1HNCA

Crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVFGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase(glutathione)
total genus 68
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1hncA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1hncA01
3ZRDA 2HLSA 3AY8A 4RQRA 3TDGA 4PUAA 4EL1A 1G7OA 1TTZA 4MABA 2BJXA 1K0DA 1PMTA 5DALA 2GSSA 1UN2A 2EIQA 1ZMAA 2H73A 2L6DA 3RPPA 2AAWA 3HVXA 3LWAA 1SK0A 2MBTA 2ON5A 4JR4A 5DCHA 4BVXA 4GQFA 5CRDA 2YP6A 1ILOA 2F51A 3EYTA 3QR6A 5DDLA 4XS6A 5F0GA 2K8SA 2B5XA 3VFIA 1TK8B 3KJYA 1SD8A 6GSVA 2DJ2A 1TW9A 5JWQB 1HNAA 1OC8A 2ON7A 4NHZA 1O8WA 5CNWA 4O5RA 5J9CA 1WP0A 3SWLA 1SD9A 1WMJA 2E2GA 1T1VA 3NIVA 1TOFA 5ABRA 2KUCA 1J08A 2C3TA 2WCIA 1MDIA 5AIVA 1GUHA 3BJ5A 1GSEA 2HSNB 1AC1A 3D4TA 5IMAA 1AAZA 4I2UA 3KEBA 1G6YA 3F63A 3EE2A 1ERWA 1TDIA 4MJEA 1FG4A 3M9JA 1AQWA 2NBSA 2VCZA 3HYPA 3H8QA 3EU3A 4OFTA 2L4QA 2MMOA 3KZQA 4DSQA 1TI1A 3L9UA 4Q5QA 2BMXA 4G0IA 2R3XA 2VLUA 3ME8A 5F8BA 3H93A 2FWFA 6GSUA 1GUKA 4N10A 5HR0A 1B4QA 3D4MA 2V2GA 5ENUA 1CQHA 3QMXA 1A0FA 2ALBA 2VCTA 1Z5YE 3RPNA 1SJ6A 5GAPD 4L5LA 4O92A 3CBUA 1A8YA 1GSQA 1YF0A 5CYYA 3F4TA 3GH9A 2IPAA 4MA9A 1GH2A 5D8IA 1OE7A 2DJ3A 1K3OA 4O7HA 2ZCTA 2VL2A 4GSNA 3IRAA 4JEDA 2HRNA 1PN9A 3N5OA 1EWXA 1YEXA 1PL2A 2MMNA 5IM9A 2O8VB 1K0BA 2K18A 5D9WA 2FCHA 3GTUB 1PGTA 5E59A 1B9XC 3KM6A 4ACSA 3FZ4A 1WOUA 1PKZA 2L6CA 3LQ7A 2EIRA 1VF1A 3QCPA 4KCAA 1J0FA 5ELAA 1A23A 3IV4A 4WKWA 4PNGA 4MPGA 1U88A 2DJ0A 1AUCA 1B8XA 4RI6A 1VRSD 5GZZB 2H72A 1EV4A 3ZFLA 2XC2A 3NOFA 2VIMA 1DUGA 5B6MA 3D5JA 4K2DA 3WGDA 2JACA 1AIUA 5CRHA 3ZIVA 5IPGA 1S3DA 2HT9A 4WEYA 3VWVA 1HNBA 3Q6OA 4V2NA 5HFIA 2YWMA 1YF1A 3PR8A 4WBRD 4RI7A 1FO5A 3PPUA 1M7TA 4XHMA 3KTLA 3UBLA 2UZ8A 2LNTA 3W8JA 1SU9A 2A2RA 3HZ8A 3KIJA 2NDOA 2NVLA 4K0GA 1ST9A 3HVSA 1ZYQB 4HJ2A 2C8UA 4G2EA 2GT6A 3VURA 3VWUA 1SYXA 5ECSA 4J2FA 4V1Ap 2K9FA 5H5QA 4D73A 1BEDA 2YN1A 1GLPA 3KGKA 2VLTA 2IMKA 2LJAA 1GSYA 3RHCA 1DE2A 4XTSA 2H0IA 3DEXA 1BAYA 2GLRA 3K8NA 1EP8A 1XWAA 4ILFA 5A5KA 3S9FA 1PL1A 1ZOFA 3GTUA 2E2MA 1UA5A 3BD2A 3TJFA 1V40A 5KN0A 2L5OA 4XS4B 3C8EA 4WETA 1XWCA 4NXIA 3A3TA 3DKSA 2LTKA 1GL8A 2OKAA 3ZFBA 2REMA 3V1WA 1T8EB 1DBYA 5AISA 2HSYA 4X1UA 1F2EA 3KCMA 3WT2A 1GNEA 1THOA 2F3MA 3HDCA 4ZIJA 2C1YA 2FY6A 4ECJA 4L0WA 4MMMA 2GT5A 2V6KA 5J3RA 3D0ZA 1YZXA 2WFCA 2CX4A 1FHEA 4KUNA 3RHBA 2CQ9A 4GWRA 1PQNA 1A2JA 4JE1A 1RW1A 4JRRA 5DAKB 2G2QA 5CAXA 3TOTA 3GKKA 4MF7A 1O73A 3P7XA 1NSWA 2X8GA 1K3YA 1U3AA 4ZL8A 1OVNA 4N0VA 4RUVA 2N5AA 2GGTA 4EF0A 1EP7A 2IMFA 2JZTA 4IP6A 1X9WB 1HQOA 1XZOA 3EVIA 3M1GA 4TXOA 2DBCA 5B7CA 2O89A 5ECNB 3UOMA 4L5OA 4KSOA 1FVJA 4ZB8A 1ZL9A 1X5CA 5J4UA 3WGXA 3PINA 4J57E 1XW5A 3DRNA 5ECLB 1GSDA 2BTOT 5DALB 5JCWA 1X0RA 3LYPA 9GSSA 3TGZA 4EDZA 2YPMA 1FAAA 2C3QA 2I81A 3H1NA 1ZZYA 5G1LA 6GSYA 5C00A 1K0NA 1T3BA 2OBKA 2R6KA 1BQ7A 1SK1A 3VPQA 3L9SA 3CSJA 4AF2A 3F8UA 3BCKA 4L0UA 3CXGA 3M0FA 2C4JA 4BVXB 4DEJA 5CRGA 2N5FA 2FWEA 3L78A 1GULA 1M2DA 2LRCA 5CO3A 3TJJA 1X5EA 1URMA 3CTFA 3E9JB 4EKZA 3IBHA 1JZDA 1K0CA 3MDKA 3SBCA 4TOPA 1GNWA 4HU9A 1OE8A 2YJ7A 4KE3A 4YQUA 4EE0A 1T4ZA 4IJIA 4OD7A 1M2BA 1YDKA 3QD9A 1N2AA 4GTUA 3LEFA 4JU5A 3R3EA 1NW2A 2KOKA 1K0OA 3DWVA 1WE0A 1ZCPA 4ID0A 1JZWA 1R7HA 1R26A 1I5GA 1O7UA 4I5QA 1EEJA 2GSRA 3MAKA 4ZB9A 5FHIA 5A4VA 2CT6A 2IL3A 2CA8A 3GIXA 4FYCA 2CVDA 1F3AA 3FZ5A 3ZVJD 2H6XA 4BA7A 3F3RA 4G0KA 2RUFA 2Z9SA 2B5YA 3DVXA 1QQ2A 1TK5B 5AGYA 2CVKA 3GKNA 3ZZXA 1SENA 2GQMA 5CRWA 4ZBDA 3D6IA 5G30A 3UARA 3TOUA 3UL3A 2LSTA 4MJBA 4RQXA 2XPDA 2J23A 1ZGNA 4OO4A 3D21A 4EC0A 2MBSA 4IKHA 3DXBA 4FYBA 5HR1A 4Q5RA 3US3A 2AYTA 2MMAA 5KEJA 2QGVA 2XHFA 4PXOA 3L4NA 3TKPA 1DE1A 2OE1A 3F0IA 4K6XA 2YOIA 1G7EA 2QC7A 1LU4A 2H75A 4MH2A 1V58A 3IXRA 4OFNA 5B8BA 2C80A 2C0DA 2LV3A 1M2AA 1QMVA 2IIYA 4GF0A 1E2YA 5IMZA 3F9UA 2LRTA 5JCUA 4PTSA 4IW9A 1MDKA 3ZLPA 2V6OA 4FH8A 1SJZA 2HZEA 4MZCA 2EC4A 2IJYA 4K0NA 1FOVA 2R2JA 1VF3A 2HZFA 3LXZA 1SKRB 1SL0B 4PGTA 1B4PA 2H74A 3G9BA 2RIIA 2JADA 1MDJA 3VLNA 1H75A 2K6VA 1MD3A 1WJKA 3EC3A 4YQVA 2VL2C 3HJPA 5F07A 2B7KA 1FVKA 4GSTA 5DQSA 4MCUA 3U6VA 3F4SA 2H6YA 2XBQA 4XCSA 4KCEA 4NMUA 2B1LA 3FHKA 4ECIA 4PQIA 2KLXA 3ERFA 5DBQA 2B7JA 4LMVA 2H01A 5ECQB 3IPZA 4F2IA 3HJOA 1PRXA 2V1MA 2CVBA 1OKTA 3ERGA 3TKRA 1V57A 4TXVA 4ZILA 4KNDA 4V1Ag 4MK3A 3N9JA 3TUEA 1Z7PA 2YZHA 1AXDA 5C04A 3ISOA 1SKSB 1U87A 3UIWA 1ML6A 2QKEA 1XVWA 1U3IA 2YJHA 4D73B 3QDNA 3RAZA 5DVBA 2RM5A 2YCDA 5CREA 2NPBA 3CSIA 1TK0B 2LUSA 3GX0A 4KAEA 2X8HA 3UJ1A 1ON4A 3FKFA 3HHVA 4AJ6A 3OR5A 1YY7A 1F6MC 4KA0A 1GTIA 1QGVA 2HRKB 5HFGA 1T4YA 2HSHA 12GSA 1XBSA 5G1KA 3KP9A 4LMWA 2GTUA 2HE3A 4EDYA 2KP2A 4K7IA 5FWGA 4ZBBA 4GLTA 4BVYA 3WGEA 2XPEA 3UBKA 3KD0A 3FY7A 4KF9A 3HXSA 3M8NA 4V2MA 3TRPA 3TB2A 1O81A 1USBA 4TRXA 2I3YA 2X8CA 2R5GA 3L9VA 4PQHA 4HUAA 3DVWA 1T7PB 4ZXGA 4QL9A 2FWHA 2CX3A 4F0CA 1UVZA 5ID2B 4I2TA 3ZITA 3ZL5A 5DCGA 4DVCA 2A2SA 3LJRA 1XWKA 1RK4A 3ME7A 3VI7A 18GSA 1PX6A 1BJXA 2H6ZA 3LXTA 2MMZA 2C0FA 1K0AA 3EINA 2VCQA 3KMNA 1EGRA 2VCVA 4KDUA 2XBIA 3CRTA 2ZNMA 4Z7XA 3CYNA 2PERA 3RDWA 4HZ4A 1PKWA 4GQCA 4P3YB 4IJ3A 1Y6EA 1EOHA 2GZZA 1O8XA 5DJMA 1ABAA 3A5WA 4E8EA 2WRTA 3A2XA 2H0GA 3TJKA 3EWLA 3HVVA 3HZ4A 4BL7A 3GMFA 2OADA 3ZMKA 1Z9HA 1GUMA 3FYGA 3UAPA 1EZKA 1VF4A 3F3QA 4TXOB 1MD4A 4MZBA 4IHUA 10GSA 2HSMA 2V41A 1SYRA 1BG5A 2HRKA 3ZMLA 3LFLA 5J9BA 4XRDA 16GSA 5EPFA 1OKDA 4F0BA 2WS2A 5ECHB 2GS3A 3DD3A 6GSTA 2RLIA 4FO5A 4EUYA 1K0MA 3L0HA 1M0UA 2C0GA 4ML6A 1Y25A 1E6BA 3BOAA 5COHA 3TKSC 3EMPA 4BWQA 2L5LA 1QXHA 5AN1A 5ECRB 1O6JA 2GZPA 2WDUA 4LL1B 4G19A 2YV7A 5ID2A 3FRCA 4EVMA 3IAM2 2HQTA 3G7JA 5ELGA 2FNOA 2IFQA 5JCGA 4FYUA 1IYHA 4V2LA 3UVHA 5HR3A 2P31A 4CW9A 4GCIA 1V2AA 1TXXA 2H76A 4MJCA 1XWBA 4MP4A 3FW2A 1PA3A 4WXTA 1AQXA 1JLVA 2IN3A 20GSA 1YKAA 1GSUA 1JFUA 4AJ7A 4Q5NA 3I9V2 3GKXA 2VD0A 1TU7A 4ECCA 5J41A 2H19A 5IIZA 3FEUA 3CRUA 1SL2B 4DSSA 1H4OA 5IQYA 3KH7A 5A4UA 2YNXA 3FR3A 1HYUA 4YAVA 4TR1A 2PBJA 4XIHA 3GSSA 1C72A 1PSQA 2CZ3A 4KGIA 1YKCA 5HQPA 1A24A 2FA8A 5D96A 3QPMA 3MSZA 3TJBA 4USSA 4G9HA 1TRWA 5DJLA 1GSSA 2AJQB 4IN0A 5D9TA 4OFMA 1CQGA 3IAS2 2JSZA 19GSA 1G6WA 3DMLA 2MYGA 5IOWA 2JU5A 2B3SA 2HXKA 14GSA 1FB6A 3C73A 3A2WA 4LA1A 1VF2A 1R5PA 2H1GA 3UVTA 2OA7A 1TJDA 2B5EA 1M99A 1JZRA 3DIEA 2OACA 2TIRA 5D93A 4ULXA 1KBNA 1KTEA 4N11A 2HZEB 3WD6A 2TRXA 3LORA 2V32A 4OMVA 5IOXA 4I8BA 1SKWB 1F37A 2LJRA 5KN1A 5AIXA 5J5NA 3HY2A 5GAND 4X0XA 1QFNA 2PMTA 3FZ9A 1GTAA 3IHQA 4KX4A 3QFAC 3KMOA 3UEMA 3CMIA 1Q4JA 2VL9A 4TVEA 4Q5FA 4NV5A 2LJKA 2OBIA 1TRSA 3Q74A 1TRVA 2WZ9A 1YJ6A 2DJKA 4WR4A 1B48A 5G5FA 4TW5A 5GSTA 3HCZA 3IR4A 4N30A 7GSSA 1TP9A 3RBTA 4F82A 5ECMB 1TKDB 1YQ1A 3QFBC 2H0HA 3IK7A 5ECKB 4HJMA 4MH3A 4NAXA 2FLSA 3ERWA 5EL8A 2VD1A 1QK8A 2HRFA 2LRNA 5H5SA 2H1DA 1XVQA 1SK2A 4TKYA 1OC9A 4L8EA 4FIWA 3CTGA 2N5BA 4PX1A 5HFKA 4KDXA 2JL4A 2VO4A 2DMMA 1Z6NA 1XW6A 2YANA 1XOBA 5F05A 2X99A 4K7NA 1GTUA 2YWOA 4ZL7A 2TRCP 1G0TA 4AGSA 22GSA 3MWHA 4H86A 1MEKA 3Q19A 3DYRA 3J7Yb 3VI5A 4HI7A 4I97A 4MF6A 1JZOA 4OCFA 2GSQA 4QQ7A 1M9AA 2GQKA 5JWOB 1WIKA 3FR9A 2P5RA 5F06A 2AHEA 2O7KA 4JBBA 3CSHA 5LNKe 2AB6A 1A0RP 1A2MA 1A2LA 2FUG2 1ZYEA 2H71A 3PH9A 2FD3A 2E7PA 3HD5A 1AW9A 2FA4A 5G5EA 4G0LA 3P90A 4BVYB 2DJJA 2O87A 3TKQA 3GUSA 4TR3A 2KHPA 4K9ZA 2H70A 3I69A 2AUVA 4TR0A 4PNFA 2PWJA 1XIYA 3ZREA 3KP8A 3TKSE 1MTCA 1ERTA 4HU7A 2VCWA 1W4VA 4YH2A 2WULA 1Z6MA 2R37A 4NHWA 4WF4A 2LQOA 1K3LA 8GSSA 4HOJA 3GNJA 2PN8A 4KH7A 2L57A 1SL1B 2VAFA 3TJGA 4IP1A 5KN3A 1M9BA 4GRFA 3HA9A 6GSXA 4PURA 4NV2A 2R4VA 4MF5A 2I4AA 1LJRA 1HNCA 2YV9A 4CHSA 2H1BA 2YZUA 4KDYA 5EVOA 3M9KA 2J9HA 2FGXA 2H1AA 1SJIA 1VGLA 3TRXA 5D9VA 4ECBA 2G0FA 2HFDA 1NHOA 2I9HA 2MZCA 3QAVA 1R5AA 4GXZA 4LLRA 2PPTA 4BL7B 4K8MA 1N8JA 4BPYA 2EIOA 3J7Yk 4WF5A 1X9MB 4MPFA 2L59A 2HSMB 1ERVA 4HZ2A 2LNSA 4PQ1A 1X5DA 3F6DA 3VK9A 2YWIA 1FW1A 2H8LA 4POMA 1THXA 1TU8A 4J56E 3IOSA 4EXJA 3NZNA 1RQMA 2JZSA 1WWJA 5IO0A 3LSZA 2PGTA 2DLXA 4N0ZA 5JWRB 4YQMA 3GSTA 13GSA 2A4VA 4HQZA 2WJUA 4JR6A 2VL3A 4YAPA 1AQVA 2O85A 2IMEA 5GSSA 4FQUA 5LCZA 3P2AA 2H66A 3F6FA 5KN2A 3GKMA 1GSFA 2IFQB 1Q98A 3H4KA 4JZQA 4G10A 1FB0A 2JZRA 3FZAA 3C1RA 3A2VA 4IGJA 5B6NA 1PD21 3O3TA 3GL5A 1JLWA 3LG6A 3ZTLA 3IC4A 1LBKA 4MDCA 1B9YC 2KP1A 4PUFC 1OAZA 2OE0A 2PVOC 1U6TA 1WPIA 2LS5A 2DIZA 3GX8A 1TI3A 3GYKA 5DQYA 3QOUA 3R2QA 1BX9A 6GSSA 4K1FA 2IMDA 2M46A 5IMFA 2VLVA 1GWCA 3IDVA 3BCIA 2DSAA 3F4RA 4KW6A 4KB3A 5ECIB 4IBPA 5IMDA 1ACVA 4XS1A 4K7OA 3JCML 3D22A 4POBA 1V98A 5IMVA 3APQA 4EO3A 4DSSB 1XOAA 3GFKA 4IELA 3U5RE 1YEPA 1X9SB 4TR1B 4IVFA 2LQQA 4O32A 3EU4A 5HR2A 1T00A 2VCXA 3PGTA 5H5RA 3P8WA 5BMUA 5ECOB 3WT1A 4DSRA 1XFLA 2X64A 1NHYA 4XRAA 2FWGA 3GHAA 3HKRA 2IWTA 17GSA 5IO2A 3ZYWA 5IPHA 2DC5A 5G2ZA 2RUEA 3TCOA 3GL3A 4OO5A 1NM3A 3O76A 1BYEA 2F8AA 2E0QA 2VUPA 2P0GA 2VOCA 2M72A 1ERUA 3QAGA 2LKUA 3IK9A 3MNGA 1EEMA 3LYKA 4E8HA 2FHEA 2DJ1A 3I43A 3IE3A 2LEGA 2HI7A 1DSBA 2AV4A 4OWYA 2GVPA 3BBYA 1Z7RA 2PVQA 2CV4A 3KTBA 1J9BA 3FK8A 5LD0A 4NPBA 1JHBA 2I1UA 2F8FA 4X43A 2QSIA 6GSWA 4POKA 1EGOA 5L71A 4LL4B 3E3EA 3Q18A 4MJAA 2OJLA 3GN3A 4I6XA 2WGRA 2DMLA 1KEBA 3VWXA 3KH9A 2CAQA 3C71A 1OC3A 1A8LA 4GSSA 3EMXA 4F9ZA 5IMCA 3VWWA 3DGQA 4POLA 3EURA 11GSA 1OYJA 3APSA 3LGCA 2HYXA 3M3MA 4NWYA 4TR4A 2HRAA 2F9SA 5D9XA 3G7YA 4MLYA 2PU9C 2K8VA 4HS1A 3WYWA 5INYA 3IA1A 3ED3A 4QL7A 1GRXA 4WBJA 2JSYA 4ZB6A 2ES7A 5CP1A 3TKSA 2D2ZA 2CZ2A 3GA4A 4CDOA 3GURA 4KSMA 1KNGA 4XS4A 4HQSA 4IS0A 2RM6A 2M80A 5EY6A 3H79A 2HNLA 4TN8A 2P5QA 3IC8A 2GDRA 4ISDA 1XXUA 4BWSA 4HDEA 5D73A 4ML1A 1OC9B 1XCCA 4ZBAA 5E4WA 1R4WA 3GRXA 4IQAA 1S3CA 1XPVA 3UMAA 4OCEA 2PUKC 1EV9A 3G7IA 3FR6A 1XWGA 3ZVJA 4AJ8A 4HEA2 2B1KA 4WR5A 2GZYA 2C0EA 2GQLA 1IYIA 1GP1A 1QUWA 2YWNA 1WRYA 5B8AA 2OE3A 5FT3A 2VM1A 3TRQA 1S3AA 3QAWA 1I9DA 2GSTA 3E0UA 1HD2A 2IMIA 1V9WA 3GH6A 1TRUA 1PX7A 5DAKA 3W8SA 2B6MA 2VM2A 3O6TA 4MZWA 4ZL9A 3VPTA 2NTOA 2DIYA 4F03A 3C7MA 1Z3EA 3W6GA 1XW9A 2L4CA 1EOGA 1UC7A 2H30A 3KXOA 3HJMA 2CAIA 1GTBA 2ZUPA 2C3NA 3APOA 1GLQA 1F9MA 4IQ1A 1W89A 3ZIJA 2WB9A 3I6AA 5A4WA 1F3BA 5ECPB 1O85A 5G31A 3GV1A 3C1SA
