5A34A

The crystal structure of the gst-like domains complex of eprs-aimp2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
168
structure length
168
Chain Sequence
b'TLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSCDSFTSTINELNHCLSLRTYLVGNSLSLADLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title Assembly of Multi-tRNA Synthetase Complex Via Heterotetrameric Glutathione Transferase-Homology Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 54
structure length 168
sequence length 168
chains with identical sequence C, E, G
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a34A00
5A5HA 4AI6A 4ZB7A 5A5HB 4AKIA 4W66A 5A34A 5A1NA 5A34B 5A1NB 4AKGA 4AKHA 5BMUB
chains in the Genus database with same CATH superfamily
3DD3A 2VCZA 3DGQA 3G7JA 2WVXB 3RBTA 4G9HA 4ACSA 1K3YA 4ZBBA 3WD6A 1YY7A 2OT3A 1V2AA 3MAKA 4EDYA 5DJMA 3P8WA 3QAVA 4HI7A 3LYPA 1TU8A 3UAPA 3QAWA 2IMKA 1GUHA 5A5HA 4HJ2A 4W66A 5IQYA 4AGSA 3TOTA 1BG5A 4L8EA 4E8HA 3PGTA 1LBKA 5DCGA 4YQVA 3UBKA 1U87A 2GSSA 2C8UA 3RGBC 3ZFLA 4K0NA 1K3OA 4KGIA 1F3AA 2VCVA 4IBPA 6GSSA 2CAQA 2WW1A 4PUAA 3VURA 3VI7A 1OE8A 1EV9A 1HNBA 1PKWA 5LD0A 3TOUA 2VCXA 5J40A 4KSMA 5J41A 1GUKA 2WS2A 4JBBA 4GTUA 1USBA 2VCWA 3H1NA 5EVOA 2OADA 2HRKB 5JCUA 2GTUA 4MK3A 1K3LA 1EOHA 1AQVA 5DQSA 2C80A 1JLWA 2DSAA 5A4WA 2AHEA 2ON7A 1JZRA 4GDFA 3ZFBA 3EE2A 3KM6A 2GDRA 1BG1A 2PBJA 4KE3A 2LJRA 1GNEA 5F8BA 2IMIA 1PN9A 5BMUA 4L5LA 3ERGA 3FY7A 1YVLA 4IGJA 5LCZA 1AW9A 1LJRA 2IL3A 3VI5A 4ECJA 3R3EA 4FQUA 4K0GA 7GSSA 1FHEA 4KF9A 4BVXB 18GSA 4QMKA 4GF0A 5ECOB 3U6VA 2CZ2A 1HQOA 3FR3A 3GUSA 4MF6A 1ZGNA 1NHYA 2EFCA 5AIXA 1PMTA 4PTSA 5KEJA 1GSEA 5DAKA 4ECIA 4RI6A 3ERFA 4YQMA 4CHSA 1R5AA 1PD21 3LYKA 1XWKA 5GSSA 1PGTA 5AIVA 4WR5A 3VPQA 3GTUB 10GSA 4RI7A 2HQTA 2V6KA 1YDKA 3R2QA 4G10A 4KDYA 2HSMA 2WDUA 5A34B 4IQAA 3FRCA 1GTAA 3AY8A 4ECBA 2WVXA 3LG6A 1HNAA 1BYEA 2WVYA 6GSWA 1PX6A 3F63A 4YQUA 1GLQA 2HSNA 3FR9A 2H1LA 2VKZG 3PPUA 4Q5NA 4WR4A 1EV4A 1JLVA 1U3IA 4J2FA 4N0VA 1YJ6A 3CRUA 4ID0A 3WYWA 4KX4A 4IW9A 5FHIA 2JL4A 1SVLA 2R4VA 5A1NA 4OMVA 3NIVA 2CAIA 4OFMA 3CSJA 5ELGA 4AI6A 4ZBDA 4EE0A 5A4UA 3CRTA 3N5OA 3PR8A 1GULA 3EINA 1Y1UA 4KDUA 6GSTA 2R5GA 3ISOA 5JCWA 2OA7A 4GSNA 2PGTA 4NAXA 2O36A 1IYHA 5G5EA 1UA5A 4KH7A 4JEDA 4FXYP 1G6WA 1RK4A 3IK7A 1ZL9A 4Q5RA 1VF4A 2R3XA 3KMOA 1S4BP 1TDIA 3UVHA 2R6KA 3FR6A 4MP4A 1GSDA 2C3TA 1Z9HA 2HRKA 5HFKA 3D0ZA 5F07A 19GSA 5A5HB 4NHWA 4IS0A 1B48A 1M99A 2DC5A 3O3TA 4G0LA 3O76A 4YAVA 2A2SA 