1DUGA

Structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
234
structure length
234
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPQQHHLGGAKQAGDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERM
publication title Structure of the fibrinogen gamma-chain integrin binding and factor XIIIa cross-linking sites obtained through carrier protein driven crystallization.
pubmed rcsb
source organism Schistosoma japonicum
molecule tags Transferase, blood clotting
total genus 75
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1dugA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1dugA01
2VD0A 1VRSD 3D4MA 2H73A 1YKCA 4ZBDA 3QOUA 3WT2A 2WGRA 3TJFA 2V6OA 5HFKA 3MDKA 4GRFA 5GSSA 4GWRA 1YJ6A 2UZ8A 3OR5A 4TKYA 2VCXA 2DSAA 5IO2A 4F82A 5ENUA 4PQHA 4G9HA 2L6CA 4N0VA 1YY7A 3CBUA 2ALBA 5J9BA 1K3YA 3W8SA 1MD4A 2PVQA 1HNAA 3EU4A 4L0UA 1SD8A 3C73A 1TK0B 4TXOA 3HZ8A 1VF3A 3G9BA 1U6TA 1GWCA 2K8VA 2DMMA 3Q18A 5CP1A 3LXZA 2O85A 4TR3A 5IO0A 1E2YA 1JZDA 4MJAA 3LSZA 1XW6A 2WS2A 1THXA 4MZWA 3L78A 4TVEA 2HNLA 3O6TA 2B1KA 3IC8A 4K0NA 2H70A 3PPUA 1EP7A 3KGKA 6GSUA 5DJLA 5HFGA 2JACA 1DBYA 5DCHA 1BYEA 1HQOA 4PX1A 5B7CA 1B9YC 1V2AA 3FY7A 4FYCA 4NV2A 3U5RE 1G6WA 2VLUA 4LA1A 1Z3EA 3FW2A 3F4TA 4EVMA 5C00A 2GS3A 3ERGA 4MJCA 4QQ7A 1BG5A 3IK9A 4FH8A 5JCWA 5LNKe 1AQXA 3GHAA 1YF0A 3WGDA 3C7MA 1SL0B 4PNGA 1X5CA 1I5GA 1K3LA 2H30A 3F0IA 1U3IA 2X99A 4ECIA 2FWFA 5G31A 5ECKB 4K6XA 2CA8A 1TK8B 4MH3A 3L4NA 3C71A 6GSVA 1U87A 3GV1A 2HXKA 1GL8A 3FRCA 2PWJA 3V1WA 5IPGA 4ZILA 1WP0A 1XVWA 1A2JA 4EE0A 2E7PA 3QR6A 5FT3A 3TCOA 4JU5A 3RPPA 2VL2C 4F0BA 5CRDA 1ILOA 1YEXA 1TRUA 5H5SA 3IHQA 4ZB8A 4ACSA 4MPGA 2HE3A 2N5AA 10GSA 4PURA 4HJ2A 1XXUA 1PGTA 1AUCA 1MEKA 2L4CA 4JRRA 12GSA 2OACA 1ERTA 1TU7A 4KX4A 4IHUA 4BL7B 3O76A 5IPHA 1M99A 2A4VA 3A5WA 3SBCA 2K8SA 1A23A 1M2AA 2MMAA 1BAYA 4E8EA 4LL4B 2H0GA 4XHMA 1G0TA 5B6MA 2GT5A 3GIXA 2YCDA 1GUMA 5JWQB 2O8VB 4K7IA 3ZVJD 4MK3A 2L59A 1TW9A 2ON7A 4TN8A 2PUKC 4D73A 4NV5A 3IAS2 4Q5RA 4ID0A 2VCQA 1O8XA 1HNBA 4KSMA 4GF0A 3ME8A 3LQ7A 3D21A 3I69A 2X8CA 4IN0A 2VUPA 1QUWA 4XS4B 5G5EA 1WJKA 1WRYA 1ML6A 5LD0A 4K2DA 2YWNA 4O5RA 2JADA 4E8HA 2GSSA 3JCML 2OBIA 2ZNMA 4Q5QA 4XS6A 3DRNA 5DCGA 3ZZXA 3TOTA 1V98A 2MMOA 3VFIA 4RQXA 4TR0A 2MZCA 1DE2A 2REMA 4MP4A 1EOHA 3GTUB 3VWUA 1LBKA 2BMXA 2FUG2 2IMIA 1GSQA 4NHWA 5COHA 5B6NA 5HR2A 2I4AA 5EY6A 3ZFBA 3BD2A 5ECQB 4HUAA 4ZB9A 3FR6A 1W89A 2DJKA 2DJ1A 1V40A 4POMA 5CRWA 4OFMA 1O7UA 4L5OA 2FD3A 2L5LA 4O7HA 1B4PA 1URMA 3H79A 2TIRA 1EV4A 4NPBA 1SKRB 3F6DA 1ERVA 4OO5A 4NMUA 2O89A 4BVXB 2H6YA 3TKPA 3GH6A 1SL2B 3GYKA 4FQUA 2A2RA 1PA3A 1N2AA 4L5LA 4PUFC 1ZGNA 1ACVA 2R37A 3F6FA 3IRAA 1TI3A 2CV4A 4ECCA 5EPFA 2GSQA 3GH9A 1O8WA 4ZB6A 3LG6A 2OE1A 3DIEA 4OFNA 1X9MB 1JZOA 5HQPA 4XRAA 1WWJA 5HFIA 1TDIA 4EC0A 3G7JA 1ZMAA 4KW6A 2O7KA 2KLXA 2LRNA 2XPEA 1Q98A 2H75A 3HVXA 2DLXA 1GRXA 4FYBA 3RHBA 1FHEA 3VPTA 4N10A 3H1NA 1U3AA 5ECMB 1AC1A 3ZIJA 1BEDA 4IP6A 5A4UA 4HU7A 1B48A 1BQ7A 3D5JA 2TRXA 5D73A 4ULXA 2LEGA 4LMVA 3MAKA 2C3QA 1K0NA 1WE0A 2VL3A 3F3QA 4GXZA 4WBRD 5A4WA 2LS5A 2IJYA 2YJ7A 3I43A 4IQ1A 3GRXA 3A2XA 4G0KA 3WYWA 1A0FA 2NDOA 1CQHA 4K9ZA 5GAND 4POLA 3ZITA 2DBCA 2PMTA 3LYPA 2NVLA 2QKEA 1LJRA 4ECJA 1FVKA 2QC7A 3ZLPA 3EINA 1JLVA 1OE8A 4HOJA 2B5XA 3PGTA 3VWVA 5CYYA 2C80A 2EIRA 2LSTA 3CXGA 3HJOA 2HRKA 2C3TA 5L71A 4MF5A 4IS0A 1A8LA 3TUEA 1VF2A 1X9SB 4WF5A 2QGVA 3GSTA 3NIVA 2CT6A 3I6AA 2DJ3A 2J23A 2N5FA 4GQFA 1WPIA 3GKXA 1SK2A 3EU3A 5J4UA 2C4JA 3MSZA 4L0WA 5D9WA 1SYRA 2I1UA 2OKAA 2H01A 3N9JA 3QMXA 5E59A 3LXTA 5DDLA 11GSA 3EYTA 3ZL5A 1Z6MA 1XCCA 1MDJA 2XBQA 3HXSA 1SJZA 5DALA 4G2EA 1F2EA 2H6ZA 4N30A 2VCTA 5BMUA 2YWOA 4JR4A 1X5DA 4KSOA 1EEMA 3UVHA 1JZRA 4EL1A 3QAVA 5ECNB 3GSSA 1NW2A 8GSSA 2C0DA 1M7TA 5IQYA 2VOCA 1QFNA 2YP6A 2EIQA 1ZL9A 5B8BA 4TXVA 4MF7A 4MZBA 2ZUPA 4NXIA 1GSSA 5JWRB 4PQIA 3GX8A 2IMFA 3M9KA 4DSSA 5J9CA 4PUAA 1T7PB 4OCEA 3ERWA 3VI5A 1T4ZA 2MMZA 2PN8A 3CYNA 4Z7XA 4USSA 1ZOFA 3WGEA 4WBJA 3KEBA 1C72A 1O85A 2VCVA 1XOAA 5ECSA 2GQMA 2K6VA 4AJ8A 2K9FA 1F9MA 4P3YB 4TXOB 3H4KA 4KCEA 3EURA 1RQMA 4ZL8A 2F51A 4XCSA 2KHPA 3GKKA 2JSYA 1FOVA 5GZZB 1QQ2A 2LQOA 1YF1A 2CX3A 2IFQA 1A2LA 2FGXA 1EZKA 4BVYA 1AW9A 4ZL7A 2LRCA 5A4VA 1K0AA 1XWCA 1EGOA 4I2UA 1AAZA 3EMPA 2ON5A 4TR1A 4OMVA 2DIYA 4MCUA 1Z7RA 3CTFA 1R4WA 1GLPA 3ZIVA 3VK9A 1XIYA 2RLIA 3UBKA 2HRFA 1F37A 4TR1B 1VF4A 5ECHB 1MDIA 3LWAA 5FHIA 2V2GA 2QSIA 3ISOA 2P5QA 2LJKA 4LL1B 3KXOA 4WR5A 3IXRA 3EE2A 1NSWA 5IOXA 2MBTA 3HD5A 3FR3A 3CMIA 5DJMA 3KMNA 5F06A 2G0FA 2VLTA 3HY2A 1EP8A 3D4TA 1GSFA 4IVFA 3FKFA 2I3YA 4KAEA 3M0FA 1T3BA 4XTSA 4MJBA 5JWOB 2OE0A 5IMCA 5LCZA 2WFCA 5CO3A 1OYJA 2F8AA 2CZ3A 3J7Yk 3EVIA 2P31A 3QCPA 1RK4A 2HSNB 4K8MA 4TR4A 5J41A 4LLRA 4N0ZA 4Q5FA 5FWGA 2GQLA 1FB6A 3KTBA 5GAPD 3FZ4A 3A3TA 4NHZA 1KTEA 2FWHA 4HQSA 2V41A 1M0UA 1GULA 4DVCA 2P5RA 2VD1A 2H0HA 2IIYA 4G19A 2LNSA 1PD21 3HHVA 3KM6A 1ZCPA 3LEFA 3IK7A 4MA9A 1PQNA 1TKDB 4YAVA 3TRXA 2CQ9A 2IN3A 5A5KA 1PN9A 5ECOB 3E0UA 3IAM2 5G30A 1ON4A 4X0XA 3UAPA 2PVOC 3VWWA 4ZXGA 4TOPA 4GSTA 3ZFLA 2DMLA 4FIWA 1NHOA 2YZHA 1V9WA 3CRUA 4OWYA 1YQ1A 4MPFA 3DKSA 1NHYA 1M2BA 4GSNA 3WD6A 3K8NA 2FLSA 2YV7A 1NM3A 2G2QA 3TOUA 4TRXA 5GSTA 3QAWA 3WT1A 4BA7A 1XWBA 4D73B 1TRVA 2EC4A 4XIHA 4MMMA 1A0RP 3DGQA 2M46A 2YPMA 4AF2A 4GSSA 6GSYA 4JE1A 4MH2A 3UEMA 4WXTA 1PX6A 1O6JA 2B3SA 3FZAA 4Q5NA 3D0ZA 5IMVA 1SKSB 5IOWA 4XS1A 4PQ1A 1T1VA 1HD2A 2NBSA 1A2MA 1FW1A 2CAIA 4RI7A 1XWGA 4POKA 3FEUA 3LORA 4YQMA 3TJBA 2V6KA 3UL3A 1E6BA 4KDXA 3TJGA 3W8JA 2GZZA 4RUVA 4IELA 4J56E 3DYRA 3HVSA 3RPNA 2GDRA 5JCUA 3KIJA 3RBTA 2R4VA 2MBSA 1IYHA 4V1Ag 2B1LA 5HR1A 2KUCA 3ZREA 5ID2A 1WIKA 4NWYA 4X43A 2RIIA 2X64A 2L6DA 4KUNA 2V32A 5IM9A 1K0MA 3FHKA 4CDOA 3LFLA 2H74A 2CX4A 1Z7PA 2DIZA 2I9HA 5J3RA 2FCHA 3F9UA 1GNWA 4V1Ap 3MNGA 2H72A 2C0EA 2HFDA 2CAQA 1TRSA 5KN3A 1F3AA 3FYGA 1PSQA 2GZPA 5DQYA 3BOAA 1TK5B 3RHCA 3NOFA 4EKZA 4BPYA 4YQVA 3M9JA 4PGTA 2WULA 4ZIJA 2H66A 3BCIA 1UA5A 1Z9HA 1BJXA 3VLNA 1YZXA 4XRDA 1R5AA 2DJJA 2E0QA 4HZ4A 2L4QA 1V57A 22GSA 2K18A 1GSUA 4G0IA 1R7HA 3RAZA 1PMTA 2WCIA 1YEPA 3VWXA 3DWVA 1XWKA 5ELAA 1A24A 3IR4A 3PR8A 2GLRA 2R2JA 3HJMA 4WF4A 4G0LA 4MABA 3IA1A 3LYKA 3GL5A 2H1GA 5AISA 3TKSE 1OC3A 1TTZA 1ST9A 1J9BA 3GKNA 4IKHA 2YANA 1S3DA 3QFBC 4FYUA 2PBJA 1LU4A 2O87A 1N8JA 4PNFA 2XC2A 2RM5A 14GSA 4BWQA 20GSA 2YZUA 5D8IA 2H6XA 1SKWB 5D9VA 2GSTA 4GCIA 5KN0A 1K0CA 3S9FA 2LJAA 2PGTA 1XPVA 1EOGA 4YQUA 1AQWA 2CZ2A 4TW5A 4K7NA 2FA4A 4F03A 4KNDA 2IMEA 1THOA 2Z9SA 1T00A 1OVNA 1OE7A 4EF0A 3E9JB 2HRKB 1PKWA 5J5NA 2R3XA 4OO4A 5CNWA 1AXDA 1ZYEA 3BBYA 2VCZA 4GLTA 5H5QA 4ML6A 1Y6EA 2H76A 2HI7A 5D96A 2PU9C 1FO5A 5C04A 2C0FA 1G7OA 3HCZA 1SK0A 2RM6A 1USBA 4JBBA 2HLSA 2JU5A 2AYTA 2RUEA 4KGIA 4WETA 1H75A 4HDEA 2IMDA 3E3EA 1UVZA 1GUKA 3KJYA 4ILFA 2GT6A 2H1BA 3UBLA 4IW9A 4ISDA 2M80A 2OE3A 1UN2A 1YKAA 1Q4JA 2RUFA 4IJIA 3TDGA 3UJ1A 4OD7A 3FK8A 3UOMA 2YV9A 3FZ5A 3KCMA 5ELGA 2LNTA 2XHFA 2VL9A 3GUSA 6GSWA 3NZNA 2VLVA 3UVTA 3PINA 3VURA 1JHBA 5DALB 2F9SA 3L9SA 3SWLA 1GP1A 1TU8A 4F0CA 4POBA 4MZCA 5DVBA 1PRXA 1FAAA 2B6MA 2HRNA 5DQSA 3IDVA 3TKRA 4WKWA 1O73A 1TJDA 2VAFA 1FG4A 3GX0A 1SU9A 3GA4A 1GUHA 2OADA 1WMJA 1HNCA 2LJRA 1YDKA 3IOSA 3QAGA 2HZFA 2NTOA 4DSSB 2R5GA 4DSRA 3US3A 4KDUA 1JLWA 3IC4A 3QD9A 3TRPA 3CRTA 5CRGA 2C0GA 2FHEA 1A8YA 2JL4A 3P2AA 3F8UA 2DJ0A 3VI7A 2H8LA 4EXJA 2YNXA 3IV4A 2GSRA 3KD0A 3LJRA 3GFKA 4JR6A 9GSSA 2CVKA 2OBKA 2V1MA 1PX7A 5AIVA 3F4SA 3GKMA 3AY8A 3ERFA 5HR3A 1OKTA 4F2IA 1V58A 2JZTA 3D6IA 6GSTA 1W4VA 4MLYA 5G2ZA 1ZYQB 1K0BA 1GSYA 3H8QA 3IPZA 4I97A 1MDKA 2H0IA 4IQAA 4JEDA 4L8EA 3L9VA 4HU9A 4AJ6A 4K0GA 5B8AA 4KA0A 2IFQB 1GTIA 5ECPB 5HR0A 4BVYB 3ZMLA 3QPMA 3KP8A 2HSMA 4OFTA 5IMFA 13GSA 2C1YA 2WZ9A 4KDYA 4YH2A 5ECRB 3GNJA 4QL7A 2HSMB 1GTAA 5KN1A 4WR4A 4IP1A 5G1LA 3C1RA 3CSHA 5F05A 2IMKA 4LMWA 1OAZA 1TI1A 2A2SA 2IL3A 2VIMA 4RQRA 1OKDA 1EWXA 2KOKA 4O92A 2KP1A 3M3MA 4PTSA 5EL8A 3EWLA 4X1UA 4ZL9A 4RI6A 1VGLA 4JZQA 4AGSA 3EC3A 2C8UA 1T4YA 2AJQB 4ZBBA 2VCWA 3HA9A 5DAKA 1XBSA 1AQVA 1SYXA 2B7KA 1J08A 5IMDA 4MDCA 2H1DA 2HZEA 17GSA 2PPTA 3G7IA 1ABAA 4GTUA 3TB2A 5DAKB 4F9ZA 4HJMA 3U6VA 4AJ7A 5ECIB 3W6GA 2HZEB 2XBIA 5AIXA 2MMNA 3TKSC 1GH2A 4V2LA 1UC7A 1M2DA 4OCFA 5ABRA 2LKUA 2FWGA 2FA8A 3C8EA 4MF6A 3R3EA 2MYGA 5D9TA 3DMLA 3ED3A 4I5QA 3DD3A 3PH9A 1QXHA 3D22A 2LTKA 4BL7A 19GSA 4J2FA 5AGYA 2LRTA 3H93A 2GGTA 3CSJA 3IBHA 3HVVA 16GSA 1R26A 1SJIA 3KP9A 5CAXA 5IIZA 4G10A 3L9UA 1H4OA 3KMOA 1SJ6A 3A2VA 4J57E 1GSEA 3FR9A 2YN1A 1XZOA 3F4RA 2E2GA 1TRWA 2N5BA 4HQZA 4N11A 1SK1A 4WEYA 3TKSA 5KN2A 1XW5A 3HJPA 1Z6NA 3J7Yb 4H86A 1DSBA 2J9HA 4HEA2 4DSQA 2VL2A 1G6YA 4XS4A 2L57A 3O3TA 3M8NA 2H19A 2BTOT 1WOUA 4K1FA 2IPAA 4KE3A 4CHSA 4IGJA 1XFLA 2DJ2A 1SL1B 2VO4A 1TOFA 1R5PA 3GTUA 1XWAA 2LQQA 2B7JA 2AAWA 3ZMKA 3GMFA 2HQTA 3FZ9A 2FWEA 1K0OA 4HS1A 1Y25A 2IWTA 5H5RA 1OC8A 2E2MA 4V2NA 2JZSA 4O32A 18GSA 2HT9A 3ZYWA 1M9BA 3R2QA 1EGRA 1GLQA 5G5FA 3L0HA 2AV4A 2X8GA 1JZWA 5ID2B 2F3MA 2CVBA 5E4WA 1GNEA 2KP2A 3HZ4A 4IJ3A 2FNOA 5DBQA 4BVXA 2JSZA 3DXBA 7GSSA 2WRTA 4NAXA 5KEJA 6GSSA 3TJJA 1Z5YE 3RDWA 1GTUA 3UMAA 4I8BA 3APQA 3KH7A 4YAPA 4CW9A 1FB0A 1IYIA 3ZRDA 2XPDA 3GURA 4KH7A 1S3CA 3DVWA 4DEJA 1TXXA 2OA7A 4V2MA 2JZRA 2YWIA 3CTGA 4KB3A 1B9XC 5AN1A 4FO5A 6GSXA 3TJKA 5EVOA 1K3OA 3LGCA 2H71A 1J0FA 2CVDA 2GQKA 3ZVJA 1XW9A 3HDCA 1QGVA 1EV9A 1XOBA 3BJ5A 2B5YA 3IE3A 1KBNA 2ZCTA 1B4QA 3TGZA 2C3NA 3VPQA 2AUVA 4BWSA 1GSDA 2EIOA 3MWHA 3UIWA 4I6XA 2YOIA 1PKZA 2GZYA 2I81A 3M1GA 4EUYA 1F6MC 2M72A 3CSIA 3QFAC 3EMXA 2VM1A 2X8HA 2BJXA 3GN3A 5F8BA 4MJEA 2B5EA 2HYXA 2L5OA 3C1SA 4GQCA 1QK8A 4ML1A 1PL1A 1SD9A 2WDUA 5JCGA 1F3BA 2F8FA 1ERUA 1FVJA 4ZBAA 1K0DA 2P0GA 3GL3A 3Q19A 2D2ZA 2TRCP 3F3RA 4K7OA 1SENA 1AIUA 1X0RA 2HRAA 2YWMA 3APOA 1X9WB 2GTUA 3F63A 5ECLB 1JFUA 4QL9A 3Q6OA 4HZ2A 3KH9A 3BCKA 1X5EA 5F0GA 1U88A 1KNGA 2LUSA 2FY6A 3I9V2 1ZZYA 3ME7A 4I2TA 1GTBA 1MD3A 2DC5A 5INYA 2AB6A 3N5OA 5CREA 2ES7A 3WGXA 1PL2A 3A2WA 3UARA 1I9DA 3DEXA 2OJLA 5IMAA 4EDYA 2R6KA 5F07A 3ZTLA 2WB9A 1XVQA 3P8WA 3QDNA 1QMVA 1CQGA 3HKRA 2PERA 2AHEA 1T8EB 1B8XA 1DUGA 4ECBA 3KZQA 4KCAA 2GVPA 1O81A 3TKQA 4HI7A 2HSHA 4KF9A 2YJHA 4IBPA 4EO3A 2NPBA 3HYPA 1OC9A 5IMZA 3KTLA 2LV3A 1EEJA 2H1AA 1M9AA 4PXOA 1G7EA 5G1KA 4EDZA 1S3AA 1VF1A 3DVXA 2HSYA 1TP9A 3P7XA 1OC9B 5D9XA 1DE1A 3TRQA 2WJUA 3APSA 1BX9A 5D93A 3P90A 1KEBA 1HYUA 1RW1A 3Q74A 1ERWA 1MTCA 3G7YA 5CRHA 2VM2A
