5A34A

The crystal structure of the gst-like domains complex of eprs-aimp2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
168
structure length
168
Chain Sequence
TLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSCDSFTSTINELNHCLSLRTYLVGNSLSLADLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title Assembly of Multi-tRNA Synthetase Complex Via Heterotetrameric Glutathione Transferase-Homology Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 54
structure length 168
sequence length 168
chains with identical sequence C, E, G
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a34A00
5A5HA 5A1NB 5BMUB 4AKGA 5A34A 5A5HB 5A1NA 4AKHA 4ZB7A 4W66A 4AKIA 4AI6A 5A34B
chains in the Genus database with same CATH superfamily
1GSEA 4MP4A 5GSSA 6GSVA 2R6KA 4QMKA 5EVOA 1GSFA 1PL2A 6GSUA 4OFTA 4L8EA 1TW9A 1PN9A 10GSA 4DEJA 1SVMA 17GSA 5ECPB 5ECRB 5GZZB 4NAXA 5F07A 2HSMA 2VCVA 4E68A 4KDYA 3EINA 3GUSA 3EE2A 4YQMA 2GSRA 5KEJA 3I6AA 5D9XA 3P90A 5ECSA 4FQUA 2FNOA 3M3MA 4HI7A 3ZMKA 4GLTA 3R3EA 3WYWA 1JZRA 2X64A 1I1IP 1PGTA 3VI5A 3ZFLA 4BVYB 3MAKA 1PL1A 2VCXA 1M99A 4F0CA 4ISDA 4TOPA 3VLNA 1GULA 8GSSA 4KSMA 2WW3A 1IYIA 1VF1A 5EL8A 1LJRA 2OACA 2AAWA 1K0MA 5A4UA 4BVYA 5JCUA 3L0HA 5G5FA 1ZL9A 3D0ZA 2AHEA 2EFDA 1YEWC 2PMTA 4YAVA 4EDZA 6GSYA 4AGSA 5ECHB 1YJ6A 2WW0A 5DCGA 3SWLA 3LQ7A 4MPGA 5ECKB 1AQWA 2WZSA 1JLWA 1PMTA 1GTAA 5DAKB 2WB9A 3LXTA 3LYKA 4GF0A 4ZB9A 18GSA 1GUKA 4PQHA 1GTUA 3Q19A 3LYPA 1RK4A 13GSA 2HSNB 3NIVA 1F3AA 2C4JA 3FR9A 3HKRA 4KX4A 4YH2A 5F06A 4ZB7A 5AIVA 1XWGA 5J41A 5DAKA 3QAVA 4Q5NA 1KBNA 1BX9A 1GSQA 4RI6A 5DJLA 1FW1A 2VKZG 5F8BA 3U6VA 2HSNA 4IJIA 5BMUB 4GSNA 5D9WA 3WD6A 2A2SA 2YV7A 4GSSA 1OYJA 1HQOA 3M8NA 3F6FA 4BL7B 3ZFBA 1G6YA 3HJMA 1YVLA 1B4PA 4G10A 5DDLA 5DJMA 5AGYA 5BMUA 3O3TA 5ECNB 14GSA 3KJYA 5EY6A 4PGTA 4BL7A 5ECQB 4L5LA 4N3ZA 5A4WA 4LMWA 2CZ2A 2WVZA 3KMNA 1FHEA 1GSYA 1B48A 1S4BP 1K0NA 4PUAA 3KM6A 4J2FA 2CA8A 5AIXA 1U87A 5ECLB 4PX1A 1UA5A 1U3IA 4EXJA 4BVXB 4HZ4A 4IKHA 5J5NA 1K0BA 1E6BA 1HNBA 2F8FA 2VD0A 4WR5A 3TOTA 4F0BA 3N9JA 5A34B 3FR6A 4KE3A 1YQ1A 4MK3A 4IQ1A 4PHZC 3RFRC 3KXOA 3UARA 5D9VA 4ECIA 1SVOA 1BAYA 3UAPA 4BVXA 4ZB6A 1GLPA 20GSA 3GH6A 1EOHA 5FHIA 4K0GA 3TU3B 2ON7A 4GCIA 2AB6A 5ELAA 5A34A 1YKCA 3CSHA 3IC8A 3R2QA 3PR8A 1F2EA 4KAEA 2C3TA 4ID0A 2GTUA 3IE3A 1VF4A 2WW1A 1VF2A 11GSA 5ELGA 4ACSA 2R3XA 4G9HA 4NHZA 1GTBA 1GSSA 2ON5A 4Q5QA 5J4UA 3GSSA 1MTCA 1AW9A 1HNCA 2GDRA 5ECMB 3VK9A 1GUMA 4I97A 1USBA 1GSDA 