1U88 A;  4K7O A;  4K0G A;  2C3N A;  5EVO A;  4DEJ A;  4NV2 A;  2RUF A;  1S3A A;  2FGX A;  4L5O A;  4ZBB A;  1SYX A;  5J4U A;  2XPE A;  4HDE A;  1FW1 A;  1K0M A;  2LRN A;  3H1N A;  1FHE A;  3EWL A;  3NOF A;  3IHQ A;  2L6D A;  1M7T A;  1KEB A;  2HLS A;  3D0Z A;  1AIU A;  3GKK A;  2LQQ A;  1ERT A;  2QGV A;  2L5O A;  2GT6 A;  1SYR A;  1ERW A;  5B8B A;  2H6X A;  3N9J A;  2GGT A;  3CYN A;  4GWR A;  2VL9 A;  2P31 A;  3TKR A;  3ZRD A;  2GLR A;  1ZYQ B;  2V2G A;  3HVX A;  1OC8 A;  3HD5 A;  2OAC A;  3KMN A;  3A2X A;  4IN0 A;  1BQ7 A;  3MSZ A;  1X5E A;  3IC4 A;  2QSI A;  5H5R A;  1GRX A;  1M0U A;  3H4K A;  3KXO A;  18GS A;  2PBJ A;  1TRU A;  3KP8 A;  4JU5 A;  1IYH A;  4MJA A;  4ZXG A;  2H6Z A;  2HSY A;  1OE8 A;  3GL3 A;  4RI6 A;  1S3C A;  3DVX A;  2C3Q A;  1AAZ A;  1AW9 A;  1H75 A;  3PR8 A;  1T4Y A;  3G7Y A;  3ZTL A;  4JR4 A;  5ECH B;  2H73 A;  2P5Q A;  4AF2 A;  3ZFL A;  3APQ A;  2AB6 A;  3CMI A;  3US3 A;  2DIY A;  2H0G A;  4BWQ A;  4TXV A;  3IXR A;  2C1Y A;  4YQM A;  2GQL A;  2A2S A;  2IME A;  3UBL A;  5ECP B;  2X64 A;  3AY8 A;  1SEN A;  2HI7 A;  2LEG A;  2GT5 A;  1I9D A;  4HU9 A;  3Q6O A;  3NIV A;  3HZ4 A;  2GQM A;  5ECR B;  4POL A;  3IRA A;  1FVJ A;  1XW6 A;  2EIR A;  3LXT A;  4DSS B;  1M2D A;  1EOH A;  5J9B A;  5JWR B;  2CVD A;  3LYK A;  3KMO A;  2V32 A;  3F3Q A;  1R7H A;  5IO2 A;  6GST A;  3F63 A;  1XOA A;  4FYU A;  2YZH A;  2HRK B;  1T7P B;  4PQH A;  2NVL A;  4F0B A;  2R6K A;  2LJA A;  2RII A;  2M46 A;  1A24 A;  3J7Y k;  4WBJ A;  5KEJ A;  3GH9 A;  2JU5 A;  2HZF A;  3SBC A;  5GAP D;  2O87 A;  3TKS A;  2GSQ A;  2GZY A;  1QXH A;  4GLT A;  5FHI A;  2KLX A;  1TRS A;  3IK9 A;  4X1U A;  4USS A;  3H79 A;  3A2V A;  3DEX A;  3TKP A;  6GSS A;  4G0L A;  2VD1 A;  1G6Y A;  2NPB A;  1C72 A;  4G9H A;  4J57 E;  3ZML A;  1GL8 A;  4TVE A;  2OAD A;  5IOX A;  3UVH A;  1SL1 B;  4PTS A;  1GP1 A;  5A5K A;  1WE0 A;  3GX8 A;  3FEU A;  1GSS A;  3L0H A;  1XWB A;  4L5L A;  5DQY A;  3UAR A;  3ZL5 A;  4L0U A;  4F03 A;  3WYW A;  3LYP A;  3TKQ A;  2REM A;  4ZB8 A;  2YWN A;  1ST9 A;  2LTK A;  1JHB A;  3TJB A;  1KTE A;  3IK7 A;  4HOJ A;  1ERU A;  5DVB A;  5HQP A;  2B7J A;  4MCU A;  2DMM A;  1Y25 A;  2KHP A;  1SK0 A;  2MMN A;  1N8J A;  3L78 A;  1GUM A;  4LMV A;  4MJC A;  4TR0 A;  3UBK A;  2PPT A;  3LXZ A;  3ED3 A;  2H75 A;  1GUK A;  1FVK A;  2B3S A;  1K0B A;  2X99 A;  2ZCT A;  2IWT A;  4HU7 A;  1U3A A;  4DVC A;  2WDU A;  2JL4 A;  1URM A;  4EC0 A;  6GSX A;  2TRX A;  1TU8 A;  3M0F A;  3GST A;  1PKW A;  2XPD A;  2VCW A;  1PQN A;  1RW1 A;  4F0C A;  3O6T A;  4AJ7 A;  3P90 A;  4XS1 A;  3TKS E;  1G6W A;  3TJG A;  4PXO A;  1OC9 B;  3KTB A;  5IMD A;  2CZ3 A;  1CQH A;  2IMI A;  3H93 A;  2RLI A;  4Z7X A;  3IC8 A;  3VLN A;  1EGO A;  1TU7 A;  3GYK A;  1U87 A;  4TW5 A;  1ZYE A;  4POK A;  4KA0 A;  1ZOF A;  3GHA A;  1A8L A;  4XRD A;  5CRD A;  4HQZ A;  2B5Y A;  2HRA A;  3HDC A;  4HZ2 A;  2O8V B;  2GQK A;  2AYT A;  3JCM L;  3SWL A;  2VLU A;  4IVF A;  3QPM A;  1PX6 A;  2L4C A;  5ECS A;  4QL7 A;  1Z9H A;  3TOT A;  1TKD B;  4ML1 A;  4K7I A;  2YPM A;  2DSA A;  3PGT A;  1U6T A;  5CAX A;  3VWX A;  3EC3 A;  4EVM A;  1YDK A;  2FLS A;  3C1S A;  2FHE A;  1A2M A;  3LOR A;  3EMP A;  4BVX A;  4LMW A;  4XRA A;  4MLY A;  2C80 A;  1SD9 A;  1ILO A;  2GTU A;  4PX1 A;  2YN1 A;  3P7X A;  1WWJ A;  1XBS A;  1B4P A;  2AAW A;  5G5E A;  4L0W A;  3TKS C;  2N5F A;  2FNO A;  11GS A;  4GQC A;  4KH7 A;  5LCZ A;  3TUE A;  2H8L A;  1YF0 A;  2YOI A;  2MBS A;  4MPF A;  4TOP A;  4JRR A;  2I3Y A;  5HFG A;  8GSS A;  1NM3 A;  3CSH A;  4OFT A;  3EVI A;  1A8Y A;  2B1K A;  4ZIL A;  1IYI A;  1F3B A;  1PL2 A;  5AGY A;  5JWO B;  5ECN B;  3GA4 A;  4V2M A;  3KZQ A;  3GKM A;  3FZ9 A;  2ES7 A;  2RM6 A;  1H4O A;  3E0U A;  1MDI A;  4WKW A;  3A5W A;  4F9Z A;  2ON7 A;  3GTU A;  1ML6 A;  3MDK A;  2VCZ A;  1FB6 A;  2AHE A;  4GCI A;  3WD6 A;  1GSQ A;  1MD4 A;  3K8N A;  2C0F A;  4AJ8 A;  2CZ2 A;  2MMA A;  2FWF A;  2H1A A;  2L6C A;  2RM5 A;  1JZW A;  2HE3 A;  3GX0 A;  4NMU A;  4GRF A;  1J9B A;  5LD0 A;  1R4W A;  2H19 A;  2PWJ A;  3QOU A;  2HYX A;  1HQO A;  4TXO B;  4GSN A;  2CVK A;  2K6V A;  3TJK A;  1DBY A;  2J23 A;  3BBY A;  2YWI A;  3VWW A;  2VOC A;  4ISD A;  4BL7 B;  3LG6 A;  1MDJ A;  3ZRE A;  1TI1 A;  4JED A;  4MAB A;  3PIN A;  4BVY A;  4YQU A;  5F06 A;  1AUC A;  2OA7 A;  3GH6 A;  5ELG A;  4DSR A;  3TB2 A;  1BX9 A;  3VK9 A;  1AXD A;  2XHF A;  4HEA 2;  3ISO A;  5COH A;  3I43 A;  1TXX A;  2I81 A;  3ZLP A;  1A2L A;  5GSS A;  2WZ9 A;  5D9T A;  1THO A;  3GKX A;  4XS4 A;  1DSB A;  2LNT A;  3TCO A;  5CRH A;  4K8M A;  4ZBD A;  4IKH A;  3FR3 A;  1M2B A;  4AGS A;  4HJM A;  3UVT A;  1GSF A;  2WCI A;  3DIE A;  4CDO A;  2OE1 A;  1O81 A;  2IL3 A;  3R3E A;  17GS A;  4GST A;  3DYR A;  1PN9 A;  3F3R A;  3G7I A;  2B5E A;  2JAD A;  4Q5N A;  1AQW A;  1KBN A;  2E0Q A;  1HNA A;  5INY A;  1GLP A;  1SJI A;  2FUG 2;  4O32 A;  4ZBA A;  3IAM 2;  3LJR A;  4PGT A;  1X5C A;  5ECK B;  3LQ7 A;  3RHC A;  2YNX A;  4KF9 A;  4ZL7 A;  2P0G A;  1OKT A;  4NPB A;  2MZC A;  2YZU A;  3F6F A;  1GTU A;  3EIN A;  5EY6 A;  4EKZ A;  3IAS 2;  1CQG A;  3W8J A;  4F82 A;  4I8B A;  1TK8 B;  2F51 A;  1GLQ A;  5CNW A;  1XVW A;  5ECI B;  5HR0 A;  5A4W A;  5LNK e;  4MF5 A;  1XXU A;  4NWY A;  2B1L A;  1BJX A;  4O92 A;  3IV4 A;  1EEM A;  2GVP A;  3DVW A;  2C0D A;  3UJ1 A;  2CA8 A;  5ECQ B;  4TR4 A;  3TDG A;  4I5Q A;  2VL3 A;  3ZMK A;  4I6X A;  1ZMA A;  1EZK A;  5H5Q A;  4Q5Q A;  1NSW A;  4TR1 A;  22GS A;  3DML A;  4WBR