1HNCA

Crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVFGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase(glutathione)
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1hncA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1hncA01
4BVXA 4K7NA 3A5WA 2VM1A 4FIWA 3KTLA 4Q5RA 4POKA 5ECPB 5A4UA 2LRTA 1XXUA 5KEJA 1AW9A 5JCWA 3DVXA 5CRHA 4KB3A 1XZOA 1WPIA 1Z7RA 1TU8A 2O87A 1U3AA 4LL4B 4TR1A 3ZFBA 2H0HA 1SJ6A 1EV4A 4LMVA 4NV2A 2B7JA 5IMVA 2MMAA 5JWQB 3C73A 1R7HA 3GMFA 2MMNA 3D0ZA 2L59A 2HLSA 3L9VA 1MD3A 3VFIA 1X5DA 4K9ZA 1X9SB 1V2AA 2XPEA 1PN9A 3EVIA 3FW2A 5IPHA 4EO3A 5G1KA 3UBKA 5J9CA 2REMA 4BVYA 3ZIJA 2EIRA 1U6TA 2CT6A 4ILFA 3HVVA 2DJ1A 2H70A 3HYPA 2FWGA 4KUNA 1TTZA 2JL4A 1YEXA 4ULXA 4F0CA 2MBTA 2C0FA 4ZBAA 4YH2A 3FZ5A 2DJ0A 4MPFA 1BEDA 3UIWA 3DEXA 4N0ZA 5ABRA 3F8UA 2HT9A 1GRXA 2HFDA 4KCEA 4KW6A 1QMVA 1BX9A 1ZL9A 4JR4A 2VCXA 2OKAA 3C1SA 4K2DA 3M8NA 4LA1A 5IOWA 3C71A 3AY8A 3QAWA 4MPGA 2VM2A 2DBCA 3FK8A 3IOSA 5ELGA 1JZOA 2QGVA 2HSMB 4AJ6A 4XHMA 4EUYA 3DVWA 2HZEB 2C1YA 2P0GA 4E8HA 3EMPA 3TUEA 2KLXA 2V1MA 5EPFA 3U5RE 5B8BA 4V1Ap 1EOHA 4BWSA 2H76A 2AJQB 1O85A 4PNFA 4TOPA 5ECKB 2F51A 4DSSB 2KHPA 3LEFA 4QL7A 2YJHA 2B5YA 1ZZYA 4PX1A 1JLWA 5IIZA 2CVKA 2XBQA 6GSYA 2YP6A 3RAZA 5ID2A 4G0KA 3LSZA 3Q6OA 1WWJA 3KJYA 4RI7A 2L57A 4WXTA 3L9SA 5BMUA 3EINA 3WT2A 3MDKA 5KN0A 3TJJA 2LJRA 2GZZA 2A4VA 1NSWA 1PSQA 5HQPA 2YWNA 5HFIA 2P31A 1SKWB 3KEBA 2WJUA 3O6TA 5INYA 1EGOA 2VL3A 1VF4A 2IFQB 1AQVA 2MZCA 1FHEA 2XPDA 2GSQA 3W8SA 1XBSA 3ZRDA 3P8WA 2B7KA 3FR3A 2P5QA 3G9BA 5D9XA 1BG5A 2PGTA 1GSQA 4KH7A 4EC0A 3UOMA 5HFGA 2C3QA 2JSZA 1ZYQB 4IJIA 1M2AA 1QQ2A 1X0RA 2I3YA 2PPTA 2RM5A 1GH2A 4K7IA 1XFLA 2EIQA 5AN1A 4FH8A 2R3XA 4NHWA 20GSA 2OJLA 1A2MA 2RLIA 5C04A 2VCWA 3S9FA 1OYJA 2IWTA 4TR3A 4GF0A 4GWRA 1K3OA 2D2ZA 1OKDA 1ZMAA 4GCIA 4H86A 3EYTA 3WD6A 2LQQA 3LXZA 3VURA 1I5GA 3H93A 2DJ3A 4ID0A 1B9YC 4PURA 5D9WA 2GTUA 4XRDA 1VF1A 3KP9A 3LYKA 2WGRA 4POLA 1B8XA 2AB6A 2VIMA 5AIXA 5LNKe 4HZ4A 3IA1A 2QC7A 3I9V2 5H5QA 3VWWA 1JLVA 1THXA 3GX0A 1WIKA 4ZB9A 4JBBA 2LEGA 1B4PA 3TJBA 2FGXA 4FYCA 2DIYA 4HEA2 1J9BA 4NV5A 2HQTA 1A0RP 1E2YA 3APOA 1VF3A 3WGDA 1EEMA 4OO4A 1TK8B 1XW9A 1G0TA 1MDKA 2YWOA 3VK9A 2PERA 1A2JA 2YJ7A 4HJMA 2JZTA 1V9WA 5DQYA 4X43A 2WRTA 3J7Yk 5COHA 1ZOFA 3EU3A 3IXRA 4ECCA 19GSA 3O3TA 4OCFA 2YV9A 1MD4A 3UEMA 1U87A 4G10A 4QQ7A 8GSSA 6GSTA 2I1UA 2KOKA 5FWGA 2FA8A 2V6OA 5DJLA 3KGKA 1U3IA 2ON7A 2IL3A 4X1UA 4PUAA 1GSEA 1N8JA 1PL1A 1BYEA 1X9MB 5D9TA 3EMXA 2H1BA 1HQOA 4K0GA 4ML6A 1B48A 1TRSA 4ML1A 3FKFA 1WJKA 3P7XA 2EIOA 4GLTA 3F63A 4J56E 2N5BA 4Q5FA 1SKRB 4O32A 1FW1A 4V1Ag 1EZKA 3GH6A 5F05A 3QAGA 3A2XA 4AJ7A 2LNSA 1HNCA 1ACVA 1O81A 4V2LA 4I2TA 4PGTA 4MABA 3TJGA 2A2RA 5C00A 4WR4A 4WF4A 4MF7A 3F9UA 2RIIA 4TXOA 1C72A 1MEKA 1Z6MA 3QMXA 3U6VA 2PUKC 1WP0A 1EEJA 1A23A 3M3MA 1J08A 5CREA 1TRVA 2DJKA 2O85A 1YJ6A 1KTEA 4CHSA 1ERWA 5ECSA 3VI5A 1T4YA 2C3NA 4D73A 4HOJA 5E4WA 4FO5A 4BWQA 5D73A 3M9JA 1UC7A 2LJAA 5DVBA 1NM3A 1T8EB 1A8YA 4KF9A 3TRQA 4Z7XA 3IV4A 1SJZA 4AF2A 3IPZA 5JWRB 1U88A 2DLXA 3IBHA 3PPUA 4XIHA 1JZRA 3MNGA 3DXBA 3F3QA 4GXZA 5CRWA 4FYBA 1A0FA 4KX4A 4BL7B 4OFMA 4IN0A 3EE2A 4J57E 3UMAA 4G19A 2L4QA 1IYIA 1OE8A 4O92A 1WE0A 4BPYA 2HSNB 1MDJA 2FD3A 3TKRA 1SL0B 4F9ZA 4TXVA 2M72A 2FHEA 4KCAA 5F07A 3ZREA 4WR5A 4GTUA 2YANA 2H75A 3UJ1A 4PXOA 4YAPA 1ERTA 3CTGA 3ZFLA 2RM6A 3WYWA 4AGSA 3KM6A 1O8WA 4F2IA 3US3A 4YQMA 4QL9A 2H01A 16GSA 2CAIA 4ECBA 2AAWA 3CXGA 3TB2A 1K0OA 2E2MA 1GNEA 17GSA 3Q74A 2HRFA 3GFKA 4LMWA 2YZUA 3KZQA 4KDYA 3N9JA 1W89A 3HJOA 2IMDA 2C4JA 5CAXA 5D93A 1Z5YE 1YZXA 2IIYA 4NWYA 1G7OA 1A8LA 2C8UA 2HRKB 2YCDA 2VL2C 2EC4A 3TRPA 2I4AA 4IP6A 3MWHA 3HZ4A 1M7TA 2H1GA 2XC2A 4PUFC 2FA4A 1SK2A 2H71A 5DALA 2BTOT 5DCHA 1HYUA 2IMIA 1ERUA 4JZQA 2X8GA 3GX8A 1GTUA 3HY2A 1RK4A 1YY7A 1YEPA 2VCTA 1SK1A 5IMZA 3TJKA 5ECNB 1OC9B 3BBYA 1USBA 3PH9A 4KSOA 2LJKA 1ST9A 3KP8A 3UARA 2HSYA 4WF5A 3D21A 3N5OA 1FOVA 1GLPA 4NAXA 3KH9A 2XBIA 3HXSA 2L5LA 3IE3A 2VOCA 1WRYA 2HYXA 4N11A 1TDIA 1ERVA 2E0QA 4USSA 1SENA 4ZB6A 3LJRA 2R5GA 1TK0B 2H30A 1N2AA 3HD5A 4WKWA 3ZIVA 4IP1A 3APSA 5DAKB 4ZBBA 1DUGA 1HNBA 2CQ9A 2YOIA 3TKSC 4BA7A 2NBSA 4XS4B 3DMLA 2V32A 3FZ4A 5LD0A 5JCUA 3IR4A 2YWMA 3DYRA 5ECIB 2GSTA 3E9JB 12GSA 5HR3A 4L8EA 1XWBA 1ILOA 1WOUA 1NW2A 1TKDB 2R4VA 5D96A 2X8CA 1XW6A 5E59A 1SK0A 3NZNA 4NPBA 3TDGA 4TR4A 4GQCA 3ZLPA 3I6AA 2RUEA 4OCEA 2IMKA 4ACSA 5GSTA 2C0GA 3TOTA 4HQSA 1XWGA 1VF2A 5CRDA 4L5LA 4EDZA 3A3TA 2L4CA 3HCZA 5IMAA 4PNGA 3F6FA 2E7PA 5DDLA 1M9BA 1ZYEA 2ALBA 2B3SA 3IK7A 10GSA 3GTUA 1M9AA 2ON5A 1UN2A 1MDIA 2LRNA 1B4QA 3UAPA 3GKKA 2V6KA 4F0BA 3CSHA 4ZL8A 1GUKA 4MDCA 1OVNA 1A2LA 2H19A 3M9KA 3ERFA 2DJJA 2O89A 3BD2A 1TRWA 1CQGA 1X5CA 3P90A 3LFLA 4GSTA 4Q5NA 1URMA 5IMCA 1OAZA 3LYPA 2H74A 2YN1A 3HDCA 1W4VA 2F8FA 3DGQA 1M2BA 3HVSA 3GKNA 2MBSA 1F37A 5ECRB 2FWEA 3GN3A 2ES7A 5J41A 2H6YA 3H8QA 2R6KA 5F8BA 1AQXA 2HNLA 3ZYWA 3ZZXA 4NXIA 3WGXA 3QCPA 1TXXA 2OE1A 3Q18A 1Z3EA 4EL1A 3HHVA 1K0BA 3LXTA 1Q98A 1Z6NA 2LS5A 4F82A 4HU7A 5IOXA 2CVBA 3KD0A 3TKPA 2OADA 3Q19A 5CRGA 3GSSA 2QKEA 1XCCA 4GSNA 1K3LA 11GSA 1Z9HA 1TJDA 3HJMA 3DKSA 3ZMLA 1AUCA 2WB9A 5IMFA 4YAVA 1QGVA 4MP4A 4O7HA 4I5QA 2GSSA 1CQHA 2FUG2 1OKTA 1BAYA 1FG4A 1XWCA 1UVZA 1YF0A 2WS2A 2VD0A 6GSWA 3JCML 3TOUA 3GA4A 2VAFA 2CX4A 3LWAA 3RPPA 2LRCA 4IVFA 5A5KA 3GL3A 1B9XC 1G7EA 3IRAA 1GNWA 2PMTA 2F3MA 1O6JA 4PTSA 1H75A 5J9BA 3MSZA 4CW9A 4MCUA 2E2GA 3ME7A 3CRUA 2JU5A 3IAM2 1GTAA 3IDVA 1K0MA 2NDOA 4JEDA 1EP8A 4MF6A 3ZVJD 4IQAA 3WGEA 1GUHA 4EVMA 1JHBA 4BVXB 1GSSA 1TRUA 3K8NA 2VLUA 5IMDA 3VWVA 4KDXA 1PD21 2VCZA 1XOBA 1YQ1A 2OA7A 2OE0A 1F9MA 2HSMA 2OBIA 4XRAA 2C3TA 1A24A 2HZEA 2XHFA 4ZL7A 4TR1B 4IQ1A 3F4TA 4MLYA 3FEUA 4HU9A 3A2VA 5D9VA 3PGTA 3L0HA 4DSSA 4K8MA 2GQMA 4YQVA 2ZUPA 3F3RA 3TKQA 2GLRA 4N0VA 4MF5A 2HXKA 5KN3A 2YV7A 1O8XA 3PR8A 2L6DA 2VD1A 3LG6A 2V2GA 3KXOA 1XW5A 3IK9A 1PGTA 2VCQA 6GSUA 2AHEA 2J23A 3ISOA 1SJIA 1K0CA 4HS1A 1XVWA 1T3BA 1O7UA 4BVYB 4XTSA 3C1RA 2GDRA 1AIUA 3VI7A 3TJFA 2N5AA 1EWXA 2AUVA 2H72A 4G9HA 2NVLA 1GTIA 3QPMA 1SD9A 4V2MA 3IHQA 2IFQA 1PKWA 5G30A 2KP2A 1FB6A 3GURA 2L5OA 3HKRA 3GSTA 3GKXA 4I6XA 2LSTA 1BQ7A 2O7KA 3FR6A 1SKSB 5AGYA 3CSIA 4PQIA 4XCSA 3D4MA 4EF0A 3RHBA 1XOAA 1R5PA 6GSVA 5EL8A 4EXJA 3O76A 14GSA 4OO5A 4MK3A 3ZTLA 5ELAA 1AC1A 1FO5A 2QSIA 2BMXA 3GL5A 2K18A 2R2JA 2K8VA 1FB0A 3CMIA 1TW9A 1M0UA 5DCGA 1TU7A 5L71A 5J3RA 1PA3A 4RQRA 1PMTA 2TRXA 1K0AA 1GSYA 3ZVJA 4IW9A 1J0FA 3TKSE 2LUSA 4POMA 1XPVA 3CSJA 2H8LA 4N10A 1TK5B 4MJAA 4TRXA 2PU9C 4PQHA 13GSA 2CV4A 2VLVA 1DBYA 5IO0A 2H0IA 4JE1A 4DSRA 1R26A 4V2NA 5ID2B 3QAVA 4XS6A 4ECIA 3VWUA 4WEYA 5DBQA 5B8AA 4ZIJA 2DIZA 1OC3A 3W8JA 3OR5A 4ZB8A 5GZZB 1GLQA 4GSSA 2H0GA 4GQFA 4LL1B 4CDOA 4IS0A 1SYRA 5A4WA 2B5XA 3SBCA 2H66A 3MAKA 2PWJA 4WETA 2FWFA 1TI1A 4KSMA 2LV3A 5CYYA 1JZDA 4RUVA 4IBPA 1V58A 3V1WA 5ECLB 2I9HA 5FT3A 2C80A 2M80A 4HZ2A 2MYGA 1VGLA 4HUAA 2FWHA 3FZAA 1PX6A 3I69A 2VUPA 1AQWA 3WT1A 4Q5QA 2VO4A 22GSA 1V40A 4RQXA 1GL8A 4OFNA 1Y25A 3VLNA 4YQUA 2ZNMA 5GSSA 4DVCA 3H1NA 4J2FA 3W6GA 4JR6A 2K9FA 1GUMA 5FHIA 3IC8A 2OE3A 2GS3A 2VL2A 5DJMA 4G2EA 5IO2A 3FYGA 3M1GA 4DEJA 4HDEA 1TOFA 2VCVA 2KUCA 3D4TA 1THOA 2CA8A 4GRFA 4MZBA 3GUSA 3RHCA 1ZCPA 2V41A 4N30A 3E3EA 3GHAA 4JU5A 1EV9A 3FHKA 5F06A 9GSSA 1G6WA 3FZ9A 1EOGA 5LCZA 5G1LA 4F03A 4K0NA 3GYKA 3TRXA 5J4UA 3CTFA 2DJ2A 4L0WA 2X99A 1S3AA 1K3YA 1KNGA 3EURA 5D8IA 1SL1B 3ERGA 4KGIA 4E8EA 4PQ1A 2JZSA 1H4OA 2DSAA 2MMZA 3TKSA 1M2DA 2X8HA 1FVKA 3NIVA 2HRAA 3PINA 2N5FA 3D6IA 3FR9A 2WCIA 4MH2A 4KA0A 2O8VB 1QFNA 3ME8A 2L6CA 5CNWA 4ECJA 2M46A 3QOUA 4BL7A 4P3YB 2H1DA 2GT6A 1NHOA 2AYTA 1I9DA 1OC8A 4IELA 3F6DA 1XVQA 1GSDA 5ECMB 2Z9SA 1G6YA 1T7PB 4TW5A 2YPMA 3GKMA 2B6MA 1Q4JA 2NPBA 1S3DA 3IAS2 4I2UA 3DIEA 2UZ8A 3KIJA 1SL2B 4WBRD 2AV4A 1LBKA 3R3EA 2DC5A 3DD3A 2WDUA 4HI7A 4WBJA 2JACA 2G0FA 3C7MA 5G2ZA 2IN3A 5IQYA 3HZ8A 1AXDA 4TXOB 3D22A 1T00A 1TP9A 2PVOC 3QFBC 3FRCA 1QXHA 3KMOA 3C8EA 5HR1A 3RDWA 1ABAA 1F3AA 2GSRA 2PN8A 3LGCA 3HJPA 2YZHA 3H79A 1GTBA 4D73B 2ZCTA 2H1AA 3D5JA 1LU4A 1SYXA 3F4SA 1K0DA 4RI6A 1YKCA 4MA9A 3ED3A 4MZWA 5EVOA 2IJYA 1HD2A 1ZGNA 2CVDA 1QK8A 3UVTA 2JZRA 3QD9A 4TKYA 1YDKA 4HQZA 3EC3A 1KEBA 1QUWA 6GSXA 3F4RA 3KCMA 5IPGA 3SWLA 1XWAA 2B5EA 2HRKA 1PQNA 2FLSA 2OBKA 3R2QA 2VL9A 3IC4A 2LNTA 2MMOA 3CRTA 1JFUA 3A2WA 2H73A 5ECHB 4TR0A 5EY6A 4POBA 3RPNA 2F9SA 4XS1A 1PX7A 4MH3A 18GSA 4DSQA 3TGZA 3G7JA 3E0UA 3GRXA 7GSSA 1OC9A 3NOFA 4L5OA 6GSSA 2A2SA 2WZ9A 3J7Yb 5DQSA 3QDNA 1UA5A 1FAAA 2I81A 2GQLA 4NHZA 3QFAC 2CX3A 2HRNA 3L78A 2GQKA 2IMFA 5ECQB 2PVQA 3LQ7A 2HE3A 2WFCA 1OE7A 2GT5A 2R37A 3GNJA 1R4WA 5GAND 3KTBA 2NTOA 4OD7A 1YKAA 1LJRA 2B1LA 3M0FA 4IKHA 3UL3A 3BOAA 2K6VA 4MJBA 2C0EA 2GZYA 4G0IA 5DAKA 1SU9A 4O5RA 5ENUA 1WMJA 2FCHA 3ERWA 1IYHA 5H5RA 4XS4A 4KNDA 1K0NA 4IGJA 3UVHA 4OFTA 4FYUA 3EU4A 2FNOA 1V98A 1GWCA 1M99A 4IJ3A 5AIVA 3VWXA 1XWKA 5J5NA 5CP1A 3P2AA 2BJXA 3APQA 1HNAA 5G5FA 1FVJA 1PL2A 1X5EA 3L4NA 4K1FA 2J9HA 5HR2A 1E6BA 4I97A 2C0DA 2IMEA 4X0XA 5DALB 2PBJA 3DWVA 4OWYA 3BCKA 1GSFA 4ZL9A 4EE0A 3CYNA 4AJ8A 1AAZA 1V57A 2DMMA 1ML6A 1T1VA 4IHUA 5AISA 2X64A 5KN1A 2B1KA 4ZILA 1PKZA 2HI7A 4TN8A 4G0LA 2P5RA 1F2EA 5B6NA 2TRCP 2CZ2A 4FQUA 3GIXA 1SD8A 5B6MA 3BJ5A 1PRXA 4HJ2A 1DE1A 2RUFA 1GULA 1T4ZA 3I43A 5F0GA 1TI3A 2WULA 3KH7A 2F8AA 1DSBA 4JRRA 4ZXGA 2HSHA 5G31A 1DE2A 1X9WB 5HR0A 1S3CA 4MJEA 1KBNA 4TVEA 4K6XA 4LLRA 2YWIA 4I8BA 3UBLA 2JADA 1Z7PA 3BCIA 2OACA 1MTCA 4NMUA 5KN2A 5G5EA 3VPQA 1NHYA 2CAQA 2H6XA 1Y6EA 4EKZA 5IM9A 5B7CA 1GSUA 2H6ZA 2JSYA 3FY7A 2LKUA 3ZITA 3TCOA 3HA9A 1R5AA 3DRNA 2DMLA 3QR6A 4ISDA 5CO3A 3EWLA 5JCGA 2VLTA 3RBTA 2YNXA 4K7OA 1XIYA 5ECOB 2LQOA 1RQMA 1BJXA 2CZ3A 3H4KA 2LTKA 3LORA 2GGTA 1JZWA 2KP1A 3CBUA 2G2QA 1YF1A 4KDUA 4MJCA 1EP7A 1ON4A 3GTUB 3GV1A 3GH9A 4OMVA 1O73A 1EGRA 1F3BA 3F0IA 5GAPD 3L9UA 1F6MC 2K8SA 5JWOB 3ZL5A 4MZCA 5H5SA 3KMNA 1GP1A 2IPAA 3VPTA 2GVPA 5HFKA 4MMMA 4KAEA 4ZBDA 2TIRA 4L0UA 2HZFA 1VRSD 2FY6A 3G7IA 2GZPA 4EDYA 4KE3A 5A4VA 3HVXA 3ZMKA 1RW1A 3G7YA
