4ZB9A

Crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium, with one glutathione disulfide bound per dimer.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
219
Chain Sequence
SHDKQFSLFLHKASAHGWKVAFVLEELSLSYEIVLVDVAKNEQKSPEFMKLNPNGRTPALIDHGNSDFVIWESNAMVQYVADKYDTERKISMAPGTDDFYIQLQWQYFQGTGQGPYFGQLVWFTLYHEEKIPSAVTRYKEEALRVFSVLERVLSNQEWLVGGKMTIADISFVSWNDMIVHFLDNFDFEKEFPATAAWHYKMLKRPTIKRPWDERRKLMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcUre2p8
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 78
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zb9A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zb9A01
3FHKA 4K2DA 2XC2A 1FW1A 4KDUA 5JCGA 4NAXA 4PURA 3CTGA 3UBKA 2FD3A 2FLSA 4K7OA 2GQMA 4OCEA 4X0XA 2HQTA 5D9TA 1WE0A 2LRTA 1TK8B 3C71A 1R5PA 2C3TA 5GAPD 1TU8A 2GSRA 3L9VA 2B3SA 2VCXA 5EY6A 3DVXA 5IO0A 5G31A 3QFBC 4ILFA 1QXHA 1ERUA 1Z3EA 3EC3A 3NZNA 4BVXA 1LJRA 2PGTA 3UARA 5D9VA 2H01A 3GL5A 2ON7A 3CSJA 1WRYA 3LSZA 3KD0A 1SL2B 3VI7A 4J56E 2XBQA 4MJBA 4ZXGA 1BAYA 2LRNA 1M7TA 3UMAA 2B6MA 4G0IA 2ON5A 4X1UA 3KH7A 2FA8A 3ISOA 1TJDA 4HUAA 1FVKA 4KB3A 3GH9A 5AIXA 1FOVA 2IL3A 3GFKA 2FWHA 3I9V2 4ACSA 4MK3A 3APOA 1QQ2A 3G7YA 3KJYA 5DAKB 1SJIA 1G6YA 4ZILA 4FYBA 3DEXA 2GSSA 1CQHA 3Q18A 4I2UA 4O5RA 3MNGA 1OKTA 1GSEA 1EGRA 5D9XA 4EVMA 4HQSA 4Q5RA 1O7UA 3GL3A 3K8NA 4OMVA 3CMIA 2HRFA 4TR1A 18GSA 3DGQA 1ACVA 3HCZA 4HQZA 4MMMA 1OC3A 1S3DA 1AXDA 5B8BA 1F37A 2E2MA 2JL4A 5G5FA 4ZIJA 1T3BA 4MF5A 3RPNA 1H75A 3E0UA 5KEJA 4KE3A 5HR0A 3IBHA 3TRXA 2A4VA 3LYPA 2P5RA 1X5EA 3N9JA 2H8LA 4X43A 4GSSA 3UVHA 5J41A 5J4UA 2BTOT 1K0NA 4FH8A 3FEUA 4MJCA 2BMXA 5GSSA 1PL1A 1TXXA 2B5XA 5B7CA 1MD3A 4GXZA 1PL2A 7GSSA 1H4OA 4POKA 4L5LA 5F8BA 3P2AA 1EEMA 4KSMA 1XZOA 5IM9A 1A23A 3RDWA 2K8SA 3TRQA 3A5WA 1O6JA 1ZYQB 3F3QA 1U87A 4XTSA 2PMTA 1SYXA 3QOUA 3ZIVA 1SK0A 4WEYA 2ZCTA 3QAWA 1VGLA 3F6FA 2L59A 4DSQA 3CSHA 4HI7A 2LJAA 4IS0A 3MWHA 2GDRA 2R2JA 3A2VA 1JHBA 2NBSA 2C0FA 2JACA 1X9MB 2CT6A 4TXOB 2OA7A 4MF6A 2R37A 3GX8A 1R26A 4GWRA 1DE1A 3DMLA 1OE7A 1X9SB 1ZCPA 5DBQA 1THOA 1T7PB 2X8GA 1AC1A 5ECPB 3KP8A 4JRRA 4Z7XA 1M2DA 2C80A 4TR1B 1A8LA 1B8XA 4RUVA 1M2BA 3KIJA 2V6KA 1Y25A 1E2YA 1YEPA 2E0QA 1FB0A 3NIVA 4PX1A 4NV2A 5JWRB 2VIMA 4WR4A 3IC8A 3GKXA 3D5JA 3D4TA 2ES7A 2HRNA 1PA3A 4HDEA 1N8JA 3HKRA 2GT6A 10GSA 5HFIA 3QD9A 4NHZA 1PSQA 2LTKA 4POBA 3UJ1A 4EDZA 5CREA 1GSDA 1GUMA 2G0FA 2L57A 1NSWA 4TN8A 3LFLA 2GT5A 4H86A 1XFLA 2OE3A 1YKAA 2J9HA 