4LMVA 5A5HB 1G7OA 2UZ8A 4ZB8A 3O76A 4JZQA 4Q5RA 1YDKA 3PPUA 3VPQA 3CBUA 4OFMA 1GWCA 3KTLA 4MDCA 2EFCA 5A5HA 3CWGA 16GSA 2IL3A 4OFNA 2A2RA 3HMJG 2J9HA 2HRAA 4L5OA 1PD21 2N5FA 4NHWA 2GSTA 6GSXA 4ECJA 3RBTA 4ECBA 5FWGA 4E8HA 2GLRA 4IGJA 5J4VA 1G6WA 5IQYA 4EDYA 1TU8A 4WR4A 4O92A 4YAPA 1XWKA 3ERFA 3QR6A 1PKWA 3FYGA 1LBKA 4EE0A 2VCQA 3CRTA 3GURA 3LSZA 5A1NB 3P8WA 4G0LA 4AKIA 4KF9A 1M0UA 1K0AA 2CAQA 1K0CA 4USSA 2OADA 3F6DA 1V2AA 4GSTA 1AQXA 1JLVA 1XW6A 1K3LA 1HNAA 1OE7A 2WJUA 2V6KA 4KGIA 4MZWA 5A1NA 3TOUA 4AI6A 3IR4A 5D9TA 5A4VA 4G01A 1B8XA 2OT3A 2UV8G 4ECCA 1BF5A 3BBYA 2IMKA 1U88A 1K3OA 1V40A 4PNGA 1BG1A 7GSSA 2YV9A 6GSWA 5A5KA 4YQVA 2VD1A 19GSA 3CHXC 4YQUA 5LD0A 5AISA 4AKHA 5B7CA 1YY7A 5JCWA 12GSA 1Y1UA 1TXUA 2VCTA 9GSSA 4ZBBA 3UBKA 3IK9A 3G7IA 4KH7A 4W66A 1GTIA 4IELA 2R4VA 5J40A 2WS2A 3W8SA 4PI0C 3LG6A 1IYHA 2O5VA 4AKGA 4IQAA 1OKTA 2F3MA 5ECOB 4PNFA 4IW9A 4ZXGA 2WDUA 2HNLA 2WVXB 3IBHA 1PKZA 2C3QA 3N5OA 1MD3A 3UBLA 4JEDA 4EC0A 2O36A 2EFHA 1BYEA 3UVHA 2PVQA 1K0OA 5F0GA 4PQIA 2FHEA 4N0VA 3CSIA 4FXYP 4PI2C 2WVXA 4IS0A 1GSUA 5J47A 4MPFA 3ISOA 2OA7A 2D2ZA 4K0NA 3MDKA 2WVYA 5FT3A 6GSSA 5LCZA 4MF6A 4OMVA 5HFKA 2C3NA 2DSAA 4G0IA 5DQSA 3GSTA 3KMOA 4HOJA 4HZ2A 4AKXB 1NHYA 1K0DA 1SVLA 3QAGA 3I69A 3H1NA 5ECIB 4PXOA 5J4YA 1R5AA 1EOGA 3CRUA 1Y6EA 3PGTA 1PX6A 2JL4A 1F3BA 1TU7A 1GNEA 1DUGA 2PGTA 3M0FA 4GDFA 2H1LA 1C72A 2C80A 4Q5FA 2CAIA 5D73A 3FRCA 4HJ2A 1M9AA 1A0FA 2VCWA 3VI7A 4MF7A 1M9BA 1K3YA 2C8UA 1BG5A 1N25A 1EV9A 22GSA 3HJOA 2YCDA 3Q74A 4O7HA 3FY7A 4G0KA 5DALB 3FR3A 3DGQA 3G7JA 1ZGNA 1PX7A 3VURA 2R5GA 4QQ7A 1Z9HA 2DC5A 2HQTA 4RI7A 2VO4A 1Q4JA 5GSTA 1AQVA 3LJRA 3C8EA 2GSQA 1N2AA 4CHSA 3IK7A 3GX0A 5AN1A 1TDIA 4PURA 4IVFA 3F63A 2O3EA 2PBJA 4IBPA 3GTUB 3Q18A 4KDUA 5DALA 3LXZA 4ZBDA 3TGZA 4GTUA 4E8EA 5G5EA 1GLQA 2CVDA 2LJRA 4MF5A 3VPTA 1MD4A 2HSMB 2WW2A 2HRKA 1XW5A 4PTSA 1PA3A 3GTUA 3DD3A 1AXDA 1EEMA 3QAWA 6GSTA 3ZMLA 1ML6A 5F05A 1EV4A 2GSSA 2IMIA 3LFLA 3VWXA 2PERA 2HRKB 1GUHA 3CSJA 2NTOA 4KDXA 1OE8A 4G19A 2EFEA 1VF3A 3M1GA 1GNWA 4JBBA 4ZBAA 3AY8A 4F03A 3ERGA 2CZ3A 2VCZA 3RGBC 2WRTA
chains in the Genus database with same CATH topology