chains in the Genus database with same CATH superfamily
4BVXA 4K7NA 3A5WA 2VM1A 4FIWA 3KTLA 4Q5RA 4POKA 5ECPB 5A4UA 2LRTA 1XXUA 5KEJA 1AW9A 5JCWA 3DVXA 5CRHA 4KB3A 1XZOA 1WPIA 1Z7RA 1TU8A 2O87A 1U3AA 4LL4B 4TR1A 3ZFBA 2H0HA 1SJ6A 1EV4A 4LMVA 4NV2A 2B7JA 4AKGA 5IMVA 2MMAA 5JWQB 3C73A 1R7HA 3GMFA 2MMNA 3D0ZA 1BG1A 2L59A 2HLSA 3L9VA 1MD3A 3VFIA 1X5DA 4K9ZA 1X9SB 1V2AA 2XPEA 1PN9A 3EVIA 3FW2A 5IPHA 4EO3A 5G1KA 2H1LA 3UBKA 4AKHA 5J9CA 2REMA 4BVYA 3ZIJA 2EIRA 1U6TA 2CT6A 4ILFA 3HVVA 3HMJG 2DJ1A 2H70A 3HYPA 2FWGA 4KUNA 1TTZA 2JL4A 1YEXA 4ULXA 4F0CA 2MBTA 2C0FA 4ZBAA 4YH2A 3FZ5A 2DJ0A 4MPFA 1BEDA 3UIWA 3DEXA 4N0ZA 1Y1UA 5ABRA 3F8UA 2HT9A 1GRXA 2HFDA 4KCEA 4KW6A 1QMVA 1BX9A 1ZL9A 4JR4A 2VCXA 2OKAA 3C1SA 4K2DA 3M8NA 4LA1A 5IOWA 3C71A 3AY8A 3QAWA 4YKFA 4MPGA 2VM2A 2DBCA 3FK8A 3IOSA 5ELGA 1JZOA 2QGVA 2HSMB 4AJ6A 4XHMA 4EUYA 3DVWA 2HZEB 2C1YA 2P0GA 4E8HA 3EMPA 3TUEA 2KLXA 2V1MA 5EPFA 3U5RE 5B8BA 4V1Ap 1EOHA 4BWSA 2H76A 2AJQB 1O85A 4PNFA 4TOPA 5ECKB 2F51A 4DSSB 2KHPA 3LEFA 4QL7A 4AKXB 2YJHA 2B5YA 1ZZYA 4PX1A 1JLWA 5IIZA 2CVKA 2XBQA 6GSYA 2YP6A 3RAZA 2WW3A 5ID2A 4G0KA 3LSZA 3Q6OA 1WWJA 3KJYA 4RI7A 2L57A 4WXTA 3L9SA 5BMUA 3EINA 3WT2A 3MDKA 5KN0A 3TJJA 2LJRA 2GZZA 2A4VA 1NSWA 3MYDA 1PSQA 5HQPA 2EFHA 2YWNA 2WVZA 5HFIA 2P31A 4EIQA 4FXYP 3KEBA 1SKWB 2WJUA 2O36A 3O6TA 5INYA 1EGOA 2VL3A 1VF4A 2IFQB 1AQVA 2MZCA 1FHEA 2XPDA 2GSQA 3W8SA 1XBSA 3ZRDA 3P8WA 2B7KA 3FR3A 2P5QA 3G9BA 5D9XA 1BG5A 2PGTA 1GSQA 4KH7A 4EC0A 3UOMA 4QMKA 5HFGA 2C3QA 2JSZA 1ZYQB 4IJIA 2A2PA 1M2AA 1QQ2A 1X0RA 2I3YA 2PPTA 2RM5A 1GH2A 4K7IA 1XFLA 2EIQA 5AN1A 4FH8A 2R3XA 4NHWA 20GSA 2OJLA 1A2MA 2RLIA 5C04A 2VCWA 3S9FA 1OYJA 2IWTA 4TR3A 4GF0A 4GWRA 1K3OA 2D2ZA 1OKDA 1ZMAA 4GCIA 3EYTA 3WD6A 4H86A 2LQQA 2X4AA 3LXZA 3VURA 1I5GA 2QA2A 3H93A 2DJ3A 4ID0A 1B9YC 4PURA 5D9WA 2GTUA 4XRDA 1VF1A 3KP9A 3LYKA 2WGRA 4POLA 1B8XA 2AB6A 2VIMA 5AIXA 4PI0C 5LNKe 4HZ4A 3IA1A 2QC7A 3I9V2 5H5QA 3VWWA 1JLVA 1THXA 3GX0A 1WIKA 4ZB9A 4JBBA 2LEGA 1B4PA 3TJBA 2FGXA 4FYCA 2DIYA 4HEA2 1J9BA 4NV5A 2HQTA 1A0RP 1E2YA 3FMWA 4X4JA 3APOA 1VF3A 3WGDA 1EEMA 4OO4A 1TK8B 1XW9A 1G0TA 1MDKA 2YWOA 3VK9A 2PERA 3MIXA 1A2JA 2YJ7A 4HJMA 2JZTA 1V9WA 5DQYA 4X43A 4Z2TA 2WRTA 3J7Yk 5A34A 5COHA 1ZOFA 3EU3A 3IXRA 4ECCA 19GSA 3O3TA 4OCFA 2YV9A 1MD4A 3UEMA 1U87A 4G10A 4QQ7A 8GSSA 6GSTA 1ZYNA 2I1UA 2KOKA 2FA8A 5FWGA 2V6OA 5DJLA 3KGKA 1U3IA 2ON7A 2IL3A 4X1UA 4PUAA 1GSEA 1N8JA 1PL1A 1BYEA 1X9MB 5D9TA 3EMXA 1N25A 2H1BA 1HQOA 4K0GA 4ML6A 1B48A 1TRSA 4ML1A 3FKFA 1WJKA 3P7XA 2EIOA 4GLTA 3F63A 4J56E 2N5BA 4Q5FA 1SKRB 4O32A 1FW1A 4V1Ag 1EZKA 3GH6A 5F05A 3QAGA 3A2XA 4AJ7A 2LNSA 1HNCA 1ACVA 1O81A 4V2LA 4I2TA 4PGTA 4MABA 3TJGA 2A2RA 5C00A 4WR4A 4WF4A 4MF7A 3F9UA 2RIIA 4TXOA 1C72A 1MEKA 1Z6MA 3QMXA 3U6VA 2PUKC 1WP0A 1EEJA 1A23A 3M3MA 1J08A 5CREA 1TRVA 2DJKA 2O85A 1YJ6A 1KTEA 4CHSA 1ERWA 4N3ZA 4GDFA 5ECSA 4W66A 3VI5A 1T4YA 2C3NA 4D73A 4HOJA 5E4WA 4FO5A 4BWQA 5D73A 4Z2UA 3M9JA 1UC7A 2LJAA 4YKGA 5DVBA 1NM3A 1T8EB 1A8YA 4KF9A 3TRQA 4Z7XA 3IV4A 4ZB7A 1SJZA 4AF2A 3IPZA 5JWRB 1U88A 2DLXA 3IBHA 3PPUA 4XIHA 1JZRA 1SVLA 3MNGA 3DXBA 3F3QA 4GXZA 5CRWA 4FYBA 1A0FA 1ZYPA 4KX4A 4BL7B 4OFMA 4IN0A 3EE2A 4J57E 3UMAA 4G19A 4CY8A 2L4QA 1IYIA 1OE8A 4O92A 1WE0A 4BPYA 2HSNB 1MDJA 2FD3A 3TKRA 1SL0B 4F9ZA 4TXVA 2M72A 2FHEA 4KCAA 5F07A 3ZREA 4WR5A 4GTUA 2YANA 2H75A 3UJ1A 4PXOA 4YAPA 1ERTA 3CTGA 3ZFLA 2RM6A 3WYWA 4AGSA 3KM6A 1O8WA 4F2IA 3US3A 4E68A 4YQMA 4QL9A 2H01A 16GSA 2CAIA 4ECBA 1XG8A 2AAWA 3CXGA 3TB2A 1K0OA 2E2MA 1GNEA 17GSA 3Q74A 2HRFA 3GFKA 4LMWA 2YZUA 3KZQA 4KDYA 3N9JA 1W89A 3HJOA 2IMDA 2C4JA 4MNNA 5CAXA 5D93A 1Z5YE 2EFDA 1YZXA 2IIYA 4NWYA 1G7OA 1A8LA 2WVXB 4K5SA 2C8UA 2HRKB 2YCDA 2VL2C 2EC4A 3TRPA 2I4AA 4IP6A 3MWHA 3HZ4A 1M7TA 2H1GA 2XC2A 4PUFC 2FA4A 4K2XA 4K5RA 1SK2A 2H71A 5DALA 2BTOT 5DCHA 1HYUA 2IMIA 1ERUA 4JZQA 2X8GA 3GX8A 1GTUA 3HY2A 1RK4A 1YY7A 1YEPA 2VCTA 1SK1A 5IMZA 3TJKA 5ECNB 1OC9B 3BBYA 1USBA 3PH9A 4KSOA 1I1IP 2LJKA 1ST9A 3KP8A 3UARA 2HSYA 4WF5A 3D21A 3N5OA 1FOVA 1GLPA 4NAXA 4Z2RA 3KH9A 2XBIA 3HXSA 2L5LA 3IE3A 2VOCA 1WRYA 2HYXA 4N11A 1TDIA 4ICYA 1ERVA 2E0QA 4USSA 1SENA 4ZB6A 5KOWA 3LJRA 2R5GA 1TK0B 2H30A 1N2AA 3HD5A 4WKWA 3ZIVA 4IP1A 3APSA 2UV8G 5DAKB 4ZBBA 1DUGA 1HNBA 2CQ9A 2YOIA 3TKSC 4BA7A 2NBSA 4XS4B 3DMLA 2V32A 3FZ4A 5LD0A 5JCUA 3IR4A 2YWMA 3DYRA 5ECIB 2GSTA 3E9JB 12GSA 5HR3A 4EIPA 4L8EA 1XWBA 1ILOA 1WOUA 5A1NA 1NW2A 1TKDB 2R4VA 4O5UA 5D96A 2X8CA 1XW6A 5E59A 1SK0A 3NZNA 4NPBA 3TDGA 4TR4A 4GQCA 3EPTA 3ZLPA 3I6AA 2RUEA 4OCEA 2A4HA 2IMKA 4ACSA 5GSTA 2C0GA 3TOTA 4HQSA 1XWGA 1VF2A 5CRDA 4L5LA 4EDZA 3A3TA 2L4CA 3HCZA 5IMAA 5J4VA 4PNGA 3F6FA 2E7PA 5DDLA 1M9BA 1ZYEA 2ALBA 2B3SA 3IK7A 10GSA 3GTUA 1M9AA 2ON5A 1UN2A 1MDIA 2LRNA 2R0GA 1B4QA 3UAPA 3GKKA 2V6KA 4F0BA 3CSHA 4ZL8A 1GUKA 4MDCA 1OVNA 1A2LA 2H19A 3M9KA 3ERFA 2DJJA 2O89A 3BD2A 1TRWA 1CQGA 1X5CA 3P90A 3LFLA 4GSTA 1YEWC 4Q5NA 1URMA 5IMCA 1OAZA 3LYPA 2H74A 2YN1A 3HDCA 2O5VA 1W4VA 2F8FA 3DGQA 1M2BA 3HVSA 3GKNA 2MBSA 1F37A 5ECRB 2FWEA 3GN3A 2ES7A 2DKHA 5J41A 2H6YA 3H8QA 2R6KA 5F8BA 1AQXA 2HNLA 3ZYWA 3ZZXA 4NXIA 3WGXA 3QCPA 1TXXA 4PHZC 2OE1A 3Q18A 1Z3EA 4EL1A 3HHVA 1K0BA 3LXTA 1Q98A 1Z6NA 2LS5A 4F82A 4HU7A 5IOXA 2CVBA 3KD0A 3TKPA 2OADA 3Q19A 5CRGA 3GSSA 2QKEA 1XCCA 4GSNA 1K3LA 11GSA 1Z9HA 1TJDA 3HJMA 3DKSA 3ZMLA 1M3IA 1AUCA 2WB9A 5IMFA 4YAVA 1QGVA 4MP4A 4O7HA 4I5QA 2GSSA 1CQHA 2FUG2 1OKTA 1BAYA 1FG4A 1XWCA 1UVZA 2R0PA 1YF0A 2WS2A 2VD0A 6GSWA 3JCML 3TOUA 3GA4A 2VAFA 2CX4A 2VKZG 3LWAA 3RPPA 2LRCA 4IVFA 5A5KA 3GL3A 3TU3B 1B9XC 1G7EA 3IRAA 1GNWA 2PMTA 2F3MA 1O6JA 4PTSA 1H75A 5J9BA 3MSZA 4CW9A 4MCUA 2E2GA 3ME7A 3CRUA 2JU5A 5J47A 3IAM2 1GTAA 3IDVA 1K0MA 2NDOA 4JEDA 1EP8A 4MF6A 3ZVJD 4IQAA 3WGEA 1GUHA 4EVMA 1JHBA 4BVXB 1GSSA 3RGBC 1TRUA 3K8NA 2VLUA 5IMDA 3VWVA 4KDXA 1PD21 2DKIA 2VCZA 1XOBA 1YQ1A 2OA7A 2OE0A 1F9MA 2HSMA 2OBIA 4XRAA 2C3TA 4A5PA 1A24A 2HZEA 2XHFA 4ZL7A 4TR1B 4IQ1A 3F4TA 4MLYA 3FEUA 4HU9A 3A2VA 5D9VA 2WW1A 1TXUA 3PGTA 3L0HA 4DSSA 4K8MA 2GQMA 4YQVA 2ZUPA 3F3RA 3TKQA 2GLRA 4N0VA 4MF5A 2HXKA 5KN3A 2YV7A 1O8XA 3PR8A 2L6DA 1BF5A 2VD1A 3LG6A 2V2GA 3KXOA 1XW5A 3IK9A 1S3RA 1PGTA 2VCQA 5J40A 6GSUA 2AHEA 2J23A 3ISOA 1SJIA 1K0CA 4HS1A 1XVWA 1T3BA 1O7UA 4BVYB 4XTSA 3C1RA 2GDRA 1AIUA 3VI7A 3TJFA 2N5AA 1EWXA 2AUVA 2H72A 4G9HA 2NVLA 1GTIA 3QPMA 1SD9A 4V2MA 3IHQA 2IFQA 1PKWA 5G30A 2KP2A 1FB6A 3GURA 2L5OA 3HKRA 3GSTA 3GKXA 4I6XA 1SVMA 2WW0A 2LSTA 1BQ7A 2O7KA 3FR6A 1SKSB 5AGYA 3CSIA 4PQIA 4XCSA 3D4MA 4EF0A 3RHBA 1XOAA 1R5PA 6GSVA 5EL8A 4EXJA 3O76A 14GSA 4OO5A 4MK3A 3ZTLA 5ELAA 1AC1A 1FO5A 2QSIA 2BMXA 3GL5A 2K18A 2R2JA 2K8VA 1FB0A 3CMIA 1TW9A 1M0UA 5DCGA 1TU7A 5L71A 5J3RA 1PA3A 4RQRA 1PMTA 2TRXA 1K0AA 1GSYA 3ZVJA 4IW9A 1J0FA 3TKSE 2LUSA 4POMA 1XPVA 3CSJA 2H8LA 4N10A 2WVYA 1TK5B 4MJAA 4TRXA 2PU9C 4PQHA 13GSA 2CV4A 2VLVA 1DBYA 5IO0A 2H0IA 4JE1A 4DSRA 1R26A 4V2NA 5ID2B 3QAVA 4XS6A 4ECIA 3VWUA 4WEYA 5DBQA 5BMUB 5B8AA 4ZIJA 2DIZA 1OC3A 3W8JA 3OR5A 4ZB8A 5GZZB 1GLQA 4GSSA 2H0GA 4GQFA 4LL1B 4CDOA 4IS0A 1SYRA 5A4WA 2B5XA 3SBCA 2H66A 3MAKA 2PWJA 4WETA 2FWFA 3CQFA 1TI1A 4KSMA 2LV3A 5CYYA 5J4YA 1JZDA 4RUVA 4IBPA 1V58A 3V1WA 5ECLB 2I9HA 5FT3A 4G01A 2C80A 2M80A 4HZ2A 2MYGA 1VGLA 4HUAA 4AI6A 2FWHA 3FZAA 1PX6A 3I69A 2VUPA 3A5IA 1AQWA 3WT1A 4Q5QA 2VO4A 22GSA 1V40A 4RQXA 1GL8A 4OFNA 1Y25A 3VLNA 4YQUA 2ZNMA 5GSSA 4DVCA 3H1NA 4J2FA 3W6GA 4JR6A 2K9FA 1GUMA 5FHIA 4AKIA 3IC8A 1M3JA 2OE3A 2GS3A 2VL2A 5DJMA 5A5HA 4G2EA 5IO2A 3FYGA 3M1GA 4DEJA 4HDEA 1TOFA 2VCVA 2QA1A 1PN0A 2KUCA 3D4TA 1THOA 2CA8A 4GRFA 4MZBA 3GUSA 3RHCA 1ZCPA 2V41A 4N30A 3E3EA 3GHAA 4JU5A 1EV9A 3FHKA 5F06A 9GSSA 1G6WA 3FZ9A 1EOGA 5LCZA 5G1LA 4F03A 4K0NA 3GYKA 3TRXA 5J4UA 3CTFA 5A34B 2DJ2A 4L0WA 2WW2A 2X99A 1S3AA 1K3YA 1KNGA 3EURA 5D8IA 1SL1B 4O5QA 3ERGA 4KGIA 4E8EA 4PQ1A 2JZSA 1H4OA 2DSAA 2MMZA 3TKSA 1M2DA 2X8HA 1FVKA 3NIVA 2HRAA 3PINA 2N5FA 3D6IA 3FR9A 2WCIA 4MH2A 4KA0A 2O8VB 1QFNA 3ME8A 2L6CA 5CNWA 4ECJA 2M46A 3QOUA 4BL7A 4P3YB 2H1DA 2GT6A 1NHOA 2AYTA 1I9DA 1OC8A 4IELA 3F6DA 1XVQA 1GSDA 5ECMB 2HSNA 2Z9SA 1G6YA 1T7PB 4TW5A 2YPMA 3GKMA 2B6MA 1Q4JA 3LW9A 2NPBA 1S3DA 3IAS2 1SVOA 3DIEA 4I2UA 2UZ8A 3KIJA 1SL2B 4WBRD 2AV4A 1LBKA 3R3EA 2DC5A 3DD3A 2WDUA 4HI7A 4WBJA 2JACA 1FOHA 2G0FA 3C7MA 5G2ZA 2IN3A 5IQYA 3HZ8A 1AXDA 4TXOB 3D22A 1T00A 1TP9A 2PVOC 3QFBC 5KOXA 3FRCA 1QXHA 3KMOA 3C8EA 5HR1A 3RDWA 1ABAA 3IHGA 1F3AA 2GSRA 2PN8A 3LGCA 3HJPA 2YZHA 3H79A 1GTBA 4D73B 2ZCTA 2H1AA 3D5JA 1LU4A 1SYXA 3F4SA 1K0DA 4RI6A 3RFRC 1YKCA 4MA9A 3ED3A 4MZWA 5EVOA 2R0CA 2IJYA 1HD2A 1ZGNA 2CVDA 1QK8A 3UVTA 2JZRA 3QD9A 4TKYA 1YDKA 4HQZA 3EC3A 1KEBA 1QUWA 6GSXA 3F4RA 3KCMA 5IPGA 3SWLA 1XWAA 2WVXA 2B5EA 2HRKA 1PQNA 2FLSA 2OBKA 3R2QA 2VL9A 3IC4A 2LNTA 2MMOA 3CRTA 1JFUA 3A2WA 2H73A 5ECHB 4TR0A 5EY6A 4POBA 3RPNA 2F9SA 4XS1A 1PX7A 4MH3A 18GSA 4DSQA 3TGZA 3G7JA 3E0UA 3GRXA 7GSSA 1OC9A 3NOFA 4L5OA 6GSSA 2A2SA 2WZ9A 3J7Yb 5DQSA 3QDNA 1UA5A 1FAAA 2I81A 2GQLA 4NHZA 3QFAC 2CX3A 2HRNA 3L78A 2GQKA 2IMFA 4BIKA 5ECQB 2PVQA 3LQ7A 2HE3A 2WFCA 1OE7A 2GT5A 4HSCX 2R37A 3GNJA 1R4WA 5GAND 3KTBA 2NTOA 4OD7A 1YKAA 1LJRA 2B1LA 3M0FA 4IKHA 3UL3A 3BOAA 2K6VA 4MJBA 2C0EA 2GZYA 4G0IA 5DAKA 1SU9A 4O5RA 5ENUA 1WMJA 2FCHA 3ERWA 1IYHA 5H5RA 4XS4A 4KNDA 1K0NA 4IGJA 3UVHA 4OFTA 4FYUA 3EU4A 2FNOA 1V98A 1GWCA 1M99A 4IJ3A 5AIVA 3VWXA 1XWKA 5J5NA 5CP1A 3P2AA 2BJXA 3APQA 1HNAA 5G5FA 1FVJA 1PL2A 1X5EA 3L4NA 4K1FA 4PI2C 2J9HA 2OT3A 5HR2A 1E6BA 4I97A 2C0DA 2IMEA 4X0XA 5DALB 2PBJA 3DWVA 4OWYA 3BCKA 1GSFA 5A5HB 4ZL9A 4EE0A 3CYNA 4AJ8A 1AAZA 1V57A 2DMMA 1ML6A 5BRTA 1T1VA 4IHUA 5AISA 2X64A 5KN1A 2B1KA 4ZILA 1PKZA 2HI7A 4TN8A 4G0LA 2P5RA 1F2EA 5B6NA 1YVLA 2O3EA 2TRCP 2CZ2A 4FQUA 3GIXA 1SD8A 5B6MA 3BJ5A 1PRXA 4HJ2A 1PFOA 1DE1A 2RUFA 1GULA 1T4ZA 3I43A 5F0GA 1TI3A 2WULA 3KH7A 2F8AA 1S4BP 1DSBA 4JRRA 4ZXGA 2HSHA 5G31A 1DE2A 1X9WB 5HR0A 1S3CA 2X49A 4MJEA 1KBNA 4TVEA 4K6XA 4LLRA 2YWIA 4I8BA 3UBLA 2JADA 4CY6A 1Z7PA 3BCIA 2OACA 1MTCA 5A1NB 4NMUA 5KN2A 5G5EA 3VPQA 1NHYA 2CAQA 2H6XA 1Y6EA 3CHXC 4EKZA 5IM9A 5B7CA 2EFCA 1GSUA 2H6ZA 2WZSA 2JSYA 3FY7A 2LKUA 3ZITA 3TCOA 3HA9A 1R5AA 3DRNA 2DMLA 3QR6A 4ISDA 5CO3A 3EWLA 5JCGA 2VLTA 3RBTA 2YNXA 4K7OA 1XIYA 5ECOB 2LQOA 1RQMA 1BJXA 2CZ3A 3H4KA 2LTKA 3LORA 2GGTA 1JZWA 2KP1A 3CBUA 2EFEA 2G2QA 1YF1A 4KDUA 4MJCA 1EP7A 1ON4A 3GTUB 3GV1A 3GH9A 4OMVA 1O73A 1EGRA 1F3BA 3F0IA 5GAPD 3L9UA 1F6MC 2K8SA 5JWOB 3ZL5A 4MZCA 5H5SA 3KMNA 1GP1A 2IPAA 3VPTA 3CWGA 2GVPA 5HFKA 4MMMA 4KAEA 4ZBDA 2TIRA 4L0UA 2HZFA 1VRSD 2FY6A 3G7IA 2GZPA 3HVNA 4EDYA 4KE3A 5A4VA 3HVXA 3ZMKA 1RW1A 3G7YA