2GSQA 3KJYA 5ECPB 1OYJA 2PVQA 2YV7A 4PX1A 4ZB8A 4GCIA 5ELAA 4USSA 3L0HA 5A5KA 2UZ8A 4AKHA 2FNOA 1B4PA 4YH2A 5A4VA 4ZB7A 4F0CA 1SVMA 2F8FA 2HNLA 1SVOA 1V40A 3F6DA 4GLTA 3RFRC 2WW3A 5B7CA 4NHZA 1BX9A 2D2ZA 3GSSA 4IQ1A 4PHZC 4YAPA 1GWCA 2CZ3A 3LJRA 3VLNA 4BL7A 5D9VA 5ECQB 5F06A 17GSA 3LXZA 3ZMKA 4PNFA 4E68A 3M1GA 5D9WA 4MPFA 1M9AA 2EFHA 2O3EA 5GSTA 4ZBAA 4LMWA 2PMTA 2WW0A 4DEJA 4ISDA 3LXTA 5AGYA 3N9JA 2ON5A 3LFLA 4I97A 4BVYB 1F2EA 2GSTA 3VK9A 3IC8A 1BAYA 3KMNA 4F03A 2GSRA 1YEWC 3Q19A 4JZQA 4MPGA 5J4YA 1K0NA 1MD4A 2WW2A 3GH6A 1B8XA 3GTUA 2VO4A 1OE7A 4Q5QA 4E8EA 3IR4A 2WB9A 3P90A 1GTBA 4HZ2A 2J9HA 5DALA 4ZB9A 6GSYA 3M3MA 4Q5FA 2YV9A 5G5FA 1GSFA 1OKTA 1YQ1A 1ML6A 5DJLA 3CWGA 1K0CA 2AB6A 4MDCA 4G19A 5F05A 5D9TA 1U88A 5ECNB 2NTOA 1GUMA 3HMJG 5AN1A 4ZXGA 4IVFA 5J47A 3CHXC 5FT3A 5ECLB 13GSA 3MDKA 2GLRA 5DAKB 4KDXA 6GSVA 5ECKB 1AQWA 2FHEA 4IKHA 4PQHA 1VF1A 1GTUA 3HJMA 3VPTA 4IELA 4PNGA 3QAGA 2N5FA 1PA3A 20GSA 4AKIA 4GSSA 1K0BA 1EEMA 4HZ4A 3TGZA 2WJUA 1K0AA 3BBYA 4HOJA 1K0OA 1GNWA 2HSNB 1E6BA 5D9XA 1MTCA 1AQXA 4N3ZA 6GSUA 4L5OA 2VD0A 2VCTA 2VD1A 5A1NB 2A2RA 5ECIB 3KTLA 3G7IA 1GSQA 1FW1A 2VCQA 4O92A 1A0FA 1GSYA 5DDLA 5EY6A 22GSA 4ECCA 3CSIA 5ECSA 4MF5A 5ECMB 3VWXA 5GZZB 1PL2A 5ECRB 1KBNA 3LQ7A 4MZWA 4G01A 1TU7A 1N2AA 3IE3A 4KAEA 3M0FA 2X64A 4F0BA 1Q4JA 2C3NA 1XWGA 2UV8G 2WRTA 4PXOA 1C72A 3QR6A 4PQIA 9GSSA 1Y6EA 5J5NA 4MF7A 4PGTA 1GSUA 2F3MA 4BVXA 1YKCA 4OFTA 1GLPA 14GSA 4BVYA 1N25A 4G0KA 3GX0A 3HKRA 3Q74A 3HJOA 4GSTA 11GSA 4AKXB 2YCDA 2WZSA 1XW5A 3M8NA 3KXOA 4IJIA 3F6FA 2C3QA 1IYIA 3C8EA 2EFDA 1AXDA 1K0DA 16GSA 4G0IA 3GURA 3ZMLA 12GSA 3TU3B 4BL7B 1F3BA 1PX7A 4QQ7A 1I1IP 5BMUB 1BF5A 5A34A 2HRAA 1DUGA 1XW6A 4O7HA 3I6AA 3LSZA 2AAWA 2WVZA 3CBUA 1M9BA 2CVDA 1M0UA 1GSSA 4TOPA 1HNCA 5F0GA 1MD3A 5D73A 3SWLA 2CA8A 3CSHA 3FYGA 4OFNA 3Q18A 1VF3A 4ZB6A 1EOGA 3IBHA 1G6YA 4PURA 3IK9A 3W8SA 4AKGA 3I69A 1TW9A 2OACA 4EDZA 3UBLA 2EFEA 4LMVA 4PI2C 1PL1A 5ECHB 1K0MA 5FWGA 1VF2A 2PERA 2C4JA 5AISA 1PKZA 2O5VA 5DALB 3GSTA 4PI0C 8GSSA 1G7OA 5J4UA 3UARA 1TXUA 6GSXA 4EC0A 5J4VA 4EXJA 5EL8A 1GTIA 2HSMB
chains in the Genus database with same CATH topology