chains in the Genus database with same CATH superfamily
3ZRDA 2HLSA 3AY8A 4RQRA 3TDGA 4PUAA 4EL1A 1G7OA 1TTZA 4MABA 2BJXA 1K0DA 1PMTA 1PFOA 5DALA 4GDFA 2GSSA 1UN2A 2EIQA 1ZMAA 2H73A 2L6DA 3RPPA 2AAWA 3HVXA 3LWAA 1SK0A 2MBTA 1YEWC 2ON5A 4JR4A 5DCHA 4BVXA 4GQFA 5CRDA 2YP6A 1ILOA 2F51A 3EYTA 3QR6A 5DDLA 4XS6A 5F0GA 2K8SA 2B5XA 3VFIA 1TK8B 3KJYA 1SD8A 6GSVA 2DJ2A 1TW9A 5JWQB 1HNAA 1OC8A 2ON7A 4NHZA 1O8WA 5CNWA 2EFHA 4O5RA 5J9CA 1WP0A 3SWLA 1SD9A 1WMJA 2E2GA 1T1VA 3NIVA 1TOFA 5ABRA 2KUCA 1J08A 2C3TA 2WCIA 1MDIA 5AIVA 1GUHA 3BJ5A 1GSEA 2HSNB 1AC1A 3D4TA 1XG8A 5IMAA 1AAZA 4I2UA 3KEBA 1G6YA 3F63A 3EE2A 1ERWA 1TDIA 4MJEA 4E68A 1FG4A 3M9JA 1AQWA 2NBSA 2VCZA 3HYPA 3H8QA 3EU3A 4OFTA 2L4QA 2MMOA 3KZQA 4DSQA 1TI1A 3L9UA 4Q5QA 2BMXA 4G0IA 2R3XA 2VLUA 3ME8A 5F8BA 3H93A 2FWFA 6GSUA 1GUKA 4N10A 2QA1A 5HR0A 1B4QA 3D4MA 2V2GA 5ENUA 2A4HA 1CQHA 3QMXA 1A0FA 2ALBA 2VCTA 1Z5YE 3RPNA 1SJ6A 5GAPD 4L5LA 4O92A 3CBUA 1A8YA 1GSQA 1YF0A 5CYYA 3F4TA 3GH9A 2IPAA 4MA9A 1GH2A 5D8IA 1OE7A 5J4VA 2DJ3A 1K3OA 4O7HA 2ZCTA 2VL2A 4GSNA 5A1NA 3IRAA 4JEDA 2HRNA 1PN9A 3N5OA 1EWXA 1YEXA 1PL2A 2MMNA 5IM9A 2O8VB 1K0BA 2K18A 5D9WA 2FCHA 3GTUB 5BMUB 1PGTA 5E59A 1B9XC 3KM6A 4ACSA 3FZ4A 2A2PA 1WOUA 1PKZA 2L6CA 3LQ7A 1M3JA 2EIRA 1VF1A 3QCPA 4KCAA 1J0FA 5ELAA 1A23A 3IV4A 4WKWA 4PNGA 4MPGA 1U88A 2DJ0A 1M3IA 1AUCA 1B8XA 4RI6A 1VRSD 5GZZB 2H72A 2OT3A 1EV4A 3ZFLA 2XC2A 3NOFA 2VIMA 1DUGA 5B6MA 3D5JA 4K2DA 3WGDA 2JACA 1AIUA 5CRHA 3ZIVA 5IPGA 1S3DA 2HT9A 4WEYA 3VWVA 1HNBA 4AKHA 3Q6OA 2WVZA 4V2NA 5HFIA 2YWMA 1YF1A 3PR8A 4WBRD 4RI7A 1FO5A 1TXUA 3PPUA 1M7TA 4XHMA 3KTLA 3UBLA 4EIQA 2UZ8A 2LNTA 3W8JA 1SU9A 2A2RA 3HZ8A 3KIJA 2NDOA 2NVLA 4K0GA 1ST9A 3HVSA 1ZYQB 4HJ2A 2C8UA 4G2EA 2GT6A 3VURA 3VWUA 1SYXA 5ECSA 4J2FA 4V1Ap 2K9FA 5H5QA 4D73A 1BEDA 2YN1A 1N25A 1GLPA 3KGKA 2VLTA 2IMKA 2LJAA 1GSYA 3RHCA 1DE2A 4XTSA 2VKZG 2H0IA 3DEXA 1BAYA 2WZSA 2GLRA 3K8NA 4ICYA 1EP8A 1XWAA 4ILFA 5A5KA 3S9FA 1PL1A 1ZOFA 3GTUA 2E2MA 1UA5A 3BD2A 3TJFA 1V40A 5KN0A 1PN0A 2L5OA 4XS4B 3C8EA 4WETA 1XWCA 4NXIA 3A3TA 3DKSA 3CQFA 2LTKA 1GL8A 2OKAA 3ZFBA 2REMA 3V1WA 1T8EB 1DBYA 5AISA 2HSYA 4X1UA 4AKIA 1F2EA 3KCMA 3WT2A 2UV8G 1GNEA 1THOA 2F3MA 3HDCA 4ZIJA 2C1YA 2FY6A 3CWGA 2EFEA 4ECJA 4L0WA 4MMMA 2GT5A 2V6KA 5J3RA 3D0ZA 1YZXA 2WFCA 2CX4A 1FHEA 4KUNA 3RHBA 2CQ9A 4GWRA 3FMWA 1PQNA 1A2JA 4JE1A 1RW1A 4JRRA 5DAKB 2G2QA 5CAXA 3TOTA 3GKKA 4MF7A 1O73A 3EPTA 3P7XA 1NSWA 2X8GA 1K3YA 2WVXA 1U3AA 4ZL8A 1OVNA 4N0VA 4RUVA 2N5AA 2GGTA 4EF0A 1EP7A 2IMFA 2JZTA 4IP6A 1X9WB 1HQOA 1XZOA 3EVIA 3M1GA 4TXOA 2DBCA 5B7CA 2O89A 5ECNB 3UOMA 4L5OA 4KSOA 1FVJA 4ZB8A 1ZL9A 1X5CA 5J4UA 3WGXA 3PINA 4J57E 1XW5A 3DRNA 5ECLB 1GSDA 2BTOT 5DALB 5JCWA 1X0RA 3LYPA 9GSSA 3TGZA 4EDZA 2YPMA 1FAAA 2C3QA 2I81A 3H1NA 1ZZYA 5G1LA 6GSYA 5C00A 1K0NA 1T3BA 2OBKA 2R6KA 1BQ7A 1SK1A 3VPQA 3L9SA 3CSJA 4AF2A 3F8UA 2X49A 3BCKA 4L0UA 3CXGA 3M0FA 2C4JA 4BVXB 4DEJA 5CRGA 2N5FA 2FWEA 3L78A 1GULA 1M2DA 2LRCA 5CO3A 3TJJA 1X5EA 1URMA 3CTFA 3E9JB 4EKZA 3IBHA 1JZDA 1K0CA 3MDKA 3SBCA 4TOPA 1GNWA 4HU9A 1OE8A 2YJ7A 4KE3A 4YQUA 4EE0A 1T4ZA 3HVNA 4IJIA 4OD7A 2WW3A 1M2BA 1YDKA 4BIKA 3QD9A 1N2AA 4GTUA 3LEFA 4JU5A 3R3EA 1NW2A 2KOKA 1K0OA 3DWVA 1WE0A 1ZCPA 4ID0A 1JZWA 1R7HA 1R26A 1I5GA 1O7UA 4I5QA 1EEJA 2GSRA 3MAKA 4ZB9A 5FHIA 5A4VA 2CT6A 2IL3A 2CA8A 3GIXA 4FYCA 2CVDA 1F3AA 3FZ5A 3ZVJD 2H6XA 4BA7A 3F3RA 4G0KA 2RUFA 2Z9SA 2B5YA 3DVXA 1QQ2A 1TK5B 5AGYA 2CVKA 3GKNA 3ZZXA 1SENA 2GQMA 4PI0C 5CRWA 4ZBDA 3D6IA 5G30A 3UARA 3TOUA 3UL3A 2LSTA 4MJBA 4RQXA 2XPDA 2J23A 1ZGNA 4OO4A 3D21A 4EC0A 2MBSA 4IKHA 3DXBA 4FYBA 5HR1A 4Q5RA 3US3A 2AYTA 2MMAA 5KEJA 2QGVA 4CY8A 2XHFA 4PXOA 3L4NA 3TKPA 4O5QA 1DE1A 2OE1A 3F0IA 4K6XA 2YOIA 1G7EA 2QC7A 1LU4A 2H75A 4MH2A 1V58A 3IXRA 4OFNA 1BG1A 5B8BA 2C80A 2C0DA 2LV3A 1M2AA 1QMVA 2IIYA 4GF0A 1E2YA 5IMZA 3F9UA 2LRTA 5JCUA 4PTSA 4IW9A 1MDKA 3ZLPA 2V6OA 4FH8A 1SJZA 2HZEA 4MZCA 5A1NB 2EC4A 5KOWA 2IJYA 4K2XA 4K0NA 1FOVA 2R2JA 1VF3A 2R0GA 4YKFA 2HZFA 3LXZA 1SKRB 1SL0B 4PGTA 1B4PA 2H74A 3G9BA 2RIIA 1ZYPA 2JADA 1MDJA 3VLNA 1H75A 2K6VA 1MD3A 1WJKA 3EC3A 4YQVA 5BRTA 2VL2C 3HJPA 5F07A 5KOXA 2B7KA 1FVKA 4GSTA 5DQSA 4MCUA 3U6VA 3TU3B 3F4SA 2H6YA 2XBQA 4XCSA 4KCEA 1S3RA 4NMUA 2B1LA 3FHKA 4ECIA 4PQIA 2KLXA 3ERFA 5A5HA 5DBQA 2B7JA 4LMVA 2H01A 5ECQB 3IPZA 4F2IA 3HJOA 4O5UA 1PRXA 2V1MA 2CVBA 1OKTA 3ERGA 3TKRA 1V57A 4TXVA 4ZILA 4KNDA 4V1Ag 4MK3A 3N9JA 3TUEA 1Z7PA 2YZHA 4PHZC 1AXDA 5C04A 3ISOA 1SKSB 1U87A 3UIWA 1ML6A 2QKEA 1Y1UA 1XVWA 2WW0A 1U3IA 2YJHA 4D73B 4W66A 3QDNA 3RAZA 5DVBA 4A5PA 2R0PA 2RM5A 4MNNA 2YCDA 5CREA 2NPBA 3CSIA 1TK0B 2LUSA 3GX0A 4KAEA 2X8HA 3UJ1A 1ON4A 3FKFA 3HHVA 4AJ6A 3OR5A 1YY7A 1F6MC 4KA0A 1GTIA 1QGVA 2O3EA 2HRKB 5HFGA 1T4YA 2HSHA 12GSA 1XBSA 4YKGA 5G1KA 3KP9A 4LMWA 2GTUA 2HE3A 4EDYA 1S4BP 2KP2A 4K7IA 5FWGA 4ZBBA 4GLTA 4BVYA 3WGEA 2XPEA 3UBKA 3KD0A 3FY7A 4KF9A 3HXSA 3M8NA 4V2MA 3TRPA 3TB2A 1O81A 1USBA 4TRXA 2I3YA 2X8CA 2R5GA 4PI2C 3L9VA 4PQHA 4HUAA 3DVWA 1T7PB 4ZXGA 4QL9A 2FWHA 2CX3A 4F0CA 1UVZA 5ID2B 4I2TA 3ZITA 3ZL5A 5DCGA 4DVCA 2A2SA 3LJRA 1XWKA 1RK4A 3ME7A 3VI7A 18GSA 1PX6A 1BJXA 2H6ZA 3LXTA 2MMZA 2C0FA 1K0AA 3EINA 2O36A 2WW2A 2VCQA 3KMNA 1EGRA 2VCVA 4KDUA 2XBIA 3CRTA 2ZNMA 4Z7XA 3CYNA 2PERA 3RDWA 4HZ4A 1PKWA 4GQCA 4AKXB 4P3YB 4IJ3A 1Y6EA 4AKGA 1EOHA 2GZZA 1O8XA 5DJMA 2WVXB 1ABAA 3A5WA 4E8EA 2WRTA 3A2XA 2H0GA 3TJKA 3EWLA 3HVVA 3HZ4A 4BL7A 3GMFA 2OADA 3ZMKA 1Z9HA 1GUMA 3FYGA 3UAPA 1EZKA 1VF4A 3F3QA 4TXOB 1MD4A 4MZBA 4IHUA 10GSA 2HSMA 2V41A 1SYRA 1BG5A 2HRKA 3ZMLA 3LFLA 5J9BA 4XRDA 16GSA 5EPFA 1OKDA 4F0BA 2WS2A 5ECHB 1SVMA 2GS3A 3DD3A 1SVOA 6GSTA 2RLIA 4FO5A 4EUYA 1K0MA 3L0HA 1M0UA 2C0GA 4ML6A 1Y25A 1E6BA 3BOAA 5COHA 3TKSC 3EMPA 4BWQA 2L5LA 1QXHA 5AN1A 5ECRB 1O6JA 2GZPA 2WDUA 4LL1B 4G19A 2YV7A 5ID2A 1ZYNA 3FRCA 4EVMA 3IAM2 2HQTA 3G7JA 5ELGA 2FNOA 2IFQA 5JCGA 4FYUA 5J47A 1IYHA 4G01A 4V2LA 3UVHA 5HR3A 2P31A 4CW9A 4GCIA 1V2AA 1TXXA 2H76A 4MJCA 1XWBA 4MP4A 3FW2A 1PA3A 4WXTA 1AQXA 1JLVA 2IN3A 20GSA 1YKAA 1GSUA 1JFUA 4AJ7A 4Q5NA 3I9V2 3GKXA 2VD0A 1TU7A 4ECCA 5J41A 2H19A 5IIZA 3FEUA 3CRUA 1SL2B 4DSSA 1H4OA 5IQYA 3KH7A 5A4UA 2YNXA 3MYDA 3FR3A 4ZB7A 1HYUA 4YAVA 4TR1A 2PBJA 4XIHA 5J40A 3GSSA 1C72A 2DKIA 1PSQA 2CZ3A 4KGIA 1SVLA 1YKCA 5HQPA 1A24A 2FA8A 5D96A 4CY6A 3QPMA 3MSZA 3TJBA 4USSA 4G9HA 4X4JA 1TRWA 5DJLA 1GSSA 3LW9A 2AJQB 4IN0A 5D9TA 4OFMA 1CQGA 5A34B 3IAS2 2JSZA 19GSA 1G6WA 3DMLA 2MYGA 5IOWA 2JU5A 2B3SA 2HXKA 14GSA 1FB6A 3C73A 3A2WA 4LA1A 1VF2A 1R5PA 2H1GA 3UVTA 2OA7A 1TJDA 2B5EA 1M99A 1JZRA 3DIEA 2OACA 2TIRA 5D93A 4ULXA 1KBNA 2QA2A 1KTEA 4N11A 2HZEB 3WD6A 2TRXA 3LORA 2V32A 4OMVA 5IOXA 4I8BA 1SKWB 1F37A 2LJRA 5KN1A 5AIXA 5J5NA 3HY2A 5GAND 4X0XA 1QFNA 2PMTA 3FZ9A 3RFRC 1GTAA 3IHQA 4KX4A 3QFAC 3KMOA 3UEMA 3CMIA 1Q4JA 2VL9A 4TVEA 4Q5FA 4NV5A 2LJKA 2OBIA 1TRSA 3Q74A 1TRVA 2WZ9A 1YJ6A 2DJKA 2WW1A 4WR4A 1B48A 5G5FA 4TW5A 5GSTA 3HCZA 3IR4A 4N30A 7GSSA 1TP9A 3RBTA 4F82A 5ECMB 1TKDB 1YQ1A 3QFBC 2H0HA 3IK7A 5ECKB 4HJMA 4N3ZA 4MH3A 4NAXA 2FLSA 3ERWA 5EL8A 2VD1A 5A5HB 1QK8A 2HRFA 2LRNA 5H5SA 2H1DA 1BF5A 5A34A 1XVQA 1SK2A 3IHGA 4TKYA 1OC9A 4L8EA 4FIWA 3CTGA 2N5BA 4PX1A 5HFKA 4KDXA 2JL4A 2VO4A 2DMMA 1Z6NA 1XW6A 2YANA 1XOBA 5F05A 2X99A 4K7NA 1GTUA 4FXYP 2YWOA 4ZL7A 2TRCP 1G0TA 4AGSA 22GSA 2EFDA 3MWHA 4H86A 1MEKA 3Q19A 3DYRA 3J7Yb 3VI5A 4HI7A 4I97A 4MF6A 1JZOA 4OCFA 2GSQA 4QQ7A 1M9AA 2GQKA 5JWOB 1WIKA 3FR9A 2P5RA 5F06A 2AHEA 2O7KA 4JBBA 3CSHA 5LNKe 2AB6A 1A0RP 2FUG2 1A2MA 1A2LA 1ZYEA 2H71A 3PH9A 2FD3A 2E7PA 3HD5A 1AW9A 2FA4A 5G5EA 4AI6A 4G0LA 3P90A 4BVYB 2DJJA 2O87A 3TKQA 3GUSA 1I1IP 4TR3A 2KHPA 4K9ZA 2H70A 3I69A 2AUVA 4TR0A 4PNFA 2PWJA 1XIYA 3ZREA 3KP8A 3TKSE 1MTCA 1ERTA 4HU7A 2VCWA 1W4VA 4YH2A 2WULA 1Z6MA 2R37A 4NHWA 4WF4A 2LQOA 4Z2UA 1K3LA 8GSSA 4HOJA 3A5IA 3GNJA 2PN8A 4KH7A 2L57A 1SL1B 2VAFA 3TJGA 4IP1A 5KN3A 1M9BA 4GRFA 3HA9A 6GSXA 4PURA 4NV2A 2R4VA 4MF5A 2I4AA 1LJRA 1HNCA 2YV9A 4CHSA 3HMJG 2H1BA 2YZUA 4KDYA 5EVOA 3M9KA 2J9HA 2FGXA 2H1AA 1FOHA 1SJIA 1VGLA 3TRXA 5D9VA 4ECBA 2G0FA 2HFDA 1NHOA 2I9HA 4Z2RA 2MZCA 3QAVA 1R5AA 4GXZA 4LLRA 2PPTA 4BL7B 4K8MA 1N8JA 4BPYA 2EIOA 3J7Yk 4WF5A 1X9MB 4QMKA 4MPFA 2L59A 2HSMB 1ERVA 4HZ2A 2LNSA 4PQ1A 1X5DA 3F6DA 3VK9A 2YWIA 1FW1A 2H8LA 4POMA 2HSNA 1THXA 1TU8A 4J56E 3IOSA 4EXJA 3NZNA 1RQMA 2JZSA 1WWJA 5IO0A 3LSZA 2PGTA 2DLXA 4N0ZA 5JWRB 4YQMA 3GSTA 13GSA 2A4VA 4HQZA 2WJUA 4JR6A 2VL3A 4YAPA 1AQVA 2O85A 2IMEA 5GSSA 4FQUA 5LCZA 3P2AA 2H66A 3F6FA 5KN2A 3GKMA 1GSFA 2IFQB 1Q98A 3H4KA 4JZQA 4G10A 1FB0A 2JZRA 3FZAA 3C1RA 3A2VA 4IGJA 5B6NA 1PD21 3O3TA 3GL5A 1JLWA 3LG6A 3ZTLA 3IC4A 1LBKA 4MDCA 1B9YC 2KP1A 4PUFC 1OAZA 2OE0A 2PVOC 1U6TA 1WPIA 2LS5A 2DIZA 3GX8A 1TI3A 3GYKA 5DQYA 3QOUA 3R2QA 1BX9A 6GSSA 4K1FA 2IMDA 2M46A 5IMFA 2VLVA 1GWCA 3IDVA 3BCIA 2DSAA 3F4RA 4KW6A 4KB3A 5ECIB 4IBPA 5IMDA 1ACVA 4XS1A 4K7OA 3JCML 3D22A 4POBA 1V98A 5IMVA 3APQA 4EO3A 4DSSB 1XOAA 3GFKA 4IELA 3U5RE 1YEPA 1X9SB 4TR1B 4IVFA 2LQQA 4O32A 3EU4A 4K5RA 5HR2A 1T00A 3CHXC 2VCXA 3PGTA 5H5RA 3P8WA 5BMUA 5ECOB 3WT1A 4DSRA 1XFLA 2X64A 1NHYA 4XRAA 2FWGA 3GHAA 5J4YA 3HKRA 2IWTA 17GSA 5IO2A 3ZYWA 5IPHA 2DC5A 5G2ZA 2RUEA 3TCOA 3GL3A 4OO5A 1NM3A 3O76A 1BYEA 2F8AA 2E0QA 2VUPA 2P0GA 2VOCA 2M72A 1ERUA 3QAGA 2LKUA 3IK9A 3MNGA 4EIPA 2WVYA 1EEMA 3LYKA 4E8HA 2FHEA 2DJ1A 3I43A 3IE3A 2LEGA 2HI7A 1DSBA 2AV4A 4OWYA 2EFCA 2GVPA 3BBYA 1Z7RA 2PVQA 2CV4A 3KTBA 1J9BA 2DKHA 3FK8A 5LD0A 4NPBA 1JHBA 2I1UA 2F8FA 4X43A 2QSIA 6GSWA 4POKA 1EGOA 5L71A 4LL4B 3E3EA 3Q18A 4MJAA 2OJLA 4K5SA 3GN3A 4I6XA 2WGRA 2DMLA 1KEBA 3VWXA 3KH9A 2CAQA 3C71A 1OC3A 1A8LA 4GSSA 3EMXA 4F9ZA 5IMCA 3VWWA 3DGQA 4POLA 3EURA 2X4AA 2R0CA 11GSA 1OYJA 3APSA 3LGCA 2HYXA 3M3MA 4NWYA 4TR4A 2HRAA 2F9SA 5D9XA 3G7YA 4MLYA 2PU9C 2K8VA 4HS1A 3WYWA 5INYA 3IA1A 3ED3A 4QL7A 1GRXA 4WBJA 2JSYA 4ZB6A 2ES7A 5CP1A 3TKSA 2D2ZA 2CZ2A 3GA4A 4CDOA 3GURA 4KSMA 1KNGA 4XS4A 4HQSA 4IS0A 2RM6A 1YVLA 2M80A 5EY6A 3H79A 2HNLA 4Z2TA 4TN8A 2P5QA 3IC8A 2GDRA 4ISDA 1XXUA 4BWSA 4HDEA 5D73A 4ML1A 1OC9B 1XCCA 4ZBAA 5E4WA 1R4WA 3RGBC 3GRXA 4IQAA 1S3CA 1XPVA 3UMAA 4OCEA 2PUKC 1EV9A 3G7IA 3FR6A 1XWGA 3ZVJA 4AJ8A 4HEA2 2B1KA 4WR5A 2GZYA 2C0EA 2GQLA 1IYIA 4HSCX 1GP1A 1QUWA 2YWNA 1WRYA 5B8AA 2OE3A 5FT3A 2VM1A 3TRQA 1S3AA 3QAWA 1I9DA 2GSTA 3E0UA 1HD2A 2IMIA 1V9WA 3GH6A 1TRUA 1PX7A 5DAKA 3W8SA 2B6MA 2VM2A 3O6TA 4MZWA 3MIXA 4ZL9A 3VPTA 2NTOA 2DIYA 4F03A 3C7MA 1Z3EA 3W6GA 2H1LA 1XW9A 2L4CA 1EOGA 1UC7A 2H30A 3KXOA 3HJMA 2CAIA 1GTBA 2ZUPA 2C3NA 3APOA 1GLQA 1F9MA 2O5VA 4IQ1A 1W89A 3ZIJA 2WB9A 3I6AA 5A4WA 1F3BA 5ECPB 1O85A 5G31A 3GV1A 3C1SA