chains in the Genus database with same CATH topology
4BVXA 4K7NA 3A5WA 2VM1A 4FIWA 3KTLA 4Q5RA 4POKA 5ECPB 5A4UA 2LRTA 1XXUA 5KEJA 1AW9A 5JCWA 3DVXA 5CRHA 4KB3A 1XZOA 1WPIA 1Z7RA 1TU8A 2O87A 1U3AA 4LL4B 4TR1A 3ZFBA 2H0HA 1SJ6A 1EV4A 4LMVA 4NV2A 2B7JA 4AKGA 5IMVA 2MMAA 5JWQB 3C73A 1R7HA 3GMFA 2MMNA 3D0ZA 1BG1A 2L59A 2HLSA 3L9VA 1MD3A 3VFIA 1X5DA 4K9ZA 1X9SB 1V2AA 2XPEA 1PN9A 3EVIA 3FW2A 5IPHA 4EO3A 5G1KA 2H1LA 3UBKA 4AKHA 5J9CA 2REMA 4BVYA 3ZIJA 2EIRA 1U6TA 2CT6A 4ILFA 3HVVA 3HMJG 2DJ1A 2H70A 3HYPA 2FWGA 4KUNA 1TTZA 2JL4A 1YEXA 4ULXA 4F0CA 2MBTA 2C0FA 4ZBAA 4YH2A 3FZ5A 2DJ0A 4MPFA 1BEDA 3UIWA 3DEXA 4N0ZA 1Y1UA 5ABRA 3F8UA 2HT9A 1GRXA 2HFDA 4KCEA 4KW6A 1QMVA 1BX9A 1ZL9A 4JR4A 2VCXA 2OKAA 3C1SA 4K2DA 3M8NA 4LA1A 5IOWA 3C71A 3AY8A 3QAWA 4YKFA 4MPGA 2VM2A 2DBCA 3FK8A 3IOSA 5ELGA 1JZOA 2QGVA 2HSMB 4AJ6A 4XHMA 4EUYA 3DVWA 2HZEB 2C1YA 2P0GA 4E8HA 3EMPA 3TUEA 2KLXA 2V1MA 5EPFA 3U5RE 5B8BA 4V1Ap 1EOHA 4BWSA 2H76A 2AJQB 1O85A 4PNFA 4TOPA 5ECKB 2F51A 4DSSB 2KHPA 3LEFA 4QL7A 4AKXB 2YJHA 2B5YA 1ZZYA 4PX1A 1JLWA 5IIZA 2CVKA 2XBQA 6GSYA 2YP6A 3RAZA 5ID2A 4G0KA 3LSZA 3Q6OA 1WWJA 3KJYA 4RI7A 2L57A 4WXTA 3L9SA 5BMUA 3EINA 3WT2A 3MDKA 5KN0A 3TJJA 2LJRA 2GZZA 2A4VA 1NSWA 3MYDA 1PSQA 5HQPA 2EFHA 2YWNA 5HFIA 2P31A 4EIQA 1SKWB 3KEBA 2WJUA 3O6TA 5INYA 1EGOA 2VL3A 1VF4A 2IFQB 1AQVA 2MZCA 1FHEA 2XPDA 2GSQA 3W8SA 1XBSA 3ZRDA 3P8WA 2B7KA 3FR3A 2P5QA 3G9BA 5D9XA 1BG5A 2PGTA 1GSQA 4KH7A 4EC0A 3UOMA 4QMKA 5HFGA 2C3QA 2JSZA 1ZYQB 4IJIA 2A2PA 1M2AA 1QQ2A 1X0RA 2I3YA 2PPTA 2RM5A 1GH2A 4K7IA 1XFLA 2EIQA 5AN1A 4FH8A 2R3XA 4NHWA 20GSA 2OJLA 1A2MA 2RLIA 5C04A 2VCWA 3S9FA 1OYJA 2IWTA 4TR3A 4GF0A 4GWRA 1K3OA 2D2ZA 1OKDA 1ZMAA 4GCIA 3EYTA 3WD6A 4H86A 2LQQA 2X4AA 3LXZA 3VURA 1I5GA 2QA2A 3H93A 2DJ3A 4ID0A 1B9YC 4PURA 5D9WA 2GTUA 4XRDA 1VF1A 3KP9A 3LYKA 2WGRA 4POLA 1B8XA 2AB6A 2VIMA 5AIXA 5LNKe 4HZ4A 3IA1A 2QC7A 3I9V2 5H5QA 3VWWA 1JLVA 1THXA 3GX0A 1WIKA 4ZB9A 4JBBA 2LEGA 1B4PA 3TJBA 2FGXA 4FYCA 2DIYA 4HEA2 1J9BA 4NV5A 2HQTA 1A0RP 1E2YA 3FMWA 4X4JA 3APOA 1VF3A 3WGDA 1EEMA 4OO4A 1TK8B 1XW9A 1G0TA 1MDKA 2YWOA 3VK9A 2PERA 3MIXA 1A2JA 2YJ7A 4HJMA 2JZTA 1V9WA 5DQYA 4X43A 4Z2TA 2WRTA 3J7Yk 5A34A 5COHA 1ZOFA 3EU3A 3IXRA 4ECCA 19GSA 3O3TA 4OCFA 2YV9A 1MD4A 3UEMA 1U87A 4G10A 4QQ7A 8GSSA 6GSTA 1ZYNA 2I1UA 2KOKA 5FWGA 2FA8A 2V6OA 5DJLA 3KGKA 1U3IA 2ON7A 2IL3A 4X1UA 4PUAA 1GSEA 1N8JA 1PL1A 1BYEA 1X9MB 5D9TA 3EMXA 1N25A 2H1BA 1HQOA 4K0GA 4ML6A 1B48A 1TRSA 4ML1A 3FKFA 1WJKA 3P7XA 2EIOA 4GLTA 3F63A 4J56E 2N5BA 4Q5FA 1SKRB 4O32A 1FW1A 4V1Ag 1EZKA 3GH6A 5F05A 3QAGA 3A2XA 4AJ7A 2LNSA 1HNCA 1ACVA 1O81A 4V2LA 4I2TA 4PGTA 4MABA 3TJGA 2A2RA 5C00A 4WR4A 4WF4A 4MF7A 3F9UA 2RIIA 4TXOA 1C72A 1MEKA 1Z6MA 3QMXA 3U6VA 2PUKC 1WP0A 1EEJA 1A23A 3M3MA 1J08A 5CREA 1TRVA 2DJKA 2O85A 1YJ6A 1KTEA 4CHSA 1ERWA 4N3ZA 4GDFA 5ECSA 4W66A 3VI5A 1T4YA 2C3NA 4D73A 4HOJA 5E4WA 4FO5A 4BWQA 5D73A 4Z2UA 3M9JA 1UC7A 2LJAA 4YKGA 5DVBA 1NM3A 1T8EB 1A8YA 4KF9A 3TRQA 4Z7XA 3IV4A 4ZB7A 1SJZA 4AF2A 3IPZA 5JWRB 1U88A 2DLXA 3IBHA 3PPUA 4XIHA 1JZRA 1SVLA 3MNGA 3DXBA 3F3QA 4GXZA 5CRWA 4FYBA 1A0FA 1ZYPA 4KX4A 4BL7B 4OFMA 4IN0A 3EE2A 4J57E 3UMAA 4G19A 4CY8A 2L4QA 1IYIA 1OE8A 4O92A 1WE0A 4BPYA 2HSNB 1MDJA 2FD3A 3TKRA 1SL0B 4F9ZA 4TXVA 2M72A 2FHEA 4KCAA 5F07A 3ZREA 4WR5A 4GTUA 2YANA 2H75A 3UJ1A 4PXOA 4YAPA 1ERTA 3CTGA 3ZFLA 2RM6A 3WYWA 4AGSA 3KM6A 1O8WA 4F2IA 3US3A 4E68A 4YQMA 4QL9A 2H01A 16GSA 2CAIA 4ECBA 2AAWA 3CXGA 3TB2A 1K0OA 2E2MA 1GNEA 17GSA 3Q74A 2HRFA 3GFKA 4LMWA 2YZUA 3KZQA 4KDYA 3N9JA 1W89A 3HJOA 2IMDA 2C4JA 4MNNA 5CAXA 5D93A 1Z5YE 2EFDA 1YZXA 2IIYA 4NWYA 1G7OA 1A8LA 4K5SA 2C8UA 2HRKB 2YCDA 2VL2C 2EC4A 3TRPA 2I4AA 4IP6A 3MWHA 3HZ4A 1M7TA 2H1GA 2XC2A 4PUFC 2FA4A 4K2XA 4K5RA 1SK2A 2H71A 5DALA 2BTOT 5DCHA 1HYUA 2IMIA 1ERUA 4JZQA 2X8GA 3GX8A 1GTUA 3HY2A 1RK4A 1YY7A 1YEPA 2VCTA 1SK1A 5IMZA 3TJKA 5ECNB 1OC9B 3BBYA 1USBA 3PH9A 4KSOA 2LJKA 1ST9A 3KP8A 3UARA 2HSYA 4WF5A 3D21A 3N5OA 1FOVA 1GLPA 4NAXA 4Z2RA 3KH9A 2XBIA 3HXSA 2L5LA 3IE3A 2VOCA 1WRYA 2HYXA 4N11A 1TDIA 4ICYA 1ERVA 2E0QA 4USSA 1SENA 4ZB6A 5KOWA 3LJRA 2R5GA 1TK0B 2H30A 1N2AA 3HD5A 4WKWA 3ZIVA 4IP1A 3APSA 2UV8G 5DAKB 4ZBBA 1DUGA 1HNBA 2CQ9A 2YOIA 3TKSC 4BA7A 2NBSA 4XS4B 3DMLA 2V32A 3FZ4A 5LD0A 5JCUA 3IR4A 2YWMA 3DYRA 5ECIB 2GSTA 3E9JB 12GSA 5HR3A 4EIPA 4L8EA 1XWBA 1ILOA 1WOUA 5A1NA 1NW2A 1TKDB 2R4VA 4O5UA 5D96A 2X8CA 1XW6A 5E59A 1SK0A 3NZNA 4NPBA 3TDGA 4TR4A 4GQCA 3EPTA 3ZLPA 3I6AA 2RUEA 4OCEA 2A4HA 2IMKA 4ACSA 5GSTA 2C0GA 3TOTA 4HQSA 1XWGA 1VF2A 5CRDA 4L5LA 4EDZA 3A3TA 2L4CA 3HCZA 5IMAA 5J4VA 4PNGA 3F6FA 2E7PA 5DDLA 1M9BA 1ZYEA 2ALBA 2B3SA 3IK7A 10GSA 3GTUA 1M9AA 2ON5A 1UN2A 1MDIA 2LRNA 2R0GA 1B4QA 3UAPA 3GKKA 2V6KA 4F0BA 3CSHA 4ZL8A 1GUKA 4MDCA 1OVNA 1A2LA 2H19A 3M9KA 3ERFA 2DJJA 2O89A 3BD2A 1TRWA 1CQGA 1X5CA 3P90A 3LFLA 4GSTA 4Q5NA 1URMA 5IMCA 1OAZA 3LYPA 2H74A 2YN1A 3HDCA 2O5VA 1W4VA 2F8FA 3DGQA 1M2BA 3HVSA 3GKNA 2MBSA 1F37A 5ECRB 2FWEA 3GN3A 2ES7A 2DKHA 5J41A 2H6YA 3H8QA 2R6KA 5F8BA 1AQXA 2HNLA 3ZYWA 3ZZXA 4NXIA 3WGXA 3QCPA 1TXXA 2OE1A 3Q18A 1Z3EA 4EL1A 3HHVA 1K0BA 3LXTA 1Q98A 1Z6NA 2LS5A 4F82A 4HU7A 5IOXA 2CVBA 3KD0A 3TKPA 2OADA 3Q19A 5CRGA 3GSSA 2QKEA 1XCCA 4GSNA 1K3LA 11GSA 1Z9HA 1TJDA 3HJMA 3DKSA 3ZMLA 1AUCA 2WB9A 5IMFA 4YAVA 1QGVA 4MP4A 4O7HA 4I5QA 2GSSA 1CQHA 2FUG2 1OKTA 1BAYA 1FG4A 1XWCA 1UVZA 2R0PA 1YF0A 2WS2A 2VD0A 6GSWA 3JCML 3TOUA 3GA4A 2VAFA 2CX4A 2VKZG 3LWAA 3RPPA 2LRCA 4IVFA 5A5KA 3GL3A 3TU3B 1B9XC 1G7EA 3IRAA 1GNWA 2PMTA 2F3MA 1O6JA 4PTSA 1H75A 5J9BA 3MSZA 4CW9A 4MCUA 2E2GA 3ME7A 3CRUA 2JU5A 5J47A 3IAM2 1GTAA 3IDVA 1K0MA 2NDOA 4JEDA 1EP8A 4MF6A 3ZVJD 4IQAA 3WGEA 1GUHA 4EVMA 1JHBA 4BVXB 1GSSA 1TRUA 3K8NA 2VLUA 5IMDA 3VWVA 4KDXA 1PD21 2DKIA 2VCZA 1XOBA 1YQ1A 2OA7A 2OE0A 1F9MA 2HSMA 2OBIA 4XRAA 2C3TA 4A5PA 1A24A 2HZEA 2XHFA 4ZL7A 4TR1B 4IQ1A 3F4TA 4MLYA 3FEUA 4HU9A 3A2VA 5D9VA 1TXUA 3PGTA 3L0HA 4DSSA 4K8MA 2GQMA 4YQVA 2ZUPA 3F3RA 3TKQA 2GLRA 4N0VA 4MF5A 2HXKA 5KN3A 2YV7A 1O8XA 3PR8A 2L6DA 1BF5A 2VD1A 3LG6A 2V2GA 3KXOA 1XW5A 3IK9A 1PGTA 2VCQA 5J40A 6GSUA 2AHEA 2J23A 3ISOA 1SJIA 1K0CA 4HS1A 1XVWA 1T3BA 1O7UA 4BVYB 4XTSA 3C1RA 2GDRA 1AIUA 3VI7A 3TJFA 2N5AA 1EWXA 2AUVA 2H72A 4G9HA 2NVLA 1GTIA 3QPMA 1SD9A 4V2MA 3IHQA 2IFQA 1PKWA 5G30A 2KP2A 1FB6A 3GURA 2L5OA 3HKRA 3GSTA 3GKXA 4I6XA 1SVMA 2LSTA 1BQ7A 2O7KA 3FR6A 1SKSB 5AGYA 3CSIA 4PQIA 4XCSA 3D4MA 4EF0A 3RHBA 1XOAA 1R5PA 6GSVA 5EL8A 4EXJA 3O76A 14GSA 4OO5A 4MK3A 3ZTLA 5ELAA 1AC1A 1FO5A 2QSIA 2BMXA 3GL5A 2K18A 2R2JA 2K8VA 1FB0A 3CMIA 1TW9A 1M0UA 5DCGA 1TU7A 5L71A 5J3RA 1PA3A 4RQRA 1PMTA 2TRXA 1K0AA 1GSYA 3ZVJA 4IW9A 1J0FA 3TKSE 2LUSA 4POMA 1XPVA 3CSJA 2H8LA 4N10A 1TK5B 4MJAA 4TRXA 2PU9C 4PQHA 13GSA 2CV4A 2VLVA 1DBYA 5IO0A 2H0IA 4JE1A 4DSRA 1R26A 4V2NA 5ID2B 3QAVA 4XS6A 4ECIA 3VWUA 4WEYA 5DBQA 5BMUB 5B8AA 4ZIJA 2DIZA 1OC3A 3W8JA 3OR5A 4ZB8A 5GZZB 1GLQA 4GSSA 2H0GA 4GQFA 4LL1B 4CDOA 4IS0A 1SYRA 5A4WA 2B5XA 3SBCA 2H66A 3MAKA 2PWJA 4WETA 2FWFA 1TI1A 4KSMA 2LV3A 5CYYA 5J4YA 1JZDA 4RUVA 4IBPA 1V58A 3V1WA 5ECLB 2I9HA 5FT3A 4G01A 2C80A 2M80A 4HZ2A 2MYGA 1VGLA 4HUAA 4AI6A 2FWHA 3FZAA 1PX6A 3I69A 2VUPA 3A5IA 1AQWA 3WT1A 4Q5QA 2VO4A 22GSA 1V40A 4RQXA 1GL8A 4OFNA 1Y25A 3VLNA 4YQUA 2ZNMA 5GSSA 4DVCA 3H1NA 4J2FA 3W6GA 4JR6A 2K9FA 1GUMA 5FHIA 4AKIA 3IC8A 2OE3A 2GS3A 2VL2A 5DJMA 5A5HA 4G2EA 5IO2A 3FYGA 3M1GA 4DEJA 4HDEA 1TOFA 2VCVA 2QA1A 1PN0A 2KUCA 3D4TA 1THOA 2CA8A 4GRFA 4MZBA 3GUSA 3RHCA 1ZCPA 2V41A 4N30A 3E3EA 3GHAA 4JU5A 1EV9A 3FHKA 5F06A 9GSSA 1G6WA 3FZ9A 1EOGA 5LCZA 5G1LA 4F03A 4K0NA 3GYKA 3TRXA 5J4UA 3CTFA 5A34B 2DJ2A 4L0WA 2X99A 1S3AA 1K3YA 1KNGA 3EURA 5D8IA 1SL1B 4O5QA 3ERGA 4KGIA 4E8EA 4PQ1A 2JZSA 1H4OA 2DSAA 2MMZA 3TKSA 1M2DA 2X8HA 1FVKA 3NIVA 2HRAA 3PINA 2N5FA 3D6IA 3FR9A 2WCIA 4MH2A 4KA0A 2O8VB 1QFNA 3ME8A 2L6CA 5CNWA 4ECJA 2M46A 3QOUA 4BL7A 4P3YB 2H1DA 2GT6A 1NHOA 2AYTA 1I9DA 1OC8A 4IELA 3F6DA 1XVQA 1GSDA 5ECMB 2HSNA 2Z9SA 1G6YA 1T7PB 4TW5A 2YPMA 3GKMA 2B6MA 1Q4JA 3LW9A 2NPBA 1S3DA 3IAS2 1SVOA 3DIEA 4I2UA 2UZ8A 3KIJA 1SL2B 4WBRD 2AV4A 1LBKA 3R3EA 2DC5A 3DD3A 2WDUA 4HI7A 4WBJA 2JACA 1FOHA 2G0FA 3C7MA 5G2ZA 2IN3A 5IQYA 3HZ8A 1AXDA 4TXOB 3D22A 1T00A 1TP9A 2PVOC 3QFBC 5KOXA 3FRCA 1QXHA 3KMOA 3C8EA 5HR1A 3RDWA 1ABAA 3IHGA 1F3AA 2GSRA 2PN8A 3LGCA 3HJPA 2YZHA 