3DD3A 2VCZA 3DGQA 3G7JA 3RBTA 4G9HA 4ACSA 1K3YA 4ZBBA 3WD6A 1YY7A 2OT3A 1V2AA 3MAKA 4EDYA 5DJMA 3P8WA 3QAVA 4HI7A 3LYPA 1TU8A 3UAPA 3QAWA 2IMKA 1GUHA 5A5HA 4HJ2A 4W66A 5IQYA 4AGSA 3TOTA 1BG5A 4L8EA 4E8HA 3PGTA 1LBKA 5DCGA 4YQVA 3UBKA 1U87A 2GSSA 2C8UA 3ZFLA 4K0NA 1K3OA 4KGIA 1F3AA 2VCVA 4IBPA 6GSSA 2CAQA 4PUAA 3VURA 3VI7A 1OE8A 1EV9A 1HNBA 1PKWA 5LD0A 3TOUA 2VCXA 5J40A 4KSMA 5J41A 1GUKA 2WS2A 4JBBA 4GTUA 1USBA 2VCWA 3H1NA 5EVOA 2OADA 2HRKB 5JCUA 2GTUA 4MK3A 1K3LA 1EOHA 1AQVA 5DQSA 2C80A 1JLWA 2DSAA 5A4WA 2AHEA 2ON7A 1JZRA 4GDFA 3ZFBA 3EE2A 3KM6A 2GDRA 1BG1A 2PBJA 4KE3A 2LJRA 1GNEA 5F8BA 2IMIA 1PN9A 5BMUA 4L5LA 3ERGA 3FY7A 1YVLA 4IGJA 5LCZA 1AW9A 1LJRA 2IL3A 3VI5A 4ECJA 3R3EA 4FQUA 4K0GA 7GSSA 1FHEA 4KF9A 4BVXB 18GSA 4QMKA 4GF0A 5ECOB 3U6VA 2CZ2A 1HQOA 3FR3A 3GUSA 4MF6A 1ZGNA 1NHYA 2EFCA 5AIXA 1PMTA 4PTSA 5KEJA 1GSEA 5DAKA 4ECIA 4RI6A 3ERFA 4YQMA 4CHSA 1R5AA 1PD21 3LYKA 1XWKA 5GSSA 1PGTA 5AIVA 4WR5A 3VPQA 3GTUB 10GSA 4RI7A 2HQTA 2V6KA 1YDKA 3R2QA 4G10A 4KDYA 2HSMA 2WDUA 5A34B 4IQAA 3FRCA 1GTAA 3AY8A 4ECBA 3LG6A 1HNAA 1BYEA 6GSWA 1PX6A 3F63A 4YQUA 1GLQA 2HSNA 3FR9A 2H1LA 2VKZG 3PPUA 4Q5NA 4WR4A 1EV4A 1JLVA 1U3IA 4J2FA 4N0VA 1YJ6A 3CRUA 4ID0A 3WYWA 4KX4A 4IW9A 5FHIA 2JL4A 1SVLA 2R4VA 5A1NA 4OMVA 3NIVA 2CAIA 4OFMA 3CSJA 5ELGA 4AI6A 4ZBDA 4EE0A 5A4UA 3CRTA 3N5OA 3PR8A 1GULA 3EINA 1Y1UA 4KDUA 6GSTA 2R5GA 3ISOA 5JCWA 2OA7A 4GSNA 2PGTA 4NAXA 1IYHA 5G5EA 1UA5A 4KH7A 4JEDA 1G6WA 1RK4A 3IK7A 1ZL9A 4Q5RA 1VF4A 2R3XA 3KMOA 1TDIA 3UVHA 2R6KA 3FR6A 4MP4A 1GSDA 2C3TA 1Z9HA 2HRKA 5HFKA 3D0ZA 5F07A 19GSA 5A5HB 4NHWA 4IS0A 1B48A 1M99A 2DC5A 3O3TA 4G0LA 3O76A 4YAVA 2A2SA 2GSQA 3KJYA 5ECPB 1OYJA 2PVQA 2YV7A 4PX1A 4ZB8A 4GCIA 5ELAA 4USSA 3L0HA 5A5KA 2UZ8A 4AKHA 2FNOA 1B4PA 4YH2A 5A4VA 4ZB7A 4F0CA 1SVMA 2F8FA 2HNLA 1SVOA 1V40A 3F6DA 4GLTA 5B7CA 4NHZA 1BX9A 2D2ZA 3GSSA 4IQ1A 4YAPA 1GWCA 2CZ3A 3LJRA 3VLNA 4BL7A 5D9VA 5ECQB 5F06A 17GSA 3LXZA 3ZMKA 4PNFA 4E68A 3M1GA 5D9WA 4MPFA 1M9AA 2EFHA 5GSTA 4ZBAA 4LMWA 2PMTA 4DEJA 4ISDA 3LXTA 5AGYA 3N9JA 2ON5A 3LFLA 4I97A 4BVYB 1F2EA 2GSTA 3VK9A 3IC8A 1BAYA 3KMNA 4F03A 2GSRA 3Q19A 4JZQA 4MPGA 5J4YA 1K0NA 1MD4A 3GH6A 1B8XA 3GTUA 2VO4A 1OE7A 4Q5QA 4E8EA 3IR4A 2WB9A 3P90A 1GTBA 4HZ2A 2J9HA 5DALA 4ZB9A 6GSYA 3M3MA 4Q5FA 2YV9A 5G5FA 1GSFA 1OKTA 1YQ1A 1ML6A 5DJLA 3CWGA 1K0CA 2AB6A 4MDCA 4G19A 5F05A 5D9TA 1U88A 5ECNB 2NTOA 1GUMA 3HMJG 5AN1A 4ZXGA 4IVFA 5J47A 5FT3A 5ECLB 13GSA 3MDKA 2GLRA 5DAKB 4KDXA 6GSVA 5ECKB 1AQWA 2FHEA 4IKHA 4PQHA 1VF1A 1GTUA 3HJMA 3VPTA 4IELA 4PNGA 3QAGA 2N5FA 1PA3A 20GSA 4AKIA 4GSSA 1K0BA 1EEMA 4HZ4A 3TGZA 2WJUA 1K0AA 3BBYA 4HOJA 1K0OA 1GNWA 2HSNB 1E6BA 5D9XA 1MTCA 1AQXA 4N3ZA 6GSUA 4L5OA 2VD0A 2VCTA 2VD1A 5A1NB 2A2RA 5ECIB 3KTLA 3G7IA 1GSQA 1FW1A 2VCQA 4O92A 1A0FA 1GSYA 5DDLA 5EY6A 22GSA 4ECCA 3CSIA 