chains in the Genus database with same CATH topology
3ZRDA 2HLSA 3AY8A 4RQRA 3TDGA 4PUAA 4EL1A 1G7OA 1TTZA 4MABA 2BJXA 1K0DA 1PMTA 5DALA 4GDFA 2GSSA 1UN2A 2EIQA 1ZMAA 2H73A 2L6DA 3RPPA 2AAWA 3HVXA 3LWAA 1SK0A 2MBTA 2ON5A 4JR4A 5DCHA 4BVXA 4GQFA 5CRDA 2YP6A 1ILOA 2F51A 3EYTA 3QR6A 5DDLA 4XS6A 5F0GA 2K8SA 2B5XA 3VFIA 1TK8B 3KJYA 1SD8A 6GSVA 2DJ2A 1TW9A 5JWQB 1HNAA 1OC8A 2ON7A 4NHZA 1O8WA 5CNWA 2EFHA 4O5RA 5J9CA 1WP0A 3SWLA 1SD9A 1WMJA 2E2GA 1T1VA 3NIVA 1TOFA 5ABRA 2KUCA 1J08A 2C3TA 2WCIA 1MDIA 5AIVA 1GUHA 3BJ5A 1GSEA 2HSNB 1AC1A 3D4TA 5IMAA 1AAZA 4I2UA 3KEBA 1G6YA 3F63A 3EE2A 1ERWA 1TDIA 4MJEA 4E68A 1FG4A 3M9JA 1AQWA 2NBSA 2VCZA 3HYPA 3H8QA 3EU3A 4OFTA 2L4QA 2MMOA 3KZQA 4DSQA 1TI1A 3L9UA 4Q5QA 2BMXA 4G0IA 2R3XA 2VLUA 3ME8A 5F8BA 3H93A 2FWFA 6GSUA 1GUKA 4N10A 2QA1A 5HR0A 1B4QA 3D4MA 2V2GA 5ENUA 2A4HA 1CQHA 3QMXA 1A0FA 2ALBA 2VCTA 1Z5YE 3RPNA 1SJ6A 5GAPD 4L5LA 4O92A 3CBUA 1A8YA 1GSQA 1YF0A 5CYYA 3F4TA 3GH9A 2IPAA 4MA9A 1GH2A 5D8IA 1OE7A 5J4VA 2DJ3A 1K3OA 4O7HA 2ZCTA 2VL2A 4GSNA 5A1NA 3IRAA 4JEDA 2HRNA 1PN9A 3N5OA 1EWXA 1YEXA 1PL2A 2MMNA 5IM9A 2O8VB 1K0BA 2K18A 5D9WA 2FCHA 3GTUB 5BMUB 1PGTA 5E59A 1B9XC 3KM6A 4ACSA 3FZ4A 2A2PA 1WOUA 1PKZA 2L6CA 3LQ7A 2EIRA 1VF1A 3QCPA 4KCAA 1J0FA 5ELAA 1A23A 3IV4A 4WKWA 4PNGA 4MPGA 1U88A 2DJ0A 1AUCA 1B8XA 4RI6A 1VRSD 5GZZB 2H72A 2OT3A 1EV4A 3ZFLA 2XC2A 3NOFA 2VIMA 1DUGA 5B6MA 3D5JA 4K2DA 3WGDA 2JACA 1AIUA 5CRHA 3ZIVA 5IPGA 1S3DA 2HT9A 4WEYA 3VWVA 1HNBA 4AKHA 3Q6OA 4V2NA 5HFIA 2YWMA 1YF1A 3PR8A 4WBRD 4RI7A 1FO5A 1TXUA 3PPUA 1M7TA 4XHMA 3KTLA 3UBLA 4EIQA 2UZ8A 2LNTA 3W8JA 1SU9A 2A2RA 3HZ8A 3KIJA 2NDOA 2NVLA 4K0GA 1ST9A 3HVSA 1ZYQB 4HJ2A 2C8UA 4G2EA 2GT6A 3VURA 3VWUA 1SYXA 5ECSA 4J2FA 4V1Ap 2K9FA 5H5QA 4D73A 1BEDA 2YN1A 1N25A 1GLPA 3KGKA 2VLTA 2IMKA 2LJAA 1GSYA 3RHCA 1DE2A 4XTSA 2VKZG 2H0IA 3DEXA 1BAYA 2GLRA 3K8NA 4ICYA 1EP8A 1XWAA 4ILFA 5A5KA 3S9FA 1PL1A 1ZOFA 3GTUA 2E2MA 1UA5A 3BD2A 3TJFA 1V40A 5KN0A 1PN0A 2L5OA 4XS4B 3C8EA 4WETA 1XWCA 4NXIA 3A3TA 3DKSA 2LTKA 1GL8A 2OKAA 3ZFBA 2REMA 3V1WA 1T8EB 1DBYA 5AISA 2HSYA 4X1UA 4AKIA 1F2EA 3KCMA 3WT2A 2UV8G 1GNEA 1THOA 2F3MA 3HDCA 4ZIJA 2C1YA 2FY6A 3CWGA 2EFEA 4ECJA 4L0WA 4MMMA 2GT5A 2V6KA 5J3RA 3D0ZA 1YZXA 2WFCA 2CX4A 1FHEA 4KUNA 3RHBA 2CQ9A 4GWRA 3FMWA 1PQNA 1A2JA 4JE1A 1RW1A 4JRRA 5DAKB 2G2QA 5CAXA 3TOTA 3GKKA 4MF7A 1O73A 3EPTA 3P7XA 1NSWA 2X8GA 1K3YA 1U3AA 4ZL8A 1OVNA 4N0VA 4RUVA 2N5AA 2GGTA 4EF0A 1EP7A 2IMFA 2JZTA 4IP6A 1X9WB 1HQOA 1XZOA 3EVIA 3M1GA 4TXOA 2DBCA 5B7CA 2O89A 5ECNB 3UOMA 4L5OA 4KSOA 1FVJA 4ZB8A 1ZL9A 1X5CA 5J4UA 3WGXA 3PINA 4J57E 1XW5A 3DRNA 5ECLB 1GSDA 2BTOT 5DALB 5JCWA 1X0RA 3LYPA 9GSSA 3TGZA 4EDZA 2YPMA 1FAAA 2C3QA 2I81A 3H1NA 1ZZYA 5G1LA 6GSYA 5C00A 1K0NA 1T3BA 2OBKA 2R6KA 1BQ7A 1SK1A 3VPQA 3L9SA 3CSJA 4AF2A 3F8UA 2X49A 3BCKA 4L0UA 3CXGA 3M0FA 2C4JA 4BVXB 4DEJA 5CRGA 2N5FA 2FWEA 3L78A 1GULA 1M2DA 2LRCA 5CO3A 3TJJA 1X5EA 1URMA 3CTFA 3E9JB 4EKZA 3IBHA 1JZDA 1K0CA 3MDKA 3SBCA 4TOPA 1GNWA 4HU9A 1OE8A 2YJ7A 4KE3A 4YQUA 4EE0A 1T4ZA 4IJIA 4OD7A 1M2BA 1YDKA 3QD9A 1N2AA 4GTUA 3LEFA 4JU5A 3R3EA 1NW2A 2KOKA 1K0OA 3DWVA 1WE0A 1ZCPA 4ID0A 1JZWA 1R7HA 1R26A 1I5GA 1O7UA 4I5QA 1EEJA 2GSRA 3MAKA 4ZB9A 5FHIA 5A4VA 2CT6A 2IL3A 2CA8A 3GIXA 4FYCA 2CVDA 1F3AA 3FZ5A 3ZVJD 2H6XA 4BA7A 3F3RA 4G0KA 2RUFA 2Z9SA 2B5YA 3DVXA 1QQ2A 1TK5B 5AGYA 2CVKA 3GKNA 3ZZXA 1SENA 2GQMA 5CRWA 4ZBDA 3D6IA 5G30A 3UARA 3TOUA 3UL3A 2LSTA 4MJBA 4RQXA 2XPDA 2J23A 1ZGNA 4OO4A 3D21A 4EC0A 2MBSA 4IKHA 3DXBA 4FYBA 5HR1A 4Q5RA 3US3A 2AYTA 2MMAA 5KEJA 2QGVA 4CY8A 2XHFA 4PXOA 3L4NA 3TKPA 4O5QA 1DE1A 2OE1A 3F0IA 4K6XA 2YOIA 1G7EA 2QC7A 1LU4A 2H75A 4MH2A 1V58A 3IXRA 4OFNA 1BG1A 5B8BA 2C80A 2C0DA 2LV3A 1M2AA 1QMVA 2IIYA 4GF0A 1E2YA 5IMZA 3F9UA 2LRTA 5JCUA 4PTSA 4IW9A 1MDKA 3ZLPA 2V6OA 4FH8A 1SJZA 2HZEA 4MZCA 5A1NB 2EC4A 5KOWA 2IJYA 4K2XA 4K0NA 1FOVA 2R2JA 1VF3A 2R0GA 4YKFA 2HZFA 3LXZA 1SKRB 1SL0B 4PGTA 1B4PA 2H74A 3G9BA 2RIIA 1ZYPA 2JADA 1MDJA 3VLNA 1H75A 2K6VA 1MD3A 1WJKA 3EC3A 4YQVA 5BRTA 2VL2C 3HJPA 5F07A 5KOXA 2B7KA 1FVKA 4GSTA 5DQSA 4MCUA 3U6VA 3TU3B 3F4SA 2H6YA 2XBQA 4XCSA 4KCEA 4NMUA 2B1LA 3FHKA 4ECIA 4PQIA 2KLXA 3ERFA 5A5HA 5DBQA 2B7JA 4LMVA 2H01A 5ECQB 3IPZA 4F2IA 3HJOA 4O5UA 1PRXA 2V1MA 2CVBA 1OKTA 3ERGA 3TKRA 1V57A 4TXVA 4ZILA 4KNDA 4V1Ag 4MK3A 3N9JA 3TUEA 1Z7PA 2YZHA 1AXDA 5C04A 3ISOA 1SKSB 1U87A 3UIWA 1ML6A 2QKEA 1Y1UA 1XVWA 1U3IA 2YJHA 4D73B 4W66A 3QDNA 3RAZA 5DVBA 4A5PA 2R0PA 2RM5A 4MNNA 2YCDA 5CREA 2NPBA 3CSIA 1TK0B 2LUSA 3GX0A 4KAEA 2X8HA 3UJ1A 1ON4A 3FKFA 3HHVA 4AJ6A 3OR5A 1YY7A 1F6MC 4KA0A 1GTIA 1QGVA 2HRKB 5HFGA 1T4YA 2HSHA 12GSA 1XBSA 4YKGA 5G1KA 3KP9A 4LMWA 2GTUA 2HE3A 4EDYA 2KP2A 4K7IA 5FWGA 4ZBBA 4GLTA 4BVYA 3WGEA 2XPEA 3UBKA 3KD0A 3FY7A 4KF9A 3HXSA 3M8NA 4V2MA 3TRPA 3TB2A 1O81A 1USBA 4TRXA 2I3YA 2X8CA 2R5GA 3L9VA 4PQHA 4HUAA 3DVWA 1T7PB 4ZXGA 4QL9A 2FWHA 2CX3A 4F0CA 1UVZA 5ID2B 4I2TA 3ZITA 3ZL5A 5DCGA 4DVCA 2A2SA 3LJRA 1XWKA 1RK4A 3ME7A 3VI7A 18GSA 1PX6A 1BJXA 2H6ZA 3LXTA 2MMZA 2C0FA 1K0AA 3EINA 2VCQA 3KMNA 1EGRA 2VCVA 4KDUA 2XBIA 3CRTA 2ZNMA 4Z7XA 3CYNA 2PERA 3RDWA 4HZ4A 1PKWA 4GQCA 4AKXB 4P3YB 4IJ3A 1Y6EA 4AKGA 1EOHA 2GZZA 1O8XA 5DJMA 1ABAA 3A5WA 4E8EA 2WRTA 3A2XA 2H0GA 3TJKA 3EWLA 3HVVA 3HZ4A 4BL7A 3GMFA 2OADA 3ZMKA 1Z9HA 1GUMA 3FYGA 3UAPA 1EZKA 1VF4A 3F3QA 4TXOB 1MD4A 4MZBA 4IHUA 10GSA 2HSMA 2V41A 1SYRA 1BG5A 2HRKA 3ZMLA 3LFLA 5J9BA 4XRDA 16GSA 5EPFA 1OKDA 4F0BA 2WS2A 5ECHB 1SVMA 2GS3A 3DD3A 1SVOA 6GSTA 2RLIA 4FO5A 4EUYA 1K0MA 3L0HA 1M0UA 2C0GA 4ML6A 1Y25A 1E6BA 3BOAA 5COHA 3TKSC 3EMPA 4BWQA 2L5LA 1QXHA 5AN1A 5ECRB 1O6JA 2GZPA 2WDUA 4LL1B 4G19A 2YV7A 5ID2A 1ZYNA 3FRCA 4EVMA 3IAM2 2HQTA 3G7JA 5ELGA 2FNOA 2IFQA 5JCGA 4FYUA 5J47A 1IYHA 4G01A 4V2LA 3UVHA 5HR3A 2P31A 4CW9A 4GCIA 1V2AA 1TXXA 2H76A 4MJCA 1XWBA 4MP4A 3FW2A 1PA3A 4WXTA 1AQXA 1JLVA 2IN3A 20GSA 1YKAA 1GSUA 1JFUA 4AJ7A 4Q5NA 3I9V2 3GKXA 2VD0A 1TU7A 4ECCA 5J41A 2H19A 5IIZA 3FEUA 3CRUA 1SL2B 4DSSA 1H4OA 5IQYA 3KH7A 5A4UA 2YNXA 3MYDA 3FR3A 4ZB7A 1HYUA 4YAVA 4TR1A 2PBJA 4XIHA 5J40A 3GSSA 1C72A 2DKIA 1PSQA 2CZ3A 4KGIA 1SVLA 1YKCA 5HQPA 1A24A 2FA8A 5D96A 4CY6A 3QPMA 3MSZA 3TJBA 4USSA 4G9HA 4X4JA 1TRWA 5DJLA 1GSSA 3LW9A 2AJQB 4IN0A 5D9TA 4OFMA 1CQGA 5A34B 3IAS2 2JSZA 19GSA 1G6WA 3DMLA 2MYGA 5IOWA 2JU5A 2B3SA 2HXKA 14GSA 1FB6A 3C73A 3A2WA 4LA1A 1VF2A 1R5PA 2H1GA 3UVTA 2OA7A 1TJDA 2B5EA 1M99A 1JZRA 3DIEA 2OACA 2TIRA 5D93A 4ULXA 1KBNA 2QA2A 1KTEA 4N11A 2HZEB 3WD6A 2TRXA 3LORA 2V32A 4OMVA 5IOXA 4I8BA 1SKWB 1F37A 2LJRA 5KN1A 5AIXA 5J5NA 3HY2A 5GAND 4X0XA 1QFNA 2PMTA 3FZ9A 1GTAA 3IHQA 4KX4A 3QFAC 3KMOA 3UEMA 3CMIA 1Q4JA 2VL9A 4TVEA 4Q5FA 4NV5A 2LJKA 2OBIA 1TRSA 3Q74A 1TRVA 2WZ9A 1YJ6A 2DJKA 4WR4A 1B48A 5G5FA 4TW5A 5GSTA 3HCZA 3IR4A 4N30A 7GSSA 1TP9A 3RBTA 4F82A 5ECMB 1TKDB 1YQ1A 3QFBC 2H0HA 3IK7A 5ECKB 4HJMA 4N3ZA 4MH3A 4NAXA 2FLSA 3ERWA 5EL8A 2VD1A 5A5HB 1QK8A 2HRFA 2LRNA 5H5SA 2H1DA 1BF5A 5A34A 1XVQA 1SK2A 3IHGA 4TKYA 1OC9A 4L8EA 4FIWA 3CTGA 2N5BA 4PX1A 5HFKA 4KDXA 2JL4A 2VO4A 2DMMA 1Z6NA 1XW6A 2YANA 1XOBA 5F05A 2X99A 4K7NA 1GTUA 2YWOA 4ZL7A 2TRCP 1G0TA 4AGSA 22GSA 2EFDA 3MWHA 4H86A 1MEKA 3Q19A 3DYRA 3J7Yb 3VI5A 4HI7A 4I97A 4MF6A 1JZOA 4OCFA 2GSQA 4QQ7A 1M9AA 2GQKA 5JWOB 1WIKA 3FR9A 2P5RA 5F06A 2AHEA 2O7KA 4JBBA 3CSHA 5LNKe 2AB6A 1A0RP 2FUG2 1A2MA 1A2LA 1ZYEA 2H71A 3PH9A 2FD3A 2E7PA 3HD5A 1AW9A 2FA4A 5G5EA 4AI6A 4G0LA 3P90A 4BVYB 2DJJA 2O87A 3TKQA 3GUSA 4TR3A 2KHPA 4K9ZA 2H70A 3I69A 2AUVA 4TR0A 4PNFA 2PWJA 1XIYA 3ZREA 3KP8A 3TKSE 1MTCA 1ERTA 4HU7A 2VCWA 1W4VA 4YH2A 2WULA 1Z6MA 2R37A 4NHWA 4WF4A 2LQOA 4Z2UA 1K3LA 8GSSA 4HOJA 3A5IA 3GNJA 2PN8A 4KH7A 2L57A 1SL1B 2VAFA 3TJGA 4IP1A 5KN3A 1M9BA 4GRFA 3HA9A 6GSXA 4PURA 4NV2A 2R4VA 4MF5A 2I4AA 1LJRA 1HNCA 2YV9A 4CHSA 3HMJG 2H1BA 2YZUA 4KDYA 5EVOA 3M9KA 2J9HA 2FGXA 2H1AA 1FOHA 1SJIA 1VGLA 3TRXA 5D9VA 4ECBA 2G0FA 2HFDA 1NHOA 2I9HA 4Z2RA 2MZCA 3QAVA 1R5AA 4GXZA 4LLRA 2PPTA 4BL7B 4K8MA 1N8JA 4BPYA 2EIOA 3J7Yk 4WF5A 1X9MB 4QMKA 4MPFA 2L59A 2HSMB 1ERVA 4HZ2A 2LNSA 4PQ1A 1X5DA 3F6DA 3VK9A 2YWIA 1FW1A 2H8LA 4POMA 2HSNA 1THXA 1TU8A 4J56E 3IOSA 4EXJA 3NZNA 1RQMA 2JZSA 1WWJA 5IO0A 3LSZA 2PGTA 2DLXA 4N0ZA 5JWRB 4YQMA 3GSTA 13GSA 2A4VA 4HQZA 2WJUA 4JR6A 2VL3A 4YAPA 1AQVA 2O85A 2IMEA 5GSSA 4FQUA 5LCZA 3P2AA 2H66A 3F6FA 5KN2A 