chains in the Genus database with same CATH superfamily
2VD0A 1VRSD 3D4MA 2H73A 1YKCA 4ZBDA 3QOUA 3WT2A 2WGRA 3TJFA 2V6OA 5HFKA 3MDKA 4GRFA 5GSSA 2X4AA 4GWRA 1YJ6A 2UZ8A 3OR5A 4TKYA 2VCXA 1ZYPA 2DSAA 5IO2A 4F82A 5ENUA 4PQHA 4G9HA 2L6CA 4N0VA 1YY7A 3CBUA 2ALBA 5J9BA 1K3YA 3W8SA 1MD4A 2PVQA 1HNAA 3EU4A 4L0UA 1SD8A 3C73A 1TK0B 4TXOA 3HZ8A 1VF3A 3G9BA 1U6TA 1GWCA 2K8VA 2DMMA 3Q18A 5CP1A 1PN0A 3LXZA 2O85A 4TR3A 5IO0A 1E2YA 1JZDA 4MJAA 1Y1UA 3LSZA 1XW6A 2WS2A 1THXA 4MZWA 3L78A 3TU3B 4TVEA 2HNLA 2O36A 3O6TA 2B1KA 3IC8A 4K0NA 2H70A 3PPUA 1EP7A 3KGKA 6GSUA 5DJLA 5HFGA 2JACA 1DBYA 1SVOA 5DCHA 2X49A 1BYEA 1HQOA 4PX1A 5B7CA 1B9YC 1PFOA 1V2AA 3FY7A 4FYCA 4NV2A 3U5RE 1G6WA 2VLUA 4LA1A 1Z3EA 3FW2A 3F4TA 4EVMA 5C00A 2GS3A 3ERGA 4MJCA 4QQ7A 1BG5A 3IK9A 4FH8A 4X4JA 5JCWA 5LNKe 1AQXA 3GHAA 1YF0A 3WGDA 3C7MA 1SL0B 4PNGA 1X5CA 1I5GA 1K3LA 2H30A 3F0IA 1U3IA 2X99A 4ECIA 2FWFA 5G31A 5ECKB 4K6XA 4BIKA 2CA8A 1TK8B 4MH3A 3L4NA 3C71A 6GSVA 1U87A 3GV1A 2HXKA 1GL8A 3FRCA 2PWJA 3V1WA 4PHZC 5IPGA 1YEWC 4ZILA 1WP0A 1XVWA 1A2JA 4EE0A 2E7PA 3QR6A 5FT3A 3TCOA 4JU5A 3RPPA 2VL2C 4F0BA 5CRDA 1ILOA 1YEXA 1TRUA 5H5SA 3IHQA 4ZB8A 3HVNA 4ACSA 4MPGA 2HE3A 3IHGA 2N5AA 10GSA 4PURA 4HJ2A 1XXUA 1PGTA 1AUCA 1MEKA 2L4CA 4JRRA 12GSA 2OACA 1ERTA 1TU7A 4KX4A 4IHUA 4EIQA 4BL7B 3O76A 5IPHA 1M99A 2A4VA 3A5WA 3SBCA 2K8SA 1A23A 1M2AA 2MMAA 1BAYA 4E8EA 4LL4B 2H0GA 4YKGA 3CQFA 4XHMA 1G0TA 5B6MA 2GT5A 3GIXA 2YCDA 1GUMA 5JWQB 2O8VB 4K7IA 4EIPA 3ZVJD 4MK3A 4O5QA 2L59A 1TW9A 2QA1A 2ON7A 4TN8A 4K5SA 2PUKC 4D73A 4NV5A 3IAS2 4Q5RA 4ID0A 2VCQA 1O8XA 1HNBA 4KSMA 4GF0A 3ME8A 3LQ7A 3D21A 3I69A 2X8CA 4IN0A 2VUPA 1QUWA 4XS4B 5G5EA 1WJKA 1WRYA 1ML6A 5LD0A 4K2DA 2YWNA 4O5RA 2JADA 4E8HA 2GSSA 3JCML 2OBIA 2ZNMA 4Q5QA 4XS6A 3DRNA 5DCGA 3ZZXA 3TOTA 1V98A 2MMOA 3VFIA 4RQXA 4TR0A 2MZCA 4FXYP 1DE2A 3MYDA 2REMA 4MP4A 1EOHA 3GTUB 3VWUA 1LBKA 2BMXA 2FUG2 2IMIA 1GSQA 4NHWA 5COHA 5B6NA 5HR2A 2I4AA 5EY6A 3ZFBA 3BD2A 5ECQB 4HUAA 4ZB9A 3FR6A 1W89A 2DJKA 2DJ1A 1V40A 4POMA 5CRWA 4OFMA 1O7UA 4L5OA 2FD3A 5KOWA 2L5LA 4O7HA 1B4PA 1URMA 3H79A 2TIRA 1EV4A 4NPBA 1SKRB 3F6DA 1ERVA 4OO5A 4NMUA 2O89A 5A1NA 4BVXB 4GDFA 2H6YA 3TKPA 3GH6A 1SL2B 1XG8A 3GYKA 4FQUA 2A2RA 1PA3A 2EFHA 1N2AA 4AKXB 4L5LA 4PUFC 1ZGNA 1ACVA 2R37A 3F6FA 3IRAA 1TI3A 2CV4A 4ECCA 5EPFA 2GSQA 3GH9A 1O8WA 4ZB6A 3LG6A 2OE1A 3DIEA 4OFNA 1X9MB 1JZOA 5HQPA 4XRAA 1WWJA 5HFIA 1TDIA 4EC0A 3G7JA 1ZMAA 4KW6A 2O7KA 2KLXA 2LRNA 2XPEA 5KOXA 1Q98A 2H75A 3HVXA 2DLXA 1GRXA 4FYBA 3RHBA 1FHEA 3VPTA 4N10A 3H1NA 1U3AA 5ECMB 1AC1A 3ZIJA 1BEDA 4IP6A 5A4UA 4HU7A 1B48A 1BQ7A 3D5JA 2TRXA 5D73A 5J4YA 4ULXA 2LEGA 4LMVA 3MAKA 2C3QA 1K0NA 1WE0A 2VL3A 3F3QA 4GXZA 4WBRD 5A4WA 2LS5A 2IJYA 2YJ7A 3I43A 4IQ1A 3GRXA 3A2XA 4G0KA 3WYWA 1A0FA 2NDOA 1CQHA 5A34A 4K9ZA 5GAND 4POLA 3ZITA 2DBCA 2PMTA 3LYPA 2NVLA 2QKEA 2VKZG 1LJRA 4ECJA 1FVKA 2QC7A 3ZLPA 3EINA 1JLVA 1OE8A 4HOJA 2B5XA 3PGTA 3VWVA 5CYYA 2C80A 2EIRA 2LSTA 3CXGA 3HJOA 2HRKA 2C3TA 5L71A 4MF5A 4IS0A 1A8LA 3TUEA 1VF2A 1X9SB 2WVZA 4WF5A 2QGVA 3GSTA 3NIVA 5A5HB 2CT6A 3I6AA 2DJ3A 2J23A 2N5FA 4GQFA 1WPIA 3GKXA 1SK2A 3EU3A 5J4UA 2UV8G 2C4JA 3MSZA 4L0WA 5D9WA 2R0GA 1SYRA 2I1UA 2OKAA 2H01A 3N9JA 3QMXA 4YKFA 5E59A 3LXTA 5DDLA 11GSA 3EYTA 3ZL5A 1Z6MA 1XCCA 1MDJA 2XBQA 3HXSA 1SJZA 5DALA 4G2EA 1F2EA 2H6ZA 4N30A 2VCTA 5BMUA 2YWOA 4JR4A 1X5DA 4KSOA 1EEMA 3UVHA 1JZRA 4EL1A 4PI0C 3QAVA 5ECNB 3GSSA 1NW2A 8GSSA 2C0DA 1M7TA 5IQYA 2VOCA 1QFNA 2YP6A 2EIQA 1ZL9A 5B8BA 4TXVA 4MF7A 4MZBA 2ZUPA 4NXIA 1GSSA 5JWRB 4PQIA 3GX8A 2IMFA 3M9KA 4DSSA 5J9CA 4PUAA 1T7PB 4OCEA 3ERWA 3VI5A 1T4ZA 3CWGA 2MMZA 2PN8A 3CYNA 4Z7XA 4USSA 4Z2TA 1ZOFA 5J4VA 3WGEA 4WBJA 3KEBA 1C72A 1O85A 2VCVA 1XOAA 5ECSA 2GQMA 2K6VA 4AJ8A 2K9FA 1F9MA 4P3YB 4TXOB 3H4KA 4KCEA 1M3JA 3EURA 1RQMA 4ZL8A 2F51A 4XCSA 2KHPA 3GKKA 2JSYA 1FOVA 5GZZB 1QQ2A 2LQOA 4ZB7A 1YF1A 2CX3A 2IFQA 1A2LA 2FGXA 1EZKA 4BVYA 1AW9A 4ZL7A 2DKIA 2LRCA 5A4VA 1K0AA 1XWCA 1EGOA 4I2UA 1AAZA 3EMPA 2ON5A 4TR1A 4OMVA 2DIYA 4MCUA 1Z7RA 3CTFA 1R4WA 1GLPA 3ZIVA 3VK9A 1XIYA 2RLIA 3UBKA 2HRFA 1F37A 4TR1B 1VF4A 5ECHB 1MDIA 3LWAA 5FHIA 2V2GA 2QSIA 3ISOA 2P5QA 2LJKA 4LL1B 3KXOA 4WR5A 3IXRA 3EE2A 1NSWA 5IOXA 2MBTA 3HD5A 3FR3A 3CMIA 5DJMA 3KMNA 5F06A 2G0FA 2VLTA 3HY2A 1EP8A 1S3RA 3D4TA 1GSFA 4IVFA 3FKFA 2I3YA 4KAEA 3M0FA 1T3BA 4XTSA 4MJBA 5JWOB 2HSNA 2OE0A 5IMCA 5LCZA 2WFCA 5CO3A 1OYJA 2F8AA 2CZ3A 3J7Yk 3EVIA 2P31A 3QCPA 1RK4A 4CY8A 2HSNB 4K8MA 4TR4A 5J41A 4LLRA 4N0ZA 4Q5FA 5FWGA 2GQLA 1FB6A 3KTBA 5GAPD 2A4HA 3FZ4A 3A3TA 4NHZA 4AKGA 1KTEA 2FWHA 4HQSA 2V41A 1M0UA 1GULA 4DVCA 2P5RA 2VD1A 2H0HA 2IIYA 4G19A 2LNSA 1PD21 3HHVA 3KM6A 1ZCPA 3LEFA 3IK7A 4MA9A 1PQNA 1TKDB 4YAVA 3TRXA 2CQ9A 2IN3A 5A5KA 1PN9A 5ECOB 3E0UA 3IAM2 5G30A 1ON4A 4X0XA 3UAPA 2PVOC 3VWWA 4ZXGA 4TOPA 4GSTA 3ZFLA 2DMLA 4FIWA 1NHOA 2YZHA 1V9WA 3CRUA 4OWYA 1YQ1A 4MPFA 3DKSA 1NHYA 1M2BA 4GSNA 3WD6A 3K8NA 2FLSA 2YV7A 2A2PA 1NM3A 2G2QA 3TOUA 4TRXA 5GSTA 3QAWA 3WT1A 4BA7A 1XWBA 4D73B 1TRVA 2EC4A 4XIHA 4MMMA 1A0RP 3DGQA 2M46A 2YPMA 4AF2A 4GSSA 6GSYA 4JE1A 2WVXA 4MH2A 3UEMA 4WXTA 1PX6A 1O6JA 2B3SA 3FZAA 4Q5NA 3D0ZA 5IMVA 1SKSB 5IOWA 4XS1A 2WVXB 4PQ1A 1T1VA 1HD2A 2NBSA 1A2MA 1FW1A 2CAIA 4RI7A 1XWGA 4POKA 3FEUA 3LORA 4YQMA 3TJBA 2V6KA 3UL3A 1E6BA 4KDXA 3TJGA 3W8JA 2GZZA 4RUVA 4IELA 4J56E 3DYRA 3HVSA 3RPNA 2GDRA 5JCUA 3KIJA 3RBTA 2R4VA 2MBSA 1IYHA 4V1Ag 2B1LA 5HR1A 2KUCA 3ZREA 5ID2A 1WIKA 4NWYA 4X43A 2RIIA 2QA2A 2X64A 2L6DA 4KUNA 2V32A 4Z2RA 5IM9A 1K0MA 3FHKA 4CDOA 3LFLA 2H74A 2CX4A 5A1NB 1Z7PA 2DIZA 2EFCA 2I9HA 5J3RA 2FCHA 3F9UA 2R0CA 1GNWA 4MNNA 4V1Ap 4HSCX 3MNGA 2H72A 2C0EA 2HFDA 2CAQA 1TRSA 5KN3A 1F3AA 3FYGA 1PSQA 2GZPA 5DQYA 3BOAA 1TK5B 2WW0A 3RHCA 3NOFA 4EKZA 4BPYA 4YQVA 3M9JA 4PGTA 2WULA 4ZIJA 2H66A 3BCIA 1S4BP 1UA5A 1Z9HA 1BJXA 3VLNA 1YZXA 4XRDA 1R5AA 2DJJA 2E0QA 3MIXA 4HZ4A 4A5PA 2L4QA 4G01A 1V57A 22GSA 2K18A 1GSUA 4G0IA 1R7HA 3RAZA 1PMTA 2WCIA 1YEPA 3VWXA 3DWVA 1XWKA 1BF5A 5ELAA 1A24A 3IR4A 3PR8A 2GLRA 2R2JA 3HJMA 4WF4A 4G0LA 4MABA 3IA1A 3LYKA 2EFDA 3GL5A 2H1GA 5AISA 3TKSE 1OC3A 1TTZA 1ST9A 1J9BA 3GKNA 4IKHA 2YANA 1S3DA 3QFBC 4FYUA 2PBJA 1LU4A 2O87A 1N8JA 4PNFA 2XC2A 2RM5A 14GSA 5A34B 4BWQA 20GSA 2YZUA 5D8IA 4AI6A 2H6XA 1SKWB 5D9VA 2GSTA 4GCIA 5KN0A 1K0CA 3S9FA 2LJAA 2PGTA 1XPVA 1EOGA 4YQUA 1AQWA 2CZ2A 4TW5A 4K7NA 2FA4A 4F03A 4KNDA 2IMEA 2O5VA 1THOA 2Z9SA 1T00A 1OVNA 1OE7A 4EF0A 3E9JB 2HRKB 1PKWA 5J5NA 2R3XA 4OO4A 5CNWA 1AXDA 1ZYEA 3BBYA 2VCZA 4GLTA 5H5QA 4ML6A 1Y6EA 2H76A 2HI7A 3FMWA 5D96A 2PU9C 1FO5A 5C04A 2C0FA 1G7OA 3HCZA 3A5IA 1SK0A 2RM6A 1USBA 4JBBA 2HLSA 2JU5A 2OT3A 2AYTA 2RUEA 4KGIA 4WETA 1H75A 4HDEA 2IMDA 3E3EA 1UVZA 1GUKA 3KJYA 4ILFA 2GT6A 2H1BA 3UBLA 4IW9A 4ISDA 2M80A 2OE3A 1UN2A 1YKAA 1Q4JA 2RUFA 4IJIA 3TDGA 3UJ1A 4OD7A 3FK8A 3UOMA 2YV9A 3FZ5A 3KCMA 1M3IA 2R0PA 5ELGA 2LNTA 2XHFA 2VL9A 3GUSA 6GSWA 3NZNA 2VLVA 3UVTA 3PINA 3VURA 1JHBA 5DALB 4QMKA 2F9SA 3L9SA 3SWLA 1GP1A 1TU8A 5BMUB 1SVLA 4F0CA 4POBA 4MZCA 5DVBA 1PRXA 1FAAA 2B6MA 2HRNA 5DQSA 3IDVA 3TKRA 4WKWA 1O73A 1TJDA 2VAFA 1FG4A 3GX0A 1SU9A 3RGBC 3GA4A 1GUHA 2OADA 1WMJA 1HNCA 2LJRA 1YDKA 3IOSA 3QAGA 2HZFA 2NTOA 4DSSB 2R5GA 4DSRA 3US3A 4KDUA 1JLWA 3IC4A 3QD9A 1I1IP 3TRPA 3CRTA 5CRGA 2C0GA 2FHEA 1A8YA 2JL4A 3P2AA 3F8UA 2DJ0A 3VI7A 2H8LA 4EXJA 2YNXA 3IV4A 2GSRA 3KD0A 3LJRA 3GFKA 4JR6A 9GSSA 2CVKA 2OBKA 2V1MA 1PX7A 5AIVA 3F4SA 3GKMA 3AY8A 3ERFA 5HR3A 1OKTA 4F2IA 1V58A 2JZTA 3D6IA 6GSTA 1W4VA 4MLYA 5G2ZA 1ZYQB 1K0BA 1GSYA 3H8QA 3IPZA 4I97A 1MDKA 2H0IA 4IQAA 4JEDA 4L8EA 3L9VA 4HU9A 4AJ6A 4K0GA 5B8AA 4KA0A 2IFQB 1GTIA 5ECPB 5HR0A 4BVYB 3ZMLA 3QPMA 3KP8A 2HSMA 4OFTA 5IMFA 13GSA 4PI2C 2C1YA 2WZ9A 4KDYA 4YH2A 5ECRB 3GNJA 4QL7A 2HSMB 1GTAA 5KN1A 3CHXC 4WR4A 4IP1A 5G1LA 3C1RA 3LW9A 3CSHA 5F05A 2IMKA 4LMWA 1OAZA 1TI1A 2A2SA 2IL3A 2VIMA 4RQRA 1OKDA 1N25A 5J40A 1EWXA 2KOKA 4O92A 2KP1A 3M3MA 4PTSA 5EL8A 3EWLA 4X1UA 4ZL9A 4RI6A 1VGLA 4JZQA 4AGSA 3EC3A 2C8UA 1T4YA 2AJQB 4ZBBA 2VCWA 2WVYA 3HA9A 5DAKA 1XBSA 1AQVA 1SYXA 2B7KA 1J08A 5IMDA 4MDCA 2H1DA 2HZEA 17GSA 2PPTA 3G7IA 1ABAA 4GTUA 3TB2A 4O5UA 5DAKB 4F9ZA 4HJMA 3U6VA 4AJ7A 4CY6A 5ECIB 3W6GA 2HZEB 2XBIA 5AIXA 2MMNA 3TKSC 1GH2A 4V2LA 1UC7A 1M2DA 4OCFA 5ABRA 2LKUA 2FWGA 2FA8A 3C8EA 4MF6A 3R3EA 2MYGA 5D9TA 3DMLA 3ED3A 4I5QA 3DD3A 3PH9A 1QXHA 3D22A 2LTKA 4BL7A 19GSA 4J2FA 5AGYA 2LRTA 3H93A 2GGTA 3CSJA 3IBHA 5J47A 3HVVA 16GSA 4E68A 1R26A 1SJIA 3KP9A 5CAXA 5IIZA 1SVMA 4G10A 3L9UA 1H4OA 3KMOA 1SJ6A 3A2VA 4J57E 1GSEA 3FR9A 2YN1A 4N3ZA 1XZOA 3F4RA 2E2GA 1TRWA 2N5BA 4HQZA 4N11A 2WW2A 1SK1A 4WEYA 3TKSA 5KN2A 1XW5A 3HJPA 1Z6NA 2WW3A 3J7Yb 4H86A 1DSBA 2J9HA 4HEA2 4DSQA 2VL2A 1G6YA 4XS4A 2L57A 3O3TA 3M8NA 2H19A 2BTOT 1WOUA 4K1FA 1ZYNA 2IPAA 4KE3A 4CHSA 4IGJA 1XFLA 2DJ2A 1SL1B 2VO4A 1TOFA 1R5PA 3GTUA 1XWAA 2LQQA 2B7JA 2AAWA 3ZMKA 3GMFA 2HQTA 3FZ9A 2FWEA 1K0OA 4HS1A 1Y25A 2IWTA 5H5RA 1OC8A 2E2MA 4V2NA 2JZSA 4O32A 18GSA 2HT9A 3ZYWA 1M9BA 3R2QA 1EGRA 1GLQA 