3H79A 1GTBA 4D73B 2ZCTA 2H1AA 3D5JA 1LU4A 1SYXA 3F4SA 1K0DA 4RI6A 1YKCA 4MA9A 3ED3A 4MZWA 5EVOA 2R0CA 2IJYA 1HD2A 1ZGNA 2CVDA 1QK8A 3UVTA 2JZRA 3QD9A 4TKYA 1YDKA 4HQZA 3EC3A 1KEBA 1QUWA 6GSXA 3F4RA 3KCMA 5IPGA 3SWLA 1XWAA 2B5EA 2HRKA 1PQNA 2FLSA 2OBKA 3R2QA 2VL9A 3IC4A 2LNTA 2MMOA 3CRTA 1JFUA 3A2WA 2H73A 5ECHB 4TR0A 5EY6A 4POBA 3RPNA 2F9SA 4XS1A 1PX7A 4MH3A 18GSA 4DSQA 3TGZA 3G7JA 3E0UA 3GRXA 7GSSA 1OC9A 3NOFA 4L5OA 6GSSA 2A2SA 2WZ9A 3J7Yb 5DQSA 3QDNA 1UA5A 1FAAA 2I81A 2GQLA 4NHZA 3QFAC 2CX3A 2HRNA 3L78A 2GQKA 2IMFA 5ECQB 2PVQA 3LQ7A 2HE3A 2WFCA 1OE7A 2GT5A 2R37A 3GNJA 1R4WA 5GAND 3KTBA 2NTOA 4OD7A 1YKAA 1LJRA 2B1LA 3M0FA 4IKHA 3UL3A 3BOAA 2K6VA 4MJBA 2C0EA 2GZYA 4G0IA 5DAKA 1SU9A 4O5RA 5ENUA 1WMJA 2FCHA 3ERWA 1IYHA 5H5RA 4XS4A 4KNDA 1K0NA 4IGJA 3UVHA 4OFTA 4FYUA 3EU4A 2FNOA 1V98A 1GWCA 1M99A 4IJ3A 5AIVA 3VWXA 1XWKA 5J5NA 5CP1A 3P2AA 2BJXA 3APQA 1HNAA 5G5FA 1FVJA 1PL2A 1X5EA 3L4NA 4K1FA 2J9HA 2OT3A 5HR2A 1E6BA 4I97A 2C0DA 2IMEA 4X0XA 5DALB 2PBJA 3DWVA 4OWYA 3BCKA 1GSFA 5A5HB 4ZL9A 4EE0A 3CYNA 4AJ8A 1AAZA 1V57A 2DMMA 1ML6A 5BRTA 1T1VA 4IHUA 5AISA 2X64A 5KN1A 2B1KA 4ZILA 1PKZA 2HI7A 4TN8A 4G0LA 2P5RA 1F2EA 5B6NA 1YVLA 2TRCP 2CZ2A 4FQUA 3GIXA 1SD8A 5B6MA 3BJ5A 1PRXA 4HJ2A 1DE1A 2RUFA 1GULA 1T4ZA 3I43A 5F0GA 1TI3A 2WULA 3KH7A 2F8AA 1DSBA 4JRRA 4ZXGA 2HSHA 5G31A 1DE2A 1X9WB 5HR0A 1S3CA 2X49A 4MJEA 1KBNA 4TVEA 4K6XA 4LLRA 2YWIA 4I8BA 3UBLA 2JADA 4CY6A 1Z7PA 3BCIA 2OACA 1MTCA 5A1NB 4NMUA 5KN2A 5G5EA 3VPQA 1NHYA 2CAQA 2H6XA 1Y6EA 4EKZA 5IM9A 5B7CA 2EFCA 1GSUA 2H6ZA 2JSYA 3FY7A 2LKUA 3ZITA 3TCOA 3HA9A 1R5AA 3DRNA 2DMLA 3QR6A 4ISDA 5CO3A 3EWLA 5JCGA 2VLTA 3RBTA 2YNXA 4K7OA 1XIYA 5ECOB 2LQOA 1RQMA 1BJXA 2CZ3A 3H4KA 2LTKA 3LORA 2GGTA 1JZWA 2KP1A 3CBUA 2EFEA 2G2QA 1YF1A 4KDUA 4MJCA 1EP7A 1ON4A 3GTUB 3GV1A 3GH9A 4OMVA 1O73A 1EGRA 1F3BA 3F0IA 5GAPD 3L9UA 1F6MC 2K8SA 5JWOB 3ZL5A 4MZCA 5H5SA 3KMNA 1GP1A 2IPAA 3VPTA 3CWGA 2GVPA 5HFKA 4MMMA 4KAEA 4ZBDA 2TIRA 4L0UA 2HZFA 1VRSD 2FY6A 3G7IA 2GZPA 4EDYA 4KE3A 5A4VA 3HVXA 3ZMKA 1RW1A 3G7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BVX A;  4K7N A;  3A5W A;  2VM1 A;  4FIW A;  3KTL A;  4Q5R A;  4POK A;  5ECP B;  5A4U A;  2LRT A;  1XXU A;  5KEJ A;  1AW9 A;  5JCW A;  3DVX A;  5CRH A;  4KB3 A;  1XZO A;  1WPI A;  1Z7R A;  1TU8 A;  2O87 A;  1U3A A;  4LL4 B;  4TR1 A;  3ZFB A;  2H0H A;  1SJ6 A;  1EV4 A;  4LMV A;  4NV2 A;  2B7J A;  5IMV A;  2MMA A;  5JWQ B;  3C73 A;  1R7H A;  3GMF A;  2MMN A;  3D0Z A;  2L59 A;  2HLS A;  3L9V A;  1MD3 A;  3VFI A;  1X5D A;  4K9Z A;  1X9S B;  1V2A A;  2XPE A;  1PN9 A;  3EVI A;  3FW2 A;  5IPH A;  4EO3 A;  5G1K A;  3UBK A;  5J9C A;  2REM A;  4BVY A;  3ZIJ A;  2EIR A;  1U6T A;  2CT6 A;  4ILF A;  3HVV A;  2DJ1 A;  2H70 A;  3HYP A;  2FWG A;  4KUN A;  1TTZ A;  2JL4 A;  1YEX A;  4ULX A;  4F0C A;  2MBT A;  2C0F A;  4ZBA A;  4YH2 A;  3FZ5 A;  2DJ0 A;  4MPF A;  1BED A;  3UIW A;  3DEX A;  4N0Z A;  5ABR A;  3F8U A;  2HT9 A;  1GRX A;  2HFD A;  4KCE A;  4KW6 A;  1QMV A;  1BX9 A;  1ZL9 A;  4JR4 A;  2VCX A;  2OKA A;  3C1S A;  4K2D A;  3M8N A;  4LA1 A;  5IOW A;  3C71 A;  3AY8 A;  3QAW A;  4MPG A;  2VM2 A;  2DBC A;  3FK8 A;  3IOS A;  5ELG A;  1JZO A;  2QGV A;  2HSM B;  4AJ6 A;  4XHM A;  4EUY A;  3DVW A;  2HZE B;  2C1Y A;  2P0G A;  4E8H A;  3EMP A;  3TUE A;  2KLX A;  2V1M A;  5EPF A;  3U5R E;  5B8B A;  4V1A p;  1EOH A;  4BWS A;  2H76 A;  2AJQ B;  1O85 A;  4PNF A;  4TOP A;  5ECK B;  2F51 A;  4DSS B;  2KHP A;  3LEF A;  4QL7 A;  2YJH A;  2B5Y A;  1ZZY A;  4PX1 A;  1JLW A;  5IIZ A;  2CVK A;  2XBQ A;  6GSY A;  2YP6 A;  3RAZ A;  5ID2 A;  4G0K A;  3LSZ A;  3Q6O A;  1WWJ A;  3KJY A;  4RI7 A;  2L57 A;  4WXT A;  3L9S A;  5BMU A;  3EIN A;  3WT2 A;  3MDK A;  5KN0 A;  3TJJ A;  2LJR A;  2GZZ A;  2A4V A;  1NSW A;  1PSQ A;  5HQP A;  2YWN A;  5HFI A;  2P31 A;  1SKW B;  3KEB A;  2WJU A;  3O6T A;  5INY A;  1EGO A;  2VL3 A;  1VF4 A;  2IFQ B;  1AQV A;  2MZC A;  1FHE A;  2XPD A;  2GSQ A;  3W8S A;  1XBS A;  3ZRD A;  3P8W A;  2B7K A;  3FR3 A;  2P5Q A;  3G9B A;  5D9X A;  1BG5 A;  2PGT A;  1GSQ A;  4KH7 A;  4EC0 A;  3UOM A;  5HFG A;  2C3Q A;  2JSZ A;  1ZYQ B;  4IJI A;  1M2A A;  1QQ2 A;  1X0R A;  2I3Y A;  2PPT A;  2RM5 A;  1GH2 A;  4K7I A;  1XFL A;  2EIQ A;  5AN1 A;  4FH8 A;  2R3X A;  4NHW A;  20GS A;  2OJL A;  1A2M A;  2RLI A;  5C04 A;  2VCW A;  3S9F A;  1OYJ A;  2IWT A;  4TR3 A;  4GF0 A;  4GWR A;  1K3O A;  2D2Z A;  1OKD A;  1ZMA A;  4GCI A;  4H86 A;  3EYT A;  3WD6 A;  2LQQ A;  3LXZ A;  3VUR A;  1I5G A;  3H93 A;  2DJ3 A;  4ID0 A;  1B9Y C;  4PUR A;  5D9W A;  2GTU A;  4XRD A;  1VF1 A;  3KP9 A;  3LYK A;  2WGR A;  4POL A;  1B8X A;  2AB6 A;  2VIM A;  5AIX A;  5LNK e;  4HZ4 A;  3IA1 A;  2QC7 A;  3I9V 2;  5H5Q A;  3VWW A;  1JLV A;  1THX A;  3GX0 A;  1WIK A;  4ZB9 A;  4JBB A;  2LEG A;  1B4P A;  3TJB A;  2FGX A;  4FYC A;  2DIY A;  4HEA 2;  1J9B A;  4NV5 A;  2HQT A;  1A0R P;  1E2Y A;  3APO A;  1VF3 A;  3WGD A;  1EEM A;  4OO4 A;  1TK8 B;  1XW9 A;  1G0T A;  1MDK A;  2YWO A;  3VK9 A;  2PER A;  1A2J A;  2YJ7 A;  4HJM A;  2JZT A;  1V9W A;  5DQY A;  4X43 A;  2WRT A;  3J7Y k;  5COH A;  1ZOF A;  3EU3 A;  3IXR A;  4ECC A;  19GS A;  3O3T A;  4OCF A;  2YV9 A;  1MD4 A;  3UEM A;  1U87 A;  4G10 A;  4QQ7 A;  8GSS A;  6GST A;  2I1U A;  2KOK A;  5FWG A;  2FA8 A;  2V6O A;  5DJL A;  3KGK A;  1U3I A;  2ON7 A;  2IL3 A;  4X1U A;  4PUA A;  1GSE A;  1N8J A;  1PL1 A;  1BYE A;  1X9M B;  5D9T A;  3EMX A;  2H1B A;  1HQO A;  4K0G A;  4ML6 A;  1B48 A;  1TRS A;  4ML1 A;  3FKF A;  1WJK A;  3P7X A;  2EIO A;  4GLT A;  3F63 A;  4J56 E;  2N5B A;  4Q5F A;  1SKR B;  4O32 A;  1FW1 A;  4V1A g;  1EZK A;  3GH6 A;  5F05 A;  3QAG A;  3A2X A;  4AJ7 A;  2LNS A;  1HNC A;  1ACV A;  1O81 A;  4V2L A;  4I2T A;  4PGT A;  4MAB A;  3TJG A;  2A2R A;  5C00 A;  4WR4 A;  4WF4 A;  4MF7 A;  3F9U A;  2RII A;  4TXO A;  1C72 A;  1MEK A;  1Z6M A;  3QMX A;  3U6V A;  2PUK C;  1WP0 A;  1EEJ A;  1A23 A;  3M3M A;  1J08 A;  5CRE A;  1TRV A;  2DJK A;  2O85 A;  1YJ6 A;  1KTE A;  4CHS A;  1ERW A;  5ECS A;  3VI5 A;  1T4Y A;  2C3N A;  4D73 A;  4HOJ A;  5E4W A;  4FO5 A;  4BWQ A;  5D73 A;  3M9J A;  1UC7 A;  2LJA A;  5DVB A;  1NM3 A;  1T8E B;  1A8Y A;  4KF9 A;  3TRQ A;  4Z7X A;  3IV4 A;  1SJZ A;  4AF2 A;  3IPZ A;  5JWR B;  1U88 A;  2DLX A;  3IBH A;  3PPU A;  4XIH A;  1JZR A;  3MNG A;  3DXB A;  3F3Q A;  4GXZ A;  5CRW A;  4FYB A;  1A0F A;  4KX4 A;  4BL7 B;  4OFM A;  4IN0 A;  3EE2 A;  4J57 E;  3UMA A;  4G19 A;  2L4Q A;  1IYI A;  1OE8 A;  4O92 A;  1WE0 A;  4BPY A;  2HSN B;  1MDJ A;  2FD3 A;  3TKR A;  1SL0 B;  4F9Z A;  4TXV A;  2M72 A;  2FHE A;  4KCA A;  5F07 A;  3ZRE A;  4WR5 A;  4GTU A;  2YAN A;  2H75 A;  3UJ1 A;  4PXO A;  4YAP A;  1ERT A;  3CTG A;  3ZFL A;  2RM6 A;  3WYW A;  4AGS A;  3KM6 A;  1O8W A;  4F2I A;  3US3 A;  4YQM A;  4QL9 A;  2H01 A;  16GS A;  2CAI A;  4ECB A;  2AAW A;  3CXG A;  3TB2 A;  1K0O A;  2E2M A;  1GNE A;  17GS A;  3Q74 A;  2HRF A;  3GFK A;  4LMW A;  2YZU A;  3KZQ A;  4KDY A;  3N9J A;  1W89 A;  3HJO A;  2IMD A;  2C4J A;  5CAX A;  5D93 A;  1Z5Y E;  1YZX A;  2IIY A;  4NWY A;  1G7O A;  1A8L A;  2C8U A;  2HRK B;  2YCD A;  2VL2 C;  2EC4 A;  3TRP A;  2I4A A;  4IP6 A;  3MWH A;  3HZ4 A;  1M7T A;  2H1G A;  2XC2 A;  4PUF C;  2FA4 A;  1SK2 A;  2H71 A;  5DAL A;  2BTO T;  5DCH A;  1HYU A;  2IMI A;  1ERU A;  4JZQ A;  2X8G A;  3GX8 A;  1GTU A;  3HY2 A;  1RK4 A;  1YY7 A;  1YEP A;  2VCT A;  1SK1 A;  5IMZ A;  3TJK A;  5ECN B;  1OC9 B;  3BBY A;  1USB A;  3PH9 A;  4KSO A;  2LJK A;  1ST9 A;  3KP8 A;  3UAR A;  2HSY A;  4WF5 A;  3D21 A;  3N5O A;  1FOV A;  1GLP A;  4NAX A;  3KH9 A;  2XBI A;  3HXS A;  2L5L A;  3IE3 A;  2VOC A;  1WRY A;  2HYX A;  4N11 A;  1TDI A;  1ERV A;  2E0Q A;  4USS A;  1SEN A;  4ZB6 A;  3LJR A;  2R5G A;  1TK0 B;  2H30 A;  1N2A A;  3HD5 A;  4WKW A;  3ZIV A;  4IP1 A;  3APS A;  5DAK B;  4ZBB A;  1DUG A;  1HNB A;  2CQ9 A;  2YOI A;  3TKS C;  4BA7 A;  2NBS A;  4XS4 B;  3DML A;  2V32 A;  3FZ4 A;  5LD0 A;  5JCU A;  3IR4 A;  2YWM A;  3DYR A;  5ECI B;  2GST A;  3E9J B;  12GS A;  5HR3 A;  4L8E A;  1XWB A;  1ILO A;  1WOU A;  1NW2 A;  1TKD B;  2R4V A;  5D96 A;  2X8C A;  1XW6 A;  5E59 A;  1SK0 A;  3NZN A;  4NPB A;  3TDG A;  4TR4 A;  4GQC A;  3ZLP A;  3I6A A;  2RUE A;  4OCE A;  2IMK A;  4ACS A;  5GST A;  2C0G A;  3TOT A;  4HQS A;  1XWG A;  1VF2 A;  5CRD A;  4L5L A;  4EDZ A;  3A3T A;  2L4C A;  3HCZ A;  5IMA A;  4PNG A;  3F6F A;  2E7P A;  5DDL A;  1M9B A;  1ZYE A;  2ALB A;  2B3S A;  3IK7 A;  10GS A;  3GTU A;  1M9A A;  2ON5 A;  1UN2 A;  1MDI A;  2LRN A;  1B4Q A;  3UAP A;  3GKK A;  2V6K A;  4F0B A;  3CSH A;  4ZL8 A;  1GUK A;  4MDC A;  1OVN A;  1A2L A;  2H19 A;  3M9K A;  3ERF A;  2DJJ A;  2O89 A;  3BD2 A;  1TRW A;  1CQG A;  1X5C A;  3P90 A;  3LFL A;  4GST A;  4Q5N A;  1URM A;  5IMC A;  1OAZ A;  3LYP A;  2H74 A;  2YN1 A;  3HDC A;  1W4V A;  2F8F A;  3DGQ A;  1M2B A;  3HVS A;  3GKN A;  2MBS A;  1F37 A;  5ECR B;  2FWE A;  3GN3 A;  2ES7 A;  5J41 A;  2H6Y A;  3H8Q A;  2R6K A;  5F8B A;  1AQX A;  2HNL A;  3ZYW A;  3ZZX A;  4NXI A;  3WGX A;  3QCP A;  1TXX A;  2OE1 A;  3Q18 A;  1Z3E A;  4EL1 A;  3HHV A;  1K0B A;  3LXT A;  1Q98 A;  1Z6N A;  2LS5 A;  4F82 A;  4HU7 A;  5IOX A;  2CVB A;  3KD0 A;  3TKP A;  2OAD A;  3Q19 A;  5CRG A;  3GSS A;  2QKE A;  1XCC A;  4GSN A;  1K3L A;  11GS A;  1Z9H A;  1TJD A;  3HJM A;  3DKS A;  3ZML A;  1AUC A;  2WB9 A;  5IMF A;  4YAV A;  1QGV A;  4MP4 A;  4O7H A;  4I5Q A;  2GSS A;  1CQH A;  2FUG 2;  1OKT A;  1BAY A;  1FG4 A;  1XWC A;  1UVZ A;  1YF0 A;  2WS2 A;  2VD0 