3GKMA 1GSFA 2IFQB 1Q98A 3H4KA 4JZQA 4G10A 1FB0A 2JZRA 3FZAA 3C1RA 3A2VA 4IGJA 5B6NA 1PD21 3O3TA 3GL5A 1JLWA 3LG6A 3ZTLA 3IC4A 1LBKA 4MDCA 1B9YC 2KP1A 4PUFC 1OAZA 2OE0A 2PVOC 1U6TA 1WPIA 2LS5A 2DIZA 3GX8A 1TI3A 3GYKA 5DQYA 3QOUA 3R2QA 1BX9A 6GSSA 4K1FA 2IMDA 2M46A 5IMFA 2VLVA 1GWCA 3IDVA 3BCIA 2DSAA 3F4RA 4KW6A 4KB3A 5ECIB 4IBPA 5IMDA 1ACVA 4XS1A 4K7OA 3JCML 3D22A 4POBA 1V98A 5IMVA 3APQA 4EO3A 4DSSB 1XOAA 3GFKA 4IELA 3U5RE 1YEPA 1X9SB 4TR1B 4IVFA 2LQQA 4O32A 3EU4A 4K5RA 5HR2A 1T00A 2VCXA 3PGTA 5H5RA 3P8WA 5BMUA 5ECOB 3WT1A 4DSRA 1XFLA 2X64A 1NHYA 4XRAA 2FWGA 3GHAA 5J4YA 3HKRA 2IWTA 17GSA 5IO2A 3ZYWA 5IPHA 2DC5A 5G2ZA 2RUEA 3TCOA 3GL3A 4OO5A 1NM3A 3O76A 1BYEA 2F8AA 2E0QA 2VUPA 2P0GA 2VOCA 2M72A 1ERUA 3QAGA 2LKUA 3IK9A 3MNGA 4EIPA 1EEMA 3LYKA 4E8HA 2FHEA 2DJ1A 3I43A 3IE3A 2LEGA 2HI7A 1DSBA 2AV4A 4OWYA 2EFCA 2GVPA 3BBYA 1Z7RA 2PVQA 2CV4A 3KTBA 1J9BA 2DKHA 3FK8A 5LD0A 4NPBA 1JHBA 2I1UA 2F8FA 4X43A 2QSIA 6GSWA 4POKA 1EGOA 5L71A 4LL4B 3E3EA 3Q18A 4MJAA 2OJLA 4K5SA 3GN3A 4I6XA 2WGRA 2DMLA 1KEBA 3VWXA 3KH9A 2CAQA 3C71A 1OC3A 1A8LA 4GSSA 3EMXA 4F9ZA 5IMCA 3VWWA 3DGQA 4POLA 3EURA 2X4AA 2R0CA 11GSA 1OYJA 3APSA 3LGCA 2HYXA 3M3MA 4NWYA 4TR4A 2HRAA 2F9SA 5D9XA 3G7YA 4MLYA 2PU9C 2K8VA 4HS1A 3WYWA 5INYA 3IA1A 3ED3A 4QL7A 1GRXA 4WBJA 2JSYA 4ZB6A 2ES7A 5CP1A 3TKSA 2D2ZA 2CZ2A 3GA4A 4CDOA 3GURA 4KSMA 1KNGA 4XS4A 4HQSA 4IS0A 2RM6A 1YVLA 2M80A 5EY6A 3H79A 2HNLA 4Z2TA 4TN8A 2P5QA 3IC8A 2GDRA 4ISDA 1XXUA 4BWSA 4HDEA 5D73A 4ML1A 1OC9B 1XCCA 4ZBAA 5E4WA 1R4WA 3GRXA 4IQAA 1S3CA 1XPVA 3UMAA 4OCEA 2PUKC 1EV9A 3G7IA 3FR6A 1XWGA 3ZVJA 4AJ8A 4HEA2 2B1KA 4WR5A 2GZYA 2C0EA 2GQLA 1IYIA 1GP1A 1QUWA 2YWNA 1WRYA 5B8AA 2OE3A 5FT3A 2VM1A 3TRQA 1S3AA 3QAWA 1I9DA 2GSTA 3E0UA 1HD2A 2IMIA 1V9WA 3GH6A 1TRUA 1PX7A 5DAKA 3W8SA 2B6MA 2VM2A 3O6TA 4MZWA 3MIXA 4ZL9A 3VPTA 2NTOA 2DIYA 4F03A 3C7MA 1Z3EA 3W6GA 2H1LA 1XW9A 2L4CA 1EOGA 1UC7A 2H30A 3KXOA 3HJMA 2CAIA 1GTBA 2ZUPA 2C3NA 3APOA 1GLQA 1F9MA 2O5VA 4IQ1A 1W89A 3ZIJA 2WB9A 3I6AA 5A4WA 1F3BA 5ECPB 1O85A 5G31A 3GV1A 3C1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRD A;  2HLS A;  3AY8 A;  4RQR A;  3TDG A;  4PUA A;  4EL1 A;  1G7O A;  1TTZ A;  4MAB A;  2BJX A;  1K0D A;  1PMT A;  5DAL A;  2GSS A;  1UN2 A;  2EIQ A;  1ZMA A;  2H73 A;  2L6D A;  3RPP A;  2AAW A;  3HVX A;  3LWA A;  1SK0 A;  2MBT A;  2ON5 A;  4JR4 A;  5DCH A;  4BVX A;  4GQF A;  5CRD A;  2YP6 A;  1ILO A;  2F51 A;  3EYT A;  3QR6 A;  5DDL A;  4XS6 A;  5F0G A;  2K8S A;  2B5X A;  3VFI A;  1TK8 B;  3KJY A;  1SD8 A;  6GSV A;  2DJ2 A;  1TW9 A;  5JWQ B;  1HNA A;  1OC8 A;  2ON7 A;  4NHZ A;  1O8W A;  5CNW A;  4O5R A;  5J9C A;  1WP0 A;  3SWL A;  1SD9 A;  1WMJ A;  2E2G A;  1T1V A;  3NIV A;  1TOF A;  5ABR A;  2KUC A;  1J08 A;  2C3T A;  2WCI A;  1MDI A;  5AIV A;  1GUH A;  3BJ5 A;  1GSE A;  2HSN B;  1AC1 A;  3D4T A;  5IMA A;  1AAZ A;  4I2U A;  3KEB A;  1G6Y A;  3F63 A;  3EE2 A;  1ERW A;  1TDI A;  4MJE A;  1FG4 A;  3M9J A;  1AQW A;  2NBS A;  2VCZ A;  3HYP A;  3H8Q A;  3EU3 A;  4OFT A;  2L4Q A;  2MMO A;  3KZQ A;  4DSQ A;  1TI1 A;  3L9U A;  4Q5Q A;  2BMX A;  4G0I A;  2R3X A;  2VLU A;  3ME8 A;  5F8B A;  3H93 A;  2FWF A;  6GSU A;  1GUK A;  4N10 A;  5HR0 A;  1B4Q A;  3D4M A;  2V2G A;  5ENU A;  1CQH A;  3QMX A;  1A0F A;  2ALB A;  2VCT A;  1Z5Y E;  3RPN A;  1SJ6 A;  5GAP D;  4L5L A;  4O92 A;  3CBU A;  1A8Y A;  1GSQ A;  1YF0 A;  5CYY A;  3F4T A;  3GH9 A;  2IPA A;  4MA9 A;  1GH2 A;  5D8I A;  1OE7 A;  2DJ3 A;  1K3O A;  4O7H A;  2ZCT A;  2VL2 A;  4GSN A;  3IRA A;  4JED A;  2HRN A;  1PN9 A;  3N5O A;  1EWX A;  1YEX A;  1PL2 A;  2MMN A;  5IM9 A;  2O8V B;  1K0B A;  2K18 A;  5D9W A;  2FCH A;  3GTU B;  1PGT A;  5E59 A;  1B9X C;  3KM6 A;  4ACS A;  3FZ4 A;  1WOU A;  1PKZ A;  2L6C A;  3LQ7 A;  2EIR A;  1VF1 A;  3QCP A;  4KCA A;  1J0F A;  5ELA A;  1A23 A;  3IV4 A;  4WKW A;  4PNG A;  4MPG A;  1U88 A;  2DJ0 A;  1AUC A;  1B8X A;  4RI6 A;  1VRS D;  5GZZ B;  2H72 A;  1EV4 A;  3ZFL A;  2XC2 A;  3NOF A;  2VIM A;  1DUG A;  5B6M A;  3D5J A;  4K2D A;  3WGD A;  2JAC A;  1AIU A;  5CRH A;  3ZIV A;  5IPG A;  1S3D A;  2HT9 A;  4WEY A;  3VWV A;  1HNB A;  3Q6O A;  4V2N A;  5HFI A;  2YWM A;  1YF1 A;  3PR8 A;  4WBR D;  4RI7 A;  1FO5 A;  3PPU A;  1M7T A;  4XHM A;  3KTL A;  3UBL A;  2UZ8 A;  2LNT A;  3W8J A;  1SU9 A;  2A2R A;  3HZ8 A;  3KIJ A;  2NDO A;  2NVL A;  4K0G A;  1ST9 A;  3HVS A;  1ZYQ B;  4HJ2 A;  2C8U A;  4G2E A;  2GT6 A;  3VUR A;  3VWU A;  1SYX A;  5ECS A;  4J2F A;  4V1A p;  2K9F A;  5H5Q A;  4D73 A;  1BED A;  2YN1 A;  1GLP A;  3KGK A;  2VLT A;  2IMK A;  2LJA A;  1GSY A;  3RHC A;  1DE2 A;  4XTS A;  2H0I A;  3DEX A;  1BAY A;  2GLR A;  3K8N A;  1EP8 A;  1XWA A;  4ILF A;  5A5K A;  3S9F A;  1PL1 A;  1ZOF A;  3GTU A;  2E2M A;  1UA5 A;  3BD2 A;  3TJF A;  1V40 A;  5KN0 A;  2L5O A;  4XS4 B;  3C8E A;  4WET A;  1XWC A;  4NXI A;  3A3T A;  3DKS A;  2LTK A;  1GL8 A;  2OKA A;  3ZFB A;  2REM A;  3V1W A;  1T8E B;  1DBY A;  5AIS A;  2HSY A;  4X1U A;  1F2E A;  3KCM A;  3WT2 A;  1GNE A;  1THO A;  2F3M A;  3HDC A;  4ZIJ A;  2C1Y A;  2FY6 A;  4ECJ A;  4L0W A;  4MMM A;  2GT5 A;  2V6K A;  5J3R A;  3D0Z A;  1YZX A;  2WFC A;  2CX4 A;  1FHE A;  4KUN A;  3RHB A;  2CQ9 A;  4GWR A;  1PQN A;  1A2J A;  4JE1 A;  1RW1 A;  4JRR A;  5DAK B;  2G2Q A;  5CAX A;  3TOT A;  3GKK A;  4MF7 A;  1O73 A;  3P7X A;  1NSW A;  2X8G A;  1K3Y A;  1U3A A;  4ZL8 A;  1OVN A;  4N0V A;  4RUV A;  2N5A A;  2GGT A;  4EF0 A;  1EP7 A;  2IMF A;  2JZT A;  4IP6 A;  1X9W B;  1HQO A;  1XZO A;  3EVI A;  3M1G A;  4TXO A;  2DBC A;  5B7C A;  2O89 A;  5ECN B;  3UOM A;  4L5O A;  4KSO A;  1FVJ A;  4ZB8 A;  1ZL9 A;  1X5C A;  5J4U A;  3WGX A;  3PIN A;  4J57 E;  1XW5 A;  3DRN A;  5ECL B;  1GSD A;  2BTO T;  5DAL B;  5JCW A;  1X0R A;  3LYP A;  9GSS A;  3TGZ A;  4EDZ A;  2YPM A;  1FAA A;  2C3Q A;  2I81 A;  3H1N A;  1ZZY A;  5G1L A;  6GSY A;  5C00 A;  1K0N A;  1T3B A;  2OBK A;  2R6K A;  1BQ7 A;  1SK1 A;  3VPQ A;  3L9S A;  3CSJ A;  4AF2 A;  3F8U A;  3BCK A;  4L0U A;  3CXG A;  3M0F A;  2C4J A;  4BVX B;  4DEJ A;  5CRG A;  2N5F A;  2FWE A;  3L78 A;  1GUL A;  1M2D A;  2LRC A;  5CO3 A;  3TJJ A;  1X5E A;  1URM A;  3CTF A;  3E9J B;  4EKZ A;  3IBH A;  1JZD A;  1K0C A;  3MDK A;  3SBC A;  4TOP A;  1GNW A;  4HU9 A;  1OE8 A;  2YJ7 A;  4KE3 A;  4YQU A;  4EE0 A;  1T4Z A;  4IJI A;  4OD7 A;  1M2B A;  1YDK A;  3QD9 A;  1N2A A;  4GTU A;  3LEF A;  4JU5 A;  3R3E A;  1NW2 A;  2KOK A;  1K0O A;  3DWV A;  1WE0 A;  1ZCP A;  4ID0 A;  1JZW A;  1R7H A;  1R26 A;  1I5G A;  1O7U A;  4I5Q A;  1EEJ A;  2GSR A;  3MAK A;  4ZB9 A;  5FHI A;  5A4V A;  2CT6 A;  2IL3 A;  2CA8 A;  3GIX A;  4FYC A;  2CVD A;  1F3A A;  3FZ5 A;  3ZVJ D;  2H6X A;  4BA7 A;  3F3R A;  4G0K A;  2RUF A;  2Z9S A;  2B5Y A;  3DVX A;  1QQ2 A;  1TK5 B;  5AGY A;  2CVK A;  3GKN A;  3ZZX A;  1SEN A;  2GQM A;  5CRW A;  4ZBD A;  3D6I A;  5G30 A;  3UAR A;  3TOU A;  3UL3 A;  2LST A;  4MJB A;  4RQX A;  2XPD A;  2J23 A;  1ZGN A;  4OO4 A;  3D21 A;  4EC0 A;  2MBS A;  4IKH A;  3DXB A;  4FYB A;  5HR1 A;  4Q5R A;  3US3 A;  2AYT A;  2MMA A;  5KEJ A;  2QGV A;  2XHF A;  4PXO A;  3L4N A;  3TKP A;  1DE1 A;  2OE1 A;  3F0I A;  4K6X A;  2YOI A;  1G7E A;  2QC7 A;  1LU4 A;  2H75 A;  4MH2 A;  1V58 A;  3IXR A;  4OFN A;  5B8B A;  2C80 A;  2C0D A;  2LV3 A;  1M2A A;  1QMV A;  2IIY A;  4GF0 A;  1E2Y A;  5IMZ A;  3F9U A;  2LRT A;  5JCU A;  4PTS A;  4IW9 A;  1MDK A;  3ZLP A;  2V6O A;  4FH8 A;  1SJZ A;  2HZE A;  4MZC A;  2EC4 A;  2IJY A;  4K0N A;  1FOV A;  2R2J A;  1VF3 A;  2HZF A;  3LXZ A;  1SKR B;  1SL0 B;  4PGT A;  1B4P A;  2H74 A;  3G9B A;  2RII A;  2JAD A;  1MDJ A;  3VLN A;  1H75 A;  2K6V A;  1MD3 A;  1WJK A;  3EC3 A;  4YQV A;  2VL2 C;  3HJP A;  5F07 A;  2B7K A;  1FVK A;  4GST A;  5DQS A;  4MCU A;  3U6V A;  3F4S A;  2H6Y A;  2XBQ A;  4XCS A;  4KCE A;  4NMU A;  2B1L A;  3FHK A;  4ECI A;  4PQI A;  2KLX A;  3ERF A;  5DBQ A;  2B7J A;  4LMV A;  2H01 A;  5ECQ B;  3IPZ A;  4F2I A;  3HJO A;  1PRX A;  2V1M A;  2CVB A;  1OKT A;  3ERG A;  3TKR A;  1V57 A;  4TXV A;  4ZIL A;  4KND A;  4V1A g;  4MK3 A;  3N9J A;  3TUE A;  1Z7P A;  2YZH A;  1AXD A;  5C04 A;  3ISO A;  1SKS B;  1U87 A;  3UIW A;  1ML6 A;  2QKE A;  1XVW A;  1U3I A;  2YJH A;  4D73 B;  3QDN A;  3RAZ A;  5DVB A;  2RM5 A;  2YCD A;  5CRE A;  2NPB A;  3CSI A;  1TK0 B;  2LUS A;  3GX0 A;  4KAE A;  2X8H A;  3UJ1 A;  1ON4 A;  3FKF A;  3HHV A;  4AJ6 A;  3OR5 A;  1YY7 A;  1F6M C;  4KA0 A;  1GTI A;  1QGV A;  2HRK B;  5HFG A;  1T4Y A;  2HSH A;  12GS A;  1XBS A;  5G1K A;  3KP9 A;  4LMW A;  2GTU A;  2HE3 A;  4EDY A;  2KP2 A;  4K7I A;  5FWG A;  4ZBB A;  4GLT A;  4BVY A;  3WGE A;  2XPE A;  3UBK A;  3KD0 A;  3FY7 A;  4KF9 A;  3HXS A;  3M8N A;  4V2M A;  3TRP A;  3TB2 A;  1O81 A;  1USB A;  4TRX A;  2I3Y A;  2X8C A;  2R5G A;  3L9V A;  4PQH A;  4HUA A;  3DVW A;  1T7P B;  4ZXG A;  4QL9 A;  2FWH A;  2CX3 A;  4F0C A;  1UVZ A;  5ID2 B;  4I2T A;  3ZIT A;  3ZL5 A;  5DCG A;  4DVC A;  2A2S A;  3LJR A;  1XWK A;  1RK4 A;  3ME7 A;  3VI7 A;  18GS A;  1PX6 A;  1BJX A;  2H6Z A;  3LXT A;  2MMZ A;  2C0F A;  1K0A A;  3EIN A;  2VCQ A;  3KMN A;  1EGR A;  2VCV A;  4KDU A;  2XBI A;  3CRT A;  2ZNM A;  4Z7X A;  3CYN A;  2PER A;  3RDW A;  4HZ4 A;  1PKW A;  4GQC A;  4P3Y B;  4IJ3 A;  1Y6E A;  1EOH A;  2GZZ A;  1O8X A;  5DJM A;  1ABA A;  3A5W A;  4E8E A;  2WRT A;  3A2X A;  2H0G A;  3TJK A;  3EWL A;  3HVV A;  3HZ4 A;  4BL7 A;  3GMF A;  2OAD A;  3ZMK A;  1Z9H A;  1GUM A;  3FYG A;  3UAP A;  1EZK A;  1VF4 A;  3F3Q A;  4TXO B;  1MD4 A;  4MZB A;  4IHU A;  10GS