5G5FA 3L0HA 2AV4A 2X8GA 1JZWA 5ID2B 2F3MA 2CVBA 5E4WA 1GNEA 2KP2A 3HZ4A 4IJ3A 2FNOA 1YVLA 5DBQA 4BVXA 2JSZA 4Z2UA 4AKIA 3DXBA 7GSSA 2WRTA 3HMJG 4NAXA 4AKHA 5KEJA 6GSSA 3TJJA 1Z5YE 3RDWA 1GTUA 4K2XA 3UMAA 4I8BA 3APQA 3KH7A 4YAPA 4CW9A 1FB0A 1IYIA 3ZRDA 2XPDA 3GURA 4KH7A 1S3CA 3DVWA 4DEJA 1TXXA 2OA7A 4V2MA 1BG1A 2JZRA 2YWIA 2WW1A 3CTGA 4KB3A 1B9XC 5AN1A 4FO5A 6GSXA 3TJKA 5EVOA 1K3OA 3LGCA 2H71A 1J0FA 2CVDA 4W66A 2GQKA 3ZVJA 1XW9A 3HDCA 1QGVA 1EV9A 1XOBA 3BJ5A 2B5YA 3IE3A 1KBNA 2ZCTA 1B4QA 3TGZA 2C3NA 3VPQA 2AUVA 4BWSA 1GSDA 2EIOA 2DKHA 3MWHA 3UIWA 4I6XA 2YOIA 2H1LA 1PKZA 2GZYA 2I81A 3M1GA 4EUYA 1F6MC 2M72A 3CSIA 3QFAC 3EMXA 2VM1A 2X8HA 2BJXA 3GN3A 5F8BA 4MJEA 2B5EA 2HYXA 2L5OA 3C1SA 3RFRC 4GQCA 1QK8A 4ML1A 1PL1A 1SD9A 2WDUA 5JCGA 1F3BA 2F8FA 1ERUA 1FVJA 4ZBAA 1K0DA 2P0GA 3GL3A 3Q19A 2D2ZA 2TRCP 3F3RA 4ICYA 4K7OA 1SENA 1AIUA 1FOHA 1X0RA 2HRAA 2YWMA 3APOA 1X9WB 2GTUA 3F63A 5ECLB 1JFUA 4QL9A 3Q6OA 4HZ2A 3KH9A 3BCKA 1X5EA 5F0GA 1U88A 1KNGA 3I9V2 2FY6A 2LUSA 1ZZYA 3ME7A 4I2TA 1GTBA 1TXUA 1MD3A 2DC5A 5A5HA 5INYA 2AB6A 4K5RA 3N5OA 5CREA 2ES7A 3WGXA 1PL2A 3A2WA 3UARA 1I9DA 2EFEA 3DEXA 2OJLA 5IMAA 4EDYA 2R6KA 5F07A 3ZTLA 2WB9A 1XVQA 3P8WA 3QDNA 1QMVA 2WZSA 1CQGA 3HKRA 3EPTA 2PERA 2AHEA 1T8EB 1B8XA 1DUGA 4ECBA 3KZQA 4KCAA 2GVPA 1O81A 3TKQA 4HI7A 2HSHA 4KF9A 5BRTA 2YJHA 4IBPA 4EO3A 2NPBA 3HYPA 2O3EA 1OC9A 5IMZA 3KTLA 2LV3A 1EEJA 2H1AA 1M9AA 4PXOA 1G7EA 5G1KA 4EDZA 1S3AA 1VF1A 3DVXA 2HSYA 1TP9A 3P7XA 1OC9B 5D9XA 1DE1A 3TRQA 2WJUA 3APSA 1BX9A 5D93A 3P90A 1KEBA 1HYUA 1RW1A 3Q74A 1ERWA 1MTCA 3G7YA 5CRHA 2VM2A
chains in the Genus database with same CATH topology
2VD0A 1VRSD 3D4MA 2H73A 1YKCA 4ZBDA 3QOUA 3WT2A 2WGRA 3TJFA 2V6OA 5HFKA 3MDKA 4GRFA 5GSSA 2X4AA 4GWRA 1YJ6A 2UZ8A 3OR5A 4TKYA 2VCXA 1ZYPA 2DSAA 5IO2A 4F82A 5ENUA 4PQHA 4G9HA 2L6CA 4N0VA 1YY7A 3CBUA 2ALBA 5J9BA 1K3YA 3W8SA 1MD4A 2PVQA 1HNAA 3EU4A 4L0UA 1SD8A 3C73A 1TK0B 4TXOA 3HZ8A 1VF3A 3G9BA 1U6TA 1GWCA 2K8VA 2DMMA 3Q18A 5CP1A 1PN0A 3LXZA 2O85A 4TR3A 5IO0A 1E2YA 1JZDA 4MJAA 1Y1UA 3LSZA 1XW6A 2WS2A 1THXA 4MZWA 3L78A 3TU3B 4TVEA 2HNLA 3O6TA 2B1KA 3IC8A 4K0NA 2H70A 3PPUA 1EP7A 3KGKA 6GSUA 5DJLA 5HFGA 2JACA 1DBYA 1SVOA 5DCHA 2X49A 1BYEA 1HQOA 4PX1A 5B7CA 1B9YC 1V2AA 3FY7A 4FYCA 4NV2A 3U5RE 1G6WA 2VLUA 4LA1A 1Z3EA 3FW2A 3F4TA 4EVMA 5C00A 2GS3A 3ERGA 4MJCA 4QQ7A 1BG5A 3IK9A 4FH8A 4X4JA 5JCWA 5LNKe 1AQXA 3GHAA 1YF0A 3WGDA 3C7MA 1SL0B 4PNGA 1X5CA 1I5GA 1K3LA 2H30A 3F0IA 1U3IA 2X99A 4ECIA 2FWFA 5G31A 5ECKB 4K6XA 2CA8A 1TK8B 4MH3A 3L4NA 3C71A 6GSVA 1U87A 3GV1A 2HXKA 1GL8A 3FRCA 2PWJA 3V1WA 5IPGA 4ZILA 1WP0A 1XVWA 1A2JA 4EE0A 2E7PA 3QR6A 5FT3A 3TCOA 4JU5A 3RPPA 2VL2C 4F0BA 5CRDA 1ILOA 1YEXA 1TRUA 5H5SA 3IHQA 4ZB8A 4ACSA 4MPGA 2HE3A 3IHGA 2N5AA 10GSA 4PURA 4HJ2A 1XXUA 1PGTA 1AUCA 1MEKA 2L4CA 4JRRA 12GSA 2OACA 1ERTA 1TU7A 4KX4A 4IHUA 4EIQA 4BL7B 3O76A 5IPHA 1M99A 2A4VA 3A5WA 3SBCA 2K8SA 1A23A 1M2AA 2MMAA 1BAYA 4E8EA 4LL4B 2H0GA 4YKGA 4XHMA 1G0TA 5B6MA 2GT5A 3GIXA 2YCDA 1GUMA 5JWQB 2O8VB 4K7IA 4EIPA 3ZVJD 4MK3A 4O5QA 2L59A 1TW9A 2QA1A 2ON7A 4TN8A 4K5SA 2PUKC 4D73A 4NV5A 3IAS2 4Q5RA 4ID0A 2VCQA 1O8XA 1HNBA 4KSMA 4GF0A 3ME8A 3LQ7A 3D21A 3I69A 2X8CA 4IN0A 2VUPA 1QUWA 4XS4B 5G5EA 1WJKA 1WRYA 1ML6A 5LD0A 4K2DA 2YWNA 4O5RA 2JADA 4E8HA 2GSSA 3JCML 2OBIA 2ZNMA 4Q5QA 4XS6A 3DRNA 5DCGA 3ZZXA 3TOTA 1V98A 2MMOA 3VFIA 4RQXA 4TR0A 2MZCA 1DE2A 3MYDA 2REMA 4MP4A 1EOHA 3GTUB 3VWUA 1LBKA 2BMXA 2FUG2 2IMIA 1GSQA 4NHWA 5COHA 5B6NA 5HR2A 2I4AA 5EY6A 3ZFBA 3BD2A 5ECQB 4HUAA 4ZB9A 3FR6A 1W89A 2DJKA 2DJ1A 1V40A 4POMA 5CRWA 4OFMA 1O7UA 4L5OA 2FD3A 5KOWA 2L5LA 4O7HA 1B4PA 1URMA 3H79A 2TIRA 1EV4A 4NPBA 1SKRB 3F6DA 1ERVA 4OO5A 4NMUA 2O89A 5A1NA 4BVXB 4GDFA 2H6YA 3TKPA 3GH6A 1SL2B 3GYKA 4FQUA 2A2RA 1PA3A 2EFHA 1N2AA 4AKXB 4L5LA 4PUFC 1ZGNA 1ACVA 2R37A 3F6FA 3IRAA 1TI3A 2CV4A 4ECCA 5EPFA 2GSQA 3GH9A 1O8WA 4ZB6A 3LG6A 2OE1A 3DIEA 4OFNA 1X9MB 1JZOA 5HQPA 4XRAA 1WWJA 5HFIA 1TDIA 4EC0A 3G7JA 1ZMAA 4KW6A 2O7KA 2KLXA 2LRNA 2XPEA 5KOXA 1Q98A 2H75A 3HVXA 2DLXA 1GRXA 4FYBA 3RHBA 1FHEA 3VPTA 4N10A 3H1NA 1U3AA 5ECMB 1AC1A 3ZIJA 1BEDA 4IP6A 5A4UA 4HU7A 1B48A 1BQ7A 3D5JA 2TRXA 5D73A 5J4YA 4ULXA 2LEGA 4LMVA 3MAKA 2C3QA 1K0NA 1WE0A 2VL3A 3F3QA 4GXZA 4WBRD 5A4WA 2LS5A 2IJYA 2YJ7A 3I43A 4IQ1A 3GRXA 3A2XA 4G0KA 3WYWA 1A0FA 2NDOA 1CQHA 5A34A 4K9ZA 5GAND 4POLA 3ZITA 2DBCA 2PMTA 3LYPA 2NVLA 2QKEA 2VKZG 1LJRA 4ECJA 1FVKA 2QC7A 3ZLPA 3EINA 1JLVA 1OE8A 4HOJA 2B5XA 3PGTA 3VWVA 5CYYA 2C80A 2EIRA 2LSTA 3CXGA 3HJOA 2HRKA 2C3TA 5L71A 4MF5A 4IS0A 1A8LA 3TUEA 1VF2A 1X9SB 4WF5A 2QGVA 3GSTA 3NIVA 5A5HB 2CT6A 3I6AA 2DJ3A 2J23A 2N5FA 4GQFA 1WPIA 3GKXA 1SK2A 3EU3A 5J4UA 2UV8G 2C4JA 3MSZA 4L0WA 5D9WA 2R0GA 1SYRA 2I1UA 2OKAA 2H01A 3N9JA 3QMXA 4YKFA 5E59A 3LXTA 5DDLA 11GSA 3EYTA 3ZL5A 1Z6MA 1XCCA 1MDJA 2XBQA 3HXSA 1SJZA 5DALA 4G2EA 1F2EA 2H6ZA 4N30A 2VCTA 5BMUA 2YWOA 4JR4A 1X5DA 4KSOA 1EEMA 3UVHA 1JZRA 4EL1A 3QAVA 5ECNB 3GSSA 1NW2A 8GSSA 2C0DA 1M7TA 5IQYA 2VOCA 1QFNA 2YP6A 2EIQA 1ZL9A 5B8BA 4TXVA 4MF7A 4MZBA 2ZUPA 4NXIA 1GSSA 5JWRB 4PQIA 3GX8A 2IMFA 3M9KA 4DSSA 5J9CA 4PUAA 1T7PB 4OCEA 3ERWA 3VI5A 1T4ZA 3CWGA 2MMZA 2PN8A 3CYNA 4Z7XA 4USSA 4Z2TA 1ZOFA 5J4VA 3WGEA 4WBJA 3KEBA 1C72A 1O85A 2VCVA 1XOAA 5ECSA 2GQMA 2K6VA 4AJ8A 2K9FA 1F9MA 4P3YB 4TXOB 3H4KA 4KCEA 3EURA 1RQMA 4ZL8A 2F51A 4XCSA 2KHPA 3GKKA 2JSYA 1FOVA 5GZZB 1QQ2A 2LQOA 4ZB7A 1YF1A 2CX3A 2IFQA 1A2LA 2FGXA 1EZKA 4BVYA 1AW9A 4ZL7A 2DKIA 2LRCA 5A4VA 1K0AA 1XWCA 1EGOA 4I2UA 1AAZA 3EMPA 2ON5A 4TR1A 4OMVA 2DIYA 4MCUA 1Z7RA 3CTFA 1R4WA 1GLPA 3ZIVA 3VK9A 1XIYA 2RLIA 3UBKA 2HRFA 1F37A 4TR1B 1VF4A 5ECHB 1MDIA 3LWAA 5FHIA 2V2GA 2QSIA 3ISOA 2P5QA 2LJKA 4LL1B 3KXOA 4WR5A 3IXRA 3EE2A 1NSWA 5IOXA 2MBTA 3HD5A 3FR3A 3CMIA 5DJMA 3KMNA 5F06A 2G0FA 2VLTA 3HY2A 1EP8A 3D4TA 1GSFA 4IVFA 3FKFA 2I3YA 4KAEA 3M0FA 1T3BA 4XTSA 4MJBA 5JWOB 2HSNA 2OE0A 5IMCA 5LCZA 2WFCA 5CO3A 1OYJA 2F8AA 2CZ3A 3J7Yk 3EVIA 2P31A 3QCPA 1RK4A 4CY8A 2HSNB 4K8MA 4TR4A 5J41A 4LLRA 4N0ZA 4Q5FA 5FWGA 2GQLA 1FB6A 3KTBA 5GAPD 2A4HA 3FZ4A 3A3TA 4NHZA 4AKGA 1KTEA 2FWHA 4HQSA 2V41A 1M0UA 1GULA 4DVCA 2P5RA 2VD1A 2H0HA 2IIYA 4G19A 2LNSA 1PD21 3HHVA 3KM6A 1ZCPA 3LEFA 3IK7A 4MA9A 1PQNA 1TKDB 4YAVA 3TRXA 2CQ9A 2IN3A 5A5KA 1PN9A 5ECOB 3E0UA 3IAM2 5G30A 1ON4A 4X0XA 3UAPA 2PVOC 3VWWA 4ZXGA 4TOPA 4GSTA 3ZFLA 2DMLA 4FIWA 1NHOA 2YZHA 1V9WA 3CRUA 4OWYA 1YQ1A 4MPFA 3DKSA 1NHYA 1M2BA 4GSNA 3WD6A 3K8NA 2FLSA 2YV7A 2A2PA 1NM3A 2G2QA 3TOUA 4TRXA 5GSTA 3QAWA 3WT1A 4BA7A 1XWBA 4D73B 1TRVA 2EC4A 4XIHA 4MMMA 1A0RP 3DGQA 2M46A 2YPMA 4AF2A 4GSSA 6GSYA 4JE1A 4MH2A 3UEMA 4WXTA 1PX6A 1O6JA 2B3SA 3FZAA 4Q5NA 3D0ZA 5IMVA 1SKSB 5IOWA 4XS1A 4PQ1A 1T1VA 1HD2A 2NBSA 1A2MA 1FW1A 2CAIA 4RI7A 1XWGA 4POKA 3FEUA 3LORA 4YQMA 3TJBA 2V6KA 3UL3A 1E6BA 4KDXA 3TJGA 3W8JA 2GZZA 4RUVA 4IELA 4J56E 3DYRA 3HVSA 3RPNA 2GDRA 5JCUA 3KIJA 3RBTA 2R4VA 2MBSA 1IYHA 4V1Ag 2B1LA 5HR1A 2KUCA 3ZREA 5ID2A 1WIKA 4NWYA 4X43A 2RIIA 2QA2A 2X64A 2L6DA 4KUNA 2V32A 4Z2RA 5IM9A 1K0MA 3FHKA 4CDOA 3LFLA 2H74A 2CX4A 5A1NB 1Z7PA 2DIZA 2EFCA 2I9HA 5J3RA 2FCHA 3F9UA 2R0CA 1GNWA 4MNNA 4V1Ap 3MNGA 2H72A 2C0EA 2HFDA 2CAQA 1TRSA 5KN3A 1F3AA 3FYGA 1PSQA 2GZPA 5DQYA 3BOAA 1TK5B 3RHCA 3NOFA 4EKZA 4BPYA 4YQVA 3M9JA 4PGTA 2WULA 4ZIJA 2H66A 3BCIA 1UA5A 1Z9HA 1BJXA 3VLNA 1YZXA 4XRDA 1R5AA 2DJJA 2E0QA 3MIXA 4HZ4A 4A5PA 2L4QA 4G01A 1V57A 22GSA 2K18A 1GSUA 4G0IA 1R7HA 3RAZA 1PMTA 2WCIA 1YEPA 3VWXA 3DWVA 1XWKA 1BF5A 5ELAA 1A24A 3IR4A 3PR8A 2GLRA 2R2JA 3HJMA 4WF4A 4G0LA 4MABA 3IA1A 3LYKA 2EFDA 3GL5A 2H1GA 5AISA 3TKSE 1OC3A 1TTZA 1ST9A 1J9BA 3GKNA 4IKHA 2YANA 1S3DA 3QFBC 4FYUA 2PBJA 1LU4A 2O87A 1N8JA 4PNFA 2XC2A 2RM5A 14GSA 5A34B 4BWQA 20GSA 2YZUA 5D8IA 4AI6A 2H6XA 1SKWB 5D9VA 2GSTA 4GCIA 5KN0A 1K0CA 3S9FA 2LJAA 2PGTA 1XPVA 1EOGA 4YQUA 1AQWA 2CZ2A 4TW5A 4K7NA 2FA4A 4F03A 4KNDA 2IMEA 2O5VA 1THOA 2Z9SA 1T00A 1OVNA 1OE7A 4EF0A 3E9JB 2HRKB 1PKWA 5J5NA 2R3XA 4OO4A 5CNWA 1AXDA 1ZYEA 3BBYA 2VCZA 4GLTA 5H5QA 4ML6A 1Y6EA 2H76A 2HI7A 3FMWA 5D96A 2PU9C 1FO5A 5C04A 2C0FA 1G7OA 3HCZA 3A5IA 1SK0A 2RM6A 1USBA 4JBBA 2HLSA 2JU5A 2OT3A 2AYTA 2RUEA 4KGIA 4WETA 1H75A 4HDEA 2IMDA 3E3EA 1UVZA 1GUKA 3KJYA 4ILFA 2GT6A 2H1BA 3UBLA 4IW9A 4ISDA 2M80A 2OE3A 1UN2A 1YKAA 1Q4JA 2RUFA 4IJIA 3TDGA 3UJ1A 4OD7A 3FK8A 3UOMA 2YV9A 3FZ5A 3KCMA 2R0PA 5ELGA 2LNTA 2XHFA 2VL9A 3GUSA 6GSWA 3NZNA 2VLVA 3UVTA 3PINA 3VURA 1JHBA 5DALB 4QMKA 2F9SA 3L9SA 3SWLA 1GP1A 1TU8A 5BMUB 1SVLA 4F0CA 4POBA 4MZCA 5DVBA 1PRXA 1FAAA 2B6MA 2HRNA 5DQSA 3IDVA 3TKRA 4WKWA 1O73A 1TJDA 2VAFA 1FG4A 3GX0A 1SU9A 3GA4A 1GUHA 2OADA 1WMJA 1HNCA 2LJRA 1YDKA 3IOSA 3QAGA 2HZFA 2NTOA 4DSSB 2R5GA 4DSRA 3US3A 4KDUA 1JLWA 3IC4A 3QD9A 3TRPA 3CRTA 5CRGA 2C0GA 2FHEA 1A8YA 2JL4A 3P2AA 3F8UA 2DJ0A 3VI7A 2H8LA 4EXJA 2YNXA 3IV4A 2GSRA 3KD0A 3LJRA 3GFKA 4JR6A 9GSSA 2CVKA 2OBKA 2V1MA 1PX7A 5AIVA 3F4SA 3GKMA 3AY8A 3ERFA 5HR3A 1OKTA 4F2IA 1V58A 2JZTA 3D6IA 6GSTA 1W4VA 4MLYA 5G2ZA 1ZYQB 1K0BA 1GSYA 3H8QA 3IPZA 4I97A 1MDKA 2H0IA 4IQAA 4JEDA 4L8EA 3L9VA 4HU9A 4AJ6A 4K0GA 5B8AA 4KA0A 2IFQB 1GTIA 5ECPB 5HR0A 4BVYB 3ZMLA 3QPMA 3KP8A 2HSMA 4OFTA 5IMFA 13GSA 2C1YA 2WZ9A 4KDYA 4YH2A 5ECRB 3GNJA 4QL7A 2HSMB 1GTAA 5KN1A 4WR4A 4IP1A 5G1LA 3C1RA 3LW9A 3CSHA 5F05A 2IMKA 4LMWA 1OAZA 1TI1A 2A2SA 2IL3A 2VIMA 4RQRA 1OKDA 1N25A 5J40A 1EWXA 2KOKA 4O92A 2KP1A 3M3MA 4PTSA 5EL8A 3EWLA 4X1UA 4ZL9A 4RI6A 1VGLA 4JZQA 4AGSA 3EC3A 2C8UA 1T4YA 2AJQB 4ZBBA 2VCWA 3HA9A 5DAKA 1XBSA 1AQVA 1SYXA 2B7KA 1J08A 5IMDA 4MDCA 2H1DA 2HZEA 17GSA 2PPTA 3G7IA 1ABAA 4GTUA 3TB2A 4O5UA 5DAKB 4F9ZA 4HJMA 3U6VA 4AJ7A 4CY6A 5ECIB 3W6GA 2HZEB 2XBIA 5AIXA 2MMNA 3TKSC 1GH2A 4V2LA 1UC7A 1M2DA 4OCFA 5ABRA 2LKUA 