1DUGA

Structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
234
structure length
234
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPQQHHLGGAKQAGDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, blood clotting
molecule keywords chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERM
publication title Structure of the fibrinogen gamma-chain integrin binding and factor XIIIa cross-linking sites obtained through carrier protein driven crystallization.
pubmed rcsb
source organism Schistosoma japonicum
total genus 75
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1dugA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1dugA01
4XHMA 3FRCA 3ME8A 4EC0A 3UIWA 4MLYA 3FZ9A 2IMKA 4PNFA 1EV9A 4QQ7A 1GSYA 2TRXA 3FZ4A 2J9HA 3HJPA 3TJFA 3KJYA 2GGTA 3HZ4A 1FVJA 1BJXA 3V1WA 1SKSB 4MJAA 2OBKA 3TJGA 2VCXA 2B7JA 2L4CA 1TOFA 3C7MA 1ERWA 3L9UA 4F9ZA 1GULA 1QXHA 3A2WA 2HRKA 2IIYA 1H4OA 4NAXA 3LJRA 17GSA 1EEJA 4WXTA 2GSTA 4V2LA 4N10A 4WF4A 8GSSA 5A4WA 2C0FA 4WF5A 4NXIA 4KDXA 3F0IA 5KN3A 1EEMA 4XIHA 2VCWA 4OMVA 2I81A 2OKAA 1QQ2A 3IE3A 2YPMA 5CREA 1M2AA 2RIIA 4BVYA 1WMJA 4TR3A 2H6ZA 5ECHB 2R2JA 4HU7A 4ZILA 4LL1B 4WETA 3MWHA 1JZRA 1THXA 1M2BA 4V1Ap 4KNDA 4ID0A 5L71A 3FEUA 1LBKA 1K0MA 1BG5A 3M9JA 1K0AA 1N2AA 4BVXB 4ZL7A 2PWJA 1WOUA 4IBPA 2XPDA 1AIUA 3GA4A 2F8AA 4IW9A 2AAWA 18GSA 2EC4A 3VI7A 4USSA 5KN2A 1F9MA 5HFIA 3EC3A 1GWCA 4TR1A 1MD4A 4BA7A 5KN0A 2P31A 4KA0A 3ZFBA 3GKNA 2H01A 3C71A 3L9SA 4TR0A 2H72A 1V40A 3F6DA 4DSSB 5LCZA 2JZRA 16GSA 1XWAA 3GH6A 3M9KA 2CVKA 1YDKA 3LG6A 2GSQA 2PVQA 2H1GA 4MZBA 5DALB 4POKA 1GL8A 4GQCA 1ERTA 4EO3A 3VPTA 5ABRA 2IFQA 3IK7A 4F0CA 5J9BA 4O92A 4IVFA 3DWVA 3EMXA 4ZL8A 3ED3A 2YNXA 1UVZA 2MMNA 5DVBA 1A2MA 1OC9A 3IRAA 1PRXA 2H30A 2B5YA 3LXZA 2KOKA 3VWWA 1SYRA 4EVMA 4L5LA 4QL7A 2LS5A 2XPEA 2FNOA 4E8HA 1WWJA 4PQHA 3WGEA 2HQTA 1UN2A 5G2ZA 4RI7A 2ZCTA 3VI5A 4RI6A 1PN9A 1X5CA 5HFGA 5DQSA 3ZVJD 3M8NA 5ID2A 4OFNA 2HSMA 1UA5A 5DBQA 5EVOA 1PL2A 4AJ6A 5GZZB 2XC2A 2YZHA 3APOA 4I8BA 3GYKA 1J9BA 1ERVA 1TP9A 3ZMLA 4PTSA 2CAQA 4HI7A 3QCPA 4AJ7A 2NVLA 1XIYA 1SL0B 3KIJA 1QUWA 3FHKA 1JFUA 4TW5A 13GSA 3F6FA 3I6AA 5COHA 3US3A 2DIYA 3ZL5A 1TI3A 4Q5FA 1ABAA 2GSSA 2PU9C 4XCSA 2LV3A 6GSTA 2VOCA 1OVNA 1SK1A 1XW9A 4K7OA 4KH7A 3C1RA 2DBCA 2REMA 2H71A 3C8EA 1AW9A 4N11A 1TXXA 1JLWA 1HNCA 3GKKA 1OC3A 3VLNA 3QD9A 3R2QA 4XS4B 2H0GA 1PQNA 1AQXA 3QDNA 3DXBA 3IHQA 2XBIA 2TRCP 3WD6A 1BYEA 2B5XA 1GNEA 4HUAA 2L4QA 1U6TA 5LD0A 4ECBA 3NIVA 3GIXA 5GSTA 3KCMA 6GSVA 3UVHA 2I1UA 3I43A 3ZIJA 3RBTA 5HR1A 3D21A 4MDCA 3HJMA 2IMDA 3GV1A 2A2RA 3KMNA 1KBNA 4MJCA 2MMOA 3RPPA 3H1NA 2OE0A 4G0LA 1S3AA 4NV2A 1M7TA 2P5RA 4GQFA 1FOVA 3E3EA 3TDGA 4IQAA 4TOPA 3QAVA 1E6BA 3KTLA 5JCUA 3FYGA 2YV7A 2WDUA 5IMFA 3GTUB 4RQRA 2H8LA 5E4WA 1FAAA 4F0BA 3IAS2 2C0DA 4IELA 1T7PB 4ZXGA 1HNBA 2FWEA 1U3IA 2HRFA 4TXVA 4V2MA 1A2JA 2H66A 1ILOA 1SK2A 2IJYA 4Z7XA 3N5OA 1X5EA 3F3QA 3IDVA 1BQ7A 2DJ3A 2DLXA 2GS3A 3GNJA 2IPAA 4XS6A 3TJJA 3ERFA 4O5RA 2FCHA 4G9HA 2V32A 1F37A 3DKSA 2QC7A 5GSSA 3A3TA 1K3YA 1XZOA 2B1KA 2MMAA 3HHVA 2MBSA 1AQVA 4IS0A 2NTOA 2AUVA 5GAPD 2VCTA 3CRTA 2MBTA 3KMOA 3MDKA 1EWXA 5JWQB 3EYTA 2YWNA 2VL3A 3E0UA 2LJRA 1SL2B 5HQPA 2YZUA 5HR0A 5IIZA 5JCGA 4BVXA 2R5GA 1J0FA 3CRUA 4IQ1A 3GX0A 2O85A 1MEKA 3LGCA 1GSEA 2PN8A 3W8JA 1B4PA 3GMFA 4ML1A 1R7HA 4KSMA 2HYXA 4J56E 5B6MA 4PQ1A 4KCEA 4TVEA 3CSHA 4KUNA 2PBJA 2YJ7A 1FW1A 4OCEA 2YOIA 2O89A 1TK8B 2LRCA 2R37A 2KP1A 4DSSA 1V9WA 3DD3A 2A4VA 3F4TA 2IL3A 3F4RA 3KTBA 3D0ZA 5D9VA 4MF7A 1Z9HA 4WR4A 5DALA 1WIKA 4YAVA 5D9TA 6GSUA 1HD2A 3IC8A 2LQQA 1TU7A 1YKCA 5D96A 1KTEA 4CW9A 1OKDA 2OA7A 2HSYA 4IGJA 3WGXA 3TKRA 1J08A 3DVWA 2G0FA 1PL1A 4HU9A 3SBCA 1ML6A 1KEBA 2XBQA 20GSA 1TJDA 2YP6A 1TKDB 5J5NA 1K3LA 2JSZA 3GRXA 3VFIA 1MD3A 4OFMA 4K0NA 3FK8A 4GSNA 3A2VA 3H93A 1AXDA 2I4AA 2HE3A 4F03A 5IMAA 2VO4A 4K8MA 1B9XC 3ZIVA 1A0FA 1FO5A 4FIWA 2YWIA 2LKUA 1RW1A 2X8HA 2WCIA 3G7JA 3O76A 3VWVA 3F3RA 1XWCA 3KGKA 4JEDA 2CZ3A 1NHOA 6GSSA 3WGDA 4GTUA 1DE1A 22GSA 1V98A 2L6CA 4V1Ag 1A8YA 2B5EA 4BL7B 3GURA 3QAGA 4NPBA 1JZDA 1AAZA 1WRYA 2VLTA 3EE2A 5C04A 3LORA 1XWBA 2HZEB 2H1DA 5F05A 2Z9SA 1LJRA 3BD2A 2VD1A 1ON4A 19GSA 4J2FA 1WJKA 2HZFA 14GSA 1PGTA 3FR9A 4TRXA 2QSIA 4MH2A 4XS4A 1GUMA 3KXOA 2VAFA 3MNGA 1GH2A 6GSXA 2F8FA 1QFNA 1VRSD 3RDWA 5KEJA 1T4ZA 2IN3A 4IP1A 3VPQA 2CAIA 1OE8A 5IPHA 5DJLA 3HYPA 2HXKA 2EIRA 1SKWB 2JU5A 1V57A 2HRAA 4ULXA 3PR8A 2C3QA 3VWUA 1GSUA 4HJ2A 2H76A 1U87A 2K9FA 3NOFA 2CA8A 3QOUA 3KD0A 1XBSA 3U5RE 3GKMA 4ZB6A 4EXJA 1M99A 4MP4A 3RPNA 1I9DA 2CX4A 3EINA 1YZXA 1JLVA 5IOWA 4GF0A 4OCFA 4MJBA 3GTUA 4G2EA 4WEYA 2V6OA 1YJ6A 1YQ1A 4JZQA 4JR4A 2D2ZA 2YCDA 1BAYA 4IJ3A 4EDZA 2OBIA 1TRWA 5G31A 3WYWA 4N30A 2YV9A 4DEJA 1JZWA 1U88A 5D73A 4TN8A 4TKYA 1YF0A 4L8EA 3IPZA 4MZWA 5DQYA 1F3AA 1H75A 2CVDA 2E7PA 1ACVA 4K0GA 3HDCA 3ZYWA 3CTGA 3ZLPA 2OE3A 4JRRA 3ZITA 4EKZA 5AN1A 4AGSA 3UBKA 3TKSE 1G7EA 4FYUA 1QGVA 4JU5A 1O7UA 2LSTA 1ZYEA 3TB2A 1O8XA 4ZIJA 4G0KA 2CVBA 2LUSA 4KX4A 3VWXA 1RQMA 2I9HA 1FB6A 3HKRA 3ZTLA 1PKZA 3TRXA 5HR2A 1M2DA 4H86A 1T8EB 2GVPA 3JCML 2FHEA 5DAKB 3EU4A 3LQ7A 5INYA 1MDKA 2V41A 3KP9A 1NHYA 1GNWA 5A4UA 4AJ8A 3Q19A 2FWFA 2X99A 3IBHA 4IHUA 1XOAA 3KH7A 2H6YA 2K18A 2DJJA 5CP1A 2YN1A 1K0BA 2C3NA 4K7NA 1XWKA 3IA1A 1K0CA 4X1UA 1ZMAA 4MJEA 2WZ9A 2EIQA 3PPUA 4I6XA 4X0XA 2N5BA 1O81A 3MAKA 3TJBA 1EV4A 2AV4A 1XPVA 2LEGA 4BWSA 2FA4A 2DMLA 2VCZA 4I2TA 2AHEA 3S9FA 3K8NA 4TXOB 2FGXA 3GFKA 3LYPA 2GZPA 3UEMA 3U6VA 3CTFA 1I5GA 1S3DA 3IV4A 1MDIA 1E2YA 4GSTA 3CBUA 1JHBA 1GSDA 1T4YA 4KGIA 3J7Yk 1VGLA 1F2EA 4HS1A 3IOSA 2NBSA 1SD8A 2K6VA 4YH2A 2N5FA 4ECCA 5HR3A 5CRDA 1HQOA 3TKSC 2FWHA 2GZZA 1ZYQB 1TI1A 5AIXA 4ZBDA 2PUKC 1GSFA 4OWYA 2DJKA 4FQUA 1ERUA 1X9SB 1WE0A 5CRWA 3ZZXA 2A2SA 1TRUA 5CAXA 3F8UA 5ECSA 4WBJA 1YF1A 1DE2A 2RUFA 2F51A 4PNGA 2OE1A 2MZCA 2ZUPA 2B6MA 1FG4A 2IWTA 2OJLA 5IMVA 2HFDA 3GSSA 4WR5A 1SU9A 4NWYA 2OADA 2WB9A 2M80A 1Z7RA 5ECLB 5BMUA 5ELGA 5IMDA 4MA9A 1SJZA 4J57E 5GAND 2L5OA 2E2GA 2F9SA 4BL7A 2DJ0A 5G5FA 3TRQA 5CO3A 3F63A 2H74A 3O3TA 2HZEA 2JACA 2DJ2A 3G7IA 4MH3A 4EF0A 3HJOA 3CSIA 2WJUA 2VL2C 4FO5A 5H5QA 2LQOA 3EU3A 3ME7A 1TRVA 3O6TA 3VK9A 2H0IA 1AUCA 2RM6A 1ZOFA 3HCZA 3MSZA 1Y6EA 4TR4A 1Z3EA 4X43A 4G0IA 2DC5A 1X0RA 5C00A 5FWGA 1GTBA 1GP1A 1USBA 2DJ1A 2WFCA 2VUPA 2VD0A 3KM6A 2DMMA 1NSWA 4KB3A 1K0NA 4YQMA 4HZ4A 4GXZA 2JADA 1B9YC 2X8CA 3J7Yb 2N5AA 3EWLA 3QR6A 4CDOA 2FWGA 11GSA 2HLSA 3M3MA 3KH9A 1TK0B 1FB0A 2HSHA 1GLPA 2NDOA 4XS1A 4MPFA 2B7KA 4PGTA 2VL9A 3Q18A 4MCUA 5JWRB 3D4TA 5G1KA 1Y25A 4QL9A 4HOJA 3L78A 4XTSA 1QMVA 4IN0A 2H6XA 4BWQA 4ZB9A 2I3YA 3CXGA 5IO2A 2V6KA 4PQIA 4K6XA 1T3BA 3FW2A 4YQVA 1XW5A 4HZ2A 1R4WA 4ZBAA 2O7KA 3UARA 1JZOA 2GQKA 4G10A 5D9WA 3D22A 2VCVA 2H1BA 4ML6A 3KEBA 3ERWA 3HA9A 5ECRB 5E59A 2C8UA 2ES7A 1XVQA 4MZCA 2VLUA 2CX3A 5B7CA 2M72A 5FHIA 1K3OA 4K1FA 3BOAA 5CRGA 1V58A 1PD21 5JWOB 3UAPA 3F4SA 3IAM2 1ZCPA 4OFTA 1XOBA 3WT2A 2F3MA 1C72A 1THOA 2OACA 4DVCA 1X9MB 3TCOA 10GSA 1SK0A 4D73B 1Z7PA 5ENUA 3DGQA 3WT1A 3DVXA 5IOXA 4I2UA 2WRTA 5B8BA 3PH9A 5F0GA 4N0ZA 2R3XA 2GSRA 5DAKA 3VURA 5F8BA 2HI7A 3HZ8A 2LRTA 4F82A 1DUGA 2PPTA 3UL3A 1BEDA 2L6DA 1O6JA 2HNLA 1EGRA 4HEA2 2BMXA 1XXUA 1CQGA 1GUKA 3LFLA 2YWMA 2KUCA 3BBYA 2QGVA 4HJMA 1A2LA 1GUHA 3L4NA 5IMCA 1A0RP 4DSRA 3KZQA 1IYHA 3UOMA 3GH9A 2JSYA 2RUEA 2J23A 5IQYA 3APQA 4TXOA 1WPIA 1TRSA 5A4VA 2P0GA 2LNTA 1G0TA 2JZTA 5KN1A 3QPMA 3OR5A 3L0HA 1X9WB 4ZBBA 1O73A 4ZL9A 2AB6A 1GRXA 2B3SA 3IXRA 1TU8A 2VM1A 3DYRA 3UJ1A 4JBBA 3C1SA 3H79A 2LJAA 4K7IA 3DMLA 2P5QA 2ON7A 5IO0A 4ILFA 3GL5A 4L5OA 3KP8A 2DSAA 3FY7A 1O8WA 2XHFA 1OKTA 4DSQA 3L9VA 4NHWA 3FR6A 4LMWA 3SWLA 1DSBA 4GCIA 4MK3A 2L59A 3ZRDA 3E9JB 4K9ZA 4O32A 3ZFLA 1YKAA 4PUFC 1NM3A 4LA1A 1EOGA 4GWRA 5D9XA 1VF2A 3F9UA 1PKWA 3CYNA 3QAWA 2K8VA 1MTCA 3ZVJA 1PX6A 1SD9A 4PURA 1W4VA 2GLRA 2AYTA 2BJXA 1O85A 3H4KA 3P90A 2L5LA 3GSTA 1U3AA 1KNGA 1EP7A 1EP8A 1K0OA 3LYKA 4Q5RA 2E0QA 4XRAA 4RQXA 5AIVA 4PXOA 2BTOT 4YAPA 1VF4A 3C73A 3IK9A 3ZREA 3AY8A 1DBYA 3LSZA 5ELAA 3HVSA 3TRPA 2YWOA 3EVIA 4O7HA 4OO4A 1GTAA 3IC4A 3GUSA 1R5AA 2R6KA 2WGRA 5IPGA 2GQLA 3G7YA 3I9V2 2JZSA 2FY6A 1QK8A 1RK4A 4GRFA 3TKQA 1ZZYA 3TKSA 2DIZA 4K2DA 3DEXA 5D93A 2AJQB 1M0UA 2GT6A 5JCWA 1VF1A 1B8XA 4G19A 4KSOA 1HNAA 2TIRA 3LWAA 4MABA 2GZYA 4IJIA 3TOUA 4WBRD 3UVTA 4ECIA 2H75A 4IKHA 2C4JA 2C0EA 5J3RA 2KHPA 1T00A 9GSSA 1XFLA 2HSNB 4KE3A 2WS2A 5DCGA 2C1YA 4ISDA 5J9CA 3PGTA 5ECQB 5F06A 5EY6A 2ZNMA 2R4VA 3DIEA 2HT9A 2JL4A 5DJMA 2LRNA 4MF6A 2ON5A 1ZL9A 3APSA 2GTUA 12GSA 5IM9A 2LTKA 2C80A 1Z6NA 2ALBA 3BCKA 4FYBA 5CYYA 2B1LA 2IMIA 5EL8A 1XVWA 1T1VA 1X5DA 3GN3A 2O8VB 2VCQA 2VL2A 2VLVA 2CQ9A 2HRKB 4E8EA 5ECNB 3FR3A 5ECIB 4MF5A 2X8GA 1F3BA 1TTZA 4NHZA 1IYIA 3BJ5A 4KF9A 1R26A 3HXSA 2GT5A 3CSJA 5H5RA 1AC1A 4POMA 2H19A 3RAZA 2PGTA 5J41A 1FHEA 2G2QA 3GHAA 4FYCA 4KCAA 1F6MC 2C3TA 5CNWA 2IMFA 1OAZA 2HRNA 4POLA 2V1MA 4I5QA 4BVYB 3QFBC 3PINA 1XCCA 4IP6A 1LU4A 4ZB8A 1WP0A 4OO5A 4PX1A 1ST9A 1Q4JA 3GL3A 3ZMKA 5DCHA 1TDIA 1HYUA 3ERGA 1PX7A 5EPFA 1M9BA 2H73A 1OC8A 1PSQA 1FVKA 3HY2A 3GX8A 2O87A 1SJ6A 1N8JA 3LEFA 4KW6A 2MYGA 4D73A 2K8SA 2CT6A 5A5KA 4OD7A 4ECJA 3N9JA 4TR1B 3A5WA 6GSYA 1XWGA 3FZAA 4JE1A 3M1GA 1G6WA 1GLQA 3I69A 4L0UA 1PMTA 4NMUA 3Q6OA 3UBLA 1CQHA 2KLXA 2QKEA 3A2XA 3G9BA 3UMAA 2PMTA 3RHBA 2RM5A 4CHSA 5B8AA 1Z6MA 1M9AA 3M0FA 2PERA 2C0GA 3W6GA 2H0HA 2IFQB 5G30A 5B6NA 3FKFA 2H70A 2YANA 2UZ8A 4LMVA 2VM2A 2LJKA 4EUYA 2X64A 1V2AA 4FH8A 3W8SA 1OC9B 2FA8A 1ZGNA 5ECPB 1SL1B 2VIMA 3P2AA 3H8QA 1A24A 1Q98A 4AF2A 4GSSA 2V2GA 1B48A 4PUAA 4XRDA 4EL1A 1GSQA 3HVXA 1GTIA 5IMZA 1VF3A 3QMXA 1B4QA 2IMEA 1EOHA 5ECKB 3NZNA 3RHCA 3TGZA 5ID2B 1S3CA 2HSMB 2CZ2A 2E2MA 2WULA 4HQSA 3CMIA 1R5PA 1NW2A 5FT3A 5DDLA 4KDUA 4F2IA 1W89A 1YEPA 4BPYA 5HFKA 3DRNA 2FUG2 4KAEA 1URMA 4LL4B 2FLSA 5LNKe 3TJKA 5AGYA 4KDYA 4JR6A 2PVOC 4RUVA 1PA3A 1A23A 4V2NA 4HDEA 1G6YA 3LXTA 5D8IA 3ISOA 2M46A 1K0DA 6GSWA 2L57A 1UC7A 3HVVA 1SJIA 5ECOB 5G1LA 4YQUA 1TW9A 4EE0A 1EZKA 1Z5YE 2NPBA 3D4MA 1TK5B 1AQWA 4Q5QA 1GSSA 4I97A 1SKRB 3QFAC 4POBA 1OE7A 2H1AA 2RLIA 4EDYA 3D6IA 2CV4A 4HQZA 4L0WA 2GDRA 4MMMA 2YJHA 5F07A 2FD3A 1XW6A 4Q5NA 5G5EA 4P3YB 1BX9A 3P7XA 4GLTA 5H5SA 1MDJA 1SYXA 3HD5A 2KP2A 3TKPA 4WKWA 3EMPA 1EGOA 3GKXA 1OYJA 3FZ5A 5AISA 3IR4A 7GSSA 1YY7A 1A8LA 1SENA 4LLRA 3TOTA 1GTUA 3TUEA 5ECMB 5CRHA 3P8WA 4MPGA 2GQMA 3Q74A 3D5JA 2MMZA 3EURA 5J4UA 2EIOA 1YEXA 2LNSA 3R3EA 3BCIA 4NV5A 4ACSA 4N0VA 1G7OA