A;  6GSW A;  3JCM L;  3TOU A;  3GA4 A;  2VAF A;  2CX4 A;  3LWA A;  3RPP A;  2LRC A;  4IVF A;  5A5K A;  3GL3 A;  1B9X C;  1G7E A;  3IRA A;  1GNW A;  2PMT A;  2F3M A;  1O6J A;  4PTS A;  1H75 A;  5J9B A;  3MSZ A;  4CW9 A;  4MCU A;  2E2G A;  3ME7 A;  3CRU A;  2JU5 A;  3IAM 2;  1GTA A;  3IDV A;  1K0M A;  2NDO A;  4JED A;  1EP8 A;  4MF6 A;  3ZVJ D;  4IQA A;  3WGE A;  1GUH A;  4EVM A;  1JHB A;  4BVX B;  1GSS A;  1TRU A;  3K8N A;  2VLU A;  5IMD A;  3VWV A;  4KDX A;  1PD2 1;  2VCZ A;  1XOB A;  1YQ1 A;  2OA7 A;  2OE0 A;  1F9M A;  2HSM A;  2OBI A;  4XRA A;  2C3T A;  1A24 A;  2HZE A;  2XHF A;  4ZL7 A;  4TR1 B;  4IQ1 A;  3F4T A;  4MLY A;  3FEU A;  4HU9 A;  3A2V A;  5D9V A;  3PGT A;  3L0H A;  4DSS A;  4K8M A;  2GQM A;  4YQV A;  2ZUP A;  3F3R A;  3TKQ A;  2GLR A;  4N0V A;  4MF5 A;  2HXK A;  5KN3 A;  2YV7 A;  1O8X A;  3PR8 A;  2L6D A;  2VD1 A;  3LG6 A;  2V2G A;  3KXO A;  1XW5 A;  3IK9 A;  1PGT A;  2VCQ A;  6GSU A;  2AHE A;  2J23 A;  3ISO A;  1SJI A;  1K0C A;  4HS1 A;  1XVW A;  1T3B A;  1O7U A;  4BVY B;  4XTS A;  3C1R A;  2GDR A;  1AIU A;  3VI7 A;  3TJF A;  2N5A A;  1EWX A;  2AUV A;  2H72 A;  4G9H A;  2NVL A;  1GTI A;  3QPM A;  1SD9 A;  4V2M A;  3IHQ A;  2IFQ A;  1PKW A;  5G30 A;  2KP2 A;  1FB6 A;  3GUR A;  2L5O A;  3HKR A;  3GST A;  3GKX A;  4I6X A;  2LST A;  1BQ7 A;  2O7K A;  3FR6 A;  1SKS B;  5AGY A;  3CSI A;  4PQI A;  4XCS A;  3D4M A;  4EF0 A;  3RHB A;  1XOA A;  1R5P A;  6GSV A;  5EL8 A;  4EXJ A;  3O76 A;  14GS A;  4OO5 A;  4MK3 A;  3ZTL A;  5ELA A;  1AC1 A;  1FO5 A;  2QSI A;  2BMX A;  3GL5 A;  2K18 A;  2R2J A;  2K8V A;  1FB0 A;  3CMI A;  1TW9 A;  1M0U A;  5DCG A;  1TU7 A;  5L71 A;  5J3R A;  1PA3 A;  4RQR A;  1PMT A;  2TRX A;  1K0A A;  1GSY A;  3ZVJ A;  4IW9 A;  1J0F A;  3TKS E;  2LUS A;  4POM A;  1XPV A;  3CSJ A;  2H8L A;  4N10 A;  1TK5 B;  4MJA A;  4TRX A;  2PU9 C;  4PQH A;  13GS A;  2CV4 A;  2VLV A;  1DBY A;  5IO0 A;  2H0I A;  4JE1 A;  4DSR A;  1R26 A;  4V2N A;  5ID2 B;  3QAV A;  4XS6 A;  4ECI A;  3VWU A;  4WEY A;  5DBQ A;  5B8A A;  4ZIJ A;  2DIZ A;  1OC3 A;  3W8J A;  3OR5 A;  4ZB8 A;  5GZZ B;  1GLQ A;  4GSS A;  2H0G A;  4GQF A;  4LL1 B;  4CDO A;  4IS0 A;  1SYR A;  5A4W A;  2B5X A;  3SBC A;  2H66 A;  3MAK A;  2PWJ A;  4WET A;  2FWF A;  1TI1 A;  4KSM A;  2LV3 A;  5CYY A;  1JZD A;  4RUV A;  4IBP A;  1V58 A;  3V1W A;  5ECL B;  2I9H A;  5FT3 A;  2C80 A;  2M80 A;  4HZ2 A;  2MYG A;  1VGL A;  4HUA A;  2FWH A;  3FZA A;  1PX6 A;  3I69 A;  2VUP A;  1AQW A;  3WT1 A;  4Q5Q A;  2VO4 A;  22GS A;  1V40 A;  4RQX A;  1GL8 A;  4OFN A;  1Y25 A;  3VLN A;  4YQU A;  2ZNM A;  5GSS A;  4DVC A;  3H1N A;  4J2F A;  3W6G A;  4JR6 A;  2K9F A;  1GUM A;  5FHI A;  3IC8 A;  2OE3 A;  2GS3 A;  2VL2 A;  5DJM A;  4G2E A;  5IO2 A;  3FYG A;  3M1G A;  4DEJ A;  4HDE A;  1TOF A;  2VCV A;  2KUC A;  3D4T A;  1THO A;  2CA8 A;  4GRF A;  4MZB A;  3GUS A;  3RHC A;  1ZCP A;  2V41 A;  4N30 A;  3E3E A;  3GHA A;  4JU5 A;  1EV9 A;  3FHK A;  5F06 A;  9GSS A;  1G6W A;  3FZ9 A;  1EOG A;  5LCZ A;  5G1L A;  4F03 A;  4K0N A;  3GYK A;  3TRX A;  5J4U A;  3CTF A;  2DJ2 A;  4L0W A;  2X99 A;  1S3A A;  1K3Y A;  1KNG A;  3EUR A;  5D8I A;  1SL1 B;  3ERG A;  4KGI A;  4E8E A;  4PQ1 A;  2JZS A;  1H4O A;  2DSA A;  2MMZ A;  3TKS A;  1M2D A;  2X8H A;  1FVK A;  3NIV A;  2HRA A;  3PIN A;  2N5F A;  3D6I A;  3FR9 A;  2WCI A;  4MH2 A;  4KA0 A;  2O8V B;  1QFN A;  3ME8 A;  2L6C A;  5CNW A;  4ECJ A;  2M46 A;  3QOU A;  4BL7 A;  4P3Y B;  2H1D A;  2GT6 A;  1NHO A;  2AYT A;  1I9D A;  1OC8 A;  4IEL A;  3F6D A;  1XVQ A;  1GSD A;  5ECM B;  2Z9S A;  1G6Y A;  1T7P B;  4TW5 A;  2YPM A;  3GKM A;  2B6M A;  1Q4J A;  2NPB A;  1S3D A;  3IAS 2;  4I2U A;  3DIE A;  2UZ8 A;  3KIJ A;  1SL2 B;  4WBR D;  2AV4 A;  1LBK A;  3R3E A;  2DC5 A;  3DD3 A;  2WDU A;  4HI7 A;  4WBJ A;  2JAC A;  2G0F A;  3C7M A;  5G2Z A;  2IN3 A;  5IQY A;  3HZ8 A;  1AXD A;  4TXO B;  3D22 A;  1T00 A;  1TP9 A;  2PVO C;  3QFB C;  3FRC A;  1QXH A;  3KMO A;  3C8E A;  5HR1 A;  3RDW A;  1ABA A;  1F3A A;  2GSR A;  2PN8 A;  3LGC A;  3HJP A;  2YZH A;  3H79 A;  1GTB A;  4D73 B;  2ZCT A;  2H1A A;  3D5J A;  1LU4 A;  1SYX A;  3F4S A;  1K0D A;  4RI6 A;  1YKC A;  4MA9 A;  3ED3 A;  4MZW A;  5EVO A;  2IJY A;  1HD2 A;  1ZGN A;  2CVD A;  1QK8 A;  3UVT A;  2JZR A;  3QD9 A;  4TKY A;  1YDK A;  4HQZ A;  3EC3 A;  1KEB A;  1QUW A;  6GSX A;  3F4R A;  3KCM A;  5IPG A;  3SWL A;  1XWA A;  2B5E A;  2HRK A;  1PQN A;  2FLS A;  2OBK A;  3R2Q A;  2VL9 A;  3IC4 A;  2LNT A;  2MMO A;  3CRT A;  1JFU A;  3A2W A;  2H73 A;  5ECH B;  4TR0 A;  5EY6 A;  4POB A;  3RPN A;  2F9S A;  4XS1 A;  1PX7 A;  4MH3 A;  18GS A;  4DSQ A;  3TGZ A;  3G7J A;  3E0U A;  3GRX A;  7GSS A;  1OC9 A;  3NOF A;  4L5O A;  6GSS A;  2A2S A;  2WZ9 A;  3J7Y b;  5DQS A;  3QDN A;  1UA5 A;  1FAA A;  2I81 A;  2GQL A;  4NHZ A;  3QFA C;  2CX3 A;  2HRN A;  3L78 A;  2GQK A;  2IMF A;  5ECQ B;  2PVQ A;  3LQ7 A;  2HE3 A;  2WFC A;  1OE7 A;  2GT5 A;  2R37 A;  3GNJ A;  1R4W A;  5GAN D;  3KTB A;  2NTO A;  4OD7 A;  1YKA A;  1LJR A;  2B1L A;  3M0F A;  4IKH A;  3UL3 A;  3BOA A;  2K6V A;  4MJB A;  2C0E A;  2GZY A;  4G0I A;  5DAK A;  1SU9 A;  4O5R A;  5ENU A;  1WMJ A;  2FCH A;  3ERW A;  1IYH A;  5H5R A;  4XS4 A;  4KND A;  1K0N A;  4IGJ A;  3UVH A;  4OFT A;  4FYU A;  3EU4 A;  2FNO A;  1V98 A;  1GWC A;  1M99 A;  4IJ3 A;  5AIV A;  3VWX A;  1XWK A;  5J5N A;  5CP1 A;  3P2A A;  2BJX A;  3APQ A;  1HNA A;  5G5F A;  1FVJ A;  1PL2 A;  1X5E A;  3L4N A;  4K1F A;  2J9H A;  5HR2 A;  1E6B A;  4I97 A;  2C0D A;  2IME A;  4X0X A;  5DAL B;  2PBJ A;  3DWV A;  4OWY A;  3BCK A;  1GSF A;  4ZL9 A;  4EE0 A;  3CYN A;  4AJ8 A;  1AAZ A;  1V57 A;  2DMM A;  1ML6 A;  1T1V A;  4IHU A;  5AIS A;  2X64 A;  5KN1 A;  2B1K A;  4ZIL A;  1PKZ A;  2HI7 A;  4TN8 A;  4G0L A;  2P5R A;  1F2E A;  5B6N A;  2TRC P;  2CZ2 A;  4FQU A;  3GIX A;  1SD8 A;  5B6M A;  3BJ5 A;  1PRX A;  4HJ2 A;  1DE1 A;  2RUF A;  1GUL A;  1T4Z A;  3I43 A;  5F0G A;  1TI3 A;  2WUL A;  3KH7 A;  2F8A A;  1DSB A;  4JRR A;  4ZXG A;  2HSH A;  5G31 A;  1DE2 A;  1X9W B;  5HR0 A;  1S3C A;  4MJE A;  1KBN A;  4TVE A;  4K6X A;  4LLR A;  2YWI A;  4I8B A;  3UBL A;  2JAD A;  1Z7P A;  3BCI A;  2OAC A;  1MTC A;  4NMU A;  5KN2 A;  5G5E A;  3VPQ A;  1NHY A;  2CAQ A;  2H6X A;  1Y6E A;  4EKZ A;  5IM9 A;  5B7C A;  1GSU A;  2H6Z A;  2JSY A;  3FY7 A;  2LKU A;  3ZIT A;  3TCO A;  3HA9 A;  1R5A A;  3DRN A;  2DML A;  3QR6 A;  4ISD A;  5CO3 A;  3EWL A;  5JCG A;  2VLT A;  3RBT A;  2YNX A;  4K7O A;  1XIY A;  5ECO B;  2LQO A;  1RQM A;  1BJX A;  2CZ3 A;  3H4K A;  2LTK A;  3LOR A;  2GGT A;  1JZW A;  2KP1 A;  3CBU A;  2G2Q A;  1YF1 A;  4KDU A;  4MJC A;  1EP7 A;  1ON4 A;  3GTU B;  3GV1 A;  3GH9 A;  4OMV A;  1O73 A;  1EGR A;  1F3B A;  3F0I A;  5GAP D;  3L9U A;  1F6M C;  2K8S A;  5JWO B;  3ZL5 A;  4MZC A;  5H5S A;  3KMN A;  1GP1 A;  2IPA A;  3VPT A;  2GVP A;  5HFK A;  4MMM A;  4KAE A;  4ZBD A;  2TIR A;  4L0U A;  2HZF A;  1VRS D;  2FY6 A;  3G7I A;  2GZP A;  4EDY A;  4KE3 A;  5A4V A;  3HVX A;  3ZMK A;  1RW1 A;  3G7Y A; 
#chains in the Genus database with same CATH topology
 4BVX A;  4K7N A;  3A5W A;  2VM1 A;  4FIW A;  3KTL A;  4Q5R A;  4POK A;  5ECP B;  5A4U A;  2LRT A;  1XXU A;  5KEJ A;  1AW9 A;  5JCW A;  3DVX A;  5CRH A;  4KB3 A;  1XZO A;  1WPI A;  1Z7R A;  1TU8 A;  2O87 A;  1U3A A;  4LL4 B;  4TR1 A;  3ZFB A;  2H0H A;  1SJ6 A;  1EV4 A;  4LMV A;  4NV2 A;  2B7J A;  4AKG A;  5IMV A;  2MMA A;  5JWQ B;  3C73 A;  1R7H A;  3GMF A;  2MMN A;  3D0Z A;  1BG1 A;  2L59 A;  2HLS A;  3L9V A;  1MD3 A;  3VFI A;  1X5D A;  4K9Z A;  1X9S B;  1V2A A;  2XPE A;  1PN9 A;  3EVI A;  3FW2 A;  5IPH A;  4EO3 A;  5G1K A;  2H1L A;  3UBK A;  4AKH A;  5J9C A;  2REM A;  4BVY A;  3ZIJ A;  2EIR A;  1U6T A;  2CT6 A;  4ILF A;  3HVV A;  3HMJ G;  2DJ1 A;  2H70 A;  3HYP A;  2FWG A;  4KUN A;  1TTZ A;  2JL4 A;  1YEX A;  4ULX A;  4F0C A;  2MBT A;  2C0F A;  4ZBA A;  4YH2 A;  3FZ5 A;  2DJ0 A;  4MPF A;  1BED A;  3UIW A;  3DEX A;  4N0Z A;  1Y1U A;  5ABR A;  3F8U A;  2HT9 A;  1GRX A;  2HFD A;  4KCE A;  4KW6 A;  1QMV A;  1BX9 A;  1ZL9 A;  4JR4 A;  2VCX A;  2OKA A;  3C1S A;  4K2D A;  3M8N A;  4LA1 A;  5IOW A;  3C71 A;  3AY8 A;  3QAW A;  4YKF A;  4MPG A;  2VM2 A;  2DBC A;  3FK8 A;  3IOS A;  5ELG A;  1JZO A;  2QGV A;  2HSM B;  4AJ6 A;  4XHM A;  4EUY A;  3DVW A;  2HZE B;  2C1Y A;  2P0G A;  4E8H A;  3EMP A;  3TUE A;  2KLX A;  2V1M A;  5EPF A;  3U5R E;  5B8B A;  4V1A p;  1EOH A;  4BWS A;  2H76 A;  2AJQ B;  1O85 A;  4PNF A;  4TOP A;  5ECK B;  2F51 A;  4DSS B;  2KHP A;  3LEF A;  4QL7 A;  4AKX B;  2YJH A;  2B5Y A;  1ZZY A;  4PX1 A;  1JLW A;  5IIZ A;  2CVK A;  2XBQ A;  6GSY A;  2YP6 A;  3RAZ A;  2WW3 A;  5ID2 A;  4G0K A;  3LSZ A;  3Q6O A;  1WWJ A;  3KJY A;  4RI7 A;  2L57 A;  4WXT A;  3L9S A;  5BMU A;  3EIN A;  3WT2 A;  3MDK A;  5KN0 A;  3TJJ A;  2LJR A;  2GZZ A;  2A4V A;  1NSW A;  3MYD A;  1PSQ A;  5HQP A;  2EFH A;  2YWN A;  2WVZ A;  5HFI A;  2P31 A;  4EIQ A;  4FXY P;  3KEB A;  1SKW B;  2WJU A;  2O36 A;  3O6T A;  5INY A;  1EGO A;  2VL3 A;  1VF4 A;  2IFQ B;  1AQV A;  2MZC A;  1FHE A;  2XPD A;  2GSQ A;  3W8S A;  1XBS A;  3ZRD A;  3P8W A;  2B7K A;  3FR3 A;  2P5Q A;  3G9B A;  5D9X A;  1BG5 A;  2PGT A;  1GSQ A;  4KH7 A;  4EC0 A;  3UOM A;  4QMK A;  5HFG A;  2C3Q A;  2JSZ A;  1ZYQ B;  4IJI A;  2A2P A;  1M2A A;  1QQ2 A;  1X0R A;  2I3Y A;  2PPT A;  2RM5 A;  1GH2 A;  4K7I A;  1XFL A;  2EIQ A;  5AN1 A;  4FH8 A;  2R3X A;  4NHW A;  20GS A;  2OJL A;  1A2M A;  2RLI A;  5C04 A;  2VCW A;  3S9F A;  1OYJ A;  2IWT