2FWGA 2FA8A 3C8EA 4MF6A 3R3EA 2MYGA 5D9TA 3DMLA 3ED3A 4I5QA 3DD3A 3PH9A 1QXHA 3D22A 2LTKA 4BL7A 19GSA 4J2FA 5AGYA 2LRTA 3H93A 2GGTA 3CSJA 3IBHA 5J47A 3HVVA 16GSA 4E68A 1R26A 1SJIA 3KP9A 5CAXA 5IIZA 1SVMA 4G10A 3L9UA 1H4OA 3KMOA 1SJ6A 3A2VA 4J57E 1GSEA 3FR9A 2YN1A 4N3ZA 1XZOA 3F4RA 2E2GA 1TRWA 2N5BA 4HQZA 4N11A 1SK1A 4WEYA 3TKSA 5KN2A 1XW5A 3HJPA 1Z6NA 3J7Yb 4H86A 1DSBA 2J9HA 4HEA2 4DSQA 2VL2A 1G6YA 4XS4A 2L57A 3O3TA 3M8NA 2H19A 2BTOT 1WOUA 4K1FA 1ZYNA 2IPAA 4KE3A 4CHSA 4IGJA 1XFLA 2DJ2A 1SL1B 2VO4A 1TOFA 1R5PA 3GTUA 1XWAA 2LQQA 2B7JA 2AAWA 3ZMKA 3GMFA 2HQTA 3FZ9A 2FWEA 1K0OA 4HS1A 1Y25A 2IWTA 5H5RA 1OC8A 2E2MA 4V2NA 2JZSA 4O32A 18GSA 2HT9A 3ZYWA 1M9BA 3R2QA 1EGRA 1GLQA 5G5FA 3L0HA 2AV4A 2X8GA 1JZWA 5ID2B 2F3MA 2CVBA 5E4WA 1GNEA 2KP2A 3HZ4A 4IJ3A 2FNOA 1YVLA 5DBQA 4BVXA 2JSZA 4Z2UA 4AKIA 3DXBA 7GSSA 2WRTA 3HMJG 4NAXA 4AKHA 5KEJA 6GSSA 3TJJA 1Z5YE 3RDWA 1GTUA 4K2XA 3UMAA 4I8BA 3APQA 3KH7A 4YAPA 4CW9A 1FB0A 1IYIA 3ZRDA 2XPDA 3GURA 4KH7A 1S3CA 3DVWA 4DEJA 1TXXA 2OA7A 4V2MA 1BG1A 2JZRA 2YWIA 3CTGA 4KB3A 1B9XC 5AN1A 4FO5A 6GSXA 3TJKA 5EVOA 1K3OA 3LGCA 2H71A 1J0FA 2CVDA 4W66A 2GQKA 3ZVJA 1XW9A 3HDCA 1QGVA 1EV9A 1XOBA 3BJ5A 2B5YA 3IE3A 1KBNA 2ZCTA 1B4QA 3TGZA 2C3NA 3VPQA 2AUVA 4BWSA 1GSDA 2EIOA 2DKHA 3MWHA 3UIWA 4I6XA 2YOIA 2H1LA 1PKZA 2GZYA 2I81A 3M1GA 4EUYA 1F6MC 2M72A 3CSIA 3QFAC 3EMXA 2VM1A 2X8HA 2BJXA 3GN3A 5F8BA 4MJEA 2B5EA 2HYXA 2L5OA 3C1SA 4GQCA 1QK8A 4ML1A 1PL1A 1SD9A 2WDUA 5JCGA 1F3BA 2F8FA 1ERUA 1FVJA 4ZBAA 1K0DA 2P0GA 3GL3A 3Q19A 2D2ZA 2TRCP 3F3RA 4ICYA 4K7OA 1SENA 1AIUA 1FOHA 1X0RA 2HRAA 2YWMA 3APOA 1X9WB 2GTUA 3F63A 5ECLB 1JFUA 4QL9A 3Q6OA 4HZ2A 3KH9A 3BCKA 1X5EA 5F0GA 1U88A 1KNGA 3I9V2 2FY6A 2LUSA 1ZZYA 3ME7A 4I2TA 1GTBA 1TXUA 1MD3A 2DC5A 5A5HA 5INYA 2AB6A 4K5RA 3N5OA 5CREA 2ES7A 3WGXA 1PL2A 3A2WA 3UARA 1I9DA 2EFEA 3DEXA 2OJLA 5IMAA 4EDYA 2R6KA 5F07A 3ZTLA 2WB9A 1XVQA 3P8WA 3QDNA 1QMVA 1CQGA 3HKRA 3EPTA 2PERA 2AHEA 1T8EB 1B8XA 1DUGA 4ECBA 3KZQA 4KCAA 2GVPA 1O81A 3TKQA 4HI7A 2HSHA 4KF9A 5BRTA 2YJHA 4IBPA 4EO3A 2NPBA 3HYPA 1OC9A 5IMZA 3KTLA 2LV3A 1EEJA 2H1AA 1M9AA 4PXOA 1G7EA 5G1KA 4EDZA 1S3AA 1VF1A 3DVXA 2HSYA 1TP9A 3P7XA 1OC9B 5D9XA 1DE1A 3TRQA 2WJUA 3APSA 1BX9A 5D93A 3P90A 1KEBA 1HYUA 1RW1A 3Q74A 1ERWA 1MTCA 3G7YA 5CRHA 2VM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VD0 A;  1VRS D;  3D4M A;  2H73 A;  1YKC A;  4ZBD A;  3QOU A;  3WT2 A;  2WGR A;  3TJF A;  2V6O A;  5HFK A;  3MDK A;  4GRF A;  5GSS A;  4GWR A;  1YJ6 A;  2UZ8 A;  3OR5 A;  4TKY A;  2VCX A;  2DSA A;  5IO2 A;  4F82 A;  5ENU A;  4PQH A;  4G9H A;  2L6C A;  4N0V A;  1YY7 A;  3CBU A;  2ALB A;  5J9B A;  1K3Y A;  3W8S A;  1MD4 A;  2PVQ A;  1HNA A;  3EU4 A;  4L0U A;  1SD8 A;  3C73 A;  1TK0 B;  4TXO A;  3HZ8 A;  1VF3 A;  3G9B A;  1U6T A;  1GWC A;  2K8V A;  2DMM A;  3Q18 A;  5CP1 A;  3LXZ A;  2O85 A;  4TR3 A;  5IO0 A;  1E2Y A;  1JZD A;  4MJA A;  3LSZ A;  1XW6 A;  2WS2 A;  1THX A;  4MZW A;  3L78 A;  4TVE A;  2HNL A;  3O6T A;  2B1K A;  3IC8 A;  4K0N A;  2H70 A;  3PPU A;  1EP7 A;  3KGK A;  6GSU A;  5DJL A;  5HFG A;  2JAC A;  1DBY A;  5DCH A;  1BYE A;  1HQO A;  4PX1 A;  5B7C A;  1B9Y C;  1V2A A;  3FY7 A;  4FYC A;  4NV2 A;  3U5R E;  1G6W A;  2VLU A;  4LA1 A;  1Z3E A;  3FW2 A;  3F4T A;  4EVM A;  5C00 A;  2GS3 A;  3ERG A;  4MJC A;  4QQ7 A;  1BG5 A;  3IK9 A;  4FH8 A;  5JCW A;  5LNK e;  1AQX A;  3GHA A;  1YF0 A;  3WGD A;  3C7M A;  1SL0 B;  4PNG A;  1X5C A;  1I5G A;  1K3L A;  2H30 A;  3F0I A;  1U3I A;  2X99 A;  4ECI A;  2FWF A;  5G31 A;  5ECK B;  4K6X A;  2CA8 A;  1TK8 B;  4MH3 A;  3L4N A;  3C71 A;  6GSV A;  1U87 A;  3GV1 A;  2HXK A;  1GL8 A;  3FRC A;  2PWJ A;  3V1W A;  5IPG A;  4ZIL A;  1WP0 A;  1XVW A;  1A2J A;  4EE0 A;  2E7P A;  3QR6 A;  5FT3 A;  3TCO A;  4JU5 A;  3RPP A;  2VL2 C;  4F0B A;  5CRD A;  1ILO A;  1YEX A;  1TRU A;  5H5S A;  3IHQ A;  4ZB8 A;  4ACS A;  4MPG A;  2HE3 A;  2N5A A;  10GS A;  4PUR A;  4HJ2 A;  1XXU A;  1PGT A;  1AUC A;  1MEK A;  2L4C A;  4JRR A;  12GS A;  2OAC A;  1ERT A;  1TU7 A;  4KX4 A;  4IHU A;  4BL7 B;  3O76 A;  5IPH A;  1M99 A;  2A4V A;  3A5W A;  3SBC A;  2K8S A;  1A23 A;  1M2A A;  2MMA A;  1BAY A;  4E8E A;  4LL4 B;  2H0G A;  4XHM A;  1G0T A;  5B6M A;  2GT5 A;  3GIX A;  2YCD A;  1GUM A;  5JWQ B;  2O8V B;  4K7I A;  3ZVJ D;  4MK3 A;  2L59 A;  1TW9 A;  2ON7 A;  4TN8 A;  2PUK C;  4D73 A;  4NV5 A;  3IAS 2;  4Q5R A;  4ID0 A;  2VCQ A;  1O8X A;  1HNB A;  4KSM A;  4GF0 A;  3ME8 A;  3LQ7 A;  3D21 A;  3I69 A;  2X8C A;  4IN0 A;  2VUP A;  1QUW A;  4XS4 B;  5G5E A;  1WJK A;  1WRY A;  1ML6 A;  5LD0 A;  4K2D A;  2YWN A;  4O5R A;  2JAD A;  4E8H A;  2GSS A;  3JCM L;  2OBI A;  2ZNM A;  4Q5Q A;  4XS6 A;  3DRN A;  5DCG A;  3ZZX A;  3TOT A;  1V98 A;  2MMO A;  3VFI A;  4RQX A;  4TR0 A;  2MZC A;  1DE2 A;  2REM A;  4MP4 A;  1EOH A;  3GTU B;  3VWU A;  1LBK A;  2BMX A;  2FUG 2;  2IMI A;  1GSQ A;  4NHW A;  5COH A;  5B6N A;  5HR2 A;  2I4A A;  5EY6 A;  3ZFB A;  3BD2 A;  5ECQ B;  4HUA A;  4ZB9 A;  3FR6 A;  1W89 A;  2DJK A;  2DJ1 A;  1V40 A;  4POM A;  5CRW A;  4OFM A;  1O7U A;  4L5O A;  2FD3 A;  2L5L A;  4O7H A;  1B4P A;  1URM A;  3H79 A;  2TIR A;  1EV4 A;  4NPB A;  1SKR B;  3F6D A;  1ERV A;  4OO5 A;  4NMU A;  2O89 A;  4BVX B;  2H6Y A;  3TKP A;  3GH6 A;  1SL2 B;  3GYK A;  4FQU A;  2A2R A;  1PA3 A;  1N2A A;  4L5L A;  4PUF C;  1ZGN A;  1ACV A;  2R37 A;  3F6F A;  3IRA A;  1TI3 A;  2CV4 A;  4ECC A;  5EPF A;  2GSQ A;  3GH9 A;  1O8W A;  4ZB6 A;  3LG6 A;  2OE1 A;  3DIE A;  4OFN A;  1X9M B;  1JZO A;  5HQP A;  4XRA A;  1WWJ A;  5HFI A;  1TDI A;  4EC0 A;  3G7J A;  1ZMA A;  4KW6 A;  2O7K A;  2KLX A;  2LRN A;  2XPE A;  1Q98 A;  2H75 A;  3HVX A;  2DLX A;  1GRX A;  4FYB A;  3RHB A;  1FHE A;  3VPT A;  4N10 A;  3H1N A;  1U3A A;  5ECM B;  1AC1 A;  3ZIJ A;  1BED A;  4IP6 A;  5A4U A;  4HU7 A;  1B48 A;  1BQ7 A;  3D5J A;  2TRX A;  5D73 A;  4ULX A;  2LEG A;  4LMV A;  3MAK A;  2C3Q A;  1K0N A;  1WE0 A;  2VL3 A;  3F3Q A;  4GXZ A;  4WBR D;  5A4W A;  2LS5 A;  2IJY A;  2YJ7 A;  3I43 A;  4IQ1 A;  3GRX A;  3A2X A;  4G0K A;  3WYW A;  1A0F A;  2NDO A;  1CQH A;  4K9Z A;  5GAN D;  4POL A;  3ZIT A;  2DBC A;  2PMT A;  3LYP A;  2NVL A;  2QKE A;  1LJR A;  4ECJ A;  1FVK A;  2QC7 A;  3ZLP A;  3EIN A;  1JLV A;  1OE8 A;  4HOJ A;  2B5X A;  3PGT A;  3VWV A;  5CYY A;  2C80 A;  2EIR A;  2LST A;  3CXG A;  3HJO A;  2HRK A;  2C3T A;  5L71 A;  4MF5 A;  4IS0 A;  1A8L A;  3TUE A;  1VF2 A;  1X9S B;  4WF5 A;  2QGV A;  3GST A;  3NIV A;  2CT6 A;  3I6A A;  2DJ3 A;  2J23 A;  2N5F A;  4GQF A;  1WPI A;  3GKX A;  1SK2 A;  3EU3 A;  5J4U A;  2C4J A;  3MSZ A;  4L0W A;  5D9W A;  1SYR A;  2I1U A;  2OKA A;  2H01 A;  3N9J A;  3QMX A;  5E59 A;  3LXT A;  5DDL A;  11GS A;  3EYT A;  3ZL5 A;  1Z6M A;  1XCC A;  1MDJ A;  2XBQ A;  3HXS A;  1SJZ A;  5DAL A;  4G2E A;  1F2E A;  2H6Z A;  4N30 A;  2VCT A;  5BMU A;  2YWO A;  4JR4 A;  1X5D A;  4KSO A;  1EEM A;  3UVH A;  1JZR A;  4EL1 A;  3QAV A;  5ECN B;  3GSS A;  1NW2 A;  8GSS A;  2C0D A;  1M7T A;  5IQY A;  2VOC A;  1QFN A;  2YP6 A;  2EIQ A;  1ZL9 A;  5B8B A;  4TXV A;  4MF7 A;  4MZB A;  2ZUP A;  4NXI A;  1GSS A;  5JWR B;  4PQI A;  3GX8 A;  2IMF A;  3M9K A;  4DSS A;  5J9C A;  4PUA A;  1T7P B;  4OCE A;  3ERW A;  3VI5 A;  1T4Z A;  2MMZ A;  2PN8 A;  3CYN A;  4Z7X A;  4USS A;  1ZOF A;  3WGE A;  4WBJ A;  3KEB A;  1C72 A;  1O85 A;  2VCV A;  1XOA A;  5ECS A;  2GQM A;  2K6V A;  4AJ8 A;  2K9F A;  1F9M A;  4P3Y B;  4TXO B;  3H4K A;  4KCE A;  3EUR A;  1RQM A;  4ZL8 A;  2F51 A;  4XCS A;  2KHP A;  3GKK A;  2JSY A;  1FOV A;  5GZZ B;  1QQ2 A;  2LQO A;  1YF1 A;  2CX3 A;  2IFQ A;  1A2L A;  2FGX A;  1EZK A;  4BVY A;  1AW9 A;  4ZL7 A;  2LRC A;  5A4V A;  1K0A A;  1XWC A;  1EGO A;  4I2U A;  1AAZ A;  3EMP A;  2ON5 A;  4TR1 A;  4OMV A;  2DIY A;  4MCU A;  1Z7R A;  3CTF A;  1R4W A;  1GLP A;  3ZIV A;  3VK9 A;  1XIY A;  2RLI A;  3UBK A;  2HRF A;  1F37 A;  4TR1 B;  1VF4 A;  5ECH B;  1MDI A;  3LWA A;  5FHI A;  2V2G A;  2QSI A;  3ISO A;  2P5Q A;  2LJK A;  4LL1 B;  3KXO A;  4WR5 A;  3IXR A;  3EE2 A;  1NSW A;  5IOX A;  2MBT A;  3HD5 A;  3FR3 A;  3CMI A;  5DJM A;  3KMN A;  5F06 A;  2G0F A;  2VLT A;  3HY2 A;  1EP8 A;  3D4T A;  1GSF A;  4IVF A;  3FKF A;  2I3Y A;  4KAE A;  3M0F A;  1T3B A;  4XTS A;  4MJB A;  5JWO B;  2OE0 A;  5IMC A;  5LCZ A;  2WFC A;  5CO3 A;  1OYJ A;  2F8A A;  2CZ3 A;  3J7Y k;  3EVI A;  2P31 A;  3QCP A;  1RK4 A;  2HSN B;  4K8M A;  4TR4 A;  5J41 A;  4LLR A;  4N0Z A;  4Q5F A;  5FWG A;  2GQL A;  1FB6 A;  3KTB A;  5GAP D;  3FZ4 A;  3A3T A;  4NHZ A;  1KTE A;  2FWH A;  4HQS A;  2V41 A;  1M0U A;  1GUL A;  4DVC A;  2P5R A;  2VD1 A;  2H0H A;  2IIY A;  4G19 A;  2LNS A;  1PD2 1;  3HHV A;  3KM6 A;  1ZCP A;  3LEF A;  3IK7 A;  4MA9 A;  1PQN A;  1TKD B;  4YAV A;  3TRX A;  2CQ9 A;  2IN3 A;  5A5K A;  1PN9 A;  5ECO B;  3E0U A;  3IAM 2;  5G30 A;  1ON4 A;  4X0X A;  3UAP A;  2PVO C;  3VWW A;  4ZXG A;  4TOP A;  4GST A;  3ZFL A;  2DML A;  4FIW A;  1NHO A;  2YZH A;  1V9W A;  3CRU A;  4OWY A;  1YQ1 A;  4MPF A;  3DKS A;  1NHY A;  1M2B A;  4GSN A;  3WD6 A;  3K8N A;  2FLS A;  2YV7 A;  1NM3 A;  2G2Q A;  3TOU A;  4TRX A;  5GST A;  3QAW A;  3WT1 A;  4BA7 A;  1XWB A;  4D73 B;  1TRV A;  2EC4 A;  4XIH A;  4MMM A;  1A0R P;  3DGQ A;  2M46 A;  2YPM A;  4AF2 A;  4GSS A;  6GSY A;  4JE1 A;  4MH2 A;  3UEM A;  4WXT A;  1PX6 A;  1O6J A;  2B3S A;  3FZA A;  4Q5N A;  3D0Z A;  5IMV A;  1SKS B;  5IOW A;  4XS1 A;  4PQ1 A;  1T1V A;  1HD2 A;  2NBS A;  1A2M A;  1FW1 A;  2CAI A;  4RI7 A;  1XWG A;  4POK A;  3FEU A;  3LOR A;  4YQM A;  3TJB A;  2V6K A;  3UL3 A;  1E6B A;  4KDX A;  3TJG