chains in the Genus database with same CATH superfamily
4XHMA 3FRCA 3ME8A 4EC0A 3UIWA 4MLYA 3FZ9A 2IMKA 4PNFA 1EV9A 3HMJG 4QQ7A 1GSYA 2TRXA 3FZ4A 2J9HA 3TU3B 3HJPA 3TJFA 3KJYA 2EFEA 2GGTA 3HZ4A 1FVJA 1BJXA 3V1WA 1SKSB 5KOWA 4MJAA 2OBKA 3TJGA 2VCXA 2B7JA 2L4CA 1TOFA 3C7MA 1ERWA 3L9UA 4F9ZA 1GULA 1QXHA 3A2WA 2HRKA 2IIYA 1H4OA 3HVNA 4NAXA 3LJRA 17GSA 1EEJA 4WXTA 2GSTA 4V2LA 4N10A 4WF4A 8GSSA 5A4WA 2C0FA 4WF5A 4NXIA 4KDXA 3F0IA 5KN3A 1EEMA 4XIHA 2VCWA 2R0GA 4OMVA 2I81A 2OKAA 1QQ2A 3IE3A 2YPMA 5CREA 1M2AA 2RIIA 4BVYA 1WMJA 4TR3A 2H6ZA 5ECHB 2R2JA 4HU7A 4ZILA 4LL1B 4WETA 3MWHA 5J4VA 1JZRA 1THXA 1M2BA 4V1Ap 2WVXA 4KNDA 4ID0A 5L71A 3FEUA 1LBKA 1K0MA 1BG5A 3M9JA 1K0AA 1N2AA 4BVXB 4ZL7A 2PWJA 1WOUA 4IBPA 3FMWA 2XPDA 1AIUA 3GA4A 2F8AA 2WVZA 4IW9A 2AAWA 18GSA 2EC4A 1YVLA 3VI7A 4QMKA 4USSA 5KN2A 1F9MA 5HFIA 3EC3A 1GWCA 4TR1A 1MD4A 4BA7A 5KN0A 2P31A 4KA0A 3ZFBA 3GKNA 2H01A 3C71A 3L9SA 4TR0A 2H72A 1V40A 3F6DA 4DSSB 5LCZA 2JZRA 16GSA 1XWAA 3GH6A 3M9KA 2CVKA 1YDKA 3LG6A 2GSQA 2PVQA 2H1GA 4MZBA 5DALB 4POKA 1GL8A 4GQCA 1ERTA 4EO3A 3VPTA 5ABRA 2IFQA 3IK7A 4F0CA 5J9BA 4O92A 4IVFA 3DWVA 3EMXA 4ZL8A 3ED3A 2YNXA 1UVZA 2MMNA 5DVBA 4Z2RA 1A2MA 1OC9A 1FOHA 3IRAA 1PRXA 2H30A 2B5YA 3LXZA 2KOKA 3VWWA 1SYRA 4EVMA 4L5LA 2R0PA 4QL7A 2LS5A 2XPEA 2FNOA 4E8HA 1WWJA 4PQHA 3WGEA 2HQTA 1UN2A 5G2ZA 4RI7A 2ZCTA 3VI5A 4RI6A 1PN9A 1X5CA 5HFGA 5DQSA 3ZVJD 3M8NA 5ID2A 4OFNA 2HSMA 5J40A 1UA5A 5DBQA 5EVOA 1PL2A 4AJ6A 5GZZB 2XC2A 2YZHA 3APOA 4I8BA 3GYKA 1J9BA 1ERVA 1TP9A 3ZMLA 4PTSA 2CAQA 4AKIA 4HI7A 3QCPA 4AJ7A 2NVLA 1XIYA 1SL0B 3KIJA 5A1NA 4YKGA 1QUWA 3FHKA 1JFUA 4TW5A 13GSA 3F6FA 3I6AA 5COHA 3US3A 2DIYA 3ZL5A 1TI3A 4Q5FA 1ABAA 2GSSA 2PU9C 4XCSA 2LV3A 6GSTA 2VOCA 1OVNA 1SK1A 1XW9A 4K7OA 4KH7A 3C1RA 2DBCA 2REMA 2H71A 3C8EA 1PN0A 1AW9A 4N11A 1TXXA 1JLWA 1HNCA 3GKKA 1OC3A 3VLNA 3QD9A 3R2QA 4XS4B 2H0GA 1PQNA 1AQXA 2OT3A 3QDNA 3DXBA 3IHQA 2XBIA 2TRCP 3WD6A 1BYEA 2B5XA 3RFRC 1GNEA 4HUAA 5A34A 2R0CA 2L4QA 1U6TA 5LD0A 4ECBA 3NIVA 3GIXA 5GSTA 3KCMA 6GSVA 3UVHA 4EIQA 2I1UA 3CWGA 3I43A 3ZIJA 3RBTA 5HR1A 3D21A 4MDCA 3HJMA 4Z2TA 2IMDA 3GV1A 2A2RA 3KMNA 1KBNA 4MJCA 2MMOA 4X4JA 3RPPA 3H1NA 2OE0A 4G0LA 1S3AA 4YKFA 4NV2A 2DKHA 1M7TA 2P5RA 4GQFA 1FOVA 3E3EA 3TDGA 4IQAA 4TOPA 3QAVA 2VKZG 1E6BA 3KTLA 5JCUA 3FYGA 2YV7A 2WDUA 5IMFA 3GTUB 4RQRA 2H8LA 5E4WA 1FAAA 4F0BA 3IAS2 2C0DA 4IELA 1T7PB 4ZXGA 1HNBA 2FWEA 1U3IA 2HRFA 4TXVA 4V2MA 1A2JA 2H66A 1ILOA 1SK2A 2IJYA 4Z7XA 1SVOA 3N5OA 1X5EA 3F3QA 3IDVA 1BQ7A 2DJ3A 2DLXA 2GS3A 3GNJA 2IPAA 4XS6A 3TJJA 3ERFA 4O5RA 2FCHA 4G9HA 2V32A 1F37A 3DKSA 2QC7A 5GSSA 3A3TA 1K3YA 1XZOA 2B1KA 2MMAA 3HHVA 2MBSA 1AQVA 4IS0A 2NTOA 2AUVA 5GAPD 2VCTA 3CRTA 2MBTA 3KMOA 3MDKA 1EWXA 5JWQB 3EYTA 2YWNA 2VL3A 3E0UA 2LJRA 1SL2B 5HQPA 2YZUA 5HR0A 5IIZA 5JCGA 4BVXA 2R5GA 1J0FA 3CRUA 4IQ1A 3GX0A 2O85A 1MEKA 3LGCA 1GSEA 2PN8A 3W8JA 1B4PA 4G01A 3GMFA 4ML1A 1R7HA 4KSMA 2HYXA 4J56E 5B6MA 4PQ1A 4KCEA 4TVEA 3CSHA 4KUNA 2PBJA 3IHGA 2YJ7A 1FW1A 4OCEA 2YOIA 2O89A 1TK8B 2LRCA 3MIXA 2R37A 1M3IA 2KP1A 4DSSA 1V9WA 3DD3A 2A4VA 3F4TA 2IL3A 3F4RA 3KTBA 3D0ZA 5D9VA 4MF7A 1Z9HA 4WR4A 5DALA 1WIKA 4YAVA 5D9TA 6GSUA 1HD2A 3IC8A 4BIKA 2LQQA 4K2XA 1PFOA 1TU7A 1YKCA 5D96A 4A5PA 1KTEA 4CW9A 1OKDA 2OA7A 2HSYA 1ZYPA 4IGJA 2UV8G 1M3JA 3WGXA 3TKRA 1J08A 1BG1A 3DVWA 2G0FA 1PL1A 4HU9A 3SBCA 1ML6A 1KEBA 2XBQA 20GSA 1TJDA 2YP6A 1TKDB 4HSCX 5J5NA 1K3LA 2JSZA 2QA1A 3GRXA 1MD3A 4OFMA 3VFIA 4K0NA 3FK8A 4GSNA 3A2VA 3H93A 1AXDA 2I4AA 2HE3A 4F03A 5IMAA 2VO4A 4K8MA 1B9XC 3ZIVA 1A0FA 1FO5A 4FIWA 2YWIA 2LKUA 1RW1A 1Y1UA 2WW0A 2X8HA 2WCIA 3G7JA 3O76A 3VWVA 3F3RA 1XWCA 3KGKA 4JEDA 2CZ3A 1NHOA 6GSSA 3WGDA 4GTUA 1DE1A 22GSA 1V98A 2L6CA 5BMUB 4V1Ag 1A8YA 2B5EA 4BL7B 3GURA 3EPTA 3QAGA 4NPBA 1JZDA 1AAZA 1WRYA 2VLTA 4CY8A 3EE2A 5C04A 3LORA 1XWBA 2HZEB 2H1DA 5F05A 2Z9SA 1LJRA 3BD2A 2VD1A 1ON4A 19GSA 4J2FA 3CQFA 1WJKA 2HZFA 14GSA 1PGTA 3FR9A 4TRXA 2QSIA 4GDFA 4MH2A 4XS4A 1GUMA 3KXOA 5A5HB 2VAFA 3MNGA 1GH2A 6GSXA 2F8FA 1QFNA 1VRSD 3RDWA 5KEJA 1T4ZA 2IN3A 4IP1A 3VPQA 2CAIA 1OE8A 5IPHA 5DJLA 3HYPA 2HXKA 2EIRA 4ICYA 2JU5A 1SKWB 1V57A 2HRAA 4ULXA 3PR8A 2C3QA 3VWUA 1GSUA 4HJ2A 2H76A 1U87A 2K9FA 3NOFA 2CA8A 3QOUA 3KD0A 1XBSA 3U5RE 3GKMA 4ZB6A 4EXJA 1M99A 4MP4A 3RPNA 1I9DA 2CX4A 3EINA 1YZXA 1JLVA 5IOWA 4GF0A 4OCFA 4MJBA 3GTUA 4G2EA 4WEYA 2WZSA 2V6OA 1YJ6A 1YQ1A 4JZQA 4JR4A 1S3RA 2D2ZA 4EIPA 2YCDA 2O36A 1BAYA 4IJ3A 4EDZA 2OBIA 1TRWA 1SVLA 5G31A 3WYWA 4N30A 2YV9A 4DEJA 1JZWA 1U88A 5D73A 4TN8A 4TKYA 1YF0A 4L8EA 3IPZA 4MZWA 5DQYA 1F3AA 1H75A 2CVDA 2E7PA 1ACVA 4K0GA 3HDCA 3ZYWA 3CTGA 3ZLPA 2OE3A 4JRRA 3ZITA 4EKZA 5AN1A 4AKGA 4AGSA 3UBKA 3TKSE 1G7EA 4FYUA 1QGVA 4JU5A 1O7UA 2LSTA 1ZYEA 3TB2A 1O8XA 4ZIJA 4G0KA 2CVBA 2LUSA 4KX4A 3VWXA 1RQMA 2I9HA 1FB6A 3HKRA 3ZTLA 1PKZA 3TRXA 5HR2A 1M2DA 4H86A 1T8EB 2GVPA 3JCML 2FHEA 5DAKB 3EU4A 3LQ7A 5INYA 1MDKA 2V41A 3KP9A 1NHYA 1GNWA 5A4UA 4AJ8A 3Q19A 2FWFA 2X99A 3IBHA 4IHUA 1XOAA 3KH7A 2H6YA 2K18A 2DJJA 5CP1A 2YN1A 1K0BA 2C3NA 4K7NA 1XWKA 3IA1A 1K0CA 4X1UA 1ZMAA 4MJEA 2WZ9A 2EIQA 3PPUA 4I6XA 4X0XA 2N5BA 1O81A 3MAKA 3TJBA 1EV4A 2AV4A 1XPVA 2LEGA 4BWSA 2FA4A 2DMLA 2VCZA 4I2TA 2AHEA 3S9FA 3K8NA 4TXOB 2FGXA 3GFKA 3LYPA 1BF5A 2X4AA 2GZPA 3UEMA 3U6VA 3CTFA 1I5GA 3LW9A 1S3DA 3IV4A 1MDIA 1E2YA 4GSTA 3CBUA 1JHBA 2O5VA 1GSDA 1T4YA 1TXUA 4KGIA 3J7Yk 1VGLA 1F2EA 4PI2C 4HS1A 3IOSA 2NBSA 1SD8A 2K6VA 4YH2A 2N5FA 4ECCA 5HR3A 5CRDA 1HQOA 3TKSC 4W66A 2FWHA 2GZZA 2WVXB 1ZYQB 1TI1A 5AIXA 4ZBDA 2PUKC 1GSFA 4OWYA 2DJKA 4FQUA 1ERUA 1X9SB 1WE0A 5CRWA 3ZZXA 2A2SA 1TRUA 5CAXA 3F8UA 5ECSA 1YEWC 4WBJA 1YF1A 1DE2A 2RUFA 2F51A 4PNGA 2OE1A 2MZCA 2ZUPA 2B6MA 1FG4A 2IWTA 2OJLA 5IMVA 2HFDA 3GSSA 4MNNA 4WR5A 1SU9A 4NWYA 2OADA 2WB9A 2M80A 1Z7RA 5ECLB 5BMUA 5ELGA 5IMDA 4MA9A 1SJZA 4J57E 5GAND 2L5OA 2E2GA 3MYDA 2F9SA 4BL7A 2DJ0A 5G5FA 3TRQA 5CO3A 3F63A 2H74A 3O3TA 2HZEA 2JACA 2DJ2A 3G7IA 4MH3A 2X49A 4EF0A 3HJOA 3CSIA 2WJUA 2VL2C 4FO5A 5H5QA 2LQOA 3EU3A 3ME7A 1TRVA 3O6TA 3VK9A 2H0IA 5A5HA 1AUCA 2RM6A 1ZOFA 3HCZA 3MSZA 1Y6EA 4TR4A 1Z3EA 4X43A 4G0IA 2DC5A 1X0RA 5C00A 5FWGA 1GTBA 1GP1A 1USBA 2DJ1A 2WFCA 2VUPA 2VD0A 3KM6A 2DMMA 1NSWA 4KB3A 1K0NA 4YQMA 4HZ4A 4GXZA 2JADA 1B9YC 2X8CA 3J7Yb 2N5AA 3EWLA 3QR6A 4CDOA 2FWGA 11GSA 2HLSA 3M3MA 3KH9A 1TK0B 1FB0A 2HSHA 1GLPA 2NDOA 4XS1A 4MPFA 2B7KA 4PGTA 2VL9A 3Q18A 4MCUA 5JWRB 1ZYNA 3D4TA 5G1KA 1Y25A 4QL9A 4HOJA 3L78A 4XTSA 1QMVA 4IN0A 4AI6A 2H6XA 4BWQA 4ZB9A 2I3YA 3CXGA 5IO2A 2V6KA 4PQIA 4K6XA 1T3BA 3FW2A 4YQVA 1XW5A 4HZ2A 1R4WA 4ZBAA 2O7KA 3UARA 1JZOA 2GQKA 4G10A 5D9WA 3D22A 2VCVA 2H1BA 4ML6A 3KEBA 3ERWA 3HA9A 5ECRB 5E59A 2C8UA 2ES7A 1XVQA 4MZCA 2VLUA 2CX3A 5B7CA 2M72A 5FHIA 1K3OA 4K1FA 5A34B 3BOAA 2EFDA 5BRTA 5CRGA 1V58A 1PD21 5JWOB 3UAPA 3F4SA 1I1IP 3IAM2 1ZCPA 4OFTA 1XOBA 3WT2A 2F3MA 1C72A 5J4YA 1THOA 2OACA 4DVCA 1X9MB 3TCOA 10GSA 1SK0A 4D73B 1Z7PA 5ENUA 3DGQA 3WT1A 3DVXA 5IOXA 4I2UA 2WRTA 5B8BA 3PH9A 5F0GA 4N0ZA 2R3XA 2WW3A 2GSRA 5DAKA 3VURA 5F8BA 2HI7A 3HZ8A 2LRTA 4F82A 2WW1A 1DUGA 2PPTA 3UL3A 1BEDA 2L6DA 1O6JA 2HNLA 1EGRA 4HEA2 2BMXA 2WVYA 1XXUA 1CQGA 1GUKA 3LFLA 2YWMA 2KUCA 3BBYA 2QGVA 4HJMA 1A2LA 1GUHA 3L4NA 5IMCA 1A0RP 4DSRA 3KZQA 1IYHA 5KOXA 3UOMA 3GH9A 2JSYA 2RUEA 2J23A 5IQYA 3APQA 4TXOA 1WPIA 1TRSA 5A4VA 2P0GA 2LNTA 1G0TA 2JZTA 5KN1A 2EFHA 3QPMA 3OR5A 3L0HA 1X9WB 4ZBBA 1O73A 4ZL9A 2AB6A 1GRXA 2B3SA 3IXRA 1S4BP 1TU8A 2VM1A 3DYRA 3UJ1A 4JBBA 3C1SA 3H79A 2LJAA 4K7IA 3DMLA 2P5QA 2ON7A 5IO0A 4ILFA 3GL5A 4N3ZA 4L5OA 3KP8A 2DSAA 3FY7A 1O8WA 2XHFA 1OKTA 4DSQA 3L9VA 4NHWA 3FR6A 4LMWA 3SWLA 1DSBA 4GCIA 4MK3A 2L59A 4E68A 3ZRDA 3E9JB 4K9ZA 4O32A 3ZFLA 1YKAA 4PUFC 1NM3A 4LA1A 1EOGA 5J47A 4GWRA 5D9XA 4K5RA 1VF2A 3F9UA 1PKWA 3CYNA 3QAWA 2K8VA 3RGBC 1MTCA 3ZVJA 1PX6A 1SD9A 4PURA 1W4VA 2GLRA 2AYTA 4Z2UA 2BJXA 2EFCA 1O85A 3H4KA 3P90A 2L5LA 3GSTA 1U3AA 1KNGA 1EP7A 1EP8A 1K0OA 3LYKA 4Q5RA 2E0QA 4XRAA 4RQXA 5AIVA 4PXOA 2BTOT 4YAPA 1VF4A 3C73A 3IK9A 3ZREA 3AY8A 1DBYA 3LSZA 5ELAA 3HVSA 3TRPA 2YWOA 3EVIA 4O7HA 4OO4A 1GTAA 3IC4A 3GUSA 1R5AA 2R6KA 2WGRA 5IPGA 2GQLA 3G7YA 3I9V2 2JZSA 2FY6A 1QK8A 1RK4A 4GRFA 3TKQA 1ZZYA 3TKSA 2DIZA 4K2DA 3DEXA 5D93A 2AJQB 1M0UA 2GT6A 5JCWA 1VF1A 1B8XA 4G19A 4KSOA 1HNAA 2TIRA 3LWAA 2H1LA 4MABA 2GZYA 4IJIA 3TOUA 4WBRD 3UVTA 4ECIA 2H75A 4IKHA 2C4JA 2C0EA 5J3RA 2KHPA 1T00A 9GSSA 1XFLA 2HSNB 4KE3A 2WS2A 5DCGA 2C1YA 4ISDA 5J9CA 1N25A 2A2PA 3PGTA 5ECQB 5F06A 5EY6A 2ZNMA 2R4VA 3DIEA 2HT9A 2JL4A 5DJMA 2LRNA 4MF6A 2ON5A 1ZL9A 3APSA 2GTUA 12GSA 5IM9A 2LTKA 2C80A 1Z6NA 2ALBA 3BCKA 4FYBA 5CYYA 2B1LA 2IMIA 5EL8A 1XG8A 1XVWA 1T1VA 1X5DA 3GN3A 2O8VB 4ZB7A 2VCQA 2VL2A 2VLVA 2CQ9A 2HRKB 4E8EA 5ECNB 3FR3A 5ECIB 4MF5A 2X8GA 1F3BA 1TTZA 3A5IA 4NHZA 1IYIA 3BJ5A 4KF9A 1R26A 3HXSA 2GT5A 3CSJA 5H5RA 1AC1A 4POMA 2H19A 3RAZA 2PGTA 5J41A 1FHEA 2G2QA 3GHAA 4FYCA 4KCAA 1F6MC 2C3TA 5CNWA 2IMFA 1OAZA 2HRNA 4POLA 2V1MA 4I5QA 4BVYB 