1HNCA

Crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
b'PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVFGNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase(glutathione)
total genus 68
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1hncA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1hncA01
4OMVA 4MF5A 1NHYA 3M9KA 2HRKA 3D22A 3ME7A 3ZL5A 4MZBA 4EL1A 2NTOA 4J56E 3W8SA 2P31A 10GSA 6GSVA 2H0GA 1K0MA 1U3AA 3UOMA 3KXOA 2K9FA 4KUNA 4ZB8A 3DKSA 5KN0A 1SK1A 6GSUA 3A3TA 3RHCA 5JWOB 1GSQA 5DQYA 6GSTA 1XBSA 2PU9C 3IC8A 5FT3A 2GSTA 5IMAA 2H66A 2XHFA 4IHUA 3KZQA 1Z6MA 4GSNA 4G0KA 1X5CA 4IJ3A 3HZ4A 1QUWA 5ECIB 4MPGA 2JU5A 2LQQA 1JLWA 2EIQA 4KW6A 4GQFA 2KP1A 2H72A 4PNGA 1FVJA 5KN1A 2C0FA 2MZCA 4MPFA 4ZILA 1XWBA 1SKWB 1XWKA 4TOPA 3DVXA 19GSA 3I6AA 1SK0A 4XS1A 4H86A 4OFMA 3EE2A 4F2IA 2H75A 4IN0A 4JRRA 4HZ2A 1U6TA 3QAVA 1YEXA 4RQRA 13GSA 1MD3A 4TXOA 2GDRA 4WR5A 1U88A 1V40A 5IMFA 2EIRA 4P3YB 2VCQA 3UEMA 1BYEA 2UZ8A 2C3NA 2N5FA 4NV2A 5DQSA 3Q18A 4JR4A 5G1LA 1GSYA 1ZYEA 2H01A 1O7UA 3WT2A 2YANA 1OC9B 4MJEA 4DVCA 1R26A 4OCFA 4TR1B 5HR2A 2ZCTA 5AIVA 4K8MA 5G30A 2OKAA 4FYUA 3TKPA 2GQLA 1T1VA 2WCIA 3CMIA 4Z7XA 1MD4A 1J9BA 2XPEA 3F9UA 2QKEA 3LGCA 1GUMA 7GSSA 3QOUA 3Q19A 4ZBDA 2IMFA 5J4UA 3GN3A 3I69A 3GX0A 3HCZA 4TVEA 4KA0A 5B8AA 2GVPA 2NDOA 3N5OA 5C04A 2GZYA 5D9XA 3UL3A 3KTLA 3EWLA 3KIJA 2PVQA 2J9HA 3VI7A 2GSSA 1YKCA 1FB6A 1FHEA 3RHBA 2MBTA 1A24A 1GSSA 1M2DA 3ERFA 3MAKA 1OE7A 1ERWA 5LCZA 5CREA 4XHMA 5JCGA 2YJ7A 3GUSA 2CT6A 3C73A 2DBCA 2K18A 1T8EB 2VIMA 4YAVA 5DCHA 2K8VA 1G6YA 3A2VA 2JZSA 2B3SA 5KN2A 4MZWA 12GSA 2IFQA 1Y6EA 1ERUA 5ECSA 5A4VA 2YWIA 4IBPA 1HQOA 1O6JA 5AIXA 5AISA 4HZ4A 1B48A 6GSSA 3E0UA 3P8WA 1EGRA 1EV4A 3M3MA 2V2GA 5DAKB 1YZXA 5GSSA 1F3BA 1SK2A 1XW9A 3HYPA 2LUSA 3HD5A 3BOAA 3ISOA 3F4RA 3TKRA 4E8HA 3CTFA 1U87A 1GSUA 2B5EA 2GZPA 3IC4A 3QAWA 3BCIA 3GKMA 3IXRA 1R4WA 3EU4A 1RW1A 4JEDA 1TI1A 4IS0A 1OC3A 2M72A 1NW2A 5E59A 1H75A 2HRAA 3WYWA 5A4UA 3QDNA 2IMKA 4IJIA 1GTIA 4PQHA 3HA9A 5C00A 3EMXA 3LG6A 2IMDA 1AC1A 2YPMA 3NOFA 3ZLPA 1E6BA 1GULA 5D9VA 3VI5A 1FB0A 3QR6A 4X1UA 3ZYWA 1OAZA 2VUPA 1UA5A 5DCGA 5EY6A 1PN9A 1XWCA 2L6DA 1EV9A 5GAPD 3VLNA 2GQKA 2G0FA 3D0ZA 5J41A 4K7OA 3R3EA 2R4VA 3NZNA 3S9FA 2HFDA 4EVMA 1JZDA 2YP6A 3TRQA 2H73A 1GUKA 4EDYA 4DSRA 1G6WA 4V2NA 4LLRA 5DVBA 1C72A 5DALA 5F8BA 4N11A 3KH9A 2H0IA 1GTAA 2LRCA 1LBKA 3LJRA 1A23A 5HFKA 2JSZA 3FR3A 1FW1A 1A2JA 3APSA 1PSQA 2H71A 2GT6A 5AN1A 3GKNA 1MTCA 2HRKB 1UN2A 4PURA 2VCTA 1LJRA 4BVYB 2VAFA 2WULA 4BA7A 3RPPA 1W89A 1THXA 3DGQA 2YOIA 4DSSA 1GRXA 5CO3A 2C0GA 2C0EA 3C1RA 3TCOA 1XXUA 3P2AA 4KNDA 5CRDA 1AQVA 5ELAA 4MMMA 1FG4A 3CTGA 2PERA 1A8YA 5IOWA 2H6XA 1XOBA 2G2QA 2H6ZA 1VF2A 5ECHB 4BVXA 2OBIA 4TRXA 2IWTA 5J3RA 3IK7A 2C1YA 3CYNA 3M8NA 1EWXA 1O8XA 2IMEA 2GSRA 1F2EA 4TXVA 5DDLA 5JWRB 4RQXA 4GWRA 4BWSA 4OFTA 5FWGA 4KCAA 3APQA 4KSMA 3H79A 3C8EA 2F3MA 3TJGA 3GH9A 4MZCA 5ID2A 2FUG2 1YF1A 2VM2A 2DJ1A 3CSHA 4HU7A 3GURA 4NHWA 4K6XA 5CRGA 3KP8A 3ZRDA 2B7KA 2ZUPA 3KP9A 3RBTA 3C71A 1VGLA 3GTUA 2REMA 2GS3A 4X43A 3L78A 2KOKA 2OE1A 3KH7A 1WOUA 2QSIA 4ULXA 4TXOB 4POMA 4K9ZA 3L9SA 3UBKA 3DMLA 1NHOA 1GH2A 1Z5YE 1Q98A 2OA7A 4OFNA 1Z6NA 1V57A 2HI7A 1OKTA 1TU8A 1TRUA 1T7PB 1NSWA 2AUVA 2HSMA 1WIKA 4IW9A 4I97A 2JZRA 2H1BA 5B6NA 4NWYA 1K0AA 3ZVJD 2DJ2A 2DC5A 1QQ2A 3K8NA 4G19A 4GSTA 2HLSA 1B8XA 2PMTA 2JACA 2I9HA 3JCML 3HY2A 1NM3A 3PH9A 2N5AA 3FYGA 1ERTA 1M9BA 4KE3A 3HDCA 3TJBA 2X8HA 1VF3A 5BMUA 3QD9A 1KBNA 2WFCA 2LRTA 5HQPA 3LORA 3TKSE 4IELA 1ML6A 2WRTA 2P5QA 4ISDA 3F3QA 3F63A 4EF0A 1MDKA 4RI6A 1VF1A 1O85A 1V2AA 4KF9A 2FGXA 2KLXA 1X0RA 1JZWA 2JADA 2O85A 4NMUA 1T4ZA 1YY7A 1F9MA 5A5KA 1B4PA 1EP7A 3BD2A 3TRXA 4ZBBA 1OC8A 3HVSA 1M9AA 1YKAA 2D2ZA 4BWQA 4EO3A 1I9DA 3ME8A 4ZL7A 1G7EA 3UMAA 4FH8A 1K0CA 3Q6OA 3LYPA 4FYBA 2HRFA 1XWGA 2DMMA 3MDKA 4IGJA 1XPVA 4EXJA 2AJQB 4EC0A 4TR0A 1SL0B 2V6OA 1FVKA 2OJLA 1TRSA 5ELGA 1AUCA 22GSA 3IK9A 4IKHA 3TJJA 1AQXA 2HQTA 4FIWA 1HNCA 5HR0A 1TJDA 1GLPA 2C8UA 2IFQB 1O8WA 3F4SA 6GSXA 3GSSA 3O3TA 3ZMKA 2QGVA 1DSBA 3GMFA 1ZL9A 3GRXA 4AJ6A 4XS6A 2YN1A 1EEJA 3APOA 2CX4A 4J2FA 1T3BA 5DJLA 2HYXA 3MWHA 4ZB6A 2GSQA 4GTUA 5IIZA 2VD0A 3MNGA 2O89A 2H0HA 4PXOA 2VM1A 1M0UA 4I2UA 4G9HA 2NBSA 2O87A 5CRWA 4XCSA 2BMXA 4TN8A 1K0DA 4Q5QA 4MK3A 1XWAA 3H93A 2ES7A 4ML1A 5FHIA 2MMNA 4XS4A 9GSSA 4XTSA 2L4CA 4HQSA 11GSA 2OE3A 3F3RA 1DE2A 1BX9A 1R5AA 1PX7A 4IQ1A 3Q74A 3G7YA 2LS5A 3F0IA 5HR3A 5COHA 3QAGA 2RM5A 4HQZA 3DIEA 2VL2A 1WRYA 1KEBA 3GHAA 4HU9A 1X9WB 1BJXA 3TJFA 1OYJA 2X99A 2WJUA 1QFNA 5DJMA 2TRXA 4CW9A 5E4WA 2HSHA 3HVVA 2C3QA 2ALBA 1A0FA 1YJ6A 3ZFBA 3BCKA 3G7IA 2WDUA 1PKZA 1M2AA 2L5LA 3A5WA 4QL9A 2CZ2A 1SD8A 2CVDA 1A8LA 5IMCA 3H8QA 1GWCA 3FKFA 1THOA 5DALB 2E2MA 3V1WA 2OBKA 3LEFA 1BAYA 3IA1A 1GSDA 5LD0A 4MH2A 2PPTA 1PRXA 3GFKA 4ECIA 2VLTA 1X5DA 4KDUA 2H30A 4JE1A 1X9MB 2DJKA 5F0GA 2AYTA 1V9WA 4EE0A 2CA8A 2VL9A 4PQ1A 4D73A 2H74A 4L8EA 2H1DA 1RK4A 3FZ5A 3WGEA 1WJKA 4ZIJA 1GTUA 1TK5B 1TOFA 3KJYA 1WE0A 2B5YA 2TIRA 3E3EA 2TRCP 3HJMA 3KM6A 4DSSB 3UARA 1XCCA 2I4AA 4KH7A 5INYA 4G0IA 1J0FA 1QK8A 1JZRA 5JWQB 2A4VA 2O8VB 3TRPA 3CSIA 1ILOA 1OVNA 3GKKA 5B8BA 3C1SA 3TUEA 2GTUA 5F05A 2JL4A 2XC2A 1V58A 4X0XA 4BVXB 4KDYA 3TOTA 1Y25A 2HSYA 1K3OA 4ECCA 2IPAA 5KEJA 5IO2A 2H1AA 4XRDA 5ECMB 4N0VA 3CRUA 4G0LA 1SD9A 4TR3A 2DIZA 2CX3A 3SWLA 3FW2A 4GXZA 1Q4JA 1V98A 2R2JA 1ST9A 1GLQA 2WS2A 1IYIA 2JSYA 5ID2B 1ZMAA 3VWVA 5B7CA 4XRAA 4Q5RA 5ENUA 3SBCA 1K0NA 4IVFA 3G7JA 3NIVA 4OD7A 1AIUA 2I1UA 3OR5A 2HNLA 3GTUB 2EC4A 2CAQA 2RIIA 2C0DA 2VCXA 4IP6A 2O7KA 3F6DA 2DLXA 3KD0A 4I2TA 3P7XA 4N10A 1Z3EA 1PMTA 2HSMB 4MCUA 4O7HA 5G5EA 1TU7A 4LL4B 3ZVJA 3QCPA 4MA9A 3ZIJA 2YZHA 4MP4A 1USBA 4WBJA 2L5OA 3KGKA 3D4MA 4K0GA 4POLA 3LQ7A 3QMXA 1SU9A 2K6VA 1HNBA 2PN8A 2YWMA 4G2EA 3CRTA 1OE8A 4WF5A 2V1MA 5D8IA 1SJIA 1TP9A 1HNAA 3FR9A 4MH3A 3DWVA 3L9UA 4RI7A 4GSSA 4KCEA 1TRVA 3ERGA 2IJYA 2GQMA 5B6MA 2ON7A 4WXTA 3EYTA 1GL8A 2J23A 3U6VA 4WF4A 3LWAA 1OKDA 3HJOA 2F8AA 1J08A 1XZOA 2R5GA 5LNKe 4F0BA 3BBYA 1JHBA 4PTSA 20GSA 17GSA 1FAAA 3HKRA 4ZXGA 2LNSA 5JCWA 4F82A 2LEGA 5GZZB 5HFIA 3EURA 4L0UA 4F9ZA 4L5LA 4USSA 2NPBA 4KAEA 3GA4A 2PBJA 4I5QA 16GSA 3ZMLA 1HYUA 4JZQA 1M7TA 2RM6A 4L0WA 3PINA 3EINA 3ZREA 1A2MA 3VK9A 2FLSA 1ZYQB 2DIYA 4N30A 3A2WA 1MDJA 2X8CA 3M1GA 3J7Yb 3O6TA 3FK8A 1TKDB 1SYXA 2HT9A 2H8LA 1SL1B 1JFUA 2VL2C 2VO4A 2LKUA 1PQNA 2HXKA 2L59A 3J7Yk 2QC7A 4N0ZA 4J57E 4PUAA 3PPUA 5ECNB 1YEPA 2E2GA 4ILFA 5ECPB 2VCWA 5IPGA 3W8JA 2B1KA 4XS4B 5J9BA 2WGRA 2E0QA 2H6YA 2F8FA 5IMZA 2DJ3A 1ACVA 4JR6A 4ZL9A 4ACSA 3O76A 1JZOA 3ZFLA 1I5GA 3I43A 3US3A 1B9YC 2HZEA 3AY8A 1R7HA 1Z7PA 2FNOA 2H76A 1SJZA 1XFLA 3TB2A 1GP1A 4LMWA 4AF2A 1VRSD 2H19A 5J5NA 1PX6A 1K0BA 3LXTA 1SJ6A 4MABA 2RUEA 2YZUA 3N9JA 3QFBC 4MJAA 4PX1A 3RPNA 3QFAC 1S3CA 2LQOA 4EKZA 2FWFA 4O32A 3HVXA 5D73A 3IDVA 3IPZA 4BVYA 3UJ1A 4JU5A 2OE0A 3VFIA 2LRNA 5GAND 2X8GA 5A4WA 4OWYA 3C7MA 4WETA 3LYKA 3KMNA 3TKSA 4JBBA 4PQIA 2DMLA 4ZL8A 1M99A 4AJ7A 4NPBA 4D73B 4ECBA 2P0GA 2GZZA 1BEDA 3W6GA 3KTBA 3IE3A 1URMA 4HJMA 2PVOC 1HD2A 1YQ1A 3FEUA 5ECOB 2XPDA 2C4JA 4K0NA 2DJJA 2DSAA 2M80A 4DEJA 1AQWA 4YQUA 4V2MA 1ABAA 2MBSA 2VD1A 3ZTLA 4V1Ag 3TJKA 5G5FA 2H1GA 5CYYA 4PUFC 2HRNA 1PD21 3VWXA 3QPMA 3H1NA 1XW5A 2M46A 3DEXA 3LFLA 1TK0B 2V41A 3TDGA 1ERVA 5IPHA 3GV1A 3IRAA 2A2RA 4POKA 3D6IA 1XVQA 1BQ7A 4QQ7A 4YQMA 1G7OA 2HE3A 4MJBA 4HEA2 3HZ8A 1EP8A 2OACA 3WT1A 2VCVA 2XBQA 1RQMA 1UC7A 1UVZA 6GSYA 5IO0A 1PL2A 3G9BA 1CQHA 2AV4A 4NHZA 2Z9SA 4LA1A 1EOGA 3CXGA 1QMVA 5IQYA 5IM9A 5JCUA 2YV9A 3KEBA 4LMVA 4NXIA 5IOXA 2VCZA 2FD3A 8GSSA 5CRHA 2CZ3A 2I81A 4BL7A 1A2LA 4RUVA 1QGVA 4CDOA 5F07A 3BJ5A 4TR4A 2V6KA 3IBHA 2IL3A 4MDCA 5EL8A 5F06A 2X64A 2FA8A 2NVLA 4MF7A 5ECKB 3DYRA 4HI7A 3I9V2 2LV3A 1ZCPA 2F9SA 4F0CA 1TK8B 1LU4A 1WPIA 4G10A 2CAIA 4WBRD 3FZ4A 1DBYA 3IAM2 4QL7A 5D9WA 3F6FA 3RDWA 3M9JA 3EU3A 2MMZA 2PUKC 3GL3A 4EDZA 5ECRB 3IV4A 1ZGNA 2H70A 2EIOA 4E8EA 3KMOA 3GX8A 4HS1A 1T4YA 2C3TA 4KB3A 4AJ8A 4BPYA 4TKYA 4OO4A 3RAZA 4FO5A 5EVOA 3MSZA 1KNGA 3M0FA 3VURA 3VPQA 2FWEA 5DBQA 3IAS2 3GIXA 3PGTA 5AGYA 3HJPA 3GKXA 2ON5A 1WMJA 3UVHA 3WD6A 2F51A 2PWJA 1DE1A 1TRWA 4PNFA 1GNEA 5IMDA 3TOUA 2FHEA 3D5JA 3IHQA 2MYGA 2BJXA 2GGTA 4GRFA 1PL1A 2AHEA 1XIYA 1AXDA 1QXHA 4K1FA 3L9VA 5KN3A 2IN3A 2YWOA 1ON4A 5ABRA 3CSJA 3ZIVA 4YQVA 2MMOA 4ID0A 3R2QA 3H4KA 5L71A 4F03A 2I3YA 2B7JA 5G2ZA 5ECQB 4WKWA 1XW6A 4NAXA 4K7NA 1F3AA 3FRCA 2RLIA 2AB6A 2GT5A 2CVBA 5IMVA 1S3DA 3D4TA 6GSWA 18GSA 1DUGA 2LSTA 4GLTA 4I6XA 1SKSB 2N5BA 1TDIA 1S3AA 1BG5A 4IQAA 1YF0A 3TGZA 1TW9A 2RUFA 3GYKA 1U3IA 3LXZA 1YDKA 4EUYA 3P90A 5GSTA 3A2XA 3GSTA 1EZKA 4CHSA 3TKQA 4ECJA 1GUHA 1MDIA 4L5OA 5CP1A 3IR4A 2HZFA 2PGTA 5D96A 1KTEA 3L0HA 1N2AA 1OC9A 2V32A 1JLVA 1EOHA 3F4TA 4TR1A 4NV5A 1Z7RA 2YV7A 1CQGA 1EGOA 2LJRA 1N8JA 1GTBA 4YAPA 5HR1A 3FZAA 4KGIA 3EVIA 2AAWA 5HFGA 1K0OA 1XVWA 2CV4A 4HJ2A 2JZTA 4K7IA 2VLVA 3WGDA 4KSOA 3E9JB 3DD3A 1F37A 4V2LA 3PR8A 5G1KA 4Q5NA 3ERWA 2E7PA 4MLYA 2IIYA 14GSA 3DRNA 1X5EA 2C80A 1FOVA 4POBA 3GH6A 3ZITA 2R37A 5H5SA 2YJHA 2KHPA 2HZEB 2YWNA 1F6MC 2MMAA 3TKSC 4KDXA 1MEKA 1ZZYA 4Q5FA 1XOAA 2L4QA 2YNXA 2GLRA 5ECLB 4FQUA 2B5XA 2WZ9A 3VWWA 4O92A 2LNTA 5H5QA 2R3XA 3VPTA 4HOJA 3LSZA 3HHVA 3WGXA 3HXSA 4MF6A 2LJAA 3FY7A 2YCDA 4ML6A 2VLUA 1PA3A 5CAXA 3FZ9A 4K2DA 1GSEA 4HUAA 2ZNMA 1AW9A 5D9TA 2KP2A 4PGTA 1K3LA 1VF4A 4FYCA 4XIHA 1B4QA 2L6CA 5DAKA 2HSNB 1T00A 3GNJA 5CNWA 1PGTA 1IYHA 4GF0A 2VOCA 1TTZA 5D93A 3ED3A 3IOSA 5G31A 2P5RA 1TXXA 4MJCA 4ZBAA 3KCMA 2OADA 4I8BA 3ZZXA 2L57A 1SL2B 4OO5A 4O5RA 1G0TA 2FA4A 1B9XC 3UIWA 2XBIA 4KX4A 1TI3A 2LJKA 2BTOT 4YH2A 4IP1A 5J9CA 3FHKA 2FWHA 1WWJA 2CQ9A 2B6MA 3UVTA 1SYRA 3EC3A 4WEYA 2DJ0A 1EEMA 1M2BA 2FWGA 3GL5A 3L4NA 1O81A 1GSFA 1GNWA 1R5PA 3UBLA 1E2YA 1W4VA 2WB9A 2LTKA 2FY6A 1FO5A 1ZOFA 1SENA 4WR4A 1X9SB 4LL1B 2K8SA 4GCIA 3EMPA 4DSQA 2CVKA 4OCEA 3UAPA 4ZB9A 1A0RP 2VL3A 3CBUA 1O73A 3D21A 4TW5A 3DVWA 1AAZA 2FCHA 1K3YA 4BL7B 5EPFA 2IMIA 3FR6A 5H5RA 1PKWA 2R6KA 1Z9HA 2KUCA 3F8UA 1H4OA 1SKRB 4GQCA 3DXBA 2A2SA 2B1LA 4V1Ap 4HDEA 3U5RE 1WP0A 3VWUA 4AGSA