5ECSA 4MF5A 5ECMB 3VWXA 5GZZB 1PL2A 5ECRB 1KBNA 3LQ7A 4MZWA 4G01A 1TU7A 1N2AA 3IE3A 4KAEA 3M0FA 2X64A 4F0BA 1Q4JA 2C3NA 1XWGA 2UV8G 2WRTA 4PXOA 1C72A 3QR6A 4PQIA 9GSSA 1Y6EA 5J5NA 4MF7A 4PGTA 1GSUA 2F3MA 4BVXA 1YKCA 4OFTA 1GLPA 14GSA 4BVYA 1N25A 4G0KA 3GX0A 3HKRA 3Q74A 3HJOA 4GSTA 11GSA 4AKXB 2YCDA 1XW5A 3M8NA 3KXOA 4IJIA 3F6FA 2C3QA 1IYIA 3C8EA 2EFDA 1AXDA 1K0DA 16GSA 4G0IA 3GURA 3ZMLA 12GSA 3TU3B 4BL7B 1F3BA 1PX7A 4QQ7A 5BMUB 1BF5A 5A34A 2HRAA 1DUGA 1XW6A 4O7HA 3I6AA 3LSZA 2AAWA 3CBUA 1M9BA 2CVDA 1M0UA 1GSSA 4TOPA 1HNCA 5F0GA 1MD3A 5D73A 3SWLA 2CA8A 3CSHA 3FYGA 4OFNA 3Q18A 1VF3A 4ZB6A 1EOGA 3IBHA 1G6YA 4PURA 3IK9A 3W8SA 4AKGA 3I69A 1TW9A 2OACA 4EDZA 3UBLA 2EFEA 4LMVA 1PL1A 5ECHB 1K0MA 5FWGA 1VF2A 2PERA 2C4JA 5AISA 1PKZA 2O5VA 5DALB 3GSTA 8GSSA 1G7OA 5J4UA 3UARA 1TXUA 6GSXA 4EC0A 5J4VA 4EXJA 5EL8A 1GTIA 2HSMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A5H A;  4AI6 A;  4ZB7 A;  5A5H B;  4AKI A;  4W66 A;  5A34 A;  5A1N A;  5A34 B;  5A1N B;  4AKG A;  4AKH A;  5BMU B; 
#chains in the Genus database with same CATH topology
 3DD3 A;  2VCZ A;  3DGQ A;  3G7J A;  2WVX B;  3RBT A;  4G9H A;  4ACS A;  1K3Y A;  4ZBB A;  3WD6 A;  1YY7 A;  2OT3 A;  1V2A A;  3MAK A;  4EDY A;  5DJM A;  3P8W A;  3QAV A;  4HI7 A;  3LYP A;  1TU8 A;  3UAP A;  3QAW A;  2IMK A;  1GUH A;  5A5H A;  4HJ2 A;  4W66 A;  5IQY A;  4AGS A;  3TOT A;  1BG5 A;  4L8E A;  4E8H A;  3PGT A;  1LBK A;  5DCG A;  4YQV A;  3UBK A;  1U87 A;  2GSS A;  2C8U A;  3RGB C;  3ZFL A;  4K0N A;  1K3O A;  4KGI A;  1F3A A;  2VCV A;  4IBP A;  6GSS A;  2CAQ A;  2WW1 A;  4PUA A;  3VUR A;  3VI7 A;  1OE8 A;  1EV9 A;  1HNB A;  1PKW A;  5LD0 A;  3TOU A;  2VCX A;  5J40 A;  4KSM A;  5J41 A;  1GUK A;  2WS2 A;  4JBB A;  4GTU A;  1USB A;  2VCW A;  3H1N A;  5EVO A;  2OAD A;  2HRK B;  5JCU A;  2GTU A;  4MK3 A;  1K3L A;  1EOH A;  1AQV A;  5DQS A;  2C80 A;  1JLW A;  2DSA A;  5A4W A;  2AHE A;  2ON7 A;  1JZR A;  4GDF A;  3ZFB A;  3EE2 A;  3KM6 A;  2GDR A;  1BG1 A;  2PBJ A;  4KE3 A;  2LJR A;  1GNE A;  5F8B A;  2IMI A;  1PN9 A;  5BMU A;  4L5L A;  3ERG A;  3FY7 A;  1YVL A;  4IGJ A;  5LCZ A;  1AW9 A;  1LJR A;  2IL3 A;  3VI5 A;  4ECJ A;  3R3E A;  4FQU A;  4K0G A;  7GSS A;  1FHE A;  4KF9 A;  4BVX B;  18GS A;  4QMK A;  4GF0 A;  5ECO B;  3U6V A;  2CZ2 A;  1HQO A;  3FR3 A;  3GUS A;  4MF6 A;  1ZGN A;  1NHY A;  2EFC A;  5AIX A;  1PMT A;  4PTS A;  5KEJ A;  1GSE A;  5DAK A;  4ECI A;  4RI6 A;  3ERF A;  4YQM A;  4CHS A;  