A;  3W8J A;  2GZZ A;  4RUV A;  4IEL A;  4J56 E;  3DYR A;  3HVS A;  3RPN A;  2GDR A;  5JCU A;  3KIJ A;  3RBT A;  2R4V A;  2MBS A;  1IYH A;  4V1A g;  2B1L A;  5HR1 A;  2KUC A;  3ZRE A;  5ID2 A;  1WIK A;  4NWY A;  4X43 A;  2RII A;  2X64 A;  2L6D A;  4KUN A;  2V32 A;  5IM9 A;  1K0M A;  3FHK A;  4CDO A;  3LFL A;  2H74 A;  2CX4 A;  1Z7P A;  2DIZ A;  2I9H A;  5J3R A;  2FCH A;  3F9U A;  1GNW A;  4V1A p;  3MNG A;  2H72 A;  2C0E A;  2HFD A;  2CAQ A;  1TRS A;  5KN3 A;  1F3A A;  3FYG A;  1PSQ A;  2GZP A;  5DQY A;  3BOA A;  1TK5 B;  3RHC A;  3NOF A;  4EKZ A;  4BPY A;  4YQV A;  3M9J A;  4PGT A;  2WUL A;  4ZIJ A;  2H66 A;  3BCI A;  1UA5 A;  1Z9H A;  1BJX A;  3VLN A;  1YZX A;  4XRD A;  1R5A A;  2DJJ A;  2E0Q A;  4HZ4 A;  2L4Q A;  1V57 A;  22GS A;  2K18 A;  1GSU A;  4G0I A;  1R7H A;  3RAZ A;  1PMT A;  2WCI A;  1YEP A;  3VWX A;  3DWV A;  1XWK A;  5ELA A;  1A24 A;  3IR4 A;  3PR8 A;  2GLR A;  2R2J A;  3HJM A;  4WF4 A;  4G0L A;  4MAB A;  3IA1 A;  3LYK A;  3GL5 A;  2H1G A;  5AIS A;  3TKS E;  1OC3 A;  1TTZ A;  1ST9 A;  1J9B A;  3GKN A;  4IKH A;  2YAN A;  1S3D A;  3QFB C;  4FYU A;  2PBJ A;  1LU4 A;  2O87 A;  1N8J A;  4PNF A;  2XC2 A;  2RM5 A;  14GS A;  4BWQ A;  20GS A;  2YZU A;  5D8I A;  2H6X A;  1SKW B;  5D9V A;  2GST A;  4GCI A;  5KN0 A;  1K0C A;  3S9F A;  2LJA A;  2PGT A;  1XPV A;  1EOG A;  4YQU A;  1AQW A;  2CZ2 A;  4TW5 A;  4K7N A;  2FA4 A;  4F03 A;  4KND A;  2IME A;  1THO A;  2Z9S A;  1T00 A;  1OVN A;  1OE7 A;  4EF0 A;  3E9J B;  2HRK B;  1PKW A;  5J5N A;  2R3X A;  4OO4 A;  5CNW A;  1AXD A;  1ZYE A;  3BBY A;  2VCZ A;  4GLT A;  5H5Q A;  4ML6 A;  1Y6E A;  2H76 A;  2HI7 A;  5D96 A;  2PU9 C;  1FO5 A;  5C04 A;  2C0F A;  1G7O A;  3HCZ A;  1SK0 A;  2RM6 A;  1USB A;  4JBB A;  2HLS A;  2JU5 A;  2AYT A;  2RUE A;  4KGI A;  4WET A;  1H75 A;  4HDE A;  2IMD A;  3E3E A;  1UVZ A;  1GUK A;  3KJY A;  4ILF A;  2GT6 A;  2H1B A;  3UBL A;  4IW9 A;  4ISD A;  2M80 A;  2OE3 A;  1UN2 A;  1YKA A;  1Q4J A;  2RUF A;  4IJI A;  3TDG A;  3UJ1 A;  4OD7 A;  3FK8 A;  3UOM A;  2YV9 A;  3FZ5 A;  3KCM A;  5ELG A;  2LNT A;  2XHF A;  2VL9 A;  3GUS A;  6GSW A;  3NZN A;  2VLV A;  3UVT A;  3PIN A;  3VUR A;  1JHB A;  5DAL B;  2F9S A;  3L9S A;  3SWL A;  1GP1 A;  1TU8 A;  4F0C A;  4POB A;  4MZC A;  5DVB A;  1PRX A;  1FAA A;  2B6M A;  2HRN A;  5DQS A;  3IDV A;  3TKR A;  4WKW A;  1O73 A;  1TJD A;  2VAF A;  1FG4 A;  3GX0 A;  1SU9 A;  3GA4 A;  1GUH A;  2OAD A;  1WMJ A;  1HNC A;  2LJR A;  1YDK A;  3IOS A;  3QAG A;  2HZF A;  2NTO A;  4DSS B;  2R5G A;  4DSR A;  3US3 A;  4KDU A;  1JLW A;  3IC4 A;  3QD9 A;  3TRP A;  3CRT A;  5CRG A;  2C0G A;  2FHE A;  1A8Y A;  2JL4 A;  3P2A A;  3F8U A;  2DJ0 A;  3VI7 A;  2H8L A;  4EXJ A;  2YNX A;  3IV4 A;  2GSR A;  3KD0 A;  3LJR A;  3GFK A;  4JR6 A;  9GSS A;  2CVK A;  2OBK A;  2V1M A;  1PX7 A;  5AIV A;  3F4S A;  3GKM A;  3AY8 A;  3ERF A;  5HR3 A;  1OKT A;  4F2I A;  1V58 A;  2JZT A;  3D6I A;  6GST A;  1W4V A;  4MLY A;  5G2Z A;  1ZYQ B;  1K0B A;  1GSY A;  3H8Q A;  3IPZ A;  4I97 A;  1MDK A;  2H0I A;  4IQA A;  4JED A;  4L8E A;  3L9V A;  4HU9 A;  4AJ6 A;  4K0G A;  5B8A A;  4KA0 A;  2IFQ B;  1GTI A;  5ECP B;  5HR0 A;  4BVY B;  3ZML A;  3QPM A;  3KP8 A;  2HSM A;  4OFT A;  5IMF A;  13GS A;  2C1Y A;  2WZ9 A;  4KDY A;  4YH2 A;  5ECR B;  3GNJ A;  4QL7 A;  2HSM B;  1GTA A;  5KN1 A;  4WR4 A;  4IP1 A;  5G1L A;  3C1R A;  3CSH A;  5F05 A;  2IMK A;  4LMW A;  1OAZ A;  1TI1 A;  2A2S A;  2IL3 A;  2VIM A;  4RQR A;  1OKD A;  1EWX A;  2KOK A;  4O92 A;  2KP1 A;  3M3M A;  4PTS A;  5EL8 A;  3EWL A;  4X1U A;  4ZL9 A;  4RI6 A;  1VGL A;  4JZQ A;  4AGS A;  3EC3 A;  2C8U A;  1T4Y A;  2AJQ B;  4ZBB A;  2VCW A;  3HA9 A;  5DAK A;  1XBS A;  1AQV A;  1SYX A;  2B7K A;  1J08 A;  5IMD A;  4MDC A;  2H1D A;  2HZE A;  17GS A;  2PPT A;  3G7I A;  1ABA A;  4GTU A;  3TB2 A;  5DAK B;  4F9Z A;  4HJM A;  3U6V A;  4AJ7 A;  5ECI B;  3W6G A;  2HZE B;  2XBI A;  5AIX A;  2MMN A;  3TKS C;  1GH2 A;  4V2L A;  1UC7 A;  1M2D A;  4OCF A;  5ABR A;  2LKU A;  2FWG A;  2FA8 A;  3C8E A;  4MF6 A;  3R3E A;  2MYG A;  5D9T A;  3DML A;  3ED3 A;  4I5Q A;  3DD3 A;  3PH9 A;  1QXH A;  3D22 A;  2LTK A;  4BL7 A;  19GS A;  4J2F A;  5AGY A;  2LRT A;  3H93 A;  2GGT A;  3CSJ A;  3IBH A;  3HVV A;  16GS A;  1R26 A;  1SJI A;  3KP9 A;  5CAX A;  5IIZ A;  4G10 A;  3L9U A;  1H4O A;  3KMO A;  1SJ6 A;  3A2V A;  4J57 E;  1GSE A;  3FR9 A;  2YN1 A;  1XZO A;  3F4R A;  2E2G A;  1TRW A;  2N5B A;  4HQZ A;  4N11 A;  1SK1 A;  4WEY A;  3TKS A;  5KN2 A;  1XW5 A;  3HJP A;  1Z6N A;  3J7Y b;  4H86 A;  1DSB A;  2J9H A;  4HEA 2;  4DSQ A;  2VL2 A;  1G6Y A;  4XS4 A;  2L57 A;  3O3T A;  3M8N A;  2H19 A;  2BTO T;  1WOU A;  4K1F A;  2IPA A;  4KE3 A;  4CHS A;  4IGJ A;  1XFL A;  2DJ2 A;  1SL1 B;  2VO4 A;  1TOF A;  1R5P A;  3GTU A;  1XWA A;  2LQQ A;  2B7J A;  2AAW A;  3ZMK A;  3GMF A;  2HQT A;  3FZ9 A;  2FWE A;  1K0O A;  4HS1 A;  1Y25 A;  2IWT A;  5H5R A;  1OC8 A;  2E2M A;  4V2N A;  2JZS A;  4O32 A;  18GS A;  2HT9 A;  3ZYW A;  1M9B A;  3R2Q A;  1EGR A;  1GLQ A;  5G5F A;  3L0H A;  2AV4 A;  2X8G A;  1JZW A;  5ID2 B;  2F3M A;  2CVB A;  5E4W A;  1GNE A;  2KP2 A;  3HZ4 A;  4IJ3 A;  2FNO A;  5DBQ A;  4BVX A;  2JSZ A;  3DXB A;  7GSS A;  2WRT A;  4NAX A;  5KEJ A;  6GSS A;  3TJJ A;  1Z5Y E;  3RDW A;  1GTU A;  3UMA A;  4I8B A;  3APQ A;  3KH7 A;  4YAP A;  4CW9 A;  1FB0 A;  1IYI A;  3ZRD A;  2XPD A;  3GUR A;  4KH7 A;  1S3C A;  3DVW A;  4DEJ A;  1TXX A;  2OA7 A;  4V2M A;  2JZR A;  2YWI A;  3CTG A;  4KB3 A;  1B9X C;  5AN1 A;  4FO5 A;  6GSX A;  3TJK A;  5EVO A;  1K3O A;  3LGC A;  2H71 A;  1J0F A;  2CVD A;  2GQK A;  3ZVJ A;  1XW9 A;  3HDC A;  1QGV A;  1EV9 A;  1XOB A;  3BJ5 A;  2B5Y A;  3IE3 A;  1KBN A;  2ZCT A;  1B4Q A;  3TGZ A;  2C3N A;  3VPQ A;  2AUV A;  4BWS A;  1GSD A;  2EIO A;  3MWH A;  3UIW A;  4I6X A;  2YOI A;  1PKZ A;  2GZY A;  2I81 A;  3M1G A;  4EUY A;  1F6M C;  2M72 A;  3CSI A;  3QFA C;  3EMX A;  2VM1 A;  2X8H A;  2BJX A;  3GN3 A;  5F8B A;  4MJE A;  2B5E A;  2HYX A;  2L5O A;  3C1S A;  4GQC A;  1QK8 A;  4ML1 A;  1PL1 A;  1SD9 A;  2WDU A;  5JCG A;  1F3B A;  2F8F A;  1ERU A;  1FVJ A;  4ZBA A;  1K0D A;  2P0G A;  3GL3 A;  3Q19 A;  2D2Z A;  2TRC P;  3F3R A;  4K7O A;  1SEN A;  1AIU A;  1X0R A;  2HRA A;  2YWM A;  3APO A;  1X9W B;  2GTU A;  3F63 A;  5ECL B;  1JFU A;  4QL9 A;  3Q6O A;  4HZ2 A;  3KH9 A;  3BCK A;  1X5E A;  5F0G A;  1U88 A;  1KNG A;  2LUS A;  2FY6 A;  3I9V 2;  1ZZY A;  3ME7 A;  4I2T A;  1GTB A;  1MD3 A;  2DC5 A;  5INY A;  2AB6 A;  3N5O A;  5CRE A;  2ES7 A;  3WGX A;  1PL2 A;  3A2W A;  3UAR A;  1I9D A;  3DEX A;  2OJL A;  5IMA A;  4EDY A;  2R6K A;  5F07 A;  3ZTL A;  2WB9 A;  1XVQ A;  3P8W A;  3QDN A;  1QMV A;  1CQG A;  3HKR A;  2PER A;  2AHE A;  1T8E B;  1B8X A;  1DUG A;  4ECB A;  3KZQ A;  4KCA A;  2GVP A;  1O81 A;  3TKQ A;  4HI7 A;  2HSH A;  4KF9 A;  2YJH A;  4IBP A;  4EO3 A;  2NPB A;  3HYP A;  1OC9 A;  5IMZ A;  3KTL A;  2LV3 A;  1EEJ A;  2H1A A;  1M9A A;  4PXO A;  1G7E A;  5G1K A;  4EDZ A;  1S3A A;  1VF1 A;  3DVX A;  2HSY A;  1TP9 A;  3P7X A;  1OC9 B;  5D9X A;  1DE1 A;  3TRQ A;  2WJU A;  3APS A;  1BX9 A;  5D93 A;  3P90 A;  1KEB A;  1HYU A;  1RW1 A;  3Q74 A;  1ERW A;  1MTC A;  3G7Y A;  5CRH A;  2VM2 A; 
#chains in the Genus database with same CATH topology
 2VD0 A;  1VRS D;  3D4M A;  2H73 A;  1YKC A;  4ZBD A;  3QOU A;  3WT2 A;  2WGR A;  3TJF A;  2V6O A;  5HFK A;  3MDK A;  4GRF A;  5GSS A;  2X4A A;  4GWR A;  1YJ6 A;  2UZ8 A;  3OR5 A;  4TKY A;  2VCX A;  1ZYP A;  2DSA A;  5IO2 A;  4F82 A;  5ENU A;  4PQH A;  4G9H A;  2L6C A;  4N0V A;  1YY7 A;  3CBU A;  2ALB A;  5J9B A;  1K3Y A;  3W8S A;  1MD4 A;  2PVQ A;  1HNA A;  3EU4 A;  4L0U A;  1SD8 A;  3C73 A;  1TK0 B;  4TXO A;  3HZ8 A;  1VF3 A;  3G9B A;  1U6T A;  1GWC A;  2K8V A;  2DMM A;  3Q18 A;  5CP1 A;  1PN0 A;  3LXZ A;  2O85 A;  4TR3 A;  5IO0 A;  1E2Y A;  1JZD A;  4MJA A;  1Y1U A;  3LSZ A;  1XW6 A;  2WS2 A;  1THX A;  4MZW A;  3L78 A;  3TU3 B;  4TVE A;  2HNL A;  2O36 A;  3O6T A;  2B1K A;  3IC8 A;  4K0N A;  2H70 A;  3PPU A;  1EP7 A;  3KGK A;  6GSU A;  5DJL A;  5HFG A;  2JAC A;  1DBY A;  1SVO A;  5DCH A;  2X49 A;  1BYE A;  1HQO A;  4PX1 A;  5B7C A;  1B9Y C;  1PFO A;  1V2A A;  3FY7 A;  4FYC A;  4NV2 A;  3U5R E;  1G6W A;  2VLU A;  4LA1 A;  1Z3E A;  3FW2 A;  3F4T A;  4EVM A;  5C00 A;  2GS3 A;  3ERG A;  4MJC A;  4QQ7 A;  1BG5 A;  3IK9 A;  4FH8 A;  4X4J A;  5JCW A;  5LNK e;  1AQX A;  3GHA A;  1YF0 A;  3WGD A;  3C7M A;  1SL0 B;  4PNG A;  1X5C A;  1I5G A;  1K3L A;  2H30 A;  3F0I A;  1U3I A;  2X99 A;  4ECI A;  2FWF A;  5G31 A;  5ECK B;  4K6X A;  4BIK A;  2CA8 A;  1TK8 B;  4MH3 A;  3L4N A;  3C71 A;  6GSV A;  1U87 A;  3GV1 A;  2HXK A;  1GL8 A;  3FRC A;  2PWJ A;  3V1W A;  4PHZ C;  5IPG A;  1YEW C;  4ZIL A;  1WP0 A;  1XVW A;  1A2J A;  4EE0 A;  2E7P A;  3QR6 A;  5FT3 A;  3TCO A;  4JU5 A;  3RPP A;  2VL2 C;  4F0B A;  5CRD A;  1ILO A;  1YEX A;  1TRU A;  5H5S A;  3IHQ A;  4ZB8 A;  3HVN A;  4ACS A;  4MPG A;  2HE3 A;  3IHG A;  2N5A A;  10GS A;  4PUR A;  4HJ2 A;  1XXU A;  1PGT A;  1AUC A;  1MEK A;  2L4C A;  4JRR A;  12GS A;  2OAC A;  1ERT A;  1TU7 A;  4KX4 A;  4IHU A;  4EIQ A;  4BL7 B;  3O76 A;  5IPH A;  1M99 A;  2A4V A;  3A5W A;  3SBC A;  2K8S A;  1A23 A;  1M2A A;  2MMA A;  1BAY A;  4E8E A;  4LL4 B;  2H0G A;  4YKG A;  3CQF A;  4XHM A;  1G0T A;  5B6M A;  2GT5 A;  3GIX A;  2YCD A;  1GUM A;  5JWQ B;  2O8V B;  4K7I A;  4EIP A;  3ZVJ D;  4MK3 A;  4O5Q A;  2L59 A;  1TW9 A;  2QA1 A;  2ON7 A;  4TN8 A;  4K5S A;  2PUK C;  4D73 A;  4NV5 A;  3IAS 2;  4Q5R A;  4ID0 A;  2VCQ A;  1O8X