chains in the Genus database with same CATH superfamily
4OMVA 4MF5A 1NHYA 3M9KA 2HRKA 3D22A 3ME7A 3ZL5A 4MZBA 4EL1A 2NTOA 4J56E 3W8SA 2P31A 10GSA 6GSVA 2H0GA 1K0MA 1U3AA 3UOMA 3KXOA 2K9FA 4KUNA 4ZB8A 3DKSA 5KN0A 1SK1A 6GSUA 3A3TA 3RHCA 5JWOB 1GSQA 5DQYA 6GSTA 1XBSA 4ZB7A 2PU9C 3IC8A 5FT3A 4QMKA 5J47A 2GSTA 2VKZG 5IMAA 2H66A 2XHFA 4IHUA 3KZQA 2R0GA 1Z6MA 4GSNA 4G0KA 1X5CA 4IJ3A 4N3ZA 3HZ4A 1QUWA 5ECIB 4MPGA 2JU5A 2LQQA 1JLWA 2EIQA 4KW6A 4GQFA 2KP1A 2H72A 4PNGA 1FVJA 5KN1A 2C0FA 2MZCA 4MPFA 4ZILA 1XWBA 1SKWB 1XWKA 4TOPA 3DVXA 19GSA 3I6AA 1SK0A 4XS1A 4H86A 4OFMA 3EE2A 4F2IA 2H75A 4IN0A 4JRRA 4HZ2A 1U6TA 3QAVA 1YEXA 4RQRA 13GSA 1MD3A 4TXOA 2GDRA 4WR5A 1U88A 1V40A 5IMFA 2EIRA 4P3YB 2VCQA 1PFOA 3UEMA 1BYEA 2UZ8A 2C3NA 2N5FA 4NV2A 5DQSA 3Q18A 4JR4A 5G1LA 1GSYA 1ZYEA 2H01A 1O7UA 3WT2A 2YANA 1OC9B 4MJEA 4DVCA 1R26A 4OCFA 4TR1B 5HR2A 2ZCTA 5AIVA 4K8MA 5G30A 2OKAA 4FYUA 3TKPA 2GQLA 1T1VA 2WCIA 3CMIA 4Z7XA 1MD4A 1J9BA 2XPEA 3F9UA 2QKEA 3LGCA 1GUMA 7GSSA 3QOUA 3Q19A 4ZBDA 2IMFA 5J4UA 3GN3A 3I69A 3GX0A 3HCZA 4TVEA 4KA0A 5B8AA 2GVPA 2NDOA 3N5OA 5C04A 2GZYA 5D9XA 3UL3A 3KTLA 3EWLA 3KIJA 2PVQA 2J9HA 3VI7A 2GSSA 1YKCA 1FB6A 1FHEA 3RHBA 2UV8G 2MBTA 1A24A 1GSSA 1M2DA 3ERFA 3MAKA 1OE7A 1ERWA 5LCZA 5CREA 4XHMA 5JCGA 2YJ7A 3GUSA 2CT6A 3C73A 2DBCA 2WW2A 2K18A 1T8EB 2VIMA 4AKIA 4YAVA 5DCHA 2K8VA 1G6YA 3A2VA 2JZSA 2B3SA 5KN2A 4MZWA 12GSA 2IFQA 1Y6EA 1ERUA 5ECSA 5A4VA 2R0PA 2YWIA 4IBPA 1HQOA 1O6JA 5AIXA 5AISA 4HZ4A 1B48A 6GSSA 3E0UA 3P8WA 3HMJG 1EGRA 1EV4A 3M3MA 2V2GA 5DAKB 1YZXA 5GSSA 1F3BA 1SK2A 1XW9A 1YVLA 3HYPA 2LUSA 3HD5A 3BOAA 3ISOA 3F4RA 3TKRA 4E8HA 3CTFA 1U87A 1GSUA 2B5EA 2GZPA 3IC4A 3QAWA 3BCIA 3GKMA 3IXRA 1R4WA 3EU4A 1RW1A 4JEDA 1TI1A 4IS0A 1OC3A 2M72A 1NW2A 5E59A 1H75A 2HRAA 3WYWA 5A4UA 3QDNA 2IMKA 4IJIA 1GTIA 4PQHA 3HA9A 5C00A 3EMXA 5A5HA 3LG6A 2IMDA 1AC1A 2YPMA 3NOFA 3ZLPA 1E6BA 1GULA 5D9VA 3VI5A 1FB0A 3QR6A 4X1UA 3ZYWA 1OAZA 2VUPA 1UA5A 5DCGA 2X49A 5EY6A 5A1NA 1PN9A 1XWCA 2L6DA 1EV9A 5GAPD 3VLNA 2GQKA 2G0FA 3D0ZA 5J41A 4K7OA 3R3EA 2R4VA 3NZNA 3S9FA 2HFDA 4MNNA 4EVMA 1JZDA 2YP6A 3TRQA 2H73A 1GUKA 4EDYA 4DSRA 1G6WA 4V2NA 5KOWA 4LLRA 5DVBA 1C72A 5DALA 5F8BA 4N11A 3KH9A 2EFCA 2H0IA 1M3IA 1GTAA 2LRCA 5KOXA 1LBKA 3LJRA 1A23A 5HFKA 2JSZA 3FR3A 1FW1A 1A2JA 3APSA 1PSQA 2H71A 2GT6A 5AN1A 3GKNA 1MTCA 2HRKB 1UN2A 4PURA 2VCTA 1LJRA 4BVYB 2VAFA 2WULA 4BA7A 3RPPA 1W89A 1THXA 3DGQA 2YOIA 4DSSA 1GRXA 5CO3A 2C0GA 2C0EA 3C1RA 3TCOA 1XXUA 3P2AA 4KNDA 5CRDA 1AQVA 5ELAA 4MMMA 1FG4A 3CTGA 2PERA 1A8YA 5IOWA 2WVYA 2H6XA 1XOBA 2G2QA 4AKHA 2H6ZA 1VF2A 4YKFA 5ECHB 4BVXA 2OBIA 4TRXA 2IWTA 2QA1A 5J3RA 3IK7A 2C1YA 3CYNA 3M8NA 5BRTA 1EWXA 1O8XA 2IMEA 3RGBC 2GSRA 1F2EA 4TXVA 5DDLA 5JWRB 4RQXA 4PHZC 4GWRA 4BWSA 4OFTA 5FWGA 4KCAA 1ZYPA 3APQA 4KSMA 3H79A 3C8EA 2F3MA 3TJGA 3GH9A 4X4JA 4MZCA 5ID2A 2FUG2 1YF1A 2VM2A 2DJ1A 3CSHA 4HU7A 3GURA 4NHWA 4K6XA 5CRGA 3KP8A 3ZRDA 4HSCX 2B7KA 2ZUPA 3KP9A 3RBTA 3C71A 2R0CA 1VGLA 3GTUA 3LW9A 2REMA 2GS3A 4X43A 3L78A 2KOKA 2OE1A 3KH7A 1WOUA 2QSIA 4ULXA 4TXOB 4POMA 4K9ZA 3L9SA 3UBKA 1ZYNA 3DMLA 1NHOA 1GH2A 1Z5YE 1Q98A 2OA7A 4OFNA 1Z6NA 1V57A 2HI7A 1OKTA 1TU8A 1TRUA 1T7PB 1NSWA 2AUVA 2HSMA 1WIKA 3TU3B 4IW9A 4I97A 2JZRA 2H1BA 5B6NA 4NWYA 1K0AA 3ZVJD 2DJ2A 2DC5A 1QQ2A 3K8NA 4G19A 4GSTA 2HLSA 1B8XA 2PMTA 2JACA 2I9HA 3JCML 3HY2A 1NM3A 3PH9A 2N5AA 3FYGA 1ERTA 1M9BA 4KE3A 3HDCA 3TJBA 2X8HA 1VF3A 5BMUA 3QD9A 1KBNA 2WFCA 2LRTA 5HQPA 3LORA 3TKSE 4IELA 1ML6A 2WRTA 2P5QA 4ISDA 3F3QA 3F63A 4EF0A 1MDKA 4RI6A 1VF1A 1O85A 1V2AA 4KF9A 2FGXA 2KLXA 1X0RA 1JZWA 2JADA 2O85A 4NMUA 1T4ZA 1YY7A 1F9MA 5A5KA 1B4PA 1EP7A 3BD2A 3TRXA 4ZBBA 1OC8A 3HVSA 1M9AA 1YKAA 2D2ZA 4BWQA 4EO3A 1I9DA 3ME8A 4ZL7A 1G7EA 3UMAA 4FH8A 1K0CA 3Q6OA 3LYPA 4FYBA 2HRFA 1XWGA 2DMMA 3MDKA 4IGJA 1XPVA 4EXJA 2AJQB 4EC0A 4TR0A 1SL0B 2V6OA 1FVKA 2OJLA 1TRSA 5ELGA 1AUCA 22GSA 3IK9A 4IKHA 3TJJA 1AQXA 2HQTA 4FIWA 1HNCA 5HR0A 1TJDA 2WZSA 1GLPA 2C8UA 2IFQB 1O8WA 3F4SA 6GSXA 3GSSA 3O3TA 3ZMKA 2QGVA 3GMFA 1DSBA 1ZL9A 3GRXA 4AJ6A 4XS6A 2YN1A 1EEJA 3APOA 2CX4A 4J2FA 1T3BA 5DJLA 2HYXA 3MWHA 4ZB6A 2GSQA 4GTUA 5IIZA 2VD0A 3MNGA 2O89A 2H0HA 4PXOA 2VM1A 1M0UA 4I2UA 4G9HA 2NBSA 2O87A 5CRWA 4XCSA 2BMXA 4TN8A 1K0DA 4Q5QA 4MK3A 1XWAA 3H93A 2ES7A 4ML1A 5FHIA 2MMNA 4XS4A 1PN0A 9GSSA 4XTSA 2L4CA 4HQSA 11GSA 2OE3A 1YEWC 3F3RA 1DE2A 1BX9A 1R5AA 1PX7A 4IQ1A 5A5HB 3Q74A 1BG1A 3G7YA 2LS5A 3F0IA 5HR3A 5COHA 3QAGA 2RM5A 4HQZA 3DIEA 2VL2A 1WRYA 1KEBA 3GHAA 4HU9A 1X9WB 1BJXA 3TJFA 1OYJA 5A1NB 2DKIA 2X99A 4K5RA 2WJUA 1QFNA 5DJMA 2TRXA 4CW9A 5E4WA 2HSHA 4K5SA 3HVVA 2C3QA 2ALBA 1A0FA 1YJ6A 3ZFBA 3BCKA 3G7IA 2WDUA 1PKZA 1M2AA 2L5LA 3A5WA 4QL9A 2CZ2A 1SD8A 2CVDA 1A8LA 5IMCA 4O5UA 3H8QA 1GWCA 3FKFA 1THOA 5DALB 2E2MA 3V1WA 2OBKA 3LEFA 1BAYA 3IA1A 1GSDA 5LD0A 4MH2A 2PPTA 1PRXA 3GFKA 4ECIA 4AKGA 2VLTA 1X5DA 4KDUA 2H30A 4JE1A 1X9MB 2DJKA 5F0GA 2AYTA 1V9WA 4EE0A 2CA8A 2VL9A 4PQ1A 4D73A 2H74A 4L8EA 2H1DA 1RK4A 3FZ5A 3WGEA 1WJKA 2QA2A 4ZIJA 1GTUA 1TK5B 1TOFA 3KJYA 1WE0A 2B5YA 2TIRA 3E3EA 2TRCP 3HJMA 3KM6A 4DSSB 3UARA 1XCCA 2I4AA 4KH7A 5INYA 4G0IA 1J0FA 1QK8A 1JZRA 5JWQB 2A4VA 2O8VB 3CQFA 3TRPA 3CSIA 1ILOA 1OVNA 3GKKA 5B8BA 3C1SA 3TUEA 2GTUA 5F05A 2JL4A 2XC2A 1V58A 4X0XA 4BVXB 4KDYA 3TOTA 1Y25A 2HSYA 3EPTA 1K3OA 4ECCA 2IPAA 5KEJA 5IO2A 2H1AA 4XRDA 5ECMB 3IHGA 4N0VA 3CRUA 4G0LA 1SD9A 4TR3A 2DIZA 2CX3A 3SWLA 3FW2A 4GXZA 1Q4JA 1V98A 2R2JA 1M3JA 1ST9A 1GLQA 2WS2A 1IYIA 2JSYA 5ID2B 1ZMAA 3VWVA 1SVOA 4A5PA 5B7CA 4XRAA 4Q5RA 5ENUA 4YKGA 1FOHA 3SBCA 2EFHA 1K0NA 2WVXB 4IVFA 3G7JA 3NIVA 4OD7A 1AIUA 2I1UA 3OR5A 2HNLA 3GTUB 2EC4A 2CAQA 2RIIA 2C0DA 2VCXA 4IP6A 2O7KA 3F6DA 2DLXA 3KD0A 4I2TA 3P7XA 4N10A 1Z3EA 1PMTA 2HSMB 4MCUA 4O7HA 5G5EA 1TU7A 4LL4B 3ZVJA 3QCPA 4MA9A 3ZIJA 2YZHA 4MP4A 1USBA 4WBJA 2L5OA 3KGKA 3D4MA 4K0GA 4POLA 3LQ7A 3QMXA 1SU9A 2K6VA 1HNBA 2PN8A 2YWMA 4G2EA 5BMUB 3CRTA 1OE8A 4WF5A 2V1MA 5D8IA 1SJIA 1TP9A 1HNAA 3FR9A 3A5IA 3DWVA 3L9UA 4MH3A 4RI7A 1I1IP 4GSSA 4KCEA 2O3EA 1TRVA 3ERGA 1BF5A 2IJYA 2GQMA 5B6MA 2ON7A 4WXTA 5J40A 3EYTA 1GL8A 2J23A 3U6VA 4CY6A 4WF4A 3CHXC 2WW1A 3LWAA 1OKDA 3HJOA 2F8AA 1J08A 1XZOA 2R5GA 5LNKe 4F0BA 3BBYA 4CY8A 1JHBA 4PTSA 3MYDA 20GSA 17GSA 1FAAA 3HKRA 4ZXGA 2LNSA 5JCWA 4F82A 2LEGA 5GZZB 5HFIA 4EIPA 3EURA 4L0UA 4F9ZA 4L5LA 4USSA 2NPBA 1Y1UA 4KAEA 3GA4A 2PBJA 4I5QA 16GSA 3ZMLA 1HYUA 4JZQA 1M7TA 2A4HA 2RM6A 4L0WA 3PINA 3EINA 3ZREA 1A2MA 3VK9A 2FLSA 1ZYQB 2DIYA 4N30A 3A2WA 1MDJA 2X8CA 1S3RA 3M1GA 3J7Yb 3O6TA 3FK8A 1TKDB 1SYXA 2HT9A 2H8LA 1SL1B 1JFUA 2VL2C 2VO4A 2LKUA 1PQNA 2HXKA 2L59A 3J7Yk 2QC7A 2A2PA 2O5VA 4N0ZA 4J57E 3FMWA 4PUAA 3PPUA 5ECNB 1YEPA 2E2GA 4ILFA 5ECPB 2VCWA 5IPGA 3W8JA 2B1KA 4XS4B 5J9BA 2WGRA 2E0QA 2H6YA 2F8FA 5IMZA 2DJ3A 1ACVA 4JR6A 4ZL9A 4ACSA 3O76A 1JZOA 3ZFLA 1I5GA 3I43A 3US3A 4Z2UA 1B9YC 5A34A 2HZEA 3AY8A 1R7HA 1Z7PA 2FNOA 2H76A 1SJZA 1XFLA 3TB2A 1GP1A 4LMWA 4AF2A 1VRSD 2H19A 5J5NA 1PX6A 1K0BA 3LXTA 1SJ6A 4MABA 2RUEA 2YZUA 4PI2C 3N9JA 2WW0A 3QFBC 4MJAA 4PX1A 3RPNA 3QFAC 1S3CA 2LQOA 4EKZA 2FWFA 4O32A 3HVXA 2X4AA 5D73A 3IDVA 3IPZA 4BVYA 3UJ1A 4JU5A 2OE0A 3VFIA 2LRNA 5GAND 2X8GA 5A4WA 4OWYA 3C7MA 4WETA 3LYKA 3KMNA 3TKSA 4JBBA 4PQIA 2DMLA 4ZL8A 1M99A 4AJ7A 4NPBA 4D73B 4ECBA 2P0GA 2HSNA 2GZZA 1BEDA 3W6GA 3KTBA 3IE3A 1URMA 4HJMA 2PVOC 4K2XA 1HD2A 1YQ1A 3FEUA 5ECOB 2XPDA 2C4JA 4K0NA 2DJJA 2DSAA 4AI6A 2M80A 4DEJA 1AQWA 4YQUA 4V2MA 1ABAA 2MBSA 2VD1A 3ZTLA 4V1Ag 3TJKA 5G5FA 2H1GA 5CYYA 4PUFC 2HRNA 1PD21 3VWXA 3QPMA 3H1NA 1XW5A 2M46A 3DEXA 3LFLA 1TK0B 2V41A 3TDGA 1ERVA 5IPHA 3GV1A 3IRAA 2A2RA 4POKA 3D6IA 1XVQA 1BQ7A 4QQ7A 4W66A 4YQMA 1G7OA 2HE3A 4MJBA 4HEA2 3HZ8A 1EP8A 2OACA 3WT1A 2VCVA 2XBQA 1RQMA 1UC7A 3CWGA 1UVZA 6GSYA 5IO0A 4GDFA 1PL2A 3G9BA 1CQHA 2AV4A 4NHZA 2Z9SA 4LA1A 1EOGA 3CXGA 1QMVA 5IQYA 5IM9A 5JCUA 3RFRC 2YV9A 3KEBA 4LMVA 4NXIA 4EIQA 5IOXA 2VCZA 2FD3A 8GSSA 5CRHA 2CZ3A 2I81A 4ICYA 4BL7A 1A2LA 4RUVA 1QGVA 4CDOA 5J4YA 5F07A 3BJ5A 4TR4A 2DKHA 2V6KA 3IBHA 2IL3A 4MDCA 5EL8A 5F06A 2X64A 2FA8A 2NVLA 4MF7A 5ECKB 3DYRA 4HI7A 3I9V2 2LV3A 1ZCPA 2F9SA 4F0CA 1TK8B 1LU4A 1WPIA 4G10A 2CAIA 4WBRD 3FZ4A 1DBYA 3IAM2 4QL7A 5D9WA 3F6FA 3RDWA 3M9JA 3EU3A 2MMZA 2PUKC 3GL3A 4EDZA 5ECRB 3IV4A 1ZGNA 4FXYP 2EIOA 2H70A 4E8EA 3KMOA 3GX8A 4HS1A 1T4YA 2C3TA 4KB3A 4AJ8A 4BPYA 4TKYA 4OO4A 3RAZA 4FO5A 5EVOA 3MSZA 1KNGA 3M0FA 3VURA 3VPQA 2FWEA 5DBQA 3IAS2 3HVNA 3GIXA 3PGTA 5AGYA 3HJPA 3GKXA 2ON5A 1WMJA 3UVHA 3WD6A 2F51A 2PWJA 1DE1A 1TRWA 4PNFA 1GNEA 5IMDA 3TOUA 2FHEA 3D5JA 3IHQA 2MYGA 2BJXA 2GGTA 4GRFA 1PL1A 2AHEA 1XIYA 1AXDA 1QXHA 4K1FA 3L9VA 5KN3A 2IN3A 2YWOA 1ON4A 5ABRA 3CSJA 3ZIVA 4YQVA 2MMOA 4ID0A 3R2QA 3H4KA 5L71A 4F03A 2I3YA 2B7JA 5G2ZA 4Z2RA 5ECQB 4WKWA 1XW6A 4NAXA 4K7NA 1F3AA 3FRCA 2RLIA 2AB6A 2EFDA 2CVBA 2GT5A 5IMVA 1S3DA 3D4TA 6GSWA 18GSA 1DUGA 2LSTA 4GLTA 4I6XA 1SKSB 2N5BA 1TDIA 1S3AA 1BG5A 4IQAA 1YF0A 3TGZA 1TW9A 2RUFA 3GYKA 1U3IA 3LXZA 1YDKA 4EUYA 3P90A 5GSTA 3A2XA 3GSTA 1EZKA 4CHSA 3TKQA 4ECJA 1GUHA 1SVLA 1MDIA 4L5OA 5CP1A 3IR4A 2HZFA 2PGTA 5D96A 1KTEA 3L0HA 1N2AA 1OC9A 2V32A 1JLVA 1EOHA 3F4TA 4TR1A 4NV5A 1Z7RA 2YV7A 1CQGA 1EGOA 1S4BP 2LJRA 1N8JA 1GTBA 4YAPA 5HR1A 3FZAA 4KGIA 3EVIA 2AAWA 5HFGA 1K0OA 1XVWA 2CV4A 4HJ2A 2JZTA 4K7IA 2VLVA 3WGDA 4KSOA 3E9JB 3DD3A 1F37A 2WVZA 4V2LA 3PR8A 5J4VA 5G1KA 3ERWA 2WW3A 4Q5NA 2E7PA 4MLYA 2H1LA 2IIYA 14GSA 3DRNA 1X5EA 2C80A 1FOVA 4POBA 3GH6A 3ZITA 2R37A 5H5SA 2YJHA 5A34B 2KHPA 2HZEB 2YWNA 1F6MC 1XG8A 2MMAA 3TKSC 4KDXA 1MEKA 1ZZYA 4Q5FA 1XOAA 2L4QA 2YNXA 2GLRA 5ECLB 4FQUA 2B5XA 2WZ9A 3VWWA 4O92A 2LNTA 1SVMA 5H5QA 2R3XA 3VPTA 4O5QA 4HOJA 4E68A 3LSZA 3HHVA 3WGXA 3HXSA 4MF6A 2O36A 2LJAA 3FY7A 2YCDA 2EFEA 1TXUA 4ML6A 2VLUA 1PA3A 5CAXA 3FZ9A 4K2DA 1GSEA 4HUAA 2ZNMA 1AW9A 5D9TA 4PI0C 2KP2A 4PGTA 1K3LA 1VF4A 4FYCA 4XIHA 1B4QA 2L6CA 5DAKA 2HSNB 4G01A 1T00A 3GNJA 5CNWA 1PGTA 1IYHA 4GF0A 2VOCA 1TTZA 5D93A 3ED3A 3IOSA 5G31A 2P5RA 1TXXA 4MJCA 4ZBAA 3KCMA 2OADA 4I8BA 3ZZXA 2L57A 1SL2B 4OO5A 4O5RA 1G0TA 2FA4A 1B9XC 4Z2TA 3UIWA 2XBIA 4KX4A 1TI3A 2LJKA 2BTOT 4YH2A 1N25A 4IP1A 5J9CA 3FHKA 4AKXB 3MIXA 2FWHA 2OT3A 1WWJA 4BIKA 2CQ9A 2B6MA 3UVTA 1SYRA 3EC3A 4WEYA 2DJ0A 1EEMA 2WVXA 1M2BA 2FWGA 3GL5A 3L4NA 1O81A 1GSFA 1GNWA 1R5PA 3UBLA 1E2YA 1W4VA 2WB9A 2LTKA 2FY6A 1FO5A 1ZOFA 1SENA 4WR4A 1X9SB 4LL1B 2K8SA 4GCIA 3EMPA 4DSQA 2CVKA 4OCEA 3UAPA 4ZB9A 1A0RP 2VL3A 3CBUA 1O73A 3D21A 4TW5A 3DVWA 1AAZA 2FCHA 1K3YA 4BL7B 5EPFA 2IMIA 3FR6A 5H5RA 1PKWA 2R6KA 1Z9HA 2KUCA 3F8UA 1H4OA 1SKRB 4GQCA 3DXBA 2A2SA 2B1LA 4V1Ap 4HDEA 3U5RE 1WP0A 3VWUA 4AGSA