A;  4TR3 A;  4GF0 A;  4GWR A;  1K3O A;  2D2Z A;  1OKD A;  1ZMA A;  4GCI A;  3EYT A;  3WD6 A;  4H86 A;  2LQQ A;  2X4A A;  3LXZ A;  3VUR A;  1I5G A;  2QA2 A;  3H93 A;  2DJ3 A;  4ID0 A;  1B9Y C;  4PUR A;  5D9W A;  2GTU A;  4XRD A;  1VF1 A;  3KP9 A;  3LYK A;  2WGR A;  4POL A;  1B8X A;  2AB6 A;  2VIM A;  5AIX A;  4PI0 C;  5LNK e;  4HZ4 A;  3IA1 A;  2QC7 A;  3I9V 2;  5H5Q A;  3VWW A;  1JLV A;  1THX A;  3GX0 A;  1WIK A;  4ZB9 A;  4JBB A;  2LEG A;  1B4P A;  3TJB A;  2FGX A;  4FYC A;  2DIY A;  4HEA 2;  1J9B A;  4NV5 A;  2HQT A;  1A0R P;  1E2Y A;  3FMW A;  4X4J A;  3APO A;  1VF3 A;  3WGD A;  1EEM A;  4OO4 A;  1TK8 B;  1XW9 A;  1G0T A;  1MDK A;  2YWO A;  3VK9 A;  2PER A;  3MIX A;  1A2J A;  2YJ7 A;  4HJM A;  2JZT A;  1V9W A;  5DQY A;  4X43 A;  4Z2T A;  2WRT A;  3J7Y k;  5A34 A;  5COH A;  1ZOF A;  3EU3 A;  3IXR A;  4ECC A;  19GS A;  3O3T A;  4OCF A;  2YV9 A;  1MD4 A;  3UEM A;  1U87 A;  4G10 A;  4QQ7 A;  8GSS A;  6GST A;  1ZYN A;  2I1U A;  2KOK A;  2FA8 A;  5FWG A;  2V6O A;  5DJL A;  3KGK A;  1U3I A;  2ON7 A;  2IL3 A;  4X1U A;  4PUA A;  1GSE A;  1N8J A;  1PL1 A;  1BYE A;  1X9M B;  5D9T A;  3EMX A;  1N25 A;  2H1B A;  1HQO A;  4K0G A;  4ML6 A;  1B48 A;  1TRS A;  4ML1 A;  3FKF A;  1WJK A;  3P7X A;  2EIO A;  4GLT A;  3F63 A;  4J56 E;  2N5B A;  4Q5F A;  1SKR B;  4O32 A;  1FW1 A;  4V1A g;  1EZK A;  3GH6 A;  5F05 A;  3QAG A;  3A2X A;  4AJ7 A;  2LNS A;  1HNC A;  1ACV A;  1O81 A;  4V2L A;  4I2T A;  4PGT A;  4MAB A;  3TJG A;  2A2R A;  5C00 A;  4WR4 A;  4WF4 A;  4MF7 A;  3F9U A;  2RII A;  4TXO A;  1C72 A;  1MEK A;  1Z6M A;  3QMX A;  3U6V A;  2PUK C;  1WP0 A;  1EEJ A;  1A23 A;  3M3M A;  1J08 A;  5CRE A;  1TRV A;  2DJK A;  2O85 A;  1YJ6 A;  1KTE A;  4CHS A;  1ERW A;  4N3Z A;  4GDF A;  5ECS A;  4W66 A;  3VI5 A;  1T4Y A;  2C3N A;  4D73 A;  4HOJ A;  5E4W A;  4FO5 A;  4BWQ A;  5D73 A;  4Z2U A;  3M9J A;  1UC7 A;  2LJA A;  4YKG A;  5DVB A;  1NM3 A;  1T8E B;  1A8Y A;  4KF9 A;  3TRQ A;  4Z7X A;  3IV4 A;  4ZB7 A;  1SJZ A;  4AF2 A;  3IPZ A;  5JWR B;  1U88 A;  2DLX A;  3IBH A;  3PPU A;  4XIH A;  1JZR A;  1SVL A;  3MNG A;  3DXB A;  3F3Q A;  4GXZ A;  5CRW A;  4FYB A;  1A0F A;  1ZYP A;  4KX4 A;  4BL7 B;  4OFM A;  4IN0 A;  3EE2 A;  4J57 E;  3UMA A;  4G19 A;  4CY8 A;  2L4Q A;  1IYI A;  1OE8 A;  4O92 A;  1WE0 A;  4BPY A;  2HSN B;  1MDJ A;  2FD3 A;  3TKR A;  1SL0 B;  4F9Z A;  4TXV A;  2M72 A;  2FHE A;  4KCA A;  5F07 A;  3ZRE A;  4WR5 A;  4GTU A;  2YAN A;  2H75 A;  3UJ1 A;  4PXO A;  4YAP A;  1ERT A;  3CTG A;  3ZFL A;  2RM6 A;  3WYW A;  4AGS A;  3KM6 A;  1O8W A;  4F2I A;  3US3 A;  4E68 A;  4YQM A;  4QL9 A;  2H01 A;  16GS A;  2CAI A;  4ECB A;  1XG8 A;  2AAW A;  3CXG A;  3TB2 A;  1K0O A;  2E2M A;  1GNE A;  17GS A;  3Q74 A;  2HRF A;  3GFK A;  4LMW A;  2YZU A;  3KZQ A;  4KDY A;  3N9J A;  1W89 A;  3HJO A;  2IMD A;  2C4J A;  4MNN A;  5CAX A;  5D93 A;  1Z5Y E;  2EFD A;  1YZX A;  2IIY A;  4NWY A;  1G7O A;  1A8L A;  2WVX B;  4K5S A;  2C8U A;  2HRK B;  2YCD A;  2VL2 C;  2EC4 A;  3TRP A;  2I4A A;  4IP6 A;  3MWH A;  3HZ4 A;  1M7T A;  2H1G A;  2XC2 A;  4PUF C;  2FA4 A;  4K2X A;  4K5R A;  1SK2 A;  2H71 A;  5DAL A;  2BTO T;  5DCH A;  1HYU A;  2IMI A;  1ERU A;  4JZQ A;  2X8G A;  3GX8 A;  1GTU A;  3HY2 A;  1RK4 A;  1YY7 A;  1YEP A;  2VCT A;  1SK1 A;  5IMZ A;  3TJK A;  5ECN B;  1OC9 B;  3BBY A;  1USB A;  3PH9 A;  4KSO A;  1I1I P;  2LJK A;  1ST9 A;  3KP8 A;  3UAR A;  2HSY A;  4WF5 A;  3D21 A;  3N5O A;  1FOV A;  1GLP A;  4NAX A;  4Z2R A;  3KH9 A;  2XBI A;  3HXS A;  2L5L A;  3IE3 A;  2VOC A;  1WRY A;  2HYX A;  4N11 A;  1TDI A;  4ICY A;  1ERV A;  2E0Q A;  4USS A;  1SEN A;  4ZB6 A;  5KOW A;  3LJR A;  2R5G A;  1TK0 B;  2H30 A;  1N2A A;  3HD5 A;  4WKW A;  3ZIV A;  4IP1 A;  3APS A;  2UV8 G;  5DAK B;  4ZBB A;  1DUG A;  1HNB A;  2CQ9 A;  2YOI A;  3TKS C;  4BA7 A;  2NBS A;  4XS4 B;  3DML A;  2V32 A;  3FZ4 A;  5LD0 A;  5JCU A;  3IR4 A;  2YWM A;  3DYR A;  5ECI B;  2GST A;  3E9J B;  12GS A;  5HR3 A;  4EIP A;  4L8E A;  1XWB A;  1ILO A;  1WOU A;  5A1N A;  1NW2 A;  1TKD B;  2R4V A;  4O5U A;  5D96 A;  2X8C A;  1XW6 A;  5E59 A;  1SK0 A;  3NZN A;  4NPB A;  3TDG A;  4TR4 A;  4GQC A;  3EPT A;  3ZLP A;  3I6A A;  2RUE A;  4OCE A;  2A4H A;  2IMK A;  4ACS A;  5GST A;  2C0G A;  3TOT A;  4HQS A;  1XWG A;  1VF2 A;  5CRD A;  4L5L A;  4EDZ A;  3A3T A;  2L4C A;  3HCZ A;  5IMA A;  5J4V A;  4PNG A;  3F6F A;  2E7P A;  5DDL A;  1M9B A;  1ZYE A;  2ALB A;  2B3S A;  3IK7 A;  10GS A;  3GTU A;  1M9A A;  2ON5 A;  1UN2 A;  1MDI A;  2LRN A;  2R0G A;  1B4Q A;  3UAP A;  3GKK A;  2V6K A;  4F0B A;  3CSH A;  4ZL8 A;  1GUK A;  4MDC A;  1OVN A;  1A2L A;  2H19 A;  3M9K A;  3ERF A;  2DJJ A;  2O89 A;  3BD2 A;  1TRW A;  1CQG A;  1X5C A;  3P90 A;  3LFL A;  4GST A;  1YEW C;  4Q5N A;  1URM A;  5IMC A;  1OAZ A;  3LYP A;  2H74 A;  2YN1 A;  3HDC A;  2O5V A;  1W4V A;  2F8F A;  3DGQ A;  1M2B A;  3HVS A;  3GKN A;  2MBS A;  1F37 A;  5ECR B;  2FWE A;  3GN3 A;  2ES7 A;  2DKH A;  5J41 A;  2H6Y A;  3H8Q A;  2R6K A;  5F8B A;  1AQX A;  2HNL A;  3ZYW A;  3ZZX A;  4NXI A;  3WGX A;  3QCP A;  1TXX A;  4PHZ C;  2OE1 A;  3Q18 A;  1Z3E A;  4EL1 A;  3HHV A;  1K0B A;  3LXT A;  1Q98 A;  1Z6N A;  2LS5 A;  4F82 A;  4HU7 A;  5IOX A;  2CVB A;  3KD0 A;  3TKP A;  2OAD A;  3Q19 A;  5CRG A;  3GSS A;  2QKE A;  1XCC A;  4GSN A;  1K3L A;  11GS A;  1Z9H A;  1TJD A;  3HJM A;  3DKS A;  3ZML A;  1M3I A;  1AUC A;  2WB9 A;  5IMF A;  4YAV A;  1QGV A;  4MP4 A;  4O7H A;  4I5Q A;  2GSS A;  1CQH A;  2FUG 2;  1OKT A;  1BAY A;  1FG4 A;  1XWC A;  1UVZ A;  2R0P A;  1YF0 A;  2WS2 A;  2VD0 A;  6GSW A;  3JCM L;  3TOU A;  3GA4 A;  2VAF A;  2CX4 A;  2VKZ G;  3LWA A;  3RPP A;  2LRC A;  4IVF A;  5A5K A;  3GL3 A;  3TU3 B;  1B9X C;  1G7E A;  3IRA A;  1GNW A;  2PMT A;  2F3M A;  1O6J A;  4PTS A;  1H75 A;  5J9B A;  3MSZ A;  4CW9 A;  4MCU A;  2E2G A;  3ME7 A;  3CRU A;  2JU5 A;  5J47 A;  3IAM 2;  1GTA A;  3IDV A;  1K0M A;  2NDO A;  4JED A;  1EP8 A;  4MF6 A;  3ZVJ D;  4IQA A;  3WGE A;  1GUH A;  4EVM A;  1JHB A;  4BVX B;  1GSS A;  3RGB C;  1TRU A;  3K8N A;  2VLU A;  5IMD A;  3VWV A;  4KDX A;  1PD2 1;  2DKI A;  2VCZ A;  1XOB A;  1YQ1 A;  2OA7 A;  2OE0 A;  1F9M A;  2HSM A;  2OBI A;  4XRA A;  2C3T A;  4A5P A;  1A24 A;  2HZE A;  2XHF A;  4ZL7 A;  4TR1 B;  4IQ1 A;  3F4T A;  4MLY A;  3FEU A;  4HU9 A;  3A2V A;  5D9V A;  2WW1 A;  1TXU A;  3PGT A;  3L0H A;  4DSS A;  4K8M A;  2GQM A;  4YQV A;  2ZUP A;  3F3R A;  3TKQ A;  2GLR A;  4N0V A;  4MF5 A;  2HXK A;  5KN3 A;  2YV7 A;  1O8X A;  3PR8 A;  2L6D A;  1BF5 A;  2VD1 A;  3LG6 A;  2V2G A;  3KXO A;  1XW5 A;  3IK9 A;  1S3R A;  1PGT A;  2VCQ A;  5J40 A;  6GSU A;  2AHE A;  2J23 A;  3ISO A;  1SJI A;  1K0C A;  4HS1 A;  1XVW A;  1T3B A;  1O7U A;  4BVY B;  4XTS A;  3C1R A;  2GDR A;  1AIU A;  3VI7 A;  3TJF A;  2N5A A;  1EWX A;  2AUV A;  2H72 A;  4G9H A;  2NVL A;  1GTI A;  3QPM A;  1SD9 A;  4V2M A;  3IHQ A;  2IFQ A;  1PKW A;  5G30 A;  2KP2 A;  1FB6 A;  3GUR A;  2L5O A;  3HKR A;  3GST A;  3GKX A;  4I6X A;  1SVM A;  2WW0 A;  2LST A;  1BQ7 A;  2O7K A;  3FR6 A;  1SKS B;  5AGY A;  3CSI A;  4PQI A;  4XCS A;  3D4M A;  4EF0 A;  3RHB A;  1XOA A;  1R5P A;  6GSV A;  5EL8 A;  4EXJ A;  3O76 A;  14GS A;  4OO5 A;  4MK3 A;  3ZTL A;  5ELA A;  1AC1 A;  1FO5 A;  2QSI A;  2BMX A;  3GL5 A;  2K18 A;  2R2J A;  2K8V A;  1FB0 A;  3CMI A;  1TW9 A;  1M0U A;  5DCG A;  1TU7 A;  5L71 A;  5J3R A;  1PA3 A;  4RQR A;  1PMT A;  2TRX A;  1K0A A;  1GSY A;  3ZVJ A;  4IW9 A;  1J0F A;  3TKS E;  2LUS A;  4POM A;  1XPV A;  3CSJ A;  2H8L A;  4N10 A;  2WVY A;  1TK5 B;  4MJA A;  4TRX A;  2PU9 C;  4PQH A;  13GS A;  2CV4 A;  2VLV A;  1DBY A;  5IO0 A;  2H0I A;  4JE1 A;  4DSR A;  1R26 A;  4V2N A;  5ID2 B;  3QAV A;  4XS6 A;  4ECI A;  3VWU A;  4WEY A;  5DBQ A;  5BMU B;  5B8A A;  4ZIJ A;  2DIZ A;  1OC3 A;  3W8J A;  3OR5 A;  4ZB8 A;  5GZZ B;  1GLQ A;  4GSS A;  2H0G A;  4GQF A;  4LL1 B;  4CDO A;  4IS0 A;  1SYR A;  5A4W A;  2B5X A;  3SBC A;  2H66 A;  3MAK A;  2PWJ A;  4WET A;  2FWF A;  3CQF A;  1TI1 A;  4KSM A;  2LV3 A;  5CYY A;  5J4Y A;  1JZD A;  4RUV A;  4IBP A;  1V58 A;  3V1W A;  5ECL B;  2I9H A;  5FT3 A;  4G01 A;  2C80 A;  2M80 A;  4HZ2 A;  2MYG A;  1VGL A;  4HUA A;  4AI6 A;  2FWH A;  3FZA A;  1PX6 A;  3I69 A;  2VUP A;  3A5I A;  1AQW A;  3WT1 A;  4Q5Q A;  2VO4 A;  22GS A;  1V40 A;  4RQX A;  1GL8 A;  4OFN A;  1Y25 A;  3VLN A;  4YQU A;  2ZNM A;  5GSS A;  4DVC A;  3H1N A;  4J2F A;  3W6G A;  4JR6 A;  2K9F A;  1GUM A;  5FHI A;  4AKI A;  3IC8 A;  1M3J A;  2OE3 A;  2GS3 A;  2VL2 A;  5DJM A;  5A5H A;  4G2E A;  5IO2 A;  3FYG A;  3M1G A;  4DEJ A;  4HDE A;  1TOF A;  2VCV A;  2QA1 A;  1PN0 A;  2KUC A;  3D4T A;  1THO A;  2CA8 A;  4GRF A;  4MZB A;  3GUS A;  3RHC A;  1ZCP A;  2V41 A;  4N30 A;  3E3E A;  3GHA A;  4JU5 A;  1EV9 A;  3FHK A;  5F06 A;  9GSS A;  1G6W A;  3FZ9 A;  1EOG A;  5LCZ A;  5G1L A;  4F03 A;  4K0N A;  3GYK A;  3TRX A;  5J4U A;  3CTF A;  5A34 B;  2DJ2 A;  4L0W A;  2WW2 A;  2X99 A;  1S3A A;  1K3Y A;  1KNG A;  3EUR A;  5D8I A;  1SL1 B;  4O5Q A;  3ERG A;  4KGI A;  4E8E A;  4PQ1 A;  2JZS A;  1H4O A;  2DSA A;  2MMZ A;  3TKS A;  1M2D A;  2X8H A;  1FVK A;  3NIV A;  2HRA A;  3PIN A;  2N5F A;  3D6I A;  3FR9 A;  2WCI A;  4MH2 A;  4KA0 A;  2O8V B;  1QFN A;  3ME8 A;  2L6C A;  5CNW A;  4ECJ A;  2M46 A;  3QOU A;  4BL7 A;  4P3Y B;  2H1D A;  2GT6 A;  1NHO A;  2AYT A;  1I9D A;  1OC8 A;  4IEL A;  3F6D A;  1XVQ A;  1GSD A;  5ECM B;  2HSN A;  2Z9S A;  1G6Y A;  1T7P B;  4TW5 A;  2YPM A;  3GKM A;  2B6M A;  1Q4J A;  3LW9 