3QFBC 3PINA 1XCCA 4IP6A 1LU4A 4ZB8A 1WP0A 4OO5A 4PX1A 1ST9A 4K5SA 1Q4JA 3GL3A 3ZMKA 5DCHA 1TDIA 1HYUA 3ERGA 1PX7A 3CHXC 5EPFA 1M9BA 2H73A 1OC8A 1PSQA 1FVKA 3HY2A 3GX8A 4O5QA 2O87A 1SJ6A 1N8JA 3LEFA 4KW6A 2MYGA 4D73A 2K8SA 2CT6A 5A5KA 4OD7A 4ECJA 3N9JA 4TR1B 3A5WA 6GSYA 4AKXB 1XWGA 3FZAA 4JE1A 3M1GA 1G6WA 1GLQA 3I69A 4L0UA 1PMTA 4NMUA 3Q6OA 3UBLA 1CQHA 2KLXA 2QKEA 3A2XA 3G9BA 3UMAA 2QA2A 2PMTA 3RHBA 2RM5A 4CHSA 5B8AA 1Z6MA 1M9AA 3M0FA 2PERA 2C0GA 3W6GA 2H0HA 2IFQB 5G30A 5B6NA 3FKFA 2H70A 2YANA 2UZ8A 4LMVA 2VM2A 2LJKA 4EUYA 2X64A 1V2AA 2O3EA 4FH8A 3W8SA 1OC9B 2FA8A 1ZGNA 5ECPB 1SL1B 2VIMA 3P2AA 3H8QA 1A24A 1Q98A 4AF2A 4PI0C 4GSSA 4AKHA 2V2GA 1B48A 4PUAA 4XRDA 4EL1A 1GSQA 3HVXA 1GTIA 5IMZA 1VF3A 3QMXA 1B4QA 2IMEA 1EOHA 5ECKB 3NZNA 3RHCA 3TGZA 4FXYP 1S3CA 5ID2B 2HSMB 2DKIA 2CZ2A 2E2MA 2WULA 4HQSA 3CMIA 1R5PA 1NW2A 5FT3A 5DDLA 4KDUA 4F2IA 1W89A 1YEPA 4BPYA 5HFKA 3DRNA 2FUG2 4KAEA 1URMA 4LL4B 2FLSA 5LNKe 3TJKA 5AGYA 4KDYA 4JR6A 2PVOC 4RUVA 1PA3A 1A23A 4V2NA 4HDEA 1G6YA 3LXTA 5D8IA 3ISOA 2M46A 1K0DA 5A1NB 6GSWA 2L57A 1UC7A 3HVVA 1SJIA 5ECOB 5G1LA 4YQUA 1TW9A 4EE0A 1EZKA 2A4HA 1Z5YE 2NPBA 3D4MA 4O5UA 1TK5B 1AQWA 4Q5QA 1GSSA 4I97A 1SKRB 3QFAC 4POBA 1OE7A 2H1AA 2RLIA 4EDYA 3D6IA 2CV4A 4HQZA 4L0WA 2GDRA 4MMMA 2YJHA 5F07A 2FD3A 1XW6A 4Q5NA 5G5EA 4P3YB 4CY6A 1BX9A 3P7XA 4GLTA 5H5SA 1MDJA 1SYXA 3HD5A 2KP2A 3TKPA 4WKWA 3EMPA 1EGOA 3GKXA 1OYJA 3FZ5A 5AISA 4PHZC 3IR4A 7GSSA 1SVMA 1YY7A 1A8LA 1SENA 4LLRA 3TOTA 1GTUA 3TUEA 5ECMB 5CRHA 3P8WA 4MPGA 2GQMA 3Q74A 3D5JA 2WW2A 2MMZA 3EURA 5J4UA 2EIOA 1YEXA 2LNSA 3R3EA 3BCIA 4NV5A 4ACSA 2HSNA 4N0VA 1G7OA
chains in the Genus database with same CATH topology
4XHMA 3FRCA 3ME8A 4EC0A 3UIWA 4MLYA 3FZ9A 2IMKA 4PNFA 1EV9A 3HMJG 4QQ7A 1GSYA 2TRXA 3FZ4A 2J9HA 3TU3B 3HJPA 3TJFA 3KJYA 2EFEA 2GGTA 3HZ4A 1FVJA 1BJXA 3V1WA 1SKSB 5KOWA 4MJAA 2OBKA 3TJGA 2VCXA 2B7JA 2L4CA 1TOFA 3C7MA 1ERWA 3L9UA 4F9ZA 1GULA 1QXHA 3A2WA 2HRKA 2IIYA 1H4OA 4NAXA 3LJRA 17GSA 1EEJA 4WXTA 2GSTA 4V2LA 4N10A 4WF4A 8GSSA 5A4WA 2C0FA 4WF5A 4NXIA 4KDXA 3F0IA 5KN3A 1EEMA 4XIHA 2VCWA 2R0GA 4OMVA 2I81A 2OKAA 1QQ2A 3IE3A 2YPMA 5CREA 1M2AA 2RIIA 4BVYA 1WMJA 4TR3A 2H6ZA 5ECHB 2R2JA 4HU7A 4ZILA 4LL1B 4WETA 3MWHA 5J4VA 1JZRA 1THXA 1M2BA 4V1Ap 4KNDA 4ID0A 5L71A 3FEUA 1LBKA 1K0MA 1BG5A 3M9JA 1K0AA 1N2AA 4BVXB 4ZL7A 2PWJA 1WOUA 4IBPA 3FMWA 2XPDA 1AIUA 3GA4A 2F8AA 4IW9A 2AAWA 18GSA 2EC4A 1YVLA 3VI7A 4QMKA 4USSA 5KN2A 1F9MA 5HFIA 3EC3A 1GWCA 4TR1A 1MD4A 4BA7A 5KN0A 2P31A 4KA0A 3ZFBA 3GKNA 2H01A 3C71A 3L9SA 4TR0A 2H72A 1V40A 3F6DA 4DSSB 5LCZA 2JZRA 16GSA 1XWAA 3GH6A 3M9KA 2CVKA 1YDKA 3LG6A 2GSQA 2PVQA 2H1GA 4MZBA 5DALB 4POKA 1GL8A 4GQCA 1ERTA 4EO3A 3VPTA 5ABRA 2IFQA 3IK7A 4F0CA 5J9BA 4O92A 4IVFA 3DWVA 3EMXA 4ZL8A 3ED3A 2YNXA 1UVZA 2MMNA 5DVBA 4Z2RA 1A2MA 1OC9A 1FOHA 3IRAA 1PRXA 2H30A 2B5YA 3LXZA 2KOKA 3VWWA 1SYRA 4EVMA 4L5LA 2R0PA 4QL7A 2LS5A 2XPEA 2FNOA 4E8HA 1WWJA 4PQHA 3WGEA 2HQTA 1UN2A 5G2ZA 4RI7A 2ZCTA 3VI5A 4RI6A 1PN9A 1X5CA 5HFGA 5DQSA 3ZVJD 3M8NA 5ID2A 4OFNA 2HSMA 5J40A 1UA5A 5DBQA 5EVOA 1PL2A 4AJ6A 5GZZB 2XC2A 2YZHA 3APOA 4I8BA 3GYKA 1J9BA 1ERVA 1TP9A 3ZMLA 4PTSA 2CAQA 4AKIA 4HI7A 3QCPA 4AJ7A 2NVLA 1XIYA 1SL0B 3KIJA 5A1NA 4YKGA 1QUWA 3FHKA 1JFUA 4TW5A 13GSA 3F6FA 3I6AA 5COHA 3US3A 2DIYA 3ZL5A 1TI3A 4Q5FA 1ABAA 2GSSA 2PU9C 4XCSA 2LV3A 6GSTA 2VOCA 1OVNA 1SK1A 1XW9A 4K7OA 4KH7A 3C1RA 2DBCA 2REMA 2H71A 3C8EA 1PN0A 1AW9A 4N11A 1TXXA 1JLWA 1HNCA 3GKKA 1OC3A 3VLNA 3QD9A 3R2QA 4XS4B 2H0GA 1PQNA 1AQXA 2OT3A 3QDNA 3DXBA 3IHQA 2XBIA 2TRCP 3WD6A 1BYEA 2B5XA 1GNEA 4HUAA 5A34A 2R0CA 2L4QA 1U6TA 5LD0A 4ECBA 3NIVA 3GIXA 5GSTA 3KCMA 6GSVA 3UVHA 4EIQA 2I1UA 3CWGA 3I43A 3ZIJA 3RBTA 5HR1A 3D21A 4MDCA 3HJMA 4Z2TA 2IMDA 3GV1A 2A2RA 3KMNA 1KBNA 4MJCA 2MMOA 4X4JA 3RPPA 3H1NA 2OE0A 4G0LA 1S3AA 4YKFA 4NV2A 2DKHA 1M7TA 2P5RA 4GQFA 1FOVA 3E3EA 3TDGA 4IQAA 4TOPA 3QAVA 2VKZG 1E6BA 3KTLA 5JCUA 3FYGA 2YV7A 2WDUA 5IMFA 3GTUB 4RQRA 2H8LA 5E4WA 1FAAA 4F0BA 3IAS2 2C0DA 4IELA 1T7PB 4ZXGA 1HNBA 2FWEA 1U3IA 2HRFA 4TXVA 4V2MA 1A2JA 2H66A 1ILOA 1SK2A 2IJYA 4Z7XA 1SVOA 3N5OA 1X5EA 3F3QA 3IDVA 1BQ7A 2DJ3A 2DLXA 2GS3A 3GNJA 2IPAA 4XS6A 3TJJA 3ERFA 4O5RA 2FCHA 4G9HA 2V32A 1F37A 3DKSA 2QC7A 5GSSA 3A3TA 1K3YA 1XZOA 2B1KA 2MMAA 3HHVA 2MBSA 1AQVA 4IS0A 2NTOA 2AUVA 5GAPD 2VCTA 3CRTA 2MBTA 3KMOA 3MDKA 1EWXA 5JWQB 3EYTA 2YWNA 2VL3A 3E0UA 2LJRA 1SL2B 5HQPA 2YZUA 5HR0A 5IIZA 5JCGA 4BVXA 2R5GA 1J0FA 3CRUA 4IQ1A 3GX0A 2O85A 1MEKA 3LGCA 1GSEA 2PN8A 3W8JA 1B4PA 4G01A 3GMFA 4ML1A 1R7HA 4KSMA 2HYXA 4J56E 5B6MA 4PQ1A 4KCEA 4TVEA 3CSHA 4KUNA 2PBJA 3IHGA 2YJ7A 1FW1A 4OCEA 2YOIA 2O89A 1TK8B 2LRCA 3MIXA 2R37A 2KP1A 4DSSA 1V9WA 3DD3A 2A4VA 3F4TA 2IL3A 3F4RA 3KTBA 3D0ZA 5D9VA 4MF7A 1Z9HA 4WR4A 5DALA 1WIKA 4YAVA 5D9TA 6GSUA 1HD2A 3IC8A 2LQQA 4K2XA 1TU7A 1YKCA 5D96A 4A5PA 1KTEA 4CW9A 1OKDA 2OA7A 2HSYA 1ZYPA 4IGJA 2UV8G 3WGXA 3TKRA 1J08A 1BG1A 3DVWA 2G0FA 1PL1A 4HU9A 3SBCA 1ML6A 1KEBA 2XBQA 20GSA 1TJDA 2YP6A 1TKDB 5J5NA 1K3LA 2JSZA 2QA1A 3GRXA 1MD3A 4OFMA 3VFIA 4K0NA 3FK8A 4GSNA 3A2VA 3H93A 1AXDA 2I4AA 2HE3A 4F03A 5IMAA 2VO4A 4K8MA 1B9XC 3ZIVA 1A0FA 1FO5A 4FIWA 2YWIA 2LKUA 1RW1A 1Y1UA 2X8HA 2WCIA 3G7JA 3O76A 3VWVA 3F3RA 1XWCA 3KGKA 4JEDA 2CZ3A 1NHOA 6GSSA 3WGDA 4GTUA 1DE1A 22GSA 1V98A 2L6CA 5BMUB 4V1Ag 1A8YA 2B5EA 4BL7B 3GURA 3EPTA 3QAGA 4NPBA 1JZDA 1AAZA 1WRYA 2VLTA 4CY8A 3EE2A 5C04A 3LORA 1XWBA 2HZEB 2H1DA 5F05A 2Z9SA 1LJRA 3BD2A 2VD1A 1ON4A 19GSA 4J2FA 1WJKA 2HZFA 14GSA 1PGTA 3FR9A 4TRXA 2QSIA 4GDFA 4MH2A 4XS4A 1GUMA 3KXOA 5A5HB 2VAFA 3MNGA 1GH2A 6GSXA 2F8FA 1QFNA 1VRSD 3RDWA 5KEJA 1T4ZA 2IN3A 4IP1A 3VPQA 2CAIA 1OE8A 5IPHA 5DJLA 3HYPA 2HXKA 2EIRA 4ICYA 2JU5A 1SKWB 1V57A 2HRAA 4ULXA 3PR8A 2C3QA 3VWUA 1GSUA 4HJ2A 2H76A 1U87A 2K9FA 3NOFA 2CA8A 3QOUA 3KD0A 1XBSA 3U5RE 3GKMA 4ZB6A 4EXJA 1M99A 4MP4A 3RPNA 1I9DA 2CX4A 3EINA 1YZXA 1JLVA 5IOWA 4GF0A 4OCFA 4MJBA 3GTUA 4G2EA 4WEYA 2V6OA 1YJ6A 1YQ1A 4JZQA 4JR4A 2D2ZA 4EIPA 2YCDA 1BAYA 4IJ3A 4EDZA 2OBIA 1TRWA 1SVLA 5G31A 3WYWA 4N30A 2YV9A 4DEJA 1JZWA 1U88A 5D73A 4TN8A 4TKYA 1YF0A 4L8EA 3IPZA 4MZWA 5DQYA 1F3AA 1H75A 2CVDA 2E7PA 1ACVA 4K0GA 3HDCA 3ZYWA 3CTGA 3ZLPA 2OE3A 4JRRA 3ZITA 4EKZA 5AN1A 4AKGA 4AGSA 3UBKA 3TKSE 1G7EA 4FYUA 1QGVA 4JU5A 1O7UA 2LSTA 1ZYEA 3TB2A 1O8XA 4ZIJA 4G0KA 2CVBA 2LUSA 4KX4A 3VWXA 1RQMA 2I9HA 1FB6A 3HKRA 3ZTLA 1PKZA 3TRXA 5HR2A 1M2DA 4H86A 1T8EB 2GVPA 3JCML 2FHEA 5DAKB 3EU4A 3LQ7A 5INYA 1MDKA 2V41A 3KP9A 1NHYA 1GNWA 5A4UA 4AJ8A 3Q19A 2FWFA 2X99A 3IBHA 4IHUA 1XOAA 3KH7A 2H6YA 2K18A 2DJJA 5CP1A 2YN1A 1K0BA 2C3NA 4K7NA 1XWKA 3IA1A 1K0CA 4X1UA 1ZMAA 4MJEA 2WZ9A 2EIQA 3PPUA 4I6XA 4X0XA 2N5BA 1O81A 3MAKA 3TJBA 1EV4A 2AV4A 1XPVA 2LEGA 4BWSA 2FA4A 2DMLA 2VCZA 4I2TA 2AHEA 3S9FA 3K8NA 4TXOB 2FGXA 3GFKA 3LYPA 1BF5A 2X4AA 2GZPA 3UEMA 3U6VA 3CTFA 1I5GA 3LW9A 1S3DA 3IV4A 1MDIA 1E2YA 4GSTA 3CBUA 1JHBA 2O5VA 1GSDA 1T4YA 1TXUA 4KGIA 3J7Yk 1VGLA 1F2EA 4HS1A 3IOSA 2NBSA 1SD8A 2K6VA 4YH2A 2N5FA 4ECCA 5HR3A 5CRDA 1HQOA 3TKSC 4W66A 2FWHA 2GZZA 1ZYQB 1TI1A 5AIXA 4ZBDA 2PUKC 1GSFA 4OWYA 2DJKA 4FQUA 1ERUA 1X9SB 1WE0A 5CRWA 3ZZXA 2A2SA 1TRUA 5CAXA 3F8UA 5ECSA 4WBJA 1YF1A 1DE2A 2RUFA 2F51A 4PNGA 2OE1A 2MZCA 2ZUPA 2B6MA 1FG4A 2IWTA 2OJLA 5IMVA 2HFDA 3GSSA 4MNNA 4WR5A 1SU9A 4NWYA 2OADA 2WB9A 2M80A 1Z7RA 5ECLB 5BMUA 5ELGA 5IMDA 4MA9A 1SJZA 4J57E 5GAND 2L5OA 2E2GA 3MYDA 2F9SA 4BL7A 2DJ0A 5G5FA 3TRQA 5CO3A 3F63A 2H74A 3O3TA 2HZEA 2JACA 2DJ2A 3G7IA 4MH3A 2X49A 4EF0A 3HJOA 3CSIA 2WJUA 2VL2C 4FO5A 5H5QA 2LQOA 3EU3A 3ME7A 1TRVA 3O6TA 3VK9A 2H0IA 5A5HA 1AUCA 2RM6A 1ZOFA 3HCZA 3MSZA 1Y6EA 4TR4A 1Z3EA 4X43A 4G0IA 2DC5A 1X0RA 5C00A 5FWGA 1GTBA 1GP1A 1USBA 2DJ1A 2WFCA 2VUPA 2VD0A 3KM6A 2DMMA 1NSWA 4KB3A 1K0NA 4YQMA 4HZ4A 4GXZA 2JADA 1B9YC 2X8CA 3J7Yb 2N5AA 3EWLA 3QR6A 4CDOA 2FWGA 11GSA 2HLSA 3M3MA 3KH9A 1TK0B 1FB0A 2HSHA 1GLPA 2NDOA 4XS1A 4MPFA 2B7KA 4PGTA 2VL9A 3Q18A 4MCUA 5JWRB 1ZYNA 3D4TA 5G1KA 1Y25A 4QL9A 4HOJA 3L78A 4XTSA 1QMVA 4IN0A 4AI6A 2H6XA 4BWQA 4ZB9A 2I3YA 3CXGA 5IO2A 2V6KA 4PQIA 4K6XA 1T3BA 3FW2A 4YQVA 1XW5A 4HZ2A 1R4WA 4ZBAA 2O7KA 3UARA 1JZOA 2GQKA 4G10A 5D9WA 3D22A 2VCVA 2H1BA 4ML6A 3KEBA 3ERWA 3HA9A 5ECRB 5E59A 2C8UA 2ES7A 1XVQA 4MZCA 2VLUA 2CX3A 5B7CA 2M72A 5FHIA 1K3OA 4K1FA 5A34B 3BOAA 2EFDA 5BRTA 5CRGA 1V58A 1PD21 5JWOB 3UAPA 3F4SA 3IAM2 1ZCPA 4OFTA 1XOBA 3WT2A 2F3MA 1C72A 5J4YA 1THOA 2OACA 4DVCA 1X9MB 3TCOA 10GSA 1SK0A 4D73B 1Z7PA 5ENUA 3DGQA 3WT1A 3DVXA 5IOXA 4I2UA 2WRTA 5B8BA 3PH9A 5F0GA 4N0ZA 2R3XA 2GSRA 5DAKA 3VURA 5F8BA 2HI7A 3HZ8A 2LRTA 4F82A 1DUGA 2PPTA 3UL3A 1BEDA 2L6DA 1O6JA 2HNLA 1EGRA 4HEA2 2BMXA 1XXUA 1CQGA 1GUKA 3LFLA 2YWMA 2KUCA 3BBYA 2QGVA 4HJMA 1A2LA 1GUHA 3L4NA 5IMCA 1A0RP 4DSRA 3KZQA 1IYHA 5KOXA 3UOMA 3GH9A 2JSYA 2RUEA 2J23A 5IQYA 3APQA 4TXOA 1WPIA 1TRSA 5A4VA 2P0GA 2LNTA 1G0TA 2JZTA 5KN1A 2EFHA 3QPMA 3OR5A 3L0HA 1X9WB 4ZBBA 1O73A 4ZL9A 2AB6A 1GRXA 2B3SA 3IXRA 1TU8A 2VM1A 3DYRA 3UJ1A 4JBBA 3C1SA 3H79A 2LJAA 4K7IA 3DMLA 2P5QA 2ON7A 5IO0A 4ILFA 3GL5A 4N3ZA 4L5OA 3KP8A 2DSAA 3FY7A 1O8WA 2XHFA 1OKTA 4DSQA 3L9VA 4NHWA 3FR6A 4LMWA 3SWLA 1DSBA 4GCIA 4MK3A 2L59A 4E68A 3ZRDA 3E9JB 4K9ZA 4O32A 3ZFLA 1YKAA 4PUFC 1NM3A 4LA1A 1EOGA 5J47A 4GWRA 5D9XA 4K5RA 1VF2A 3F9UA 1PKWA 3CYNA 3QAWA 2K8VA 1MTCA 3ZVJA 1PX6A 1SD9A 4PURA 1W4VA 2GLRA 2AYTA 4Z2UA 2BJXA 2EFCA 1O85A 3H4KA 3P90A 2L5LA 3GSTA 1U3AA 1KNGA 1EP7A 1EP8A 1K0OA 3LYKA 4Q5RA 2E0QA 4XRAA 4RQXA 5AIVA 4PXOA 2BTOT 4YAPA 1VF4A 3C73A 3IK9A 3ZREA 3AY8A 1DBYA 3LSZA 5ELAA 3HVSA 3TRPA 2YWOA 3EVIA 4O7HA 4OO4A 1GTAA 3IC4A 3GUSA 1R5AA 2R6KA 2WGRA 5IPGA 2GQLA 3G7YA 3I9V2 2JZSA 2FY6A 1QK8A 1RK4A 4GRFA 3TKQA 1ZZYA 3TKSA 2DIZA 4K2DA 3DEXA 5D93A 2AJQB 