2H6XA 2V1MA 4DEJA 1F3AA 4NWYA 3EU3A 1W4VA 4P3YB 5ECKB 4IELA 4XRAA 2YWNA 1LBKA 1GSFA 4TR0A 2WRTA 5C00A 3ZITA 2LSTA 3LJRA 4ISDA 3I6AA 3IXRA 3EURA 3IPZA 2M72A 5CRHA 2OBIA 2REMA 2VCTA 5ECQB 4JZQA 1X5CA 1U3AA 1SKSB 1ZZYA 4USSA 1IYHA 1USBA 5D73A 3WYWA 2KHPA 3VI5A 4MH3A 4N0ZA 2F8AA 2LQOA 17GSA 1VF1A 2PPTA 2I81A 4K1FA 2DBCA 1EP8A 3E9JB 1K0AA 5ECMB 5A4WA 2N5FA 4CHSA 3IE3A 4F82A 4TR4A 5ELGA 4K0GA 3CRUA 4KCAA 1T4ZA 2KP2A 3JCML 5ECHB 1R5AA 5H5RA 6GSYA 5IMCA 3LYKA 5A4VA 3P90A 4F0BA 2JZRA 4GTUA 3PR8A 3RBTA 6GSXA 3TOUA 1YDKA 2WDUA 2PN8A 2H66A 2I3YA 4MCUA 4WBJA 3US3A 1SL0B 1E6BA 3M9JA 1B9XC 2DSAA 2MMZA 1F6MC 5DQSA 1ZMAA 3MSZA 1O8WA 1Z5YE 3VWWA 2WS2A 4N11A 1XW6A 1GTBA 12GSA 5KN2A 3RHCA 1AW9A 2JU5A 5F06A 3ERWA 1FAAA 14GSA 1Y6EA 3EYTA 1F9MA 3KCMA 4IP1A 1TU7A 1TW9A 2JZSA 3FW2A 2IFQA 1WWJA 2KUCA 2XPDA 5JCUA 4ZL7A 4LA1A 1T4YA 4G0KA 5J9BA 3LORA 4N30A 2O7KA 3LGCA 1T8EB 2GZPA 3HA9A 1UA5A 3DWVA 4N10A 4AJ7A 1GRXA 1EEJA 4GSTA 1XVWA 1LU4A 2MMNA 2RIIA 5ECLB 4NPBA 1PN9A 2WZ9A 2C1YA 3QAVA 3GRXA 4EF0A 4DSSA 1XCCA 1BQ7A 1UVZA 4I97A 2YWIA 2YNXA 4ID0A 4BWQA 5GZZB 4YQUA 4QL9A 1O81A 3VURA 5DJLA 20GSA 4MPGA 5F05A 1FB6A 3QMXA 4ECCA 4NXIA 2E7PA 5IOWA 1U88A 2GS3A 3HXSA 1A2MA 2WJUA 1K3YA 3F4RA 2G2QA 1AQWA 6GSTA 5DCHA 5E4WA 4AJ6A 3UEMA 2B1KA 2HT9A 4WXTA 1GTUA 1ZL9A 4JEDA 3LEFA 5FHIA 1XIYA 3C7MA 1OC9B 2R6KA 2V6OA 1Q98A 2Z9SA 3GX0A 2DIYA 2VOCA 2GZZA 5AISA 3KMOA 1BJXA 1C72A 1O8XA 2MZCA 2DJ3A 5ECOB 3VK9A 3EU4A 3ZLPA 1AAZA 1RQMA 1ZGNA 3TKPA 4KSOA 4GQFA 2YP6A 3BOAA 4MF7A 2H70A 4XIHA 1R7HA 2IFQB 4KDXA 3CRTA 3IHQA 5ECIB 3F8UA 3KMNA 4N0VA 4IJIA 3QDNA 1XPVA 1RW1A 3UVTA 3ZFBA 3ERGA 1K3OA 2FWFA 2GGTA 2TIRA 2X99A 2VLVA 3IK9A 2O8VB 2M80A 2L5LA 4KW6A 5HQPA 1BYEA 1VRSD 2DC5A 2WCIA 2YWOA 1B4PA 2OACA 1M99A 1GSSA 1YKCA 2GQLA 3D22A 3ZL5A 2XBIA 3F4TA 4NHWA 3TJGA 1A2JA 1HNCA 4ECJA 5IMFA 4DSSB 1XWBA 1SL1B 22GSA 3PPUA 4EL1A 2H6YA 3TRPA 3GN3A 1QUWA 5G1KA 3Q19A 1UN2A 1ILOA 3TCOA 3IRAA 4NV5A 3I69A 4ZL8A 1SJZA 1YZXA 4IKHA 3GSSA 2HE3A 3FZ9A 2OJLA 2I9HA 4DSRA 4J2FA 5DVBA 2MMOA 2RM5A 4G10A 3GA4A 2FA4A 2C0EA 1M0UA 1PX7A 2CA8A 5HFKA 2WULA 2EC4A 4IBPA 3KXOA 2HYXA 2FNOA 1JZWA 4KNDA 1WIKA 4IQAA 4I8BA 3L9UA 2A2RA 5KN3A 1X0RA 2QGVA 4CDOA 2TRXA 4KH7A 4TKYA 3BBYA 3FR9A 4OO5A 4WETA 4K7NA 3F4SA 4WBRD 2YV9A 5IIZA 4OD7A 2R4VA 3GYKA 1URMA 1WP0A 5ELAA 1OVNA 4IN0A 3GKMA 4QL7A 3TKSE 2CAQA 2XPEA 5G1LA 4IJ3A 5J9CA 2HRKA 4ZL9A 2QSIA 5DJMA 5B6MA 2H1GA 4BVXB 4OFMA 1PX6A 3CTFA 3IR4A 2MYGA 3IA1A 5FWGA 