1R5A A;  1PD2 1;  3LYK A;  1XWK A;  5GSS A;  1PGT A;  5AIV A;  4WR5 A;  3VPQ A;  3GTU B;  10GS A;  4RI7 A;  2HQT A;  2V6K A;  1YDK A;  3R2Q A;  4G10 A;  4KDY A;  2HSM A;  2WDU A;  5A34 B;  4IQA A;  3FRC A;  1GTA A;  3AY8 A;  4ECB A;  2WVX A;  3LG6 A;  1HNA A;  1BYE A;  2WVY A;  6GSW A;  1PX6 A;  3F63 A;  4YQU A;  1GLQ A;  2HSN A;  3FR9 A;  2H1L A;  2VKZ G;  3PPU A;  4Q5N A;  4WR4 A;  1EV4 A;  1JLV A;  1U3I A;  4J2F A;  4N0V A;  1YJ6 A;  3CRU A;  4ID0 A;  3WYW A;  4KX4 A;  4IW9 A;  5FHI A;  2JL4 A;  1SVL A;  2R4V A;  5A1N A;  4OMV A;  3NIV A;  2CAI A;  4OFM A;  3CSJ A;  5ELG A;  4AI6 A;  4ZBD A;  4EE0 A;  5A4U A;  3CRT A;  3N5O A;  3PR8 A;  1GUL A;  3EIN A;  1Y1U A;  4KDU A;  6GST A;  2R5G A;  3ISO A;  5JCW A;  2OA7 A;  4GSN A;  2PGT A;  4NAX A;  2O36 A;  1IYH A;  5G5E A;  1UA5 A;  4KH7 A;  4JED A;  4FXY P;  1G6W A;  1RK4 A;  3IK7 A;  1ZL9 A;  4Q5R A;  1VF4 A;  2R3X A;  3KMO A;  1S4B P;  1TDI A;  3UVH A;  2R6K A;  3FR6 A;  4MP4 A;  1GSD A;  2C3T A;  1Z9H A;  2HRK A;  5HFK A;  3D0Z A;  5F07 A;  19GS A;  5A5H B;  4NHW A;  4IS0 A;  1B48 A;  1M99 A;  2DC5 A;  3O3T A;  4G0L A;  3O76 A;  4YAV A;  2A2S A;  2GSQ A;  3KJY A;  5ECP B;  1OYJ A;  2PVQ A;  2YV7 A;  4PX1 A;  4ZB8 A;  4GCI A;  5ELA A;  4USS A;  3L0H A;  5A5K A;  2UZ8 A;  4AKH A;  2FNO A;  1B4P A;  4YH2 A;  5A4V A;  4ZB7 A;  4F0C A;  1SVM A;  2F8F A;  2HNL A;  1SVO A;  1V40 A;  3F6D A;  4GLT A;  3RFR C;  2WW3 A;  5B7C A;  4NHZ A;  1BX9 A;  2D2Z A;  3GSS A;  4IQ1 A;  4PHZ C;  4YAP A;  1GWC A;  2CZ3 A;  3LJR A;  3VLN A;  4BL7 A;  5D9V A;  5ECQ B;  5F06 A;  17GS A;  3LXZ A;  3ZMK A;  4PNF A;  4E68 A;  3M1G A;  5D9W A;  4MPF A;  1M9A A;  2EFH A;  2O3E A;  5GST A;  4ZBA A;  4LMW A;  2PMT A;  2WW0 A;  4DEJ A;  4ISD A;  3LXT A;  5AGY A;  3N9J A;  2ON5 A;  3LFL A;  4I97 A;  4BVY B;  1F2E A;  2GST A;  3VK9 A;  3IC8 A;  1BAY A;  3KMN A;  4F03 A;  2GSR A;  1YEW C;  3Q19 A;  4JZQ A;  4MPG A;  5J4Y A;  1K0N A;  1MD4 A;  2WW2 A;  3GH6 A;  1B8X A;  3GTU A;  2VO4 A;  1OE7 A;  4Q5Q A;  4E8E A;  3IR4 A;  2WB9 A;  3P90 A;  1GTB A;  4HZ2 A;  2J9H A;  5DAL A;  4ZB9 A;  6GSY A;  3M3M A;  4Q5F A;  2YV9 A;  5G5F A;  1GSF A;  1OKT A;  1YQ1 A;  1ML6 A;  5DJL A;  3CWG A;  1K0C A;  2AB6 A;  4MDC A;  4G19 A;  5F05 A;  5D9T A;  1U88 A;  5ECN B;  2NTO A;  1GUM A;  3HMJ G;  5AN1 A;  4ZXG A;  4IVF A;  5J47 A;  3CHX C;  5FT3 A;  5ECL B;  13GS A;  3MDK A;  2GLR A;  5DAK B;  4KDX A;  6GSV A;  5ECK B;  1AQW A;  