1GSEA 4MP4A 5GSSA 6GSVA 2R6KA 4QMKA 5EVOA 1GSFA 1PL2A 6GSUA 4OFTA 4L8EA 1TW9A 1PN9A 10GSA 4DEJA 1SVMA 17GSA 5ECPB 5ECRB 5GZZB 4NAXA 5F07A 2HSMA 2VCVA 4E68A 4KDYA 3EINA 3GUSA 3EE2A 4YQMA 2GSRA 5KEJA 3I6AA 5D9XA 3P90A 5ECSA 4FQUA 2FNOA 3M3MA 4HI7A 3ZMKA 4GLTA 3R3EA 3WYWA 1JZRA 2X64A 3VI5A 1PGTA 3ZFLA 4BVYB 3MAKA 1PL1A 2VCXA 1M99A 4F0CA 4ISDA 4TOPA 3VLNA 1GULA 8GSSA 4KSMA 1IYIA 1VF1A 5EL8A 1LJRA 2OACA 2AAWA 1K0MA 5A4UA 4BVYA 5JCUA 3L0HA 5G5FA 1ZL9A 3D0ZA 2AHEA 2EFDA 2PMTA 4YAVA 4EDZA 6GSYA 4AGSA 5ECHB 1YJ6A 5DCGA 3SWLA 3LQ7A 4MPGA 5ECKB 1AQWA 1JLWA 1PMTA 1GTAA 5DAKB 2WB9A 3LXTA 3LYKA 4GF0A 4ZB9A 18GSA 1GUKA 4PQHA 1GTUA 3Q19A 3LYPA 1RK4A 13GSA 2HSNB 3NIVA 1F3AA 2C4JA 3FR9A 3HKRA 4KX4A 4YH2A 5F06A 4ZB7A 5AIVA 1XWGA 5J41A 5DAKA 3QAVA 4Q5NA 1KBNA 1BX9A 1GSQA 4RI6A 5DJLA 1FW1A 2VKZG 5F8BA 3U6VA 2HSNA 4IJIA 5BMUB 4GSNA 5D9WA 3WD6A 2A2SA 2YV7A 4GSSA 1OYJA 1HQOA 3M8NA 3F6FA 4BL7B 3ZFBA 1G6YA 3HJMA 1YVLA 1B4PA 4G10A 5DDLA 5DJMA 5AGYA 5BMUA 3O3TA 5ECNB 14GSA 3KJYA 5EY6A 4PGTA 4BL7A 5ECQB 4L5LA 4N3ZA 5A4WA 4LMWA 2CZ2A 3KMNA 1FHEA 1GSYA 1B48A 1K0NA 4PUAA 3KM6A 4J2FA 2CA8A 5AIXA 1U87A 5ECLB 4PX1A 1UA5A 1U3IA 4EXJA 4BVXB 4HZ4A 4IKHA 5J5NA 1K0BA 1E6BA 1HNBA 2F8FA 2VD0A 4WR5A 3TOTA 4F0BA 3N9JA 5A34B 3FR6A 4KE3A 1YQ1A 4MK3A 4IQ1A 3UARA 4ECIA 3KXOA 5D9VA 1SVOA 1BAYA 3UAPA 4BVXA 4ZB6A 1GLPA 20GSA 3GH6A 1EOHA 5FHIA 4K0GA 3TU3B 2ON7A 4GCIA 2AB6A 5ELAA 5A34A 1YKCA 3CSHA 3IC8A 3R2QA 3PR8A 1F2EA 4KAEA 2C3TA 4ID0A 2GTUA 3IE3A 1VF4A 1VF2A 11GSA 5ELGA 4ACSA 2R3XA 4G9HA 4NHZA 1GTBA 1GSSA 2ON5A 4Q5QA 5J4UA 3GSSA 1MTCA 1AW9A 1HNCA 2GDRA 5ECMB 3VK9A 1GUMA 4I97A 1USBA 1GSDA 4LMVA 5A5HB 1G7OA 2UZ8A 4ZB8A 3O76A 4JZQA 4Q5RA 1YDKA 3PPUA 3VPQA 3CBUA 4OFMA 1GWCA 3KTLA 4MDCA 2EFCA 5A5HA 3CWGA 16GSA 2IL3A 4OFNA 2A2RA 3HMJG 2J9HA 2HRAA 4L5OA 1PD21 2N5FA 4NHWA 2GSTA 6GSXA 4ECJA 3RBTA 4ECBA 5FWGA 4E8HA 2GLRA 4IGJA 5J4VA 1G6WA 5IQYA 4EDYA 1TU8A 4WR4A 4O92A 4YAPA 1XWKA 3ERFA 3QR6A 1PKWA 3FYGA 1LBKA 4EE0A 2VCQA 3CRTA 3GURA 3LSZA 5A1NB 3P8WA 4G0LA 4AKIA 4KF9A 1M0UA 1K0AA 2CAQA 1K0CA 4USSA 2OADA 3F6DA 1V2AA 4GSTA 1AQXA 1JLVA 1XW6A 1K3LA 1HNAA 1OE7A 2WJUA 2V6KA 4KGIA 4MZWA 5A1NA 3TOUA 4AI6A 3IR4A 5D9TA 5A4VA 4G01A 1B8XA 2OT3A 2UV8G 4ECCA 1BF5A 3BBYA 2IMKA 1U88A 1K3OA 1V40A 4PNGA 1BG1A 7GSSA 2YV9A 6GSWA 5A5KA 4YQVA 2VD1A 19GSA 4YQUA 5LD0A 5AISA 4AKHA 5B7CA 1YY7A 5JCWA 12GSA 1Y1UA 1TXUA 2VCTA 9GSSA 4ZBBA 3UBKA 3IK9A 3G7IA 4KH7A 4W66A 1GTIA 4IELA 2R4VA 5J40A 2WS2A 3W8SA 3LG6A 1IYHA 2O5VA 4AKGA 4IQAA 1OKTA 2F3MA 5ECOB 4PNFA 4IW9A 4ZXGA 2WDUA 2HNLA 3IBHA 1PKZA 2C3QA 3N5OA 1MD3A 3UBLA 4JEDA 4EC0A 2EFHA 1BYEA 3UVHA 2PVQA 1K0OA 5F0GA 4PQIA 2FHEA 4N0VA 3CSIA 4IS0A 1GSUA 5J47A 4MPFA 3ISOA 2OA7A 2D2ZA 4K0NA 3MDKA 5FT3A 6GSSA 5LCZA 4MF6A 4OMVA 5HFKA 2C3NA 2DSAA 4G0IA 5DQSA 3GSTA 3KMOA 4HOJA 4HZ2A 