D;  2GSS A;  3CBU A;  3EU3 A;  3HZ8 A;  2OE0 A;  3BCI A;  4NHW A;  4POM A;  1PGT A;  3M8N A;  4IW9 A;  2YWM A;  4O5R A;  4ACS A;  3FRC A;  3ZFB A;  3CSJ A;  1M9A A;  4EXJ A;  3G7J A;  4ZB6 A;  4ZL8 A;  1QFN A;  1X9S B;  1NHY A;  1W4V A;  2R3X A;  3HVS A;  2PVO C;  4FH8 A;  3UMA A;  6GSV A;  3Q18 A;  5ID2 A;  1V40 A;  5KN3 A;  4XHM A;  3F9U A;  1BED A;  2BJX A;  5GAN D;  3QR6 A;  3WGE A;  4ZB9 A;  1AC1 A;  6GSU A;  3QAG A;  3RDW A;  1Z7P A;  2NTO A;  3CRU A;  4KDY A;  1SKR B;  1QGV A;  5C00 A;  4MMM A;  4YQV A;  5HFI A;  1Z3E A;  3GV1 A;  1PD2 1;  3GFK A;  3CRT A;  5D93 A;  5GZZ B;  2LRC A;  1HYU A;  1WJK A;  1TW9 A;  4OFN A;  3KGK A;  1G0T A;  4KAE A;  2AV4 A;  2O85 A;  2N5A A;  1ON4 A;  1WMJ A;  4EUY A;  5CRE A;  3IDV A;  2OJL A;  3TRX A;  3ERG A;  3QAV A;  4OO5 A;  2CQ9 A;  1Y6E A;  4EO3 A;  5D9V A;  3ZVJ A;  2VD0 A;  1HD2 A;  5CRG A;  1HNC A;  1PKZ A;  2A4V A;  3QMX A;  4PNF A;  3APS A;  2ALB A;  1O85 A;  3KH9 A;  5B6M A;  3HXS A;  1Z5Y E;  2FCH A;  3M3M A;  3VI5 A;  4IS0 A;  1B48 A;  1XWA A;  2O7K A;  5JCG A;  4ECI A;  3GUS A;  1Z7R A;  1GNW A;  7GSS A;  4FO5 A;  4WF4 A;  5G2Z A;  4X43 A;  5AIS A;  4ECJ A;  2DJK A;  2HZE A;  2YV7 A;  4G10 A;  2UZ8 A;  1GTA A;  4XS6 A;  4BA7 A;  2VCQ A;  2HSM A;  1ABA A;  5H5S A;  2H72 A;  5KN0 A;  1K0N A;  2H0H A;  4FQU A;  2XBQ A;  2JAC A;  5F05 A;  1XWC A;  2V1M A;  1YJ6 A;  4WR5 A;  1F37 A;  2O89 A;  5JWQ B;  4POB A;  2L57 A;  3VUR A;  1O8X A;  3PH9 A;  1PSQ A;  1HNB A;  2IFQ A;  1B9X C;  5DAL A;  2FWG A;  1O7U A;  3NZN A;  1FO5 A;  4HQS A;  1K3Y A;  4OMV A;  1GWC A;  3GSS A;  3BJ5 A;  2YAN A;  5IMA A;  5ECL B;  5L71 A;  3TRQ A;  1GSY A;  3CTF A;  5CRW A;  1WOU A;  3HCZ A;  5DCH A;  2I9H A;  3C73 A;  1VGL A;  2X8H A;  2JSZ A;  4MH2 A;  3FZA A;  1F2E A;  3C71 A;  5BMU A;  3EU4 A;  3FY7 A;  4IP1 A;  3UOM A;  2DJ0 A;  2HQT A;  3RPP A;  3D4T A;  1MDK A;  1F6M C;  3TJJ A;  1VF2 A;  3UL3 A;  2LS5 A;  3EYT A;  5A4U A;  4MF6 A;  4YAP A;  2KP1 A;  2VM1 A;  3F8U A;  1T00 A;  2V41 A;  1JZD A;  1A23 A;  2WJU A;  2ZNM A;  3IOS A;  1ZZY A;  3PPU A;  5IOW A;  4MF7 A;  2HRN A;  1Z6M A;  3GN3 A;  4KUN A;  2EIQ A;  5DCG A;  1THX A;  2DJ3 A;  2R2J A;  4KND A;  2IN3 A;  2WB9 A;  3L4N A;  5IO0 A;  2JSY A;  2VL2 A;  2QC7 A;  1M99 A;  3KD0 A;  2M72 A;  2JZR A;  4J56 E;  1OVN A;  1TK5 B;  2Z9S A;  3U5R E;  3M1G A;  2OBK A;  3C8E A;  4E8H A;  4XTS A;  2H1B A;  3QAW A;  3HKR A;  4K2D A;  3D21 A;  2H66 A;  1Q4J A;  1SU9 A;  3HYP A;  5G5F A;  9GSS A;  5CP1 A;  1UC7 A;  1RK4 A;  5ELA A;  1QK8 A;  1SJZ A;  3RBT A;  4I2T A;  4KW6 A;  4GQF A;  5ECO B;  2V6O A;  4MPG A;  4ZIJ A;  2D2Z A;  5EPF A;  5FWG A;  1UVZ A;  4KX4 A;  1SJ6 A;  4EDY A;  3E3E A;  2H70 A;  2KUC A;  1SL2 B;  3RPN A;  1X9M B;  2E2M A;  3GMF A;  4K0N A;  2LRT A;  1SK1 A;  3H8Q A;  3J7Y b;  1ERV A;  2DML A;  2J9H A;  1Z6N A;  4BVX B;  4L8E A;  1N2A A;  3BOA A;  5B6N A;  1GUH A;  2YCD A;  1AQV A;  4OCE A;  2DIZ A;  4XIH A;  4WR4 A;  2FWE A;  20GS A;  5KN2 A;  2I1U A;  5AIX A;  4MZW A;  3EMX A;  3C7M A;  1MEK A;  1USB A;  2B7K A;  4ULX A;  1OE7 A;  2B6M A;  5D96 A;  2GS3 A;  5A4V A;  3KJY A;  4MP4 A;  2WUL A;  2LKU A;  1X0R A;  2MMO A;  5DDL A;  1U3I A;  5J3R A;  1GH2 A;  1JZR A;  4OO4 A;  2C0G A;  4G19 A;  2MBT A;  3KH7 A;  2VCX A;  3MWH A;  2H30 A;  1V58 A;  5DAK A;  1TJD A;  3IA1 A;  3GUR A;  2BTO T;  2XBI A;  3LFL A;  1WIK A;  2VIM A;  1FOV A;  5IQY A;  3D22 A;  4GSS A;  1K0A A;  2PU9 C;  3F4S A;  4I97 A;  4IJ3 A;  3C1R A;  4Q5R A;  3R2Q A;  5F07 A;  3FZ4 A;  2H1G A;  2FA4 A;  1JLV A;  5D73 A;  1FB0 A;  3GTU B;  4ID0 A;  4IQA A;  2L4Q A;  1BG5 A;  2BMX A;  4LL1 B;  3UAP A;  2G0F A;  5DQS A;  1PMT A;  1O73 A;  4RQX A;  5C04 A;  3U6V A;  3HJO A;  5DJM A;  2DBC A;  1QMV A;  2PER A;  5J9C A;  2VCT A;  2CV4 A;  3ERF A;  2LUS A;  2DJJ A;  3DKS A;  3BCK A;  1GTI A;  3KIJ A;  1PA3 A;  2A2R A;  3QCP A;  4I2U A;  3FHK A;  5B7C A;  3TOU A;  4XCS A;  5HR1 A;  3D5J A;  2QKE A;  2PMT A;  2DJ1 A;  1G7O A;  4BVY B;  4WF5 A;  4P3Y B;  5ECM B;  4NHZ A;  3WGD A;  3FZ5 A;  3VWV A;  3F6D A;  2OE3 A;  1X5D A;  1J0F A;  4KB3 A;  2VL2 C;  1B9Y C;  3F4T A;  3HHV A;  2M80 A;  4Q5F A;  2AUV A;  4D73 A;  4E8E A;  1YY7 A;  1JZO A;  2VAF A;  4RUV A;  4IHU A;  2HRF A;  1SKW B;  4XS4 B;  4N0Z A;  1T4Z A;  1UA5 A;  4LA1 A;  1EP7 A;  4ECC A;  2FWH A;  16GS A;  4V2L A;  3QD9 A;  3L9U A;  4KCA A;  1YQ1 A;  4G0I A;  1TRV A;  2PN8 A;  1EV9 A;  5G1L A;  3LEF A;  1A2J A;  3ZYW A;  1EP8 A;  2C0E A;  2ZUP A;  3ERW A;  1WP0 A;  4ILF A;  5IPH A;  4EF0 A;  4ECB A;  1VF3 A;  5B8A A;  1QQ2 A;  3QFB C;  1K3O A;  2DJ2 A;  4MJB A;  4WXT A;  4X0X A;  2LV3 A;  4AJ6 A;  3CSI A;  1Q98 A;  2X8C A;  3CXG A;  1B4Q A;  2DLX A;  4PQ1 A;  4HS1 A;  2IMF A;  2F8F A;  1KNG A;  3HJP A;  4F2I A;  5KN1 A;  2C4J A;  3WT2 A;  3DXB A;  1K3L A;  1E6B A;  2RUE A;  13GS A;  3TGZ A;  1X9W B;  3RAZ A;  5CYY A;  3ME8 A;  4BWS A;  1A0F A;  2IMK A;  4WET A;  1SL0 B;  1M2A A;  4PQI A;  3LGC A;  5E59 A;  1GSU A;  4IJI A;  4TR1 B;  3F0I A;  3HY2 A;  1LJR A;  4K6X A;  3WT1 A;  2IJY A;  5IMV A;  4N0V A;  5IPG A;  4V2N A;  2F9S A;  1WRY A;  2K9F A;  3F4R A;  1V57 A;  2LQO A;  2X8G A;  4TKY A;  2NBS A;  1WPI A;  4DSS A;  3GL5 A;  12GS A;  3EE2 A;  1B8X A;  1VF4 A;  4QQ7 A;  5JCU A;  2P5R A;  2V6K A;  4KGI A;  2HT9 A;  2LST A;  5ID2 B;  4RI7 A;  2TRC P;  3FR6 A;  2HRK A;  2MMZ A;  2FD3 A;  1I5G A;  2H71 A;  3GKN A;  3FW2 A;  4KSO A;  1TTZ A;  1XZO A;  1FAA A;  4MK3 