2FHE A;  4IKH A;  4PQH A;  1VF1 A;  1GTU A;  3HJM A;  3VPT A;  4IEL A;  4PNG A;  3QAG A;  2N5F A;  1PA3 A;  20GS A;  4AKI A;  4GSS A;  1K0B A;  1EEM A;  4HZ4 A;  3TGZ A;  2WJU A;  1K0A A;  3BBY A;  4HOJ A;  1K0O A;  1GNW A;  2HSN B;  1E6B A;  5D9X A;  1MTC A;  1AQX A;  4N3Z A;  6GSU A;  4L5O A;  2VD0 A;  2VCT A;  2VD1 A;  5A1N B;  2A2R A;  5ECI B;  3KTL A;  3G7I A;  1GSQ A;  1FW1 A;  2VCQ A;  4O92 A;  1A0F A;  1GSY A;  5DDL A;  5EY6 A;  22GS A;  4ECC A;  3CSI A;  5ECS A;  4MF5 A;  5ECM B;  3VWX A;  5GZZ B;  1PL2 A;  5ECR B;  1KBN A;  3LQ7 A;  4MZW A;  4G01 A;  1TU7 A;  1N2A A;  3IE3 A;  4KAE A;  3M0F A;  2X64 A;  4F0B A;  1Q4J A;  2C3N A;  1XWG A;  2UV8 G;  2WRT A;  4PXO A;  1C72 A;  3QR6 A;  4PQI A;  9GSS A;  1Y6E A;  5J5N A;  4MF7 A;  4PGT A;  1GSU A;  2F3M A;  4BVX A;  1YKC A;  4OFT A;  1GLP A;  14GS A;  4BVY A;  1N25 A;  4G0K A;  3GX0 A;  3HKR A;  3Q74 A;  3HJO A;  4GST A;  11GS A;  4AKX B;  2YCD A;  2WZS A;  1XW5 A;  3M8N A;  3KXO A;  4IJI A;  3F6F A;  2C3Q A;  1IYI A;  3C8E A;  2EFD A;  1AXD A;  1K0D A;  16GS A;  4G0I A;  3GUR A;  3ZML A;  12GS A;  3TU3 B;  4BL7 B;  1F3B A;  1PX7 A;  4QQ7 A;  1I1I P;  5BMU B;  1BF5 A;  5A34 A;  2HRA A;  1DUG A;  1XW6 A;  4O7H A;  3I6A A;  3LSZ A;  2AAW A;  2WVZ A;  3CBU A;  1M9B A;  2CVD A;  1M0U A;  1GSS A;  4TOP A;  1HNC A;  5F0G A;  1MD3 A;  5D73 A;  3SWL A;  2CA8 A;  3CSH A;  3FYG A;  4OFN A;  3Q18 A;  1VF3 A;  4ZB6 A;  1EOG A;  3IBH A;  1G6Y A;  4PUR A;  3IK9 A;  3W8S A;  4AKG A;  3I69 A;  1TW9 A;  2OAC A;  4EDZ A;  3UBL A;  2EFE A;  4LMV A;  4PI2 C;  1PL1 A;  5ECH B;  1K0M A;  5FWG A;  1VF2 A;  2PER A;  2C4J A;  5AIS A;  1PKZ A;  2O5V A;  5DAL B;  3GST A;  4PI0 C;  8GSS A;  1G7O A;  5J4U A;  3UAR A;  1TXU A;  6GSX A;  4EC0 A;  5J4V A;  4EXJ A;  5EL8 A;  1GTI A;  2HSM B; 
#chains in the Genus database with same CATH homology
 3DD3 A;  2VCZ A;  3DGQ A;  3G7J A;  3RBT A;  4G9H A;  4ACS A;  1K3Y A;  4ZBB A;  3WD6 A;  1YY7 A;  2OT3 A;  1V2A A;  3MAK A;  4EDY A;  5DJM A;  3P8W A;  3QAV A;  4HI7 A;  3LYP A;  1TU8 A;  3UAP A;  3QAW A;  2IMK A;  1GUH A;  5A5H A;  4HJ2 A;  4W66 A;  5IQY A;  4AGS A;  3TOT A;  1BG5 A;  4L8E A;  4E8H A;  3PGT A;  1LBK A;  5DCG A;  4YQV A;  3UBK A;  1U87 A;  2GSS A;  2C8U A;  3ZFL A;  4K0N A;  1K3O A;  4KGI A;  1F3A A;  2VCV A;  4IBP A;  6GSS A;  2CAQ A;  4PUA A;  3VUR A;  3VI7 A;  1OE8 A;  1EV9 A;  1HNB A;  1PKW A;  5LD0 A;  3TOU A;  2VCX A;  5J40 A;  4KSM A;  