A;  2NPB A;  1S3D A;  3IAS 2;  1SVO A;  3DIE A;  4I2U A;  2UZ8 A;  3KIJ A;  1SL2 B;  4WBR D;  2AV4 A;  1LBK A;  3R3E A;  2DC5 A;  3DD3 A;  2WDU A;  4HI7 A;  4WBJ A;  2JAC A;  1FOH A;  2G0F A;  3C7M A;  5G2Z A;  2IN3 A;  5IQY A;  3HZ8 A;  1AXD A;  4TXO B;  3D22 A;  1T00 A;  1TP9 A;  2PVO C;  3QFB C;  5KOX A;  3FRC A;  1QXH A;  3KMO A;  3C8E A;  5HR1 A;  3RDW A;  1ABA A;  3IHG A;  1F3A A;  2GSR A;  2PN8 A;  3LGC A;  3HJP A;  2YZH A;  3H79 A;  1GTB A;  4D73 B;  2ZCT A;  2H1A A;  3D5J A;  1LU4 A;  1SYX A;  3F4S A;  1K0D A;  4RI6 A;  3RFR C;  1YKC A;  4MA9 A;  3ED3 A;  4MZW A;  5EVO A;  2R0C A;  2IJY A;  1HD2 A;  1ZGN A;  2CVD A;  1QK8 A;  3UVT A;  2JZR A;  3QD9 A;  4TKY A;  1YDK A;  4HQZ A;  3EC3 A;  1KEB A;  1QUW A;  6GSX A;  3F4R A;  3KCM A;  5IPG A;  3SWL A;  1XWA A;  2WVX A;  2B5E A;  2HRK A;  1PQN A;  2FLS A;  2OBK A;  3R2Q A;  2VL9 A;  3IC4 A;  2LNT A;  2MMO A;  3CRT A;  1JFU A;  3A2W A;  2H73 A;  5ECH B;  4TR0 A;  5EY6 A;  4POB A;  3RPN A;  2F9S A;  4XS1 A;  1PX7 A;  4MH3 A;  18GS A;  4DSQ A;  3TGZ A;  3G7J A;  3E0U A;  3GRX A;  7GSS A;  1OC9 A;  3NOF A;  4L5O A;  6GSS A;  2A2S A;  2WZ9 A;  3J7Y b;  5DQS A;  3QDN A;  1UA5 A;  1FAA A;  2I81 A;  2GQL A;  4NHZ A;  3QFA C;  2CX3 A;  2HRN A;  3L78 A;  2GQK A;  2IMF A;  4BIK A;  5ECQ B;  2PVQ A;  3LQ7 A;  2HE3 A;  2WFC A;  1OE7 A;  2GT5 A;  4HSC X;  2R37 A;  3GNJ A;  1R4W A;  5GAN D;  3KTB A;  2NTO A;  4OD7 A;  1YKA A;  1LJR A;  2B1L A;  3M0F A;  4IKH A;  3UL3 A;  3BOA A;  2K6V A;  4MJB A;  2C0E A;  2GZY A;  4G0I A;  5DAK A;  1SU9 A;  4O5R A;  5ENU A;  1WMJ A;  2FCH A;  3ERW A;  1IYH A;  5H5R A;  4XS4 A;  4KND A;  1K0N A;  4IGJ A;  3UVH A;  4OFT A;  4FYU A;  3EU4 A;  2FNO A;  1V98 A;  1GWC A;  1M99 A;  4IJ3 A;  5AIV A;  3VWX A;  1XWK A;  5J5N A;  5CP1 A;  3P2A A;  2BJX A;  3APQ A;  1HNA A;  5G5F A;  1FVJ A;  1PL2 A;  1X5E A;  3L4N A;  4K1F A;  4PI2 C;  2J9H A;  2OT3 A;  5HR2 A;  1E6B A;  4I97 A;  2C0D A;  2IME A;  4X0X A;  5DAL B;  2PBJ A;  3DWV A;  4OWY A;  3BCK A;  1GSF A;  5A5H B;  4ZL9 A;  4EE0 A;  3CYN A;  4AJ8 A;  1AAZ A;  1V57 A;  2DMM A;  1ML6 A;  5BRT A;  1T1V A;  4IHU A;  5AIS A;  2X64 A;  5KN1 A;  2B1K A;  4ZIL A;  1PKZ A;  2HI7 A;  4TN8 A;  4G0L A;  2P5R A;  1F2E A;  5B6N A;  1YVL A;  2O3E A;  2TRC P;  2CZ2 A;  4FQU A;  3GIX A;  1SD8 A;  5B6M A;  3BJ5 A;  1PRX A;  4HJ2 A;  1PFO A;  1DE1 A;  2RUF A;  1GUL A;  1T4Z A;  3I43 A;  5F0G A;  1TI3 A;  2WUL A;  3KH7 A;  2F8A A;  1S4B P;  1DSB A;  4JRR A;  4ZXG A;  2HSH A;  5G31 A;  1DE2 A;  1X9W B;  5HR0 A;  1S3C A;  2X49 A;  4MJE A;  1KBN A;  4TVE A;  4K6X A;  4LLR A;  2YWI A;  4I8B A;  3UBL A;  2JAD A;  4CY6 A;  1Z7P A;  3BCI A;  2OAC A;  1MTC A;  5A1N B;  4NMU A;  5KN2 A;  5G5E A;  3VPQ A;  1NHY A;  2CAQ A;  2H6X A;  1Y6E A;  3CHX C;  4EKZ A;  5IM9 A;  5B7C A;  2EFC A;  1GSU A;  2H6Z A;  2WZS A;  2JSY A;  3FY7 A;  2LKU A;  3ZIT A;  3TCO A;  3HA9 A;  1R5A A;  3DRN A;  2DML A;  3QR6 A;  4ISD A;  5CO3 A;  3EWL A;  5JCG A;  2VLT A;  3RBT A;  2YNX A;  4K7O A;  1XIY A;  5ECO B;  2LQO A;  1RQM A;  1BJX A;  2CZ3 A;  3H4K A;  2LTK A;  3LOR A;  2GGT A;  1JZW A;  2KP1 A;  3CBU A;  2EFE A;  2G2Q A;  1YF1 A;  4KDU A;  4MJC A;  1EP7 A;  1ON4 A;  3GTU B;  3GV1 A;  3GH9 A;  4OMV A;  1O73 A;  1EGR A;  1F3B A;  3F0I A;  5GAP D;  3L9U A;  1F6M C;  2K8S A;  5JWO B;  3ZL5 A;  4MZC A;  5H5S A;  3KMN A;  1GP1 A;  2IPA A;  3VPT A;  3CWG A;  2GVP A;  5HFK A;  4MMM A;  4KAE A;  4ZBD A;  2TIR A;  4L0U A;  2HZF A;  1VRS D;  2FY6 A;  3G7I A;  2GZP A;  3HVN A;  4EDY A;  4KE3 A;  5A4V A;  3HVX A;  3ZMK A;  1RW1 A;  3G7Y A; 
#chains in the Genus database with same CATH homology
 4BVX A;  4K7N A;  3A5W A;  2VM1 A;  4FIW A;  3KTL A;  4Q5R A;  4POK A;  5ECP B;  5A4U A;  2LRT A;  1XXU A;  5KEJ A;  1AW9 A;  5JCW A;  3DVX A;  5CRH A;  4KB3 A;  1XZO A;  1WPI A;  1Z7R A;  1TU8 A;  2O87 A;  1U3A A;  4LL4 B;  4TR1 A;  3ZFB A;  2H0H A;  1SJ6 A;  1EV4 A;  4LMV A;  4NV2 A;  2B7J A;  4AKG A;  5IMV A;  2MMA A;  5JWQ B;  3C73 A;  1R7H A;  3GMF A;  2MMN A;  3D0Z A;  1BG1 A;  2L59 A;  2HLS A;  3L9V A;  1MD3 A;  3VFI A;  1X5D A;  4K9Z A;  1X9S B;  1V2A A;  2XPE A;  1PN9 A;  3EVI A;  3FW2 A;  5IPH A;  4EO3 A;  5G1K A;  2H1L A;  3UBK A;  4AKH A;  5J9C A;  2REM A;  4BVY A;  3ZIJ A;  2EIR A;  1U6T A;  2CT6 A;  4ILF A;  3HVV A;  3HMJ G;  2DJ1 A;  2H70 A;  3HYP A;  2FWG A;  4KUN A;  1TTZ A;  2JL4 A;  1YEX A;  4ULX A;  4F0C A;  2MBT A;  2C0F A;  4ZBA A;  4YH2 A;  3FZ5 A;  2DJ0 A;  4MPF A;  1BED A;  3UIW A;  3DEX A;  4N0Z A;  1Y1U A;  5ABR A;  3F8U A;  2HT9 A;  1GRX A;  2HFD A;  4KCE A;  4KW6 A;  1QMV A;  1BX9 A;  1ZL9 A;  4JR4 A;  2VCX A;  2OKA A;  3C1S A;  4K2D A;  3M8N A;  4LA1 A;  5IOW A;  3C71 A;  3AY8 A;  3QAW A;  4YKF A;  4MPG A;  2VM2 A;  2DBC A;  3FK8 A;  3IOS A;  5ELG A;  1JZO A;  2QGV A;  2HSM B;  4AJ6 A;  4XHM A;  4EUY A;  3DVW A;  2HZE B;  2C1Y A;  2P0G A;  4E8H A;  3EMP A;  3TUE A;  2KLX A;  2V1M A;  5EPF A;  3U5R E;  5B8B A;  4V1A p;  1EOH A;  4BWS A;  2H76 A;  2AJQ B;  1O85 A;  4PNF A;  4TOP A;  5ECK B;  2F51 A;  4DSS B;  2KHP A;  3LEF A;  4QL7 A;  4AKX B;  2YJH A;  2B5Y A;  1ZZY A;  4PX1 A;  1JLW A;  5IIZ A;  2CVK A;  2XBQ A;  6GSY A;  2YP6 A;  3RAZ A;  5ID2 A;  4G0K A;  3LSZ A;  3Q6O A;  1WWJ A;  3KJY A;  4RI7 A;  2L57 A;  4WXT A;  3L9S A;  5BMU A;  3EIN A;  3WT2 A;  3MDK A;  5KN0 A;  3TJJ A;  2LJR A;  2GZZ A;  2A4V A;  1NSW A;  3MYD A;  1PSQ A;  5HQP A;  2EFH A;  2YWN A;  5HFI A;  2P31 A;  4EIQ A;  1SKW B;  3KEB A;  2WJU A;  3O6T A;  5INY A;  1EGO A;  2VL3 A;  1VF4 A;  2IFQ B;  1AQV A;  2MZC A;  1FHE A;  2XPD A;  2GSQ A;  3W8S A;  1XBS A;  3ZRD A;  3P8W A;  2B7K A;  3FR3 A;  2P5Q A;  3G9B A;  5D9X A;  1BG5 A;  2PGT A;  1GSQ A;  4KH7 A;  4EC0 A;  3UOM A;  4QMK A;  5HFG A;  2C3Q A;  2JSZ A;  1ZYQ B;  4IJI A;  2A2P A;  1M2A A;  1QQ2 A;  1X0R A;  2I3Y A;  2PPT A;  2RM5 A;  1GH2 A;  4K7I A;  1XFL A;  2EIQ A;  5AN1 A;  4FH8 A;  2R3X A;  4NHW A;  20GS A;  2OJL A;  1A2M A;  2RLI A;  5C04 A;  2VCW A;  3S9F A;  1OYJ A;  2IWT A;  4TR3 A;  4GF0 A;  4GWR A;  1K3O A;  2D2Z A;  1OKD A;  1ZMA A;  4GCI A;  3EYT A;  3WD6 A;  4H86 A;  2LQQ A;  2X4A A;  3LXZ A;  3VUR A;  1I5G A;  2QA2 A;  3H93 A;  2DJ3 A;  4ID0 A;  1B9Y C;  4PUR A;  5D9W A;  2GTU A;  4XRD A;  1VF1 A;  3KP9 A;  3LYK A;  2WGR A;  4POL A;  1B8X A;  2AB6 A;  2VIM A;  5AIX A;  5LNK e;  4HZ4 A;  3IA1 A;  2QC7 A;  3I9V 2;  5H5Q A;  3VWW A;  1JLV A;  1THX A;  3GX0 A;  1WIK A;  4ZB9 A;  4JBB A;  2LEG A;  1B4P A;  3TJB A;  2FGX A;  4FYC A;  2DIY A;  4HEA 2;  1J9B A;  4NV5 A;  2HQT A;  1A0R P;  1E2Y A;  3FMW A;  4X4J A;  3APO A;  1VF3 A;  3WGD A;  1EEM A;  4OO4 A;  1TK8 B;  1XW9 A;  1G0T A;  1MDK A;  2YWO A;  3VK9 A;  2PER A;  3MIX A;  1A2J A;  2YJ7 A;  4HJM A;  2JZT A;  1V9W A;  5DQY A;  4X43 A;  4Z2T A;  2WRT A;  3J7Y k;  5A34 A;  5COH A;  1ZOF A;  3EU3 A;  3IXR A;  4ECC A;  19GS A;  3O3T A;  4OCF A;  2YV9 A;  1MD4 A;  3UEM A;  1U87 A;  4G10 A;  4QQ7 A;  8GSS A;  6GST A;  1ZYN A;  2I1U A;  2KOK A;  5FWG A;  2FA8 A;  2V6O A;  5DJL A;  3KGK A;  1U3I A;  2ON7 A;  2IL3 A;  4X1U A;  4PUA A;  1GSE A;  1N8J A;  1PL1 A;  1BYE A;  1X9M B;  5D9T A;  3EMX A;  1N25 A;  2H1B A;  1HQO A;  4K0G A;  4ML6 A;  1B48 A;  1TRS A;  4ML1 A;  3FKF A;  1WJK A;  3P7X A;  2EIO A;  4GLT A;  3F63 A;  4J56 E;  2N5B A;  4Q5F A;  1SKR B;  4O32 A;  1FW1 A;  4V1A g;  1EZK A;  3GH6 A;  5F05 A;  3QAG A;  3A2X A;  4AJ7 A;  2LNS A;  1HNC A;  1ACV A;  1O81 A;  4V2L A;  4I2T A;  4PGT A;  4MAB A;  3TJG A;  2A2R A;  5C00 A;  4WR4 A;  4WF4 A;  4MF7 A;  3F9U A;  2RII A;  4TXO A;  1C72 A;  1MEK A;  1Z6M A;  3QMX A;  3U6V A;  2PUK C;  1WP0 A;  1EEJ A;  1A23 A;  3M3M A;  1J08 A;  5CRE A;  1TRV A;  2DJK A;  2O85 A;  1YJ6 A;  1KTE A;  4CHS A;  1ERW A;  4N3Z A;  4GDF A;  5ECS A;  4W66 A;  3VI5 A;  1T4Y A;  2C3N A;  4D73 A;  4HOJ A;  5E4W A;  4FO5 A;  4BWQ A;  5D73 A;  4Z2U A;  3M9J A;  1UC7 A;  2LJA A;  4YKG A;  5DVB A;  1NM3 A;  1T8E B;  1A8Y A;  4KF9 A;  3TRQ A;  4Z7X A;  3IV4 A;  4ZB7 A;  1SJZ A;  4AF2 A;  3IPZ A;  5JWR B;  1U88 A;  2DLX A;  3IBH A;  3PPU A;  4XIH A;  1JZR A;  1SVL A;  3MNG A;  3DXB A;  3F3Q A;  4GXZ A;  5CRW A;  4FYB A;  1A0F A;  1ZYP A;  4KX4 A;  4BL7 B;  4OFM A;  4IN0 A;  3EE2 A;  4J57 E;  3UMA A;  4G19 A;  4CY8 A;  2L4Q A;  1IYI A;  1OE8 A;  4O92 A;  1WE0 A;  4BPY A;  2HSN B;  1MDJ A;  2FD3 A;  3TKR A;  1SL0 B;  4F9Z A;  4TXV A;  2M72 A;  2FHE A;  4KCA A;  5F07 A;  3ZRE A;  4WR5 A;  4GTU A;  2YAN A;  2H75 A;  3UJ1 A;  4PXO A;  4YAP A;  1ERT A;  3CTG A;  3ZFL A;  2RM6 A;  3WYW A;  4AGS A;  3KM6 A;  1O8W A;  4F2I A;  3US3 A;  4E68 A;  4YQM A;  4QL9 A;  2H01 A;  16GS A;  2CAI A;  4ECB A;  2AAW A;  3CXG A;  3TB2 A;  1K0O A;  2E2M A;  1GNE A;  17GS A;  3Q74 A;  2HRF A;  3GFK A;  4LMW A;  2YZU A;  3KZQ A;  4KDY A;  3N9J A;  1W89 A;  3HJO A;  2IMD A;  2C4J A;  4MNN A;  5CAX A;  5D93 A;  1Z5Y E;  2EFD A;  1YZX A;  2IIY A;  4NWY A;  1G7O A;  1A8L A;  4K5S A;  2C8U A;  2HRK B;  2YCD A;  2VL2 C;  2EC4 A;  3TRP A;  2I4A A;  4IP6 A;  3MWH A;  3HZ4 A;  1M7T A;  2H1G A;  2XC2 A;  4PUF C;  2FA4 A;  4K2X A;  4K5R A;  1SK2 A;  2H71 A;  5DAL A;  2BTO T;  5DCH A;  1HYU A;  2IMI A;  1ERU A;  4JZQ A;  2X8G A;  3GX8 A;  1GTU A;  3HY2 A;  1RK4 A;  1YY7 A;  1YEP A;  2VCT A;  1SK1 A;  5IMZ A;  3TJK A;  5ECN B;  1OC9 B;  3BBY A;  1USB A;  3PH9 A;  4KSO A;  2LJK A;  1ST9 A;  3KP8 A;  3UAR A;  2HSY A;  4WF5 A;  3D21 A;  3N5O A;  1FOV A;  1GLP