A;  1HNB A;  4KSM A;  4GF0 A;  3ME8 A;  3LQ7 A;  3D21 A;  3I69 A;  2X8C A;  4IN0 A;  2VUP A;  1QUW A;  4XS4 B;  5G5E A;  1WJK A;  1WRY A;  1ML6 A;  5LD0 A;  4K2D A;  2YWN A;  4O5R A;  2JAD A;  4E8H A;  2GSS A;  3JCM L;  2OBI A;  2ZNM A;  4Q5Q A;  4XS6 A;  3DRN A;  5DCG A;  3ZZX A;  3TOT A;  1V98 A;  2MMO A;  3VFI A;  4RQX A;  4TR0 A;  2MZC A;  4FXY P;  1DE2 A;  3MYD A;  2REM A;  4MP4 A;  1EOH A;  3GTU B;  3VWU A;  1LBK A;  2BMX A;  2FUG 2;  2IMI A;  1GSQ A;  4NHW A;  5COH A;  5B6N A;  5HR2 A;  2I4A A;  5EY6 A;  3ZFB A;  3BD2 A;  5ECQ B;  4HUA A;  4ZB9 A;  3FR6 A;  1W89 A;  2DJK A;  2DJ1 A;  1V40 A;  4POM A;  5CRW A;  4OFM A;  1O7U A;  4L5O A;  2FD3 A;  5KOW A;  2L5L A;  4O7H A;  1B4P A;  1URM A;  3H79 A;  2TIR A;  1EV4 A;  4NPB A;  1SKR B;  3F6D A;  1ERV A;  4OO5 A;  4NMU A;  2O89 A;  5A1N A;  4BVX B;  4GDF A;  2H6Y A;  3TKP A;  3GH6 A;  1SL2 B;  1XG8 A;  3GYK A;  4FQU A;  2A2R A;  1PA3 A;  2EFH A;  1N2A A;  4AKX B;  4L5L A;  4PUF C;  1ZGN A;  1ACV A;  2R37 A;  3F6F A;  3IRA A;  1TI3 A;  2CV4 A;  4ECC A;  5EPF A;  2GSQ A;  3GH9 A;  1O8W A;  4ZB6 A;  3LG6 A;  2OE1 A;  3DIE A;  4OFN A;  1X9M B;  1JZO A;  5HQP A;  4XRA A;  1WWJ A;  5HFI A;  1TDI A;  4EC0 A;  3G7J A;  1ZMA A;  4KW6 A;  2O7K A;  2KLX A;  2LRN A;  2XPE A;  5KOX A;  1Q98 A;  2H75 A;  3HVX A;  2DLX A;  1GRX A;  4FYB A;  3RHB A;  1FHE A;  3VPT A;  4N10 A;  3H1N A;  1U3A A;  5ECM B;  1AC1 A;  3ZIJ A;  1BED A;  4IP6 A;  5A4U A;  4HU7 A;  1B48 A;  1BQ7 A;  3D5J A;  2TRX A;  5D73 A;  5J4Y A;  4ULX A;  2LEG A;  4LMV A;  3MAK A;  2C3Q A;  1K0N A;  1WE0 A;  2VL3 A;  3F3Q A;  4GXZ A;  4WBR D;  5A4W A;  2LS5 A;  2IJY A;  2YJ7 A;  3I43 A;  4IQ1 A;  3GRX A;  3A2X A;  4G0K A;  3WYW A;  1A0F A;  2NDO A;  1CQH A;  5A34 A;  4K9Z A;  5GAN D;  4POL A;  3ZIT A;  2DBC A;  2PMT A;  3LYP A;  2NVL A;  2QKE A;  2VKZ G;  1LJR A;  4ECJ A;  1FVK A;  2QC7 A;  3ZLP A;  3EIN A;  1JLV A;  1OE8 A;  4HOJ A;  2B5X A;  3PGT A;  3VWV A;  5CYY A;  2C80 A;  2EIR A;  2LST A;  3CXG A;  3HJO A;  2HRK A;  2C3T A;  5L71 A;  4MF5 A;  4IS0 A;  1A8L A;  3TUE A;  1VF2 A;  1X9S B;  2WVZ A;  4WF5 A;  2QGV A;  3GST A;  3NIV A;  5A5H B;  2CT6 A;  3I6A A;  2DJ3 A;  2J23 A;  2N5F A;  4GQF A;  1WPI A;  3GKX A;  1SK2 A;  3EU3 A;  5J4U A;  2UV8 G;  2C4J A;  3MSZ A;  4L0W A;  5D9W A;  2R0G A;  1SYR A;  2I1U A;  2OKA A;  2H01 A;  3N9J A;  3QMX A;  4YKF A;  5E59 A;  3LXT A;  5DDL A;  11GS A;  3EYT A;  3ZL5 A;  1Z6M A;  1XCC A;  1MDJ A;  2XBQ A;  3HXS A;  1SJZ A;  5DAL A;  4G2E A;  1F2E A;  2H6Z A;  4N30 A;  2VCT A;  5BMU A;  2YWO A;  4JR4 A;  1X5D A;  4KSO A;  1EEM A;  3UVH A;  1JZR A;  4EL1 A;  4PI0 C;  3QAV A;  5ECN B;  3GSS A;  1NW2 A;  8GSS A;  2C0D A;  1M7T A;  5IQY A;  2VOC A;  1QFN A;  2YP6 A;  2EIQ A;  1ZL9 A;  5B8B A;  4TXV A;  4MF7 A;  4MZB A;  2ZUP A;  4NXI A;  1GSS A;  5JWR B;  4PQI A;  3GX8 A;  2IMF A;  3M9K A;  4DSS A;  5J9C A;  4PUA A;  1T7P B;  4OCE A;  3ERW A;  3VI5 A;  1T4Z A;  3CWG A;  2MMZ A;  2PN8 A;  3CYN A;  4Z7X A;  4USS A;  4Z2T A;  1ZOF A;  5J4V A;  3WGE A;  4WBJ A;  3KEB A;  1C72 A;  1O85 A;  2VCV A;  1XOA A;  5ECS A;  2GQM A;  2K6V A;  4AJ8 A;  2K9F A;  1F9M A;  4P3Y B;  4TXO B;  3H4K A;  4KCE A;  1M3J A;  3EUR A;  1RQM A;  4ZL8 A;  2F51 A;  4XCS A;  2KHP A;  3GKK A;  2JSY A;  1FOV A;  5GZZ B;  1QQ2 A;  2LQO A;  4ZB7 A;  1YF1 A;  2CX3 A;  2IFQ A;  1A2L A;  2FGX A;  1EZK A;  4BVY A;  1AW9 A;  4ZL7 A;  2DKI A;  2LRC A;  5A4V A;  1K0A A;  1XWC A;  1EGO A;  4I2U A;  1AAZ A;  3EMP A;  2ON5 A;  4TR1 A;  4OMV A;  2DIY A;  4MCU A;  1Z7R A;  3CTF A;  1R4W A;  1GLP A;  3ZIV A;  3VK9 A;  1XIY A;  2RLI A;  3UBK A;  2HRF A;  1F37 A;  4TR1 B;  1VF4 A;  5ECH B;  1MDI A;  3LWA A;  5FHI A;  2V2G A;  2QSI A;  3ISO A;  2P5Q A;  2LJK A;  4LL1 B;  3KXO A;  4WR5 A;  3IXR A;  3EE2 A;  1NSW A;  5IOX A;  2MBT A;  3HD5 A;  3FR3 A;  3CMI A;  5DJM A;  3KMN A;  5F06 A;  2G0F A;  2VLT A;  3HY2 A;  1EP8 A;  1S3R A;  3D4T A;  1GSF A;  4IVF A;  3FKF A;  2I3Y A;  4KAE A;  3M0F A;  1T3B A;  4XTS A;  4MJB A;  5JWO B;  2HSN A;  2OE0 A;  5IMC A;  5LCZ A;  2WFC A;  5CO3 A;  1OYJ A;  2F8A A;  2CZ3 A;  3J7Y k;  3EVI A;  2P31 A;  3QCP A;  1RK4 A;  4CY8 A;  2HSN B;  4K8M A;  4TR4 A;  5J41 A;  4LLR A;  4N0Z A;  4Q5F A;  5FWG A;  2GQL A;  1FB6 A;  3KTB A;  5GAP D;  2A4H A;  3FZ4 A;  3A3T A;  4NHZ A;  4AKG A;  1KTE A;  2FWH A;  4HQS A;  2V41 A;  1M0U A;  1GUL A;  4DVC A;  2P5R A;  2VD1 A;  2H0H A;  2IIY A;  4G19 A;  2LNS A;  1PD2 1;  3HHV A;  3KM6 A;  1ZCP A;  3LEF A;  3IK7 A;  4MA9 A;  1PQN A;  1TKD B;  4YAV A;  3TRX A;  2CQ9 A;  2IN3 A;  5A5K A;  1PN9 A;  5ECO B;  3E0U A;  3IAM 2;  5G30 A;  1ON4 A;  4X0X A;  3UAP A;  2PVO C;  3VWW A;  4ZXG A;  4TOP A;  4GST A;  3ZFL A;  2DML A;  4FIW A;  1NHO A;  2YZH A;  1V9W A;  3CRU A;  4OWY A;  1YQ1 A;  4MPF A;  3DKS A;  1NHY A;  1M2B A;  4GSN A;  3WD6 A;  3K8N A;  2FLS A;  2YV7 A;  2A2P A;  1NM3 A;  2G2Q A;  3TOU A;  4TRX A;  5GST A;  3QAW A;  3WT1 A;  4BA7 A;  1XWB A;  4D73 B;  1TRV A;  2EC4 A;  4XIH A;  4MMM A;  1A0R P;  3DGQ A;  2M46 A;  2YPM A;  4AF2 A;  4GSS A;  6GSY A;  4JE1 A;  2WVX A;  4MH2 A;  3UEM A;  4WXT A;  1PX6 A;  1O6J A;  2B3S A;  3FZA A;  4Q5N A;  3D0Z A;  5IMV A;  1SKS B;  5IOW A;  4XS1 A;  2WVX B;  4PQ1 A;  1T1V A;  1HD2 A;  2NBS A;  1A2M A;  1FW1 A;  2CAI A;  4RI7 A;  1XWG A;  4POK A;  3FEU A;  3LOR A;  4YQM A;  3TJB A;  2V6K A;  3UL3 A;  1E6B A;  4KDX A;  3TJG A;  3W8J A;  2GZZ A;  4RUV A;  4IEL A;  4J56 E;  3DYR A;  3HVS A;  3RPN A;  2GDR A;  5JCU A;  3KIJ A;  3RBT A;  2R4V A;  2MBS A;  1IYH A;  4V1A g;  2B1L A;  5HR1 A;  2KUC A;  3ZRE A;  5ID2 A;  1WIK A;  4NWY A;  4X43 A;  2RII A;  2QA2 A;  2X64 A;  2L6D A;  4KUN A;  2V32 A;  4Z2R A;  5IM9 A;  1K0M A;  3FHK A;  4CDO A;  3LFL A;  2H74 A;  2CX4 A;  5A1N B;  1Z7P A;  2DIZ A;  2EFC A;  2I9H A;  5J3R A;  2FCH A;  3F9U A;  2R0C A;  1GNW A;  4MNN A;  4V1A p;  4HSC X;  3MNG A;  2H72 A;  2C0E A;  2HFD A;  2CAQ A;  1TRS A;  5KN3 A;  1F3A A;  3FYG A;  1PSQ A;  2GZP A;  5DQY A;  3BOA A;  1TK5 B;  2WW0 A;  3RHC A;  3NOF A;  4EKZ A;  4BPY A;  4YQV A;  3M9J A;  4PGT A;  2WUL A;  4ZIJ A;  2H66 A;  3BCI A;  1S4B P;  1UA5 A;  1Z9H A;  1BJX A;  3VLN A;  1YZX A;  4XRD A;  1R5A A;  2DJJ A;  2E0Q A;  3MIX A;  4HZ4 A;  4A5P A;  2L4Q A;  4G01 A;  1V57 A;  22GS A;  2K18 A;  1GSU A;  4G0I A;  1R7H A;  3RAZ A;  1PMT A;  2WCI A;  1YEP A;  3VWX A;  3DWV A;  1XWK A;  1BF5 A;  5ELA A;  1A24 A;  3IR4 A;  3PR8 A;  2GLR A;  2R2J A;  3HJM A;  4WF4 A;  4G0L A;  4MAB A;  3IA1 A;  3LYK A;  2EFD A;  3GL5 A;  2H1G A;  5AIS A;  3TKS E;  1OC3 A;  1TTZ A;  1ST9 A;  1J9B A;  3GKN A;  4IKH A;  2YAN A;  1S3D A;  3QFB C;  4FYU A;  2PBJ A;  1LU4 A;  2O87 A;  1N8J A;  4PNF A;  2XC2 A;  2RM5 A;  14GS A;  5A34 B;  4BWQ A;  20GS A;  2YZU A;  5D8I A;  4AI6 A;  2H6X A;  1SKW B;  5D9V A;  2GST A;  4GCI A;  5KN0 A;  1K0C A;  3S9F A;  2LJA A;  2PGT A;  1XPV A;  1EOG A;  4YQU A;  1AQW A;  2CZ2 A;  4TW5 A;  4K7N A;  2FA4 A;  4F03 A;  4KND A;  2IME A;  2O5V A;  1THO A;  2Z9S A;  1T00 A;  1OVN A;  1OE7 A;  4EF0 A;  3E9J B;  2HRK B;  1PKW A;  5J5N A;  2R3X A;  4OO4 A;  5CNW A;  1AXD A;  1ZYE A;  3BBY A;  2VCZ A;  4GLT A;  5H5Q A;  4ML6 A;  1Y6E A;  2H76 A;  2HI7 A;  3FMW A;  5D96 A;  2PU9 C;  1FO5 A;  5C04 A;  2C0F A;  1G7O A;  3HCZ A;  3A5I A;  1SK0 A;  2RM6 A;  1USB A;  4JBB A;  2HLS A;  2JU5 A;  2OT3 A;  2AYT A;  2RUE A;  4KGI A;  4WET A;  1H75 A;  4HDE A;  2IMD A;  3E3E A;  1UVZ A;  1GUK A;  3KJY A;  4ILF A;  2GT6 A;  2H1B A;  3UBL A;  4IW9 A;  4ISD A;  2M80 A;  2OE3 A;  1UN2 A;  1YKA A;  1Q4J A;  2RUF A;  4IJI A;  3TDG A;  3UJ1 A;  4OD7 A;  3FK8 A;  3UOM A;  2YV9 A;  3FZ5 A;  3KCM A;  1M3I A;  2R0P A;  5ELG A;  2LNT A;  2XHF A;  2VL9 A;  3GUS A;  6GSW A;  3NZN A;  2VLV A;  3UVT A;  3PIN A;  3VUR A;  1JHB A;  5DAL B;  4QMK A;  2F9S A;  3L9S A;  3SWL A;  1GP1 A;  1TU8 A;  5BMU B;  1SVL A;  4F0C A;  4POB A;  4MZC A;  5DVB A;  1PRX A;  1FAA A;  2B6M A;  2HRN A;  5DQS A;  3IDV A;  3TKR A;  4WKW A;  1O73 A;  1TJD A;  2VAF A;  1FG4 A;  3GX0 A;  1SU9 A;  3RGB C;  3GA4 A;  1GUH A;  2OAD A;  1WMJ A;  1HNC A;  2LJR A;  1YDK A;  3IOS A;  3QAG A;  2HZF A;  2NTO A;  4DSS B;  2R5G A;  4DSR A;  3US3 A;  4KDU A;  1JLW A;  3IC4 A;  3QD9 A;  1I1I P;  3TRP A;  3CRT A;  5CRG A;  2C0G A;  2FHE A;  1A8Y A;  2JL4 A;  3P2A A;  3F8U A;  2DJ0 A;  3VI7 A;  2H8L A;  4EXJ A;  2YNX A;  3IV4 A;  2GSR A;  3KD0 A;  3LJR A;  3GFK A;  4JR6 A;  9GSS A;  2CVK A;  2OBK A;  2V1M A;  1PX7 A;  5AIV A;  3F4S A;  3GKM A;  3AY8 A;  3ERF A;  5HR3 A;  1OKT A;  4F2I A;  1V58 A;  2JZT A;  3D6I A;  6GST A;  1W4V A;  4MLY A;  5G2Z A;  1ZYQ B;  1K0B A;  1GSY A;  3H8Q A;  3IPZ A;  4I97 A;  1MDK A;  2H0I A;  4IQA A;  4JED A;  4L8E A;  3L9V A;  4HU9 A;  4AJ6 A;  4K0G A;  5B8A A;  4KA0 A;  2IFQ B;  1GTI A;  5ECP B;  5HR0 A;  4BVY B;  3ZML A;  3QPM A;  3KP8 A;  2HSM A;  4OFT A;  5IMF A;  13GS A;  4PI2 C;  2C1Y A;  2WZ9 A;  4KDY A;  4YH2 A;  5ECR B;  3GNJ A;  4QL7 A;  2HSM B;  1GTA A;  5KN1 A;  3CHX C;  4WR4 A;  4IP1 A;  5G1L A;  3C1R A;  3LW9 A;  3CSH A;  5F05 A;  2IMK A;  4LMW A;  1OAZ A;  1TI1 A;  2A2S A;  2IL3 A;  2VIM A;  4RQR A;  1OKD A;  1N25 A;  5J40 A;  1EWX A;  2KOK A;  4O92 A;  2KP1 A;  3M3M A;  4PTS A;  5EL8 A;  3EWL A;  4X1U A;  4ZL9 A;  4RI6 A;  1VGL A;  4JZQ A;  4AGS A;  3EC3 A;  2C8U A;  1T4Y A;  2AJQ B;  4ZBB A;  2VCW A;  2WVY A;  3HA9 A;  5DAK A;  1XBS A;  1AQV A;  1SYX A;  2B7K A;  1J08 A;  5IMD A;  4MDC A;  2H1D A;  2HZE A;  17GS