1M0UA 2GT6A 5JCWA 1VF1A 1B8XA 4G19A 4KSOA 1HNAA 2TIRA 3LWAA 2H1LA 4MABA 2GZYA 4IJIA 3TOUA 4WBRD 3UVTA 4ECIA 2H75A 4IKHA 2C4JA 2C0EA 5J3RA 2KHPA 1T00A 9GSSA 1XFLA 2HSNB 4KE3A 2WS2A 5DCGA 2C1YA 4ISDA 5J9CA 1N25A 2A2PA 3PGTA 5ECQB 5F06A 5EY6A 2ZNMA 2R4VA 3DIEA 2HT9A 2JL4A 5DJMA 2LRNA 4MF6A 2ON5A 1ZL9A 3APSA 2GTUA 12GSA 5IM9A 2LTKA 2C80A 1Z6NA 2ALBA 3BCKA 4FYBA 5CYYA 2B1LA 2IMIA 5EL8A 1XVWA 1T1VA 1X5DA 3GN3A 2O8VB 4ZB7A 2VCQA 2VL2A 2VLVA 2CQ9A 2HRKB 4E8EA 5ECNB 3FR3A 5ECIB 4MF5A 2X8GA 1F3BA 1TTZA 3A5IA 4NHZA 1IYIA 3BJ5A 4KF9A 1R26A 3HXSA 2GT5A 3CSJA 5H5RA 1AC1A 4POMA 2H19A 3RAZA 2PGTA 5J41A 1FHEA 2G2QA 3GHAA 4FYCA 4KCAA 1F6MC 2C3TA 5CNWA 2IMFA 1OAZA 2HRNA 4POLA 2V1MA 4I5QA 4BVYB 3QFBC 3PINA 1XCCA 4IP6A 1LU4A 4ZB8A 1WP0A 4OO5A 4PX1A 1ST9A 4K5SA 1Q4JA 3GL3A 3ZMKA 5DCHA 1TDIA 1HYUA 3ERGA 1PX7A 5EPFA 1M9BA 2H73A 1OC8A 1PSQA 1FVKA 3HY2A 3GX8A 4O5QA 2O87A 1SJ6A 1N8JA 3LEFA 4KW6A 2MYGA 4D73A 2K8SA 2CT6A 5A5KA 4OD7A 4ECJA 3N9JA 4TR1B 3A5WA 6GSYA 4AKXB 1XWGA 3FZAA 4JE1A 3M1GA 1G6WA 1GLQA 3I69A 4L0UA 1PMTA 4NMUA 3Q6OA 3UBLA 1CQHA 2KLXA 2QKEA 3A2XA 3G9BA 3UMAA 2QA2A 2PMTA 3RHBA 2RM5A 4CHSA 5B8AA 1Z6MA 1M9AA 3M0FA 2PERA 2C0GA 3W6GA 2H0HA 2IFQB 5G30A 5B6NA 3FKFA 2H70A 2YANA 2UZ8A 4LMVA 2VM2A 2LJKA 4EUYA 2X64A 1V2AA 4FH8A 3W8SA 1OC9B 2FA8A 1ZGNA 5ECPB 1SL1B 2VIMA 3P2AA 3H8QA 1A24A 1Q98A 4AF2A 4GSSA 4AKHA 2V2GA 1B48A 4PUAA 4XRDA 4EL1A 1GSQA 3HVXA 1GTIA 5IMZA 1VF3A 3QMXA 1B4QA 2IMEA 1EOHA 5ECKB 3NZNA 3RHCA 3TGZA 5ID2B 1S3CA 2HSMB 2DKIA 2CZ2A 2E2MA 2WULA 4HQSA 3CMIA 1R5PA 1NW2A 5FT3A 5DDLA 4KDUA 4F2IA 1W89A 1YEPA 4BPYA 5HFKA 3DRNA 2FUG2 4KAEA 1URMA 4LL4B 2FLSA 5LNKe 3TJKA 5AGYA 4KDYA 4JR6A 2PVOC 4RUVA 1PA3A 1A23A 4V2NA 4HDEA 1G6YA 3LXTA 5D8IA 3ISOA 2M46A 1K0DA 5A1NB 6GSWA 2L57A 1UC7A 3HVVA 1SJIA 5ECOB 5G1LA 4YQUA 1TW9A 4EE0A 1EZKA 2A4HA 1Z5YE 2NPBA 3D4MA 4O5UA 1TK5B 1AQWA 4Q5QA 1GSSA 4I97A 1SKRB 3QFAC 4POBA 1OE7A 2H1AA 2RLIA 4EDYA 3D6IA 2CV4A 4HQZA 4L0WA 2GDRA 4MMMA 2YJHA 5F07A 2FD3A 1XW6A 4Q5NA 5G5EA 4P3YB 4CY6A 1BX9A 3P7XA 4GLTA 5H5SA 1MDJA 1SYXA 3HD5A 2KP2A 3TKPA 4WKWA 3EMPA 1EGOA 3GKXA 1OYJA 3FZ5A 5AISA 3IR4A 7GSSA 1SVMA 1YY7A 1A8LA 1SENA 4LLRA 3TOTA 1GTUA 3TUEA 5ECMB 5CRHA 3P8WA 4MPGA 2GQMA 3Q74A 3D5JA 2MMZA 3EURA 5J4UA 2EIOA 1YEXA 2LNSA 3R3EA 3BCIA 4NV5A 4ACSA 2HSNA 4N0VA 1G7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XHM A;  3FRC A;  3ME8 A;  4EC0 A;  3UIW A;  4MLY A;  3FZ9 A;  2IMK A;  4PNF A;  1EV9 A;  4QQ7 A;  1GSY A;  2TRX A;  3FZ4 A;  2J9H A;  3HJP A;  3TJF A;  3KJY A;  2GGT A;  3HZ4 A;  1FVJ A;  1BJX A;  3V1W A;  1SKS B;  4MJA A;  2OBK A;  3TJG A;  2VCX A;  2B7J A;  2L4C A;  1TOF A;  3C7M A;  1ERW A;  3L9U A;  4F9Z A;  1GUL A;  1QXH A;  3A2W A;  2HRK A;  2IIY A;  1H4O A;  4NAX A;  3LJR A;  17GS A;  1EEJ A;  4WXT A;  2GST A;  4V2L A;  4N10 A;  4WF4 A;  8GSS A;  5A4W A;  2C0F A;  4WF5 A;  4NXI A;  4KDX A;  3F0I A;  5KN3 A;  1EEM A;  4XIH A;  2VCW A;  4OMV A;  2I81 A;  2OKA A;  1QQ2 A;  3IE3 A;  2YPM A;  5CRE A;  1M2A A;  2RII A;  4BVY A;  1WMJ A;  4TR3 A;  2H6Z A;  5ECH B;  2R2J A;  4HU7 A;  4ZIL A;  4LL1 B;  4WET A;  3MWH A;  1JZR A;  1THX A;  1M2B A;  4V1A p;  4KND A;  4ID0 A;  5L71 A;  3FEU A;  1LBK A;  1K0M A;  1BG5 A;  3M9J A;  1K0A A;  1N2A A;  4BVX B;  4ZL7 A;  2PWJ A;  1WOU A;  4IBP A;  2XPD A;  1AIU A;  3GA4 A;  2F8A A;  4IW9 A;  2AAW A;  18GS A;  2EC4 A;  3VI7 A;  4USS A;  5KN2 A;  1F9M A;  5HFI A;  3EC3 A;  1GWC A;  4TR1 A;  1MD4 A;  4BA7 A;  5KN0 A;  2P31 A;  4KA0 A;  3ZFB A;  3GKN A;  2H01 A;  3C71 A;  3L9S A;  4TR0 A;  2H72 A;  1V40 A;  3F6D A;  4DSS B;  5LCZ A;  2JZR A;  16GS A;  1XWA A;  3GH6 A;  3M9K A;  2CVK A;  1YDK A;  3LG6 A;  2GSQ A;  2PVQ A;  2H1G A;  4MZB A;  5DAL B;  4POK A;  1GL8 A;  4GQC A;  1ERT A;  4EO3 A;  3VPT A;  5ABR A;  2IFQ A;  3IK7 A;  4F0C A;  5J9B A;  4O92 A;  4IVF A;  3DWV A;  3EMX A;  4ZL8 A;  3ED3 A;  2YNX A;  1UVZ A;  2MMN A;  5DVB A;  1A2M A;  1OC9 A;  3IRA A;  1PRX A;  2H30 A;  2B5Y A;  3LXZ A;  2KOK A;  3VWW A;  1SYR A;  4EVM A;  4L5L A;  4QL7 A;  2LS5 A;  2XPE A;  2FNO A;  4E8H A;  1WWJ A;  4PQH A;  3WGE A;  2HQT A;  1UN2 A;  5G2Z A;  4RI7 A;  2ZCT A;  3VI5 A;  4RI6 A;  1PN9 A;  1X5C A;  5HFG A;  5DQS A;  3ZVJ D;  3M8N A;  5ID2 A;  4OFN A;  2HSM A;  1UA5 A;  5DBQ A;  5EVO A;  1PL2 A;  4AJ6 A;  5GZZ B;  2XC2 A;  2YZH A;  3APO A;  4I8B A;  3GYK A;  1J9B A;  1ERV A;  1TP9 A;  3ZML A;  4PTS A;  2CAQ A;  4HI7 A;  3QCP A;  4AJ7 A;  2NVL A;  1XIY A;  1SL0 B;  3KIJ A;  1QUW A;  3FHK A;  1JFU A;  4TW5 A;  13GS A;  3F6F A;  3I6A A;  5COH A;  3US3 A;  2DIY A;  3ZL5 A;  1TI3 A;  4Q5F A;  1ABA A;  2GSS A;  2PU9 C;  4XCS A;  2LV3 A;  6GST A;  2VOC A;  1OVN A;  1SK1 A;  1XW9 A;  4K7O A;  4KH7 A;  3C1R A;  2DBC A;  2REM A;  2H71 A;  3C8E A;  1AW9 A;  4N11 A;  1TXX A;  1JLW A;  1HNC A;  3GKK A;  1OC3 A;  3VLN A;  3QD9 A;  3R2Q A;  4XS4 B;  2H0G A;  1PQN A;  1AQX A;  3QDN A;  3DXB A;  3IHQ A;  2XBI A;  2TRC P;  3WD6 A;  1BYE A;  2B5X A;  1GNE A;  4HUA A;  2L4Q A;  1U6T A;  5LD0 A;  4ECB A;  3NIV A;  3GIX A;  5GST A;  3KCM A;  6GSV A;  3UVH A;  2I1U A;  3I43 A;  3ZIJ A;  3RBT A;  5HR1 A;  3D21 A;  4MDC A;  3HJM A;  2IMD A;  3GV1 A;  2A2R A;  3KMN A;  1KBN A;  4MJC A;  2MMO A;  3RPP A;  3H1N A;  2OE0 A;  4G0L A;  1S3A A;  4NV2 A;  1M7T A;  2P5R A;  4GQF A;  1FOV A;  3E3E A;  3TDG A;  4IQA A;  4TOP A;  3QAV A;  1E6B A;  3KTL A;  5JCU A;  3FYG A;  2YV7 A;  2WDU A;  5IMF A;  3GTU B;  4RQR A;  2H8L A;  5E4W A;  1FAA A;  4F0B A;  3IAS 2;  2C0D A;  4IEL A;  1T7P B;  4ZXG A;  1HNB A;  2FWE A;  1U3I A;  2HRF A;  4TXV A;  4V2M A;  1A2J A;  2H66 A;  1ILO A;  1SK2 A;  2IJY A;  4Z7X A;  3N5O A;  1X5E A;  3F3Q A;  3IDV A;  1BQ7 A;  2DJ3 A;  2DLX A;  2GS3 A;  3GNJ A;  2IPA A;  4XS6 A;  3TJJ A;  3ERF A;  4O5R A;  2FCH A;  4G9H A;  2V32 A;  1F37 A;  3DKS A;  2QC7 A;  5GSS A;  3A3T A;  1K3Y A;  1XZO A;  2B1K A;  2MMA A;  3HHV A;  2MBS A;  1AQV A;  4IS0 A;  2NTO A;  2AUV A;  5GAP D;  2VCT A;  3CRT A;  2MBT A;  3KMO A;  3MDK A;  1EWX A;  5JWQ B;  3EYT A;  2YWN A;  2VL3 A;  3E0U A;  2LJR A;  1SL2 B;  5HQP A;  2YZU A;  5HR0 A;  5IIZ A;  5JCG A;  4BVX A;  2R5G A;  1J0F A;  3CRU A;  4IQ1 A;  3GX0 A;  2O85 A;  1MEK A;  3LGC A;  1GSE A;  2PN8 A;  3W8J A;  1B4P A;  3GMF A;  4ML1 A;  1R7H A;  4KSM A;  2HYX A;  4J56 E;  5B6M A;  4PQ1 A;  4KCE A;  4TVE A;  3CSH A;  4KUN A;  2PBJ A;  2YJ7 A;  1FW1 A;  4OCE A;  2YOI A;  2O89 A;  1TK8 B;  2LRC A;  2R37 A;  2KP1 A;  4DSS A;  1V9W A;  3DD3 A;  2A4V A;  3F4T A;  2IL3 A;  3F4R A;  3KTB A;  3D0Z A;  5D9V A;  4MF7 A;  1Z9H A;  4WR4 A;  5DAL A;  1WIK A;  4YAV A;  5D9T A;  6GSU A;  1HD2 A;  3IC8 A;  2LQQ A;  1TU7 A;  1YKC A;  5D96 A;  1KTE A;  4CW9 A;  1OKD A;  2OA7 A;  2HSY A;  4IGJ A;  3WGX A;  3TKR A;  1J08 A;  3DVW A;  2G0F A;  1PL1 A;  4HU9 A;  3SBC A;  1ML6 A;  1KEB A;  2XBQ A;  20GS A;  1TJD A;  2YP6 A;  1TKD B;  5J5N A;  1K3L A;  2JSZ A;  3GRX A;  3VFI A;  1MD3 A;  4OFM A;  4K0N A;  3FK8 A;  4GSN A;  3A2V A;  3H93 A;  1AXD A;  2I4A A;  2HE3 A;  4F03 A;  5IMA A;  2VO4 A;  4K8M A;  1B9X C;  3ZIV A;  1A0F A;  1FO5 A;  4FIW A;  2YWI A;  2LKU A;  1RW1 A;  2X8H A;  2WCI A;  3G7J A;  3O76 A;  3VWV A;  3F3R A;  1XWC A;  3KGK A;  4JED A;  2CZ3 A;  1NHO A;  6GSS A;  3WGD A;  4GTU A;  1DE1 A;  22GS A;  1V98 A;  2L6C A;  4V1A g;  1A8Y A;  2B5E A;  4BL7 B;  3GUR A;  3QAG A;  4NPB A;  1JZD A;  1AAZ A;  1WRY A;  2VLT A;  3EE2 A;  5C04 A;  3LOR A;  1XWB A;  2HZE B;  2H1D A;  5F05 A;  2Z9S A;  1LJR A;  3BD2 A;  2VD1 A;  1ON4 A;  19GS A;  4J2F A;  1WJK A;  2HZF A;  14GS A;  1PGT A;  3FR9 A;  4TRX A;  2QSI A;  4MH2 A;  4XS4 A;  1GUM A;  3KXO A;  2VAF A;  3MNG A;  1GH2 A;  6GSX A;  2F8F A;  1QFN A;  1VRS D;  3RDW A;  5KEJ A;  1T4Z A;  2IN3 A;  4IP1 A;  3VPQ A;  2CAI A;  1OE8 A;  5IPH A;  5DJL A;  3HYP A;  2HXK A;  2EIR A;  1SKW B;  2JU5 A;  1V57 A;  2HRA A;  4ULX A;  3PR8 A;  2C3Q A;  3VWU A;  1GSU A;  4HJ2 A;  2H76 A;  1U87 A;  2K9F A;  3NOF A;  2CA8 A;  3QOU A;  3KD0 A;  1XBS A;  3U5R E;  3GKM A;  4ZB6 A;  4EXJ A;  1M99 A;  4MP4 A;  3RPN A;  1I9D A;  2CX4 A;  3EIN A;  1YZX A;  1JLV A;  5IOW A;  4GF0 A;  4OCF A;  4MJB A;  3GTU A;  4G2E A;  4WEY A;  2V6O A;  1YJ6 A;  1YQ1 A;  4JZQ A;  4JR4 A;  2D2Z A;  2YCD A;  1BAY A;  4IJ3 A;  4EDZ A;  2OBI A;  1TRW A;  5G31 A;  3WYW A;  4N30 A;  2YV9 A;  4DEJ A;  1JZW A;  1U88 A;  5D73 A;  4TN8 A;  4TKY A;  1YF0 A;  4L8E A;  3IPZ A;  4MZW A;  5DQY A;  1F3A A;  1H75 A;  2CVD A;  2E7P A;  1ACV A;  4K0G A;  3HDC A;  3ZYW A;  3CTG A;  3ZLP A;  2OE3 A;  4JRR A;  3ZIT A;  4EKZ A;  5AN1 A;  4AGS A;  3UBK A;  3TKS E;  1G7E A;  4FYU A;  1QGV A;  4JU5 A;  1O7U A;  2LST A;  1ZYE A;  3TB2 A;  1O8X A;  4ZIJ A;  4G0K A;  2CVB A;  2LUS A;  4KX4 A;  3VWX A;  1RQM A;  2I9H A;  1FB6 A;  3HKR A;  3ZTL A;  1PKZ A;  3TRX A;  5HR2 A;  1M2D A;  4H86 A;  1T8E B;  2GVP A;  3JCM L;  2FHE A;  5DAK B;  3EU4 A;  3LQ7 A;  5INY A;  1MDK A;  2V41 A;  3KP9 A;  1NHY A;  1GNW A;  5A4U A;  4AJ8 A;  3Q19 A;  2FWF A;  2X99 A;  3IBH A;  4IHU A;  1XOA A;  3KH7 A;  2H6Y A;  2K18 A;  2DJJ A;  5CP1 A;  2YN1 A;  1K0B A;  2C3N A;  4K7N A;  1XWK A;  3IA1 A;  1K0C A;  4X1U A;  1ZMA A;  4MJE A;  2WZ9 A;  2EIQ A;  3PPU A;  4I6X A;  4X0X A;  2N5B A;  1O81 A;  3MAK A;  3TJB A;  1EV4 A;  2AV4 A;  1XPV A;  2LEG A;  4BWS A;  2FA4 A;  2DML A;  2VCZ A;  4I2T A;  2AHE A;  3S9F A;  3K8N A;  4TXO B;  2FGX A;  3GFK A;  3LYP A;  2GZP A;  3UEM A;  3U6V A;  3CTF A;  1I5G A;  1S3D A;  3IV4 A;  1MDI A;  1E2Y A;  4GST A;  3CBU A;  1JHB A;  1GSD A;  