chains in the Genus database with same CATH topology
4OMVA 4MF5A 1NHYA 3M9KA 2HRKA 3D22A 3ME7A 3ZL5A 4MZBA 4EL1A 2NTOA 4J56E 3W8SA 2P31A 10GSA 6GSVA 2H0GA 1K0MA 1U3AA 3UOMA 3KXOA 2K9FA 4KUNA 4ZB8A 3DKSA 5KN0A 1SK1A 6GSUA 3A3TA 3RHCA 5JWOB 1GSQA 5DQYA 6GSTA 1XBSA 4ZB7A 2PU9C 3IC8A 5FT3A 4QMKA 5J47A 2GSTA 2VKZG 5IMAA 2H66A 2XHFA 4IHUA 3KZQA 2R0GA 1Z6MA 4GSNA 4G0KA 1X5CA 4IJ3A 4N3ZA 3HZ4A 1QUWA 5ECIB 4MPGA 2JU5A 2LQQA 1JLWA 2EIQA 4KW6A 4GQFA 2KP1A 2H72A 4PNGA 1FVJA 5KN1A 2C0FA 2MZCA 4MPFA 4ZILA 1XWBA 1SKWB 1XWKA 4TOPA 3DVXA 19GSA 3I6AA 1SK0A 4XS1A 4H86A 4OFMA 3EE2A 4F2IA 2H75A 4IN0A 4JRRA 4HZ2A 1U6TA 3QAVA 1YEXA 4RQRA 13GSA 1MD3A 4TXOA 2GDRA 4WR5A 1U88A 1V40A 5IMFA 2EIRA 4P3YB 2VCQA 3UEMA 1BYEA 2UZ8A 2C3NA 2N5FA 4NV2A 5DQSA 3Q18A 4JR4A 5G1LA 1GSYA 1ZYEA 2H01A 1O7UA 3WT2A 2YANA 1OC9B 4MJEA 4DVCA 1R26A 4OCFA 4TR1B 5HR2A 2ZCTA 5AIVA 4K8MA 5G30A 2OKAA 4FYUA 3TKPA 2GQLA 1T1VA 2WCIA 3CMIA 4Z7XA 1MD4A 1J9BA 2XPEA 3F9UA 2QKEA 3LGCA 1GUMA 7GSSA 3QOUA 3Q19A 4ZBDA 2IMFA 5J4UA 3GN3A 3I69A 3GX0A 3HCZA 4TVEA 4KA0A 5B8AA 2GVPA 2NDOA 3N5OA 5C04A 2GZYA 5D9XA 3UL3A 3KTLA 3EWLA 3KIJA 2PVQA 2J9HA 3VI7A 2GSSA 1YKCA 1FB6A 1FHEA 3RHBA 2UV8G 2MBTA 1A24A 1GSSA 1M2DA 3ERFA 3MAKA 1OE7A 1ERWA 5LCZA 5CREA 4XHMA 5JCGA 2YJ7A 3GUSA 2CT6A 3C73A 2DBCA 2K18A 1T8EB 2VIMA 4AKIA 4YAVA 5DCHA 2K8VA 1G6YA 3A2VA 2JZSA 2B3SA 5KN2A 4MZWA 12GSA 2IFQA 1Y6EA 1ERUA 5ECSA 5A4VA 2R0PA 2YWIA 4IBPA 1HQOA 1O6JA 5AIXA 5AISA 4HZ4A 1B48A 6GSSA 3E0UA 3P8WA 3HMJG 1EGRA 1EV4A 3M3MA 2V2GA 5DAKB 1YZXA 5GSSA 1F3BA 1SK2A 1XW9A 1YVLA 3HYPA 2LUSA 3HD5A 3BOAA 3ISOA 3F4RA 3TKRA 4E8HA 3CTFA 1U87A 1GSUA 2B5EA 2GZPA 3IC4A 3QAWA 3BCIA 3GKMA 3IXRA 1R4WA 3EU4A 1RW1A 4JEDA 1TI1A 4IS0A 1OC3A 2M72A 1NW2A 5E59A 1H75A 2HRAA 3WYWA 5A4UA 3QDNA 2IMKA 4IJIA 1GTIA 4PQHA 3HA9A 5C00A 3EMXA 5A5HA 3LG6A 2IMDA 1AC1A 2YPMA 3NOFA 3ZLPA 1E6BA 1GULA 5D9VA 3VI5A 1FB0A 3QR6A 4X1UA 3ZYWA 1OAZA 2VUPA 1UA5A 5DCGA 2X49A 5EY6A 5A1NA 1PN9A 1XWCA 2L6DA 1EV9A 5GAPD 3VLNA 2GQKA 2G0FA 3D0ZA 5J41A 4K7OA 3R3EA 2R4VA 3NZNA 3S9FA 2HFDA 4MNNA 4EVMA 1JZDA 2YP6A 3TRQA 2H73A 1GUKA 4EDYA 4DSRA 1G6WA 4V2NA 5KOWA 4LLRA 5DVBA 1C72A 5DALA 5F8BA 4N11A 3KH9A 2EFCA 2H0IA 1GTAA 2LRCA 5KOXA 1LBKA 3LJRA 1A23A 5HFKA 2JSZA 3FR3A 1FW1A 1A2JA 3APSA 1PSQA 2H71A 2GT6A 5AN1A 3GKNA 1MTCA 2HRKB 1UN2A 4PURA 2VCTA 1LJRA 4BVYB 2VAFA 2WULA 4BA7A 3RPPA 1W89A 1THXA 3DGQA 2YOIA 4DSSA 1GRXA 5CO3A 2C0GA 2C0EA 3C1RA 3TCOA 1XXUA 3P2AA 4KNDA 5CRDA 1AQVA 5ELAA 4MMMA 1FG4A 3CTGA 2PERA 1A8YA 5IOWA 2H6XA 1XOBA 2G2QA 4AKHA 2H6ZA 1VF2A 4YKFA 5ECHB 4BVXA 2OBIA 4TRXA 2IWTA 2QA1A 5J3RA 3IK7A 2C1YA 3CYNA 3M8NA 5BRTA 1EWXA 1O8XA 2IMEA 2GSRA 1F2EA 4TXVA 5DDLA 5JWRB 4RQXA 4GWRA 4BWSA 4OFTA 5FWGA 4KCAA 1ZYPA 3APQA 4KSMA 3H79A 3C8EA 2F3MA 3TJGA 3GH9A 4X4JA 4MZCA 5ID2A 2FUG2 1YF1A 2VM2A 2DJ1A 3CSHA 4HU7A 3GURA 4NHWA 4K6XA 5CRGA 3KP8A 3ZRDA 2B7KA 2ZUPA 3KP9A 3RBTA 3C71A 2R0CA 1VGLA 3GTUA 3LW9A 2REMA 2GS3A 4X43A 3L78A 2KOKA 2OE1A 3KH7A 1WOUA 2QSIA 4ULXA 4TXOB 4POMA 4K9ZA 3L9SA 3UBKA 1ZYNA 3DMLA 1NHOA 1GH2A 1Z5YE 1Q98A 2OA7A 4OFNA 1Z6NA 1V57A 2HI7A 1OKTA 1TU8A 1TRUA 1T7PB 1NSWA 2AUVA 2HSMA 1WIKA 3TU3B 4IW9A 4I97A 2JZRA 2H1BA 5B6NA 4NWYA 1K0AA 3ZVJD 2DJ2A 2DC5A 1QQ2A 3K8NA 4G19A 4GSTA 2HLSA 1B8XA 2PMTA 2JACA 2I9HA 3JCML 3HY2A 1NM3A 3PH9A 2N5AA 3FYGA 1ERTA 1M9BA 4KE3A 3HDCA 3TJBA 2X8HA 1VF3A 5BMUA 3QD9A 1KBNA 2WFCA 2LRTA 5HQPA 3LORA 3TKSE 4IELA 1ML6A 2WRTA 2P5QA 4ISDA 3F3QA 3F63A 4EF0A 1MDKA 4RI6A 1VF1A 1O85A 1V2AA 4KF9A 2FGXA 2KLXA 1X0RA 1JZWA 2JADA 2O85A 4NMUA 1T4ZA 1YY7A 1F9MA 5A5KA 1B4PA 1EP7A 3BD2A 3TRXA 4ZBBA 1OC8A 3HVSA 1M9AA 1YKAA 2D2ZA 4BWQA 4EO3A 1I9DA 3ME8A 4ZL7A 1G7EA 3UMAA 4FH8A 1K0CA 3Q6OA 3LYPA 4FYBA 2HRFA 1XWGA 2DMMA 3MDKA 4IGJA 1XPVA 4EXJA 2AJQB 4EC0A 4TR0A 1SL0B 2V6OA 1FVKA 2OJLA 1TRSA 5ELGA 1AUCA 22GSA 3IK9A 4IKHA 3TJJA 1AQXA 2HQTA 4FIWA 1HNCA 5HR0A 1TJDA 1GLPA 2C8UA 2IFQB 1O8WA 3F4SA 6GSXA 3GSSA 3O3TA 3ZMKA 2QGVA 3GMFA 1DSBA 1ZL9A 3GRXA 4AJ6A 4XS6A 2YN1A 1EEJA 3APOA 2CX4A 4J2FA 1T3BA 5DJLA 2HYXA 3MWHA 4ZB6A 2GSQA 4GTUA 5IIZA 2VD0A 3MNGA 2O89A 2H0HA 4PXOA 2VM1A 1M0UA 4I2UA 4G9HA 2NBSA 2O87A 5CRWA 4XCSA 2BMXA 4TN8A 1K0DA 4Q5QA 4MK3A 1XWAA 3H93A 2ES7A 4ML1A 5FHIA 2MMNA 4XS4A 1PN0A 9GSSA 4XTSA 2L4CA 4HQSA 11GSA 2OE3A 3F3RA 1DE2A 1BX9A 1R5AA 1PX7A 4IQ1A 5A5HB 3Q74A 1BG1A 3G7YA 2LS5A 3F0IA 5HR3A 5COHA 3QAGA 2RM5A 4HQZA 3DIEA 2VL2A 1WRYA 1KEBA 3GHAA 4HU9A 1X9WB 1BJXA 3TJFA 1OYJA 5A1NB 2DKIA 2X99A 4K5RA 2WJUA 1QFNA 5DJMA 2TRXA 4CW9A 5E4WA 2HSHA 4K5SA 3HVVA 2C3QA 2ALBA 1A0FA 1YJ6A 3ZFBA 3BCKA 3G7IA 2WDUA 1PKZA 1M2AA 2L5LA 3A5WA 4QL9A 2CZ2A 1SD8A 2CVDA 1A8LA 5IMCA 4O5UA 3H8QA 1GWCA 3FKFA 1THOA 5DALB 2E2MA 3V1WA 2OBKA 3LEFA 1BAYA 3IA1A 1GSDA 5LD0A 4MH2A 2PPTA 1PRXA 3GFKA 4ECIA 4AKGA 2VLTA 1X5DA 4KDUA 2H30A 4JE1A 1X9MB 2DJKA 5F0GA 2AYTA 1V9WA 4EE0A 2CA8A 2VL9A 4PQ1A 4D73A 2H74A 4L8EA 2H1DA 1RK4A 3FZ5A 3WGEA 1WJKA 2QA2A 4ZIJA 1GTUA 1TK5B 1TOFA 3KJYA 1WE0A 2B5YA 2TIRA 3E3EA 2TRCP 3HJMA 3KM6A 4DSSB 3UARA 1XCCA 2I4AA 4KH7A 5INYA 4G0IA 1J0FA 1QK8A 1JZRA 5JWQB 2A4VA 2O8VB 3TRPA 3CSIA 1ILOA 1OVNA 3GKKA 5B8BA 3C1SA 3TUEA 2GTUA 5F05A 2JL4A 2XC2A 1V58A 4X0XA 4BVXB 4KDYA 3TOTA 1Y25A 2HSYA 3EPTA 1K3OA 4ECCA 2IPAA 5KEJA 5IO2A 2H1AA 4XRDA 5ECMB 3IHGA 4N0VA 3CRUA 4G0LA 1SD9A 4TR3A 2DIZA 2CX3A 3SWLA 3FW2A 4GXZA 1Q4JA 1V98A 2R2JA 1ST9A 1GLQA 2WS2A 1IYIA 2JSYA 5ID2B 1ZMAA 3VWVA 1SVOA 4A5PA 5B7CA 4XRAA 4Q5RA 5ENUA 4YKGA 1FOHA 3SBCA 2EFHA 1K0NA 4IVFA 3G7JA 3NIVA 4OD7A 1AIUA 2I1UA 3OR5A 2HNLA 3GTUB 2EC4A 2CAQA 2RIIA 2C0DA 2VCXA 4IP6A 2O7KA 3F6DA 2DLXA 3KD0A 4I2TA 3P7XA 4N10A 1Z3EA 1PMTA 2HSMB 4MCUA 4O7HA 5G5EA 1TU7A 4LL4B 3ZVJA 3QCPA 4MA9A 3ZIJA 2YZHA 4MP4A 1USBA 4WBJA 2L5OA 3KGKA 3D4MA 4K0GA 4POLA 3LQ7A 3QMXA 1SU9A 2K6VA 1HNBA 2PN8A 2YWMA 4G2EA 5BMUB 3CRTA 1OE8A 4WF5A 2V1MA 5D8IA 1SJIA 1TP9A 1HNAA 3FR9A 3A5IA 3DWVA 3L9UA 4MH3A 4RI7A 4GSSA 4KCEA 1TRVA 3ERGA 1BF5A 2IJYA 2GQMA 5B6MA 2ON7A 4WXTA 5J40A 3EYTA 1GL8A 2J23A 3U6VA 4CY6A 4WF4A 3LWAA 1OKDA 3HJOA 2F8AA 1J08A 1XZOA 2R5GA 5LNKe 4F0BA 3BBYA 4CY8A 1JHBA 4PTSA 3MYDA 20GSA 17GSA 1FAAA 3HKRA 4ZXGA 2LNSA 5JCWA 4F82A 2LEGA 5GZZB 5HFIA 4EIPA 3EURA 4L0UA 4F9ZA 4L5LA 4USSA 2NPBA 1Y1UA 4KAEA 3GA4A 2PBJA 4I5QA 16GSA 3ZMLA 1HYUA 4JZQA 1M7TA 2A4HA 2RM6A 4L0WA 3PINA 3EINA 3ZREA 1A2MA 3VK9A 2FLSA 1ZYQB 2DIYA 4N30A 3A2WA 1MDJA 2X8CA 3M1GA 3J7Yb 3O6TA 3FK8A 1TKDB 1SYXA 2HT9A 2H8LA 1SL1B 1JFUA 2VL2C 2VO4A 2LKUA 1PQNA 2HXKA 2L59A 3J7Yk 2QC7A 2A2PA 2O5VA 4N0ZA 4J57E 3FMWA 4PUAA 3PPUA 5ECNB 1YEPA 2E2GA 4ILFA 5ECPB 2VCWA 5IPGA 3W8JA 2B1KA 4XS4B 5J9BA 2WGRA 2E0QA 2H6YA 2F8FA 5IMZA 2DJ3A 1ACVA 4JR6A 4ZL9A 4ACSA 3O76A 1JZOA 3ZFLA 1I5GA 3I43A 3US3A 4Z2UA 1B9YC 5A34A 2HZEA 3AY8A 1R7HA 1Z7PA 2FNOA 2H76A 1SJZA 1XFLA 3TB2A 1GP1A 4LMWA 4AF2A 1VRSD 2H19A 5J5NA 1PX6A 1K0BA 3LXTA 1SJ6A 4MABA 2RUEA 2YZUA 3N9JA 3QFBC 4MJAA 4PX1A 3RPNA 3QFAC 1S3CA 2LQOA 4EKZA 2FWFA 4O32A 3HVXA 2X4AA 5D73A 3IDVA 3IPZA 4BVYA 3UJ1A 4JU5A 2OE0A 3VFIA 2LRNA 5GAND 2X8GA 5A4WA 4OWYA 3C7MA 4WETA 3LYKA 3KMNA 3TKSA 4JBBA 4PQIA 2DMLA 4ZL8A 1M99A 4AJ7A 4NPBA 4D73B 4ECBA 2P0GA 2HSNA 2GZZA 1BEDA 3W6GA 3KTBA 3IE3A 1URMA 4HJMA 2PVOC 4K2XA 1HD2A 1YQ1A 3FEUA 5ECOB 2XPDA 2C4JA 4K0NA 2DJJA 2DSAA 4AI6A 2M80A 4DEJA 1AQWA 4YQUA 4V2MA 1ABAA 2MBSA 2VD1A 3ZTLA 4V1Ag 3TJKA 5G5FA 2H1GA 5CYYA 4PUFC 2HRNA 1PD21 3VWXA 3QPMA 3H1NA 1XW5A 2M46A 3DEXA 3LFLA 1TK0B 2V41A 3TDGA 1ERVA 5IPHA 3GV1A 3IRAA 2A2RA 4POKA 3D6IA 1XVQA 1BQ7A 4QQ7A 4W66A 4YQMA 1G7OA 2HE3A 4MJBA 4HEA2 3HZ8A 1EP8A 2OACA 3WT1A 2VCVA 2XBQA 1RQMA 1UC7A 3CWGA 1UVZA 6GSYA 5IO0A 4GDFA 1PL2A 3G9BA 1CQHA 2AV4A 4NHZA 2Z9SA 4LA1A 1EOGA 3CXGA 1QMVA 5IQYA 5IM9A 5JCUA 2YV9A 3KEBA 4LMVA 4NXIA 4EIQA 5IOXA 2VCZA 2FD3A 8GSSA 5CRHA 2CZ3A 2I81A 4ICYA 4BL7A 1A2LA 4RUVA 1QGVA 4CDOA 5J4YA 5F07A 3BJ5A 4TR4A 2DKHA 2V6KA 3IBHA 2IL3A 4MDCA 5EL8A 5F06A 2X64A 2FA8A 2NVLA 4MF7A 5ECKB 3DYRA 4HI7A 3I9V2 2LV3A 1ZCPA 2F9SA 4F0CA 1TK8B 1LU4A 1WPIA 4G10A 2CAIA 4WBRD 3FZ4A 1DBYA 3IAM2 4QL7A 5D9WA 3F6FA 3RDWA 3M9JA 3EU3A 2MMZA 2PUKC 3GL3A 4EDZA 5ECRB 3IV4A 1ZGNA 2H70A 2EIOA 4E8EA 3KMOA 3GX8A 4HS1A 1T4YA 2C3TA 4KB3A 4AJ8A 4BPYA 4TKYA 4OO4A 3RAZA 4FO5A 5EVOA 3MSZA 1KNGA 3M0FA 3VURA 3VPQA 2FWEA 5DBQA 3IAS2 