5J41 A;  1GUK A;  2WS2 A;  4JBB A;  4GTU A;  1USB A;  2VCW A;  3H1N A;  5EVO A;  2OAD A;  2HRK B;  5JCU A;  2GTU A;  4MK3 A;  1K3L A;  1EOH A;  1AQV A;  5DQS A;  2C80 A;  1JLW A;  2DSA A;  5A4W A;  2AHE A;  2ON7 A;  1JZR A;  4GDF A;  3ZFB A;  3EE2 A;  3KM6 A;  2GDR A;  1BG1 A;  2PBJ A;  4KE3 A;  2LJR A;  1GNE A;  5F8B A;  2IMI A;  1PN9 A;  5BMU A;  4L5L A;  3ERG A;  3FY7 A;  1YVL A;  4IGJ A;  5LCZ A;  1AW9 A;  1LJR A;  2IL3 A;  3VI5 A;  4ECJ A;  3R3E A;  4FQU A;  4K0G A;  7GSS A;  1FHE A;  4KF9 A;  4BVX B;  18GS A;  4QMK A;  4GF0 A;  5ECO B;  3U6V A;  2CZ2 A;  1HQO A;  3FR3 A;  3GUS A;  4MF6 A;  1ZGN A;  1NHY A;  2EFC A;  5AIX A;  1PMT A;  4PTS A;  5KEJ A;  1GSE A;  5DAK A;  4ECI A;  4RI6 A;  3ERF A;  4YQM A;  4CHS A;  1R5A A;  1PD2 1;  3LYK A;  1XWK A;  5GSS A;  1PGT A;  5AIV A;  4WR5 A;  3VPQ A;  3GTU B;  10GS A;  4RI7 A;  2HQT A;  2V6K A;  1YDK A;  3R2Q A;  4G10 A;  4KDY A;  2HSM A;  2WDU A;  5A34 B;  4IQA A;  3FRC A;  1GTA A;  3AY8 A;  4ECB A;  3LG6 A;  1HNA A;  1BYE A;  6GSW A;  1PX6 A;  3F63 A;  4YQU A;  1GLQ A;  2HSN A;  3FR9 A;  2H1L A;  2VKZ G;  3PPU A;  4Q5N A;  4WR4 A;  1EV4 A;  1JLV A;  1U3I A;  4J2F A;  4N0V A;  1YJ6 A;  3CRU A;  4ID0 A;  3WYW A;  4KX4 A;  4IW9 A;  5FHI A;  2JL4 A;  1SVL A;  2R4V A;  5A1N A;  4OMV A;  3NIV A;  2CAI A;  4OFM A;  3CSJ A;  5ELG A;  4AI6 A;  4ZBD A;  4EE0 A;  5A4U A;  3CRT A;  3N5O A;  3PR8 A;  1GUL A;  3EIN A;  1Y1U A;  4KDU A;  6GST A;  2R5G A;  3ISO A;  5JCW A;  2OA7 A;  4GSN A;  2PGT A;  4NAX A;  1IYH A;  5G5E A;  1UA5 A;  4KH7 A;  4JED A;  1G6W A;  1RK4 A;  3IK7 A;  1ZL9 A;  4Q5R A;  1VF4 A;  2R3X A;  3KMO A;  1TDI A;  3UVH A;  2R6K A;  3FR6 A;  4MP4 A;  1GSD A;  2C3T A;  1Z9H A;  2HRK A;  5HFK A;  3D0Z A;  5F07 A;  19GS A;  5A5H B;  4NHW A;  4IS0 A;  1B48 A;  1M99 A;  2DC5 A;  3O3T A;  4G0L A;  3O76 A;  4YAV A;  2A2S A;  2GSQ A;  3KJY A;  5ECP B;  1OYJ A;  2PVQ A;  2YV7 A;  4PX1 A;  4ZB8 A;  4GCI A;  5ELA A;  4USS A;  3L0H A;  5A5K A;  2UZ8 A;  4AKH A;  2FNO A;  1B4P A;  4YH2 A;  5A4V A;  4ZB7 A;  4F0C A;  1SVM A;  2F8F A;  2HNL A;  1SVO A;  1V40 A;  3F6D A;  4GLT A;  5B7C A;  4NHZ A;  1BX9 A;  2D2Z A;  3GSS A;  4IQ1 A;  4YAP A;  1GWC A;  2CZ3 A;  3LJR A;  3VLN A;  4BL7 A;  5D9V A;  5ECQ B;  5F06 A;  17GS A;  3LXZ A;  3ZMK A;  4PNF A;  4E68 A;  3M1G A;  5D9W A;  4MPF A;  1M9A A;  2EFH A;  5GST A;  4ZBA A;  4LMW A;  2PMT A;  4DEJ A;  4ISD A;  3LXT A;  5AGY A;  3N9J A;  2ON5 