A;  2VCV A;  2ON5 A;  2OBI A;  2CAQ A;  3D4M A;  2YP6 A;  2C8U A;  4JE1 A;  2GSR A;  4KE3 A;  3HA9 A;  3GNJ A;  3FR9 A;  1T8E B;  1TOF A;  5AIV A;  1MD3 A;  3GIX A;  5ENU A;  1SKS B;  3Q19 A;  4FIW A;  5G30 A;  2HFD A;  1OC3 A;  1XIY A;  3IPZ A;  5CO3 A;  2I4A A;  3W8S A;  3A2W A;  3KTL A;  5D9X A;  1R26 A;  4PUA A;  4NAX A;  3KCM A;  3VFI A;  2YWO A;  1DUG A;  5F0G A;  4MDC A;  4BPY A;  1OAZ A;  1GTB A;  5D8I A;  1S3D A;  1XPV A;  1ACV A;  3P2A A;  2L59 A;  4MZB A;  1ZGN A;  2GZZ A;  4WEY A;  2CT6 A;  3DD3 A;  2K18 A;  2E7P A;  4CHS A;  1XWG A;  1J08 A;  1SD8 A;  5IMC A;  5DBQ A;  2HZE B;  4IQ1 A;  1EEJ A;  2HSH A;  1XVQ A;  4PUF C;  1TDI A;  1G7E A;  2HSM B;  3MNG A;  4CW9 A;  2F3M A;  2WFC A;  2LJR A;  1V2A A;  4NV5 A;  2IIY A;  4PUR A;  3VPQ A;  2IPA A;  1TRW A;  2HXK A;  3ME7 A;  1EGR A;  4HJ2 A;  5JCW A;  3I69 A;  1JFU A;  3M9J A;  2IFQ B;  1BAY A;  2R5G A;  3EUR A;  1LU4 A;  1PX7 A;  5DAL B;  2VO4 A;  4K1F A;  4KSM A;  2L5L A;  3DWV A;  1PL1 A;  1TP9 A;  4MA9 A;  3VPT A;  4JR6 A;  5ABR A;  4NXI A;  1R5P A;  5FT3 A;  1T1V A;  1OC9 A;  1VF1 A;  1R5A A;  1YZX A;  1O6J A;  1GNE A;  2WRT A;  3ZIT A;  2FA8 A;  3UEM A;  5G31 A;  1DE1 A;  3M9K A;  3QDN A;  2KP2 A;  2LNS A;  3O3T A;  1SK2 A;  1AQX A;  3FK8 A;  3VI7 A;  4YH2 A;  1QUW A;  1XW9 A;  1XWK A;  2KOK A;  4J2F A;  1GUL A;  1V9W A;  1XCC A;  2GST A;  3A3T A;  3ZIV A;  1BYE A;  1A0R P;  2H76 A;  5IM9 A;  3P8W A;  3ZIJ A;  3O76 A;  6GSW A;  4N10 A;  4GXZ A;  3HJM A;  3I6A A;  2NDO A;  3APO A;  2CX4 A;  1MTC A;  2CVB A;  2OKA A;  4LLR A;  2WGR A;  3DGQ A;  2YJH A;  5G1K A;  1K0D A;  2YV9 A;  2C3T A;  4O7H A;  1NW2 A;  4JZQ A;  4YAV A;  4GF0 A;  3IR4 A;  2PVQ A;  3E9J B;  2TIR A;  1LBK A;  3L9S A;  4HUA A;  5AN1 A;  5D9W A;  1PRX A;  2G2Q A;  2VLV A;  4V1A g;  1YF1 A;  3IE3 A;  3FKF A;  2R37 A;  3D6I A;  4HI7 A;  10GS A;  2GDR A;  1YEX A;  4ML6 A;  5IMZ A;  2K8V A;  2VM2 A;  3VWU A;  3TRP A;  3DRN A;  4OD7 A;  2YJ7 A;  3IBH A;  2CX3 A;  3W6G A;  5EL8 A;  4IP6 A;  3UIW A;  1K0C A; 
#chains in the Genus database with same CATH topology
 1F3A A;  3LWA A;  1GSD A;  5KOW A;  3KM6 A;  4IEL A;  5DJL A;  4PNG A;  1E2Y A;  2EIO A;  4FYC A;  5F8B A;  4RQR A;  4QL9 A;  1XW5 A;  2R4V A;  4GTU A;  4TN8 A;  2K8S A;  3WGX A;  4KDU A;  5J41 A;  2HSN B;  3G9B A;  4OCF A;  4N3Z A;  4MH3 A;  4OFM A;  1UN2 A;  4G2E A;  4IGJ A;  2PUK C;  4DSQ A;  3OR5 A;  2VKZ G;  1XFL A;  1M9B A;  1EV4 A;  2PGT A;  2VUP A;  2F8A A;  5IMF A;  2H1D A;  1SVM A;  4TXO A;  14GS A;  2JZT A;  2HNL A;  1VRS D;  3Q74 A;  3FYG A;  3KEB A;  3ZVJ D;  4TR3 A;  5DAK B;  4ZL9 A;  3LW9 A;  5GST A;  4BL7 A;  6GSY A;  2AJQ B;  3CTG A;  4KCE A;  4ZB7 A;  3L9V A;  2N5B A;  5J5N A;  4N11 A;  1ZL9 A;  1S4B P;  1FG4 A;  2VLT A;  2H0I A;  1ZCP A;  2E2G A;  4MZC A;  2DC5 A;  3KP9 A;  2H6Y A;  2IMD A;  4LL4 B;  5J4V A;  1TK0 B;  4OWY A;  3HVV A;  3QFA C;  2O5V A;  1TI3 A;  2WS2 A;  2WVX B;  3MAK A;  4H86 A;  4FYB A;  4KDX A;  2XC2 A;  4K7N A;  1NHO A;  5IIZ A;  2EC4 A;  1F9M A;  1GSE A;  2JZS A;  1RQM A;  3TJF A;  3N5O A;  3GRX A;  2H74 A;  4EDZ A;  4EE0 A;  2LJK A;  2MYG A;  4N30 A;  1EOG A;  1YKA A;  1XOB A;  4K9Z A;  1JLW A;  4IBP A;  19GS A;  3LSZ A;  3I9V 2;  1OYJ A;  2FY6 A;  1OKD A;  1T3B A;  3ZZX A;  4HZ4 A;  5HFK A;  1W89 A;  1O8W A;  4EL1 A;  4JBB A;  1YEP A;  1K0O A;  5HR2 A;  5E4W A;  3S9F A;  1V98 A;  1EWX A;  3BD2 A;  2B5X A;  3RHB A;  1YKC A;  2GZP A;  1DE2 A;  2WW1 A;  4V1A p;  4D73 B;  2CAI A;  3V1W A;  5HR3 A;  4MJE A;  4TRX A;  2H01 A;  4G0K A;  1U88 A;  4K7O A;  4K0G A;  2C3N A;  5EVO A;  4DEJ A;  4NV2 A;  2RUF A;  1S3A A;  2FGX A;  4L5O A;  4ZBB A;  1SYX A;  5J4U A;  2XPE A;  5J47 A;  4HDE A;  1FW1 A;  1K0M A;  2LRN A;  3H1N A;  1FHE A;  3EWL A;  3NOF A;  3IHQ A;  2L6D A;  1M7T A;  1KEB A;  2HLS A;  3D0Z A;  2EFE A;  1AIU A;  3GKK A;  2LQQ A;  1ERT A;  2QGV A;  2L5O A;  2GT6 A;  1SYR A;  1ERW A;  5B8B A;  2H6X A;  3N9J A;  2GGT A;  3CYN A;  4GWR A;  2VL9 A;  2P31 A;  3TKR A;  3ZRD A;  2GLR A;  1ZYQ B;  2V2G A;  3HVX A;  1OC8 A;  3HD5 A;  2OAC A;  3KMN A;  3A2X A;  5A5H B;  4IN0 A;  1BQ7 A;  3MSZ A;  1X5E A;  3IC4 A;  2QSI A;  5H5R A;  1GRX A;  1M0U A;  3H4K A;  3KXO A;  18GS A;  2PBJ A;  1TRU A;  3KP8 A;  4JU5 A;  1IYH A;  4MJA A;  4ZXG A;  2H6Z A;  2HSY A;  1OE8 A;  3GL3 A;  4RI6 A;  1S3C A;  3DVX A;  2C3Q A;  2A4H A;  1AAZ A;  1AW9 A;  1H75 A;  3PR8 A;  1T4Y A;  3G7Y A;  3ZTL A;  4JR4 A;  1ZYN A;  5ECH B;  2H73 A;  3A5I A;  2P5Q A;  4AF2 A;  3ZFL A;  3APQ A;  2AB6 A;  3CMI A;  3US3 A;  2DIY A;  2H0G A;  4BWQ A;  4TXV A;  3IXR A;  2C1Y A;  4YQM A;  2GQL A;  2A2S A;  2IME A;  5A1N B;  3UBL A;  5ECP B;  2X64 A;  3AY8 A;  1SEN A;  2HI7 A;  2LEG A;  2GT5 A;  1I9D A;  4HU9 A;  3Q6O A;  3NIV A;  3HZ4 A;  2GQM A;  5ECR B;  4POL A;  3IRA A;  1FVJ A;  1XW6 A;  2EIR A;  3LXT A;  1PN0 A;  4DSS B;  1M2D A;  1EOH A;  5J9B A;  5JWR B;  2CVD A;  3LYK A;  3KMO A;  4E68 A;  2V32 A;  3F3Q A;  1R7H A;  5IO2 A;  6GST A;  3CHX C;  3F63 A;  1XOA A;  4FYU A;  2YZH A;  2HRK B;  1T7P B;  4PQH A;  2NVL A;  4F0B A;  2R6K A;  2LJA A;  2RII A;  2M46 A;  1A24 A;  3J7Y k;  4WBJ A;  5KEJ A;  3GH9 A;  4O5Q A;  2JU5 A;  2HZF A;  3SBC A;  5GAP D;  2O87 A;  3TKS A;  2GSQ A;  2GZY A;  1QXH A;  4GLT A;  5FHI A;  2KLX A;  1TRS A;  3IK9 A;  4X1U A;  3EPT A;  4USS A;  3H79 A;  3A2V A;  3DEX A;  3TKP A;  6GSS A;  4G0L A;  2VD1 A;  1G6Y A;  2NPB A;  1C72 A;  4G9H A;  4J57 E;  3ZML A;  