1T4Y A;  4KGI A;  3J7Y k;  1VGL A;  1F2E A;  4HS1 A;  3IOS A;  2NBS A;  1SD8 A;  2K6V A;  4YH2 A;  2N5F A;  4ECC A;  5HR3 A;  5CRD A;  1HQO A;  3TKS C;  2FWH A;  2GZZ A;  1ZYQ B;  1TI1 A;  5AIX A;  4ZBD A;  2PUK C;  1GSF A;  4OWY A;  2DJK A;  4FQU A;  1ERU A;  1X9S B;  1WE0 A;  5CRW A;  3ZZX A;  2A2S A;  1TRU A;  5CAX A;  3F8U A;  5ECS A;  4WBJ A;  1YF1 A;  1DE2 A;  2RUF A;  2F51 A;  4PNG A;  2OE1 A;  2MZC A;  2ZUP A;  2B6M A;  1FG4 A;  2IWT A;  2OJL A;  5IMV A;  2HFD A;  3GSS A;  4WR5 A;  1SU9 A;  4NWY A;  2OAD A;  2WB9 A;  2M80 A;  1Z7R A;  5ECL B;  5BMU A;  5ELG A;  5IMD A;  4MA9 A;  1SJZ A;  4J57 E;  5GAN D;  2L5O A;  2E2G A;  2F9S A;  4BL7 A;  2DJ0 A;  5G5F A;  3TRQ A;  5CO3 A;  3F63 A;  2H74 A;  3O3T A;  2HZE A;  2JAC A;  2DJ2 A;  3G7I A;  4MH3 A;  4EF0 A;  3HJO A;  3CSI A;  2WJU A;  2VL2 C;  4FO5 A;  5H5Q A;  2LQO A;  3EU3 A;  3ME7 A;  1TRV A;  3O6T A;  3VK9 A;  2H0I A;  1AUC A;  2RM6 A;  1ZOF A;  3HCZ A;  3MSZ A;  1Y6E A;  4TR4 A;  1Z3E A;  4X43 A;  4G0I A;  2DC5 A;  1X0R A;  5C00 A;  5FWG A;  1GTB A;  1GP1 A;  1USB A;  2DJ1 A;  2WFC A;  2VUP A;  2VD0 A;  3KM6 A;  2DMM A;  1NSW A;  4KB3 A;  1K0N A;  4YQM A;  4HZ4 A;  4GXZ A;  2JAD A;  1B9Y C;  2X8C A;  3J7Y b;  2N5A A;  3EWL A;  3QR6 A;  4CDO A;  2FWG A;  11GS A;  2HLS A;  3M3M A;  3KH9 A;  1TK0 B;  1FB0 A;  2HSH A;  1GLP A;  2NDO A;  4XS1 A;  4MPF A;  2B7K A;  4PGT A;  2VL9 A;  3Q18 A;  4MCU A;  5JWR B;  3D4T A;  5G1K A;  1Y25 A;  4QL9 A;  4HOJ A;  3L78 A;  4XTS A;  1QMV A;  4IN0 A;  2H6X A;  4BWQ A;  4ZB9 A;  2I3Y A;  3CXG A;  5IO2 A;  2V6K A;  4PQI A;  4K6X A;  1T3B A;  3FW2 A;  4YQV A;  1XW5 A;  4HZ2 A;  1R4W A;  4ZBA A;  2O7K A;  3UAR A;  1JZO A;  2GQK A;  4G10 A;  5D9W A;  3D22 A;  2VCV A;  2H1B A;  4ML6 A;  3KEB A;  3ERW A;  3HA9 A;  5ECR B;  5E59 A;  2C8U A;  2ES7 A;  1XVQ A;  4MZC A;  2VLU A;  2CX3 A;  5B7C A;  2M72 A;  5FHI A;  1K3O A;  4K1F A;  3BOA A;  5CRG A;  1V58 A;  1PD2 1;  5JWO B;  3UAP A;  3F4S A;  3IAM 2;  1ZCP A;  4OFT A;  1XOB A;  3WT2 A;  2F3M A;  1C72 A;  1THO A;  2OAC A;  4DVC A;  1X9M B;  3TCO A;  10GS A;  1SK0 A;  4D73 B;  1Z7P A;  5ENU A;  3DGQ A;  3WT1 A;  3DVX A;  5IOX A;  4I2U A;  2WRT A;  5B8B A;  3PH9 A;  5F0G A;  4N0Z A;  2R3X A;  2GSR A;  5DAK A;  3VUR A;  5F8B A;  2HI7 A;  3HZ8 A;  2LRT A;  4F82 A;  1DUG A;  2PPT A;  3UL3 A;  1BED A;  2L6D A;  1O6J A;  2HNL A;  1EGR A;  4HEA 2;  2BMX A;  1XXU A;  1CQG A;  1GUK A;  3LFL A;  2YWM A;  2KUC A;  3BBY A;  2QGV A;  4HJM A;  1A2L A;  1GUH A;  3L4N A;  5IMC A;  1A0R P;  4DSR A;  3KZQ A;  1IYH A;  3UOM A;  3GH9 A;  2JSY A;  2RUE A;  2J23 A;  5IQY A;  3APQ A;  4TXO A;  1WPI A;  1TRS A;  5A4V A;  2P0G A;  2LNT A;  1G0T A;  2JZT A;  5KN1 A;  3QPM A;  3OR5 A;  3L0H A;  1X9W B;  4ZBB A;  1O73 A;  4ZL9 A;  2AB6 A;  1GRX A;  2B3S A;  3IXR A;  1TU8 A;  2VM1 A;  3DYR A;  3UJ1 A;  4JBB A;  3C1S A;  3H79 A;  2LJA A;  4K7I A;  3DML A;  2P5Q A;  2ON7 A;  5IO0 A;  4ILF A;  3GL5 A;  4L5O A;  3KP8 A;  2DSA A;  3FY7 A;  1O8W A;  2XHF A;  1OKT A;  4DSQ A;  3L9V A;  4NHW A;  3FR6 A;  4LMW A;  3SWL A;  1DSB A;  4GCI A;  4MK3 A;  2L59 A;  3ZRD A;  3E9J B;  4K9Z A;  4O32 A;  3ZFL A;  1YKA A;  4PUF C;  1NM3 A;  4LA1 A;  1EOG A;  4GWR A;  5D9X A;  1VF2 A;  3F9U A;  1PKW A;  3CYN A;  3QAW A;  2K8V A;  1MTC A;  3ZVJ A;  1PX6 A;  1SD9 A;  4PUR A;  1W4V A;  2GLR A;  2AYT A;  2BJX A;  1O85 A;  3H4K A;  3P90 A;  2L5L A;  3GST A;  1U3A A;  1KNG A;  1EP7 A;  1EP8 A;  1K0O A;  3LYK A;  4Q5R A;  2E0Q A;  4XRA A;  4RQX A;  5AIV A;  4PXO A;  2BTO T;  4YAP A;  1VF4 A;  3C73 A;  3IK9 A;  3ZRE A;  3AY8 A;  1DBY A;  3LSZ A;  5ELA A;  3HVS A;  3TRP A;  2YWO A;  3EVI A;  4O7H A;  4OO4 A;  1GTA A;  3IC4 A;  3GUS A;  1R5A A;  2R6K A;  2WGR A;  5IPG A;  2GQL A;  3G7Y A;  3I9V 2;  2JZS A;  2FY6 A;  1QK8 A;  1RK4 A;  4GRF A;  3TKQ A;  1ZZY A;  3TKS A;  2DIZ A;  4K2D A;  3DEX A;  5D93 A;  2AJQ B;  1M0U A;  2GT6 A;  5JCW A;  1VF1 A;  1B8X A;  4G19 A;  4KSO A;  1HNA A;  2TIR A;  3LWA A;  4MAB A;  2GZY A;  4IJI A;  3TOU A;  4WBR D;  3UVT A;  4ECI A;  2H75 A;  4IKH A;  2C4J A;  2C0E A;  5J3R A;  2KHP A;  1T00 A;  9GSS A;  1XFL A;  2HSN B;  4KE3 A;  2WS2 A;  5DCG A;  2C1Y A;  4ISD A;  5J9C A;  3PGT A;  5ECQ B;  5F06 A;  5EY6 A;  2ZNM A;  2R4V A;  3DIE A;  2HT9 A;  2JL4 A;  5DJM A;  2LRN A;  4MF6 A;  2ON5 A;  1ZL9 A;  3APS A;  2GTU A;  12GS A;  5IM9 A;  2LTK A;  2C80 A;  1Z6N A;  2ALB A;  3BCK A;  4FYB A;  5CYY A;  2B1L A;  2IMI A;  5EL8 A;  1XVW A;  1T1V A;  1X5D A;  3GN3 A;  2O8V B;  2VCQ A;  2VL2 A;  2VLV A;  2CQ9 A;  2HRK B;  4E8E A;  5ECN B;  3FR3 A;  5ECI B;  4MF5 A;  2X8G A;  1F3B A;  1TTZ A;  4NHZ A;  1IYI A;  3BJ5 A;  4KF9 A;  1R26 A;  3HXS A;  2GT5 A;  3CSJ A;  5H5R A;  1AC1 A;  4POM A;  2H19 A;  3RAZ A;  2PGT A;  5J41 A;  1FHE A;  2G2Q A;  3GHA A;  4FYC A;  4KCA A;  1F6M C;  2C3T A;  5CNW A;  2IMF A;  1OAZ A;  2HRN A;  4POL A;  2V1M A;  4I5Q A;  4BVY B;  3QFB C;  3PIN A;  1XCC A;  4IP6 A;  1LU4 A;  4ZB8 A;  1WP0 A;  4OO5 A;  4PX1 A;  1ST9 A;  1Q4J A;  3GL3 A;  3ZMK A;  5DCH A;  1TDI A;  1HYU A;  3ERG A;  1PX7 A;  5EPF A;  1M9B A;  2H73 A;  1OC8 A;  1PSQ A;  1FVK A;  3HY2 A;  3GX8 A;  2O87 A;  1SJ6 A;  1N8J A;  3LEF A;  4KW6 A;  2MYG A;  4D73 A;  2K8S A;  2CT6 A;  5A5K A;  4OD7 A;  4ECJ A;  3N9J A;  4TR1 B;  3A5W A;  6GSY A;  1XWG A;  3FZA A;  4JE1 A;  3M1G A;  1G6W A;  1GLQ A;  3I69 A;  4L0U A;  1PMT A;  4NMU A;  3Q6O A;  3UBL A;  1CQH A;  2KLX A;  2QKE A;  3A2X A;  3G9B A;  3UMA A;  2PMT A;  3RHB A;  2RM5 A;  4CHS A;  5B8A A;  1Z6M A;  1M9A A;  3M0F A;  2PER A;  2C0G A;  3W6G A;  2H0H A;  2IFQ B;  5G30 A;  5B6N A;  3FKF A;  2H70 A;  2YAN A;  2UZ8 A;  4LMV A;  2VM2 A;  2LJK A;  4EUY A;  2X64 A;  1V2A A;  4FH8 A;  3W8S A;  1OC9 B;  2FA8 A;  1ZGN A;  5ECP B;  1SL1 B;  2VIM A;  3P2A A;  3H8Q A;  1A24 A;  1Q98 A;  4AF2 A;  4GSS A;  2V2G A;  1B48 A;  4PUA A;  4XRD A;  4EL1 A;  1GSQ A;  3HVX A;  1GTI A;  5IMZ A;  1VF3 A;  3QMX A;  1B4Q A;  2IME A;  1EOH A;  5ECK B;  3NZN A;  3RHC A;  3TGZ A;  5ID2 B;  1S3C A;  2HSM B;  2CZ2 A;  2E2M A;  2WUL A;  4HQS A;  3CMI A;  1R5P A;  1NW2 A;  5FT3 A;  5DDL A;  4KDU A;  4F2I A;  1W89 A;  1YEP A;  4BPY A;  5HFK A;  3DRN A;  2FUG 2;  4KAE A;  1URM A;  4LL4 B;  2FLS A;  5LNK e;  3TJK A;  5AGY A;  4KDY A;  4JR6 A;  2PVO C;  4RUV A;  1PA3 A;  1A23 A;  4V2N A;  4HDE A;  1G6Y A;  3LXT A;  5D8I A;  3ISO A;  2M46 A;  1K0D A;  6GSW A;  2L57 A;  1UC7 A;  3HVV A;  1SJI A;  5ECO B;  5G1L A;  4YQU A;  1TW9 A;  4EE0 A;  1EZK A;  1Z5Y E;  2NPB A;  3D4M A;  1TK5 B;  1AQW A;  4Q5Q A;  1GSS A;  4I97 A;  1SKR B;  3QFA C;  4POB A;  1OE7 A;  2H1A A;  2RLI A;  4EDY A;  3D6I A;  2CV4 A;  4HQZ A;  4L0W A;  2GDR A;  4MMM A;  2YJH A;  5F07 A;  2FD3 A;  1XW6 A;  4Q5N A;  5G5E A;  4P3Y B;  1BX9 A;  3P7X A;  4GLT A;  5H5S A;  1MDJ A;  1SYX A;  3HD5 A;  2KP2 A;  3TKP A;  4WKW A;  3EMP A;  1EGO A;  3GKX A;  1OYJ A;  3FZ5 A;  5AIS A;  3IR4 A;  7GSS A;  1YY7 A;  1A8L A;  1SEN A;  4LLR A;  3TOT A;  1GTU A;  3TUE A;  5ECM B;  5CRH A;  3P8W A;  4MPG A;  2GQM A;  3Q74 A;  3D5J A;  2MMZ A;  3EUR A;  5J4U A;  2EIO A;  1YEX A;  2LNS A;  3R3E A;  3BCI A;  4NV5 A;  4ACS A;  4N0V A;  1G7O A; 
#chains in the Genus database with same CATH topology
 4XHM A;  3FRC A;  3ME8 A;  4EC0 A;  3UIW A;  4MLY A;  3FZ9 A;  2IMK A;  4PNF A;  1EV9 A;  3HMJ G;  4QQ7 A;  1GSY A;  2TRX A;  3FZ4 A;  2J9H A;  3TU3 B;  3HJP A;  3TJF A;  3KJY A;  2EFE A;  2GGT A;  3HZ4 A;  1FVJ A;  1BJX A;  3V1W A;  1SKS B;  5KOW A;  4MJA A;  2OBK A;  3TJG A;  2VCX A;  2B7J A;  2L4C A;  1TOF A;  3C7M A;  1ERW A;  3L9U A;  4F9Z A;  1GUL A;  1QXH A;  3A2W A;  2HRK A;  2IIY A;  1H4O A;  3HVN A;  4NAX A;  3LJR A;  17GS A;  1EEJ A;  4WXT A;  2GST A;  4V2L A;  4N10 A;  4WF4 A;  8GSS A;  5A4W A;  2C0F A;  4WF5 A;  4NXI A;  4KDX A;  3F0I A;  5KN3 A;  1EEM A;  4XIH A;  2VCW A;  2R0G A;  4OMV A;  2I81 A;  2OKA A;  1QQ2 A;  3IE3 A;  2YPM A;  5CRE A;  1M2A A;  2RII A;  4BVY A;  1WMJ A;  4TR3 A;  2H6Z A;  5ECH B;  2R2J A;  4HU7 A;  4ZIL A;  4LL1 B;  4WET A;  3MWH A;  5J4V A;  1JZR A;  1THX A;  1M2B A;  4V1A p;  2WVX A;  4KND A;  4ID0 A;  5L71 A;  3FEU A;  1LBK A;  1K0M A;  1BG5 A;  3M9J A;  1K0A A;  1N2A A;  4BVX B;  4ZL7 A;  2PWJ A;  1WOU A;  4IBP A;  3FMW A;  2XPD A;  1AIU A;  3GA4 A;  2F8A A;  2WVZ A;  4IW9 A;  2AAW A;  18GS A;  2EC4 A;  1YVL A;  3VI7 A;  4QMK A;  4USS A;  5KN2 A;  1F9M A;  5HFI A;  3EC3 A;  1GWC A;  4TR1 A;  1MD4 A;  4BA7 A;  5KN0 A;  2P31 A;  4KA0 A;  3ZFB A;  3GKN A;  2H01 A;  3C71 A;  3L9S A;  4TR0 A;  2H72 A;  1V40 A;  3F6D A;  4DSS B;  5LCZ A;  2JZR A;  16GS A;  1XWA A;  3GH6 A;  3M9K A;  2CVK A;  1YDK A;  3LG6 A;  2GSQ A;  2PVQ A;  2H1G A;  4MZB A;  5DAL B;  4POK A;  1GL8 A;  4GQC A;  1ERT A;  4EO3 A;  3VPT A;  5ABR A;  2IFQ A;  3IK7 A;  4F0C A;  5J9B A;  4O92 A;  4IVF A;  3DWV A;  3EMX A;  4ZL8 A;  3ED3 A;  2YNX A;  1UVZ A;  2MMN A;  5DVB A;  4Z2R A;  1A2M A;  1OC9 A;  1FOH A;  3IRA A;  1PRX A;  2H30 A;  2B5Y A;  3LXZ A;  2KOK A;  3VWW A;  1SYR A;  4EVM A;  4L5L A;  2R0P A;  4QL7 A;  2LS5 A;  2XPE A;  2FNO A;  4E8H A;  1WWJ A;  4PQH A;  3WGE A;  2HQT A;  1UN2 A;  5G2Z A;  4RI7 A;  2ZCT A;  3VI5 A;  4RI6 A;  1PN9 A;  1X5C A;  5HFG A;  5DQS A;  3ZVJ D;  3M8N A;  5ID2 A;  4OFN A;  2HSM A;  5J40 A;  1UA5 A;  5DBQ A;  5EVO A;  1PL2 A;  4AJ6 A;  5GZZ B;  2XC2 A;  2YZH A;  3APO A;  4I8B A;  3GYK A;  1J9B A;  1ERV A;  1TP9 A;  3ZML A;  4PTS A;  2CAQ A;  4AKI A;  4HI7 A;  3QCP A;  4AJ7 A;  2NVL