3GIXA 3PGTA 5AGYA 3HJPA 3GKXA 2ON5A 1WMJA 3UVHA 3WD6A 2F51A 2PWJA 1DE1A 1TRWA 4PNFA 1GNEA 5IMDA 3TOUA 2FHEA 3D5JA 3IHQA 2MYGA 2BJXA 2GGTA 4GRFA 1PL1A 2AHEA 1XIYA 1AXDA 1QXHA 4K1FA 3L9VA 5KN3A 2IN3A 2YWOA 1ON4A 5ABRA 3CSJA 3ZIVA 4YQVA 2MMOA 4ID0A 3R2QA 3H4KA 5L71A 4F03A 2I3YA 2B7JA 5G2ZA 4Z2RA 5ECQB 4WKWA 1XW6A 4NAXA 4K7NA 1F3AA 3FRCA 2RLIA 2AB6A 2EFDA 2CVBA 2GT5A 5IMVA 1S3DA 3D4TA 6GSWA 18GSA 1DUGA 2LSTA 4GLTA 4I6XA 1SKSB 2N5BA 1TDIA 1S3AA 1BG5A 4IQAA 1YF0A 3TGZA 1TW9A 2RUFA 3GYKA 1U3IA 3LXZA 1YDKA 4EUYA 3P90A 5GSTA 3A2XA 3GSTA 1EZKA 4CHSA 3TKQA 4ECJA 1GUHA 1SVLA 1MDIA 4L5OA 5CP1A 3IR4A 2HZFA 2PGTA 5D96A 1KTEA 3L0HA 1N2AA 1OC9A 2V32A 1JLVA 1EOHA 3F4TA 4TR1A 4NV5A 1Z7RA 2YV7A 1CQGA 1EGOA 2LJRA 1N8JA 1GTBA 4YAPA 5HR1A 3FZAA 4KGIA 3EVIA 2AAWA 5HFGA 1K0OA 1XVWA 2CV4A 4HJ2A 2JZTA 4K7IA 2VLVA 3WGDA 4KSOA 3E9JB 3DD3A 1F37A 4V2LA 3PR8A 5J4VA 5G1KA 4Q5NA 3ERWA 2E7PA 4MLYA 2H1LA 2IIYA 14GSA 3DRNA 1X5EA 2C80A 1FOVA 4POBA 3GH6A 3ZITA 2R37A 5H5SA 2YJHA 5A34B 2KHPA 2HZEB 2YWNA 1F6MC 2MMAA 3TKSC 4KDXA 1MEKA 1ZZYA 4Q5FA 1XOAA 2L4QA 2YNXA 2GLRA 5ECLB 4FQUA 2B5XA 2WZ9A 3VWWA 4O92A 2LNTA 1SVMA 5H5QA 2R3XA 3VPTA 4O5QA 4HOJA 4E68A 3LSZA 3HHVA 3WGXA 3HXSA 4MF6A 2LJAA 3FY7A 2YCDA 2EFEA 1TXUA 4ML6A 2VLUA 1PA3A 5CAXA 3FZ9A 4K2DA 1GSEA 4HUAA 2ZNMA 1AW9A 5D9TA 2KP2A 4PGTA 1K3LA 1VF4A 4FYCA 4XIHA 1B4QA 2L6CA 5DAKA 2HSNB 4G01A 1T00A 3GNJA 5CNWA 1PGTA 1IYHA 4GF0A 2VOCA 1TTZA 5D93A 3ED3A 3IOSA 5G31A 2P5RA 1TXXA 4MJCA 4ZBAA 3KCMA 2OADA 4I8BA 3ZZXA 2L57A 1SL2B 4OO5A 4O5RA 1G0TA 2FA4A 1B9XC 4Z2TA 3UIWA 2XBIA 4KX4A 1TI3A 2LJKA 2BTOT 4YH2A 1N25A 4IP1A 5J9CA 3FHKA 4AKXB 3MIXA 2FWHA 2OT3A 1WWJA 2CQ9A 2B6MA 3UVTA 1SYRA 3EC3A 4WEYA 2DJ0A 1EEMA 1M2BA 2FWGA 3GL5A 3L4NA 1O81A 1GSFA 1GNWA 1R5PA 3UBLA 1E2YA 1W4VA 2WB9A 2LTKA 2FY6A 1FO5A 1ZOFA 1SENA 4WR4A 1X9SB 4LL1B 2K8SA 4GCIA 3EMPA 4DSQA 2CVKA 4OCEA 3UAPA 4ZB9A 1A0RP 2VL3A 3CBUA 1O73A 3D21A 4TW5A 3DVWA 1AAZA 2FCHA 1K3YA 4BL7B 5EPFA 2IMIA 3FR6A 5H5RA 1PKWA 2R6KA 1Z9HA 2KUCA 3F8UA 1H4OA 1SKRB 4GQCA 3DXBA 2A2SA 2B1LA 4V1Ap 4HDEA 3U5RE 1WP0A 3VWUA 4AGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMV A;  4MF5 A;  1NHY A;  3M9K A;  2HRK A;  3D22 A;  3ME7 A;  3ZL5 A;  4MZB A;  4EL1 A;  2NTO A;  4J56 E;  3W8S A;  2P31 A;  10GS A;  6GSV A;  2H0G A;  1K0M A;  1U3A A;  3UOM A;  3KXO A;  2K9F A;  4KUN A;  4ZB8 A;  3DKS A;  5KN0 A;  1SK1 A;  6GSU A;  3A3T A;  3RHC A;  5JWO B;  1GSQ A;  5DQY A;  6GST A;  1XBS A;  2PU9 C;  3IC8 A;  5FT3 A;  2GST A;  5IMA A;  2H66 A;  2XHF A;  4IHU A;  3KZQ A;  1Z6M A;  4GSN A;  4G0K A;  1X5C A;  4IJ3 A;  3HZ4 A;  1QUW A;  5ECI B;  4MPG A;  2JU5 A;  2LQQ A;  1JLW A;  2EIQ A;  4KW6 A;  4GQF A;  2KP1 A;  2H72 A;  4PNG A;  1FVJ A;  5KN1 A;  2C0F A;  2MZC A;  4MPF A;  4ZIL A;  1XWB A;  1SKW B;  1XWK A;  4TOP A;  3DVX A;  19GS A;  3I6A A;  1SK0 A;  4XS1 A;  4H86 A;  4OFM A;  3EE2 A;  4F2I A;  2H75 A;  4IN0 A;  4JRR A;  4HZ2 A;  1U6T A;  3QAV A;  1YEX A;  4RQR A;  13GS A;  1MD3 A;  4TXO A;  2GDR A;  4WR5 A;  1U88 A;  1V40 A;  5IMF A;  2EIR A;  4P3Y B;  2VCQ A;  3UEM A;  1BYE A;  2UZ8 A;  2C3N A;  2N5F A;  4NV2 A;  5DQS A;  3Q18 A;  4JR4 A;  5G1L A;  1GSY A;  1ZYE A;  2H01 A;  1O7U A;  3WT2 A;  2YAN A;  1OC9 B;  4MJE A;  4DVC A;  1R26 A;  4OCF A;  4TR1 B;  5HR2 A;  2ZCT A;  5AIV A;  4K8M A;  5G30 A;  2OKA A;  4FYU A;  3TKP A;  2GQL A;  1T1V A;  2WCI A;  3CMI A;  4Z7X A;  1MD4 A;  1J9B A;  2XPE A;  3F9U A;  2QKE A;  3LGC A;  1GUM A;  7GSS A;  3QOU A;  3Q19 A;  4ZBD A;  2IMF A;  5J4U A;  3GN3 A;  3I69 A;  3GX0 A;  3HCZ A;  4TVE A;  4KA0 A;  5B8A A;  2GVP A;  2NDO A;  3N5O A;  5C04 A;  2GZY A;  5D9X A;  3UL3 A;  3KTL A;  3EWL A;  3KIJ A;  2PVQ A;  2J9H A;  3VI7 A;  2GSS A;  1YKC A;  1FB6 A;  1FHE A;  3RHB A;  2MBT A;  1A24 A;  1GSS A;  1M2D A;  3ERF A;  3MAK A;  1OE7 A;  1ERW A;  5LCZ A;  5CRE A;  4XHM A;  5JCG A;  2YJ7 A;  3GUS A;  2CT6 A;  3C73 A;  2DBC A;  2K18 A;  1T8E B;  2VIM A;  4YAV A;  5DCH A;  2K8V A;  1G6Y A;  3A2V A;  2JZS A;  2B3S A;  5KN2 A;  4MZW A;  12GS A;  2IFQ A;  1Y6E A;  1ERU A;  5ECS A;  5A4V A;  2YWI A;  4IBP A;  1HQO A;  1O6J A;  5AIX A;  5AIS A;  4HZ4 A;  1B48 A;  6GSS A;  3E0U A;  3P8W A;  1EGR A;  1EV4 A;  3M3M A;  2V2G A;  5DAK B;  1YZX A;  5GSS A;  1F3B A;  1SK2 A;  1XW9 A;  3HYP A;  2LUS A;  3HD5 A;  3BOA A;  3ISO A;  3F4R A;  3TKR A;  4E8H A;  3CTF A;  1U87 A;  1GSU A;  2B5E A;  2GZP A;  3IC4 A;  3QAW A;  3BCI A;  3GKM A;  3IXR A;  1R4W A;  3EU4 A;  1RW1 A;  4JED A;  1TI1 A;  4IS0 A;  1OC3 A;  2M72 A;  1NW2 A;  5E59 A;  1H75 A;  2HRA A;  3WYW A;  5A4U A;  3QDN A;  2IMK A;  4IJI A;  1GTI A;  4PQH A;  3HA9 A;  5C00 A;  3EMX A;  3LG6 A;  2IMD A;  1AC1 A;  2YPM A;  3NOF A;  3ZLP A;  1E6B A;  1GUL A;  5D9V A;  3VI5 A;  1FB0 A;  3QR6 A;  4X1U A;  3ZYW A;  1OAZ A;  2VUP A;  1UA5 A;  5DCG A;  5EY6 A;  1PN9 A;  1XWC A;  2L6D A;  1EV9 A;  5GAP D;  3VLN A;  2GQK A;  2G0F A;  3D0Z A;  5J41 A;  4K7O A;  3R3E A;  2R4V A;  3NZN A;  3S9F A;  2HFD A;  4EVM A;  1JZD A;  2YP6 A;  3TRQ A;  2H73 A;  1GUK A;  4EDY A;  4DSR A;  1G6W A;  4V2N A;  4LLR A;  5DVB A;  1C72 A;  5DAL A;  5F8B A;  4N11 A;  3KH9 A;  2H0I A;  1GTA A;  2LRC A;  1LBK A;  3LJR A;  1A23 A;  5HFK A;  2JSZ A;  3FR3 A;  1FW1 A;  1A2J A;  3APS A;  1PSQ A;  2H71 A;  2GT6 A;  5AN1 A;  3GKN A;  1MTC A;  2HRK B;  1UN2 A;  4PUR A;  2VCT A;  1LJR A;  4BVY B;  2VAF A;  2WUL A;  4BA7 A;  3RPP A;  1W89 A;  1THX A;  3DGQ A;  2YOI A;  4DSS A;  1GRX A;  5CO3 A;  2C0G A;  2C0E A;  3C1R A;  3TCO A;  1XXU A;  3P2A A;  4KND A;  5CRD A;  1AQV A;  5ELA A;  4MMM A;  1FG4 A;  3CTG A;  2PER A;  1A8Y A;  5IOW A;  2H6X A;  1XOB A;  2G2Q A;  2H6Z A;  1VF2 A;  5ECH B;  4BVX A;  2OBI A;  4TRX A;  2IWT A;  5J3R A;  3IK7 A;  2C1Y A;  3CYN A;  3M8N A;  1EWX A;  1O8X A;  2IME A;  2GSR A;  1F2E A;  4TXV A;  5DDL A;  5JWR B;  4RQX A;  4GWR A;  4BWS A;  4OFT A;  5FWG A;  4KCA A;  3APQ A;  4KSM A;  3H79 A;  3C8E A;  2F3M A;  3TJG A;  3GH9 A;  4MZC A;  5ID2 A;  2FUG 2;  1YF1 A;  2VM2 A;  2DJ1 A;  3CSH A;  4HU7 A;  3GUR A;  4NHW A;  4K6X A;  5CRG A;  3KP8 A;  3ZRD A;  2B7K A;  2ZUP A;  3KP9 A;  3RBT A;  3C71 A;  1VGL A;  3GTU A;  2REM A;  2GS3 A;  4X43 A;  3L78 A;  2KOK A;  2OE1 A;  3KH7 A;  1WOU A;  2QSI A;  4ULX A;  4TXO B;  4POM A;  4K9Z A;  3L9S A;  3UBK A;  3DML A;  1NHO A;  1GH2 A;  1Z5Y E;  1Q98 A;  2OA7 A;  4OFN A;  1Z6N A;  1V57 A;  2HI7 A;  1OKT A;  1TU8 A;  1TRU A;  1T7P B;  1NSW A;  2AUV A;  2HSM A;  1WIK A;  4IW9 A;  4I97 A;  2JZR A;  2H1B A;  5B6N A;  4NWY A;  1K0A A;  3ZVJ D;  2DJ2 A;  2DC5 A;  1QQ2 A;  3K8N A;  4G19 A;  4GST A;  2HLS A;  1B8X A;  2PMT A;  2JAC A;  2I9H A;  3JCM L;  3HY2 A;  1NM3 A;  3PH9 A;  2N5A A;  3FYG A;  1ERT A;  1M9B A;  4KE3 A;  3HDC A;  3TJB A;  2X8H A;  1VF3 A;  5BMU A;  3QD9 A;  1KBN A;  2WFC A;  2LRT A;  5HQP A;  3LOR A;  3TKS E;  4IEL A;  1ML6 A;  2WRT A;  2P5Q A;  4ISD A;  3F3Q A;  3F63 A;  4EF0 A;  1MDK A;  4RI6 A;  1VF1 A;  1O85 A;  1V2A A;  4KF9 A;  2FGX A;  2KLX A;  1X0R A;  1JZW A;  2JAD A;  2O85 A;  4NMU A;  1T4Z A;  1YY7 A;  1F9M A;  5A5K A;  1B4P A;  1EP7 A;  3BD2 A;  3TRX A;  4ZBB A;  1OC8 A;  3HVS A;  1M9A A;  1YKA A;  2D2Z A;  4BWQ A;  4EO3 A;  1I9D A;  3ME8 A;  4ZL7 A;  1G7E A;  3UMA A;  4FH8 A;  1K0C A;  3Q6O A;  3LYP A;  4FYB A;  2HRF A;  1XWG A;  2DMM A;  3MDK A;  4IGJ A;  1XPV A;  4EXJ A;  2AJQ B;  4EC0 A;  4TR0 A;  1SL0 B;  2V6O A;  1FVK A;  2OJL A;  1TRS A;  5ELG A;  1AUC A;  22GS A;  3IK9 A;  4IKH A;  3TJJ A;  1AQX A;  2HQT A;  4FIW A;  1HNC A;  5HR0 A;  1TJD A;  1GLP A;  2C8U A;  2IFQ B;  1O8W A;  3F4S A;  6GSX A;  3GSS A;  3O3T A;  3ZMK A;  2QGV A;  1DSB A;  3GMF A;  1ZL9 A;  3GRX A;  4AJ6 A;  4XS6 A;  2YN1 A;  1EEJ A;  3APO A;  2CX4 A;  4J2F A;  1T3B A;  5DJL A;  2HYX A;  3MWH A;  4ZB6 A;  2GSQ A;  4GTU A;  5IIZ A;  2VD0 A;  3MNG A;  2O89 A;  2H0H A;  4PXO A;  2VM1 A;  1M0U A;  4I2U A;  4G9H A;  2NBS A;  2O87 A;  5CRW A;  4XCS A;  2BMX A;  4TN8 A;  1K0D A;  4Q5Q A;  4MK3 A;  1XWA A;  3H93 A;  2ES7 A;  4ML1 A;  5FHI A;  2MMN A;  4XS4 A;  9GSS A;  4XTS A;  2L4C A;  4HQS A;  11GS A;  2OE3 A;  3F3R A;  1DE2 A;  1BX9 A;  1R5A A;  1PX7 A;  4IQ1 A;  3Q74 A;  3G7Y A;  2LS5 A;  3F0I A;  5HR3 A;  5COH A;  3QAG A;  2RM5 A;  4HQZ A;  3DIE A;  2VL2 A;  1WRY A;  1KEB A;  3GHA A;  4HU9 A;  1X9W B;  1BJX A;  3TJF A;  1OYJ A;  2X99 A;  2WJU A;  1QFN A;  5DJM A;  2TRX A;  4CW9 A;  5E4W A;  2HSH A;  3HVV A;  2C3Q A;  2ALB A;  1A0F A;  1YJ6 A;  3ZFB A;  3BCK A;  3G7I A;  2WDU A;  1PKZ A;  1M2A A;  2L5L A;  3A5W A;  4QL9 A;  2CZ2 A;  1SD8 A;  2CVD A;  1A8L A;  5IMC A;  3H8Q A;  1GWC A;  3FKF A;  1THO A;  5DAL B;  2E2M A;  3V1W A;  2OBK A;  3LEF A;  1BAY A;  3IA1 A;  1GSD A;  5LD0 A;  4MH2 A;  2PPT A;  1PRX A;  3GFK A;  4ECI A;  2VLT A;  1X5D A;  4KDU A;  2H30 A;  4JE1 A;  1X9M B;  2DJK A;  5F0G A;  2AYT A;  1V9W A;  4EE0 A;  2CA8 A;  2VL9 A;  4PQ1 A;  4D73 A;  2H74 A;  4L8E A;  2H1D A;  1RK4 A;  3FZ5 A;  3WGE A;  1WJK A;  4ZIJ A;  1GTU A;  1TK5 B;  1TOF A;  3KJY A;  1WE0 A;  2B5Y A;  2TIR A;  3E3E A;  2TRC P;  3HJM A;  3KM6 A;  4DSS B;  3UAR A;  1XCC A;  2I4A A;  4KH7 A;  5INY A;  4G0I A;  1J0F A;  1QK8 A;  1JZR A;  5JWQ B;  2A4V A;  2O8V B;  3TRP A;  3CSI A;  1ILO A;  1OVN A;  3GKK A;  5B8B A;  3C1S A;  3TUE A;  2GTU A;  5F05 A;  2JL4 A;  2XC2 A;  1V58 A;  4X0X A;  4BVX B;  4KDY A;  3TOT A;  1Y25 A;  2HSY A;  1K3O A;  4ECC A;  2IPA A;  5KEJ A;  5IO2 A;  2H1A A;  4XRD A;  5ECM B;  4N0V A;  3CRU