A;  2HSM A;  2V41 A;  1SYR A;  1BG5 A;  2HRK A;  3ZML A;  3LFL A;  5J9B A;  4XRD A;  16GS A;  5EPF A;  1OKD A;  4F0B A;  2WS2 A;  5ECH B;  2GS3 A;  3DD3 A;  6GST A;  2RLI A;  4FO5 A;  4EUY A;  1K0M A;  3L0H A;  1M0U A;  2C0G A;  4ML6 A;  1Y25 A;  1E6B A;  3BOA A;  5COH A;  3TKS C;  3EMP A;  4BWQ A;  2L5L A;  1QXH A;  5AN1 A;  5ECR B;  1O6J A;  2GZP A;  2WDU A;  4LL1 B;  4G19 A;  2YV7 A;  5ID2 A;  3FRC A;  4EVM A;  3IAM 2;  2HQT A;  3G7J A;  5ELG A;  2FNO A;  2IFQ A;  5JCG A;  4FYU A;  1IYH A;  4V2L A;  3UVH A;  5HR3 A;  2P31 A;  4CW9 A;  4GCI A;  1V2A A;  1TXX A;  2H76 A;  4MJC A;  1XWB A;  4MP4 A;  3FW2 A;  1PA3 A;  4WXT A;  1AQX A;  1JLV A;  2IN3 A;  20GS A;  1YKA A;  1GSU A;  1JFU A;  4AJ7 A;  4Q5N A;  3I9V 2;  3GKX A;  2VD0 A;  1TU7 A;  4ECC A;  5J41 A;  2H19 A;  5IIZ A;  3FEU A;  3CRU A;  1SL2 B;  4DSS A;  1H4O A;  5IQY A;  3KH7 A;  5A4U A;  2YNX A;  3FR3 A;  1HYU A;  4YAV A;  4TR1 A;  2PBJ A;  4XIH A;  3GSS A;  1C72 A;  1PSQ A;  2CZ3 A;  4KGI A;  1YKC A;  5HQP A;  1A24 A;  2FA8 A;  5D96 A;  3QPM A;  3MSZ A;  3TJB A;  4USS A;  4G9H A;  1TRW A;  5DJL A;  1GSS A;  2AJQ B;  4IN0 A;  5D9T A;  4OFM A;  1CQG A;  3IAS 2;  2JSZ A;  19GS A;  1G6W A;  3DML A;  2MYG A;  5IOW A;  2JU5 A;  2B3S A;  2HXK A;  14GS A;  1FB6 A;  3C73 A;  3A2W A;  4LA1 A;  1VF2 A;  1R5P A;  2H1G A;  3UVT A;  2OA7 A;  1TJD A;  2B5E A;  1M99 A;  1JZR A;  3DIE A;  2OAC A;  2TIR A;  5D93 A;  4ULX A;  1KBN A;  1KTE A;  4N11 A;  2HZE B;  3WD6 A;  2TRX A;  3LOR A;  2V32 A;  4OMV A;  5IOX A;  4I8B A;  1SKW B;  1F37 A;  2LJR A;  5KN1 A;  5AIX A;  5J5N A;  3HY2 A;  5GAN D;  4X0X A;  1QFN A;  2PMT A;  3FZ9 A;  1GTA A;  3IHQ A;  4KX4 A;  3QFA C;  3KMO A;  3UEM A;  3CMI A;  1Q4J A;  2VL9 A;  4TVE A;  4Q5F A;  4NV5 A;  2LJK A;  2OBI A;  1TRS A;  3Q74 A;  1TRV A;  2WZ9 A;  1YJ6 A;  2DJK A;  4WR4 A;  1B48 A;  5G5F A;  4TW5 A;  5GST A;  3HCZ A;  3IR4 A;  4N30 A;  7GSS A;  1TP9 A;  3RBT A;  4F82 A;  5ECM B;  1TKD B;  1YQ1 A;  3QFB C;  2H0H A;  3IK7 A;  5ECK B;  4HJM A;  4MH3 A;  4NAX A;  2FLS A;  3ERW A;  5EL8 A;  2VD1 A;  1QK8 A;  2HRF A;  2LRN A;  5H5S A;  2H1D A;  1XVQ A;  1SK2 A;  4TKY A;  1OC9 A;  4L8E A;  4FIW A;  3CTG A;  2N5B A;  4PX1 A;  5HFK A;  4KDX A;  2JL4 A;  2VO4 A;  2DMM A;  1Z6N A;  1XW6 A;  2YAN A;  1XOB A;  5F05 A;  2X99 A;  4K7N A;  1GTU A;  2YWO A;  4ZL7 A;  2TRC P;  1G0T A;  4AGS A;  22GS A;  3MWH A;  4H86 A;  1MEK A;  3Q19 A;  3DYR A;  3J7Y b;  3VI5 A;  4HI7 A;  4I97 A;  4MF6 A;  1JZO A;  4OCF A;  2GSQ A;  4QQ7 A;  1M9A A;  2GQK A;  5JWO B;  1WIK A;  3FR9 A;  2P5R A;  5F06 A;  2AHE A;  2O7K A;  4JBB A;  3CSH A;  5LNK e;  2AB6 A;  1A0R P;  1A2M A;  1A2L A;  2FUG 2;  1ZYE A;  2H71 A;  3PH9 A;  2FD3 A;  2E7P A;  3HD5 A;  1AW9 A;  2FA4 A;  5G5E A;  4G0L A;  3P90 A;  4BVY B;  2DJJ A;  2O87 A;  3TKQ A;  3GUS A;  4TR3 A;  2KHP A;  4K9Z A;  2H70 A;  3I69 A;  2AUV A;  4TR0 A;  4PNF A;  2PWJ A;  1XIY A;  3ZRE A;  3KP8 A;  3TKS E;  1MTC A;  1ERT A;  4HU7 A;  2VCW A;  1W4V A;  4YH2 A;  2WUL A;  1Z6M A;  2R37 A;  4NHW A;  4WF4 A;  2LQO A;  1K3L A;  8GSS A;  4HOJ A;  3GNJ A;  2PN8 A;  4KH7 A;  2L57 A;  1SL1 B;  2VAF A;  3TJG A;  4IP1 A;  5KN3 A;  1M9B A;  4GRF A;  3HA9 A;  6GSX A;  4PUR A;  4NV2 A;  2R4V A;  4MF5 A;  2I4A A;  1LJR A;  1HNC A;  2YV9 A;  4CHS A;  2H1B A;  2YZU A;  4KDY A;  5EVO A;  3M9K A;  2J9H A;  2FGX A;  2H1A A;  1SJI A;  1VGL A;  3TRX A;  5D9V A;  4ECB A;  2G0F A;  2HFD A;  1NHO A;  2I9H A;  2MZC A;  3QAV A;  1R5A A;  4GXZ A;  4LLR A;  2PPT A;  4BL7 B;  4K8M A;  1N8J A;  4BPY A;  2EIO A;  3J7Y k;  4WF5 A;  1X9M B;  4MPF A;  2L59 A;  2HSM B;  1ERV A;  4HZ2 A;  2LNS A;  4PQ1 A;  1X5D A;  3F6D A;  3VK9 A;  2YWI A;  1FW1 A;  2H8L A;  4POM A;  1THX A;  1TU8 A;  4J56 E;  3IOS A;  4EXJ A;  3NZN A;  1RQM A;  2JZS A;  1WWJ A;  5IO0 A;  3LSZ A;  2PGT A;  2DLX A;  4N0Z A;  5JWR B;  4YQM A;  3GST A;  13GS A;  2A4V A;  4HQZ A;  2WJU A;  4JR6 A;  2VL3 A;  4YAP A;  1AQV A;  2O85 A;  2IME A;  5GSS A;  4FQU A;  5LCZ A;  3P2A A;  2H66 A;  3F6F A;  5KN2 A;  3GKM A;  1GSF A;  2IFQ B;  1Q98 A;  3H4K A;  4JZQ A;  4G10 A;  1FB0 A;  2JZR A;  3FZA A;  3C1R A;  3A2V A;  4IGJ A;  5B6N A;  1PD2 1;  3O3T A;  3GL5 A;  1JLW A;  3LG6 A;  3ZTL A;  3IC4 A;  1LBK A;  4MDC A;  1B9Y C;  2KP1 A;  4PUF C;  1OAZ A;  2OE0 A;  2PVO C;  1U6T A;  1WPI A;  2LS5 A;  2DIZ A;  3GX8 A;  1TI3 A;  3GYK A;  5DQY A;  3QOU A;  3R2Q A;  1BX9 A;  6GSS A;  4K1F A;  2IMD A;  2M46 A;  5IMF A;  2VLV A;  1GWC A;  3IDV A;  3BCI A;  2DSA A;  3F4R A;  4KW6 A;  4KB3 A;  5ECI B;  4IBP A;  5IMD A;  1ACV A;  4XS1 A;  4K7O A;  3JCM L;  3D22 A;  4POB A;  1V98 A;  5IMV A;  3APQ A;  4EO3 A;  4DSS B;  1XOA A;  3GFK A;  4IEL A;  3U5R E;  1YEP A;  1X9S B;  4TR1 B;  4IVF A;  2LQQ A;  4O32 A;  3EU4 A;  5HR2 A;  1T00 A;  2VCX A;  3PGT A;  5H5R A;  3P8W A;  5BMU A;  5ECO B;  3WT1 A;  4DSR A;  1XFL A;  2X64 A;  1NHY A;  4XRA A;  2FWG A;  3GHA A;  3HKR A;  2IWT A;  17GS A;  5IO2 A;  3ZYW A;  5IPH A;  2DC5 A;  5G2Z A;  2RUE A;  3TCO A;  3GL3 A;  4OO5 A;  1NM3 A;  3O76 A;  1BYE A;  2F8A A;  2E0Q A;  2VUP A;  2P0G A;  2VOC A;  2M72 A;  1ERU A;  3QAG A;  2LKU A;  3IK9 A;  3MNG A;  1EEM A;  3LYK A;  4E8H A;  2FHE A;  2DJ1 A;  3I43 A;  3IE3 A;  2LEG A;  2HI7 A;  1DSB A;  2AV4 A;  4OWY A;  2GVP A;  3BBY A;  1Z7R A;  2PVQ A;  2CV4 A;  3KTB A;  1J9B A;  3FK8 A;  5LD0 A;  4NPB A;  1JHB A;  2I1U A;  2F8F A;  4X43 A;  2QSI A;  6GSW A;  4POK A;  1EGO A;  5L71 A;  4LL4 B;  3E3E A;  3Q18 A;  4MJA A;  2OJL A;  3GN3 A;  4I6X A;  2WGR A;  2DML A;  1KEB A;  3VWX A;  3KH9 A;  2CAQ A;  3C71 A;  1OC3 A;  1A8L A;  4GSS A;  3EMX A;  4F9Z A;  5IMC A;  3VWW A;  3DGQ A;  4POL A;  3EUR A;  11GS A;  1OYJ A;  3APS A;  3LGC A;  2HYX A;  3M3M A;  4NWY A;  4TR4 A;  2HRA A;  2F9S A;  5D9X A;  3G7Y A;  4MLY A;  2PU9 C;  2K8V A;  4HS1 A;  3WYW A;  5INY A;  3IA1 A;  3ED3 A;  4QL7 A;  1GRX A;  4WBJ A;  2JSY A;  4ZB6 A;  2ES7 A;  5CP1 A;  3TKS A;  2D2Z A;  2CZ2 A;  3GA4 A;  4CDO A;  3GUR A;  4KSM A;  1KNG A;  4XS4 A;  4HQS A;  4IS0 A;  2RM6 A;  2M80 A;  5EY6 A;  3H79 A;  2HNL A;  4TN8 A;  2P5Q A;  3IC8 A;  2GDR A;  4ISD A;  1XXU A;  4BWS A;  4HDE A;  5D73 A;  4ML1 A;  1OC9 B;  1XCC A;  4ZBA A;  5E4W A;  1R4W A;  3GRX A;  4IQA A;  1S3C A;  1XPV A;  3UMA A;  4OCE A;  2PUK C;  1EV9 A;  3G7I A;  3FR6 A;  1XWG A;  3ZVJ A;  4AJ8 A;  4HEA 2;  2B1K A;  4WR5 A;  2GZY A;  2C0E A;  2GQL A;  1IYI A;  1GP1 A;  1QUW A;  2YWN A;  1WRY A;  5B8A A;  2OE3 A;  5FT3 A;  2VM1 A;  3TRQ A;  1S3A A;  3QAW A;  1I9D A;  2GST A;  3E0U A;  1HD2 A;  2IMI A;  1V9W A;  3GH6 A;  1TRU A;  1PX7 A;  5DAK A;  3W8S A;  2B6M A;  2VM2 A;  3O6T A;  4MZW A;  4ZL9 A;  3VPT A;  2NTO A;  2DIY A;  4F03 A;  3C7M A;  1Z3E A;  3W6G A;  1XW9 A;  2L4C A;  1EOG A;  1UC7 A;  2H30 A;  3KXO A;  3HJM A;  2CAI A;  1GTB A;  2ZUP A;  2C3N A;  3APO A;  1GLQ A;  1F9M A;  4IQ1 A;  1W89 A;  3ZIJ A;  2WB9 A;  3I6A A;  5A4W A;  1F3B A;  5ECP B;  1O85 A;  5G31 A;  3GV1 A;  3C1S A; 
#chains in the Genus database with same CATH topology
 3ZRD A;  2HLS A;  3AY8 A;  4RQR A;  3TDG A;  4PUA A;  4EL1 A;  1G7O A;  1TTZ A;  4MAB A;  2BJX A;  1K0D A;  1PMT A;  1PFO A;  5DAL A;  4GDF A;  2GSS A;  1UN2 A;  2EIQ A;  1ZMA A;  2H73 A;  2L6D A;  3RPP A;  2AAW A;  3HVX A;  3LWA A;  1SK0 A;  2MBT A;  1YEW C;  2ON5 A;  4JR4 A;  5DCH A;  4BVX A;  4GQF A;  5CRD A;  2YP6 A;  1ILO A;  2F51 A;  3EYT A;  3QR6 A;  5DDL A;  4XS6 A;  5F0G A;  2K8S A;  2B5X A;  3VFI A;  1TK8 B;  3KJY A;  1SD8 A;  6GSV A;  2DJ2 A;  1TW9 A;  5JWQ B;  1HNA A;  1OC8 A;  2ON7 A;  4NHZ A;  1O8W A;  5CNW A;  2EFH A;  4O5R A;  5J9C A;  1WP0 A;  3SWL A;  1SD9 A;  1WMJ A;  2E2G A;  1T1V A;  3NIV A;  1TOF A;  5ABR A;  2KUC A;  1J08 A;  2C3T A;  2WCI A;  1MDI A;  5AIV A;  1GUH A;  3BJ5 A;  1GSE A;  2HSN B;  1AC1 A;  3D4T A;  1XG8 A;  5IMA A;  1AAZ A;  4I2U A;  3KEB A;  1G6Y A;  3F63 A;  3EE2 A;  1ERW A;  1TDI A;  4MJE A;  4E68 A;  1FG4 A;  3M9J A;  1AQW A;  2NBS A;  2VCZ A;  3HYP A;  3H8Q A;  3EU3 A;  4OFT A;  2L4Q A;  2MMO A;  3KZQ A;  4DSQ A;  1TI1 A;  3L9U A;  4Q5Q A;  2BMX A;  4G0I A;  2R3X A;  2VLU A;  3ME8 A;  5F8B A;  3H93 A;  2FWF A;  6GSU A;  1GUK A;  4N10 A;  2QA1 A;  5HR0 A;  1B4Q A;  3D4M A;  2V2G A;  5ENU A;  2A4H A;  1CQH A;  3QMX A;  1A0F A;  2ALB A;  2VCT A;  1Z5Y E;  3RPN A;  1SJ6 A;  5GAP D;  4L5L A;  4O92 A;  3CBU A;  1A8Y A;  1GSQ A;  1YF0 A;  5CYY A;  3F4T A;  3GH9 A;  2IPA A;  4MA9 A;  1GH2 A;  5D8I A;  1OE7 A;  5J4V A;  2DJ3 A;  1K3O A;  4O7H A;  2ZCT A;  2VL2 A;  4GSN A;  5A1N A;  3IRA A;  4JED A;  2HRN A;  1PN9 A;  3N5O A;  1EWX A;  1YEX A;  1PL2 A;  2MMN A;  5IM9 A;  2O8V B;  1K0B A;  2K18 A;  5D9W A;  2FCH A;  3GTU B;  5BMU B;  1PGT A;  5E59 A;  1B9X C;  3KM6 A;  4ACS A;  3FZ4 A;  2A2P A;  1WOU A;  1PKZ A;  2L6C A;  3LQ7 A;  1M3J A;  2EIR A;  1VF1 A;  3QCP A;  4KCA A;  1J0F A;  5ELA A;  1A23 A;  3IV4 A;  4WKW A;  4PNG A;  4MPG A;  1U88 A;  2DJ0 A;  1M3I A;  1AUC A;  1B8X A;  4RI6 A;  1VRS D;  5GZZ B;  2H72 A;  2OT3 A;  1EV4 A;  3ZFL A;  2XC2 A;  3NOF A;  2VIM A;  1DUG A;  5B6M A;  3D5J A;  4K2D A;  3WGD A;  2JAC A;  1AIU A;  5CRH A;  3ZIV A;  5IPG A;  1S3D A;  2HT9 A;  4WEY A;  3VWV A;  1HNB A;  4AKH A;  3Q6O A;  2WVZ A;  4V2N A;  5HFI A;  2YWM A;  1YF1 A;  3PR8 A;  4WBR D;  4RI7 A;  1FO5 A;  1TXU A;  3PPU A;  1M7T A;  4XHM A;  3KTL A;  3UBL A;  4EIQ A;  2UZ8 A;  2LNT A;  3W8J A;  1SU9 A;  2A2R A;  3HZ8 A;  3KIJ A;  2NDO