1GL8 A;  4TVE A;  2OAD A;  5IOX A;  3UVH A;  1SL1 B;  4PTS A;  1GP1 A;  5A5K A;  1WE0 A;  3GX8 A;  3FEU A;  1GSS A;  3L0H A;  1XWB A;  4L5L A;  5DQY A;  3UAR A;  3ZL5 A;  4L0U A;  4F03 A;  3WYW A;  3LYP A;  3TKQ A;  2REM A;  4ZB8 A;  2YWN A;  1ST9 A;  3FMW A;  2LTK A;  1JHB A;  3TJB A;  1KTE A;  3IK7 A;  4HOJ A;  1ERU A;  5DVB A;  5HQP A;  2B7J A;  4MCU A;  2DMM A;  1Y25 A;  2KHP A;  1SK0 A;  2MMN A;  1N8J A;  3L78 A;  1GUM A;  4LMV A;  4MJC A;  4TR0 A;  3UBK A;  2PPT A;  2UV8 G;  3LXZ A;  3ED3 A;  2H75 A;  1GUK A;  1FVK A;  2B3S A;  1K0B A;  2X99 A;  2ZCT A;  2IWT A;  4HU7 A;  1U3A A;  4DVC A;  2WDU A;  2JL4 A;  1URM A;  4EC0 A;  6GSX A;  4Z2R A;  2TRX A;  1TU8 A;  3M0F A;  1S3R A;  3GST A;  1PKW A;  2XPD A;  2VCW A;  1PQN A;  1RW1 A;  4F0C A;  3O6T A;  4AJ7 A;  3P90 A;  2R0C A;  4XS1 A;  3TKS E;  1G6W A;  3TJG A;  4PXO A;  1OC9 B;  3KTB A;  5IMD A;  2CZ3 A;  1CQH A;  2WVZ A;  2IMI A;  3H93 A;  2RLI A;  4Z7X A;  3IC8 A;  3VLN A;  1EGO A;  1TU7 A;  3GYK A;  1U87 A;  4TW5 A;  1ZYE A;  4POK A;  4KA0 A;  1ZOF A;  3GHA A;  1A8L A;  2O3E A;  4XRD A;  5CRD A;  4HQZ A;  2B5Y A;  2HRA A;  3HDC A;  4HZ2 A;  2O8V B;  2GQK A;  2AYT A;  3JCM L;  3SWL A;  2VLU A;  4IVF A;  3QPM A;  1PX6 A;  2L4C A;  5ECS A;  4QL7 A;  1Z9H A;  3TOT A;  1TKD B;  4ML1 A;  4K7I A;  2YPM A;  2DSA A;  3PGT A;  1U6T A;  5KOX A;  5CAX A;  3VWX A;  3EC3 A;  4EVM A;  4CY8 A;  1YDK A;  2FLS A;  3C1S A;  2FHE A;  1A2M A;  3LOR A;  3EMP A;  4BVX A;  4LMW A;  4XRA A;  4MLY A;  2C80 A;  1SD9 A;  1ILO A;  2GTU A;  4PX1 A;  2YN1 A;  3P7X A;  1WWJ A;  1XBS A;  1B4P A;  2AAW A;  5G5E A;  4L0W A;  3TKS C;  2N5F A;  2FNO A;  11GS A;  4GQC A;  4KH7 A;  5LCZ A;  3TUE A;  2H8L A;  1YF0 A;  2YOI A;  2MBS A;  4MPF A;  4TOP A;  4G01 A;  4JRR A;  2I3Y A;  5HFG A;  8GSS A;  1NM3 A;  3CSH A;  4OFT A;  3EVI A;  1A8Y A;  2B1K A;  4K5R A;  4ZIL A;  1IYI A;  1F3B A;  4QMK A;  1PL2 A;  5AGY A;  5JWO B;  5ECN B;  3GA4 A;  4V2M A;  3KZQ A;  3GKM A;  3FZ9 A;  2ES7 A;  2RM6 A;  1H4O A;  3E0U A;  1MDI A;  4WKW A;  3A5W A;  4F9Z A;  2ON7 A;  4Z2U A;  3GTU A;  1ML6 A;  3MDK A;  2VCZ A;  1FB6 A;  2AHE A;  4GCI A;  3WD6 A;  1GSQ A;  1MD4 A;  3K8N A;  2C0F A;  4AJ8 A;  2CZ2 A;  2MMA A;  2FWF A;  2H1A A;  2L6C A;  2RM5 A;  1JZW A;  2HE3 A;  4AKI A;  3GX0 A;  4NMU A;  4AKX B;  5A34 A;  4GRF A;  1J9B A;  5LD0 A;  1R4W A;  2H19 A;  2PWJ A;  3QOU A;  2HYX A;  1HQO A;  4TXO B;  4GSN A;  2CVK A;  2K6V A;  3TJK A;  1DBY A;  2J23 A;  3BBY A;  2YWI A;  3VWW A;  2VOC A;  4ISD A;  4BL7 B;  3LG6 A;  1MDJ A;  4GDF A;  1SVO A;  3ZRE A;  1TI1 A;  4JED A;  4MAB A;  3PIN A;  4BVY A;  4YQU A;  5F06 A;  1YEW C;  1AUC A;  2OA7 A;  3GH6 A;  5ELG A;  4DSR A;  3TB2 A;  1BX9 A;  3VK9 A;  1AXD A;  2XHF A;  4HEA 2;  3ISO A;  5COH A;  3I43 A;  1TXX A;  2I81 A;  3ZLP A;  1A2L A;  5GSS A;  2WZ9 A;  2EFD A;  5D9T A;  1THO A;  3GKX A;  4XS4 A;  1DSB A;  2LNT A;  3TCO A;  5CRH A;  4K8M A;  4ZBD A;  4IKH A;  3FR3 A;  1M2B A;  4AGS A;  4ICY A;  4HJM A;  2DKI A;  3UVT A;  1GSF A;  2WCI A;  1YVL A;  3DIE A;  4CDO A;  2OE1 A;  1O81 A;  2IL3 A;  3R3E A;  17GS A;  4GST A;  3DYR A;  1PN9 A;  3F3R A;  3G7I A;  2B5E A;  4PI2 C;  2JAD A;  4Q5N A;  1AQW A;  4AKG A;  4EIQ A;  1KBN A;  2E0Q A;  1HNA A;  5INY A;  1GLP A;  1SJI A;  2FUG 2;  4O32 A;  4ZBA A;  3IAM 2;  3LJR A;  4PGT A;  1X5C A;  5ECK B;  3LQ7 A;  3RHC A;  2YNX A;  4KF9 A;  4ZL7 A;  2P0G A;  1OKT A;  1Y1U A;  4NPB A;  2MZC A;  2YZU A;  3F6F A;  1GTU A;  3EIN A;  5EY6 A;  4EKZ A;  3IAS 2;  1CQG A;  3W8J A;  4F82 A;  4I8B A;  1TK8 B;  2F51 A;  1GLQ A;  5CNW A;  1XVW A;  5ECI B;  5HR0 A;  5A4W A;  5LNK e;  4MF5 A;  1XXU A;  4NWY A;  2B1L A;  1BJX A;  4O92 A;  3IV4 A;  1EEM A;  1M3I A;  2GVP A;  3DVW A;  2C0D A;  3UJ1 A;  2CA8 A;  5ECQ B;  3MYD A;  4TR4 A;  3TDG A;  4I5Q A;  2R0G A;  2VL3 A;  3ZMK A;  4I6X A;  1ZMA A;  1EZK A;  5H5Q A;  4Q5Q A;  1NSW A;  4TR1 A;  1BG1 A;  22GS A;  3DML A;  4WBR D;  2GSS A;  3CBU A;  3EU3 A;  3HZ8 A;  2OE0 A;  3BCI A;  4NHW A;  4POM A;  1PGT A;  3M8N A;  4IW9 A;  2YWM A;  4O5R A;  4ACS A;  3FRC A;  3ZFB A;  3CSJ A;  1M9A A;  4EXJ A;  3G7J A;  4ZB6 A;  4ZL8 A;  1QFN A;  1X9S B;  1NHY A;  1W4V A;  2R3X A;  3HVS A;  2PVO C;  4FH8 A;  3UMA A;  6GSV A;  3Q18 A;  5ID2 A;  1V40 A;  5KN3 A;  4XHM A;  3F9U A;  1BED A;  2BJX A;  5GAN D;  3QR6 A;  3WGE A;  4ZB9 A;  1M3J A;  1AC1 A;  4AI6 A;  6GSU A;  3QAG A;  3RDW A;  1Z7P A;  2NTO A;  3CRU A;  4KDY A;  1SKR B;  1QGV A;  5C00 A;  4MMM A;  4YQV A;  5HFI A;  1Z3E A;  3GV1 A;  1PD2 1;  3GFK A;  3CRT A;  5D93 A;  5GZZ B;  2LRC A;  1HYU A;  1WJK A;  1TW9 A;  4OFN A;  3KGK A;  1G0T A;  4KAE A;  2AV4 A;  2O85 A;  2N5A A;  1ON4 A;  1WMJ A;  4EUY A;  5CRE A;  3IDV A;  2OJL A;  3TRX A;  3ERG A;  3QAV A;  4OO5 A;  2CQ9 A;  1Y6E A;  4EO3 A;  5D9V A;  3ZVJ A;  2VD0 A;  1HD2 A;  5CRG A;  1HNC A;  1PKZ A;  2A4V A;  3QMX A;  4PNF A;  3APS A;  2ALB A;  1O85 A;  3KH9 A;  5B6M A;  3HXS A;  1Z5Y E;  2A2P A;  2FCH A;  2H1L A;  3M3M A;  3VI5 A;  4IS0 A;  1N25 A;  3HVN A;  1B48 A;  1XWA A;  2O7K A;  5JCG A;  4ECI A;  3GUS A;  1Z7R A;  1GNW A;  7GSS A;  4FO5 A;  4WF4 A;  5G2Z A;  4X43 A;  5AIS A;  4ECJ A;  2DJK A;  2HZE A;  2YV7 A;  4G10 A;  2EFH A;  2UZ8 A;  1GTA A;  4XS6 A;  4BA7 A;  2VCQ A;  2HSM A;  1ABA A;  5H5S A;  2H72 A;  5KN0 A;  1K0N A;  2H0H A;  4FQU A;  2XBQ A;  2JAC A;  5F05 A;  1XWC A;  2V1M A;  1YJ6 A;  2O36 A;  4WR5 A;  1F37 A;  2O89 A;  5JWQ B;  4POB