2VO4A 1K3LA 4HEA2 4D73A 1ZYEA 5H5SA 4O7HA 2VCZA 8GSSA 3FKFA 4F9ZA 1YF0A 2IMFA 2CX4A 1TRUA 1G7EA 11GSA 3UOMA 1IYIA 5ENUA 3HVSA 3H1NA 2VL2A 2LUSA 3BCKA 3M1GA 2NVLA 3TKSA 5B8AA 1BEDA 4EC0A 3J7Yb 4Q5QA 3U5RE 2WGRA 2H1AA 4RI6A 4PNGA 2GVPA 1EP7A 1V9WA 1GSUA 2FGXA 5GSTA 5LCZA 2HRAA 2KLXA 2AJQB 1V58A 4I5QA 1B4QA 3P7XA 4GF0A 1EV9A 3H4KA 1K0MA 1HNBA 5EPFA 3EMXA 4EKZA 1GTIA 1FG4A 5A4UA 3APSA 4IQ1A 1K0BA 2B7KA 5L71A 1AUCA 2RM6A 4YQVA 3ZYWA 5A5KA 3VPQA 2L4QA 3WGDA 4TW5A 3GMFA 3IOSA 2VCWA 3KM6A 1S3AA 2HXKA 4EO3A 4ZBDA 2RLIA 2M46A 4FO5A 4K6XA 4MJAA 5ABRA 5J3RA 4E8HA 4MLYA 4FQUA 4V2NA 3F63A 4ZBAA 4XCSA 2IMIA 3NOFA 3CYNA 2OE0A 4WKWA 5FT3A 2H72A 3DXBA 1DSBA 4PQIA 1SU9A 1QMVA 3TB2A 3W6GA 1A2LA 3LWAA 3S9FA 1SJ6A 3ZREA 2HRKB 1B9YC 5ID2A 3QFAC 4ML1A 2PUKC 5G2ZA 4E8EA 1FHEA 4KDYA 2B5YA 3EMPA 4ZB6A 1QGVA 1MD4A 1PQNA 3TOTA 2VL9A 4PQHA 2LNSA 4CW9A 5DCGA 1WPIA 6GSUA 3HHVA 1PRXA 5IPGA 4FYCA 4D73B 3H79A 5COHA 2DJJA 2YJ7A 1TTZA 2MBTA 2EIQA 2IWTA 4KX4A 1QK8A 4YQMA 6GSSA 3Q6OA 1TI1A 3IAS2 3IV4A 4BWSA 1YF1A 2L5OA 4GSNA 1VF3A 3HDCA 3WD6A 2IN3A 2AHEA 1TRSA 4QQ7A 2YWMA 2DJ2A 3L9SA 2YV7A 1V40A 4OWYA 1EWXA 4BVYA 1BG5A 4ECIA 1XW9A 4WR5A 1RK4A 3LXZA 3F3RA 2AUVA 1V98A 4EE0A 3I43A 2BJXA 4EXJA 5CAXA 3R3EA 2GQKA 3GNJA 1JLWA 1JLVA 4GQCA 5ECRB 4HZ2A 1G7OA 3DYRA 3L78A 2VM1A 5D93A 1JZOA 4L8EA 2LNTA 1XWCA 3FYGA 4TRXA 1O85A 3D0ZA 2XHFA 3QCPA 3VWUA 1J9BA 9GSSA 3RPPA 5IMVA 1ERTA 4POLA 2VD0A 16GSA 2YOIA 4KGIA 1I9DA 1GSYA 2YCDA 1T00A 2PWJA 1ABAA 2C8UA 2D2ZA 3MDKA 4XRDA 3FZAA 1HD2A 5ID2B 4PQ1A 3ZTLA 5D96A 1O73A 1MEKA 2ALBA 3ERFA 3WT1A 3M9KA 2GTUA 5CRDA 2IMKA 2VL2C 3C1RA 4POMA 5CP1A 3PH9A 1HNAA 3TKSC 1ML6A 5B6NA 1NHOA 1F3BA 1GWCA 1KNGA 2QC7A 4FYUA 1TRWA 4TXVA 1YY7A 1EZKA 4GCIA 4KUNA 4OCFA 5CRGA 4ZBBA 1GP1A 1OAZA 1S3CA 3KZQA 1X5DA 4XS1A 2HZEA 3CSIA 1M2AA 3D21A 2VL3A 3EE2A 1GNEA 1K0CA 5CNWA 2FY6A 4K7IA 3KH9A 1Z7PA 2L6CA 4NMUA 1XOBA 2OKAA 3F9UA 1SK2A 2F8FA 3ZRDA 1THXA 3A3TA 2WFCA 4BVYB 4AJ8A 1XOAA 2I1UA 4ECBA 2LRCA 1AQXA 2DMLA 3H8QA 1K0DA 4OFNA 2OADA 1MDJA 5ECNB 4IGJA 3GH6A 4Q5FA 1HYUA 5JWQB 1MDIA 2HSHA 1M9BA 3BJ5A 1V2AA 5ECSA 1SENA 5G5EA 1OE8A 3J7Yk 2A2SA 4JU5A 3QAGA 1GNWA 3TKQA 4HU9A 1J0FA 3WGXA 5LD0A 3O6TA 5H5QA 1TI3A 2DIZA 4PGTA 2V2GA 4IW9A 3DVWA 1QFNA 2IMDA 3HZ4A 1ST9A 2J23A 2YPMA 3EVIA 1A0RP 3FZ4A 1TDIA 5CYYA 1EOGA 3SWLA 3FK8A 2VCVA 1MTCA 4HJMA 5EVOA 1ON4A 2YZHA 4XS4A 4MDCA 1JZRA 4V2LA 2PVOC 2F51A 2K9FA 2H71A 3VFIA 3GTUA 2FCHA 1TRVA 5AN1A 2DMMA 3RAZA 4V1Ap 