A;  4G0L A;  1SD9 A;  4TR3 A;  2DIZ A;  2CX3 A;  3SWL A;  3FW2 A;  4GXZ A;  1Q4J A;  1V98 A;  2R2J A;  1ST9 A;  1GLQ A;  2WS2 A;  1IYI A;  2JSY A;  5ID2 B;  1ZMA A;  3VWV A;  5B7C A;  4XRA A;  4Q5R A;  5ENU A;  3SBC A;  1K0N A;  4IVF A;  3G7J A;  3NIV A;  4OD7 A;  1AIU A;  2I1U A;  3OR5 A;  2HNL A;  3GTU B;  2EC4 A;  2CAQ A;  2RII A;  2C0D A;  2VCX A;  4IP6 A;  2O7K A;  3F6D A;  2DLX A;  3KD0 A;  4I2T A;  3P7X A;  4N10 A;  1Z3E A;  1PMT A;  2HSM B;  4MCU A;  4O7H A;  5G5E A;  1TU7 A;  4LL4 B;  3ZVJ A;  3QCP A;  4MA9 A;  3ZIJ A;  2YZH A;  4MP4 A;  1USB A;  4WBJ A;  2L5O A;  3KGK A;  3D4M A;  4K0G A;  4POL A;  3LQ7 A;  3QMX A;  1SU9 A;  2K6V A;  1HNB A;  2PN8 A;  2YWM A;  4G2E A;  3CRT A;  1OE8 A;  4WF5 A;  2V1M A;  5D8I A;  1SJI A;  1TP9 A;  1HNA A;  3FR9 A;  4MH3 A;  3DWV A;  3L9U A;  4RI7 A;  4GSS A;  4KCE A;  1TRV A;  3ERG A;  2IJY A;  2GQM A;  5B6M A;  2ON7 A;  4WXT A;  3EYT A;  1GL8 A;  2J23 A;  3U6V A;  4WF4 A;  3LWA A;  1OKD A;  3HJO A;  2F8A A;  1J08 A;  1XZO A;  2R5G A;  5LNK e;  4F0B A;  3BBY A;  1JHB A;  4PTS A;  20GS A;  17GS A;  1FAA A;  3HKR A;  4ZXG A;  2LNS A;  5JCW A;  4F82 A;  2LEG A;  5GZZ B;  5HFI A;  3EUR A;  4L0U A;  4F9Z A;  4L5L A;  4USS A;  2NPB A;  4KAE A;  3GA4 A;  2PBJ A;  4I5Q A;  16GS A;  3ZML A;  1HYU A;  4JZQ A;  1M7T A;  2RM6 A;  4L0W A;  3PIN A;  3EIN A;  3ZRE A;  1A2M A;  3VK9 A;  2FLS A;  1ZYQ B;  2DIY A;  4N30 A;  3A2W A;  1MDJ A;  2X8C A;  3M1G A;  3J7Y b;  3O6T A;  3FK8 A;  1TKD B;  1SYX A;  2HT9 A;  2H8L A;  1SL1 B;  1JFU A;  2VL2 C;  2VO4 A;  2LKU A;  1PQN A;  2HXK A;  2L59 A;  3J7Y k;  2QC7 A;  4N0Z A;  4J57 E;  4PUA A;  3PPU A;  5ECN B;  1YEP A;  2E2G A;  4ILF A;  5ECP B;  2VCW A;  5IPG A;  3W8J A;  2B1K A;  4XS4 B;  5J9B A;  2WGR A;  2E0Q A;  2H6Y A;  2F8F A;  5IMZ A;  2DJ3 A;  1ACV A;  4JR6 A;  4ZL9 A;  4ACS A;  3O76 A;  1JZO A;  3ZFL A;  1I5G A;  3I43 A;  3US3 A;  1B9Y C;  2HZE A;  3AY8 A;  1R7H A;  1Z7P A;  2FNO A;  2H76 A;  1SJZ A;  1XFL A;  3TB2 A;  1GP1 A;  4LMW A;  4AF2 A;  1VRS D;  2H19 A;  5J5N A;  1PX6 A;  1K0B A;  3LXT A;  1SJ6 A;  4MAB A;  2RUE A;  2YZU A;  3N9J A;  3QFB C;  4MJA A;  4PX1 A;  3RPN A;  3QFA C;  1S3C A;  2LQO A;  4EKZ A;  2FWF A;  4O32 A;  3HVX A;  5D73 A;  3IDV A;  3IPZ A;  4BVY A;  3UJ1 A;  4JU5 A;  2OE0 A;  3VFI A;  2LRN A;  5GAN D;  2X8G A;  5A4W A;  4OWY A;  3C7M A;  4WET A;  3LYK A;  3KMN A;  3TKS A;  4JBB A;  4PQI A;  2DML A;  4ZL8 A;  1M99 A;  4AJ7 A;  4NPB A;  4D73 B;  4ECB A;  2P0G A;  2GZZ A;  1BED A;  3W6G A;  3KTB A;  3IE3 A;  1URM A;  4HJM A;  2PVO C;  1HD2 A;  1YQ1 A;  3FEU A;  5ECO B;  2XPD A;  2C4J A;  4K0N A;  2DJJ A;  2DSA A;  2M80 A;  4DEJ A;  1AQW A;  4YQU A;  4V2M A;  1ABA A;  2MBS A;  2VD1 A;  3ZTL A;  4V1A g;  3TJK A;  5G5F A;  2H1G A;  5CYY A;  4PUF C;  2HRN A;  1PD2 1;  3VWX A;  3QPM A;  3H1N A;  1XW5 A;  2M46 A;  3DEX A;  3LFL A;  1TK0 B;  2V41 A;  3TDG A;  1ERV A;  5IPH A;  3GV1 A;  3IRA A;  2A2R A;  4POK A;  3D6I A;  1XVQ A;  1BQ7 A;  4QQ7 A;  4YQM A;  1G7O A;  2HE3 A;  4MJB A;  4HEA 2;  3HZ8 A;  1EP8 A;  2OAC A;  3WT1 A;  2VCV A;  2XBQ A;  1RQM A;  1UC7 A;  1UVZ A;  6GSY A;  5IO0 A;  1PL2 A;  3G9B A;  1CQH A;  2AV4 A;  4NHZ A;  2Z9S A;  4LA1 A;  1EOG A;  3CXG A;  1QMV A;  5IQY A;  5IM9 A;  5JCU A;  2YV9 A;  3KEB A;  4LMV A;  4NXI A;  5IOX A;  2VCZ A;  2FD3 A;  8GSS A;  5CRH A;  2CZ3 A;  2I81 A;  4BL7 A;  1A2L A;  4RUV A;  1QGV A;  4CDO A;  5F07 A;  3BJ5 A;  4TR4 A;  2V6K A;  3IBH A;  2IL3 A;  4MDC A;  5EL8 A;  5F06 A;  2X64 A;  2FA8 A;  2NVL A;  4MF7 A;  5ECK B;  3DYR A;  4HI7 A;  3I9V 2;  2LV3 A;  1ZCP A;  2F9S A;  4F0C A;  1TK8 B;  1LU4 A;  1WPI A;  4G10 A;  2CAI A;  4WBR D;  3FZ4 A;  1DBY A;  3IAM 2;  4QL7 A;  5D9W A;  3F6F A;  3RDW A;  3M9J A;  3EU3 A;  2MMZ A;  2PUK C;  3GL3 A;  4EDZ A;  5ECR B;  3IV4 A;  1ZGN A;  2H70 A;  2EIO A;  4E8E A;  3KMO A;  3GX8 A;  4HS1 A;  1T4Y A;  2C3T A;  4KB3 A;  4AJ8 A;  4BPY A;  4TKY A;  4OO4 A;  3RAZ A;  4FO5 A;  5EVO A;  3MSZ A;  1KNG A;  3M0F A;  3VUR A;  3VPQ A;  2FWE A;  5DBQ A;  3IAS 2;  3GIX A;  3PGT A;  5AGY A;  3HJP A;  3GKX A;  2ON5 A;  1WMJ A;  3UVH A;  3WD6 A;  2F51 A;  2PWJ A;  1DE1 A;  1TRW A;  4PNF A;  1GNE A;  5IMD A;  3TOU A;  2FHE A;  3D5J A;  3IHQ A;  2MYG A;  2BJX A;  2GGT A;  4GRF A;  1PL1 A;  2AHE A;  1XIY A;  1AXD A;  1QXH A;  4K1F A;  3L9V A;  5KN3 A;  2IN3 A;  2YWO A;  1ON4 A;  5ABR A;  3CSJ A;  3ZIV A;  4YQV A;  2MMO A;  4ID0 A;  3R2Q A;  3H4K A;  5L71 A;  4F03 A;  2I3Y A;  2B7J A;  5G2Z A;  5ECQ B;  4WKW A;  1XW6 A;  4NAX A;  4K7N A;  1F3A A;  3FRC A;  2RLI A;  2AB6 A;  2GT5 A;  2CVB A;  5IMV A;  1S3D A;  3D4T A;  6GSW A;  18GS A;  1DUG A;  2LST A;  4GLT A;  4I6X A;  1SKS B;  2N5B A;  1TDI A;  1S3A A;  1BG5 A;  4IQA A;  1YF0 A;  3TGZ A;  1TW9 A;  2RUF A;  3GYK A;  1U3I A;  3LXZ A;  1YDK A;  4EUY A;  3P90 A;  5GST A;  3A2X A;  3GST A;  1EZK A;  4CHS A;  3TKQ A;  4ECJ A;  1GUH A;  1MDI A;  4L5O A;  5CP1 A;  3IR4 A;  2HZF A;  2PGT A;  5D96 A;  1KTE A;  3L0H A;  1N2A A;  1OC9 A;  2V32 A;  1JLV A;  1EOH A;  3F4T A;  4TR1 A;  4NV5 A;  1Z7R A;  2YV7 A;  1CQG A;  1EGO A;  2LJR A;  1N8J A;  1GTB A;  4YAP A;  5HR1 A;  3FZA A;  4KGI A;  3EVI A;  2AAW A;  5HFG A;  1K0O A;  1XVW A;  2CV4 A;  4HJ2 A;  2JZT A;  4K7I A;  2VLV A;  3WGD A;  4KSO A;  3E9J B;  3DD3 A;  1F37 A;  4V2L A;  3PR8 A;  5G1K A;  4Q5N A;  3ERW A;  2E7P A;  4MLY A;  2IIY A;  14GS A;  3DRN A;  1X5E A;  2C80 A;  1FOV A;  4POB A;  3GH6 A;  3ZIT A;  2R37 A;  5H5S A;  2YJH A;  2KHP A;  2HZE B;  2YWN A;  1F6M C;  2MMA A;  3TKS C;  4KDX A;  1MEK A;  1ZZY A;  4Q5F A;  1XOA A;  2L4Q A;  2YNX A;  2GLR A;  5ECL B;  4FQU A;  2B5X A;  2WZ9 A;  3VWW A;  4O92 A;  2LNT A;  5H5Q A;  2R3X A;  3VPT A;  4HOJ A;  3LSZ A;  3HHV A;  3WGX A;  3HXS A;  4MF6 A;  2LJA A;  3FY7 A;  2YCD A;  4ML6 A;  2VLU A;  1PA3 A;  5CAX A;  3FZ9 A;  4K2D A;  1GSE A;  4HUA A;  2ZNM A;  1AW9 A;  5D9T A;  2KP2 A;  4PGT A;  1K3L A;  1VF4 A;  4FYC A;  4XIH A;  1B4Q A;  2L6C A;  5DAK A;  2HSN B;  1T00 A;  3GNJ A;  5CNW A;  1PGT A;  1IYH A;  4GF0 A;  2VOC A;  1TTZ A;  5D93 A;  3ED3 A;  3IOS A;  5G31 A;  2P5R A;  1TXX A;  4MJC A;  4ZBA A;  3KCM A;  2OAD A;  4I8B A;  3ZZX A;  2L57 A;  1SL2 B;  4OO5 A;  4O5R A;  1G0T A;  2FA4 A;  1B9X C;  3UIW A;  2XBI A;  4KX4 A;  1TI3 A;  2LJK A;  2BTO T;  4YH2 A;  4IP1 A;  5J9C A;  3FHK A;  2FWH A;  1WWJ A;  2CQ9 A;  2B6M A;  3UVT A;  1SYR A;  3EC3 A;  4WEY A;  2DJ0 A;  1EEM A;  1M2B A;  2FWG A;  3GL5 A;  3L4N A;  1O81 A;  1GSF A;  1GNW A;  1R5P A;  3UBL A;  1E2Y A;  1W4V A;  2WB9 A;  2LTK A;  2FY6 A;  1FO5 A;  1ZOF A;  1SEN A;  4WR4 A;  1X9S B;  4LL1 B;  2K8S A;  4GCI A;  3EMP A;  4DSQ A;  2CVK A;  4OCE A;  3UAP A;  4ZB9 A;  1A0R P;  2VL3 A;  3CBU A;  1O73 A;  3D21 A;  4TW5 A;  3DVW A;  1AAZ A;  2FCH A;  1K3Y A;  4BL7 B;  5EPF A;  2IMI A;  3FR6 A;  5H5R A;  1PKW A;  2R6K A;  1Z9H A;  2KUC A;  3F8U A;  1H4O A;  1SKR B;  4GQC A;  3DXB A;  2A2S A;  2B1L A;  4V1A p;  4HDE A;  3U5R E;  1WP0 A;  3VWU A;  4AGS A; 
#chains in the Genus database with same CATH topology
 4OMV A;  4MF5 A;  1NHY A;  3M9K A;  2HRK A;  3D22 A;  3ME7 A;  3ZL5 A;  4MZB A;  4EL1 A;  2NTO A;  4J56 E;  3W8S A;  2P31 A;  10GS A;  6GSV A;  2H0G A;  1K0M A;  1U3A A;  3UOM A;  3KXO A;  2K9F A;  4KUN A;  4ZB8 A;  3DKS A;  5KN0 A;  1SK1 A;  6GSU A;  3A3T A;  3RHC A;  5JWO B;  1GSQ A;  5DQY A;  6GST A;  1XBS A;  4ZB7 A;  2PU9 C;  3IC8 A;  5FT3 A;  4QMK A;  5J47 A;  2GST A;  2VKZ G;  5IMA A;  2H66 A;  2XHF A;  4IHU A;  3KZQ A;  2R0G A;  1Z6M A;  4GSN A;  4G0K A;  1X5C A;  4IJ3 A;  4N3Z A;  3HZ4 A;  1QUW A;  5ECI B;  4MPG A;  2JU5 A;  2LQQ A;  1JLW A;  2EIQ A;  4KW6 A;  4GQF A;  2KP1 A;  2H72 A;  4PNG A;  1FVJ A;  5KN1 A;  2C0F A;  2MZC A;  4MPF A;  4ZIL A;  1XWB A;  1SKW B;  1XWK A;  4TOP A;  3DVX A;  19GS A;  3I6A A;  1SK0 A;  4XS1 A;  4H86 A;  4OFM A;  3EE2 A;  4F2I A;  2H75 A;  4IN0 A;  4JRR A;  4HZ2 A;  1U6T A;  3QAV A;  1YEX A;  4RQR A;  13GS A;  1MD3 A;  4TXO A;  2GDR A;  4WR5 A;  1U88 A;  1V40 A;  5IMF A;  2EIR A;  4P3Y B;  2VCQ A;  1PFO A;  3UEM A;  1BYE A;  2UZ8 A;  2C3N A;  2N5F A;  4NV2 A;  5DQS A;  3Q18 A;  4JR4 A;  5G1L A;  1GSY A;  1ZYE A;  2H01 A;  1O7U A;  3WT2 A;  2YAN A;  1OC9 B;  4MJE A;  4DVC A;  1R26 A;  4OCF A;  4TR1 B;  5HR2 A;  2ZCT A;  5AIV A;  4K8M A;  5G30 A;  2OKA A;  4FYU A;  3TKP A;  2GQL A;  1T1V A;  2WCI A;  3CMI A;  4Z7X A;  1MD4 A;  1J9B A;  2XPE A;  3F9U A;  2QKE A;  3LGC A;  1GUM A;  7GSS A;  3QOU A;  3Q19 A;  4ZBD A;  2IMF A;  5J4U A;  3GN3 A;  3I69 A;  3GX0 A;  3HCZ A;  4TVE A;  4KA0 A;  5B8A A;  2GVP A;  2NDO A;  3N5O A;  5C04 A;  2GZY A;  5D9X A;  3UL3 A;  3KTL A;  3EWL A;  3KIJ A;  2PVQ A;  2J9H A;  3VI7 A;  2GSS A;  1YKC A;  1FB6 A;  1FHE A;  3RHB A;  2UV8 G;  2MBT A;  1A24 A;  1GSS A;  1M2D A;  3ERF A;  3MAK A;  1OE7 A;  1ERW A;  5LCZ A;  5CRE A;  4XHM A;  5JCG A;  2YJ7 A;  3GUS A;  2CT6 A;  3C73 A;  2DBC A;  2WW2 A;  2K18 A;  1T8E B;  2VIM A;  4AKI A;  4YAV A;  5DCH A;  2K8V A;  1G6Y A;  3A2V A;  2JZS A;  2B3S A;  5KN2 A;  4MZW A;  12GS A;  2IFQ A;  1Y6E A;  1ERU A;  5ECS A;  5A4V A;  2R0P A;  2YWI A;  4IBP A;  1HQO A;  1O6J A;  5AIX A;  5AIS A;  4HZ4 A;  1B48 A;  6GSS A;  3E0U A;  3P8W A;  3HMJ G;  1EGR A;  1EV4 A;  3M3M A;  2V2G A;  5DAK B;  1YZX A;  5GSS A;  1F3B A;  1SK2 A;  1XW9 A;  1YVL A;  3HYP A;  2LUS A;  3HD5 A;  3BOA A;  3ISO A;  3F4R A;  3TKR A;  4E8H A;  3CTF A;  1U87 A;  1GSU A;  2B5E