A;  2L57 A;  3VUR A;  1O8X A;  3PH9 A;  1PSQ A;  1HNB A;  2IFQ A;  4MNN A;  1B9X C;  5DAL A;  2FWG A;  1O7U A;  3NZN A;  1FO5 A;  4HQS A;  1K3Y A;  4OMV A;  1GWC A;  3GSS A;  3BJ5 A;  2YAN A;  5IMA A;  5ECL B;  5L71 A;  1TXU A;  3TRQ A;  1GSY A;  3CTF A;  5CRW A;  1WOU A;  3HCZ A;  5DCH A;  2I9H A;  3C73 A;  1VGL A;  2X8H A;  2JSZ A;  4MH2 A;  3FZA A;  1F2E A;  3C71 A;  3CWG A;  5BMU A;  3EU4 A;  4K5S A;  3FY7 A;  4IP1 A;  3UOM A;  2DJ0 A;  2HQT A;  3RPP A;  3D4T A;  1MDK A;  1F6M C;  3TJJ A;  1VF2 A;  3UL3 A;  2LS5 A;  3HMJ G;  3EYT A;  5A4U A;  4MF6 A;  4YAP A;  2KP1 A;  2VM1 A;  3F8U A;  1T00 A;  2V41 A;  1JZD A;  1A23 A;  2WJU A;  2ZNM A;  3IOS A;  1ZZY A;  3PPU A;  5IOW A;  4MF7 A;  2HRN A;  1Z6M A;  3GN3 A;  4KUN A;  2EIQ A;  5DCG A;  1THX A;  2DJ3 A;  2R2J A;  4KND A;  2IN3 A;  2WB9 A;  3L4N A;  5IO0 A;  2JSY A;  3MIX A;  2VL2 A;  2QC7 A;  1M99 A;  3KD0 A;  2M72 A;  2JZR A;  4J56 E;  1OVN A;  1TK5 B;  2Z9S A;  3U5R E;  3M1G A;  2OBK A;  3C8E A;  4E8H A;  4XTS A;  2H1B A;  3QAW A;  3HKR A;  4K2D A;  3D21 A;  2H66 A;  1Q4J A;  1SU9 A;  3HYP A;  5G5F A;  4K2X A;  9GSS A;  5CP1 A;  1UC7 A;  1RK4 A;  5ELA A;  1QK8 A;  1SJZ A;  3RBT A;  4I2T A;  4KW6 A;  4GQF A;  5ECO B;  2V6O A;  4MPG A;  4ZIJ A;  2D2Z A;  5EPF A;  5FWG A;  1UVZ A;  4KX4 A;  1SJ6 A;  4EDY A;  3E3E A;  2H70 A;  2KUC A;  1SL2 B;  3RPN A;  1X9M B;  2E2M A;  3GMF A;  4K0N A;  4Z2T A;  2LRT A;  1SK1 A;  3H8Q A;  2QA1 A;  3J7Y b;  1ERV A;  2HSN A;  2DML A;  2WW2 A;  2J9H A;  1Z6N A;  4BVX B;  4L8E A;  1N2A A;  3BOA A;  5B6N A;  1GUH A;  2YCD A;  1AQV A;  4OCE A;  2DIZ A;  4XIH A;  4WR4 A;  2FWE A;  20GS A;  5KN2 A;  2WVY A;  2I1U A;  5AIX A;  4MZW A;  3EMX A;  3C7M A;  1MEK A;  1USB A;  2B7K A;  4ULX A;  1OE7 A;  2B6M A;  5D96 A;  2GS3 A;  5A4V A;  3KJY A;  4MP4 A;  2WUL A;  2LKU A;  1X0R A;  2MMO A;  5DDL A;  1U3I A;  5J3R A;  1GH2 A;  1JZR A;  4OO4 A;  2C0G A;  4G19 A;  2MBT A;  3KH7 A;  2VCX A;  1BF5 A;  3MWH A;  2H30 A;  1V58 A;  5DAK A;  1TJD A;  3IA1 A;  3GUR A;  2BTO T;  2XBI A;  3LFL A;  1WIK A;  2VIM A;  1FOV A;  5IQY A;  3D22 A;  4GSS A;  4YKF A;  1K0A A;  2PU9 C;  3F4S A;  4I97 A;  4IJ3 A;  3C1R A;  4Q5R A;  3R2Q A;  5F07 A;  3FZ4 A;  2H1G A;  2FA4 A;  1JLV A;  5D73 A;  1FB0 A;  3GTU B;  4ID0 A;  4IQA A;  2L4Q A;  1SVL A;  1BG5 A;  2WVX A;  2BMX A;  4LL1 B;  3UAP A;  2G0F A;  5DQS A;  1PMT A;  1O73 A;  4RQX A;  5C04 A;  3U6V A;  3HJO A;  5DJM A;  2DBC A;  1QMV A;  2PER A;  5J9C A;  5A34 B;  2VCT A;  2CV4 A;  3ERF A;  2LUS A;  2DJJ A;  3DKS A;  3BCK A;  1GTI A;  3KIJ A;  1PA3 A;  1PFO A;  2A2R A;  3QCP A;  4I2U A;  3FHK A;  5B7C A;  3TOU A;  4XCS A;  5HR1 A;  3D5J A;  2QKE A;  2PMT A;  2DJ1 A;  1G7O A;  4BVY B;  4WF5 A;  4P3Y B;  3RFR C;  5ECM B;  4NHZ A;  3WGD A;  3FZ5 A;  3VWV A;  3F6D A;  2OE3 A;  1X5D A;  3CQF A;  1J0F A;  4KB3 A;  2VL2 C;  1B9Y C;  3F4T A;  3HHV A;  2M80 A;  4Q5F A;  2AUV A;  4D73 A;  4E8E A;  1YY7 A;  1JZO A;  2VAF A;  4RUV A;  4IHU A;  2HRF A;  1SKW B;  4XS4 B;  4N0Z A;  1T4Z A;  1UA5 A;  4LA1 A;  1EP7 A;  4ECC A;  2FWH A;  16GS A;  4V2L A;  3QD9 A;  3L9U A;  4KCA A;  1YQ1 A;  4G0I A;  1TRV A;  2PN8 A;  1EV9 A;  5G1L A;  3LEF A;  5J40 A;  1A2J A;  3ZYW A;  1EP8 A;  2C0E A;  2ZUP A;  3ERW A;  1WP0 A;  4ILF A;  5IPH A;  2X49 A;  4EF0 A;  4ECB A;  1VF3 A;  5B8A A;  1QQ2 A;  3QFB C;  1K3O A;  2DJ2 A;  4MJB A;  4WXT A;  4X0X A;  2LV3 A;  4AJ6 A;  3CSI A;  1Q98 A;  2X8C A;  3CXG A;  1B4Q A;  5A5H A;  2DLX A;  4W66 A;  4PQ1 A;  4HS1 A;  2IMF A;  2F8F A;  1KNG A;  3HJP A;  4F2I A;  5KN1 A;  2C4J A;  3WT2 A;  3DXB A;  1ZYP A;  1K3L A;  1E6B A;  2RUE A;  13GS A;  3TGZ A;  1X9W B;  3RAZ A;  5CYY A;  3ME8 A;  3IHG A;  1A0F A;  4BWS A;  2IMK A;  4WET A;  2WW0 A;  1SL0 B;  1I1I P;  1M2A A;  4PQI A;  3LGC A;  5E59 A;  1GSU A;  4IJI A;  4TR1 B;  3F0I A;  3HY2 A;  5A1N A;  1LJR A;  4K6X A;  3WT1 A;  2IJY A;  5IMV A;  4N0V A;  4CY6 A;  5IPG A;  4V2N A;  2F9S A;  1WRY A;  4AKH A;  2K9F A;  3F4R A;  1V57 A;  2LQO A;  2X8G A;  2DKH A;  4TKY A;  2NBS A;  1WPI A;  4DSS A;  3GL5 A;  12GS A;  3EE2 A;  1B8X A;  1XG8 A;  1VF4 A;  4QQ7 A;  5JCU A;  2P5R A;  2V6K A;  4KGI A;  2HT9 A;  2LST A;  5ID2 B;  4RI7 A;  2TRC P;  1FOH A;  3FR6 A;  2QA2 A;  2HRK A;  2MMZ A;  2FD3 A;  1I5G A;  2H71 A;  3GKN A;  3FW2 A;  4KSO A;  1TTZ A;  1XZO A;  1FAA A;  4MK3 A;  2VCV A;  2ON5 A;  2OBI A;  2CAQ A;  3D4M A;  2YP6 A;  2C8U A;  2GSR A;  4JE1 A;  4KE3 A;  3HA9 A;  3GNJ A;  3FR9 A;  1T8E B;  1TOF A;  5AIV A;  1MD3 A;  3GIX A;  5ENU A;  4O5U A;  1SKS B;  3Q19 A;  4FIW A;  5J4Y A;  5G30 A;  2HFD A;  1OC3 A;  1XIY A;  3IPZ A;  5CO3 A;  2I4A A;  3W8S A;  3A2W A;  3KTL A;  5D9X A;  1R26 A;  4PUA A;  4NAX A;  2WZS A;  3KCM A;  3VFI A;  2YWO A;  1DUG A;  5F0G A;  4MDC A;  4BPY A;  1OAZ A;  1GTB A;  5D8I A;  1S3D A;  1XPV A;  1ACV A;  3P2A A;  2L59 A;  4MZB A;  1ZGN A;  2GZZ A;  4WEY A;  2CT6 A;  3DD3 A;  2K18 A;  4BIK A;  2E7P A;  4CHS A;  1XWG A;  1J08 A;  1SD8 A;  4A5P A;  5IMC A;  5DBQ A;  2HZE B;  4IQ1 A;  1EEJ A;  3TU3 B;  2HSH A;  1XVQ A;  4PUF C;  1TDI A;  1G7E A;  4FXY P;  2R0P A;  2HSM B;  3MNG A;  4CW9 A;  4YKG A;  3RGB C;  2F3M A;  2WFC A;  2LJR A;  1V2A A;  4NV5 A;  2IIY A;  4X4J A;  4PUR A;  3VPQ A;  2IPA A;  1TRW A;  2HXK A;  3ME7 A;  1EGR A;  4HJ2 A;  5JCW A;  3I69 A;  1JFU A;  3M9J A;  2IFQ B;  1BAY A;  2R5G A;  3EUR A;  1LU4 A;  1PX7 A;  5DAL B;  2VO4 A;  4K1F A;  4KSM A;  2L5L A;  2WW3 A;  2X4A