A;  2NVL A;  4K0G A;  1ST9 A;  3HVS A;  1ZYQ B;  4HJ2 A;  2C8U A;  4G2E A;  2GT6 A;  3VUR A;  3VWU A;  1SYX A;  5ECS A;  4J2F A;  4V1A p;  2K9F A;  5H5Q A;  4D73 A;  1BED A;  2YN1 A;  1N25 A;  1GLP A;  3KGK A;  2VLT A;  2IMK A;  2LJA A;  1GSY A;  3RHC A;  1DE2 A;  4XTS A;  2VKZ G;  2H0I A;  3DEX A;  1BAY A;  2WZS A;  2GLR A;  3K8N A;  4ICY A;  1EP8 A;  1XWA A;  4ILF A;  5A5K A;  3S9F A;  1PL1 A;  1ZOF A;  3GTU A;  2E2M A;  1UA5 A;  3BD2 A;  3TJF A;  1V40 A;  5KN0 A;  1PN0 A;  2L5O A;  4XS4 B;  3C8E A;  4WET A;  1XWC A;  4NXI A;  3A3T A;  3DKS A;  3CQF A;  2LTK A;  1GL8 A;  2OKA A;  3ZFB A;  2REM A;  3V1W A;  1T8E B;  1DBY A;  5AIS A;  2HSY A;  4X1U A;  4AKI A;  1F2E A;  3KCM A;  3WT2 A;  2UV8 G;  1GNE A;  1THO A;  2F3M A;  3HDC A;  4ZIJ A;  2C1Y A;  2FY6 A;  3CWG A;  2EFE A;  4ECJ A;  4L0W A;  4MMM A;  2GT5 A;  2V6K A;  5J3R A;  3D0Z A;  1YZX A;  2WFC A;  2CX4 A;  1FHE A;  4KUN A;  3RHB A;  2CQ9 A;  4GWR A;  3FMW A;  1PQN A;  1A2J A;  4JE1 A;  1RW1 A;  4JRR A;  5DAK B;  2G2Q A;  5CAX A;  3TOT A;  3GKK A;  4MF7 A;  1O73 A;  3EPT A;  3P7X A;  1NSW A;  2X8G A;  1K3Y A;  2WVX A;  1U3A A;  4ZL8 A;  1OVN A;  4N0V A;  4RUV A;  2N5A A;  2GGT A;  4EF0 A;  1EP7 A;  2IMF A;  2JZT A;  4IP6 A;  1X9W B;  1HQO A;  1XZO A;  3EVI A;  3M1G A;  4TXO A;  2DBC A;  5B7C A;  2O89 A;  5ECN B;  3UOM A;  4L5O A;  4KSO A;  1FVJ A;  4ZB8 A;  1ZL9 A;  1X5C A;  5J4U A;  3WGX A;  3PIN A;  4J57 E;  1XW5 A;  3DRN A;  5ECL B;  1GSD A;  2BTO T;  5DAL B;  5JCW A;  1X0R A;  3LYP A;  9GSS A;  3TGZ A;  4EDZ A;  2YPM A;  1FAA A;  2C3Q A;  2I81 A;  3H1N A;  1ZZY A;  5G1L A;  6GSY A;  5C00 A;  1K0N A;  1T3B A;  2OBK A;  2R6K A;  1BQ7 A;  1SK1 A;  3VPQ A;  3L9S A;  3CSJ A;  4AF2 A;  3F8U A;  2X49 A;  3BCK A;  4L0U A;  3CXG A;  3M0F A;  2C4J A;  4BVX B;  4DEJ A;  5CRG A;  2N5F A;  2FWE A;  3L78 A;  1GUL A;  1M2D A;  2LRC A;  5CO3 A;  3TJJ A;  1X5E A;  1URM A;  3CTF A;  3E9J B;  4EKZ A;  3IBH A;  1JZD A;  1K0C A;  3MDK A;  3SBC A;  4TOP A;  1GNW A;  4HU9 A;  1OE8 A;  2YJ7 A;  4KE3 A;  4YQU A;  4EE0 A;  1T4Z A;  3HVN A;  4IJI A;  4OD7 A;  2WW3 A;  1M2B A;  1YDK A;  4BIK A;  3QD9 A;  1N2A A;  4GTU A;  3LEF A;  4JU5 A;  3R3E A;  1NW2 A;  2KOK A;  1K0O A;  3DWV A;  1WE0 A;  1ZCP A;  4ID0 A;  1JZW A;  1R7H A;  1R26 A;  1I5G A;  1O7U A;  4I5Q A;  1EEJ A;  2GSR A;  3MAK A;  4ZB9 A;  5FHI A;  5A4V A;  2CT6 A;  2IL3 A;  2CA8 A;  3GIX A;  4FYC A;  2CVD A;  1F3A A;  3FZ5 A;  3ZVJ D;  2H6X A;  4BA7 A;  3F3R A;  4G0K A;  2RUF A;  2Z9S A;  2B5Y A;  3DVX A;  1QQ2 A;  1TK5 B;  5AGY A;  2CVK A;  3GKN A;  3ZZX A;  1SEN A;  2GQM A;  4PI0 C;  5CRW A;  4ZBD A;  3D6I A;  5G30 A;  3UAR A;  3TOU A;  3UL3 A;  2LST A;  4MJB A;  4RQX A;  2XPD A;  2J23 A;  1ZGN A;  4OO4 A;  3D21 A;  4EC0 A;  2MBS A;  4IKH A;  3DXB A;  4FYB A;  5HR1 A;  4Q5R A;  3US3 A;  2AYT A;  2MMA A;  5KEJ A;  2QGV A;  4CY8 A;  2XHF A;  4PXO A;  3L4N A;  3TKP A;  4O5Q A;  1DE1 A;  2OE1 A;  3F0I A;  4K6X A;  2YOI A;  1G7E A;  2QC7 A;  1LU4 A;  2H75 A;  4MH2 A;  1V58 A;  3IXR A;  4OFN A;  1BG1 A;  5B8B A;  2C80 A;  2C0D A;  2LV3 A;  1M2A A;  1QMV A;  2IIY A;  4GF0 A;  1E2Y A;  5IMZ A;  3F9U A;  2LRT A;  5JCU A;  4PTS A;  4IW9 A;  1MDK A;  3ZLP A;  2V6O A;  4FH8 A;  1SJZ A;  2HZE A;  4MZC A;  5A1N B;  2EC4 A;  5KOW A;  2IJY A;  4K2X A;  4K0N A;  1FOV A;  2R2J A;  1VF3 A;  2R0G A;  4YKF A;  2HZF A;  3LXZ A;  1SKR B;  1SL0 B;  4PGT A;  1B4P A;  2H74 A;  3G9B A;  2RII A;  1ZYP A;  2JAD A;  1MDJ A;  3VLN A;  1H75 A;  2K6V A;  1MD3 A;  1WJK A;  3EC3 A;  4YQV A;  5BRT A;  2VL2 C;  3HJP A;  5F07 A;  5KOX A;  2B7K A;  1FVK A;  4GST A;  5DQS A;  4MCU A;  3U6V A;  3TU3 B;  3F4S A;  2H6Y A;  2XBQ A;  4XCS A;  4KCE A;  1S3R A;  4NMU A;  2B1L A;  3FHK A;  4ECI A;  4PQI A;  2KLX A;  3ERF A;  5A5H A;  5DBQ A;  2B7J A;  4LMV A;  2H01 A;  5ECQ B;  3IPZ A;  4F2I A;  3HJO A;  4O5U A;  1PRX A;  2V1M A;  2CVB A;  1OKT A;  3ERG A;  3TKR A;  1V57 A;  4TXV A;  4ZIL A;  4KND A;  4V1A g;  4MK3 A;  3N9J A;  3TUE A;  1Z7P A;  2YZH A;  4PHZ C;  1AXD A;  5C04 A;  3ISO A;  1SKS B;  1U87 A;  3UIW A;  1ML6 A;  2QKE A;  1Y1U A;  1XVW A;  2WW0 A;  1U3I A;  2YJH A;  4D73 B;  4W66 A;  3QDN A;  3RAZ A;  5DVB A;  4A5P A;  2R0P A;  2RM5 A;  4MNN A;  2YCD A;  5CRE A;  2NPB A;  3CSI A;  1TK0 B;  2LUS A;  3GX0 A;  4KAE A;  2X8H A;  3UJ1 A;  1ON4 A;  3FKF A;  3HHV A;  4AJ6 A;  3OR5 A;  1YY7 A;  1F6M C;  4KA0 A;  1GTI A;  1QGV A;  2O3E A;  2HRK B;  5HFG A;  1T4Y A;  2HSH A;  12GS A;  1XBS A;  4YKG A;  5G1K A;  3KP9 A;  4LMW A;  2GTU A;  2HE3 A;  4EDY A;  1S4B P;  2KP2 A;  4K7I A;  5FWG A;  4ZBB A;  4GLT A;  4BVY A;  3WGE A;  2XPE A;  3UBK A;  3KD0 A;  3FY7 A;  4KF9 A;  3HXS A;  3M8N A;  4V2M A;  3TRP A;  3TB2 A;  1O81 A;  1USB A;  4TRX A;  2I3Y A;  2X8C A;  2R5G A;  4PI2 C;  3L9V A;  4PQH A;  4HUA A;  3DVW A;  1T7P B;  4ZXG A;  4QL9 A;  2FWH A;  2CX3 A;  4F0C A;  1UVZ A;  5ID2 B;  4I2T A;  3ZIT A;  3ZL5 A;  5DCG A;  4DVC A;  2A2S A;  3LJR A;  1XWK A;  1RK4 A;  3ME7 A;  3VI7 A;  18GS A;  1PX6 A;  1BJX A;  2H6Z A;  3LXT A;  2MMZ A;  2C0F A;  1K0A A;  3EIN A;  2O36 A;  2WW2 A;  2VCQ A;  3KMN A;  1EGR A;  2VCV A;  4KDU A;  2XBI A;  3CRT A;  2ZNM A;  4Z7X A;  3CYN A;  2PER A;  3RDW A;  4HZ4 A;  1PKW A;  4GQC A;  4AKX B;  4P3Y B;  4IJ3 A;  1Y6E A;  4AKG A;  1EOH A;  2GZZ A;  1O8X A;  5DJM A;  2WVX B;  1ABA A;  3A5W A;  4E8E A;  2WRT A;  3A2X A;  2H0G A;  3TJK A;  3EWL A;  3HVV A;  3HZ4 A;  4BL7 A;  3GMF A;  2OAD A;  3ZMK A;  1Z9H A;  1GUM A;  3FYG A;  3UAP A;  1EZK A;  1VF4 A;  3F3Q A;  4TXO B;  1MD4 A;  4MZB A;  4IHU A;  10GS A;  2HSM A;  2V41 A;  1SYR A;  1BG5 A;  2HRK A;  3ZML A;  3LFL A;  5J9B A;  4XRD A;  16GS A;  5EPF A;  1OKD A;  4F0B A;  2WS2 A;  5ECH B;  1SVM A;  2GS3 A;  3DD3 A;  1SVO A;  6GST A;  2RLI A;  4FO5 A;  4EUY A;  1K0M A;  3L0H A;  1M0U A;  2C0G A;  4ML6 A;  1Y25 A;  1E6B A;  3BOA A;  5COH A;  3TKS C;  3EMP A;  4BWQ A;  2L5L A;  1QXH A;  5AN1 A;  5ECR B;  1O6J A;  2GZP A;  2WDU A;  4LL1 B;  4G19 A;  2YV7 A;  5ID2 A;  1ZYN A;  3FRC A;  4EVM A;  3IAM 2;  2HQT A;  3G7J A;  5ELG A;  2FNO A;  2IFQ A;  5JCG A;  4FYU A;  5J47 A;  1IYH A;  4G01 A;  4V2L A;  3UVH A;  5HR3 A;  2P31 A;  4CW9 A;  4GCI A;  1V2A A;  1TXX A;  2H76 A;  4MJC A;  1XWB A;  4MP4 A;  3FW2 A;  1PA3 A;  4WXT A;  1AQX A;  1JLV A;  2IN3 A;  20GS A;  1YKA A;  1GSU A;  1JFU A;  4AJ7 A;  4Q5N A;  3I9V 2;  3GKX A;  2VD0 A;  1TU7 A;  4ECC A;  5J41 A;  2H19 A;  5IIZ A;  3FEU A;  3CRU A;  1SL2 B;  4DSS A;  1H4O A;  5IQY A;  3KH7 A;  5A4U A;  2YNX A;  3MYD A;  3FR3 A;  4ZB7 A;  1HYU A;  4YAV A;  4TR1 A;  2PBJ A;  4XIH A;  5J40 A;  3GSS A;  1C72 A;  2DKI A;  1PSQ A;  2CZ3 A;  4KGI A;  1SVL A;  1YKC A;  5HQP A;  1A24 A;  2FA8 A;  5D96 A;  4CY6 A;  3QPM A;  3MSZ A;  3TJB A;  4USS A;  4G9H A;  4X4J A;  1TRW A;  5DJL A;  1GSS A;  3LW9 A;  2AJQ B;  4IN0 A;  5D9T A;  4OFM A;  1CQG A;  5A34 B;  3IAS 2;  2JSZ A;  19GS A;  1G6W A;  3DML A;  2MYG A;  5IOW A;  2JU5 A;  2B3S A;  2HXK A;  14GS A;  1FB6 A;  3C73 A;  3A2W A;  4LA1 A;  1VF2 A;  1R5P A;  2H1G A;  3UVT A;  2OA7 A;  1TJD A;  2B5E A;  1M99 A;  1JZR A;  3DIE A;  2OAC A;  2TIR A;  5D93 A;  4ULX A;  1KBN A;  2QA2 A;  1KTE A;  4N11 A;  2HZE B;  3WD6 A;  2TRX A;  3LOR A;  2V32 A;  4OMV A;  5IOX A;  4I8B A;  1SKW B;  1F37 A;  2LJR A;  5KN1 A;  5AIX A;  5J5N A;  3HY2 A;  5GAN D;  4X0X A;  1QFN A;  2PMT A;  3FZ9 A;  3RFR C;  1GTA A;  3IHQ A;  4KX4 A;  3QFA C;  3KMO A;  3UEM A;  3CMI A;  1Q4J A;  2VL9 A;  4TVE A;  4Q5F A;  4NV5 A;  2LJK A;  2OBI A;  1TRS A;  3Q74 A;  1TRV A;  2WZ9 A;  1YJ6 A;  2DJK A;  2WW1 A;  4WR4 A;  1B48 A;  5G5F A;  4TW5 A;  5GST A;  3HCZ A;  3IR4 A;  4N30 A;  7GSS A;  1TP9 A;  3RBT A;  4F82 A;  5ECM B;  1TKD B;  1YQ1 A;  3QFB C;  2H0H A;  3IK7 A;  5ECK B;  4HJM A;  4N3Z A;  4MH3 A;  4NAX A;  2FLS A;  3ERW A;  5EL8 A;  2VD1 A;  5A5H B;  1QK8 A;  2HRF A;  2LRN A;  5H5S A;  2H1D A;  1BF5 A;  5A34 A;  1XVQ A;  1SK2 A;  3IHG A;  4TKY A;  1OC9 A;  4L8E A;  4FIW A;  3CTG A;  2N5B A;  4PX1 A;  5HFK A;  4KDX A;  2JL4 A;  2VO4 A;  2DMM A;  1Z6N A;  1XW6 A;  2YAN A;  1XOB A;  5F05 A;  2X99 A;  4K7N A;  1GTU A;  4FXY P;  2YWO A;  4ZL7 A;  2TRC P;  1G0T A;  4AGS A;  22GS A;  2EFD A;  3MWH A;  4H86 A;  1MEK A;  3Q19 A;  3DYR A;  3J7Y b;  3VI5 A;  4HI7 A;  4I97 A;  4MF6 A;  1JZO A;  4OCF A;  2GSQ A;  4QQ7 A;  1M9A A;  2GQK A;  5JWO B;  1WIK A;  3FR9 A;  2P5R A;  5F06 A;  2AHE A;  2O7K A;  4JBB A;  3CSH A;  5LNK e;  2AB6 A;  1A0R P;  2FUG 2;  1A2M A;  1A2L A;  1ZYE A;  2H71 A;  3PH9 A;  2FD3 A;  2E7P A;  3HD5 A;  1AW9 A;  2FA4 A;  5G5E A;  4AI6 A;  4G0L A;  3P90 A;  4BVY B;  2DJJ A;  2O87 A;  3TKQ A;  3GUS A;  1I1I P;  4TR3 A;  2KHP A;  4K9Z A;  2H70 A;  3I69 A;  2AUV A;  4TR0 A;  4PNF A;  2PWJ A;  1XIY A;  3ZRE A;  3KP8 A;  3TKS E;  1MTC A;  1ERT A;  4HU7 A;  2VCW A;  1W4V A;  4YH2 A;  2WUL A;  1Z6M A;  2R37 A;  4NHW A;  4WF4 A;  2LQO A;  4Z2U A;  1K3L A;  8GSS A;  4HOJ A;  3A5I A;  3GNJ A;  2PN8 A;  4KH7 A;  2L57 A;  1SL1 B;  2VAF A;  3TJG A;  4IP1 A;  5KN3 A;  1M9B A;  4GRF A;  3HA9 A;  6GSX A;  4PUR A;  4NV2 A;  2R4V A;  4MF5 A;  2I4A A;  1LJR A;  1HNC A;  2YV9 A;  4CHS A;  3HMJ G;  2H1B A;  2YZU A;  4KDY A;  5EVO A;  3M9K A;  2J9H A;  2FGX A;  2H1A A;  1FOH A;  1SJI A;  1VGL A;  3TRX A;  5D9V A;  4ECB A;  2G0F A;  2HFD A;  1NHO A;  2I9H A;  4Z2R A;  2MZC A;  3QAV A;  1R5A A;  4GXZ A;  4LLR A;  2PPT A;  4BL7 B;  4K8M A;  1N8J A;  