A;  1XIY A;  1SL0 B;  3KIJ A;  5A1N A;  4YKG A;  1QUW A;  3FHK A;  1JFU A;  4TW5 A;  13GS A;  3F6F A;  3I6A A;  5COH A;  3US3 A;  2DIY A;  3ZL5 A;  1TI3 A;  4Q5F A;  1ABA A;  2GSS A;  2PU9 C;  4XCS A;  2LV3 A;  6GST A;  2VOC A;  1OVN A;  1SK1 A;  1XW9 A;  4K7O A;  4KH7 A;  3C1R A;  2DBC A;  2REM A;  2H71 A;  3C8E A;  1PN0 A;  1AW9 A;  4N11 A;  1TXX A;  1JLW A;  1HNC A;  3GKK A;  1OC3 A;  3VLN A;  3QD9 A;  3R2Q A;  4XS4 B;  2H0G A;  1PQN A;  1AQX A;  2OT3 A;  3QDN A;  3DXB A;  3IHQ A;  2XBI A;  2TRC P;  3WD6 A;  1BYE A;  2B5X A;  3RFR C;  1GNE A;  4HUA A;  5A34 A;  2R0C A;  2L4Q A;  1U6T A;  5LD0 A;  4ECB A;  3NIV A;  3GIX A;  5GST A;  3KCM A;  6GSV A;  3UVH A;  4EIQ A;  2I1U A;  3CWG A;  3I43 A;  3ZIJ A;  3RBT A;  5HR1 A;  3D21 A;  4MDC A;  3HJM A;  4Z2T A;  2IMD A;  3GV1 A;  2A2R A;  3KMN A;  1KBN A;  4MJC A;  2MMO A;  4X4J A;  3RPP A;  3H1N A;  2OE0 A;  4G0L A;  1S3A A;  4YKF A;  4NV2 A;  2DKH A;  1M7T A;  2P5R A;  4GQF A;  1FOV A;  3E3E A;  3TDG A;  4IQA A;  4TOP A;  3QAV A;  2VKZ G;  1E6B A;  3KTL A;  5JCU A;  3FYG A;  2YV7 A;  2WDU A;  5IMF A;  3GTU B;  4RQR A;  2H8L A;  5E4W A;  1FAA A;  4F0B A;  3IAS 2;  2C0D A;  4IEL A;  1T7P B;  4ZXG A;  1HNB A;  2FWE A;  1U3I A;  2HRF A;  4TXV A;  4V2M A;  1A2J A;  2H66 A;  1ILO A;  1SK2 A;  2IJY A;  4Z7X A;  1SVO A;  3N5O A;  1X5E A;  3F3Q A;  3IDV A;  1BQ7 A;  2DJ3 A;  2DLX A;  2GS3 A;  3GNJ A;  2IPA A;  4XS6 A;  3TJJ A;  3ERF A;  4O5R A;  2FCH A;  4G9H A;  2V32 A;  1F37 A;  3DKS A;  2QC7 A;  5GSS A;  3A3T A;  1K3Y A;  1XZO A;  2B1K A;  2MMA A;  3HHV A;  2MBS A;  1AQV A;  4IS0 A;  2NTO A;  2AUV A;  5GAP D;  2VCT A;  3CRT A;  2MBT A;  3KMO A;  3MDK A;  1EWX A;  5JWQ B;  3EYT A;  2YWN A;  2VL3 A;  3E0U A;  2LJR A;  1SL2 B;  5HQP A;  2YZU A;  5HR0 A;  5IIZ A;  5JCG A;  4BVX A;  2R5G A;  1J0F A;  3CRU A;  4IQ1 A;  3GX0 A;  2O85 A;  1MEK A;  3LGC A;  1GSE A;  2PN8 A;  3W8J A;  1B4P A;  4G01 A;  3GMF A;  4ML1 A;  1R7H A;  4KSM A;  2HYX A;  4J56 E;  5B6M A;  4PQ1 A;  4KCE A;  4TVE A;  3CSH A;  4KUN A;  2PBJ A;  3IHG A;  2YJ7 A;  1FW1 A;  4OCE A;  2YOI A;  2O89 A;  1TK8 B;  2LRC A;  3MIX A;  2R37 A;  1M3I A;  2KP1 A;  4DSS A;  1V9W A;  3DD3 A;  2A4V A;  3F4T A;  2IL3 A;  3F4R A;  3KTB A;  3D0Z A;  5D9V A;  4MF7 A;  1Z9H A;  4WR4 A;  5DAL A;  1WIK A;  4YAV A;  5D9T A;  6GSU A;  1HD2 A;  3IC8 A;  4BIK A;  2LQQ A;  4K2X A;  1PFO A;  1TU7 A;  1YKC A;  5D96 A;  4A5P A;  1KTE A;  4CW9 A;  1OKD A;  2OA7 A;  2HSY A;  1ZYP A;  4IGJ A;  2UV8 G;  1M3J A;  3WGX A;  3TKR A;  1J08 A;  1BG1 A;  3DVW A;  2G0F A;  1PL1 A;  4HU9 A;  3SBC A;  1ML6 A;  1KEB A;  2XBQ A;  20GS A;  1TJD A;  2YP6 A;  1TKD B;  4HSC X;  5J5N A;  1K3L A;  2JSZ A;  2QA1 A;  3GRX A;  1MD3 A;  4OFM A;  3VFI A;  4K0N A;  3FK8 A;  4GSN A;  3A2V A;  3H93 A;  1AXD A;  2I4A A;  2HE3 A;  4F03 A;  5IMA A;  2VO4 A;  4K8M A;  1B9X C;  3ZIV A;  1A0F A;  1FO5 A;  4FIW A;  2YWI A;  2LKU A;  1RW1 A;  1Y1U A;  2WW0 A;  2X8H A;  2WCI A;  3G7J A;  3O76 A;  3VWV A;  3F3R A;  1XWC A;  3KGK A;  4JED A;  2CZ3 A;  1NHO A;  6GSS A;  3WGD A;  4GTU A;  1DE1 A;  22GS A;  1V98 A;  2L6C A;  5BMU B;  4V1A g;  1A8Y A;  2B5E A;  4BL7 B;  3GUR A;  3EPT A;  3QAG A;  4NPB A;  1JZD A;  1AAZ A;  1WRY A;  2VLT A;  4CY8 A;  3EE2 A;  5C04 A;  3LOR A;  1XWB A;  2HZE B;  2H1D A;  5F05 A;  2Z9S A;  1LJR A;  3BD2 A;  2VD1 A;  1ON4 A;  19GS A;  4J2F A;  3CQF A;  1WJK A;  2HZF A;  14GS A;  1PGT A;  3FR9 A;  4TRX A;  2QSI A;  4GDF A;  4MH2 A;  4XS4 A;  1GUM A;  3KXO A;  5A5H B;  2VAF A;  3MNG A;  1GH2 A;  6GSX A;  2F8F A;  1QFN A;  1VRS D;  3RDW A;  5KEJ A;  1T4Z A;  2IN3 A;  4IP1 A;  3VPQ A;  2CAI A;  1OE8 A;  5IPH A;  5DJL A;  3HYP A;  2HXK A;  2EIR A;  4ICY A;  2JU5 A;  1SKW B;  1V57 A;  2HRA A;  4ULX A;  3PR8 A;  2C3Q A;  3VWU A;  1GSU A;  4HJ2 A;  2H76 A;  1U87 A;  2K9F A;  3NOF A;  2CA8 A;  3QOU A;  3KD0 A;  1XBS A;  3U5R E;  3GKM A;  4ZB6 A;  4EXJ A;  1M99 A;  4MP4 A;  3RPN A;  1I9D A;  2CX4 A;  3EIN A;  1YZX A;  1JLV A;  5IOW A;  4GF0 A;  4OCF A;  4MJB A;  3GTU A;  4G2E A;  4WEY A;  2WZS A;  2V6O A;  1YJ6 A;  1YQ1 A;  4JZQ A;  4JR4 A;  1S3R A;  2D2Z A;  4EIP A;  2YCD A;  2O36 A;  1BAY A;  4IJ3 A;  4EDZ A;  2OBI A;  1TRW A;  1SVL A;  5G31 A;  3WYW A;  4N30 A;  2YV9 A;  4DEJ A;  1JZW A;  1U88 A;  5D73 A;  4TN8 A;  4TKY A;  1YF0 A;  4L8E A;  3IPZ A;  4MZW A;  5DQY A;  1F3A A;  1H75 A;  2CVD A;  2E7P A;  1ACV A;  4K0G A;  3HDC A;  3ZYW A;  3CTG A;  3ZLP A;  2OE3 A;  4JRR A;  3ZIT A;  4EKZ A;  5AN1 A;  4AKG A;  4AGS A;  3UBK A;  3TKS E;  1G7E A;  4FYU A;  1QGV A;  4JU5 A;  1O7U A;  2LST A;  1ZYE A;  3TB2 A;  1O8X A;  4ZIJ A;  4G0K A;  2CVB A;  2LUS A;  4KX4 A;  3VWX A;  1RQM A;  2I9H A;  1FB6 A;  3HKR A;  3ZTL A;  1PKZ A;  3TRX A;  5HR2 A;  1M2D A;  4H86 A;  1T8E B;  2GVP A;  3JCM L;  2FHE A;  5DAK B;  3EU4 A;  3LQ7 A;  5INY A;  1MDK A;  2V41 A;  3KP9 A;  1NHY A;  1GNW A;  5A4U A;  4AJ8 A;  3Q19 A;  2FWF A;  2X99 A;  3IBH A;  4IHU A;  1XOA A;  3KH7 A;  2H6Y A;  2K18 A;  2DJJ A;  5CP1 A;  2YN1 A;  1K0B A;  2C3N A;  4K7N A;  1XWK A;  3IA1 A;  1K0C A;  4X1U A;  1ZMA A;  4MJE A;  2WZ9 A;  2EIQ A;  3PPU A;  4I6X A;  4X0X A;  2N5B A;  1O81 A;  3MAK A;  3TJB A;  1EV4 A;  2AV4 A;  1XPV A;  2LEG A;  4BWS A;  2FA4 A;  2DML A;  2VCZ A;  4I2T A;  2AHE A;  3S9F A;  3K8N A;  4TXO B;  2FGX A;  3GFK A;  3LYP A;  1BF5 A;  2X4A A;  2GZP A;  3UEM A;  3U6V A;  3CTF A;  1I5G A;  3LW9 A;  1S3D A;  3IV4 A;  1MDI A;  1E2Y A;  4GST A;  3CBU A;  1JHB A;  2O5V A;  1GSD A;  1T4Y A;  1TXU A;  4KGI A;  3J7Y k;  1VGL A;  1F2E A;  4PI2 C;  4HS1 A;  3IOS A;  2NBS A;  1SD8 A;  2K6V A;  4YH2 A;  2N5F A;  4ECC A;  5HR3 A;  5CRD A;  1HQO A;  3TKS C;  4W66 A;  2FWH A;  2GZZ A;  2WVX B;  1ZYQ B;  1TI1 A;  5AIX A;  4ZBD A;  2PUK C;  1GSF A;  4OWY A;  2DJK A;  4FQU A;  1ERU A;  1X9S B;  1WE0 A;  5CRW A;  3ZZX A;  2A2S A;  1TRU A;  5CAX A;  3F8U A;  5ECS A;  1YEW C;  4WBJ A;  1YF1 A;  1DE2 A;  2RUF A;  2F51 A;  4PNG A;  2OE1 A;  2MZC A;  2ZUP A;  2B6M A;  1FG4 A;  2IWT A;  2OJL A;  5IMV A;  2HFD A;  3GSS A;  4MNN A;  4WR5 A;  1SU9 A;  4NWY A;  2OAD A;  2WB9 A;  2M80 A;  1Z7R A;  5ECL B;  5BMU A;  5ELG A;  5IMD A;  4MA9 A;  1SJZ A;  4J57 E;  5GAN D;  2L5O A;  2E2G A;  3MYD A;  2F9S A;  4BL7 A;  2DJ0 A;  5G5F A;  3TRQ A;  5CO3 A;  3F63 A;  2H74 A;  3O3T A;  2HZE A;  2JAC A;  2DJ2 A;  3G7I A;  4MH3 A;  2X49 A;  4EF0 A;  3HJO A;  3CSI A;  2WJU A;  2VL2 C;  4FO5 A;  5H5Q A;  2LQO A;  3EU3 A;  3ME7 A;  1TRV A;  3O6T A;  3VK9 A;  2H0I A;  5A5H A;  1AUC A;  2RM6 A;  1ZOF A;  3HCZ A;  3MSZ A;  1Y6E A;  4TR4 A;  1Z3E A;  4X43 A;  4G0I A;  2DC5 A;  1X0R A;  5C00 A;  5FWG A;  1GTB A;  1GP1 A;  1USB A;  2DJ1 A;  2WFC A;  2VUP A;  2VD0 A;  3KM6 A;  2DMM A;  1NSW A;  4KB3 A;  1K0N A;  4YQM A;  4HZ4 A;  4GXZ A;  2JAD A;  1B9Y C;  2X8C A;  3J7Y b;  2N5A A;  3EWL A;  3QR6 A;  4CDO A;  2FWG A;  11GS A;  2HLS A;  3M3M A;  3KH9 A;  1TK0 B;  1FB0 A;  2HSH A;  1GLP A;  2NDO A;  4XS1 A;  4MPF A;  2B7K A;  4PGT A;  2VL9 A;  3Q18 A;  4MCU A;  5JWR B;  1ZYN A;  3D4T A;  5G1K A;  1Y25 A;  4QL9 A;  4HOJ A;  3L78 A;  4XTS A;  1QMV A;  4IN0 A;  4AI6 A;  2H6X A;  4BWQ A;  4ZB9 A;  2I3Y A;  3CXG A;  5IO2 A;  2V6K A;  4PQI A;  4K6X A;  1T3B A;  3FW2 A;  4YQV A;  1XW5 A;  4HZ2 A;  1R4W A;  4ZBA A;  2O7K A;  3UAR A;  1JZO A;  2GQK A;  4G10 A;  5D9W A;  3D22 A;  2VCV A;  2H1B A;  4ML6 A;  3KEB A;  3ERW A;  3HA9 A;  5ECR B;  5E59 A;  2C8U A;  2ES7 A;  1XVQ A;  4MZC A;  2VLU A;  2CX3 A;  5B7C A;  2M72 A;  5FHI A;  1K3O A;  4K1F A;  5A34 B;  3BOA A;  2EFD A;  5BRT A;  5CRG A;  1V58 A;  1PD2 1;  5JWO B;  3UAP A;  3F4S A;  1I1I P;  3IAM 2;  1ZCP A;  4OFT A;  1XOB A;  3WT2 A;  2F3M A;  1C72 A;  5J4Y A;  1THO A;  2OAC A;  4DVC A;  1X9M B;  3TCO A;  10GS A;  1SK0 A;  4D73 B;  1Z7P A;  5ENU A;  3DGQ A;  3WT1 A;  3DVX A;  5IOX A;  4I2U A;  2WRT A;  5B8B A;  3PH9 A;  5F0G A;  4N0Z A;  2R3X A;  2WW3 A;  2GSR A;  5DAK A;  3VUR A;  5F8B A;  2HI7 A;  3HZ8 A;  2LRT A;  4F82 A;  2WW1 A;  1DUG A;  2PPT A;  3UL3 A;  1BED A;  2L6D A;  1O6J A;  2HNL A;  1EGR A;  4HEA 2;  2BMX A;  2WVY A;  1XXU A;  1CQG A;  1GUK A;  3LFL A;  2YWM A;  2KUC A;  3BBY A;  2QGV A;  4HJM A;  1A2L A;  1GUH A;  3L4N A;  5IMC A;  1A0R P;  4DSR A;  3KZQ A;  1IYH A;  5KOX A;  3UOM A;  3GH9 A;  2JSY A;  2RUE A;  2J23 A;  5IQY A;  3APQ A;  4TXO A;  1WPI A;  1TRS A;  5A4V A;  2P0G A;  2LNT A;  1G0T A;  2JZT A;  5KN1 A;  2EFH A;  3QPM A;  3OR5 A;  3L0H A;  1X9W B;  4ZBB A;  1O73 A;  4ZL9 A;  2AB6 A;  1GRX A;  2B3S A;  3IXR A;  1S4B P;  1TU8 A;  2VM1 A;  3DYR A;  3UJ1 A;  4JBB A;  3C1S A;  3H79 A;  2LJA A;  4K7I A;  3DML A;  2P5Q A;  2ON7 A;  5IO0 A;  4ILF A;  3GL5 A;  4N3Z A;  4L5O A;  3KP8 A;  2DSA A;  3FY7 A;  1O8W A;  2XHF A;  1OKT A;  4DSQ A;  3L9V A;  4NHW A;  3FR6 A;  4LMW A;  3SWL A;  1DSB A;  4GCI A;  4MK3 A;  2L59 A;  4E68 A;  3ZRD A;  3E9J B;  4K9Z A;  4O32 A;  3ZFL A;  1YKA A;  4PUF C;  1NM3 A;  4LA1 A;  1EOG A;  5J47 A;  4GWR A;  5D9X A;  4K5R A;  1VF2 A;  3F9U A;  1PKW A;  3CYN A;  3QAW A;  2K8V A;  3RGB C;  1MTC A;  3ZVJ A;  1PX6 A;  1SD9 A;  4PUR A;  1W4V A;  2GLR A;  2AYT A;  4Z2U A;  2BJX A;  2EFC A;  1O85 A;  3H4K A;  3P90 A;  2L5L A;  3GST A;  1U3A A;  1KNG A;  1EP7 A;  1EP8 A;  1K0O A;  3LYK A;  4Q5R A;  2E0Q A;  4XRA A;  4RQX A;  5AIV A;  4PXO A;  2BTO T;  4YAP A;  1VF4 A;  3C73 A;  3IK9 A;  3ZRE A;  3AY8 A;  1DBY A;  3LSZ A;  5ELA A;  3HVS A;  3TRP A;  2YWO A;  3EVI A;  4O7H A;  4OO4 A;  1GTA A;  