A;  3DWV A;  1PL1 A;  1TP9 A;  4MA9 A;  3VPT A;  4JR6 A;  5ABR A;  4NXI A;  1R5P A;  5FT3 A;  1T1V A;  1OC9 A;  1VF1 A;  1R5A A;  5BRT A;  1YZX A;  1O6J A;  1GNE A;  2WRT A;  3ZIT A;  2EFC A;  2FA8 A;  3UEM A;  5G31 A;  1DE1 A;  3M9K A;  3QDN A;  2KP2 A;  4PI0 C;  2LNS A;  3O3T A;  1SK2 A;  1AQX A;  5BMU B;  3FK8 A;  4EIP A;  3VI7 A;  4YH2 A;  1QUW A;  2OT3 A;  1XW9 A;  1XWK A;  2KOK A;  4J2F A;  1GUL A;  1V9W A;  1XCC A;  2GST A;  3A3T A;  3ZIV A;  1BYE A;  1A0R P;  2H76 A;  5IM9 A;  3P8W A;  3ZIJ A;  3O76 A;  6GSW A;  4N10 A;  4GXZ A;  3HJM A;  3I6A A;  2NDO A;  3APO A;  4PHZ C;  2CX4 A;  1MTC A;  2CVB A;  2OKA A;  4LLR A;  2WGR A;  3DGQ A;  2YJH A;  5G1K A;  1K0D A;  2YV9 A;  2C3T A;  4O7H A;  1NW2 A;  4JZQ A;  4YAV A;  4GF0 A;  3IR4 A;  2PVQ A;  3E9J B;  2TIR A;  1LBK A;  3L9S A;  4HUA A;  5AN1 A;  5D9W A;  1PRX A;  2G2Q A;  2VLV A;  4V1A g;  1YF1 A;  3IE3 A;  3FKF A;  2R37 A;  4HSC X;  3D6I A;  4HI7 A;  10GS A;  2GDR A;  1YEX A;  4ML6 A;  5IMZ A;  2K8V A;  2VM2 A;  3VWU A;  3TRP A;  3DRN A;  4OD7 A;  2YJ7 A;  3IBH A;  2CX3 A;  3W6G A;  5EL8 A;  4IP6 A;  3UIW A;  1K0C A; 
#chains in the Genus database with same CATH homology
 1F3A A;  3LWA A;  1GSD A;  5KOW A;  3KM6 A;  4IEL A;  5DJL A;  4PNG A;  1E2Y A;  2EIO A;  4FYC A;  5F8B A;  4RQR A;  4QL9 A;  1XW5 A;  2R4V A;  4GTU A;  4TN8 A;  2K8S A;  3WGX A;  4KDU A;  5J41 A;  2HSN B;  3G9B A;  4OCF A;  4N3Z A;  4MH3 A;  4OFM A;  1UN2 A;  4G2E A;  4IGJ A;  2PUK C;  4DSQ A;  3OR5 A;  2VKZ G;  1XFL A;  1M9B A;  1EV4 A;  2PGT A;  2VUP A;  2F8A A;  5IMF A;  2H1D A;  1SVM A;  4TXO A;  14GS A;  2JZT A;  2HNL A;  1VRS D;  3Q74 A;  3FYG A;  3KEB A;  3ZVJ D;  4TR3 A;  5DAK B;  4ZL9 A;  3LW9 A;  5GST A;  4BL7 A;  6GSY A;  2AJQ B;  3CTG A;  4KCE A;  4ZB7 A;  3L9V A;  2N5B A;  5J5N A;  4N11 A;  1ZL9 A;  1FG4 A;  2VLT A;  2H0I A;  1ZCP A;  2E2G A;  4MZC A;  2DC5 A;  3KP9 A;  2H6Y A;  2IMD A;  4LL4 B;  5J4V A;  1TK0 B;  4OWY A;  3HVV A;  3QFA C;  2O5V A;  1TI3 A;  2WS2 A;  3MAK A;  4H86 A;  4FYB A;  4KDX A;  2XC2 A;  4K7N A;  1NHO A;  5IIZ A;  2EC4 A;  1F9M A;  1GSE A;  2JZS A;  1RQM A;  3TJF A;  3N5O A;  3GRX A;  2H74 A;  4EDZ A;  4EE0 A;  2LJK A;  2MYG A;  4N30 A;  1EOG A;  1YKA A;  1XOB A;  4K9Z A;  1JLW A;  4IBP A;  19GS A;  3LSZ A;  3I9V 2;  1OYJ A;  2FY6 A;  1OKD A;  1T3B A;  3ZZX A;  4HZ4 A;  5HFK A;  1W89 A;  1O8W A;  4EL1 A;  4JBB A;  1YEP A;  1K0O A;  5HR2 A;  5E4W A;  3S9F A;  1V98 A;  1EWX A;  3BD2 A;  2B5X A;  3RHB A;  1YKC A;  2GZP A;  1DE2 A;  4V1A p;  4D73 B;  2CAI A;  3V1W A;  5HR3 A;  4MJE A;  4TRX A;  2H01 A;  4G0K A;  1U88 A;  4K7O A;  4K0G A;  2C3N A;  5EVO A;  4DEJ A;  4NV2 A;  2RUF A;  1S3A A;  2FGX A;  4L5O A;  4ZBB A;  1SYX A;  5J4U A;  2XPE A;  5J47 A;  4HDE A;  1FW1 A;  1K0M A;  2LRN A;  3H1N A;  1FHE A;  3EWL A;  3NOF A;  3IHQ A;  2L6D A;  1M7T A;  1KEB A;  2HLS A;  3D0Z A;  2EFE A;  1AIU A;  3GKK A;  2LQQ A;  1ERT A;  2QGV A;  2L5O A;  2GT6 A;  1SYR A;  1ERW A;  5B8B A;  2H6X A;  3N9J A;  2GGT A;  3CYN A;  4GWR A;  2VL9 A;  2P31 A;  3TKR A;  3ZRD A;  2GLR A;  1ZYQ B;  2V2G A;  3HVX A;  1OC8 A;  3HD5 A;  2OAC A;  3KMN A;  3A2X A;  5A5H B;  4IN0 A;  1BQ7 A;  3MSZ A;  1X5E A;  3IC4 A;  2QSI A;  5H5R A;  1GRX A;  1M0U A;  3H4K A;  3KXO A;  18GS A;  2PBJ A;  1TRU A;  3KP8 A;  4JU5 A;  1IYH A;  4MJA A;  4ZXG A;  2H6Z A;  2HSY A;  1OE8 A;  3GL3 A;  4RI6 A;  1S3C A;  3DVX A;  2C3Q A;  2A4H A;  1AAZ A;  1AW9 A;  1H75 A;  3PR8 A;  1T4Y A;  3G7Y A;  3ZTL A;  4JR4 A;  1ZYN A;  5ECH B;  2H73 A;  3A5I A;  2P5Q A;  4AF2 A;  3ZFL A;  3APQ A;  2AB6 A;  3CMI A;  3US3 A;  2DIY A;  2H0G A;  4BWQ A;  4TXV A;  3IXR A;  2C1Y A;  4YQM A;  2GQL A;  2A2S A;  2IME A;  5A1N B;  3UBL A;  5ECP B;  2X64 A;  3AY8 A;  1SEN A;  2HI7 A;  2LEG A;  2GT5 A;  1I9D A;  4HU9 A;  3Q6O A;  3NIV A;  3HZ4 A;  2GQM A;  5ECR B;  4POL A;  3IRA A;  1FVJ A;  1XW6 A;  2EIR A;  3LXT A;  1PN0 A;  4DSS B;  1M2D A;  1EOH A;  5J9B A;  5JWR B;  2CVD A;  3LYK A;  3KMO A;  4E68 A;  2V32 A;  3F3Q A;  1R7H A;  5IO2 A;  6GST A;  3F63 A;  1XOA A;  4FYU A;  2YZH A;  2HRK B;  1T7P B;  4PQH A;  2NVL A;  4F0B A;  2R6K A;  2LJA A;  2RII A;  2M46 A;  1A24 A;  3J7Y k;  4WBJ A;  5KEJ A;  3GH9 A;  4O5Q A;  2JU5 A;  2HZF A;  3SBC A;  5GAP D;  2O87 A;  3TKS A;  2GSQ A;  2GZY A;  1QXH A;  4GLT A;  5FHI A;  2KLX A;  1TRS A;  3IK9 A;  4X1U A;  3EPT A;  4USS A;  3H79 A;  3A2V A;  3DEX A;  3TKP A;  6GSS A;  4G0L A;  2VD1 A;  1G6Y A;  2NPB A;  1C72 A;  4G9H A;  4J57 E;  3ZML A;  1GL8 A;  4TVE A;  2OAD A;  5IOX A;  3UVH A;  1SL1 B;  4PTS A;  1GP1 A;  5A5K A;  1WE0 A;  3GX8 A;  3FEU A;  1GSS A;  3L0H A;  1XWB A;  4L5L A;  5DQY A;  3UAR A;  3ZL5 A;  4L0U A;  4F03 A;  3WYW A;  3LYP A;  3TKQ A;  2REM A;  4ZB8 A;  2YWN A;  1ST9 A;  3FMW A;  2LTK A;  1JHB A;  3TJB A;  1KTE A;  3IK7 A;  4HOJ A;  1ERU A;  5DVB A;  5HQP A;  2B7J A;  4MCU A;  2DMM A;  1Y25 A;  2KHP A;  1SK0 A;  2MMN A;  1N8J A;  3L78 A;  1GUM A;  4LMV A;  4MJC A;  4TR0 A;  3UBK A;  2PPT A;  2UV8 G;  3LXZ A;  3ED3 A;  2H75 A;  1GUK A;  1FVK A;  2B3S A;  1K0B A;  2X99 A;  2ZCT A;  2IWT A;  4HU7 A;  1U3A A;  4DVC A;  2WDU A;  2JL4 A;  1URM A;  4EC0 A;  6GSX A;  4Z2R A;  2TRX A;  1TU8 A;  3M0F A;  3GST A;  1PKW A;  2XPD A;  2VCW A;  1PQN A;  1RW1 A;  4F0C A;  3O6T A;  4AJ7 A;  3P90 A;  2R0C A;  4XS1 A;  3TKS E;  1G6W A;  3TJG A;  4PXO A;  1OC9 B;  3KTB A;  5IMD A;  2CZ3 A;  1CQH A;  2IMI A;  3H93 A;  2RLI A;  4Z7X A;  