A;  3LFL A;  4I97 A;  4BVY B;  1F2E A;  2GST A;  3VK9 A;  3IC8 A;  1BAY A;  3KMN A;  4F03 A;  2GSR A;  3Q19 A;  4JZQ A;  4MPG A;  5J4Y A;  1K0N A;  1MD4 A;  3GH6 A;  1B8X A;  3GTU A;  2VO4 A;  1OE7 A;  4Q5Q A;  4E8E A;  3IR4 A;  2WB9 A;  3P90 A;  1GTB A;  4HZ2 A;  2J9H A;  5DAL A;  4ZB9 A;  6GSY A;  3M3M A;  4Q5F A;  2YV9 A;  5G5F A;  1GSF A;  1OKT A;  1YQ1 A;  1ML6 A;  5DJL A;  3CWG A;  1K0C A;  2AB6 A;  4MDC A;  4G19 A;  5F05 A;  5D9T A;  1U88 A;  5ECN B;  2NTO A;  1GUM A;  3HMJ G;  5AN1 A;  4ZXG A;  4IVF A;  5J47 A;  5FT3 A;  5ECL B;  13GS A;  3MDK A;  2GLR A;  5DAK B;  4KDX A;  6GSV A;  5ECK B;  1AQW A;  2FHE A;  4IKH A;  4PQH A;  1VF1 A;  1GTU A;  3HJM A;  3VPT A;  4IEL A;  4PNG A;  3QAG A;  2N5F A;  1PA3 A;  20GS A;  4AKI A;  4GSS A;  1K0B A;  1EEM A;  4HZ4 A;  3TGZ A;  2WJU A;  1K0A A;  3BBY A;  4HOJ A;  1K0O A;  1GNW A;  2HSN B;  1E6B A;  5D9X A;  1MTC A;  1AQX A;  4N3Z A;  6GSU A;  4L5O A;  2VD0 A;  2VCT A;  2VD1 A;  5A1N B;  2A2R A;  5ECI B;  3KTL A;  3G7I A;  1GSQ A;  1FW1 A;  2VCQ A;  4O92 A;  1A0F A;  1GSY A;  5DDL A;  5EY6 A;  22GS A;  4ECC A;  3CSI A;  5ECS A;  4MF5 A;  5ECM B;  3VWX A;  5GZZ B;  1PL2 A;  5ECR B;  1KBN A;  3LQ7 A;  4MZW A;  4G01 A;  1TU7 A;  1N2A A;  3IE3 A;  4KAE A;  3M0F A;  2X64 A;  4F0B A;  1Q4J A;  2C3N A;  1XWG A;  2UV8 G;  2WRT A;  4PXO A;  1C72 A;  3QR6 A;  4PQI A;  9GSS A;  1Y6E A;  5J5N A;  4MF7 A;  4PGT A;  1GSU A;  2F3M A;  4BVX A;  1YKC A;  4OFT A;  1GLP A;  14GS A;  4BVY A;  1N25 A;  4G0K A;  3GX0 A;  3HKR A;  3Q74 A;  3HJO A;  4GST A;  11GS A;  4AKX B;  2YCD A;  1XW5 A;  3M8N A;  3KXO A;  4IJI A;  3F6F A;  2C3Q A;  1IYI A;  3C8E A;  2EFD A;  1AXD A;  1K0D A;  16GS A;  4G0I A;  3GUR A;  3ZML A;  12GS A;  3TU3 B;  4BL7 B;  1F3B A;  1PX7 A;  4QQ7 A;  5BMU B;  1BF5 A;  5A34 A;  2HRA A;  1DUG A;  1XW6 A;  4O7H A;  3I6A A;  3LSZ A;  2AAW A;  3CBU A;  1M9B A;  2CVD A;  1M0U A;  1GSS A;  4TOP A;  1HNC A;  5F0G A;  1MD3 A;  5D73 A;  3SWL A;  2CA8 A;  3CSH A;  3FYG A;  4OFN A;  3Q18 A;  1VF3 A;  4ZB6 A;  1EOG A;  3IBH A;  1G6Y A;  4PUR A;  3IK9 A;  3W8S A;  4AKG A;  3I69 A;  1TW9 A;  2OAC A;  4EDZ A;  3UBL A;  2EFE A;  4LMV A;  1PL1 A;  5ECH B;  1K0M A;  5FWG A;  1VF2 A;  2PER A;  2C4J A;  5AIS A;  1PKZ A;  2O5V A;  5DAL B;  3GST A;  8GSS A;  1G7O A;  5J4U A;  3UAR A;  1TXU A;  6GSX A;  4EC0 A;  5J4V A;  4EXJ A;  5EL8 A;  1GTI A;  2HSM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...