A;  2GZP A;  3IC4 A;  3QAW A;  3BCI A;  3GKM A;  3IXR A;  1R4W A;  3EU4 A;  1RW1 A;  4JED A;  1TI1 A;  4IS0 A;  1OC3 A;  2M72 A;  1NW2 A;  5E59 A;  1H75 A;  2HRA A;  3WYW A;  5A4U A;  3QDN A;  2IMK A;  4IJI A;  1GTI A;  4PQH A;  3HA9 A;  5C00 A;  3EMX A;  5A5H A;  3LG6 A;  2IMD A;  1AC1 A;  2YPM A;  3NOF A;  3ZLP A;  1E6B A;  1GUL A;  5D9V A;  3VI5 A;  1FB0 A;  3QR6 A;  4X1U A;  3ZYW A;  1OAZ A;  2VUP A;  1UA5 A;  5DCG A;  2X49 A;  5EY6 A;  5A1N A;  1PN9 A;  1XWC A;  2L6D A;  1EV9 A;  5GAP D;  3VLN A;  2GQK A;  2G0F A;  3D0Z A;  5J41 A;  4K7O A;  3R3E A;  2R4V A;  3NZN A;  3S9F A;  2HFD A;  4MNN A;  4EVM A;  1JZD A;  2YP6 A;  3TRQ A;  2H73 A;  1GUK A;  4EDY A;  4DSR A;  1G6W A;  4V2N A;  5KOW A;  4LLR A;  5DVB A;  1C72 A;  5DAL A;  5F8B A;  4N11 A;  3KH9 A;  2EFC A;  2H0I A;  1M3I A;  1GTA A;  2LRC A;  5KOX A;  1LBK A;  3LJR A;  1A23 A;  5HFK A;  2JSZ A;  3FR3 A;  1FW1 A;  1A2J A;  3APS A;  1PSQ A;  2H71 A;  2GT6 A;  5AN1 A;  3GKN A;  1MTC A;  2HRK B;  1UN2 A;  4PUR A;  2VCT A;  1LJR A;  4BVY B;  2VAF A;  2WUL A;  4BA7 A;  3RPP A;  1W89 A;  1THX A;  3DGQ A;  2YOI A;  4DSS A;  1GRX A;  5CO3 A;  2C0G A;  2C0E A;  3C1R A;  3TCO A;  1XXU A;  3P2A A;  4KND A;  5CRD A;  1AQV A;  5ELA A;  4MMM A;  1FG4 A;  3CTG A;  2PER A;  1A8Y A;  5IOW A;  2WVY A;  2H6X A;  1XOB A;  2G2Q A;  4AKH A;  2H6Z A;  1VF2 A;  4YKF A;  5ECH B;  4BVX A;  2OBI A;  4TRX A;  2IWT A;  2QA1 A;  5J3R A;  3IK7 A;  2C1Y A;  3CYN A;  3M8N A;  5BRT A;  1EWX A;  1O8X A;  2IME A;  3RGB C;  2GSR A;  1F2E A;  4TXV A;  5DDL A;  5JWR B;  4RQX A;  4PHZ C;  4GWR A;  4BWS A;  4OFT A;  5FWG A;  4KCA A;  1ZYP A;  3APQ A;  4KSM A;  3H79 A;  3C8E A;  2F3M A;  3TJG A;  3GH9 A;  4X4J A;  4MZC A;  5ID2 A;  2FUG 2;  1YF1 A;  2VM2 A;  2DJ1 A;  3CSH A;  4HU7 A;  3GUR A;  4NHW A;  4K6X A;  5CRG A;  3KP8 A;  3ZRD A;  4HSC X;  2B7K A;  2ZUP A;  3KP9 A;  3RBT A;  3C71 A;  2R0C A;  1VGL A;  3GTU A;  3LW9 A;  2REM A;  2GS3 A;  4X43 A;  3L78 A;  2KOK A;  2OE1 A;  3KH7 A;  1WOU A;  2QSI A;  4ULX A;  4TXO B;  4POM A;  4K9Z A;  3L9S A;  3UBK A;  1ZYN A;  3DML A;  1NHO A;  1GH2 A;  1Z5Y E;  1Q98 A;  2OA7 A;  4OFN A;  1Z6N A;  1V57 A;  2HI7 A;  1OKT A;  1TU8 A;  1TRU A;  1T7P B;  1NSW A;  2AUV A;  2HSM A;  1WIK A;  3TU3 B;  4IW9 A;  4I97 A;  2JZR A;  2H1B A;  5B6N A;  4NWY A;  1K0A A;  3ZVJ D;  2DJ2 A;  2DC5 A;  1QQ2 A;  3K8N A;  4G19 A;  4GST A;  2HLS A;  1B8X A;  2PMT A;  2JAC A;  2I9H A;  3JCM L;  3HY2 A;  1NM3 A;  3PH9 A;  2N5A A;  3FYG A;  1ERT A;  1M9B A;  4KE3 A;  3HDC A;  3TJB A;  2X8H A;  1VF3 A;  5BMU A;  3QD9 A;  1KBN A;  2WFC A;  2LRT A;  5HQP A;  3LOR A;  3TKS E;  4IEL A;  1ML6 A;  2WRT A;  2P5Q A;  4ISD A;  3F3Q A;  3F63 A;  4EF0 A;  1MDK A;  4RI6 A;  1VF1 A;  1O85 A;  1V2A A;  4KF9 A;  2FGX A;  2KLX A;  1X0R A;  1JZW A;  2JAD A;  2O85 A;  4NMU A;  1T4Z A;  1YY7 A;  1F9M A;  5A5K A;  1B4P A;  1EP7 A;  3BD2 A;  3TRX A;  4ZBB A;  1OC8 A;  3HVS A;  1M9A A;  1YKA A;  2D2Z A;  4BWQ A;  4EO3 A;  1I9D A;  3ME8 A;  4ZL7 A;  1G7E A;  3UMA A;  4FH8 A;  1K0C A;  3Q6O A;  3LYP A;  4FYB A;  2HRF A;  1XWG A;  2DMM A;  3MDK A;  4IGJ A;  1XPV A;  4EXJ A;  2AJQ B;  4EC0 A;  4TR0 A;  1SL0 B;  2V6O A;  1FVK A;  2OJL A;  1TRS A;  5ELG A;  1AUC A;  22GS A;  3IK9 A;  4IKH A;  3TJJ A;  1AQX A;  2HQT A;  4FIW A;  1HNC A;  5HR0 A;  1TJD A;  2WZS A;  1GLP A;  2C8U A;  2IFQ B;  1O8W A;  3F4S A;  6GSX A;  3GSS A;  3O3T A;  3ZMK A;  2QGV A;  3GMF A;  1DSB A;  1ZL9 A;  3GRX A;  4AJ6 A;  4XS6 A;  2YN1 A;  1EEJ A;  3APO A;  2CX4 A;  4J2F A;  1T3B A;  5DJL A;  2HYX A;  3MWH A;  4ZB6 A;  2GSQ A;  4GTU A;  5IIZ A;  2VD0 A;  3MNG A;  2O89 A;  2H0H A;  4PXO A;  2VM1 A;  1M0U A;  4I2U A;  4G9H A;  2NBS A;  2O87 A;  5CRW A;  4XCS A;  2BMX A;  4TN8 A;  1K0D A;  4Q5Q A;  4MK3 A;  1XWA A;  3H93 A;  2ES7 A;  4ML1 A;  5FHI A;  2MMN A;  4XS4 A;  1PN0 A;  9GSS A;  4XTS A;  2L4C A;  4HQS A;  11GS A;  2OE3 A;  1YEW C;  3F3R A;  1DE2 A;  1BX9 A;  1R5A A;  1PX7 A;  4IQ1 A;  5A5H B;  3Q74 A;  1BG1 A;  3G7Y A;  2LS5 A;  3F0I A;  5HR3 A;  5COH A;  3QAG A;  2RM5 A;  4HQZ A;  3DIE A;  2VL2 A;  1WRY A;  1KEB A;  3GHA A;  4HU9 A;  1X9W B;  1BJX A;  3TJF A;  1OYJ A;  5A1N B;  2DKI A;  2X99 A;  4K5R A;  2WJU A;  1QFN A;  5DJM A;  2TRX A;  4CW9 A;  5E4W A;  2HSH A;  4K5S A;  3HVV A;  2C3Q A;  2ALB A;  1A0F A;  1YJ6 A;  3ZFB A;  3BCK A;  3G7I A;  2WDU A;  1PKZ A;  1M2A A;  2L5L A;  3A5W A;  4QL9 A;  2CZ2 A;  1SD8 A;  2CVD A;  1A8L A;  5IMC A;  4O5U A;  3H8Q A;  1GWC A;  3FKF A;  1THO A;  5DAL B;  2E2M A;  3V1W A;  2OBK A;  3LEF A;  1BAY A;  3IA1 A;  1GSD A;  5LD0 A;  4MH2 A;  2PPT A;  1PRX A;  3GFK A;  4ECI A;  4AKG A;  2VLT A;  1X5D A;  4KDU A;  2H30 A;  4JE1 A;  1X9M B;  2DJK A;  5F0G A;  2AYT A;  1V9W A;  4EE0 A;  2CA8 A;  2VL9 A;  4PQ1 A;  4D73 A;  2H74 A;  4L8E A;  2H1D A;  1RK4 A;  3FZ5 A;  3WGE A;  1WJK A;  2QA2 A;  4ZIJ A;  1GTU A;  1TK5 B;  1TOF A;  3KJY A;  1WE0 A;  2B5Y A;  2TIR A;  3E3E A;  2TRC P;  3HJM A;  3KM6 A;  4DSS B;  3UAR A;  1XCC A;  2I4A A;  4KH7 A;  5INY A;  4G0I A;  1J0F A;  1QK8 A;  1JZR A;  5JWQ B;  2A4V A;  2O8V B;  3CQF A;  3TRP A;  3CSI A;  1ILO A;  1OVN A;  3GKK A;  5B8B A;  3C1S A;  3TUE A;  2GTU A;  5F05 A;  2JL4 A;  2XC2 A;  1V58 A;  4X0X A;  4BVX B;  4KDY A;  3TOT A;  1Y25 A;  2HSY A;  3EPT A;  1K3O A;  4ECC A;  2IPA A;  5KEJ A;  5IO2 A;  2H1A A;  4XRD A;  5ECM B;  3IHG A;  4N0V A;  3CRU A;  4G0L A;  1SD9 A;  4TR3 A;  2DIZ A;  2CX3 A;  3SWL A;  3FW2 A;  4GXZ A;  1Q4J A;  1V98 A;  2R2J A;  1M3J A;  1ST9 A;  1GLQ A;  2WS2 A;  1IYI A;  2JSY A;  5ID2 B;  1ZMA A;  3VWV A;  1SVO A;  4A5P A;  5B7C A;  4XRA A;  4Q5R A;  5ENU A;  4YKG A;  1FOH A;  3SBC A;  2EFH A;  1K0N A;  2WVX B;  4IVF A;  3G7J A;  3NIV A;  4OD7 A;  1AIU A;  2I1U A;  3OR5 A;  2HNL A;  3GTU B;  2EC4 A;  2CAQ A;  2RII A;  2C0D A;  2VCX A;  4IP6 A;  2O7K A;  3F6D A;  2DLX A;  3KD0 A;  4I2T A;  3P7X A;  4N10 A;  1Z3E A;  1PMT A;  2HSM B;  4MCU A;  4O7H A;  5G5E A;  1TU7 A;  4LL4 B;  3ZVJ A;  3QCP A;  4MA9 A;  3ZIJ A;  2YZH A;  4MP4 A;  1USB A;  4WBJ A;  2L5O A;  3KGK A;  3D4M A;  4K0G A;  4POL A;  3LQ7 A;  3QMX A;  1SU9 A;  2K6V A;  1HNB A;  2PN8 A;  2YWM A;  4G2E A;  5BMU B;  3CRT A;  1OE8 A;  4WF5 A;  2V1M A;  5D8I A;  1SJI A;  1TP9 A;  1HNA A;  3FR9 A;  3A5I A;  3DWV A;  3L9U A;  4MH3 A;  4RI7 A;  1I1I P;  4GSS A;  4KCE A;  2O3E A;  1TRV A;  3ERG A;  1BF5 A;  2IJY A;  2GQM A;  5B6M A;  2ON7 A;  4WXT A;  5J40 A;  3EYT A;  1GL8 A;  2J23 A;  3U6V A;  4CY6 A;  4WF4 A;  3CHX C;  2WW1 A;  3LWA A;  1OKD A;  3HJO A;  2F8A A;  1J08 A;  1XZO A;  2R5G A;  5LNK e;  4F0B A;  3BBY A;  4CY8 A;  1JHB A;  4PTS A;  3MYD A;  20GS A;  17GS A;  1FAA A;  3HKR A;  4ZXG A;  2LNS A;  5JCW A;  4F82 A;  2LEG A;  5GZZ B;  5HFI A;  4EIP A;  3EUR A;  4L0U A;  4F9Z A;  4L5L A;  4USS A;  2NPB A;  1Y1U A;  4KAE A;  3GA4 A;  2PBJ A;  4I5Q A;  16GS A;  3ZML A;  1HYU A;  4JZQ A;  1M7T A;  2A4H A;  2RM6 A;  4L0W A;  3PIN A;  3EIN A;  3ZRE A;  1A2M A;  3VK9 A;  2FLS A;  1ZYQ B;  2DIY A;  4N30 A;  3A2W A;  1MDJ A;  2X8C A;  1S3R A;  3M1G A;  3J7Y b;  3O6T A;  3FK8 A;  1TKD B;  1SYX A;  2HT9 A;  2H8L A;  1SL1 B;  1JFU A;  2VL2 C;  2VO4 A;  2LKU A;  1PQN A;  2HXK A;  2L59 A;  3J7Y k;  2QC7 A;  2A2P A;  2O5V A;  4N0Z A;  4J57 E;  3FMW A;  4PUA A;  3PPU A;  5ECN B;  1YEP A;  2E2G A;  4ILF A;  5ECP B;  2VCW A;  5IPG A;  3W8J A;  2B1K A;  4XS4 B;  5J9B A;  2WGR A;  2E0Q A;  2H6Y A;  2F8F A;  5IMZ A;  2DJ3 A;  1ACV A;  4JR6 A;  4ZL9 A;  4ACS A;  3O76 A;  1JZO A;  3ZFL A;  1I5G A;  3I43 A;  3US3 A;  4Z2U A;  1B9Y C;  5A34 A;  2HZE A;  3AY8 A;  1R7H A;  1Z7P A;  2FNO A;  2H76 A;  1SJZ A;  1XFL A;  3TB2 A;  1GP1 A;  4LMW A;  4AF2 A;  1VRS D;  2H19 A;  5J5N A;  1PX6 A;  1K0B A;  3LXT A;  1SJ6 A;  4MAB A;  2RUE A;  2YZU A;  4PI2 C;  3N9J A;  2WW0 A;  3QFB C;  4MJA A;  4PX1 A;  3RPN A;  3QFA C;  1S3C A;  2LQO A;  4EKZ A;  2FWF A;  4O32 A;  3HVX A;  2X4A A;  5D73 A;  3IDV A;  3IPZ A;  4BVY A;  3UJ1 A;  4JU5 A;  2OE0 A;  3VFI A;  2LRN A;  5GAN D;  2X8G A;  5A4W A;  4OWY A;  3C7M A;  4WET A;  3LYK A;  3KMN A;  3TKS A;  4JBB A;  4PQI A;  2DML A;  4ZL8 A;  1M99 A;  4AJ7 A;  4NPB A;  4D73 B;  4ECB A;  2P0G A;  2HSN A;  2GZZ A;  1BED A;  3W6G A;  3KTB A;  3IE3 A;  1URM A;  4HJM A;  2PVO C;  4K2X A;  1HD2 A;  1YQ1 A;  3FEU A;  5ECO B;  2XPD A;  2C4J A;  4K0N A;  2DJJ A;  2DSA A;  4AI6 A;  2M80 A;  4DEJ A;  1AQW A;  4YQU A;  4V2M A;  1ABA A;  2MBS A;  2VD1 A;  3ZTL A;  4V1A g;  3TJK A;  5G5F A;  2H1G A;  5CYY A;  4PUF C;  2HRN A;  1PD2 1;  3VWX A;  3QPM A;  3H1N A;  1XW5 A;  2M46 A;  3DEX A;  3LFL A;  1TK0 B;  2V41 A;  3TDG A;  1ERV A;  5IPH A;  3GV1 A;  3IRA A;  2A2R A;  4POK A;  3D6I A;  1XVQ A;  1BQ7 A;  4QQ7 A;  4W66 A;  4YQM A;  1G7O A;  2HE3 A;  4MJB A;  4HEA 2;  3HZ8 A;  1EP8 A;  2OAC A;  3WT1 A;  2VCV A;  2XBQ A;  1RQM A;  1UC7 A;  3CWG A;  1UVZ A;  6GSY A;  5IO0 A;  4GDF A;  1PL2 A;  3G9B A;  1CQH A;  2AV4 A;  4NHZ A;  2Z9S A;  4LA1 A;  1EOG A;  3CXG A;  1QMV A;  5IQY A;  5IM9 A;  5JCU A;  3RFR C;  2YV9 A;  3KEB A;  4LMV A;  4NXI A;  4EIQ A;  5IOX A;  2VCZ A;  2FD3 A;  8GSS A;  5CRH A;  2CZ3 A;  2I81 A;  4ICY A;  4BL7 A;  1A2L A;  4RUV A;  1QGV A;  4CDO A;  5J4Y A;  5F07 A;  3BJ5 A;  4TR4 A;  2DKH A;  2V6K A;  3IBH A;  2IL3 A;  4MDC A;  5EL8 A;  5F06 A;  2X64 A;  2FA8 A;  2NVL A;  4MF7 A;  5ECK B;  3DYR A;  4HI7 A;  3I9V 2;  2LV3 A;  1ZCP A;  2F9S A;  4F0C A;  1TK8 B;  1LU4 A;  1WPI A;  4G10 A;  2CAI A;  4WBR D;  3FZ4 A;  1DBY A;  3IAM 2;  4QL7 A;  5D9W A;  3F6F A;  3RDW A;  3M9J A;  3EU3 A;  2MMZ A;  2PUK C;  3GL3 A;  4EDZ A;  5ECR B;  3IV4 A;  1ZGN A;  4FXY P;  2EIO A;  2H70 A;  4E8E A;  3KMO A;  3GX8 A;  4HS1 A;  1T4Y A;  2C3T A;  4KB3 A;  4AJ8 A;  4BPY A;  4TKY A;  4OO4 A;  3RAZ A;  4FO5 A;  5EVO A;  3MSZ A;  1KNG A;  3M0F A;  3VUR A;  3VPQ A;  2FWE A;  5DBQ A;  3IAS 2;  3HVN A;  3GIX A;  3PGT A;  5AGY A;  3HJP A;  3GKX A;  2ON5 A;  1WMJ A;  3UVH A;  3WD6 A;  2F51 A;  2PWJ A;  1DE1 A;  1TRW A;  4PNF A;  1GNE A;  5IMD A;  3TOU A;  2FHE A;  3D5J A;  3IHQ A;  2MYG A;  2BJX A;  2GGT A;  4GRF A;  1PL1 A;  2AHE A;  1XIY A;  1AXD A;  1QXH A;  4K1F A;  3L9V A;  5KN3 A;  2IN3 A;  2YWO A;  1ON4 A;  5ABR A;  3CSJ A;  3ZIV A;  4YQV A;  2MMO A;  4ID0 A;  3R2Q A;  3H4K A;  5L71 A;  4F03 A;  2I3Y A;  2B7J A;  5G2Z A;  4Z2R A;  5ECQ B;  4WKW A;  1XW6 A;  4NAX A;  4K7N A;  1F3A A;  3FRC A;  2RLI A;  2AB6 A;  2EFD A;  2CVB A;  2GT5 A;  5IMV A;  1S3D A;  3D4T A;  6GSW A;  18GS A;  1DUG A;  2LST A;  4GLT A;  4I6X A;  1SKS B;  2N5B A;  1TDI A;  1S3A A;  1BG5 A;  4IQA A;  1YF0 A;  3TGZ A;  1TW9 A;  2RUF A;  3GYK A;  1U3I A;  3LXZ A;  1YDK A;  4EUY A;  3P90 A;  5GST A;  3A2X A;  3GST A;  1EZK A;  4CHS A;  3TKQ A;  4ECJ A;  1GUH A;  1SVL A;  1MDI A;  4L5O A;  5CP1 A;  3IR4 A;  2HZF A;  2PGT A;  5D96 A;  1KTE A;  3L0H A;  1N2A A;  1OC9 A;  2V32 A;  1JLV A;  1EOH A;  3F4T A;  4TR1 A;  4NV5 A;  1Z7R A;  2YV7 A;  1CQG A;  1EGO A;  1S4B P;  2LJR A;  1N8J A;  1GTB A;  4YAP A;  5HR1 A;  3FZA A;  4KGI A;  3EVI A;  2AAW A;  5HFG A;  1K0O A;  1XVW A;  2CV4 A;  4HJ2 A;  2JZT A;  4K7I A;  2VLV A;  3WGD A;  4KSO A;  3E9J B;  3DD3 A;  1F37 A;  2WVZ A;  4V2L A;  3PR8 A;  5J4V A;  5G1K A;  3ERW A;  2WW3 A;  4Q5N A;  2E7P A;  4MLY A;  2H1L A;  2IIY A;  14GS A;  3DRN A;  1X5E A;  2C80 A;  1FOV A;  4POB A;  3GH6 A;  3ZIT A;  2R37 A;  5H5S A;  2YJH A;  5A34 B;  2KHP A;  2HZE B;  2YWN A;  1F6M C;  1XG8 A;  2MMA A;  3TKS C;  4KDX A;  1MEK A;  1ZZY A;  4Q5F A;  1XOA A;  2L4Q A;  2YNX A;  2GLR A;  5ECL B;  4FQU A;  2B5X A;  2WZ9 A;  3VWW A;  4O92 A;  2LNT A;  1SVM A;  5H5Q A;  2R3X A;  3VPT A;  4O5Q A;  4HOJ A;  4E68 A;  3LSZ A;  3HHV A;  3WGX A;  3HXS A;  4MF6 A;  2O36 A;  2LJA A;  3FY7 A;  2YCD A;  2EFE A;  1TXU A;  4ML6 A;  2VLU A;  1PA3 A;  5CAX A;  3FZ9 A;  4K2D A;  1GSE A;  4HUA A;  2ZNM A;  1AW9 A;  5D9T A;  4PI0 C;  2KP2 A;  4PGT A;  1K3L A;  1VF4 A;  4FYC A;  4XIH A;  1B4Q A;  2L6C A;  5DAK A;  2HSN B;  4G01 A;  1T00 A;  3GNJ A;  5CNW A;  1PGT A;  1IYH A;  4GF0 A;  2VOC A;  1TTZ A;  5D93 A;  3ED3 A;  3IOS A;  5G31 A;  2P5R A;  1TXX A;  4MJC A;  4ZBA A;  3KCM A;  2OAD A;  4I8B A;  3ZZX A;  2L57 A;  1SL2 B;  4OO5 A;  4O5R A;  1G0T A;  2FA4 A;  1B9X C;  4Z2T A;  3UIW A;  2XBI A;  4KX4 A;  1TI3 A;  2LJK A;  2BTO T;  4YH2 A;  1N25 A;  4IP1 A;  5J9C A;  3FHK A;  4AKX B;  3MIX A;  2FWH A;  2OT3 A;  1WWJ A;  4BIK A;  2CQ9 A;  2B6M A;  3UVT A;  1SYR A;  3EC3 A;  4WEY A;  2DJ0 A;  1EEM A;  2WVX A;  1M2B A;  2FWG A;  3GL5 A;  3L4N A;  1O81 A;  1GSF A;  1GNW A;  1R5P A;  3UBL A;  1E2Y A;  1W4V A;  2WB9 A;  2LTK A;  2FY6 A;  1FO5 A;  1ZOF A;  1SEN A;  4WR4 A;  1X9S B;  4LL1 B;  2K8S A;  4GCI A;  3EMP A;  4DSQ A;  2CVK A;  4OCE A;  3UAP A;  4ZB9 A;  1A0R P;  2VL3 A;  3CBU A;  1O73 A;  3D21 A;  4TW5 A;  3DVW A;  1AAZ A;  2FCH A;  1K3Y A;  4BL7 B;  5EPF A;  2IMI A;  3FR6 A;  5H5R A;  1PKW A;  2R6K A;  1Z9H A;  2KUC A;  3F8U A;  1H4O A;  1SKR B;  4GQC A;  3DXB A;  2A2S A;  2B1L A;  4V1A p;  4HDE A;  3U5R E;  1WP0 A;  3VWU A;  4AGS A; 
#chains in the Genus database with same CATH homology
 4OMV A;  4MF5 A;  1NHY A;  3M9K A;  2HRK A;  3D22 A;  3ME7 A;  3ZL5 A;  4MZB A;  4EL1 A;  2NTO A;  4J56 E;  3W8S A;  2P31 A;  10GS A;  6GSV A;  2H0G A;  1K0M A;  1U3A A;  3UOM A;  3KXO A;  2K9F A;  4KUN A;  4ZB8 A;  3DKS A;  5KN0 A;  1SK1 A;  6GSU A;  3A3T A;  3RHC A;  5JWO B;  1GSQ A;  5DQY A;  6GST A;  1XBS A;  4ZB7 A;  2PU9 C;  3IC8 A;  5FT3 A;  4QMK A;  5J47 A;  2GST A;  2VKZ G;  5IMA A;  2H66 A;  2XHF A;  4IHU A;  3KZQ A;  2R0G A;  1Z6M A;  4GSN A;  4G0K A;  1X5C A;  4IJ3 A;  4N3Z A;  3HZ4 A;  1QUW A;  5ECI B;  4MPG A;  2JU5 A;  2LQQ A;  1JLW A;  2EIQ A;  4KW6 A;  4GQF A;  2KP1 A;  2H72 A;  4PNG A;  1FVJ A;  5KN1 A;  2C0F A;  2MZC A;  4MPF A;  4ZIL A;  1XWB A;  1SKW B;  1XWK A;  4TOP A;  3DVX A;  19GS A;  3I6A A;  1SK0 A;  4XS1 A;  4H86 A;  4OFM A;  3EE2 A;  4F2I A;  2H75 A;  4IN0 A;  4JRR A;  4HZ2 A;  1U6T A;  3QAV A;  1YEX A;  4RQR A;  13GS A;  1MD3 A;  4TXO A;  2GDR A;  4WR5 A;  1U88 A;  1V40 A;  5IMF A;  2EIR A;  4P3Y B;  2VCQ A;  3UEM A;  1BYE A;  2UZ8 A;  2C3N A;  2N5F A;  4NV2 A;  5DQS A;  3Q18 A;  4JR4 A;  5G1L A;  1GSY A;  1ZYE A;  2H01 A;  1O7U A;  3WT2 A;  2YAN A;  1OC9 B;  4MJE A;  4DVC A;  1R26 A;  4OCF A;  4TR1 B;  5HR2 A;  2ZCT A;  5AIV A;  4K8M A;  5G30 A;  2OKA A;  4FYU A;  3TKP A;  2GQL A;  1T1V A;  2WCI A;  3CMI A;  4Z7X A;  1MD4 A;  1J9B A;  2XPE A;  3F9U A;  2QKE A;  3LGC A;  1GUM A;  7GSS A;  3QOU A;  3Q19 A;  4ZBD A;  2IMF A;  5J4U A;  3GN3 A;  3I69 A;  3GX0 A;  3HCZ A;  4TVE A;  4KA0 A;  5B8A A;  2GVP A;  2NDO A;  3N5O A;  5C04 A;  2GZY A;  5D9X A;  3UL3 A;  3KTL A;  3EWL A;  3KIJ A;  2PVQ A;  2J9H A;  3VI7 A;  2GSS A;  1YKC A;  1FB6 A;  1FHE A;  3RHB A;  2UV8 G;  2MBT A;  1A24 A;  1GSS A;  1M2D A;  3ERF A;  3MAK A;  1OE7 A;  1ERW A;  5LCZ A;  5CRE A;  4XHM A;  5JCG A;  2YJ7 A;  3GUS A;  2CT6 A;  3C73 A;  2DBC A;  2K18 A;  1T8E B;  2VIM A;  4AKI A;  4YAV A;  5DCH A;  2K8V A;  1G6Y A;  3A2V A;  2JZS A;  2B3S A;  5KN2 A;  4MZW A;  12GS A;  2IFQ A;  1Y6E A;  1ERU A;  5ECS A;  5A4V A;  2R0P A;  2YWI A;  4IBP A;  1HQO A;  1O6J A;  5AIX A;  5AIS A;  4HZ4 A;  1B48 A;  6GSS A;  3E0U A;  3P8W A;  3HMJ G;  1EGR A;  1EV4 A;  3M3M A;  2V2G A;  5DAK B;  1YZX A;  5GSS A;  1F3B A;  1SK2 A;  1XW9 A;  1YVL A;  3HYP A;  2LUS A;  3HD5 A;  3BOA A;  3ISO A;  3F4R A;  3TKR A;  4E8H A;  3CTF A;  1U87 A;  1GSU A;  2B5E A;  2GZP A;  3IC4 A;  3QAW A;  3BCI A;  3GKM A;  3IXR A;  1R4W A;  3EU4 A;  1RW1 A;  4JED A;  1TI1 A;  4IS0 A;  1OC3 A;  2M72 A;  1NW2 A;  5E59 A;  1H75 A;  2HRA A;  3WYW A;  5A4U A;  3QDN A;  2IMK A;  4IJI A;  1GTI A;  4PQH A;  3HA9 A;  5C00 A;  3EMX A;  5A5H A;  3LG6 A;  2IMD A;  1AC1 A;  2YPM A;  3NOF A;  3ZLP A;  1E6B A;  1GUL A;  5D9V A;  3VI5 A;  1FB0 A;  3QR6 A;  4X1U A;  3ZYW A;  1OAZ A;  2VUP A;  1UA5 A;  5DCG A;  2X49 A;  5EY6 A;  5A1N A;  1PN9 A;  1XWC A;  2L6D A;  1EV9 A;  5GAP D;  3VLN A;  2GQK A;  2G0F A;  3D0Z A;  5J41 A;  4K7O A;  3R3E A;  2R4V A;  3NZN A;  3S9F A;  2HFD A;  4MNN A;  4EVM A;  1JZD A;  2YP6 A;  3TRQ A;  2H73 A;  1GUK A;  4EDY A;  4DSR A;  1G6W A;  4V2N A;  5KOW A;  4LLR A;  5DVB A;  1C72 A;  5DAL A;  5F8B A;  4N11 A;  3KH9 A;  2EFC A;  2H0I A;  1GTA A;  2LRC A;  5KOX A;  1LBK A;  3LJR A;  1A23 A;  5HFK A;  2JSZ A;  3FR3 A;  1FW1 A;  1A2J A;  3APS A;  1PSQ A;  2H71 A;  2GT6 A;  5AN1 A;  3GKN A;  1MTC A;  2HRK B;  1UN2 A;  4PUR A;  2VCT A;  1LJR A;  4BVY B;  2VAF A;  2WUL A;  4BA7 A;  3RPP A;  1W89 A;  1THX A;  3DGQ A;  2YOI A;  4DSS A;  1GRX A;  5CO3 A;  2C0G A;  2C0E A;  3C1R A;  3TCO A;  1XXU A;  3P2A A;  4KND A;  5CRD A;  1AQV A;  5ELA A;  4MMM A;  1FG4 A;  3CTG A;  2PER A;  1A8Y A;  5IOW A;  2H6X A;  1XOB A;  2G2Q A;  4AKH A;  2H6Z A;  1VF2 A;  4YKF A;  5ECH B;  4BVX A;  2OBI A;  4TRX A;  2IWT A;  2QA1 A;  5J3R A;  3IK7 A;  2C1Y A;  3CYN A;  3M8N A;  5BRT A;  1EWX A;  1O8X A;  2IME A;  2GSR A;  1F2E A;  4TXV A;  5DDL A;  5JWR B;  4RQX A;  4GWR A;  4BWS A;  4OFT A;  5FWG A;  4KCA A;  1ZYP A;  3APQ A;  4KSM A;  3H79 A;  3C8E A;  2F3M A;  3TJG A;  3GH9 A;  4X4J A;  4MZC A;  5ID2 A;  2FUG 2;  1YF1 A;  2VM2 A;  2DJ1 A;  3CSH A;  4HU7 A;  3GUR A;  4NHW A;  4K6X A;  5CRG A;  3KP8 A;  3ZRD A;  2B7K A;  2ZUP A;  3KP9 A;  3RBT A;  3C71 A;  2R0C A;  1VGL A;  3GTU A;  3LW9 A;  2REM A;  2GS3 A;  4X43 A;  3L78 A;  2KOK A;  2OE1 A;  3KH7 A;  1WOU A;  2QSI A;  4ULX A;  4TXO B;  4POM A;  4K9Z A;  3L9S A;  3UBK A;  1ZYN A;  3DML A;  1NHO A;  1GH2 A;  1Z5Y E;  1Q98 A;  2OA7 A;  4OFN A;  1Z6N A;  1V57 A;  2HI7 A;  1OKT A;  1TU8 A;  1TRU A;  1T7P B;  1NSW A;  2AUV A;  2HSM A;  1WIK A;  3TU3 B;  4IW9 A;  4I97 A;  2JZR A;  2H1B A;  5B6N A;  4NWY A;  1K0A A;  3ZVJ D;  2DJ2 A;  2DC5 A;  1QQ2 A;  3K8N A;  4G19 A;  4GST A;  2HLS A;  1B8X A;  2PMT A;  2JAC A;  2I9H A;  3JCM L;  3HY2 A;  1NM3 A;  3PH9 A;  2N5A A;  3FYG A;  1ERT A;  1M9B A;  4KE3 A;  3HDC A;  3TJB A;  2X8H A;  1VF3 A;  5BMU A;  3QD9 A;  1KBN A;  2WFC A;  2LRT A;  5HQP A;  3LOR A;  3TKS E;  4IEL A;  1ML6 A;  2WRT A;  2P5Q A;  4ISD A;  3F3Q A;  3F63 A;  4EF0 A;  1MDK A;  4RI6 A;  1VF1 A;  1O85 A;  1V2A A;  4KF9 A;  2FGX A;  2KLX A;  1X0R A;  1JZW A;  2JAD A;  2O85 A;  4NMU A;  1T4Z A;  1YY7 A;  1F9M A;  5A5K A;  1B4P A;  1EP7 A;  3BD2 A;  3TRX A;  4ZBB A;  1OC8 A;  3HVS A;  1M9A A;  1YKA A;  2D2Z A;  4BWQ A;  4EO3 A;  1I9D A;  3ME8 A;  4ZL7 A;  1G7E A;  3UMA A;  4FH8 A;  1K0C A;  3Q6O A;  3LYP A;  4FYB A;  2HRF A;  1XWG A;  2DMM A;  3MDK A;  4IGJ A;  1XPV A;  4EXJ A;  2AJQ B;  4EC0 A;  4TR0 A;  1SL0 B;  2V6O A;  1FVK A;  2OJL A;  1TRS A;  5ELG A;  1AUC A;  22GS A;  3IK9 A;  4IKH A;  3TJJ A;  1AQX A;  2HQT A;  4FIW A;  1HNC A;  5HR0 A;  1TJD A;  1GLP A;  2C8U A;  2IFQ B;  1O8W A;  3F4S A;  6GSX A;  3GSS A;  3O3T A;  3ZMK A;  2QGV A;  3GMF A;  1DSB