A;  4NAX A;  4Z2R A;  3KH9 A;  2XBI A;  3HXS A;  2L5L A;  3IE3 A;  2VOC A;  1WRY A;  2HYX A;  4N11 A;  1TDI A;  4ICY A;  1ERV A;  2E0Q A;  4USS A;  1SEN A;  4ZB6 A;  5KOW A;  3LJR A;  2R5G A;  1TK0 B;  2H30 A;  1N2A A;  3HD5 A;  4WKW A;  3ZIV A;  4IP1 A;  3APS A;  2UV8 G;  5DAK B;  4ZBB A;  1DUG A;  1HNB A;  2CQ9 A;  2YOI A;  3TKS C;  4BA7 A;  2NBS A;  4XS4 B;  3DML A;  2V32 A;  3FZ4 A;  5LD0 A;  5JCU A;  3IR4 A;  2YWM A;  3DYR A;  5ECI B;  2GST A;  3E9J B;  12GS A;  5HR3 A;  4EIP A;  4L8E A;  1XWB A;  1ILO A;  1WOU A;  5A1N A;  1NW2 A;  1TKD B;  2R4V A;  4O5U A;  5D96 A;  2X8C A;  1XW6 A;  5E59 A;  1SK0 A;  3NZN A;  4NPB A;  3TDG A;  4TR4 A;  4GQC A;  3EPT A;  3ZLP A;  3I6A A;  2RUE A;  4OCE A;  2A4H A;  2IMK A;  4ACS A;  5GST A;  2C0G A;  3TOT A;  4HQS A;  1XWG A;  1VF2 A;  5CRD A;  4L5L A;  4EDZ A;  3A3T A;  2L4C A;  3HCZ A;  5IMA A;  5J4V A;  4PNG A;  3F6F A;  2E7P A;  5DDL A;  1M9B A;  1ZYE A;  2ALB A;  2B3S A;  3IK7 A;  10GS A;  3GTU A;  1M9A A;  2ON5 A;  1UN2 A;  1MDI A;  2LRN A;  2R0G A;  1B4Q A;  3UAP A;  3GKK A;  2V6K A;  4F0B A;  3CSH A;  4ZL8 A;  1GUK A;  4MDC A;  1OVN A;  1A2L A;  2H19 A;  3M9K A;  3ERF A;  2DJJ A;  2O89 A;  3BD2 A;  1TRW A;  1CQG A;  1X5C A;  3P90 A;  3LFL A;  4GST A;  4Q5N A;  1URM A;  5IMC A;  1OAZ A;  3LYP A;  2H74 A;  2YN1 A;  3HDC A;  2O5V A;  1W4V A;  2F8F A;  3DGQ A;  1M2B A;  3HVS A;  3GKN A;  2MBS A;  1F37 A;  5ECR B;  2FWE A;  3GN3 A;  2ES7 A;  2DKH A;  5J41 A;  2H6Y A;  3H8Q A;  2R6K A;  5F8B A;  1AQX A;  2HNL A;  3ZYW A;  3ZZX A;  4NXI A;  3WGX A;  3QCP A;  1TXX A;  2OE1 A;  3Q18 A;  1Z3E A;  4EL1 A;  3HHV A;  1K0B A;  3LXT A;  1Q98 A;  1Z6N A;  2LS5 A;  4F82 A;  4HU7 A;  5IOX A;  2CVB A;  3KD0 A;  3TKP A;  2OAD A;  3Q19 A;  5CRG A;  3GSS A;  2QKE A;  1XCC A;  4GSN A;  1K3L A;  11GS A;  1Z9H A;  1TJD A;  3HJM A;  3DKS A;  3ZML A;  1AUC A;  2WB9 A;  5IMF A;  4YAV A;  1QGV A;  4MP4 A;  4O7H A;  4I5Q A;  2GSS A;  1CQH A;  2FUG 2;  1OKT A;  1BAY A;  1FG4 A;  1XWC A;  1UVZ A;  2R0P A;  1YF0 A;  2WS2 A;  2VD0 A;  6GSW A;  3JCM L;  3TOU A;  3GA4 A;  2VAF A;  2CX4 A;  2VKZ G;  3LWA A;  3RPP A;  2LRC A;  4IVF A;  5A5K A;  3GL3 A;  3TU3 B;  1B9X C;  1G7E A;  3IRA A;  1GNW A;  2PMT A;  2F3M A;  1O6J A;  4PTS A;  1H75 A;  5J9B A;  3MSZ A;  4CW9 A;  4MCU A;  2E2G A;  3ME7 A;  3CRU A;  2JU5 A;  5J47 A;  3IAM 2;  1GTA A;  3IDV A;  1K0M A;  2NDO A;  4JED A;  1EP8 A;  4MF6 A;  3ZVJ D;  4IQA A;  3WGE A;  1GUH A;  4EVM A;  1JHB A;  4BVX B;  1GSS A;  1TRU A;  3K8N A;  2VLU A;  5IMD A;  3VWV A;  4KDX A;  1PD2 1;  2DKI A;  2VCZ A;  1XOB A;  1YQ1 A;  2OA7 A;  2OE0 A;  1F9M A;  2HSM A;  2OBI A;  4XRA A;  2C3T A;  4A5P A;  1A24 A;  2HZE A;  2XHF A;  4ZL7 A;  4TR1 B;  4IQ1 A;  3F4T A;  4MLY A;  3FEU A;  4HU9 A;  3A2V A;  5D9V A;  1TXU A;  3PGT A;  3L0H A;  4DSS A;  4K8M A;  2GQM A;  4YQV A;  2ZUP A;  3F3R A;  3TKQ A;  2GLR A;  4N0V A;  4MF5 A;  2HXK A;  5KN3 A;  2YV7 A;  1O8X A;  3PR8 A;  2L6D A;  1BF5 A;  2VD1 A;  3LG6 A;  2V2G A;  3KXO A;  1XW5 A;  3IK9 A;  1PGT A;  2VCQ A;  5J40 A;  6GSU A;  2AHE A;  2J23 A;  3ISO A;  1SJI A;  1K0C A;  4HS1 A;  1XVW A;  1T3B A;  1O7U A;  4BVY B;  4XTS A;  3C1R A;  2GDR A;  1AIU A;  3VI7 A;  3TJF A;  2N5A A;  1EWX A;  2AUV A;  2H72 A;  4G9H A;  2NVL A;  1GTI A;  3QPM A;  1SD9 A;  4V2M A;  3IHQ A;  2IFQ A;  1PKW A;  5G30 A;  2KP2 A;  1FB6 A;  3GUR A;  2L5O A;  3HKR A;  3GST A;  3GKX A;  4I6X A;  1SVM A;  2LST A;  1BQ7 A;  2O7K A;  3FR6 A;  1SKS B;  5AGY A;  3CSI A;  4PQI A;  4XCS A;  3D4M A;  4EF0 A;  3RHB A;  1XOA A;  1R5P A;  6GSV A;  5EL8 A;  4EXJ A;  3O76 A;  14GS A;  4OO5 A;  4MK3 A;  3ZTL A;  5ELA A;  1AC1 A;  1FO5 A;  2QSI A;  2BMX A;  3GL5 A;  2K18 A;  2R2J A;  2K8V A;  1FB0 A;  3CMI A;  1TW9 A;  1M0U A;  5DCG A;  1TU7 A;  5L71 A;  5J3R A;  1PA3 A;  4RQR A;  1PMT A;  2TRX A;  1K0A A;  1GSY A;  3ZVJ A;  4IW9 A;  1J0F A;  3TKS E;  2LUS A;  4POM A;  1XPV A;  3CSJ A;  2H8L A;  4N10 A;  1TK5 B;  4MJA A;  4TRX A;  2PU9 C;  4PQH A;  13GS A;  2CV4 A;  2VLV A;  1DBY A;  5IO0 A;  2H0I A;  4JE1 A;  4DSR A;  1R26 A;  4V2N A;  5ID2 B;  3QAV A;  4XS6 A;  4ECI A;  3VWU A;  4WEY A;  5DBQ A;  5BMU B;  5B8A A;  4ZIJ A;  2DIZ A;  1OC3 A;  3W8J A;  3OR5 A;  4ZB8 A;  5GZZ B;  1GLQ A;  4GSS A;  2H0G A;  4GQF A;  4LL1 B;  4CDO A;  4IS0 A;  1SYR A;  5A4W A;  2B5X A;  3SBC A;  2H66 A;  3MAK A;  2PWJ A;  4WET A;  2FWF A;  1TI1 A;  4KSM A;  2LV3 A;  5CYY A;  5J4Y A;  1JZD A;  4RUV A;  4IBP A;  1V58 A;  3V1W A;  5ECL B;  2I9H A;  5FT3 A;  4G01 A;  2C80 A;  2M80 A;  4HZ2 A;  2MYG A;  1VGL A;  4HUA A;  4AI6 A;  2FWH A;  3FZA A;  1PX6 A;  3I69 A;  2VUP A;  3A5I A;  1AQW A;  3WT1 A;  4Q5Q A;  2VO4 A;  22GS A;  1V40 A;  4RQX A;  1GL8 A;  4OFN A;  1Y25 A;  3VLN A;  4YQU A;  2ZNM A;  5GSS A;  4DVC A;  3H1N A;  4J2F A;  3W6G A;  4JR6 A;  2K9F A;  1GUM A;  5FHI A;  4AKI A;  3IC8 A;  2OE3 A;  2GS3 A;  2VL2 A;  5DJM A;  5A5H A;  4G2E A;  5IO2 A;  3FYG A;  3M1G A;  4DEJ A;  4HDE A;  1TOF A;  2VCV A;  2QA1 A;  1PN0 A;  2KUC A;  3D4T A;  1THO A;  2CA8 A;  4GRF A;  4MZB A;  3GUS A;  3RHC A;  1ZCP A;  2V41 A;  4N30 A;  3E3E A;  3GHA A;  4JU5 A;  1EV9 A;  3FHK A;  5F06 A;  9GSS A;  1G6W A;  3FZ9 A;  1EOG A;  5LCZ A;  5G1L A;  4F03 A;  4K0N A;  3GYK A;  3TRX A;  5J4U A;  3CTF A;  5A34 B;  2DJ2 A;  4L0W A;  2X99 A;  1S3A A;  1K3Y A;  1KNG A;  3EUR A;  5D8I A;  1SL1 B;  4O5Q A;  3ERG A;  4KGI A;  4E8E A;  4PQ1 A;  2JZS A;  1H4O A;  2DSA A;  2MMZ A;  3TKS A;  1M2D A;  2X8H A;  1FVK A;  3NIV A;  2HRA A;  3PIN A;  2N5F A;  3D6I A;  3FR9 A;  2WCI A;  4MH2 A;  4KA0 A;  2O8V B;  1QFN A;  3ME8 A;  2L6C A;  5CNW A;  4ECJ A;  2M46 A;  3QOU A;  4BL7 A;  4P3Y B;  2H1D A;  2GT6 A;  1NHO A;  2AYT A;  1I9D A;  1OC8 A;  4IEL A;  3F6D A;  1XVQ A;  1GSD A;  5ECM B;  2HSN A;  2Z9S A;  1G6Y A;  1T7P B;  4TW5 A;  2YPM A;  3GKM A;  2B6M A;  1Q4J A;  3LW9 A;  2NPB A;  1S3D A;  3IAS 2;  1SVO A;  3DIE A;  4I2U A;  2UZ8 A;  3KIJ A;  1SL2 B;  4WBR D;  2AV4 A;  1LBK A;  3R3E A;  2DC5 A;  3DD3 A;  2WDU A;  4HI7 A;  4WBJ A;  2JAC A;  1FOH A;  2G0F A;  3C7M A;  5G2Z A;  2IN3 A;  5IQY A;  3HZ8 A;  1AXD A;  4TXO B;  3D22 A;  1T00 A;  1TP9 A;  2PVO C;  3QFB C;  5KOX A;  3FRC A;  1QXH A;  3KMO A;  3C8E A;  5HR1 A;  3RDW A;  1ABA A;  3IHG A;  1F3A A;  2GSR A;  2PN8 A;  3LGC A;  3HJP A;  2YZH A;  3H79 A;  1GTB A;  4D73 B;  2ZCT A;  2H1A A;  3D5J A;  1LU4 A;  1SYX A;  3F4S A;  1K0D A;  4RI6 A;  1YKC A;  4MA9 A;  3ED3 A;  4MZW A;  5EVO A;  2R0C A;  2IJY A;  1HD2 A;  1ZGN A;  2CVD A;  1QK8 A;  3UVT A;  2JZR A;  3QD9 A;  4TKY A;  1YDK A;  4HQZ A;  3EC3 A;  1KEB A;  1QUW A;  6GSX A;  3F4R A;  3KCM A;  5IPG A;  3SWL A;  1XWA A;  2B5E A;  2HRK A;  1PQN A;  2FLS A;  2OBK A;  3R2Q A;  2VL9 A;  3IC4 A;  2LNT A;  2MMO A;  3CRT A;  1JFU A;  3A2W A;  2H73 A;  5ECH B;  4TR0 A;  5EY6 A;  4POB A;  3RPN A;  2F9S A;  4XS1 A;  1PX7 A;  4MH3 A;  18GS A;  4DSQ A;  3TGZ A;  3G7J A;  3E0U A;  3GRX A;  7GSS A;  1OC9 A;  3NOF A;  4L5O A;  6GSS A;  2A2S A;  2WZ9 A;  3J7Y b;  5DQS A;  3QDN A;  1UA5 A;  1FAA A;  2I81 A;  2GQL A;  4NHZ A;  3QFA C;  2CX3 A;  2HRN A;  3L78 A;  2GQK A;  2IMF A;  5ECQ B;  2PVQ A;  3LQ7 A;  2HE3 A;  2WFC A;  1OE7 A;  2GT5 A;  2R37 A;  3GNJ A;  1R4W A;  5GAN D;  3KTB A;  2NTO A;  4OD7 A;  1YKA A;  1LJR A;  2B1L A;  3M0F A;  4IKH A;  3UL3 A;  3BOA A;  2K6V A;  4MJB A;  2C0E A;  2GZY A;  4G0I A;  5DAK A;  1SU9 A;  4O5R A;  5ENU A;  1WMJ A;  2FCH A;  3ERW A;  1IYH A;  5H5R A;  4XS4 A;  4KND A;  1K0N A;  4IGJ A;  3UVH A;  4OFT A;  4FYU A;  3EU4 A;  2FNO A;  1V98 A;  1GWC A;  1M99 A;  4IJ3 A;  5AIV A;  3VWX A;  1XWK A;  5J5N A;  5CP1 A;  3P2A A;  2BJX A;  3APQ A;  1HNA A;  5G5F A;  1FVJ A;  1PL2 A;  1X5E A;  3L4N A;  4K1F A;  2J9H A;  2OT3 A;  5HR2 A;  1E6B A;  4I97 A;  2C0D A;  2IME A;  4X0X A;  5DAL B;  2PBJ A;  3DWV A;  4OWY A;  3BCK A;  1GSF A;  5A5H B;  4ZL9 A;  4EE0 A;  3CYN A;  4AJ8 A;  1AAZ A;  1V57 A;  2DMM A;  1ML6 A;  5BRT A;  1T1V A;  4IHU A;  5AIS A;  2X64 A;  5KN1 A;  2B1K A;  4ZIL A;  1PKZ A;  2HI7 A;  4TN8 A;  4G0L A;  2P5R A;  1F2E A;  5B6N A;  1YVL A;  2TRC P;  2CZ2 A;  4FQU A;  3GIX A;  1SD8 A;  5B6M A;  3BJ5 A;  1PRX A;  4HJ2 A;  1DE1 A;  2RUF A;  1GUL A;  1T4Z A;  3I43 A;  5F0G A;  1TI3 A;  2WUL A;  3KH7 A;  2F8A A;  1DSB A;  4JRR A;  4ZXG A;  2HSH A;  5G31 A;  1DE2 A;  1X9W B;  5HR0 A;  1S3C A;  2X49 A;  4MJE A;  1KBN A;  4TVE A;  4K6X A;  4LLR A;  2YWI A;  4I8B A;  3UBL A;  2JAD A;  4CY6 A;  1Z7P A;  3BCI A;  2OAC A;  1MTC A;  5A1N B;  4NMU A;  5KN2 A;  5G5E A;  3VPQ A;  1NHY A;  2CAQ A;  2H6X A;  1Y6E A;  4EKZ A;  5IM9 A;  5B7C A;  2EFC A;  1GSU A;  2H6Z A;  2JSY A;  3FY7 A;  2LKU A;  3ZIT A;  3TCO A;  3HA9 A;  1R5A A;  3DRN A;  2DML A;  3QR6 A;  4ISD A;  5CO3 A;  3EWL A;  5JCG A;  2VLT A;  3RBT A;  2YNX A;  4K7O A;  1XIY A;  5ECO B;  2LQO A;  1RQM A;  1BJX A;  2CZ3 A;  3H4K A;  2LTK A;  3LOR A;  2GGT A;  1JZW A;  2KP1 A;  3CBU A;  2EFE A;  2G2Q A;  1YF1 A;  4KDU A;  4MJC A;  1EP7 A;  1ON4 A;  3GTU B;  3GV1 A;  3GH9 A;  4OMV A;  1O73 A;  1EGR A;  1F3B A;  3F0I A;  5GAP D;  3L9U A;  1F6M C;  2K8S A;  5JWO B;  3ZL5 A;  4MZC A;  5H5S A;  3KMN A;  1GP1 A;  2IPA A;  3VPT A;  3CWG A;  2GVP A;  5HFK A;  4MMM A;  4KAE A;  4ZBD A;  2TIR A;  4L0U A;  2HZF A;  1VRS D;  2FY6 A;  3G7I A;  2GZP A;  4EDY A;  4KE3 A;  5A4V A;  3HVX A;  3ZMK A;  1RW1 A;  3G7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...