4AKXB 1NHYA 1K0DA 1SVLA 3QAGA 3I69A 3H1NA 5ECIB 4PXOA 5J4YA 1R5AA 1EOGA 3CRUA 1Y6EA 3PGTA 1PX6A 2JL4A 1F3BA 1TU7A 1GNEA 1DUGA 2PGTA 3M0FA 4GDFA 2H1LA 1C72A 2C80A 4Q5FA 2CAIA 5D73A 3FRCA 4HJ2A 1M9AA 1A0FA 2VCWA 3VI7A 4MF7A 1M9BA 1K3YA 2C8UA 1BG5A 1N25A 1EV9A 22GSA 3HJOA 2YCDA 3Q74A 4O7HA 3FY7A 4G0KA 5DALB 3FR3A 3DGQA 3G7JA 1ZGNA 1PX7A 3VURA 2R5GA 4QQ7A 1Z9HA 2DC5A 2HQTA 4RI7A 2VO4A 1Q4JA 5GSTA 1AQVA 3LJRA 3C8EA 2GSQA 1N2AA 4CHSA 3IK7A 3GX0A 5AN1A 1TDIA 4PURA 4IVFA 3F63A 2PBJA 4IBPA 3GTUB 3Q18A 4KDUA 5DALA 3LXZA 4ZBDA 3TGZA 4GTUA 4E8EA 5G5EA 1GLQA 2CVDA 2LJRA 4MF5A 3VPTA 1MD4A 2HSMB 2HRKA 1XW5A 4PTSA 1PA3A 3GTUA 3DD3A 1AXDA 1EEMA 3QAWA 6GSTA 3ZMLA 1ML6A 5F05A 1EV4A 2GSSA 2IMIA 3LFLA 3VWXA 2PERA 2HRKB 1GUHA 3CSJA 2NTOA 4KDXA 1OE8A 4G19A 2EFEA 1VF3A 3M1GA 1GNWA 4JBBA 4ZBAA 3AY8A 4F03A 3ERGA 2CZ3A 2VCZA 2WRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A5H A;  5A1N B;  5BMU B;  4AKG A;  5A34 A;  5A5H B;  5A1N A;  4AKH A;  4ZB7 A;  4W66 A;  4AKI A;  4AI6 A;  5A34 B; 
#chains in the Genus database with same CATH topology
 1GSE A;  4MP4 A;  5GSS A;  6GSV A;  2R6K A;  4QMK A;  5EVO A;  1GSF A;  1PL2 A;  6GSU A;  4OFT A;  4L8E A;  1TW9 A;  1PN9 A;  10GS A;  4DEJ A;  1SVM A;  17GS A;  5ECP B;  5ECR B;  5GZZ B;  4NAX A;  5F07 A;  2HSM A;  2VCV A;  4E68 A;  4KDY A;  3EIN A;  3GUS A;  3EE2 A;  4YQM A;  2GSR A;  5KEJ A;  3I6A A;  5D9X A;  3P90 A;  5ECS A;  4FQU A;  2FNO A;  3M3M A;  4HI7 A;  3ZMK A;  4GLT A;  3R3E A;  3WYW A;  1JZR A;  2X64 A;  1I1I P;  1PGT A;  3VI5 A;  3ZFL A;  4BVY B;  3MAK A;  1PL1 A;  2VCX A;  1M99 A;  4F0C A;  4ISD A;  4TOP A;  3VLN A;  1GUL A;  8GSS A;  4KSM A;  2WW3 A;  1IYI A;  1VF1 A;  5EL8 A;  1LJR A;  2OAC A;  2AAW A;  1K0M A;  5A4U A;  4BVY A;  5JCU A;  3L0H A;  5G5F A;  1ZL9 A;  3D0Z A;  2AHE A;  2EFD A;  1YEW C;  2PMT A;  4YAV A;  4EDZ A;  6GSY A;  4AGS A;  5ECH B;  1YJ6 A;  2WW0 A;  5DCG A;  3SWL A;  3LQ7 A;  4MPG A;  5ECK B;  1AQW A;  2WZS A;  1JLW A;  1PMT A;  1GTA A;  5DAK B;  2WB9 A;  3LXT A;  3LYK A;  4GF0 A;  4ZB9 A;  18GS A;  1GUK A;  4PQH A;  1GTU A;  3Q19 A;  3LYP A;  1RK4 A;  13GS A;  2HSN B;  3NIV A;  1F3A A;  2C4J A;  3FR9 A;  3HKR A;  4KX4 A;  4YH2 A;  5F06 A;  4ZB7 A;  5AIV A;  1XWG A;  5J41 A;  5DAK A;  3QAV A;  4Q5N A;  1KBN A;  1BX9 A;  1GSQ A;  4RI6 A;  5DJL A;  1FW1 A;  2VKZ G;  5F8B A;  3U6V A;  2HSN A;  4IJI A;  5BMU B;  4GSN A;  5D9W A;  3WD6 A;  2A2S A;  2YV7 A;  4GSS A;  1OYJ A;  1HQO A;  3M8N A;  3F6F A;  4BL7 B;  3ZFB A;  1G6Y A;  3HJM A;  1YVL A;  1B4P A;  4G10 A;  5DDL A;  5DJM A;  5AGY A;  5BMU A;  3O3T A;  5ECN B;  14GS A;  3KJY A;  5EY6 A;  4PGT A;  4BL7 A;  5ECQ B;  4L5L A;  4N3Z A;  5A4W A;  4LMW A;  2CZ2 A;  2WVZ A;  3KMN A;  1FHE A;  1GSY A;  1B48 A;  1S4B P;  1K0N A;  4PUA A;  3KM6 A;  4J2F A;  2CA8 A;  5AIX A;  1U87 A;  5ECL B;  4PX1 A;  1UA5 A;  1U3I A;  4EXJ A;  4BVX B;  4HZ4 A;  4IKH A;  5J5N A;  1K0B A;  1E6B A;  1HNB A;  2F8F A;  2VD0 A;  4WR5 A;  3TOT A;  4F0B A;  3N9J A;  5A34 B;  3FR6 A;  4KE3 A;  1YQ1 A;  4MK3 A;  4IQ1 A;  4PHZ C;  3RFR C;  3KXO A;  3UAR A;  5D9V A;  4ECI A;  1SVO A;  1BAY A;  3UAP A;  4BVX A;  4ZB6 A;  1GLP A;  20GS A;  3GH6 A;  1EOH A;  5FHI A;  4K0G A;  3TU3 B;  2ON7 A;  4GCI A;  2AB6 A;  5ELA A;  5A34 A;  1YKC A;  3CSH A;  3IC8 A;  3R2Q A;  3PR8 A;  1F2E A;  4KAE A;  2C3T A;  4ID0 A;  2GTU A;  3IE3 A;  1VF4 A;  2WW1 A;  1VF2 A;  11GS A;  5ELG A;  4ACS A;  2R3X A;  4G9H A;  4NHZ A;  1GTB A;  1GSS A;  2ON5 A;  4Q5Q A;  5J4U A;  3GSS A;  1MTC A;  1AW9 A;  1HNC A;  2GDR A;  5ECM B;  3VK9 A;  1GUM A;  4I97 A;  1USB A;  1GSD A;  4LMV A;  5A5H B;  1G7O A;  2UZ8 A;  4ZB8 A;  3O76 A;  4JZQ A;  4Q5R A;  1YDK A;  3PPU A;  3VPQ A;  3CBU A;  4OFM A;  1GWC A;  3KTL A;  4MDC A;  2EFC A;  5A5H A;  3CWG A;  16GS A;  2IL3 A;  4OFN A;  2A2R A;  3HMJ G;  2J9H A;  2HRA A;  4L5O A;  1PD2 1;  2N5F A;  4NHW A;  2GST A;  6GSX A;  4ECJ A;  3RBT A;  4ECB A;  5FWG A;  4E8H A;  2GLR A;  4IGJ A;  5J4V A;  1G6W A;  5IQY A;  4EDY A;  1TU8 A;  4WR4 A;  4O92 A;  4YAP A;  1XWK A;  3ERF A;  3QR6 A;  1PKW A;  3FYG A;  1LBK A;  4EE0 A;  2VCQ A;  3CRT A;  3GUR A;  3LSZ A;  5A1N B;  3P8W A;  4G0L A;  4AKI A;  4KF9 A;  1M0U A;  1K0A A;  2CAQ A;  1K0C A;  4USS A;  2OAD A;  3F6D A;  1V2A A;  4GST A;  1AQX A;  1JLV A;  1XW6 A;  1K3L A;  1HNA A;  1OE7 A;  2WJU A;  2V6K A;  4KGI A;  4MZW A;  5A1N A;  3TOU A;  4AI6 A;  3IR4 A;  5D9T A;  5A4V A;  4G01 A;  1B8X A;  2OT3 A;  2UV8 G;  4ECC A;  1BF5 A;  3BBY A;  2IMK A;  1U88 A;  1K3O A;  1V40 A;  4PNG A;  1BG1 A;  7GSS A;  2YV9 A;  6GSW A;  5A5K A;  4YQV A;  2VD1 A;  19GS A;  3CHX C;  4YQU A;  5LD0 A;  5AIS A;  4AKH A;  5B7C A;  1YY7 A;  5JCW A;  12GS A;  1Y1U A;  1TXU A;  2VCT A;  9GSS A;  4ZBB A;  3UBK A;  3IK9 A;  3G7I A;  4KH7 A;  4W66 A;  1GTI A;  4IEL A;  2R4V A;  5J40 A;  2WS2 A;  3W8S A;  4PI0 C;  3LG6 A;  1IYH A;  2O5V A;  4AKG A;  4IQA A;  