4F0CA 1VF4A 3HJMA 4MZCA 4XHMA 2HLSA 2HZFA 3ZMLA 2DJ1A 2N5BA 3ME8A 2LS5A 4LLRA 1SKWB 2JZTA 3R2QA 4MZWA 3HYPA 4O32A 3EINA 1J08A 4Q5NA 2HZEB 2VLUA 3QR6A 3H93A 2FWEA 2HI7A 3N5OA 3C73A 3WT2A 4G19A 4XS6A 2ZUPA 4GRFA 1CQGA 4MPFA 3LQ7A 3LG6A 3L4NA 1EOHA 4V1Ag 1EGOA 2P0GA 2H76A 3G9BA 3C8EA 2CVBA 2HSMA 2KOKA 4LMVA 2CX3A 2CQ9A 2H75A 3GIXA 2VLTA 2JSZA 2MBSA 2PERA 3TDGA 1TOFA 2L4CA 2JSYA 3HJPA 3CBUA 3F0IA 1FO5A 2F3MA 2IPAA 4OFTA 4YAVA 4TXOA 1UC7A 4TVEA 2IJYA 1R4WA 3O3TA 2HNLA 3AY8A 2C0DA 1Z9HA 2OBKA 3P8WA 1A0FA 2WB9A 1ERWA 5BMUA 4K9ZA 3ZZXA 4TR3A 3G7IA 1GULA 3FRCA 2IMEA 5IMDA 1SD9A 4TOPA 3DKSA 4L5OA 3ZMKA 3IDVA 2EIOA 1GUKA 1YJ6A 3UIWA 1SYRA 4ZB8A 1KTEA 2H1DA 5DALA 1JZDA 5C04A 3FR6A 1NW2A 1NM3A 4XS4B 3W8SA 2EIRA 2YN1A 1K0OA 3CXGA 1N2AA 1PD21 2PBJA 13GSA 1VF2A 3GTUB 2UZ8A 4PXOA 4RI7A 3TKRA 2O85A 1U6TA 5IOXA 2GSTA 2DJKA 2V41A 2LJRA 2PVQA 3E3EA 4MABA 1Z6MA 4ULXA 5IO2A 4IP6A 2OE1A 4AF2A 4KCEA 1TP9A 5INYA 2C4JA 1MDKA 4LL1B 1XWAA 3C1SA 1TKDB 2YZUA 1I5GA 1TK0B 4IVFA 1XXUA 3MAKA 4PNFA 2B1LA 3WGEA 1M9AA 2CV4A 1PGTA 5JCWA 1XVQA 3GV1A 4JE1A 3IK7A 3ZVJD 3DD3A 3KTLA 3TJFA 3DRNA 1GH2A 6GSVA 2HSMB 3A2XA 2O87A 5LNKe 3V1WA 3GKKA 3Q74A 3O76A 4I6XA 1A8YA 3GHAA 4RQRA 2IIYA 3ZVJA 2H1BA 4F03A 4MA9A 1GSQA 5DQYA 2V32A 1NHYA 4I2TA 2YANA 4L0UA 1DUGA 3GKNA 5JWOB 1YEXA 2CVKA 2L6DA 2DLXA 3UL3A 4IHUA 3ZIJA 1XWGA 4BA7A 2P5QA 1Z6NA 2H30A 5J5NA 4EDYA 2TRCP 4G9HA 4YAPA 1TK5B 1ERVA 3UAPA 3L0HA 4JR6A 2FHEA 2C3QA 1SKRB 5HR2A 3UBLA 1WOUA 5IPHA 1G6WA 5DALB 4G0LA 5F0GA 3LXTA 2GZYA 3GURA 3APQA 3QPMA 4FIWA 4HS1A 1WJKA 3M8NA 2HFDA 1KBNA 3FZ5A 2K18A 2ZNMA 5HR3A 4HOJA 4MJEA 2R5GA 2K6VA 2NDOA 5DDLA 2NPBA 2JADA 3F6DA 5IQYA 4OO4A 2LJKA 3W8JA 5EL8A 1HQOA 2FUG2 1Q4JA 5CO3A 3FY7A 4HU7A 2CVDA 4AGSA 4PUAA 4HZ4A 2E2GA 2K8VA 2H0HA 2R3XA 2AYTA 2B7JA 3DIEA 4WF5A 4V2MA 3VWXA 5HFGA 1KEBA 1A24A 2H0GA 3RHBA 2LEGA 3KTBA 3M3MA 3U6VA 19GSA 3TGZA 1GUHA 2LV3A 1W89A 1U3IA 4PUFC 1Z7RA 1AIUA 1XWKA 2CZ3A 1PMTA 1XBSA 3GUSA 5F07A 1YQ1A 5D9WA 1ZOFA 1SK1A 2VAFA 3TJBA 1JFUA 3KEBA 2CZ2A 5IMZA 2N5AA 2HSYA 4GLTA 6GSWA 2I4AA 5D8IA 2AB6A 2LQQA 2C0GA 2YJHA 2P31A 1F2EA 2H6ZA 4BL7A 4MH2A 1OC9A 1G0TA 3ME7A 4ML6A 4MZBA 4BPYA 2VD1A 2DJ0A 2X8CA 4G2EA 2AAWA 2QKEA 2RUFA 4PTSA 4LMWA 4DVCA 4L0WA 1OKDA 1EV4A 3FR3A 3A2WA 3ED3A 1XW5A 3TUEA 2VM2A 2NTOA 1DBYA 3PINA 5CRWA 3OR5A 1V57A 3HVVA 3BCIA 1GLPA 3VLNA 2VUPA 3HY2A 4LL4B 5GAND 4KF9A 5E59A 4KA0A 3KGKA 4JR4A 5IMAA 3VWVA 2VCQA 4KAEA 3SBCA 1B48A 1GTAA 4RQXA 5G30A 