3IC8 A;  3VLN A;  1EGO A;  1TU7 A;  3GYK A;  1U87 A;  4TW5 A;  1ZYE A;  4POK A;  4KA0 A;  1ZOF A;  3GHA A;  1A8L A;  4XRD A;  5CRD A;  4HQZ A;  2B5Y A;  2HRA A;  3HDC A;  4HZ2 A;  2O8V B;  2GQK A;  2AYT A;  3JCM L;  3SWL A;  2VLU A;  4IVF A;  3QPM A;  1PX6 A;  2L4C A;  5ECS A;  4QL7 A;  1Z9H A;  3TOT A;  1TKD B;  4ML1 A;  4K7I A;  2YPM A;  2DSA A;  3PGT A;  1U6T A;  5KOX A;  5CAX A;  3VWX A;  3EC3 A;  4EVM A;  4CY8 A;  1YDK A;  2FLS A;  3C1S A;  2FHE A;  1A2M A;  3LOR A;  3EMP A;  4BVX A;  4LMW A;  4XRA A;  4MLY A;  2C80 A;  1SD9 A;  1ILO A;  2GTU A;  4PX1 A;  2YN1 A;  3P7X A;  1WWJ A;  1XBS A;  1B4P A;  2AAW A;  5G5E A;  4L0W A;  3TKS C;  2N5F A;  2FNO A;  11GS A;  4GQC A;  4KH7 A;  5LCZ A;  3TUE A;  2H8L A;  1YF0 A;  2YOI A;  2MBS A;  4MPF A;  4TOP A;  4G01 A;  4JRR A;  2I3Y A;  5HFG A;  8GSS A;  1NM3 A;  3CSH A;  4OFT A;  3EVI A;  1A8Y A;  2B1K A;  4K5R A;  4ZIL A;  1IYI A;  1F3B A;  4QMK A;  1PL2 A;  5AGY A;  5JWO B;  5ECN B;  3GA4 A;  4V2M A;  3KZQ A;  3GKM A;  3FZ9 A;  2ES7 A;  2RM6 A;  1H4O A;  3E0U A;  1MDI A;  4WKW A;  3A5W A;  4F9Z A;  2ON7 A;  4Z2U A;  3GTU A;  1ML6 A;  3MDK A;  2VCZ A;  1FB6 A;  2AHE A;  4GCI A;  3WD6 A;  1GSQ A;  1MD4 A;  3K8N A;  2C0F A;  4AJ8 A;  2CZ2 A;  2MMA A;  2FWF A;  2H1A A;  2L6C A;  2RM5 A;  1JZW A;  2HE3 A;  4AKI A;  3GX0 A;  4NMU A;  4AKX B;  5A34 A;  4GRF A;  1J9B A;  5LD0 A;  1R4W A;  2H19 A;  2PWJ A;  3QOU A;  2HYX A;  1HQO A;  4TXO B;  4GSN A;  2CVK A;  2K6V A;  3TJK A;  1DBY A;  2J23 A;  3BBY A;  2YWI A;  3VWW A;  2VOC A;  4ISD A;  4BL7 B;  3LG6 A;  1MDJ A;  4GDF A;  1SVO A;  3ZRE A;  1TI1 A;  4JED A;  4MAB A;  3PIN A;  4BVY A;  4YQU A;  5F06 A;  1AUC A;  2OA7 A;  3GH6 A;  5ELG A;  4DSR A;  3TB2 A;  1BX9 A;  3VK9 A;  1AXD A;  2XHF A;  4HEA 2;  3ISO A;  5COH A;  3I43 A;  1TXX A;  2I81 A;  3ZLP A;  1A2L A;  5GSS A;  2WZ9 A;  2EFD A;  5D9T A;  1THO A;  3GKX A;  4XS4 A;  1DSB A;  2LNT A;  3TCO A;  5CRH A;  4K8M A;  4ZBD A;  4IKH A;  3FR3 A;  1M2B A;  4AGS A;  4ICY A;  4HJM A;  2DKI A;  3UVT A;  1GSF A;  2WCI A;  1YVL A;  3DIE A;  4CDO A;  2OE1 A;  1O81 A;  2IL3 A;  3R3E A;  17GS A;  4GST A;  3DYR A;  1PN9 A;  3F3R A;  3G7I A;  2B5E A;  2JAD A;  4Q5N A;  1AQW A;  4AKG A;  4EIQ A;  1KBN A;  2E0Q A;  1HNA A;  5INY A;  1GLP A;  1SJI A;  2FUG 2;  4O32 A;  4ZBA A;  3IAM 2;  3LJR A;  4PGT A;  1X5C A;  5ECK B;  3LQ7 A;  3RHC A;  2YNX A;  4KF9 A;  4ZL7 A;  2P0G A;  1OKT A;  1Y1U A;  4NPB A;  2MZC A;  2YZU A;  3F6F A;  1GTU A;  3EIN A;  5EY6 A;  4EKZ A;  3IAS 2;  1CQG A;  3W8J A;  4F82 A;  4I8B A;  1TK8 B;  2F51 A;  1GLQ A;  5CNW A;  1XVW A;  5ECI B;  5HR0 A;  5A4W A;  5LNK e;  4MF5 A;  1XXU A;  4NWY A;  2B1L A;  1BJX A;  4O92 A;  3IV4 A;  1EEM A;  2GVP A;  3DVW A;  2C0D A;  3UJ1 A;  2CA8 A;  5ECQ B;  3MYD A;  4TR4 A;  3TDG A;  4I5Q A;  2R0G A;  2VL3 A;  3ZMK A;  4I6X A;  1ZMA A;  1EZK A;  5H5Q A;  4Q5Q A;  1NSW A;  4TR1 A;  1BG1 A;  22GS A;  3DML A;  4WBR D;  2GSS A;  3CBU A;  3EU3 A;  3HZ8 A;  2OE0 A;  3BCI A;  4NHW A;  4POM A;  1PGT A;  3M8N A;  4IW9 A;  2YWM A;  4O5R A;  4ACS A;  3FRC A;  3ZFB A;  3CSJ A;  1M9A A;  4EXJ A;  3G7J A;  4ZB6 A;  4ZL8 A;  1QFN A;  1X9S B;  1NHY A;  1W4V A;  2R3X A;  3HVS A;  2PVO C;  4FH8 A;  3UMA A;  6GSV A;  3Q18 A;  5ID2 A;  1V40 A;  5KN3 A;  4XHM A;  3F9U A;  1BED A;  2BJX A;  5GAN D;  3QR6 A;  3WGE A;  4ZB9 A;  1AC1 A;  4AI6 A;  6GSU A;  3QAG A;  3RDW A;  1Z7P A;  2NTO A;  3CRU A;  4KDY A;  1SKR B;  1QGV A;  5C00 A;  4MMM A;  4YQV A;  5HFI A;  1Z3E A;  3GV1 A;  1PD2 1;  3GFK A;  3CRT A;  5D93 A;  5GZZ B;  2LRC A;  1HYU A;  1WJK A;  1TW9 A;  4OFN A;  3KGK A;  1G0T A;  4KAE A;  2AV4 A;  2O85 A;  2N5A A;  1ON4 A;  1WMJ A;  4EUY A;  5CRE A;  3IDV A;  2OJL A;  3TRX A;  3ERG A;  3QAV A;  4OO5 A;  2CQ9 A;  1Y6E A;  4EO3 A;  5D9V A;  3ZVJ A;  2VD0 A;  1HD2 A;  5CRG A;  1HNC A;  1PKZ A;  2A4V A;  3QMX A;  4PNF A;  3APS A;  2ALB A;  1O85 A;  3KH9 A;  5B6M A;  3HXS A;  1Z5Y E;  2A2P A;  2FCH A;  2H1L A;  3M3M A;  3VI5 A;  4IS0 A;  1N25 A;  1B48 A;  1XWA A;  2O7K A;  5JCG A;  4ECI A;  3GUS A;  1Z7R A;  1GNW A;  7GSS A;  4FO5 A;  4WF4 A;  5G2Z A;  4X43 A;  5AIS A;  4ECJ A;  2DJK A;  2HZE A;  2YV7 A;  4G10 A;  2EFH A;  2UZ8 A;  1GTA A;  4XS6 A;  4BA7 A;  2VCQ A;  2HSM A;  1ABA A;  5H5S A;  2H72 A;  5KN0 A;  1K0N A;  2H0H A;  4FQU A;  2XBQ A;  2JAC A;  5F05 A;  1XWC A;  2V1M A;  1YJ6 A;  4WR5 A;  1F37 A;  2O89 A;  5JWQ B;  4POB A;  2L57 A;  3VUR A;  1O8X A;  3PH9 A;  1PSQ A;  1HNB A;  2IFQ A;  4MNN A;  1B9X C;  5DAL A;  2FWG A;  1O7U A;  3NZN A;  1FO5 A;  4HQS A;  1K3Y A;  4OMV A;  1GWC A;  3GSS A;  3BJ5 A;  2YAN A;  5IMA A;  5ECL B;  5L71 A;  1TXU A;  3TRQ A;  1GSY A;  3CTF A;  5CRW A;  1WOU A;  3HCZ A;  5DCH A;  2I9H A;  3C73 A;  1VGL A;  2X8H A;  2JSZ A;  4MH2 A;  3FZA A;  1F2E A;  3C71 A;  3CWG A;  5BMU A;  3EU4 A;  4K5S A;  3FY7 A;  4IP1 A;  3UOM A;  2DJ0 A;  2HQT A;  3RPP A;  3D4T A;  1MDK A;  1F6M C;  3TJJ A;  1VF2 A;  3UL3 A;  2LS5 A;  3HMJ G;  3EYT A;  5A4U A;  4MF6 A;  4YAP A;  2KP1 A;  2VM1 A;  3F8U A;  1T00 A;  2V41 A;  1JZD A;  1A23 A;  2WJU A;  2ZNM A;  3IOS A;  1ZZY A;  3PPU A;  5IOW A;  4MF7 A;  2HRN A;  1Z6M A;  3GN3 A;  4KUN A;  2EIQ A;  5DCG A;  1THX A;  2DJ3 A;  2R2J A;  4KND A;  2IN3 A;  2WB9 A;  3L4N A;  5IO0 A;  2JSY A;  3MIX A;  2VL2 A;  2QC7 A;  1M99 A;  3KD0 A;  2M72 A;  2JZR A;  4J56 E;  1OVN A;  1TK5 B;  2Z9S A;  3U5R E;  3M1G A;  2OBK A;  3C8E A;  4E8H A;  4XTS A;  2H1B A;  