1OKT A;  2F3M A;  5ECO B;  4PNF A;  4IW9 A;  4ZXG A;  2WDU A;  2HNL A;  2WVX B;  3IBH A;  1PKZ A;  2C3Q A;  3N5O A;  1MD3 A;  3UBL A;  4JED A;  4EC0 A;  2O36 A;  2EFH A;  1BYE A;  3UVH A;  2PVQ A;  1K0O A;  5F0G A;  4PQI A;  2FHE A;  4N0V A;  3CSI A;  4FXY P;  4PI2 C;  2WVX A;  4IS0 A;  1GSU A;  5J47 A;  4MPF A;  3ISO A;  2OA7 A;  2D2Z A;  4K0N A;  3MDK A;  2WVY A;  5FT3 A;  6GSS A;  5LCZ A;  4MF6 A;  4OMV A;  5HFK A;  2C3N A;  2DSA A;  4G0I A;  5DQS A;  3GST A;  3KMO A;  4HOJ A;  4HZ2 A;  4AKX B;  1NHY A;  1K0D A;  1SVL A;  3QAG A;  3I69 A;  3H1N A;  5ECI B;  4PXO A;  5J4Y A;  1R5A A;  1EOG A;  3CRU A;  1Y6E A;  3PGT A;  1PX6 A;  2JL4 A;  1F3B A;  1TU7 A;  1GNE A;  1DUG A;  2PGT A;  3M0F A;  4GDF A;  2H1L A;  1C72 A;  2C80 A;  4Q5F A;  2CAI A;  5D73 A;  3FRC A;  4HJ2 A;  1M9A A;  1A0F A;  2VCW A;  3VI7 A;  4MF7 A;  1M9B A;  1K3Y A;  2C8U A;  1BG5 A;  1N25 A;  1EV9 A;  22GS A;  3HJO A;  2YCD A;  3Q74 A;  4O7H A;  3FY7 A;  4G0K A;  5DAL B;  3FR3 A;  3DGQ A;  3G7J A;  1ZGN A;  1PX7 A;  3VUR A;  2R5G A;  4QQ7 A;  1Z9H A;  2DC5 A;  2HQT A;  4RI7 A;  2VO4 A;  1Q4J A;  5GST A;  1AQV A;  3LJR A;  3C8E A;  2GSQ A;  1N2A A;  4CHS A;  3IK7 A;  3GX0 A;  5AN1 A;  1TDI A;  4PUR A;  4IVF A;  3F63 A;  2O3E A;  2PBJ A;  4IBP A;  3GTU B;  3Q18 A;  4KDU A;  5DAL A;  3LXZ A;  4ZBD A;  3TGZ A;  4GTU A;  4E8E A;  5G5E A;  1GLQ A;  2CVD A;  2LJR A;  4MF5 A;  3VPT A;  1MD4 A;  2HSM B;  2WW2 A;  2HRK A;  1XW5 A;  4PTS A;  1PA3 A;  3GTU A;  3DD3 A;  1AXD A;  1EEM A;  3QAW A;  6GST A;  3ZML A;  1ML6 A;  5F05 A;  1EV4 A;  2GSS A;  2IMI A;  3LFL A;  3VWX A;  2PER A;  2HRK B;  1GUH A;  3CSJ A;  2NTO A;  4KDX A;  1OE8 A;  4G19 A;  2EFE A;  1VF3 A;  3M1G A;  1GNW A;  4JBB A;  4ZBA A;  3AY8 A;  4F03 A;  3ERG A;  2CZ3 A;  2VCZ A;  3RGB C;  2WRT A; 
#chains in the Genus database with same CATH homology
 1GSE A;  4MP4 A;  5GSS A;  6GSV A;  2R6K A;  4QMK A;  5EVO A;  1GSF A;  1PL2 A;  6GSU A;  4OFT A;  4L8E A;  1TW9 A;  1PN9 A;  10GS A;  4DEJ A;  1SVM A;  17GS A;  5ECP B;  5ECR B;  5GZZ B;  4NAX A;  5F07 A;  2HSM A;  2VCV A;  4E68 A;  4KDY A;  3EIN A;  3GUS A;  3EE2 A;  4YQM A;  2GSR A;  5KEJ A;  3I6A A;  5D9X A;  3P90 A;  5ECS A;  4FQU A;  2FNO A;  3M3M A;  4HI7 A;  3ZMK A;  4GLT A;  3R3E A;  3WYW A;  1JZR A;  2X64 A;  3VI5 A;  1PGT A;  3ZFL A;  4BVY B;  3MAK A;  1PL1 A;  2VCX A;  1M99 A;  4F0C A;  4ISD A;  4TOP A;  3VLN A;  1GUL A;  8GSS A;  4KSM A;  1IYI A;  