4BPY A;  2EIO A;  3J7Y k;  4WF5 A;  1X9M B;  4QMK A;  4MPF A;  2L59 A;  2HSM B;  1ERV A;  4HZ2 A;  2LNS A;  4PQ1 A;  1X5D A;  3F6D A;  3VK9 A;  2YWI A;  1FW1 A;  2H8L A;  4POM A;  2HSN A;  1THX A;  1TU8 A;  4J56 E;  3IOS A;  4EXJ A;  3NZN A;  1RQM A;  2JZS A;  1WWJ A;  5IO0 A;  3LSZ A;  2PGT A;  2DLX A;  4N0Z A;  5JWR B;  4YQM A;  3GST A;  13GS A;  2A4V A;  4HQZ A;  2WJU A;  4JR6 A;  2VL3 A;  4YAP A;  1AQV A;  2O85 A;  2IME A;  5GSS A;  4FQU A;  5LCZ A;  3P2A A;  2H66 A;  3F6F A;  5KN2 A;  3GKM A;  1GSF A;  2IFQ B;  1Q98 A;  3H4K A;  4JZQ A;  4G10 A;  1FB0 A;  2JZR A;  3FZA A;  3C1R A;  3A2V A;  4IGJ A;  5B6N A;  1PD2 1;  3O3T A;  3GL5 A;  1JLW A;  3LG6 A;  3ZTL A;  3IC4 A;  1LBK A;  4MDC A;  1B9Y C;  2KP1 A;  4PUF C;  1OAZ A;  2OE0 A;  2PVO C;  1U6T A;  1WPI A;  2LS5 A;  2DIZ A;  3GX8 A;  1TI3 A;  3GYK A;  5DQY A;  3QOU A;  3R2Q A;  1BX9 A;  6GSS A;  4K1F A;  2IMD A;  2M46 A;  5IMF A;  2VLV A;  1GWC A;  3IDV A;  3BCI A;  2DSA A;  3F4R A;  4KW6 A;  4KB3 A;  5ECI B;  4IBP A;  5IMD A;  1ACV A;  4XS1 A;  4K7O A;  3JCM L;  3D22 A;  4POB A;  1V98 A;  5IMV A;  3APQ A;  4EO3 A;  4DSS B;  1XOA A;  3GFK A;  4IEL A;  3U5R E;  1YEP A;  1X9S B;  4TR1 B;  4IVF A;  2LQQ A;  4O32 A;  3EU4 A;  4K5R A;  5HR2 A;  1T00 A;  3CHX C;  2VCX A;  3PGT A;  5H5R A;  3P8W A;  5BMU A;  5ECO B;  3WT1 A;  4DSR A;  1XFL A;  2X64 A;  1NHY A;  4XRA A;  2FWG A;  3GHA A;  5J4Y A;  3HKR A;  2IWT A;  17GS A;  5IO2 A;  3ZYW A;  5IPH A;  2DC5 A;  5G2Z A;  2RUE A;  3TCO A;  3GL3 A;  4OO5 A;  1NM3 A;  3O76 A;  1BYE A;  2F8A A;  2E0Q A;  2VUP A;  2P0G A;  2VOC A;  2M72 A;  1ERU A;  3QAG A;  2LKU A;  3IK9 A;  3MNG A;  4EIP A;  2WVY A;  1EEM A;  3LYK A;  4E8H A;  2FHE A;  2DJ1 A;  3I43 A;  3IE3 A;  2LEG A;  2HI7 A;  1DSB A;  2AV4 A;  4OWY A;  2EFC A;  2GVP A;  3BBY A;  1Z7R A;  2PVQ A;  2CV4 A;  3KTB A;  1J9B A;  2DKH A;  3FK8 A;  5LD0 A;  4NPB A;  1JHB A;  2I1U A;  2F8F A;  4X43 A;  2QSI A;  6GSW A;  4POK A;  1EGO A;  5L71 A;  4LL4 B;  3E3E A;  3Q18 A;  4MJA A;  2OJL A;  4K5S A;  3GN3 A;  4I6X A;  2WGR A;  2DML A;  1KEB A;  3VWX A;  3KH9 A;  2CAQ A;  3C71 A;  1OC3 A;  1A8L A;  4GSS A;  3EMX A;  4F9Z A;  5IMC A;  3VWW A;  3DGQ A;  4POL A;  3EUR A;  2X4A A;  2R0C A;  11GS A;  1OYJ A;  3APS A;  3LGC A;  2HYX A;  3M3M A;  4NWY A;  4TR4 A;  2HRA A;  2F9S A;  5D9X A;  3G7Y A;  4MLY A;  2PU9 C;  2K8V A;  4HS1 A;  3WYW A;  5INY A;  3IA1 A;  3ED3 A;  4QL7 A;  1GRX A;  4WBJ A;  2JSY A;  4ZB6 A;  2ES7 A;  5CP1 A;  3TKS A;  2D2Z A;  2CZ2 A;  3GA4 A;  4CDO A;  3GUR A;  4KSM A;  1KNG A;  4XS4 A;  4HQS A;  4IS0 A;  2RM6 A;  1YVL A;  2M80 A;  5EY6 A;  3H79 A;  2HNL A;  4Z2T A;  4TN8 A;  2P5Q A;  3IC8 A;  2GDR A;  4ISD A;  1XXU A;  4BWS A;  4HDE A;  5D73 A;  4ML1 A;  1OC9 B;  1XCC A;  4ZBA A;  5E4W A;  1R4W A;  3RGB C;  3GRX A;  4IQA A;  1S3C A;  1XPV A;  3UMA A;  4OCE A;  2PUK C;  1EV9 A;  3G7I A;  3FR6 A;  1XWG A;  3ZVJ A;  4AJ8 A;  4HEA 2;  2B1K A;  4WR5 A;  2GZY A;  2C0E A;  2GQL A;  1IYI A;  4HSC X;  1GP1 A;  1QUW A;  2YWN A;  1WRY A;  5B8A A;  2OE3 A;  5FT3 A;  2VM1 A;  3TRQ A;  1S3A A;  3QAW A;  1I9D A;  2GST A;  3E0U A;  1HD2 A;  2IMI A;  1V9W A;  3GH6 A;  1TRU A;  1PX7 A;  5DAK A;  3W8S A;  2B6M A;  2VM2 A;  3O6T A;  4MZW A;  3MIX A;  4ZL9 A;  3VPT A;  2NTO A;  2DIY A;  4F03 A;  3C7M A;  1Z3E A;  3W6G A;  2H1L A;  1XW9 A;  2L4C A;  1EOG A;  1UC7 A;  2H30 A;  3KXO A;  3HJM A;  2CAI A;  1GTB A;  2ZUP A;  2C3N A;  3APO A;  1GLQ A;  1F9M A;  2O5V A;  4IQ1 A;  1W89 A;  3ZIJ A;  2WB9 A;  3I6A A;  5A4W A;  1F3B A;  5ECP B;  1O85 A;  5G31 A;  3GV1 A;  3C1S A; 
#chains in the Genus database with same CATH homology
 3ZRD A;  2HLS A;  3AY8 A;  4RQR A;  3TDG A;  4PUA A;  4EL1 A;  1G7O A;  1TTZ A;  4MAB A;  2BJX A;  1K0D A;  1PMT A;  5DAL A;  4GDF A;  2GSS A;  1UN2 A;  2EIQ A;  1ZMA A;  2H73 A;  2L6D A;  3RPP A;  2AAW A;  3HVX A;  3LWA A;  1SK0 A;  2MBT A;  2ON5 A;  4JR4 A;  5DCH A;  4BVX A;  4GQF A;  5CRD A;  2YP6 A;  1ILO A;  2F51 A;  3EYT A;  3QR6 A;  5DDL A;  4XS6 A;  5F0G A;  2K8S A;  2B5X A;  3VFI A;  1TK8 B;  3KJY A;  1SD8 A;  6GSV A;  2DJ2 A;  1TW9 A;  5JWQ B;  1HNA A;  1OC8 A;  2ON7 A;  4NHZ A;  1O8W A;  5CNW A;  2EFH A;  4O5R A;  5J9C A;  1WP0 A;  3SWL A;  1SD9 A;  1WMJ A;  2E2G A;  1T1V A;  3NIV A;  1TOF A;  5ABR A;  2KUC A;  1J08 A;  2C3T A;  2WCI A;  1MDI A;  5AIV A;  1GUH A;  3BJ5 A;  1GSE A;  2HSN B;  1AC1 A;  3D4T A;  5IMA A;  1AAZ A;  4I2U A;  3KEB A;  1G6Y A;  3F63 A;  3EE2 A;  1ERW A;  1TDI A;  4MJE A;  4E68 A;  1FG4 A;  3M9J A;  1AQW A;  2NBS A;  2VCZ A;  3HYP A;  3H8Q A;  3EU3 A;  4OFT A;  2L4Q A;  2MMO A;  3KZQ A;  4DSQ A;  1TI1 A;  3L9U A;  4Q5Q A;  2BMX A;  4G0I A;  2R3X A;  2VLU A;  3ME8 A;  5F8B A;  3H93 A;  2FWF A;  6GSU A;  1GUK A;  4N10 A;  2QA1 A;  5HR0 A;  1B4Q A;  3D4M A;  2V2G A;  5ENU A;  2A4H A;  1CQH A;  3QMX A;  1A0F A;  2ALB A;  2VCT A;  1Z5Y E;  3RPN A;  1SJ6 A;  5GAP D;  4L5L A;  4O92 A;  3CBU A;  1A8Y A;  1GSQ A;  1YF0 A;  5CYY A;  3F4T A;  3GH9 A;  2IPA A;  4MA9 A;  1GH2 A;  5D8I A;  1OE7 A;  5J4V A;  2DJ3 A;  1K3O A;  4O7H A;  2ZCT A;  2VL2 A;  4GSN A;  5A1N A;  3IRA A;  4JED A;  2HRN A;  1PN9 A;  3N5O A;  1EWX A;  1YEX A;  1PL2 A;  2MMN A;  5IM9 A;  2O8V B;  1K0B A;  2K18 A;  5D9W A;  2FCH A;  3GTU B;  5BMU B;  1PGT A;  5E59 A;  1B9X C;  3KM6 A;  4ACS A;  3FZ4 A;  2A2P A;  1WOU A;  1PKZ A;  2L6C A;  3LQ7 A;  2EIR A;  1VF1 A;  3QCP A;  4KCA A;  1J0F A;  5ELA A;  1A23 A;  3IV4 A;  4WKW A;  4PNG A;  4MPG A;  1U88 A;  2DJ0 A;  1AUC A;  1B8X A;  4RI6 A;  1VRS D;  5GZZ B;  2H72 A;  2OT3 A;  1EV4 A;  3ZFL A;  2XC2 A;  3NOF A;  2VIM A;  1DUG A;  5B6M A;  3D5J A;  4K2D A;  3WGD A;  2JAC A;  1AIU A;  5CRH A;  3ZIV A;  5IPG A;  1S3D A;  2HT9 A;  4WEY A;  3VWV A;  1HNB A;  4AKH A;  3Q6O A;  4V2N A;  5HFI A;  2YWM A;  1YF1 A;  3PR8 A;  4WBR D;  4RI7 A;  1FO5 A;  1TXU A;  3PPU A;  1M7T A;  4XHM A;  3KTL A;  3UBL A;  4EIQ A;  2UZ8 A;  2LNT A;  3W8J A;  1SU9 A;  2A2R A;  3HZ8 A;  3KIJ A;  2NDO A;  2NVL A;  4K0G A;  1ST9 A;  3HVS A;  1ZYQ B;  4HJ2 A;  2C8U A;  4G2E A;  2GT6 A;  3VUR A;  3VWU A;  1SYX A;  5ECS A;  4J2F A;  4V1A p;  2K9F A;  5H5Q A;  4D73 A;  1BED A;  2YN1 A;  1N25 A;  1GLP A;  3KGK A;  2VLT A;  2IMK A;  2LJA A;  1GSY A;  3RHC A;  1DE2 A;  4XTS A;  2VKZ G;  2H0I A;  3DEX A;  1BAY A;  2GLR A;  3K8N A;  4ICY A;  1EP8 A;  1XWA A;  4ILF A;  5A5K A;  3S9F A;  1PL1 A;  1ZOF A;  3GTU A;  2E2M A;  1UA5 A;  3BD2 A;  3TJF A;  1V40 A;  5KN0 A;  1PN0 A;  2L5O A;  4XS4 B;  3C8E A;  4WET A;  1XWC A;  4NXI A;  3A3T A;  3DKS A;  2LTK A;  1GL8 A;  2OKA A;  3ZFB A;  2REM A;  3V1W A;  1T8E B;  1DBY A;  5AIS A;  2HSY A;  4X1U A;  4AKI A;  1F2E A;  3KCM A;  3WT2 A;  2UV8 G;  1GNE A;  1THO A;  2F3M A;  3HDC A;  4ZIJ A;  2C1Y A;  2FY6 A;  3CWG A;  2EFE A;  4ECJ A;  4L0W A;  4MMM A;  2GT5 A;  2V6K A;  5J3R A;  3D0Z A;  1YZX A;  2WFC A;  2CX4 A;  1FHE A;  4KUN A;  3RHB A;  2CQ9 A;  4GWR A;  3FMW A;  1PQN A;  1A2J A;  4JE1 A;  1RW1 A;  4JRR A;  5DAK B;  2G2Q A;  5CAX A;  3TOT A;  3GKK A;  4MF7 A;  1O73 A;  3EPT A;  3P7X A;  1NSW A;  2X8G A;  1K3Y A;  1U3A A;  4ZL8 A;  1OVN A;  4N0V A;  4RUV A;  2N5A A;  2GGT A;  4EF0 A;  1EP7 A;  2IMF A;  2JZT A;  4IP6 A;  1X9W B;  1HQO A;  1XZO A;  3EVI A;  3M1G A;  4TXO A;  2DBC A;  5B7C A;  2O89 A;  5ECN B;  3UOM A;  4L5O A;  4KSO A;  1FVJ A;  4ZB8 A;  1ZL9 A;  1X5C A;  5J4U A;  3WGX A;  3PIN A;  4J57 E;  1XW5 A;  3DRN A;  5ECL B;  1GSD A;  2BTO T;  5DAL B;  5JCW A;  1X0R A;  3LYP A;  9GSS A;  3TGZ A;  4EDZ A;  2YPM A;  1FAA A;  2C3Q A;  2I81 A;  3H1N A;  1ZZY A;  5G1L A;  6GSY A;  5C00 A;  1K0N A;  1T3B A;  2OBK A;  2R6K A;  1BQ7 A;  1SK1 A;  3VPQ A;  3L9S A;  3CSJ A;  4AF2 A;  3F8U A;  2X49 A;  3BCK A;  4L0U A;  3CXG A;  3M0F A;  2C4J A;  4BVX B;  4DEJ A;  5CRG A;  2N5F A;  2FWE A;  3L78 A;  1GUL A;  1M2D A;  2LRC A;  5CO3 A;  3TJJ A;  1X5E A;  1URM A;  3CTF A;  3E9J B;  4EKZ A;  3IBH A;  1JZD A;  1K0C A;  3MDK A;  3SBC A;  4TOP A;  1GNW A;  4HU9 A;  1OE8 A;  2YJ7 A;  4KE3 A;  4YQU A;  4EE0 A;  1T4Z A;  4IJI A;  4OD7 A;  1M2B A;  1YDK A;  3QD9 A;  1N2A A;  4GTU A;  3LEF A;  4JU5 A;  3R3E A;  1NW2 A;  2KOK A;  1K0O A;  3DWV A;  1WE0 A;  1ZCP A;  4ID0 A;  1JZW A;  1R7H A;  1R26 A;  1I5G A;  1O7U A;  4I5Q A;  1EEJ A;  2GSR A;  3MAK A;  4ZB9 A;  5FHI A;  5A4V A;  2CT6 A;  2IL3 A;  2CA8 A;  3GIX A;  4FYC A;  2CVD A;  1F3A A;  3FZ5 A;  3ZVJ D;  2H6X A;  4BA7 A;  3F3R A;  4G0K A;  2RUF A;  2Z9S A;  2B5Y A;  3DVX A;  1QQ2 A;  1TK5 B;  5AGY A;  2CVK A;  3GKN A;  3ZZX A;  1SEN A;  2GQM A;  5CRW A;  4ZBD A;  3D6I A;  5G30 A;  3UAR A;  3TOU A;  3UL3 A;  2LST A;  4MJB A;  4RQX A;  2XPD A;  2J23 A;  1ZGN A;  4OO4 A;  3D21 A;  4EC0 A;  2MBS A;  4IKH A;  3DXB A;  4FYB A;  5HR1 A;  4Q5R A;  3US3 A;  2AYT A;  2MMA A;  5KEJ A;  2QGV A;  4CY8 A;  2XHF A;  4PXO A;  3L4N A;  3TKP A;  4O5Q A;  1DE1 A;  2OE1 A;  3F0I A;  4K6X A;  2YOI A;  1G7E A;  2QC7 A;  1LU4 A;  2H75 A;  4MH2 A;  1V58 A;  3IXR A;  4OFN A;  1BG1 A;  5B8B A;  2C80 A;  2C0D A;  2LV3 A;  1M2A A;  1QMV A;  2IIY A;  4GF0 A;  1E2Y A;  5IMZ A;  3F9U A;  2LRT A;  5JCU A;  4PTS A;  4IW9 A;  1MDK A;  3ZLP A;  2V6O A;  4FH8 A;  1SJZ A;  2HZE A;  4MZC A;  5A1N B;  2EC4 A;  5KOW A;  2IJY A;  4K2X A;  4K0N A;  1FOV A;  2R2J A;  1VF3 A;  2R0G A;  4YKF A;  2HZF A;  3LXZ A;  1SKR B;  1SL0 B;  4PGT A;  1B4P A;  2H74 A;  3G9B A;  2RII A;  1ZYP A;  2JAD A;  1MDJ A;  3VLN A;  