2FWGA 4K0NA 3HVXA 1GLQA 5AGYA 2AV4A 1GL8A 4EUYA 2B5EA 3D4MA 2GSQA 1OYJA 3M0FA 4O92A 1WMJA 3TJKA 4MP4A 3GSTA 4HJ2A 3BD2A 3ZFLA 2RUEA 2PU9C 1BX9A 2LKUA 1T1VA 2H19A 3EWLA 4JBBA 2C3NA 5DAKA 1X9WB 1PKWA 2H73A 2MMAA 2X8HA 3KP9A 3HD5A 5KN1A 4ZB9A 3VPTA 1AQVA 5AIVA 3HZ8A 4K8MA 2CAIA 2GLRA 4F2IA 3G7JA 3IAM2 2H0IA 2O89A 2X64A 1SD8A 4J57E 4YH2A 1DE2A 1PKZA 4BL7B 3HJOA 3D6IA 4WF4A 3TJJA 1OC8A 2KP1A 5KN0A 5HR1A 2H74A 1FVJA 3IC4A 3PGTA 2F9SA 2HSNB
chains in the Genus database with same CATH superfamily
3FHKA 4K2DA 2XC2A 1FW1A 4KDUA 5JCGA 4NAXA 4PURA 3CTGA 3UBKA 2FD3A 2FLSA 4K7OA 2GQMA 4OCEA 4X0XA 2HQTA 5D9TA 1WE0A 2LRTA 1TK8B 3C71A 1R5PA 2C3TA 2EFDA 5GAPD 1TU8A 2GSRA 3L9VA 2B3SA 4PHZC 2VCXA 5EY6A 3DVXA 5IO0A 5G31A 3QFBC 4ILFA 3LW9A 1QXHA 1ERUA 1Z3EA 3EC3A 3NZNA 4BVXA 1LJRA 2PGTA 3UARA 5D9VA 2H01A 3RGBC 3GL5A 2ON7A 1YEWC 3CSJA 1WRYA 3LSZA 3KD0A 1SL2B 3VI7A 4J56E 2XBQA 4MJBA 4ZXGA 1BAYA 2LRNA 1M7TA 3UMAA 2B6MA 4G0IA 2ON5A 4X1UA 3KH7A 2FA8A 3ISOA 1TJDA 4HUAA 1FVKA 4KB3A 3GH9A 5AIXA 1FOVA 2IL3A 3GFKA 2FWHA 3I9V2 4ACSA 4MK3A 3APOA 1QQ2A 3G7YA 3KJYA 5DAKB 1SJIA 1G6YA 4ZILA 4FYBA 3DEXA 1N25A 2GSSA 1CQHA 3Q18A 4I2UA 4O5RA 3MNGA 1OKTA 1GSEA 1EGRA 5D9XA 4EVMA 4HQSA 4Q5RA 1O7UA 3GL3A 3K8NA 4OMVA 3CMIA 2HRFA 4TR1A 18GSA 3DGQA 1ACVA 3HCZA 4HQZA 4MMMA 3CWGA 1OC3A 1S3DA 1AXDA 5B8BA 1F37A 2E2MA 2JL4A 5G5FA 4ZIJA 1T3BA 4MF5A 3RPNA 1H75A 4EIPA 2WVXA 3E0UA 5KEJA 4KE3A 5HR0A 3IBHA 3TRXA 2A4VA 3LYPA 2P5RA 1X5EA 3N9JA 2H8LA 4X43A 4GSSA 3UVHA 5J41A 5J4UA 2BTOT 1K0NA 4FH8A 3FEUA 4MJCA 2BMXA 5GSSA 1PL1A 1TXXA 2B5XA 5B7CA 1MD3A 4GXZA 1PL2A 7GSSA 1H4OA 4POKA 4L5LA 5F8BA 3P2AA 1EEMA 4KSMA 1XZOA 5IM9A 1A23A 3RDWA 2K8SA 3TRQA 3A5WA 1O6JA 1ZYQB 3F3QA 1U87A 4XTSA 2PMTA 1SYXA 3QOUA 3ZIVA 4N3ZA 1SK0A 4MNNA 2ZCTA 4WEYA 3QAWA 1VGLA 3F6FA 5A34A 2L59A 4DSQA 3CSHA 4HI7A 2LJAA 4IS0A 3MWHA 2GDRA 2R2JA 3A2VA 1JHBA 2NBSA 2C0FA 2JACA 1X9MB 2CT6A 4TXOB 2OA7A 2R37A 4MF6A 3GX8A 2H1LA 1R26A 4GWRA 1DE1A 3DMLA 1OE7A 1X9SB 1ZCPA 5DBQA 1THOA 1T7PB 4YKGA 2X8GA 1AC1A 5ECPB 3KP8A 4JRRA 4Z7XA 1M2DA 2C80A 4TR1B 1A8LA 1B8XA 2X4AA 4RUVA 1M2BA 3KIJA 2V6KA 1Y25A 5A1NA 1E2YA 1YEPA 2E0QA 1FB0A 3NIVA 4K2XA 4PX1A 4NV2A 5JWRB 2VIMA 4WR4A 3IC8A 3GKXA 2WVXB 3D5JA 3D4TA 2ES7A 2HRNA 1PA3A 4HDEA 1N8JA 3HKRA 2GT6A 10GSA 5HFIA 3QD9A 4CY6A 4NHZA 2WW1A 1M3IA 1PSQA 2LTKA 4POBA 3UJ1A 4EDZA 5CREA 1GSDA 1GUMA 2G0FA 2L57A 1NSWA 4TN8A 3LFLA 2GT5A 1XFLA 4H86A 2OE3A 1YKAA 2J9HA 2H6XA 2V1MA 4DEJA 