1VF1 A;  5EL8 A;  1LJR A;  2OAC A;  2AAW A;  1K0M A;  5A4U A;  4BVY A;  5JCU A;  3L0H A;  5G5F A;  1ZL9 A;  3D0Z A;  2AHE A;  2EFD A;  2PMT A;  4YAV A;  4EDZ A;  6GSY A;  4AGS A;  5ECH B;  1YJ6 A;  5DCG A;  3SWL A;  3LQ7 A;  4MPG A;  5ECK B;  1AQW A;  1JLW A;  1PMT A;  1GTA A;  5DAK B;  2WB9 A;  3LXT A;  3LYK A;  4GF0 A;  4ZB9 A;  18GS A;  1GUK A;  4PQH A;  1GTU A;  3Q19 A;  3LYP A;  1RK4 A;  13GS A;  2HSN B;  3NIV A;  1F3A A;  2C4J A;  3FR9 A;  3HKR A;  4KX4 A;  4YH2 A;  5F06 A;  4ZB7 A;  5AIV A;  1XWG A;  5J41 A;  5DAK A;  3QAV A;  4Q5N A;  1KBN A;  1BX9 A;  1GSQ A;  4RI6 A;  5DJL A;  1FW1 A;  2VKZ G;  5F8B A;  3U6V A;  2HSN A;  4IJI A;  5BMU B;  4GSN A;  5D9W A;  3WD6 A;  2A2S A;  2YV7 A;  4GSS A;  1OYJ A;  1HQO A;  3M8N A;  3F6F A;  4BL7 B;  3ZFB A;  1G6Y A;  3HJM A;  1YVL A;  1B4P A;  4G10 A;  5DDL A;  5DJM A;  5AGY A;  5BMU A;  3O3T A;  5ECN B;  14GS A;  3KJY A;  5EY6 A;  4PGT A;  4BL7 A;  5ECQ B;  4L5L A;  4N3Z A;  5A4W A;  4LMW A;  2CZ2 A;  3KMN A;  1FHE A;  1GSY A;  1B48 A;  1K0N A;  4PUA A;  3KM6 A;  4J2F A;  2CA8 A;  5AIX A;  1U87 A;  5ECL B;  4PX1 A;  1UA5 A;  1U3I A;  4EXJ A;  4BVX B;  4HZ4 A;  4IKH A;  5J5N A;  1K0B A;  1E6B A;  1HNB A;  2F8F A;  2VD0 A;  4WR5 A;  3TOT A;  4F0B A;  3N9J A;  5A34 B;  3FR6 A;  4KE3 A;  1YQ1 A;  4MK3 A;  4IQ1 A;  3UAR A;  4ECI A;  3KXO A;  5D9V A;  1SVO A;  1BAY A;  3UAP A;  4BVX A;  4ZB6 A;  1GLP A;  20GS A;  3GH6 A;  1EOH A;  5FHI A;  4K0G A;  3TU3 B;  2ON7 A;  4GCI A;  2AB6 A;  5ELA A;  5A34 A;  1YKC A;  3CSH A;  3IC8 A;  3R2Q A;  3PR8 A;  1F2E A;  4KAE A;  2C3T A;  4ID0 A;  2GTU A;  3IE3 A;  1VF4 A;  1VF2 A;  11GS A;  5ELG A;  4ACS A;  2R3X A;  4G9H A;  4NHZ A;  1GTB A;  1GSS A;  2ON5 A;  4Q5Q A;  5J4U A;  3GSS A;  1MTC A;  1AW9 A;  1HNC A;  2GDR A;  5ECM B;  3VK9 A;  1GUM A;  4I97 A;  1USB A;  1GSD A;  4LMV A;  5A5H B;  1G7O A;  2UZ8 A;  4ZB8 A;  3O76 A;  4JZQ A;  4Q5R A;  1YDK A;  3PPU A;  3VPQ A;  3CBU A;  4OFM A;  1GWC A;  3KTL A;  4MDC A;  2EFC A;  5A5H A;  3CWG A;  16GS A;  2IL3 A;  4OFN A;  2A2R A;  3HMJ G;  2J9H A;  2HRA A;  4L5O A;  1PD2 1;  2N5F A;  4NHW A;  2GST A;  6GSX A;  4ECJ A;  3RBT A;  4ECB A;  5FWG A;  4E8H A;  2GLR A;  4IGJ A;  5J4V A;  1G6W A;  5IQY A;  4EDY A;  1TU8 A;  4WR4 A;  4O92 A;  4YAP A;  1XWK A;  3ERF A;  3QR6 A;  1PKW A;  3FYG A;  1LBK A;  4EE0 A;  2VCQ A;  3CRT A;  3GUR A;  3LSZ A;  5A1N B;  3P8W A;  4G0L A;  4AKI A;  4KF9 A;  1M0U A;  1K0A