A;  1ZL9 A;  3GRX A;  4AJ6 A;  4XS6 A;  2YN1 A;  1EEJ A;  3APO A;  2CX4 A;  4J2F A;  1T3B A;  5DJL A;  2HYX A;  3MWH A;  4ZB6 A;  2GSQ A;  4GTU A;  5IIZ A;  2VD0 A;  3MNG A;  2O89 A;  2H0H A;  4PXO A;  2VM1 A;  1M0U A;  4I2U A;  4G9H A;  2NBS A;  2O87 A;  5CRW A;  4XCS A;  2BMX A;  4TN8 A;  1K0D A;  4Q5Q A;  4MK3 A;  1XWA A;  3H93 A;  2ES7 A;  4ML1 A;  5FHI A;  2MMN A;  4XS4 A;  1PN0 A;  9GSS A;  4XTS A;  2L4C A;  4HQS A;  11GS A;  2OE3 A;  3F3R A;  1DE2 A;  1BX9 A;  1R5A A;  1PX7 A;  4IQ1 A;  5A5H B;  3Q74 A;  1BG1 A;  3G7Y A;  2LS5 A;  3F0I A;  5HR3 A;  5COH A;  3QAG A;  2RM5 A;  4HQZ A;  3DIE A;  2VL2 A;  1WRY A;  1KEB A;  3GHA A;  4HU9 A;  1X9W B;  1BJX A;  3TJF A;  1OYJ A;  5A1N B;  2DKI A;  2X99 A;  4K5R A;  2WJU A;  1QFN A;  5DJM A;  2TRX A;  4CW9 A;  5E4W A;  2HSH A;  4K5S A;  3HVV A;  2C3Q A;  2ALB A;  1A0F A;  1YJ6 A;  3ZFB A;  3BCK A;  3G7I A;  2WDU A;  1PKZ A;  1M2A A;  2L5L A;  3A5W A;  4QL9 A;  2CZ2 A;  1SD8 A;  2CVD A;  1A8L A;  5IMC A;  4O5U A;  3H8Q A;  1GWC A;  3FKF A;  1THO A;  5DAL B;  2E2M A;  3V1W A;  2OBK A;  3LEF A;  1BAY A;  3IA1 A;  1GSD A;  5LD0 A;  4MH2 A;  2PPT A;  1PRX A;  3GFK A;  4ECI A;  4AKG A;  2VLT A;  1X5D A;  4KDU A;  2H30 A;  4JE1 A;  1X9M B;  2DJK A;  5F0G A;  2AYT A;  1V9W A;  4EE0 A;  2CA8 A;  2VL9 A;  4PQ1 A;  4D73 A;  2H74 A;  4L8E A;  2H1D A;  1RK4 A;  3FZ5 A;  3WGE A;  1WJK A;  2QA2 A;  4ZIJ A;  1GTU A;  1TK5 B;  1TOF A;  3KJY A;  1WE0 A;  2B5Y A;  2TIR A;  3E3E A;  2TRC P;  3HJM A;  3KM6 A;  4DSS B;  3UAR A;  1XCC A;  2I4A A;  4KH7 A;  5INY A;  4G0I A;  1J0F A;  1QK8 A;  1JZR A;  5JWQ B;  2A4V A;  2O8V B;  3TRP A;  3CSI A;  1ILO A;  1OVN A;  3GKK A;  5B8B A;  3C1S A;  3TUE A;  2GTU A;  5F05 A;  2JL4 A;  2XC2 A;  1V58 A;  4X0X A;  4BVX B;  4KDY A;  3TOT A;  1Y25 A;  2HSY A;  3EPT A;  1K3O A;  4ECC A;  2IPA A;  5KEJ A;  5IO2 A;  2H1A A;  4XRD A;  5ECM B;  3IHG A;  4N0V A;  3CRU A;  4G0L A;  1SD9 A;  4TR3 A;  2DIZ A;  2CX3 A;  3SWL A;  3FW2 A;  4GXZ A;  1Q4J A;  1V98 A;  2R2J A;  1ST9 A;  1GLQ A;  2WS2 A;  1IYI A;  2JSY A;  5ID2 B;  1ZMA A;  3VWV A;  1SVO A;  4A5P A;  5B7C A;  4XRA A;  4Q5R A;  5ENU A;  4YKG A;  1FOH A;  3SBC A;  2EFH A;  1K0N A;  4IVF A;  3G7J A;  3NIV A;  4OD7 A;  1AIU A;  2I1U A;  3OR5 A;  2HNL A;  3GTU B;  2EC4 A;  2CAQ A;  2RII A;  2C0D A;  2VCX A;  4IP6 A;  2O7K A;  3F6D A;  2DLX A;  3KD0 A;  4I2T A;  3P7X A;  4N10 A;  1Z3E A;  1PMT A;  2HSM B;  4MCU A;  4O7H A;  5G5E A;  1TU7 A;  4LL4 B;  3ZVJ A;  3QCP A;  4MA9 A;  3ZIJ A;  2YZH A;  4MP4 A;  1USB A;  4WBJ A;  2L5O A;  3KGK A;  3D4M A;  4K0G A;  4POL A;  3LQ7 A;  3QMX A;  1SU9 A;  2K6V A;  1HNB A;  2PN8 A;  2YWM A;  4G2E A;  5BMU B;  3CRT A;  1OE8 A;  4WF5 A;  2V1M A;  5D8I A;  1SJI A;  1TP9 A;  1HNA A;  3FR9 A;  3A5I A;  3DWV A;  3L9U A;  4MH3 A;  4RI7 A;  4GSS A;  4KCE A;  1TRV A;  3ERG A;  1BF5 A;  2IJY A;  2GQM A;  5B6M A;  2ON7 A;  4WXT A;  5J40 A;  3EYT A;  1GL8 A;  2J23 A;  3U6V A;  4CY6 A;  4WF4 A;  3LWA A;  1OKD A;  3HJO A;  2F8A A;  1J08 A;  1XZO A;  2R5G A;  5LNK e;  4F0B A;  3BBY A;  4CY8 A;  1JHB A;  4PTS A;  3MYD A;  20GS A;  17GS A;  1FAA A;  3HKR A;  4ZXG A;  2LNS A;  5JCW A;  4F82 A;  2LEG A;  5GZZ B;  5HFI A;  4EIP A;  3EUR A;  4L0U A;  4F9Z A;  4L5L A;  4USS A;  2NPB A;  1Y1U A;  4KAE A;  3GA4 A;  2PBJ A;  4I5Q A;  16GS A;  3ZML A;  1HYU A;  4JZQ A;  1M7T A;  2A4H A;  2RM6 A;  4L0W A;  3PIN A;  3EIN A;  3ZRE A;  1A2M A;  3VK9 A;  2FLS A;  1ZYQ B;  2DIY A;  4N30 A;  3A2W A;  1MDJ A;  2X8C A;  3M1G A;  3J7Y b;  3O6T A;  3FK8 A;  1TKD B;  1SYX A;  2HT9 A;  2H8L A;  1SL1 B;  1JFU A;  2VL2 C;  2VO4 A;  2LKU A;  1PQN A;  2HXK A;  2L59 A;  3J7Y k;  2QC7 A;  2A2P A;  2O5V A;  4N0Z A;  4J57 E;  3FMW A;  4PUA A;  3PPU A;  5ECN B;  1YEP A;  2E2G A;  4ILF A;  5ECP B;  2VCW A;  5IPG A;  3W8J A;  2B1K A;  4XS4 B;  5J9B A;  2WGR A;  2E0Q A;  2H6Y A;  2F8F A;  5IMZ A;  2DJ3 A;  1ACV A;  4JR6 A;  4ZL9 A;  4ACS A;  3O76 A;  1JZO A;  3ZFL A;  1I5G A;  3I43 A;  3US3 A;  4Z2U A;  1B9Y C;  5A34 A;  2HZE A;  3AY8 A;  1R7H A;  1Z7P A;  2FNO A;  2H76 A;  1SJZ A;  1XFL A;  3TB2 A;  1GP1 A;  4LMW A;  4AF2 A;  1VRS D;  2H19 A;  5J5N A;  1PX6 A;  1K0B A;  3LXT A;  1SJ6 A;  4MAB A;  2RUE A;  2YZU A;  3N9J A;  3QFB C;  4MJA A;  4PX1 A;  3RPN A;  3QFA C;  1S3C A;  2LQO A;  4EKZ A;  2FWF A;  4O32 A;  3HVX A;  2X4A A;  5D73 A;  3IDV A;  3IPZ A;  4BVY A;  3UJ1 A;  4JU5 A;  2OE0 A;  3VFI A;  2LRN A;  5GAN D;  2X8G A;  5A4W A;  4OWY A;  3C7M A;  4WET A;  3LYK A;  3KMN A;  3TKS A;  4JBB A;  4PQI A;  2DML A;  4ZL8 A;  1M99 A;  4AJ7 A;  4NPB A;  4D73 B;  4ECB A;  2P0G A;  2HSN A;  2GZZ A;  1BED A;  3W6G A;  3KTB A;  3IE3 A;  1URM A;  4HJM A;  2PVO C;  4K2X A;  1HD2 A;  1YQ1 A;  3FEU A;  5ECO B;  2XPD A;  2C4J A;  4K0N A;  2DJJ A;  2DSA A;  4AI6 A;  2M80 A;  4DEJ A;  1AQW A;  4YQU A;  4V2M A;  1ABA A;  2MBS A;  2VD1 A;  3ZTL A;  4V1A g;  3TJK A;  5G5F A;  2H1G A;  5CYY A;  4PUF C;  2HRN A;  1PD2 1;  3VWX A;  3QPM A;  3H1N A;  1XW5 A;  2M46 A;  3DEX A;  3LFL A;  1TK0 B;  2V41 A;  3TDG A;  1ERV A;  5IPH A;  3GV1 A;  3IRA A;  2A2R A;  4POK A;  3D6I A;  1XVQ A;  1BQ7 A;  4QQ7 A;  4W66 A;  4YQM A;  1G7O A;  2HE3 A;  4MJB A;  4HEA 2;  3HZ8 A;  1EP8 A;  2OAC A;  3WT1 A;  2VCV A;  2XBQ A;  1RQM A;  1UC7 A;  3CWG A;  1UVZ A;  6GSY A;  5IO0 A;  4GDF A;  1PL2 A;  3G9B A;  1CQH A;  2AV4 A;  4NHZ A;  2Z9S A;  4LA1 A;  1EOG A;  3CXG A;  1QMV A;  5IQY A;  5IM9 A;  5JCU A;  2YV9 A;  3KEB A;  4LMV A;  4NXI A;  4EIQ A;  5IOX A;  2VCZ A;  2FD3 A;  8GSS A;  5CRH A;  2CZ3 A;  2I81 A;  4ICY A;  4BL7 A;  1A2L A;  4RUV A;  1QGV A;  4CDO A;  5J4Y A;  5F07 A;  3BJ5 A;  4TR4 A;  2DKH A;  2V6K A;  3IBH A;  2IL3 A;  4MDC A;  5EL8 A;  5F06 A;  2X64 A;  2FA8 A;  2NVL A;  4MF7 A;  5ECK B;  3DYR A;  4HI7 A;  3I9V 2;  2LV3 A;  1ZCP A;  2F9S A;  4F0C A;  1TK8 B;  1LU4 A;  1WPI A;  4G10 A;  2CAI A;  4WBR D;  3FZ4 A;  1DBY A;  3IAM 2;  4QL7 A;  5D9W A;  3F6F A;  3RDW A;  3M9J A;  3EU3 A;  2MMZ A;  2PUK C;  3GL3 A;  4EDZ A;  5ECR B;  3IV4 A;  1ZGN A;  2H70 A;  2EIO A;  4E8E A;  3KMO A;  3GX8 A;  4HS1 A;  1T4Y A;  2C3T A;  4KB3 A;  4AJ8 A;  4BPY A;  4TKY A;  4OO4 A;  3RAZ A;  4FO5 A;  5EVO A;  3MSZ A;  1KNG A;  3M0F A;  3VUR A;  3VPQ A;  2FWE A;  5DBQ A;  3IAS 2;  3GIX A;  3PGT A;  5AGY A;  3HJP A;  3GKX A;  2ON5 A;  1WMJ A;  3UVH A;  3WD6 A;  2F51 A;  2PWJ A;  1DE1 A;  1TRW A;  4PNF A;  1GNE A;  5IMD A;  3TOU A;  2FHE A;  3D5J A;  3IHQ A;  2MYG A;  2BJX A;  2GGT A;  4GRF A;  1PL1 A;  2AHE A;  1XIY A;  1AXD A;  1QXH A;  4K1F A;  3L9V A;  5KN3 A;  2IN3 A;  2YWO A;  1ON4 A;  5ABR A;  3CSJ A;  3ZIV A;  4YQV A;  2MMO A;  4ID0 A;  3R2Q A;  3H4K A;  5L71 A;  4F03 A;  2I3Y A;  2B7J A;  5G2Z A;  4Z2R A;  5ECQ B;  4WKW A;  1XW6 A;  4NAX A;  4K7N A;  1F3A A;  3FRC A;  2RLI A;  2AB6 A;  2EFD A;  2CVB A;  2GT5 A;  5IMV A;  1S3D A;  3D4T A;  6GSW A;  18GS A;  1DUG A;  2LST A;  4GLT A;  4I6X A;  1SKS B;  2N5B A;  1TDI A;  1S3A A;  1BG5 A;  4IQA A;  1YF0 A;  3TGZ A;  1TW9 A;  2RUF A;  3GYK A;  1U3I A;  3LXZ A;  1YDK A;  4EUY A;  3P90 A;  5GST A;  3A2X A;  3GST A;  1EZK A;  4CHS A;  3TKQ A;  4ECJ A;  1GUH A;  1SVL A;  1MDI A;  4L5O A;  5CP1 A;  3IR4 A;  2HZF A;  2PGT A;  5D96 A;  1KTE A;  3L0H A;  1N2A A;  1OC9 A;  2V32 A;  1JLV A;  1EOH A;  3F4T A;  4TR1 A;  4NV5 A;  1Z7R A;  2YV7 A;  1CQG A;  1EGO A;  2LJR A;  1N8J A;  1GTB A;  4YAP A;  5HR1 A;  3FZA A;  4KGI A;  3EVI A;  2AAW A;  5HFG A;  1K0O A;  1XVW A;  2CV4 A;  4HJ2 A;  2JZT A;  4K7I A;  2VLV A;  3WGD A;  4KSO A;  3E9J B;  3DD3 A;  1F37 A;  4V2L A;  3PR8 A;  5J4V A;  5G1K A;  4Q5N A;  3ERW A;  2E7P A;  4MLY A;  2H1L A;  2IIY A;  14GS A;  3DRN A;  1X5E A;  2C80 A;  1FOV A;  4POB A;  3GH6 A;  3ZIT A;  2R37 A;  5H5S A;  2YJH A;  5A34 B;  2KHP A;  2HZE B;  2YWN A;  1F6M C;  2MMA A;  3TKS C;  4KDX A;  1MEK A;  1ZZY A;  4Q5F A;  1XOA A;  2L4Q A;  2YNX A;  2GLR A;  5ECL B;  4FQU A;  2B5X A;  2WZ9 A;  3VWW A;  4O92 A;  2LNT A;  1SVM A;  5H5Q A;  2R3X A;  3VPT A;  4O5Q A;  4HOJ A;  4E68 A;  3LSZ A;  3HHV A;  3WGX A;  3HXS A;  4MF6 A;  2LJA A;  3FY7 A;  2YCD A;  2EFE A;  1TXU A;  4ML6 A;  2VLU A;  1PA3 A;  5CAX A;  3FZ9 A;  4K2D A;  1GSE A;  4HUA A;  2ZNM A;  1AW9 A;  5D9T A;  2KP2 A;  4PGT A;  1K3L A;  1VF4 A;  4FYC A;  4XIH A;  1B4Q A;  2L6C A;  5DAK A;  2HSN B;  4G01 A;  1T00 A;  3GNJ A;  5CNW A;  1PGT A;  1IYH A;  4GF0 A;  2VOC A;  1TTZ A;  5D93 A;  3ED3 A;  3IOS A;  5G31 A;  2P5R A;  1TXX A;  4MJC A;  4ZBA A;  3KCM A;  2OAD A;  4I8B A;  3ZZX A;  2L57 A;  1SL2 B;  4OO5 A;  4O5R A;  1G0T A;  2FA4 A;  1B9X C;  4Z2T A;  3UIW A;  2XBI A;  4KX4 A;  1TI3 A;  2LJK A;  2BTO T;  4YH2 A;  1N25 A;  4IP1 A;  5J9C A;  3FHK A;  4AKX B;  3MIX A;  2FWH A;  2OT3 A;  1WWJ A;  2CQ9 A;  2B6M A;  3UVT A;  1SYR A;  3EC3 A;  4WEY A;  2DJ0 A;  1EEM A;  1M2B A;  2FWG A;  3GL5 A;  3L4N A;  1O81 A;  1GSF A;  1GNW A;  1R5P A;  3UBL A;  1E2Y A;  1W4V A;  2WB9 A;  2LTK A;  2FY6 A;  1FO5 A;  1ZOF A;  1SEN A;  4WR4 A;  1X9S B;  4LL1 B;  2K8S A;  4GCI A;  3EMP A;  4DSQ A;  2CVK A;  4OCE A;  3UAP A;  4ZB9 A;  1A0R P;  2VL3 A;  3CBU A;  1O73 A;  3D21 A;  4TW5 A;  3DVW A;  1AAZ A;  2FCH A;  1K3Y A;  4BL7 B;  5EPF A;  2IMI A;  3FR6 A;  5H5R A;  1PKW A;  2R6K A;  1Z9H A;  2KUC A;  3F8U A;  1H4O A;  1SKR B;  4GQC A;  3DXB A;  2A2S A;  2B1L A;  4V1A p;  4HDE A;  3U5R E;  1WP0 A;  3VWU A;  4AGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...