1F3AA 4NWYA 3EU3A 5A5HA 1W4VA 4P3YB 5ECKB 4IELA 4XRAA 2YWNA 1LBKA 1GSFA 4TR0A 2WRTA 5C00A 3ZITA 2LSTA 3LJRA 4ISDA 3I6AA 3IXRA 3EURA 3IPZA 2M72A 5CRHA 2OBIA 2REMA 2VCTA 5ECQB 4JZQA 1X5CA 1U3AA 1SKSB 1ZZYA 4USSA 1IYHA 1USBA 5D73A 3WYWA 5A34B 3VI5A 2KHPA 2WW3A 4MH3A 4N0ZA 2F8AA 2LQOA 17GSA 1VF1A 2PPTA 2I81A 4K1FA 2DBCA 1EP8A 3E9JB 1K0AA 5ECMB 5A4WA 2N5FA 4CHSA 3IE3A 4F82A 4TR4A 5ELGA 4K0GA 1FOHA 3CRUA 4KCAA 1T4ZA 2KP2A 3JCML 5ECHB 1R5AA 5H5RA 6GSYA 5IMCA 3LYKA 5A4VA 3P90A 4F0BA 2JZRA 4GTUA 3PR8A 3RBTA 6GSXA 3TOUA 1YDKA 2WDUA 2PN8A 2H66A 2I3YA 4MCUA 4WBJA 3US3A 1SL0B 1E6BA 3M9JA 1B9XC 2DSAA 4AKXB 2MMZA 1F6MC 5DQSA 1ZMAA 3MSZA 1O8WA 1Z5YE 3VWWA 2WS2A 4N11A 1XW6A 1GTBA 12GSA 5KN2A 3RHCA 1AW9A 2JU5A 5A1NB 5F06A 3ERWA 1FAAA 14GSA 1Y6EA 3EYTA 1F9MA 3KCMA 4IP1A 1TU7A 1TW9A 2JZSA 3FW2A 2IFQA 1WWJA 2KUCA 2XPDA 5JCUA 3HMJG 2WVZA 4ZL7A 4LA1A 1T4YA 5A5HB 4G0KA 5J9BA 3LORA 4N30A 2O7KA 3LGCA 1T8EB 2GZPA 3HA9A 1UA5A 3DWVA 4N10A 4AJ7A 1GRXA 1EEJA 4GSTA 1XVWA 1LU4A 2MMNA 2RIIA 5ECLB 4NPBA 1PN9A 2WZ9A 2C1YA 4G01A 3QAVA 3GRXA 4EF0A 4DSSA 1XCCA 1BQ7A 1UVZA 4I97A 2YWIA 2YNXA 4ID0A 4BWQA 5GZZB 4YQUA 4QL9A 1O81A 3VURA 5DJLA 1M3JA 20GSA 4MPGA 5F05A 3RFRC 1FB6A 3QMXA 4ECCA 4NXIA 5BRTA 2E7PA 5IOWA 1U88A 1YVLA 2GS3A 3HXSA 1A2MA 2WJUA 1K3YA 3F4RA 2G2QA 1AQWA 1ZYNA 6GSTA 5DCHA 5E4WA 4AJ6A 3UEMA 2B1KA 2HT9A 4WXTA 1GTUA 1ZL9A 4JEDA 3LEFA 5FHIA 1XIYA 2A2PA 3C7MA 1OC9B 2R6KA 2V6OA 1Q98A 4QMKA 2Z9SA 3GX0A 2DIYA 2VOCA 2GZZA 5AISA 3KMOA 2DKIA 1BJXA 1C72A 1O8XA 2MZCA 2DJ3A 5ECOB 3VK9A 3EU4A 3ZLPA 1AAZA 1RQMA 1ZGNA 3TKPA 4KSOA 4GQFA 2YP6A 3BOAA 4MF7A 2H70A 4XIHA 1R7HA 2IFQB 4KDXA 3CRTA 3IHQA 5ECIB 3F8UA 3TU3B 3KMNA 4N0VA 4IJIA 3QDNA 1XPVA 1RW1A 2R0PA 3UVTA 3ZFBA 3ERGA 1K3OA 2FWFA 2GGTA 2WVYA 2TIRA 2X99A 2VLVA 3IK9A 2O8VB 2M80A 2L5LA 4KW6A 5HQPA 1BYEA 1VRSD 2DC5A 2WCIA 2YWOA 1B4PA 2OACA 1M99A 1GSSA 1YKCA 4W66A 2GQLA 3D22A 3ZL5A 2XBIA 3F4TA 4NHWA 2QA1A 3TJGA 1A2JA 1HNCA 4ECJA 5IMFA 4DSSB 1XWBA 4AI6A 1SL1B 22GSA 3PPUA 4EL1A 2H6YA 3TRPA 3GN3A 1QUWA 5G1KA 3Q19A 1UN2A 2OT3A 1ILOA 3TCOA 3IRAA 4NV5A 3I69A 4ZL8A 1SJZA 1YZXA 4IKHA 2O3EA 4YKFA 3GSSA 2HE3A 3FZ9A 2OJLA 2I9HA 4DSRA 1I1IP 2WW2A 4J2FA 5DVBA 2MMOA 2RM5A 4G10A 3GA4A 2FA4A 2C0EA 1M0UA 1PX7A 2CA8A 5HFKA 2WULA 2EC4A 4IBPA 3KXOA 1TXUA 2HYXA 2FNOA 1JZWA 4KNDA 1WIKA 4IQAA 4I8BA 3L9UA 2A2RA 5KN3A 1X0RA 2QGVA 4CDOA 2TRXA 4KH7A 4TKYA 3BBYA 3FR9A 4OO5A 4WETA 4K7NA 2WZSA 3F4SA 4WBRD 2YV9A 5IIZA 4OD7A 2R4VA 