3IC4 A;  3GUS A;  1R5A A;  2R6K A;  2WGR A;  5IPG A;  2GQL A;  3G7Y A;  3I9V 2;  2JZS A;  2FY6 A;  1QK8 A;  1RK4 A;  4GRF A;  3TKQ A;  1ZZY A;  3TKS A;  2DIZ A;  4K2D A;  3DEX A;  5D93 A;  2AJQ B;  1M0U A;  2GT6 A;  5JCW A;  1VF1 A;  1B8X A;  4G19 A;  4KSO A;  1HNA A;  2TIR A;  3LWA A;  2H1L A;  4MAB A;  2GZY A;  4IJI A;  3TOU A;  4WBR D;  3UVT A;  4ECI A;  2H75 A;  4IKH A;  2C4J A;  2C0E A;  5J3R A;  2KHP A;  1T00 A;  9GSS A;  1XFL A;  2HSN B;  4KE3 A;  2WS2 A;  5DCG A;  2C1Y A;  4ISD A;  5J9C A;  1N25 A;  2A2P A;  3PGT A;  5ECQ B;  5F06 A;  5EY6 A;  2ZNM A;  2R4V A;  3DIE A;  2HT9 A;  2JL4 A;  5DJM A;  2LRN A;  4MF6 A;  2ON5 A;  1ZL9 A;  3APS A;  2GTU A;  12GS A;  5IM9 A;  2LTK A;  2C80 A;  1Z6N A;  2ALB A;  3BCK A;  4FYB A;  5CYY A;  2B1L A;  2IMI A;  5EL8 A;  1XG8 A;  1XVW A;  1T1V A;  1X5D A;  3GN3 A;  2O8V B;  4ZB7 A;  2VCQ A;  2VL2 A;  2VLV A;  2CQ9 A;  2HRK B;  4E8E A;  5ECN B;  3FR3 A;  5ECI B;  4MF5 A;  2X8G A;  1F3B A;  1TTZ A;  3A5I A;  4NHZ A;  1IYI A;  3BJ5 A;  4KF9 A;  1R26 A;  3HXS A;  2GT5 A;  3CSJ A;  5H5R A;  1AC1 A;  4POM A;  2H19 A;  3RAZ A;  2PGT A;  5J41 A;  1FHE A;  2G2Q A;  3GHA A;  4FYC A;  4KCA A;  1F6M C;  2C3T A;  5CNW A;  2IMF A;  1OAZ A;  2HRN A;  4POL A;  2V1M A;  4I5Q A;  4BVY B;  3QFB C;  3PIN A;  1XCC A;  4IP6 A;  1LU4 A;  4ZB8 A;  1WP0 A;  4OO5 A;  4PX1 A;  1ST9 A;  4K5S A;  1Q4J A;  3GL3 A;  3ZMK A;  5DCH A;  1TDI A;  1HYU A;  3ERG A;  1PX7 A;  3CHX C;  5EPF A;  1M9B A;  2H73 A;  1OC8 A;  1PSQ A;  1FVK A;  3HY2 A;  3GX8 A;  4O5Q A;  2O87 A;  1SJ6 A;  1N8J A;  3LEF A;  4KW6 A;  2MYG A;  4D73 A;  2K8S A;  2CT6 A;  5A5K A;  4OD7 A;  4ECJ A;  3N9J A;  4TR1 B;  3A5W A;  6GSY A;  4AKX B;  1XWG A;  3FZA A;  4JE1 A;  3M1G A;  1G6W A;  1GLQ A;  3I69 A;  4L0U A;  1PMT A;  4NMU A;  3Q6O A;  3UBL A;  1CQH A;  2KLX A;  2QKE A;  3A2X A;  3G9B A;  3UMA A;  2QA2 A;  2PMT A;  3RHB A;  2RM5 A;  4CHS A;  5B8A A;  1Z6M A;  1M9A A;  3M0F A;  2PER A;  2C0G A;  3W6G A;  2H0H A;  2IFQ B;  5G30 A;  5B6N A;  3FKF A;  2H70 A;  2YAN A;  2UZ8 A;  4LMV A;  2VM2 A;  2LJK A;  4EUY A;  2X64 A;  1V2A A;  2O3E A;  4FH8 A;  3W8S A;  1OC9 B;  2FA8 A;  1ZGN A;  5ECP B;  1SL1 B;  2VIM A;  3P2A A;  3H8Q A;  1A24 A;  1Q98 A;  4AF2 A;  4PI0 C;  4GSS A;  4AKH A;  2V2G A;  1B48 A;  4PUA A;  4XRD A;  4EL1 A;  1GSQ A;  3HVX A;  1GTI A;  5IMZ A;  1VF3 A;  3QMX A;  1B4Q A;  2IME A;  1EOH A;  5ECK B;  3NZN A;  3RHC A;  3TGZ A;  4FXY P;  1S3C A;  5ID2 B;  2HSM B;  2DKI A;  2CZ2 A;  2E2M A;  2WUL A;  4HQS A;  3CMI A;  1R5P A;  1NW2 A;  5FT3 A;  5DDL A;  4KDU A;  4F2I A;  1W89 A;  1YEP A;  4BPY A;  5HFK A;  3DRN A;  2FUG 2;  4KAE A;  1URM A;  4LL4 B;  2FLS A;  5LNK e;  3TJK A;  5AGY A;  4KDY A;  4JR6 A;  2PVO C;  4RUV A;  1PA3 A;  1A23 A;  4V2N A;  4HDE A;  1G6Y A;  3LXT A;  5D8I A;  3ISO A;  2M46 A;  1K0D A;  5A1N B;  6GSW A;  2L57 A;  1UC7 A;  3HVV A;  1SJI A;  5ECO B;  5G1L A;  4YQU A;  1TW9 A;  4EE0 A;  1EZK A;  2A4H A;  1Z5Y E;  2NPB A;  3D4M A;  4O5U A;  1TK5 B;  1AQW A;  4Q5Q A;  1GSS A;  4I97 A;  1SKR B;  3QFA C;  4POB A;  1OE7 A;  2H1A A;  2RLI A;  4EDY A;  3D6I A;  2CV4 A;  4HQZ A;  4L0W A;  2GDR A;  4MMM A;  2YJH A;  5F07 A;  2FD3 A;  1XW6 A;  4Q5N A;  5G5E A;  4P3Y B;  4CY6 A;  1BX9 A;  3P7X A;  4GLT A;  5H5S A;  1MDJ A;  1SYX A;  3HD5 A;  2KP2 A;  3TKP A;  4WKW A;  3EMP A;  1EGO A;  3GKX A;  1OYJ A;  3FZ5 A;  5AIS A;  4PHZ C;  3IR4 A;  7GSS A;  1SVM A;  1YY7 A;  1A8L A;  1SEN A;  4LLR A;  3TOT A;  1GTU A;  3TUE A;  5ECM B;  5CRH A;  3P8W A;  4MPG A;  2GQM A;  3Q74 A;  3D5J A;  2WW2 A;  2MMZ A;  3EUR A;  5J4U A;  2EIO A;  1YEX A;  2LNS A;  3R3E A;  3BCI A;  4NV5 A;  4ACS A;  2HSN A;  4N0V A;  1G7O A; 
#chains in the Genus database with same CATH homology
 4XHM A;  3FRC A;  3ME8 A;  4EC0 A;  3UIW A;  4MLY A;  3FZ9 A;  2IMK A;  4PNF A;  1EV9 A;  3HMJ G;  4QQ7 A;  1GSY A;  2TRX A;  3FZ4 A;  2J9H A;  3TU3 B;  3HJP A;  3TJF A;  3KJY A;  2EFE A;  2GGT A;  3HZ4 A;  1FVJ A;  1BJX A;  3V1W A;  1SKS B;  5KOW A;  4MJA A;  2OBK A;  3TJG A;  2VCX A;  2B7J A;  2L4C A;  1TOF A;  3C7M A;  1ERW A;  3L9U A;  4F9Z A;  1GUL A;  1QXH A;  3A2W A;  2HRK A;  2IIY A;  1H4O A;  4NAX A;  3LJR A;  17GS A;  1EEJ A;  4WXT A;  2GST A;  4V2L A;  4N10 A;  4WF4 A;  8GSS A;  5A4W A;  2C0F A;  4WF5 A;  4NXI A;  4KDX A;  3F0I A;  5KN3 A;  1EEM A;  4XIH A;  2VCW A;  2R0G A;  4OMV A;  2I81 A;  2OKA A;  1QQ2 A;  3IE3 A;  2YPM A;  5CRE A;  1M2A A;  2RII A;  4BVY A;  1WMJ A;  4TR3 A;  2H6Z A;  5ECH B;  2R2J A;  4HU7 A;  4ZIL A;  4LL1 B;  4WET A;  3MWH A;  5J4V A;  1JZR A;  1THX A;  1M2B A;  4V1A p;  4KND A;  4ID0 A;  5L71 A;  3FEU A;  1LBK A;  1K0M A;  1BG5 A;  3M9J A;  1K0A A;  1N2A A;  4BVX B;  4ZL7 A;  2PWJ A;  1WOU A;  4IBP A;  3FMW A;  2XPD A;  1AIU A;  3GA4 A;  2F8A A;  4IW9 A;  2AAW A;  18GS A;  2EC4 A;  1YVL A;  3VI7 A;  4QMK A;  4USS A;  5KN2 A;  1F9M A;  5HFI A;  3EC3 A;  1GWC A;  4TR1 A;  1MD4 A;  4BA7 A;  5KN0 A;  2P31 A;  4KA0 A;  3ZFB A;  3GKN A;  2H01 A;  3C71 A;  3L9S A;  4TR0 A;  2H72 A;  1V40 A;  3F6D A;  4DSS B;  5LCZ A;  2JZR A;  16GS A;  1XWA A;  3GH6 A;  3M9K A;  2CVK A;  1YDK A;  3LG6 A;  2GSQ A;  2PVQ A;  2H1G A;  4MZB A;  5DAL B;  4POK A;  1GL8 A;  4GQC A;  1ERT A;  4EO3 A;  3VPT A;  5ABR A;  2IFQ A;  3IK7 A;  4F0C A;  5J9B A;  4O92 A;  4IVF A;  3DWV A;  3EMX A;  4ZL8 A;  3ED3 A;  2YNX A;  1UVZ A;  2MMN A;  5DVB A;  4Z2R A;  1A2M A;  1OC9 A;  1FOH A;  3IRA A;  1PRX A;  2H30 A;  2B5Y A;  3LXZ A;  2KOK A;  3VWW A;  1SYR A;  4EVM A;  4L5L A;  2R0P A;  4QL7 A;  2LS5 A;  2XPE A;  2FNO A;  4E8H A;  1WWJ A;  4PQH A;  3WGE A;  2HQT A;  1UN2 A;  5G2Z A;  4RI7 A;  2ZCT A;  3VI5 A;  4RI6 A;  1PN9 A;  1X5C A;  5HFG A;  5DQS A;  3ZVJ D;  3M8N A;  5ID2 A;  4OFN A;  2HSM A;  5J40 A;  1UA5 A;  5DBQ A;  5EVO A;  1PL2 A;  4AJ6 A;  5GZZ B;  2XC2 A;  2YZH A;  3APO A;  4I8B A;  3GYK A;  1J9B A;  1ERV A;  1TP9 A;  3ZML A;  4PTS A;  2CAQ A;  4AKI A;  4HI7 A;  3QCP A;  4AJ7 A;  2NVL A;  1XIY A;  1SL0 B;  3KIJ A;  5A1N A;  4YKG A;  1QUW A;  3FHK A;  1JFU A;  4TW5 A;  13GS A;  3F6F A;  3I6A A;  5COH A;  3US3 A;  2DIY A;  3ZL5 A;  1TI3 A;  4Q5F A;  1ABA A;  2GSS A;  2PU9 C;  4XCS A;  2LV3 A;  6GST A;  2VOC A;  1OVN A;  1SK1 A;  1XW9 A;  4K7O A;  4KH7 A;  3C1R A;  2DBC A;  2REM A;  2H71 A;  3C8E A;  1PN0 A;  1AW9 A;  4N11 A;  1TXX A;  1JLW A;  1HNC A;  3GKK A;  1OC3 A;  3VLN A;  3QD9 A;  3R2Q A;  4XS4 B;  2H0G A;  1PQN A;  1AQX A;  2OT3 A;  3QDN A;  3DXB A;  3IHQ A;  2XBI A;  2TRC P;  3WD6 A;  1BYE A;  2B5X A;  1GNE A;  4HUA A;  5A34 A;  2R0C A;  2L4Q A;  1U6T A;  5LD0 A;  4ECB A;  3NIV A;  3GIX A;  5GST A;  3KCM A;  6GSV A;  3UVH A;  4EIQ A;  2I1U A;  3CWG A;  3I43 A;  3ZIJ A;  3RBT A;  5HR1 A;  3D21 A;  4MDC A;  3HJM A;  4Z2T A;  2IMD A;  3GV1 A;  2A2R A;  3KMN A;  1KBN A;  4MJC A;  2MMO A;  4X4J A;  3RPP A;  3H1N A;  2OE0 A;  4G0L A;  1S3A A;  4YKF A;  4NV2 A;  2DKH A;  1M7T A;  2P5R A;  4GQF A;  1FOV A;  3E3E A;  3TDG A;  4IQA A;  4TOP A;  3QAV A;  2VKZ G;  1E6B A;  3KTL A;  5JCU A;  3FYG A;  2YV7 A;  2WDU A;  5IMF A;  3GTU B;  4RQR A;  2H8L A;  5E4W A;  1FAA A;  4F0B A;  3IAS 2;  2C0D A;  4IEL A;  1T7P B;  4ZXG A;  1HNB A;  2FWE A;  1U3I A;  2HRF A;  4TXV A;  4V2M A;  1A2J A;  2H66 A;  1ILO A;  1SK2 A;  2IJY A;  4Z7X A;  1SVO A;  3N5O A;  1X5E A;  3F3Q A;  3IDV A;  1BQ7 A;  2DJ3 A;  2DLX A;  2GS3 A;  3GNJ A;  2IPA A;  4XS6 A;  3TJJ A;  3ERF A;  4O5R A;  2FCH A;  4G9H A;  2V32 A;  1F37 A;  3DKS A;  2QC7 A;  5GSS A;  3A3T A;  1K3Y A;  1XZO A;  2B1K A;  2MMA A;  3HHV A;  2MBS A;  1AQV A;  4IS0 A;  2NTO A;  2AUV A;  5GAP D;  2VCT A;  3CRT A;  2MBT A;  3KMO A;  3MDK A;  1EWX A;  5JWQ B;  3EYT A;  2YWN A;  2VL3 A;  3E0U A;  2LJR A;  1SL2 B;  5HQP A;  2YZU A;  5HR0 A;  5IIZ A;  5JCG A;  4BVX A;  2R5G A;  1J0F A;  3CRU A;  4IQ1 A;  3GX0 A;  2O85 A;  1MEK A;  3LGC A;  1GSE A;  2PN8 A;  3W8J A;  1B4P A;  4G01 A;  3GMF A;  4ML1 A;  1R7H A;  4KSM A;  2HYX A;  4J56 E;  5B6M A;  4PQ1 A;  4KCE A;  4TVE A;  3CSH A;  4KUN A;  2PBJ A;  3IHG A;  2YJ7 A;  1FW1 A;  4OCE A;  2YOI A;  2O89 A;  1TK8 B;  2LRC A;  3MIX A;  2R37 A;  2KP1 A;  4DSS A;  1V9W A;  3DD3 A;  2A4V A;  3F4T A;  2IL3 A;  3F4R A;  3KTB A;  3D0Z A;  5D9V A;  4MF7 A;  1Z9H A;  4WR4 A;  5DAL A;  1WIK A;  4YAV A;  5D9T A;  6GSU A;  1HD2 A;  3IC8 A;  2LQQ A;  4K2X A;  1TU7 A;  1YKC A;  5D96 A;  4A5P A;  1KTE A;  4CW9 A;  1OKD A;  2OA7 A;  2HSY A;  1ZYP A;  4IGJ A;  2UV8 G;  3WGX A;  3TKR A;  1J08 A;  1BG1 A;  3DVW A;  2G0F A;  1PL1 A;  4HU9 A;  3SBC A;  1ML6 A;  1KEB A;  2XBQ A;  20GS A;  1TJD A;  2YP6 A;  1TKD B;  5J5N A;  1K3L A;  2JSZ A;  2QA1 A;  3GRX A;  1MD3 A;  4OFM A;  3VFI A;  4K0N A;  3FK8 A;  4GSN A;  3A2V A;  3H93 A;  1AXD A;  2I4A A;  2HE3 A;  4F03 A;  5IMA A;  2VO4 A;  4K8M A;  1B9X C;  3ZIV A;  1A0F A;  1FO5 A;  4FIW A;  2YWI A;  2LKU A;  1RW1 A;  1Y1U A;  2X8H A;  2WCI A;  3G7J A;  3O76 A;  3VWV A;  3F3R A;  1XWC A;  3KGK A;  4JED A;  2CZ3 A;  1NHO A;  6GSS A;  3WGD A;  4GTU A;  1DE1 A;  22GS A;  1V98 A;  2L6C A;  5BMU B;  4V1A g;  1A8Y A;  2B5E A;  4BL7 B;  3GUR A;  3EPT A;  3QAG A;  4NPB A;  1JZD A;  1AAZ A;  1WRY A;  2VLT A;  4CY8 A;  3EE2 A;  5C04 A;  3LOR A;  1XWB A;  2HZE B;  2H1D A;  5F05 A;  2Z9S A;  1LJR A;  3BD2 A;  2VD1 A;  1ON4 A;  19GS A;  4J2F A;  1WJK A;  2HZF A;  14GS A;  1PGT A;  3FR9 A;  4TRX A;  2QSI A;  4GDF A;  4MH2 A;  4XS4 A;  1GUM A;  3KXO A;  5A5H B;  2VAF A;  3MNG A;  1GH2 A;  6GSX A;  2F8F A;  1QFN A;  