3QAW A;  3HKR A;  4K2D A;  3D21 A;  2H66 A;  1Q4J A;  1SU9 A;  3HYP A;  5G5F A;  4K2X A;  9GSS A;  5CP1 A;  1UC7 A;  1RK4 A;  5ELA A;  1QK8 A;  1SJZ A;  3RBT A;  4I2T A;  4KW6 A;  4GQF A;  5ECO B;  2V6O A;  4MPG A;  4ZIJ A;  2D2Z A;  5EPF A;  5FWG A;  1UVZ A;  4KX4 A;  1SJ6 A;  4EDY A;  3E3E A;  2H70 A;  2KUC A;  1SL2 B;  3RPN A;  1X9M B;  2E2M A;  3GMF A;  4K0N A;  4Z2T A;  2LRT A;  1SK1 A;  3H8Q A;  2QA1 A;  3J7Y b;  1ERV A;  2HSN A;  2DML A;  2J9H A;  1Z6N A;  4BVX B;  4L8E A;  1N2A A;  3BOA A;  5B6N A;  1GUH A;  2YCD A;  1AQV A;  4OCE A;  2DIZ A;  4XIH A;  4WR4 A;  2FWE A;  20GS A;  5KN2 A;  2I1U A;  5AIX A;  4MZW A;  3EMX A;  3C7M A;  1MEK A;  1USB A;  2B7K A;  4ULX A;  1OE7 A;  2B6M A;  5D96 A;  2GS3 A;  5A4V A;  3KJY A;  4MP4 A;  2WUL A;  2LKU A;  1X0R A;  2MMO A;  5DDL A;  1U3I A;  5J3R A;  1GH2 A;  1JZR A;  4OO4 A;  2C0G A;  4G19 A;  2MBT A;  3KH7 A;  2VCX A;  1BF5 A;  3MWH A;  2H30 A;  1V58 A;  5DAK A;  1TJD A;  3IA1 A;  3GUR A;  2BTO T;  2XBI A;  3LFL A;  1WIK A;  2VIM A;  1FOV A;  5IQY A;  3D22 A;  4GSS A;  4YKF A;  1K0A A;  2PU9 C;  3F4S A;  4I97 A;  4IJ3 A;  3C1R A;  4Q5R A;  3R2Q A;  5F07 A;  3FZ4 A;  2H1G A;  2FA4 A;  1JLV A;  5D73 A;  1FB0 A;  3GTU B;  4ID0 A;  4IQA A;  2L4Q A;  1SVL A;  1BG5 A;  2BMX A;  4LL1 B;  3UAP A;  2G0F A;  5DQS A;  1PMT A;  1O73 A;  4RQX A;  5C04 A;  3U6V A;  3HJO A;  5DJM A;  2DBC A;  1QMV A;  2PER A;  5J9C A;  5A34 B;  2VCT A;  2CV4 A;  3ERF A;  2LUS A;  2DJJ A;  3DKS A;  3BCK A;  1GTI A;  3KIJ A;  1PA3 A;  2A2R A;  3QCP A;  4I2U A;  3FHK A;  5B7C A;  3TOU A;  4XCS A;  5HR1 A;  3D5J A;  2QKE A;  2PMT A;  2DJ1 A;  1G7O A;  4BVY B;  4WF5 A;  4P3Y B;  5ECM B;  4NHZ A;  3WGD A;  3FZ5 A;  3VWV A;  3F6D A;  2OE3 A;  1X5D A;  1J0F A;  4KB3 A;  2VL2 C;  1B9Y C;  3F4T A;  3HHV A;  2M80 A;  4Q5F A;  2AUV A;  4D73 A;  4E8E A;  1YY7 A;  1JZO A;  2VAF A;  4RUV A;  4IHU A;  2HRF A;  1SKW B;  4XS4 B;  4N0Z A;  1T4Z A;  1UA5 A;  4LA1 A;  1EP7 A;  4ECC A;  2FWH A;  16GS A;  4V2L A;  3QD9 A;  3L9U A;  4KCA A;  1YQ1 A;  4G0I A;  1TRV A;  2PN8 A;  1EV9 A;  5G1L A;  3LEF A;  5J40 A;  1A2J A;  3ZYW A;  1EP8 A;  2C0E A;  2ZUP A;  3ERW A;  1WP0 A;  4ILF A;  5IPH A;  2X49 A;  4EF0 A;  4ECB A;  1VF3 A;  5B8A A;  1QQ2 A;  3QFB C;  1K3O A;  2DJ2 A;  4MJB A;  4WXT A;  4X0X A;  2LV3 A;  4AJ6 A;  3CSI A;  1Q98 A;  2X8C A;  3CXG A;  1B4Q A;  5A5H A;  2DLX A;  4W66 A;  4PQ1 A;  4HS1 A;  2IMF A;  2F8F A;  1KNG A;  3HJP A;  4F2I A;  5KN1 A;  2C4J A;  3WT2 A;  3DXB A;  1ZYP A;  1K3L A;  1E6B A;  2RUE A;  13GS A;  3TGZ A;  1X9W B;  3RAZ A;  5CYY A;  3ME8 A;  3IHG A;  1A0F A;  4BWS A;  2IMK A;  4WET A;  1SL0 B;  1M2A A;  4PQI A;  3LGC A;  5E59 A;  1GSU A;  4IJI A;  4TR1 B;  3F0I A;  3HY2 A;  5A1N A;  1LJR A;  4K6X A;  3WT1 A;  2IJY A;  5IMV A;  4N0V A;  4CY6 A;  5IPG A;  4V2N A;  2F9S A;  1WRY A;  4AKH A;  2K9F A;  3F4R A;  1V57 A;  2LQO A;  2X8G A;  2DKH A;  4TKY A;  2NBS A;  1WPI A;  4DSS A;  3GL5 A;  12GS A;  3EE2 A;  1B8X A;  1VF4 A;  4QQ7 A;  5JCU A;  2P5R A;  2V6K A;  4KGI A;  2HT9 A;  2LST A;  5ID2 B;  4RI7 A;  2TRC P;  1FOH A;  3FR6 A;  2QA2 A;  2HRK A;  2MMZ A;  2FD3 A;  1I5G A;  2H71 A;  3GKN A;  3FW2 A;  4KSO A;  1TTZ A;  1XZO A;  1FAA A;  4MK3 A;  2VCV A;  2ON5 A;  2OBI A;  2CAQ A;  3D4M A;  2YP6 A;  2C8U A;  2GSR A;  4JE1 A;  4KE3 A;  3HA9 A;  3GNJ A;  3FR9 A;  1T8E B;  1TOF A;  5AIV A;  1MD3 A;  3GIX A;  5ENU A;  4O5U A;  1SKS B;  3Q19 A;  4FIW A;  5J4Y A;  5G30 A;  2HFD A;  1OC3 A;  1XIY A;  3IPZ A;  5CO3 A;  2I4A A;  3W8S A;  3A2W A;  3KTL A;  5D9X A;  1R26 A;  4PUA A;  4NAX A;  3KCM A;  3VFI A;  2YWO A;  1DUG A;  5F0G A;  4MDC A;  4BPY A;  1OAZ A;  1GTB A;  5D8I A;  1S3D A;  1XPV A;  1ACV A;  3P2A A;  2L59 A;  4MZB A;  1ZGN A;  2GZZ A;  4WEY A;  2CT6 A;  3DD3 A;  2K18 A;  2E7P A;  4CHS A;  1XWG A;  1J08 A;  1SD8 A;  4A5P A;  5IMC A;  5DBQ A;  2HZE B;  4IQ1 A;  1EEJ A;  3TU3 B;  2HSH A;  1XVQ A;  4PUF C;  1TDI A;  1G7E A;  2R0P A;  2HSM B;  3MNG A;  4CW9 A;  4YKG A;  2F3M A;  2WFC A;  2LJR A;  1V2A A;  4NV5 A;  2IIY A;  4X4J A;  4PUR A;  3VPQ A;  2IPA A;  1TRW A;  2HXK A;  3ME7 A;  1EGR A;  4HJ2 A;  5JCW A;  3I69 A;  1JFU A;  3M9J A;  2IFQ B;  1BAY A;  2R5G A;  3EUR A;  1LU4 A;  1PX7 A;  5DAL B;  2VO4 A;  4K1F A;  4KSM A;  2L5L A;  2X4A A;  3DWV A;  1PL1 A;  1TP9 A;  4MA9 A;  3VPT A;  4JR6 A;  5ABR A;  4NXI A;  1R5P A;  5FT3 A;  1T1V A;  1OC9 A;  1VF1 A;  1R5A A;  5BRT A;  1YZX A;  1O6J A;  1GNE A;  2WRT A;  3ZIT A;  2EFC A;  2FA8 A;  3UEM A;  5G31 A;  1DE1 A;  3M9K A;  3QDN A;  2KP2 A;  2LNS A;  3O3T A;  1SK2 A;  1AQX A;  5BMU B;  3FK8 A;  4EIP A;  3VI7 A;  4YH2 A;  1QUW A;  2OT3 A;  1XW9 A;  1XWK A;  2KOK A;  4J2F A;  1GUL A;  1V9W A;  1XCC A;  2GST A;  3A3T A;  3ZIV A;  1BYE A;  1A0R P;  2H76 A;  5IM9 A;  3P8W A;  3ZIJ A;  3O76 A;  6GSW A;  4N10 A;  4GXZ A;  3HJM A;  3I6A A;  2NDO A;  3APO A;  2CX4 A;  1MTC A;  2CVB A;  2OKA A;  4LLR A;  2WGR A;  3DGQ A;  2YJH A;  5G1K A;  1K0D A;  2YV9 A;  2C3T A;  4O7H A;  1NW2 A;  4JZQ A;  4YAV A;  4GF0 A;  3IR4 A;  2PVQ A;  3E9J B;  2TIR A;  1LBK A;  3L9S A;  4HUA A;  5AN1 A;  5D9W A;  1PRX A;  2G2Q A;  2VLV A;  4V1A g;  1YF1 A;  3IE3 A;  3FKF A;  2R37 A;  3D6I A;  4HI7 A;  10GS A;  2GDR A;  1YEX A;  4ML6 A;  5IMZ A;  2K8V A;  2VM2 A;  3VWU A;  3TRP A;  3DRN A;  4OD7 A;  2YJ7 A;  3IBH A;  2CX3 A;  3W6G A;  5EL8 A;  4IP6 A;  3UIW A;  1K0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...