3GYKA 1URMA 1WP0A 5ELAA 1OVNA 4IN0A 3GKMA 4QL7A 3TKSE 2CAQA 2XPEA 5G1LA 4IJ3A 5J9CA 2HRKA 4ZL9A 2QSIA 5DJMA 4PI0C 5B6MA 2H1GA 4BVXB 4OFMA 1PX6A 3CTFA 3IR4A 2MYGA 3IA1A 4O5QA 5FWGA 2VO4A 1K3LA 4HEA2 4D73A 1ZYEA 5H5SA 4O7HA 2VCZA 8GSSA 3FKFA 4F9ZA 1YF0A 2IMFA 2CX4A 1TRUA 1G7EA 11GSA 3UOMA 1IYIA 5ENUA 3HVSA 4AKIA 3H1NA 2VL2A 2LUSA 3BCKA 3M1GA 2NVLA 3TKSA 5B8AA 1BEDA 4EC0A 3J7Yb 4Q5QA 3U5RE 1PN0A 2WGRA 2H1AA 4RI6A 4PNGA 2GVPA 1EP7A 1V9WA 1GSUA 2FGXA 5GSTA 5LCZA 2HRAA 2KLXA 2AJQB 1V58A 4I5QA 1B4QA 3P7XA 4GF0A 1EV9A 3H4KA 1K0MA 1HNBA 5EPFA 5KOWA 3EMXA 4EKZA 1GTIA 2A4HA 1FG4A 5A4UA 3APSA 2VKZG 4IQ1A 1K0BA 2B7KA 5L71A 1AUCA 2RM6A 4YQVA 3ZYWA 5A5KA 3VPQA 2L4QA 4X4JA 3FMWA 3WGDA 4TW5A 3GMFA 3IOSA 2VCWA 3KM6A 1S3AA 2HXKA 4EO3A 4ZBDA 2RLIA 2M46A 4FO5A 4K6XA 4MJAA 5ABRA 5J3RA 4E8HA 4MLYA 4FQUA 4V2NA 3F63A 4ZBAA 2DKHA 4XCSA 2EFHA 2IMIA 3CYNA 2OE0A 3NOFA 4WKWA 5FT3A 2O5VA 2H72A 1SVOA 3DXBA 4EIQA 1DSBA 4PQIA 1SU9A 1QMVA 3TB2A 3W6GA 1A2LA 3LWAA 3HVNA 3S9FA 1SJ6A 3ZREA 4BIKA 2HRKB 1B9YC 5ID2A 3QFAC 4ML1A 2PUKC 5G2ZA 4E8EA 1FHEA 4KDYA 2B5YA 3EMPA 4ZB6A 1QGVA 1MD4A 1PQNA 3TOTA 2VL9A 4PQHA 2LNSA 4CW9A 3MIXA 5DCGA 1WPIA 6GSUA 3HHVA 1PRXA 5IPGA 4FYCA 4D73B 3H79A 5COHA 2DJJA 2YJ7A 1TTZA 2MBTA 2EIQA 2IWTA 4KX4A 1QK8A 4YQMA 6GSSA 3Q6OA 1TI1A 3IAS2 3IV4A 4BWSA 1YF1A 2L5OA 4GSNA 1VF3A 3HDCA 3WD6A 2IN3A 2AHEA 1TRSA 4QQ7A 2YWMA 2DJ2A 3L9SA 2YV7A 1V40A 4OWYA 1EWXA 4BVYA 1BG5A 4ECIA 1XW9A 4WR5A 1RK4A 3LXZA 3F3RA 2AUVA 1V98A 4EE0A 3I43A 2BJXA 4EXJA 5CAXA 3R3EA 2GQKA 3GNJA 1JLWA 1JLVA 4GQCA 5ECRB 4HZ2A 1G7OA 3DYRA 3L78A 2VM1A 5D93A 1JZOA 4L8EA 2LNTA 1XWCA 3FYGA 4TRXA 1O85A 3D0ZA 2XHFA 3QCPA 3VWUA 1J9BA 9GSSA 3RPPA 5IMVA 1ERTA 4POLA 2VD0A 16GSA 2YOIA 4KGIA 1I9DA 1GSYA 2EFEA 2YCDA 1T00A 2PWJA 1ABAA 2C8UA 2D2ZA 2QA2A 3MDKA 4XRDA 3FZAA 1HD2A 5ID2B 4PQ1A 3ZTLA 5D96A 1O73A 1MEKA 2ALBA 3ERFA 3WT1A 2EFCA 3M9KA 2GTUA 5CRDA 2IMKA 3IHGA 2VL2C 3C1RA 4POMA 5CP1A 3PH9A 1HNAA 3TKSC 1ML6A 5B6NA 1NHOA 1F3BA 1GWCA 5J47A 1KNGA 2QC7A 4FYUA 1TRWA 3CHXC 1YY7A 4TXVA 1EZKA 4GCIA 4KUNA 4OCFA 5CRGA 4ZBBA 1GP1A 1OAZA 1S3CA 3KZQA 1X5DA 4XS1A 2HZEA 3CSIA 1M2AA 3D21A 2VL3A 5J4VA 3EE2A 1GNEA 1K0CA 5CNWA 2FY6A 4K7IA 3KH9A 1Z7PA 2L6CA 4NMUA 1XOBA 2OKAA 3F9UA 1SK2A 2F8FA 3ZRDA 1THXA 3A3TA 2WFCA 4BVYB 4AJ8A 1XOAA 2I1UA 4ECBA 2LRCA 1AQXA 5J4YA 2DMLA 3H8QA 1K0DA 4OFNA 2OADA 1MDJA 5ECNB 4IGJA 3GH6A 4Q5FA 1HYUA 5JWQB 1MDIA 2HSHA 1M9BA 3BJ5A 1V2AA 5ECSA 1SENA 5G5EA 1OE8A 3J7Yk 