A;  2PPT A;  3G7I A;  1ABA A;  4GTU A;  3TB2 A;  4O5U A;  5DAK B;  4F9Z A;  4HJM A;  3U6V A;  4AJ7 A;  4CY6 A;  5ECI B;  3W6G A;  2HZE B;  2XBI A;  5AIX A;  2MMN A;  3TKS C;  1GH2 A;  4V2L A;  1UC7 A;  1M2D A;  4OCF A;  5ABR A;  2LKU A;  2FWG A;  2FA8 A;  3C8E A;  4MF6 A;  3R3E A;  2MYG A;  5D9T A;  3DML A;  3ED3 A;  4I5Q A;  3DD3 A;  3PH9 A;  1QXH A;  3D22 A;  2LTK A;  4BL7 A;  19GS A;  4J2F A;  5AGY A;  2LRT A;  3H93 A;  2GGT A;  3CSJ A;  3IBH A;  5J47 A;  3HVV A;  16GS A;  4E68 A;  1R26 A;  1SJI A;  3KP9 A;  5CAX A;  5IIZ A;  1SVM A;  4G10 A;  3L9U A;  1H4O A;  3KMO A;  1SJ6 A;  3A2V A;  4J57 E;  1GSE A;  3FR9 A;  2YN1 A;  4N3Z A;  1XZO A;  3F4R A;  2E2G A;  1TRW A;  2N5B A;  4HQZ A;  4N11 A;  2WW2 A;  1SK1 A;  4WEY A;  3TKS A;  5KN2 A;  1XW5 A;  3HJP A;  1Z6N A;  2WW3 A;  3J7Y b;  4H86 A;  1DSB A;  2J9H A;  4HEA 2;  4DSQ A;  2VL2 A;  1G6Y A;  4XS4 A;  2L57 A;  3O3T A;  3M8N A;  2H19 A;  2BTO T;  1WOU A;  4K1F A;  1ZYN A;  2IPA A;  4KE3 A;  4CHS A;  4IGJ A;  1XFL A;  2DJ2 A;  1SL1 B;  2VO4 A;  1TOF A;  1R5P A;  3GTU A;  1XWA A;  2LQQ A;  2B7J A;  2AAW A;  3ZMK A;  3GMF A;  2HQT A;  3FZ9 A;  2FWE A;  1K0O A;  4HS1 A;  1Y25 A;  2IWT A;  5H5R A;  1OC8 A;  2E2M A;  4V2N A;  2JZS A;  4O32 A;  18GS A;  2HT9 A;  3ZYW A;  1M9B A;  3R2Q A;  1EGR A;  1GLQ A;  5G5F A;  3L0H A;  2AV4 A;  2X8G A;  1JZW A;  5ID2 B;  2F3M A;  2CVB A;  5E4W A;  1GNE A;  2KP2 A;  3HZ4 A;  4IJ3 A;  2FNO A;  1YVL A;  5DBQ A;  4BVX A;  2JSZ A;  4Z2U A;  4AKI A;  3DXB A;  7GSS A;  2WRT A;  3HMJ G;  4NAX A;  4AKH A;  5KEJ A;  6GSS A;  3TJJ A;  1Z5Y E;  3RDW A;  1GTU A;  4K2X A;  3UMA A;  4I8B A;  3APQ A;  3KH7 A;  4YAP A;  4CW9 A;  1FB0 A;  1IYI A;  3ZRD A;  2XPD A;  3GUR A;  4KH7 A;  1S3C A;  3DVW A;  4DEJ A;  1TXX A;  2OA7 A;  4V2M A;  1BG1 A;  2JZR A;  2YWI A;  2WW1 A;  3CTG A;  4KB3 A;  1B9X C;  5AN1 A;  4FO5 A;  6GSX A;  3TJK A;  5EVO A;  1K3O A;  3LGC A;  2H71 A;  1J0F A;  2CVD A;  4W66 A;  2GQK A;  3ZVJ A;  1XW9 A;  3HDC A;  1QGV A;  1EV9 A;  1XOB A;  3BJ5 A;  2B5Y A;  3IE3 A;  1KBN A;  2ZCT A;  1B4Q A;  3TGZ A;  2C3N A;  3VPQ A;  2AUV A;  4BWS A;  1GSD A;  2EIO A;  2DKH A;  3MWH A;  3UIW A;  4I6X A;  2YOI A;  2H1L A;  1PKZ A;  2GZY A;  2I81 A;  3M1G A;  4EUY A;  1F6M C;  2M72 A;  3CSI A;  3QFA C;  3EMX A;  2VM1 A;  2X8H A;  2BJX A;  3GN3 A;  5F8B A;  4MJE A;  2B5E A;  2HYX A;  2L5O A;  3C1S A;  3RFR C;  4GQC A;  1QK8 A;  4ML1 A;  1PL1 A;  1SD9 A;  2WDU A;  5JCG A;  1F3B A;  2F8F A;  1ERU A;  1FVJ A;  4ZBA A;  1K0D A;  2P0G A;  3GL3 A;  3Q19 A;  2D2Z A;  2TRC P;  3F3R A;  4ICY A;  4K7O A;  1SEN A;  1AIU A;  1FOH A;  1X0R A;  2HRA A;  2YWM A;  3APO A;  1X9W B;  2GTU A;  3F63 A;  5ECL B;  1JFU A;  4QL9 A;  3Q6O A;  4HZ2 A;  3KH9 A;  3BCK A;  1X5E A;  5F0G A;  1U88 A;  1KNG A;  3I9V 2;  2FY6 A;  2LUS A;  1ZZY A;  3ME7 A;  4I2T A;  1GTB A;  1TXU A;  1MD3 A;  2DC5 A;  5A5H A;  5INY A;  2AB6 A;  4K5R A;  3N5O A;  5CRE A;  2ES7 A;  3WGX A;  1PL2 A;  3A2W A;  3UAR A;  1I9D A;  2EFE A;  3DEX A;  2OJL A;  5IMA A;  4EDY A;  2R6K A;  5F07 A;  3ZTL A;  2WB9 A;  1XVQ A;  3P8W A;  3QDN A;  1QMV A;  2WZS A;  1CQG A;  3HKR A;  3EPT A;  2PER A;  2AHE A;  1T8E B;  1B8X A;  1DUG A;  4ECB A;  3KZQ A;  4KCA A;  2GVP A;  1O81 A;  3TKQ A;  4HI7 A;  2HSH A;  4KF9 A;  5BRT A;  2YJH A;  4IBP A;  4EO3 A;  2NPB A;  3HYP A;  2O3E A;  1OC9 A;  5IMZ A;  3KTL A;  2LV3 A;  1EEJ A;  2H1A A;  1M9A A;  4PXO A;  1G7E A;  5G1K A;  4EDZ A;  1S3A A;  1VF1 A;  3DVX A;  2HSY A;  1TP9 A;  3P7X A;  1OC9 B;  5D9X A;  1DE1 A;  3TRQ A;  2WJU A;  3APS A;  1BX9 A;  5D93 A;  3P90 A;  1KEB A;  1HYU A;  1RW1 A;  3Q74 A;  1ERW A;  1MTC A;  3G7Y A;  5CRH A;  2VM2 A; 
#chains in the Genus database with same CATH homology
 2VD0 A;  1VRS D;  3D4M A;  2H73 A;  1YKC A;  4ZBD A;  3QOU A;  3WT2 A;  2WGR A;  3TJF A;  2V6O A;  5HFK A;  3MDK A;  4GRF A;  5GSS A;  2X4A A;  4GWR A;  1YJ6 A;  2UZ8 A;  3OR5 A;  4TKY A;  2VCX A;  1ZYP A;  2DSA A;  5IO2 A;  4F82 A;  5ENU A;  4PQH A;  4G9H A;  2L6C A;  4N0V A;  1YY7 A;  3CBU A;  2ALB A;  5J9B A;  1K3Y A;  3W8S A;  1MD4 A;  2PVQ A;  1HNA A;  3EU4 A;  4L0U A;  1SD8 A;  3C73 A;  1TK0 B;  4TXO A;  3HZ8 A;  1VF3 A;  3G9B A;  1U6T A;  1GWC A;  2K8V A;  2DMM A;  3Q18 A;  5CP1 A;  1PN0 A;  3LXZ A;  2O85 A;  4TR3 A;  5IO0 A;  1E2Y A;  1JZD A;  4MJA A;  1Y1U A;  3LSZ A;  1XW6 A;  2WS2 A;  1THX A;  4MZW A;  3L78 A;  3TU3 B;  4TVE A;  2HNL A;  3O6T A;  2B1K A;  3IC8 A;  4K0N A;  2H70 A;  3PPU A;  1EP7 A;  3KGK A;  6GSU A;  5DJL A;  5HFG A;  2JAC A;  1DBY A;  1SVO A;  5DCH A;  2X49 A;  1BYE A;  1HQO A;  4PX1 A;  5B7C A;  1B9Y C;  1V2A A;  3FY7 A;  4FYC A;  4NV2 A;  3U5R E;  1G6W A;  2VLU A;  4LA1 A;  1Z3E A;  3FW2 A;  3F4T A;  4EVM A;  5C00 A;  2GS3 A;  3ERG A;  4MJC A;  4QQ7 A;  1BG5 A;  3IK9 A;  4FH8 A;  4X4J A;  5JCW A;  5LNK e;  1AQX A;  3GHA A;  1YF0 A;  3WGD A;  3C7M A;  1SL0 B;  4PNG A;  1X5C A;  1I5G A;  1K3L A;  2H30 A;  3F0I A;  1U3I A;  2X99 A;  4ECI A;  2FWF A;  5G31 A;  5ECK B;  4K6X A;  2CA8 A;  1TK8 B;  4MH3 A;  3L4N A;  3C71 A;  6GSV A;  1U87 A;  3GV1 A;  2HXK A;  1GL8 A;  3FRC A;  2PWJ A;  3V1W A;  5IPG A;  4ZIL A;  1WP0 A;  1XVW A;  1A2J A;  4EE0 A;  2E7P A;  3QR6 A;  5FT3 A;  3TCO A;  4JU5 A;  3RPP A;  2VL2 C;  4F0B A;  5CRD A;  1ILO A;  1YEX A;  1TRU A;  5H5S A;  3IHQ A;  4ZB8 A;  4ACS A;  4MPG A;  2HE3 A;  3IHG A;  2N5A A;  10GS A;  4PUR A;  4HJ2 A;  1XXU A;  1PGT A;  1AUC A;  1MEK A;  2L4C A;  4JRR A;  12GS A;  2OAC A;  1ERT A;  1TU7 A;  4KX4 A;  4IHU A;  4EIQ A;  4BL7 B;  3O76 A;  5IPH A;  1M99 A;  2A4V A;  3A5W A;  3SBC A;  2K8S A;  1A23 A;  1M2A A;  2MMA A;  1BAY A;  4E8E A;  4LL4 B;  2H0G A;  4YKG A;  4XHM A;  1G0T A;  5B6M A;  2GT5 A;  3GIX A;  2YCD A;  1GUM A;  5JWQ B;  2O8V B;  4K7I A;  4EIP A;  3ZVJ D;  4MK3 A;  4O5Q A;  2L59 A;  1TW9 A;  2QA1 A;  2ON7 A;  4TN8 A;  4K5S A;  2PUK C;  4D73 A;  4NV5 A;  3IAS 2;  4Q5R A;  4ID0 A;  2VCQ A;  1O8X A;  1HNB A;  4KSM A;  4GF0 A;  3ME8 A;  3LQ7 A;  3D21 A;  3I69 A;  2X8C A;  4IN0 A;  2VUP A;  1QUW A;  4XS4 B;  5G5E A;  1WJK A;  1WRY A;  1ML6 A;  5LD0 A;  4K2D A;  2YWN A;  4O5R A;  2JAD A;  4E8H A;  2GSS A;  3JCM L;  2OBI A;  2ZNM A;  4Q5Q A;  4XS6 A;  3DRN A;  5DCG A;  3ZZX A;  3TOT A;  1V98 A;  2MMO A;  3VFI A;  4RQX A;  4TR0 A;  2MZC A;  1DE2 A;  3MYD A;  2REM A;  4MP4 A;  1EOH A;  3GTU B;  3VWU A;  1LBK A;  2BMX A;  2FUG 2;  2IMI A;  1GSQ A;  4NHW A;  5COH A;  5B6N A;  5HR2 A;  2I4A A;  5EY6 A;  3ZFB A;  3BD2 A;  5ECQ B;  4HUA A;  4ZB9 A;  3FR6 A;  1W89 A;  2DJK A;  2DJ1 A;  1V40 A;  4POM A;  5CRW A;  4OFM A;  1O7U A;  4L5O A;  2FD3 A;  5KOW A;  2L5L A;  4O7H A;  1B4P A;  1URM A;  3H79 A;  2TIR A;  1EV4 A;  4NPB A;  1SKR B;  3F6D A;  1ERV A;  4OO5 A;  4NMU A;  2O89 A;  5A1N A;  4BVX B;  4GDF A;  2H6Y A;  3TKP A;  3GH6 A;  1SL2 B;  3GYK A;  4FQU A;  2A2R A;  1PA3 A;  2EFH A;  1N2A A;  4AKX B;  4L5L A;  4PUF C;  1ZGN A;  1ACV A;  2R37 A;  3F6F A;  3IRA A;  1TI3 A;  2CV4 A;  4ECC A;  5EPF A;  2GSQ A;  3GH9 A;  1O8W A;  4ZB6 A;  3LG6 A;  2OE1 A;  3DIE A;  4OFN A;  1X9M B;  1JZO A;  5HQP A;  4XRA A;  1WWJ A;  5HFI A;  1TDI A;  4EC0 A;  3G7J A;  1ZMA A;  4KW6 A;  2O7K A;  2KLX A;  2LRN A;  2XPE A;  5KOX A;  1Q98 A;  2H75 A;  3HVX A;  2DLX A;  1GRX A;  4FYB A;  3RHB A;  1FHE A;  3VPT A;  4N10 A;  3H1N A;  1U3A A;  5ECM B;  1AC1 A;  3ZIJ A;  1BED A;  4IP6 A;  5A4U A;  4HU7 A;  1B48 A;  1BQ7 A;  3D5J A;  2TRX A;  5D73 A;  5J4Y A;  4ULX A;  2LEG A;  4LMV A;  3MAK A;  2C3Q A;  1K0N A;  1WE0 A;  2VL3 A;  3F3Q A;  4GXZ A;  4WBR D;  5A4W A;  2LS5 A;  2IJY A;  2YJ7 A;  3I43 A;  4IQ1 A;  3GRX A;  3A2X A;  4G0K A;  3WYW A;  1A0F A;  2NDO A;  1CQH A;  5A34 A;  4K9Z A;  5GAN D;  4POL A;  3ZIT A;  2DBC A;  2PMT A;  3LYP A;  2NVL A;  2QKE A;  2VKZ G;  1LJR A;  4ECJ A;  1FVK A;  2QC7 A;  3ZLP A;  3EIN A;  1JLV A;  1OE8 A;  4HOJ A;  2B5X A;  3PGT A;  3VWV A;  5CYY A;  2C80 A;  2EIR A;  2LST A;  3CXG A;  3HJO A;  2HRK A;  2C3T A;  5L71 A;  4MF5 A;  4IS0 A;  1A8L A;  3TUE A;  1VF2 A;  1X9S B;  4WF5 A;  2QGV A;  3GST A;  3NIV A;  5A5H B;  2CT6 A;  3I6A A;  2DJ3 A;  2J23 A;  2N5F A;  4GQF A;  1WPI A;  3GKX A;  1SK2 A;  3EU3 A;  5J4U A;  2UV8 G;  2C4J A;  3MSZ A;  4L0W A;  5D9W A;  2R0G A;  1SYR A;  2I1U A;  2OKA A;  2H01 A;  3N9J A;  3QMX A;  4YKF A;  5E59 A;  3LXT A;  5DDL A;  11GS A;  3EYT A;  3ZL5 A;  1Z6M A;  1XCC A;  1MDJ A;  2XBQ A;  3HXS A;  1SJZ A;  5DAL A;  4G2E A;  1F2E A;  2H6Z A;  4N30 A;  2VCT A;  5BMU A;  2YWO A;  4JR4 A;  1X5D A;  4KSO A;  1EEM A;  3UVH A;  1JZR A;  4EL1 A;  3QAV A;  5ECN B;  3GSS A;  1NW2 A;  8GSS A;  2C0D A;  1M7T A;  5IQY A;  2VOC A;  1QFN A;  2YP6 A;  2EIQ A;  1ZL9 A;  5B8B A;  4TXV A;  4MF7 A;  4MZB A;  2ZUP A;  4NXI A;  1GSS A;  5JWR B;  4PQI A;  3GX8 A;  2IMF A;  3M9K A;  4DSS A;  5J9C A;  4PUA A;  1T7P B;  4OCE A;  3ERW A;  3VI5 A;  1T4Z A;  3CWG A;  2MMZ A;  2PN8 A;  3CYN A;  4Z7X A;  4USS A;  4Z2T A;  1ZOF A;  5J4V A;  3WGE A;  4WBJ A;  3KEB A;  1C72 A;  1O85 A;  2VCV A;  1XOA A;  5ECS A;  2GQM A;  2K6V A;  4AJ8 A;  2K9F A;  1F9M A;  4P3Y B;  4TXO B;  3H4K A;  4KCE A;  3EUR A;  1RQM A;  4ZL8 A;  2F51 A;  4XCS A;  2KHP A;  3GKK A;  2JSY A;  1FOV A;  5GZZ B;  1QQ2 A;  2LQO A;  4ZB7 A;  1YF1 A;  2CX3 A;  2IFQ A;  1A2L A;  2FGX A;  1EZK A;  4BVY A;  1AW9 A;  4ZL7 A;  2DKI A;  2LRC A;  5A4V A;  1K0A A;  1XWC A;  1EGO A;  4I2U A;  1AAZ A;  3EMP A;  2ON5 A;  4TR1 A;  4OMV A;  2DIY A;  4MCU A;  1Z7R A;  3CTF A;  1R4W