1H75 A;  2K6V A;  1MD3 A;  1WJK A;  3EC3 A;  4YQV A;  5BRT A;  2VL2 C;  3HJP A;  5F07 A;  5KOX A;  2B7K A;  1FVK A;  4GST A;  5DQS A;  4MCU A;  3U6V A;  3TU3 B;  3F4S A;  2H6Y A;  2XBQ A;  4XCS A;  4KCE A;  4NMU A;  2B1L A;  3FHK A;  4ECI A;  4PQI A;  2KLX A;  3ERF A;  5A5H A;  5DBQ A;  2B7J A;  4LMV A;  2H01 A;  5ECQ B;  3IPZ A;  4F2I A;  3HJO A;  4O5U A;  1PRX A;  2V1M A;  2CVB A;  1OKT A;  3ERG A;  3TKR A;  1V57 A;  4TXV A;  4ZIL A;  4KND A;  4V1A g;  4MK3 A;  3N9J A;  3TUE A;  1Z7P A;  2YZH A;  1AXD A;  5C04 A;  3ISO A;  1SKS B;  1U87 A;  3UIW A;  1ML6 A;  2QKE A;  1Y1U A;  1XVW A;  1U3I A;  2YJH A;  4D73 B;  4W66 A;  3QDN A;  3RAZ A;  5DVB A;  4A5P A;  2R0P A;  2RM5 A;  4MNN A;  2YCD A;  5CRE A;  2NPB A;  3CSI A;  1TK0 B;  2LUS A;  3GX0 A;  4KAE A;  2X8H A;  3UJ1 A;  1ON4 A;  3FKF A;  3HHV A;  4AJ6 A;  3OR5 A;  1YY7 A;  1F6M C;  4KA0 A;  1GTI A;  1QGV A;  2HRK B;  5HFG A;  1T4Y A;  2HSH A;  12GS A;  1XBS A;  4YKG A;  5G1K A;  3KP9 A;  4LMW A;  2GTU A;  2HE3 A;  4EDY A;  2KP2 A;  4K7I A;  5FWG A;  4ZBB A;  4GLT A;  4BVY A;  3WGE A;  2XPE A;  3UBK A;  3KD0 A;  3FY7 A;  4KF9 A;  3HXS A;  3M8N A;  4V2M A;  3TRP A;  3TB2 A;  1O81 A;  1USB A;  4TRX A;  2I3Y A;  2X8C A;  2R5G A;  3L9V A;  4PQH A;  4HUA A;  3DVW A;  1T7P B;  4ZXG A;  4QL9 A;  2FWH A;  2CX3 A;  4F0C A;  1UVZ A;  5ID2 B;  4I2T A;  3ZIT A;  3ZL5 A;  5DCG A;  4DVC A;  2A2S A;  3LJR A;  1XWK A;  1RK4 A;  3ME7 A;  3VI7 A;  18GS A;  1PX6 A;  1BJX A;  2H6Z A;  3LXT A;  2MMZ A;  2C0F A;  1K0A A;  3EIN A;  2VCQ A;  3KMN A;  1EGR A;  2VCV A;  4KDU A;  2XBI A;  3CRT A;  2ZNM A;  4Z7X A;  3CYN A;  2PER A;  3RDW A;  4HZ4 A;  1PKW A;  4GQC A;  4AKX B;  4P3Y B;  4IJ3 A;  1Y6E A;  4AKG A;  1EOH A;  2GZZ A;  1O8X A;  5DJM A;  1ABA A;  3A5W A;  4E8E A;  2WRT A;  3A2X A;  2H0G A;  3TJK A;  3EWL A;  3HVV A;  3HZ4 A;  4BL7 A;  3GMF A;  2OAD A;  3ZMK A;  1Z9H A;  1GUM A;  3FYG A;  3UAP A;  1EZK A;  1VF4 A;  3F3Q A;  4TXO B;  1MD4 A;  4MZB A;  4IHU A;  10GS A;  2HSM A;  2V41 A;  1SYR A;  1BG5 A;  2HRK A;  3ZML A;  3LFL A;  5J9B A;  4XRD A;  16GS A;  5EPF A;  1OKD A;  4F0B A;  2WS2 A;  5ECH B;  1SVM A;  2GS3 A;  3DD3 A;  1SVO A;  6GST A;  2RLI A;  4FO5 A;  4EUY A;  1K0M A;  3L0H A;  1M0U A;  2C0G A;  4ML6 A;  1Y25 A;  1E6B A;  3BOA A;  5COH A;  3TKS C;  3EMP A;  4BWQ A;  2L5L A;  1QXH A;  5AN1 A;  5ECR B;  1O6J A;  2GZP A;  2WDU A;  4LL1 B;  4G19 A;  2YV7 A;  5ID2 A;  1ZYN A;  3FRC A;  4EVM A;  3IAM 2;  2HQT A;  3G7J A;  5ELG A;  2FNO A;  2IFQ A;  5JCG A;  4FYU A;  5J47 A;  1IYH A;  4G01 A;  4V2L A;  3UVH A;  5HR3 A;  2P31 A;  4CW9 A;  4GCI A;  1V2A A;  1TXX A;  2H76 A;  4MJC A;  1XWB A;  4MP4 A;  3FW2 A;  1PA3 A;  4WXT A;  1AQX A;  1JLV A;  2IN3 A;  20GS A;  1YKA A;  1GSU A;  1JFU A;  4AJ7 A;  4Q5N A;  3I9V 2;  3GKX A;  2VD0 A;  1TU7 A;  4ECC A;  5J41 A;  2H19 A;  5IIZ A;  3FEU A;  3CRU A;  1SL2 B;  4DSS A;  1H4O A;  5IQY A;  3KH7 A;  5A4U A;  2YNX A;  3MYD A;  3FR3 A;  4ZB7 A;  1HYU A;  4YAV A;  4TR1 A;  2PBJ A;  4XIH A;  5J40 A;  3GSS A;  1C72 A;  2DKI A;  1PSQ A;  2CZ3 A;  4KGI A;  1SVL A;  1YKC A;  5HQP A;  1A24 A;  2FA8 A;  5D96 A;  4CY6 A;  3QPM A;  3MSZ A;  3TJB A;  4USS A;  4G9H A;  4X4J A;  1TRW A;  5DJL A;  1GSS A;  3LW9 A;  2AJQ B;  4IN0 A;  5D9T A;  4OFM A;  1CQG A;  5A34 B;  3IAS 2;  2JSZ A;  19GS A;  1G6W A;  3DML A;  2MYG A;  5IOW A;  2JU5 A;  2B3S A;  2HXK A;  14GS A;  1FB6 A;  3C73 A;  3A2W A;  4LA1 A;  1VF2 A;  1R5P A;  2H1G A;  3UVT A;  2OA7 A;  1TJD A;  2B5E A;  1M99 A;  1JZR A;  3DIE A;  2OAC A;  2TIR A;  5D93 A;  4ULX A;  1KBN A;  2QA2 A;  1KTE A;  4N11 A;  2HZE B;  3WD6 A;  2TRX A;  3LOR A;  2V32 A;  4OMV A;  5IOX A;  4I8B A;  1SKW B;  1F37 A;  2LJR A;  5KN1 A;  5AIX A;  5J5N A;  3HY2 A;  5GAN D;  4X0X A;  1QFN A;  2PMT A;  3FZ9 A;  1GTA A;  3IHQ A;  4KX4 A;  3QFA C;  3KMO A;  3UEM A;  3CMI A;  1Q4J A;  2VL9 A;  4TVE A;  4Q5F A;  4NV5 A;  2LJK A;  2OBI A;  1TRS A;  3Q74 A;  1TRV A;  2WZ9 A;  1YJ6 A;  2DJK A;  4WR4 A;  1B48 A;  5G5F A;  4TW5 A;  5GST A;  3HCZ A;  3IR4 A;  4N30 A;  7GSS A;  1TP9 A;  3RBT A;  4F82 A;  5ECM B;  1TKD B;  1YQ1 A;  3QFB C;  2H0H A;  3IK7 A;  5ECK B;  4HJM A;  4N3Z A;  4MH3 A;  4NAX A;  2FLS A;  3ERW A;  5EL8 A;  2VD1 A;  5A5H B;  1QK8 A;  2HRF A;  2LRN A;  5H5S A;  2H1D A;  1BF5 A;  5A34 A;  1XVQ A;  1SK2 A;  3IHG A;  4TKY A;  1OC9 A;  4L8E A;  4FIW A;  3CTG A;  2N5B A;  4PX1 A;  5HFK A;  4KDX A;  2JL4 A;  2VO4 A;  2DMM A;  1Z6N A;  1XW6 A;  2YAN A;  1XOB A;  5F05 A;  2X99 A;  4K7N A;  1GTU A;  2YWO A;  4ZL7 A;  2TRC P;  1G0T A;  4AGS A;  22GS A;  2EFD A;  3MWH A;  4H86 A;  1MEK A;  3Q19 A;  3DYR A;  3J7Y b;  3VI5 A;  4HI7 A;  4I97 A;  4MF6 A;  1JZO A;  4OCF A;  2GSQ A;  4QQ7 A;  1M9A A;  2GQK A;  5JWO B;  1WIK A;  3FR9 A;  2P5R A;  5F06 A;  2AHE A;  2O7K A;  4JBB A;  3CSH A;  5LNK e;  2AB6 A;  1A0R P;  2FUG 2;  1A2M A;  1A2L A;  1ZYE A;  2H71 A;  3PH9 A;  2FD3 A;  2E7P A;  3HD5 A;  1AW9 A;  2FA4 A;  5G5E A;  4AI6 A;  4G0L A;  3P90 A;  4BVY B;  2DJJ A;  2O87 A;  3TKQ A;  3GUS A;  4TR3 A;  2KHP A;  4K9Z A;  2H70 A;  3I69 A;  2AUV A;  4TR0 A;  4PNF A;  2PWJ A;  1XIY A;  3ZRE A;  3KP8 A;  3TKS E;  1MTC A;  1ERT A;  4HU7 A;  2VCW A;  1W4V A;  4YH2 A;  2WUL A;  1Z6M A;  2R37 A;  4NHW A;  4WF4 A;  2LQO A;  4Z2U A;  1K3L A;  8GSS A;  4HOJ A;  3A5I A;  3GNJ A;  2PN8 A;  4KH7 A;  2L57 A;  1SL1 B;  2VAF A;  3TJG A;  4IP1 A;  5KN3 A;  1M9B A;  4GRF A;  3HA9 A;  6GSX A;  4PUR A;  4NV2 A;  2R4V A;  4MF5 A;  2I4A A;  1LJR A;  1HNC A;  2YV9 A;  4CHS A;  3HMJ G;  2H1B A;  2YZU A;  4KDY A;  5EVO A;  3M9K A;  2J9H A;  2FGX A;  2H1A A;  1FOH A;  1SJI A;  1VGL A;  3TRX A;  5D9V A;  4ECB A;  2G0F A;  2HFD A;  1NHO A;  2I9H A;  4Z2R A;  2MZC A;  3QAV A;  1R5A A;  4GXZ A;  4LLR A;  2PPT A;  4BL7 B;  4K8M A;  1N8J A;  4BPY A;  2EIO A;  3J7Y k;  4WF5 A;  1X9M B;  4QMK A;  4MPF A;  2L59 A;  2HSM B;  1ERV A;  4HZ2 A;  2LNS A;  4PQ1 A;  1X5D A;  3F6D A;  3VK9 A;  2YWI A;  1FW1 A;  2H8L A;  4POM A;  2HSN A;  1THX A;  1TU8 A;  4J56 E;  3IOS A;  4EXJ A;  3NZN A;  1RQM A;  2JZS A;  1WWJ A;  5IO0 A;  3LSZ A;  2PGT A;  2DLX A;  4N0Z A;  5JWR B;  4YQM A;  3GST A;  13GS A;  2A4V A;  4HQZ A;  2WJU A;  4JR6 A;  2VL3 A;  4YAP A;  1AQV A;  2O85 A;  2IME A;  5GSS A;  4FQU A;  5LCZ A;  3P2A A;  2H66 A;  3F6F A;  5KN2 A;  3GKM A;  1GSF A;  2IFQ B;  1Q98 A;  3H4K A;  4JZQ A;  4G10 A;  1FB0 A;  2JZR A;  3FZA A;  3C1R A;  3A2V A;  4IGJ A;  5B6N A;  1PD2 1;  3O3T A;  3GL5 A;  1JLW A;  3LG6 A;  3ZTL A;  3IC4 A;  1LBK A;  4MDC A;  1B9Y C;  2KP1 A;  4PUF C;  1OAZ A;  2OE0 A;  2PVO C;  1U6T A;  1WPI A;  2LS5 A;  2DIZ A;  3GX8 A;  1TI3 A;  3GYK A;  5DQY A;  3QOU A;  3R2Q A;  1BX9 A;  6GSS A;  4K1F A;  2IMD A;  2M46 A;  5IMF A;  2VLV A;  1GWC A;  3IDV A;  3BCI A;  2DSA A;  3F4R A;  4KW6 A;  4KB3 A;  5ECI B;  4IBP A;  5IMD A;  1ACV A;  4XS1 A;  4K7O A;  3JCM L;  3D22 A;  4POB A;  1V98 A;  5IMV A;  3APQ A;  4EO3 A;  4DSS B;  1XOA A;  3GFK A;  4IEL A;  3U5R E;  1YEP A;  1X9S B;  4TR1 B;  4IVF A;  2LQQ A;  4O32 A;  3EU4 A;  4K5R A;  5HR2 A;  1T00 A;  2VCX A;  3PGT A;  5H5R A;  3P8W A;  5BMU A;  5ECO B;  3WT1 A;  4DSR A;  1XFL A;  2X64 A;  1NHY A;  4XRA A;  2FWG A;  3GHA A;  5J4Y A;  3HKR A;  2IWT A;  17GS A;  5IO2 A;  3ZYW A;  5IPH A;  2DC5 A;  5G2Z A;  2RUE A;  3TCO A;  3GL3 A;  4OO5 A;  1NM3 A;  3O76 A;  1BYE A;  2F8A A;  2E0Q A;  2VUP A;  2P0G A;  2VOC A;  2M72 A;  1ERU A;  3QAG A;  2LKU A;  3IK9 A;  3MNG A;  4EIP A;  1EEM A;  3LYK A;  4E8H A;  2FHE A;  2DJ1 A;  3I43 A;  3IE3 A;  2LEG A;  2HI7 A;  1DSB A;  2AV4 A;  4OWY A;  2EFC A;  2GVP A;  3BBY A;  1Z7R A;  2PVQ A;  2CV4 A;  3KTB A;  1J9B A;  2DKH A;  3FK8 A;  5LD0 A;  4NPB A;  1JHB A;  2I1U A;  2F8F A;  4X43 A;  2QSI A;  6GSW A;  4POK A;  1EGO A;  5L71 A;  4LL4 B;  3E3E A;  3Q18 A;  4MJA A;  2OJL A;  4K5S A;  3GN3 A;  4I6X A;  2WGR A;  2DML A;  1KEB A;  3VWX A;  3KH9 A;  2CAQ A;  3C71 A;  1OC3 A;  1A8L A;  4GSS A;  3EMX A;  4F9Z A;  5IMC A;  3VWW A;  3DGQ A;  4POL A;  3EUR A;  2X4A A;  2R0C A;  11GS A;  1OYJ A;  3APS A;  3LGC A;  2HYX A;  3M3M A;  4NWY A;  4TR4 A;  2HRA A;  2F9S A;  5D9X A;  3G7Y A;  4MLY A;  2PU9 C;  2K8V A;  4HS1 A;  3WYW A;  5INY A;  3IA1 A;  3ED3 A;  4QL7 A;  1GRX A;  4WBJ A;  2JSY A;  4ZB6 A;  2ES7 A;  5CP1 A;  3TKS A;  2D2Z A;  2CZ2 A;  3GA4 A;  4CDO A;  3GUR A;  4KSM A;  1KNG A;  4XS4 A;  4HQS A;  4IS0 A;  2RM6 A;  1YVL A;  2M80 A;  5EY6 A;  3H79 A;  2HNL A;  4Z2T A;  4TN8 A;  2P5Q A;  3IC8 A;  2GDR A;  4ISD A;  1XXU A;  4BWS A;  4HDE A;  5D73 A;  4ML1 A;  1OC9 B;  1XCC A;  4ZBA A;  5E4W A;  1R4W A;  3GRX A;  4IQA A;  1S3C A;  1XPV A;  3UMA A;  4OCE A;  2PUK C;  1EV9 A;  3G7I A;  3FR6 A;  1XWG A;  3ZVJ A;  4AJ8 A;  4HEA 2;  2B1K A;  4WR5 A;  2GZY A;  2C0E A;  2GQL A;  1IYI A;  1GP1 A;  1QUW A;  2YWN A;  1WRY A;  5B8A A;  2OE3 A;  5FT3 A;  2VM1 A;  3TRQ A;  1S3A A;  3QAW A;  1I9D A;  2GST A;  3E0U A;  1HD2 A;  2IMI A;  1V9W A;  3GH6 A;  1TRU A;  1PX7 A;  5DAK A;  3W8S A;  2B6M A;  2VM2 A;  3O6T A;  4MZW A;  3MIX A;  4ZL9 A;  3VPT A;  2NTO A;  2DIY A;  4F03 A;  3C7M A;  1Z3E A;  3W6G A;  2H1L A;  1XW9 A;  2L4C A;  1EOG A;  1UC7 A;  2H30 A;  3KXO A;  3HJM A;  2CAI A;  1GTB A;  2ZUP A;  2C3N A;  3APO A;  1GLQ A;  1F9M A;  2O5V A;  4IQ1 A;  1W89 A;  3ZIJ A;  2WB9 A;  3I6A A;  5A4W A;  1F3B A;  5ECP B;  1O85 A;  5G31 A;  3GV1 A;  3C1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...