A;  2CAQ A;  1K0C A;  4USS A;  2OAD A;  3F6D A;  1V2A A;  4GST A;  1AQX A;  1JLV A;  1XW6 A;  1K3L A;  1HNA A;  1OE7 A;  2WJU A;  2V6K A;  4KGI A;  4MZW A;  5A1N A;  3TOU A;  4AI6 A;  3IR4 A;  5D9T A;  5A4V A;  4G01 A;  1B8X A;  2OT3 A;  2UV8 G;  4ECC A;  1BF5 A;  3BBY A;  2IMK A;  1U88 A;  1K3O A;  1V40 A;  4PNG A;  1BG1 A;  7GSS A;  2YV9 A;  6GSW A;  5A5K A;  4YQV A;  2VD1 A;  19GS A;  4YQU A;  5LD0 A;  5AIS A;  4AKH A;  5B7C A;  1YY7 A;  5JCW A;  12GS A;  1Y1U A;  1TXU A;  2VCT A;  9GSS A;  4ZBB A;  3UBK A;  3IK9 A;  3G7I A;  4KH7 A;  4W66 A;  1GTI A;  4IEL A;  2R4V A;  5J40 A;  2WS2 A;  3W8S A;  3LG6 A;  1IYH A;  2O5V A;  4AKG A;  4IQA A;  1OKT A;  2F3M A;  5ECO B;  4PNF A;  4IW9 A;  4ZXG A;  2WDU A;  2HNL A;  3IBH A;  1PKZ A;  2C3Q A;  3N5O A;  1MD3 A;  3UBL A;  4JED A;  4EC0 A;  2EFH A;  1BYE A;  3UVH A;  2PVQ A;  1K0O A;  5F0G A;  4PQI A;  2FHE A;  4N0V A;  3CSI A;  4IS0 A;  1GSU A;  5J47 A;  4MPF A;  3ISO A;  2OA7 A;  2D2Z A;  4K0N A;  3MDK A;  5FT3 A;  6GSS A;  5LCZ A;  4MF6 A;  4OMV A;  5HFK A;  2C3N A;  2DSA A;  4G0I A;  5DQS A;  3GST A;  3KMO A;  4HOJ A;  4HZ2 A;  4AKX B;  1NHY A;  1K0D A;  1SVL A;  3QAG A;  3I69 A;  3H1N A;  5ECI B;  4PXO A;  5J4Y A;  1R5A A;  1EOG A;  3CRU A;  1Y6E A;  3PGT A;  1PX6 A;  2JL4 A;  1F3B A;  1TU7 A;  1GNE A;  1DUG A;  2PGT A;  3M0F A;  4GDF A;  2H1L A;  1C72 A;  2C80 A;  4Q5F A;  2CAI A;  5D73 A;  3FRC A;  4HJ2 A;  1M9A A;  1A0F A;  2VCW A;  3VI7 A;  4MF7 A;  1M9B A;  1K3Y A;  2C8U A;  1BG5 A;  1N25 A;  1EV9 A;  22GS A;  3HJO A;  2YCD A;  3Q74 A;  4O7H A;  3FY7 A;  4G0K A;  5DAL B;  3FR3 A;  3DGQ A;  3G7J A;  1ZGN A;  1PX7 A;  3VUR A;  2R5G A;  4QQ7 A;  1Z9H A;  2DC5 A;  2HQT A;  4RI7 A;  2VO4 A;  1Q4J A;  5GST A;  1AQV A;  3LJR A;  3C8E A;  2GSQ A;  1N2A A;  4CHS A;  3IK7 A;  3GX0 A;  5AN1 A;  1TDI A;  4PUR A;  4IVF A;  3F63 A;  2PBJ A;  4IBP A;  3GTU B;  3Q18 A;  4KDU A;  5DAL A;  3LXZ A;  4ZBD A;  3TGZ A;  4GTU A;  4E8E A;  5G5E A;  1GLQ A;  2CVD A;  2LJR A;  4MF5 A;  3VPT A;  1MD4 A;  2HSM B;  2HRK A;  1XW5 A;  4PTS A;  1PA3 A;  3GTU A;  3DD3 A;  1AXD A;  1EEM A;  3QAW A;  6GST A;  3ZML A;  1ML6 A;  5F05 A;  1EV4 A;  2GSS A;  2IMI A;  3LFL A;  3VWX A;  2PER A;  2HRK B;  1GUH A;  3CSJ A;  2NTO A;  4KDX A;  1OE8 A;  4G19 A;  2EFE A;  1VF3 A;  3M1G A;  1GNW A;  4JBB A;  4ZBA A;  3AY8 A;  4F03 A;  3ERG A;  2CZ3 A;  2VCZ A;  2WRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...