1VRS D;  3RDW A;  5KEJ A;  1T4Z A;  2IN3 A;  4IP1 A;  3VPQ A;  2CAI A;  1OE8 A;  5IPH A;  5DJL A;  3HYP A;  2HXK A;  2EIR A;  4ICY A;  2JU5 A;  1SKW B;  1V57 A;  2HRA A;  4ULX A;  3PR8 A;  2C3Q A;  3VWU A;  1GSU A;  4HJ2 A;  2H76 A;  1U87 A;  2K9F A;  3NOF A;  2CA8 A;  3QOU A;  3KD0 A;  1XBS A;  3U5R E;  3GKM A;  4ZB6 A;  4EXJ A;  1M99 A;  4MP4 A;  3RPN A;  1I9D A;  2CX4 A;  3EIN A;  1YZX A;  1JLV A;  5IOW A;  4GF0 A;  4OCF A;  4MJB A;  3GTU A;  4G2E A;  4WEY A;  2V6O A;  1YJ6 A;  1YQ1 A;  4JZQ A;  4JR4 A;  2D2Z A;  4EIP A;  2YCD A;  1BAY A;  4IJ3 A;  4EDZ A;  2OBI A;  1TRW A;  1SVL A;  5G31 A;  3WYW A;  4N30 A;  2YV9 A;  4DEJ A;  1JZW A;  1U88 A;  5D73 A;  4TN8 A;  4TKY A;  1YF0 A;  4L8E A;  3IPZ A;  4MZW A;  5DQY A;  1F3A A;  1H75 A;  2CVD A;  2E7P A;  1ACV A;  4K0G A;  3HDC A;  3ZYW A;  3CTG A;  3ZLP A;  2OE3 A;  4JRR A;  3ZIT A;  4EKZ A;  5AN1 A;  4AKG A;  4AGS A;  3UBK A;  3TKS E;  1G7E A;  4FYU A;  1QGV A;  4JU5 A;  1O7U A;  2LST A;  1ZYE A;  3TB2 A;  1O8X A;  4ZIJ A;  4G0K A;  2CVB A;  2LUS A;  4KX4 A;  3VWX A;  1RQM A;  2I9H A;  1FB6 A;  3HKR A;  3ZTL A;  1PKZ A;  3TRX A;  5HR2 A;  1M2D A;  4H86 A;  1T8E B;  2GVP A;  3JCM L;  2FHE A;  5DAK B;  3EU4 A;  3LQ7 A;  5INY A;  1MDK A;  2V41 A;  3KP9 A;  1NHY A;  1GNW A;  5A4U A;  4AJ8 A;  3Q19 A;  2FWF A;  2X99 A;  3IBH A;  4IHU A;  1XOA A;  3KH7 A;  2H6Y A;  2K18 A;  2DJJ A;  5CP1 A;  2YN1 A;  1K0B A;  2C3N A;  4K7N A;  1XWK A;  3IA1 A;  1K0C A;  4X1U A;  1ZMA A;  4MJE A;  2WZ9 A;  2EIQ A;  3PPU A;  4I6X A;  4X0X A;  2N5B A;  1O81 A;  3MAK A;  3TJB A;  1EV4 A;  2AV4 A;  1XPV A;  2LEG A;  4BWS A;  2FA4 A;  2DML A;  2VCZ A;  4I2T A;  2AHE A;  3S9F A;  3K8N A;  4TXO B;  2FGX A;  3GFK A;  3LYP A;  1BF5 A;  2X4A A;  2GZP A;  3UEM A;  3U6V A;  3CTF A;  1I5G A;  3LW9 A;  1S3D A;  3IV4 A;  1MDI A;  1E2Y A;  4GST A;  3CBU A;  1JHB A;  2O5V A;  1GSD A;  1T4Y A;  1TXU A;  4KGI A;  3J7Y k;  1VGL A;  1F2E A;  4HS1 A;  3IOS A;  2NBS A;  1SD8 A;  2K6V A;  4YH2 A;  2N5F A;  4ECC A;  5HR3 A;  5CRD A;  1HQO A;  3TKS C;  4W66 A;  2FWH A;  2GZZ A;  1ZYQ B;  1TI1 A;  5AIX A;  4ZBD A;  2PUK C;  1GSF A;  4OWY A;  2DJK A;  4FQU A;  1ERU A;  1X9S B;  1WE0 A;  5CRW A;  3ZZX A;  2A2S A;  1TRU A;  5CAX A;  3F8U A;  5ECS A;  4WBJ A;  1YF1 A;  1DE2 A;  2RUF A;  2F51 A;  4PNG A;  2OE1 A;  2MZC A;  2ZUP A;  2B6M A;  1FG4 A;  2IWT A;  2OJL A;  5IMV A;  2HFD A;  3GSS A;  4MNN A;  4WR5 A;  1SU9 A;  4NWY A;  2OAD A;  2WB9 A;  2M80 A;  1Z7R A;  5ECL B;  5BMU A;  5ELG A;  5IMD A;  4MA9 A;  1SJZ A;  4J57 E;  5GAN D;  2L5O A;  2E2G A;  3MYD A;  2F9S A;  4BL7 A;  2DJ0 A;  5G5F A;  3TRQ A;  5CO3 A;  3F63 A;  2H74 A;  3O3T A;  2HZE A;  2JAC A;  2DJ2 A;  3G7I A;  4MH3 A;  2X49 A;  4EF0 A;  3HJO A;  3CSI A;  2WJU A;  2VL2 C;  4FO5 A;  5H5Q A;  2LQO A;  3EU3 A;  3ME7 A;  1TRV A;  3O6T A;  3VK9 A;  2H0I A;  5A5H A;  1AUC A;  2RM6 A;  1ZOF A;  3HCZ A;  3MSZ A;  1Y6E A;  4TR4 A;  1Z3E A;  4X43 A;  4G0I A;  2DC5 A;  1X0R A;  5C00 A;  5FWG A;  1GTB A;  1GP1 A;  1USB A;  2DJ1 A;  2WFC A;  2VUP A;  2VD0 A;  3KM6 A;  2DMM A;  1NSW A;  4KB3 A;  1K0N A;  4YQM A;  4HZ4 A;  4GXZ A;  2JAD A;  1B9Y C;  2X8C A;  3J7Y b;  2N5A A;  3EWL A;  3QR6 A;  4CDO A;  2FWG A;  11GS A;  2HLS A;  3M3M A;  3KH9 A;  1TK0 B;  1FB0 A;  2HSH A;  1GLP A;  2NDO A;  4XS1 A;  4MPF A;  2B7K A;  4PGT A;  2VL9 A;  3Q18 A;  4MCU A;  5JWR B;  1ZYN A;  3D4T A;  5G1K A;  1Y25 A;  4QL9 A;  4HOJ A;  3L78 A;  4XTS A;  1QMV A;  4IN0 A;  4AI6 A;  2H6X A;  4BWQ A;  4ZB9 A;  2I3Y A;  3CXG A;  5IO2 A;  2V6K A;  4PQI A;  4K6X A;  1T3B A;  3FW2 A;  4YQV A;  1XW5 A;  4HZ2 A;  1R4W A;  4ZBA A;  2O7K A;  3UAR A;  1JZO A;  2GQK A;  4G10 A;  5D9W A;  3D22 A;  2VCV A;  2H1B A;  4ML6 A;  3KEB A;  3ERW A;  3HA9 A;  5ECR B;  5E59 A;  2C8U A;  2ES7 A;  1XVQ A;  4MZC A;  2VLU A;  2CX3 A;  5B7C A;  2M72 A;  5FHI A;  1K3O A;  4K1F A;  5A34 B;  3BOA A;  2EFD A;  5BRT A;  5CRG A;  1V58 A;  1PD2 1;  5JWO B;  3UAP A;  3F4S A;  3IAM 2;  1ZCP A;  4OFT A;  1XOB A;  3WT2 A;  2F3M A;  1C72 A;  5J4Y A;  1THO A;  2OAC A;  4DVC A;  1X9M B;  3TCO A;  10GS A;  1SK0 A;  4D73 B;  1Z7P A;  5ENU A;  3DGQ A;  3WT1 A;  3DVX A;  5IOX A;  4I2U A;  2WRT A;  5B8B A;  3PH9 A;  5F0G A;  4N0Z A;  2R3X A;  2GSR A;  5DAK A;  3VUR A;  5F8B A;  2HI7 A;  3HZ8 A;  2LRT A;  4F82 A;  1DUG A;  2PPT A;  3UL3 A;  1BED A;  2L6D A;  1O6J A;  2HNL A;  1EGR A;  4HEA 2;  2BMX A;  1XXU A;  1CQG A;  1GUK A;  3LFL A;  2YWM A;  2KUC A;  3BBY A;  2QGV A;  4HJM A;  1A2L A;  1GUH A;  3L4N A;  5IMC A;  1A0R P;  4DSR A;  3KZQ A;  1IYH A;  5KOX A;  3UOM A;  3GH9 A;  2JSY A;  2RUE A;  2J23 A;  5IQY A;  3APQ A;  4TXO A;  1WPI A;  1TRS A;  5A4V A;  2P0G A;  2LNT A;  1G0T A;  2JZT A;  5KN1 A;  2EFH A;  3QPM A;  3OR5 A;  3L0H A;  1X9W B;  4ZBB A;  1O73 A;  4ZL9 A;  2AB6 A;  1GRX A;  2B3S A;  3IXR A;  1TU8 A;  2VM1 A;  3DYR A;  3UJ1 A;  4JBB A;  3C1S A;  3H79 A;  2LJA A;  4K7I A;  3DML A;  2P5Q A;  2ON7 A;  5IO0 A;  4ILF A;  3GL5 A;  4N3Z A;  4L5O A;  3KP8 A;  2DSA A;  3FY7 A;  1O8W A;  2XHF A;  1OKT A;  4DSQ A;  3L9V A;  4NHW A;  3FR6 A;  4LMW A;  3SWL A;  1DSB A;  4GCI A;  4MK3 A;  2L59 A;  4E68 A;  3ZRD A;  3E9J B;  4K9Z A;  4O32 A;  3ZFL A;  1YKA A;  4PUF C;  1NM3 A;  4LA1 A;  1EOG A;  5J47 A;  4GWR A;  5D9X A;  4K5R A;  1VF2 A;  3F9U A;  1PKW A;  3CYN A;  3QAW A;  2K8V A;  1MTC A;  3ZVJ A;  1PX6 A;  1SD9 A;  4PUR A;  1W4V A;  2GLR A;  2AYT A;  4Z2U A;  2BJX A;  2EFC A;  1O85 A;  3H4K A;  3P90 A;  2L5L A;  3GST A;  1U3A A;  1KNG A;  1EP7 A;  1EP8 A;  1K0O A;  3LYK A;  4Q5R A;  2E0Q A;  4XRA A;  4RQX A;  5AIV A;  4PXO A;  2BTO T;  4YAP A;  1VF4 A;  3C73 A;  3IK9 A;  3ZRE A;  3AY8 A;  1DBY A;  3LSZ A;  5ELA A;  3HVS A;  3TRP A;  2YWO A;  3EVI A;  4O7H A;  4OO4 A;  1GTA A;  3IC4 A;  3GUS A;  1R5A A;  2R6K A;  2WGR A;  5IPG A;  2GQL A;  3G7Y A;  3I9V 2;  2JZS A;  2FY6 A;  1QK8 A;  1RK4 A;  4GRF A;  3TKQ A;  1ZZY A;  3TKS A;  2DIZ A;  4K2D A;  3DEX A;  5D93 A;  2AJQ B;  1M0U A;  2GT6 A;  5JCW A;  1VF1 A;  1B8X A;  4G19 A;  4KSO A;  1HNA A;  2TIR A;  3LWA A;  2H1L A;  4MAB A;  2GZY A;  4IJI A;  3TOU A;  4WBR D;  3UVT A;  4ECI A;  2H75 A;  4IKH A;  2C4J A;  2C0E A;  5J3R A;  2KHP A;  1T00 A;  9GSS A;  1XFL A;  2HSN B;  4KE3 A;  2WS2 A;  5DCG A;  2C1Y A;  4ISD A;  5J9C A;  1N25 A;  2A2P A;  3PGT A;  5ECQ B;  5F06 A;  5EY6 A;  2ZNM A;  2R4V A;  3DIE A;  2HT9 A;  2JL4 A;  5DJM A;  2LRN A;  4MF6 A;  2ON5 A;  1ZL9 A;  3APS A;  2GTU A;  12GS A;  5IM9 A;  2LTK A;  2C80 A;  1Z6N A;  2ALB A;  3BCK A;  4FYB A;  5CYY A;  2B1L A;  2IMI A;  5EL8 A;  1XVW A;  1T1V A;  1X5D A;  3GN3 A;  2O8V B;  4ZB7 A;  2VCQ A;  2VL2 A;  2VLV A;  2CQ9 A;  2HRK B;  4E8E A;  5ECN B;  3FR3 A;  5ECI B;  4MF5 A;  2X8G A;  1F3B A;  1TTZ A;  3A5I A;  4NHZ A;  1IYI A;  3BJ5 A;  4KF9 A;  1R26 A;  3HXS A;  2GT5 A;  3CSJ A;  5H5R A;  1AC1 A;  4POM A;  2H19 A;  3RAZ A;  2PGT A;  5J41 A;  1FHE A;  2G2Q A;  3GHA A;  4FYC A;  4KCA A;  1F6M C;  2C3T A;  5CNW A;  2IMF A;  1OAZ A;  2HRN A;  4POL A;  2V1M A;  4I5Q A;  4BVY B;  3QFB C;  3PIN A;  1XCC A;  4IP6 A;  1LU4 A;  4ZB8 A;  1WP0 A;  4OO5 A;  4PX1 A;  1ST9 A;  4K5S A;  1Q4J A;  3GL3 A;  3ZMK A;  5DCH A;  1TDI A;  1HYU A;  3ERG A;  1PX7 A;  5EPF A;  1M9B A;  2H73 A;  1OC8 A;  1PSQ A;  1FVK A;  3HY2 A;  3GX8 A;  4O5Q A;  2O87 A;  1SJ6 A;  1N8J A;  3LEF A;  4KW6 A;  2MYG A;  4D73 A;  2K8S A;  2CT6 A;  5A5K A;  4OD7 A;  4ECJ A;  3N9J A;  4TR1 B;  3A5W A;  6GSY A;  4AKX B;  1XWG A;  3FZA A;  4JE1 A;  3M1G A;  1G6W A;  1GLQ A;  3I69 A;  4L0U A;  1PMT A;  4NMU A;  3Q6O A;  3UBL A;  1CQH A;  2KLX A;  2QKE A;  3A2X A;  3G9B A;  3UMA A;  2QA2 A;  2PMT A;  3RHB A;  2RM5 A;  4CHS A;  5B8A A;  1Z6M A;  1M9A A;  3M0F A;  2PER A;  2C0G A;  3W6G A;  2H0H A;  2IFQ B;  5G30 A;  5B6N A;  3FKF A;  2H70 A;  2YAN A;  2UZ8 A;  4LMV A;  2VM2 A;  2LJK A;  4EUY A;  2X64 A;  1V2A A;  4FH8 A;  3W8S A;  1OC9 B;  2FA8 A;  1ZGN A;  5ECP B;  1SL1 B;  2VIM A;  3P2A A;  3H8Q A;  1A24 A;  1Q98 A;  4AF2 A;  4GSS A;  4AKH A;  2V2G A;  1B48 A;  4PUA A;  4XRD A;  4EL1 A;  1GSQ A;  3HVX A;  1GTI A;  5IMZ A;  1VF3 A;  3QMX A;  1B4Q A;  2IME A;  1EOH A;  5ECK B;  3NZN A;  3RHC A;  3TGZ A;  5ID2 B;  1S3C A;  2HSM B;  2DKI A;  2CZ2 A;  2E2M A;  2WUL A;  4HQS A;  3CMI A;  1R5P A;  1NW2 A;  5FT3 A;  5DDL A;  4KDU A;  4F2I A;  1W89 A;  1YEP A;  4BPY A;  5HFK A;  3DRN A;  2FUG 2;  4KAE A;  1URM A;  4LL4 B;  2FLS A;  5LNK e;  3TJK A;  5AGY A;  4KDY A;  4JR6 A;  2PVO C;  4RUV A;  1PA3 A;  1A23 A;  4V2N A;  4HDE A;  1G6Y A;  3LXT A;  5D8I A;  3ISO A;  2M46 A;  1K0D A;  5A1N B;  6GSW A;  2L57 A;  1UC7 A;  3HVV A;  1SJI A;  5ECO B;  5G1L A;  4YQU A;  1TW9 A;  4EE0 A;  1EZK A;  2A4H A;  1Z5Y E;  2NPB A;  3D4M A;  4O5U A;  1TK5 B;  1AQW A;  4Q5Q A;  1GSS A;  4I97 A;  1SKR B;  3QFA C;  4POB A;  1OE7 A;  2H1A A;  2RLI A;  4EDY A;  3D6I A;  2CV4 A;  4HQZ A;  4L0W A;  2GDR A;  4MMM A;  2YJH A;  5F07 A;  2FD3 A;  1XW6 A;  4Q5N A;  5G5E A;  4P3Y B;  4CY6 A;  1BX9 A;  3P7X A;  4GLT A;  5H5S A;  1MDJ A;  1SYX A;  3HD5 A;  2KP2 A;  3TKP A;  4WKW A;  3EMP A;  1EGO A;  3GKX A;  1OYJ A;  3FZ5 A;  5AIS A;  3IR4 A;  7GSS A;  1SVM A;  1YY7 A;  1A8L A;  1SEN A;  4LLR A;  3TOT A;  1GTU A;  3TUE A;  5ECM B;  5CRH A;  3P8W A;  4MPG A;  2GQM A;  3Q74 A;  3D5J A;  2MMZ A;  3EUR A;  5J4U A;  2EIO A;  1YEX A;  2LNS A;  3R3E A;  3BCI A;  4NV5 A;  4ACS A;  2HSN A;  4N0V A;  1G7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...