A;  1GLP A;  3ZIV A;  3VK9 A;  1XIY A;  2RLI A;  3UBK A;  2HRF A;  1F37 A;  4TR1 B;  1VF4 A;  5ECH B;  1MDI A;  3LWA A;  5FHI A;  2V2G A;  2QSI A;  3ISO A;  2P5Q A;  2LJK A;  4LL1 B;  3KXO A;  4WR5 A;  3IXR A;  3EE2 A;  1NSW A;  5IOX A;  2MBT A;  3HD5 A;  3FR3 A;  3CMI A;  5DJM A;  3KMN A;  5F06 A;  2G0F A;  2VLT A;  3HY2 A;  1EP8 A;  3D4T A;  1GSF A;  4IVF A;  3FKF A;  2I3Y A;  4KAE A;  3M0F A;  1T3B A;  4XTS A;  4MJB A;  5JWO B;  2HSN A;  2OE0 A;  5IMC A;  5LCZ A;  2WFC A;  5CO3 A;  1OYJ A;  2F8A A;  2CZ3 A;  3J7Y k;  3EVI A;  2P31 A;  3QCP A;  1RK4 A;  4CY8 A;  2HSN B;  4K8M A;  4TR4 A;  5J41 A;  4LLR A;  4N0Z A;  4Q5F A;  5FWG A;  2GQL A;  1FB6 A;  3KTB A;  5GAP D;  2A4H A;  3FZ4 A;  3A3T A;  4NHZ A;  4AKG A;  1KTE A;  2FWH A;  4HQS A;  2V41 A;  1M0U A;  1GUL A;  4DVC A;  2P5R A;  2VD1 A;  2H0H A;  2IIY A;  4G19 A;  2LNS A;  1PD2 1;  3HHV A;  3KM6 A;  1ZCP A;  3LEF A;  3IK7 A;  4MA9 A;  1PQN A;  1TKD B;  4YAV A;  3TRX A;  2CQ9 A;  2IN3 A;  5A5K A;  1PN9 A;  5ECO B;  3E0U A;  3IAM 2;  5G30 A;  1ON4 A;  4X0X A;  3UAP A;  2PVO C;  3VWW A;  4ZXG A;  4TOP A;  4GST A;  3ZFL A;  2DML A;  4FIW A;  1NHO A;  2YZH A;  1V9W A;  3CRU A;  4OWY A;  1YQ1 A;  4MPF A;  3DKS A;  1NHY A;  1M2B A;  4GSN A;  3WD6 A;  3K8N A;  2FLS A;  2YV7 A;  2A2P A;  1NM3 A;  2G2Q A;  3TOU A;  4TRX A;  5GST A;  3QAW A;  3WT1 A;  4BA7 A;  1XWB A;  4D73 B;  1TRV A;  2EC4 A;  4XIH A;  4MMM A;  1A0R P;  3DGQ A;  2M46 A;  2YPM A;  4AF2 A;  4GSS A;  6GSY A;  4JE1 A;  4MH2 A;  3UEM A;  4WXT A;  1PX6 A;  1O6J A;  2B3S A;  3FZA A;  4Q5N A;  3D0Z A;  5IMV A;  1SKS B;  5IOW A;  4XS1 A;  4PQ1 A;  1T1V A;  1HD2 A;  2NBS A;  1A2M A;  1FW1 A;  2CAI A;  4RI7 A;  1XWG A;  4POK A;  3FEU A;  3LOR A;  4YQM A;  3TJB A;  2V6K A;  3UL3 A;  1E6B A;  4KDX A;  3TJG A;  3W8J A;  2GZZ A;  4RUV A;  4IEL A;  4J56 E;  3DYR A;  3HVS A;  3RPN A;  2GDR A;  5JCU A;  3KIJ A;  3RBT A;  2R4V A;  2MBS A;  1IYH A;  4V1A g;  2B1L A;  5HR1 A;  2KUC A;  3ZRE A;  5ID2 A;  1WIK A;  4NWY A;  4X43 A;  2RII A;  2QA2 A;  2X64 A;  2L6D A;  4KUN A;  2V32 A;  4Z2R A;  5IM9 A;  1K0M A;  3FHK A;  4CDO A;  3LFL A;  2H74 A;  2CX4 A;  5A1N B;  1Z7P A;  2DIZ A;  2EFC A;  2I9H A;  5J3R A;  2FCH A;  3F9U A;  2R0C A;  1GNW A;  4MNN A;  4V1A p;  3MNG A;  2H72 A;  2C0E A;  2HFD A;  2CAQ A;  1TRS A;  5KN3 A;  1F3A A;  3FYG A;  1PSQ A;  2GZP A;  5DQY A;  3BOA A;  1TK5 B;  3RHC A;  3NOF A;  4EKZ A;  4BPY A;  4YQV A;  3M9J A;  4PGT A;  2WUL A;  4ZIJ A;  2H66 A;  3BCI A;  1UA5 A;  1Z9H A;  1BJX A;  3VLN A;  1YZX A;  4XRD A;  1R5A A;  2DJJ A;  2E0Q A;  3MIX A;  4HZ4 A;  4A5P A;  2L4Q A;  4G01 A;  1V57 A;  22GS A;  2K18 A;  1GSU A;  4G0I A;  1R7H A;  3RAZ A;  1PMT A;  2WCI A;  1YEP A;  3VWX A;  3DWV A;  1XWK A;  1BF5 A;  5ELA A;  1A24 A;  3IR4 A;  3PR8 A;  2GLR A;  2R2J A;  3HJM A;  4WF4 A;  4G0L A;  4MAB A;  3IA1 A;  3LYK A;  2EFD A;  3GL5 A;  2H1G A;  5AIS A;  3TKS E;  1OC3 A;  1TTZ A;  1ST9 A;  1J9B A;  3GKN A;  4IKH A;  2YAN A;  1S3D A;  3QFB C;  4FYU A;  2PBJ A;  1LU4 A;  2O87 A;  1N8J A;  4PNF A;  2XC2 A;  2RM5 A;  14GS A;  5A34 B;  4BWQ A;  20GS A;  2YZU A;  5D8I A;  4AI6 A;  2H6X A;  1SKW B;  5D9V A;  2GST A;  4GCI A;  5KN0 A;  1K0C A;  3S9F A;  2LJA A;  2PGT A;  1XPV A;  1EOG A;  4YQU A;  1AQW A;  2CZ2 A;  4TW5 A;  4K7N A;  2FA4 A;  4F03 A;  4KND A;  2IME A;  2O5V A;  1THO A;  2Z9S A;  1T00 A;  1OVN A;  1OE7 A;  4EF0 A;  3E9J B;  2HRK B;  1PKW A;  5J5N A;  2R3X A;  4OO4 A;  5CNW A;  1AXD A;  1ZYE A;  3BBY A;  2VCZ A;  4GLT A;  5H5Q A;  4ML6 A;  1Y6E A;  2H76 A;  2HI7 A;  3FMW A;  5D96 A;  2PU9 C;  1FO5 A;  5C04 A;  2C0F A;  1G7O A;  3HCZ A;  3A5I A;  1SK0 A;  2RM6 A;  1USB A;  4JBB A;  2HLS A;  2JU5 A;  2OT3 A;  2AYT A;  2RUE A;  4KGI A;  4WET A;  1H75 A;  4HDE A;  2IMD A;  3E3E A;  1UVZ A;  1GUK A;  3KJY A;  4ILF A;  2GT6 A;  2H1B A;  3UBL A;  4IW9 A;  4ISD A;  2M80 A;  2OE3 A;  1UN2 A;  1YKA A;  1Q4J A;  2RUF A;  4IJI A;  3TDG A;  3UJ1 A;  4OD7 A;  3FK8 A;  3UOM A;  2YV9 A;  3FZ5 A;  3KCM A;  2R0P A;  5ELG A;  2LNT A;  2XHF A;  2VL9 A;  3GUS A;  6GSW A;  3NZN A;  2VLV A;  3UVT A;  3PIN A;  3VUR A;  1JHB A;  5DAL B;  4QMK A;  2F9S A;  3L9S A;  3SWL A;  1GP1 A;  1TU8 A;  5BMU B;  1SVL A;  4F0C A;  4POB A;  4MZC A;  5DVB A;  1PRX A;  1FAA A;  2B6M A;  2HRN A;  5DQS A;  3IDV A;  3TKR A;  4WKW A;  1O73 A;  1TJD A;  2VAF A;  1FG4 A;  3GX0 A;  1SU9 A;  3GA4 A;  1GUH A;  2OAD A;  1WMJ A;  1HNC A;  2LJR A;  1YDK A;  3IOS A;  3QAG A;  2HZF A;  2NTO A;  4DSS B;  2R5G A;  4DSR A;  3US3 A;  4KDU A;  1JLW A;  3IC4 A;  3QD9 A;  3TRP A;  3CRT A;  5CRG A;  2C0G A;  2FHE A;  1A8Y A;  2JL4 A;  3P2A A;  3F8U A;  2DJ0 A;  3VI7 A;  2H8L A;  4EXJ A;  2YNX A;  3IV4 A;  2GSR A;  3KD0 A;  3LJR A;  3GFK A;  4JR6 A;  9GSS A;  2CVK A;  2OBK A;  2V1M A;  1PX7 A;  5AIV A;  3F4S A;  3GKM A;  3AY8 A;  3ERF A;  5HR3 A;  1OKT A;  4F2I A;  1V58 A;  2JZT A;  3D6I A;  6GST A;  1W4V A;  4MLY A;  5G2Z A;  1ZYQ B;  1K0B A;  1GSY A;  3H8Q A;  3IPZ A;  4I97 A;  1MDK A;  2H0I A;  4IQA A;  4JED A;  4L8E A;  3L9V A;  4HU9 A;  4AJ6 A;  4K0G A;  5B8A A;  4KA0 A;  2IFQ B;  1GTI A;  5ECP B;  5HR0 A;  4BVY B;  3ZML A;  3QPM A;  3KP8 A;  2HSM A;  4OFT A;  5IMF A;  13GS A;  2C1Y A;  2WZ9 A;  4KDY A;  4YH2 A;  5ECR B;  3GNJ A;  4QL7 A;  2HSM B;  1GTA A;  5KN1 A;  4WR4 A;  4IP1 A;  5G1L A;  3C1R A;  3LW9 A;  3CSH A;  5F05 A;  2IMK A;  4LMW A;  1OAZ A;  1TI1 A;  2A2S A;  2IL3 A;  2VIM A;  4RQR A;  1OKD A;  1N25 A;  5J40 A;  1EWX A;  2KOK A;  4O92 A;  2KP1 A;  3M3M A;  4PTS A;  5EL8 A;  3EWL A;  4X1U A;  4ZL9 A;  4RI6 A;  1VGL A;  4JZQ A;  4AGS A;  3EC3 A;  2C8U A;  1T4Y A;  2AJQ B;  4ZBB A;  2VCW A;  3HA9 A;  5DAK A;  1XBS A;  1AQV A;  1SYX A;  2B7K A;  1J08 A;  5IMD A;  4MDC A;  2H1D A;  2HZE A;  17GS A;  2PPT A;  3G7I A;  1ABA A;  4GTU A;  3TB2 A;  4O5U A;  5DAK B;  4F9Z A;  4HJM A;  3U6V A;  4AJ7 A;  4CY6 A;  5ECI B;  3W6G A;  2HZE B;  2XBI A;  5AIX A;  2MMN A;  3TKS C;  1GH2 A;  4V2L A;  1UC7 A;  1M2D A;  4OCF A;  5ABR A;  2LKU A;  2FWG A;  2FA8 A;  3C8E A;  4MF6 A;  3R3E A;  2MYG A;  5D9T A;  3DML A;  3ED3 A;  4I5Q A;  3DD3 A;  3PH9 A;  1QXH A;  3D22 A;  2LTK A;  4BL7 A;  19GS A;  4J2F A;  5AGY A;  2LRT A;  3H93 A;  2GGT A;  3CSJ A;  3IBH A;  5J47 A;  3HVV A;  16GS A;  4E68 A;  1R26 A;  1SJI A;  3KP9 A;  5CAX A;  5IIZ A;  1SVM A;  4G10 A;  3L9U A;  1H4O A;  3KMO A;  1SJ6 A;  3A2V A;  4J57 E;  1GSE A;  3FR9 A;  2YN1 A;  4N3Z A;  1XZO A;  3F4R A;  2E2G A;  1TRW A;  2N5B A;  4HQZ A;  4N11 A;  1SK1 A;  4WEY A;  3TKS A;  5KN2 A;  1XW5 A;  3HJP A;  1Z6N A;  3J7Y b;  4H86 A;  1DSB A;  2J9H A;  4HEA 2;  4DSQ A;  2VL2 A;  1G6Y A;  4XS4 A;  2L57 A;  3O3T A;  3M8N A;  2H19 A;  2BTO T;  1WOU A;  4K1F A;  1ZYN A;  2IPA A;  4KE3 A;  4CHS A;  4IGJ A;  1XFL A;  2DJ2 A;  1SL1 B;  2VO4 A;  1TOF A;  1R5P A;  3GTU A;  1XWA A;  2LQQ A;  2B7J A;  2AAW A;  3ZMK A;  3GMF A;  2HQT A;  3FZ9 A;  2FWE A;  1K0O A;  4HS1 A;  1Y25 A;  2IWT A;  5H5R A;  1OC8 A;  2E2M A;  4V2N A;  2JZS A;  4O32 A;  18GS A;  2HT9 A;  3ZYW A;  1M9B A;  3R2Q A;  1EGR A;  1GLQ A;  5G5F A;  3L0H A;  2AV4 A;  2X8G A;  1JZW A;  5ID2 B;  2F3M A;  2CVB A;  5E4W A;  1GNE A;  2KP2 A;  3HZ4 A;  4IJ3 A;  2FNO A;  1YVL A;  5DBQ A;  4BVX A;  2JSZ A;  4Z2U A;  4AKI A;  3DXB A;  7GSS A;  2WRT A;  3HMJ G;  4NAX A;  4AKH A;  5KEJ A;  6GSS A;  3TJJ A;  1Z5Y E;  3RDW A;  1GTU A;  4K2X A;  3UMA A;  4I8B A;  3APQ A;  3KH7 A;  4YAP A;  4CW9 A;  1FB0 A;  1IYI A;  3ZRD A;  2XPD A;  3GUR A;  4KH7 A;  1S3C A;  3DVW A;  4DEJ A;  1TXX A;  2OA7 A;  4V2M A;  1BG1 A;  2JZR A;  2YWI A;  3CTG A;  4KB3 A;  1B9X C;  5AN1 A;  4FO5 A;  6GSX A;  3TJK A;  5EVO A;  1K3O A;  3LGC A;  2H71 A;  1J0F A;  2CVD A;  4W66 A;  2GQK A;  3ZVJ A;  1XW9 A;  3HDC A;  1QGV A;  1EV9 A;  1XOB A;  3BJ5 A;  2B5Y A;  3IE3 A;  1KBN A;  2ZCT A;  1B4Q A;  3TGZ A;  2C3N A;  3VPQ A;  2AUV A;  4BWS A;  1GSD A;  2EIO A;  2DKH A;  3MWH A;  3UIW A;  4I6X A;  2YOI A;  2H1L A;  1PKZ A;  2GZY A;  2I81 A;  3M1G A;  4EUY A;  1F6M C;  2M72 A;  3CSI A;  3QFA C;  3EMX A;  2VM1 A;  2X8H A;  2BJX A;  3GN3 A;  5F8B A;  4MJE A;  2B5E A;  2HYX A;  2L5O A;  3C1S A;  4GQC A;  1QK8 A;  4ML1 A;  1PL1 A;  1SD9 A;  2WDU A;  5JCG A;  1F3B A;  2F8F A;  1ERU A;  1FVJ A;  4ZBA A;  1K0D A;  2P0G A;  3GL3 A;  3Q19 A;  2D2Z A;  2TRC P;  3F3R A;  4ICY A;  4K7O A;  1SEN A;  1AIU A;  1FOH A;  1X0R A;  2HRA A;  2YWM A;  3APO A;  1X9W B;  2GTU A;  3F63 A;  5ECL B;  1JFU A;  4QL9 A;  3Q6O A;  4HZ2 A;  3KH9 A;  3BCK A;  1X5E A;  5F0G A;  1U88 A;  1KNG A;  3I9V 2;  2FY6 A;  2LUS A;  1ZZY A;  3ME7 A;  4I2T A;  1GTB A;  1TXU A;  1MD3 A;  2DC5 A;  5A5H A;  5INY A;  2AB6 A;  4K5R A;  3N5O A;  5CRE A;  2ES7 A;  3WGX A;  1PL2 A;  3A2W A;  3UAR A;  1I9D A;  2EFE A;  3DEX A;  2OJL A;  5IMA A;  4EDY A;  2R6K A;  5F07 A;  3ZTL A;  2WB9 A;  1XVQ A;  3P8W A;  3QDN A;  1QMV A;  1CQG A;  3HKR A;  3EPT A;  2PER A;  2AHE A;  1T8E B;  1B8X A;  1DUG A;  4ECB A;  3KZQ A;  4KCA A;  2GVP A;  1O81 A;  3TKQ A;  4HI7 A;  2HSH A;  4KF9 A;  5BRT A;  2YJH A;  4IBP A;  4EO3 A;  2NPB A;  3HYP A;  1OC9 A;  5IMZ A;  3KTL A;  2LV3 A;  1EEJ A;  2H1A A;  1M9A A;  4PXO A;  1G7E A;  5G1K A;  4EDZ A;  1S3A A;  1VF1 A;  3DVX A;  2HSY A;  1TP9 A;  3P7X A;  1OC9 B;  5D9X A;  1DE1 A;  3TRQ A;  2WJU A;  3APS A;  1BX9 A;  5D93 A;  3P90 A;  1KEB A;  1HYU A;  1RW1 A;  3Q74 A;  1ERW A;  1MTC A;  3G7Y A;  5CRH A;  2VM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...