2A2SA 4JU5A 3QAGA 1GNWA 3TKQA 4HU9A 2WW0A 1J0FA 3WGXA 5LD0A 3O6TA 5H5QA 1TI3A 2DIZA 4PGTA 2V2GA 4IW9A 3DVWA 1QFNA 2IMDA 3HZ4A 1ST9A 2J23A 2YPMA 3EVIA 1A0RP 3FZ4A 1TDIA 5CYYA 1EOGA 3SWLA 3FK8A 2VCVA 1MTCA 4HJMA 5EVOA 1ON4A 2YZHA 4XS4A 4MDCA 1JZRA 4V2LA 2PVOC 2F51A 2K9FA 2H71A 4HSCX 3VFIA 3GTUA 2FCHA 1TRVA 5AN1A 2DMMA 3RAZA 4V1Ap 4F0CA 1VF4A 3HJMA 4MZCA 4XHMA 2HLSA 2HZFA 3ZMLA 2DJ1A 2N5BA 3ME8A 4GDFA 2LS5A 4LLRA 1SKWB 2JZTA 3R2QA 4MZWA 3HYPA 4O32A 3EINA 1J08A 4Q5NA 2HZEB 2VLUA 3QR6A 3H93A 2FWEA 2HI7A 3N5OA 3C73A 3WT2A 4G19A 4XS6A 2ZUPA 4GRFA 1CQGA 4MPFA 3LQ7A 3LG6A 3L4NA 1EOHA 4V1Ag 1EGOA 2P0GA 2H76A 3G9BA 3C8EA 2CVBA 2HSMA 2KOKA 4LMVA 2CX3A 2CQ9A 2H75A 3GIXA 2VLTA 2JSZA 2MBSA 2PERA 2X49A 3TDGA 1TOFA 2L4CA 2JSYA 3HJPA 3CBUA 3F0IA 2R0CA 1FO5A 2F3MA 2IPAA 4OFTA 4YAVA 4TXOA 1UC7A 4TVEA 2IJYA 1R4WA 3O3TA 2HNLA 3AY8A 2C0DA 1Z9HA 2OBKA 4FXYP 3P8WA 1A0FA 2WB9A 1ERWA 5BMUA 4K9ZA 3ZZXA 4TR3A 3G7IA 1GULA 3FRCA 2IMEA 5IMDA 1SD9A 4TOPA 3DKSA 4L5OA 3ZMKA 3IDVA 2EIOA 1GUKA 1YJ6A 3UIWA 1SYRA 1PFOA 4ZB8A 1KTEA 2H1DA 2R0GA 5DALA 1JZDA 5C04A 4Z2TA 3FR6A 1NW2A 1NM3A 4XS4B 3W8SA 2EIRA 2YN1A 1K0OA 1SVMA 3CXGA 1N2AA 1PD21 2PBJA 13GSA 1VF2A 3GTUB 4A5PA 2UZ8A 4PXOA 4RI7A 3TKRA 2O85A 1U6TA 5IOXA 2GSTA 2DJKA 2V41A 2LJRA 2PVQA 3E3EA 4MABA 1Z6MA 4ULXA 5IO2A 4IP6A 2OE1A 4AF2A 4KCEA 1TP9A 5INYA 2C4JA 1MDKA 4LL1B 1XWAA 3C1SA 1TKDB 2YZUA 1I5GA 1TK0B 4IVFA 1XXUA 3MAKA 4PNFA 2B1LA 3WGEA 4CY8A 3CQFA 1M9AA 2CV4A 1PGTA 5JCWA 1XVQA 3GV1A 4JE1A 3IK7A 3ZVJD 3DD3A 3KTLA 3TJFA 3DRNA 1GH2A 6GSVA 2HSMB 3A2XA 2O87A 5LNKe 1ZYPA 3V1WA 3GKKA 3Q74A 2UV8G 3O76A 4I6XA 4AKGA 1A8YA 3GHAA 4RQRA 2IIYA 3ZVJA 2H1BA 4F03A 4MA9A 1GSQA 5DQYA 2V32A 1NHYA 4I2TA 2YANA 4L0UA 1DUGA 3GKNA 5JWOB 1YEXA 2CVKA 2L6DA 2DLXA 5BMUB 3UL3A 4IHUA 3ZIJA 1XWGA 4BA7A 2P5QA 1Z6NA 2H30A 5J5NA 4EDYA 2TRCP 4G9HA 4YAPA 1TK5B 1ERVA 3UAPA 3L0HA 4JR6A 2FHEA 2C3QA 1SKRB 5HR2A 3UBLA 1WOUA 5IPHA 1G6WA 5DALB 4G0LA 5F0GA 3LXTA 2GZYA 3GURA 4K5SA 3APQA 3QPMA 4FIWA 4HS1A 1WJKA 1Y1UA 3M8NA 2HFDA 1KBNA 3FZ5A 2K18A 2ZNMA 5HR3A 4HOJA 4MJEA 2R5GA 2K6VA 2NDOA 1BF5A 5DDLA 2NPBA 2JADA 1S4BP 3F6DA 5IQYA 4OO4A 2LJKA 3W8JA 5EL8A 1HQOA 2FUG2 1Q4JA 5CO3A 3FY7A 4ZB7A 4HU7A 2CVDA 4AGSA 4PUAA 4HZ4A 5KOXA 2E2GA 2K8VA 3EPTA 2H0HA 2R3XA 2AYTA 2B7JA 3DIEA 4WF5A 4V2MA 3VWXA 5HFGA 1KEBA 1A24A 2H0GA 3RHBA 2LEGA 3KTBA 3M3MA 3U6VA 1BG1A 19GSA 3TGZA 1GUHA 2LV3A 1W89A 1U3IA 4PUFC 1Z7RA 1AIUA 1XWKA 2CZ3A 1PMTA 3MYDA 1XBSA 3GUSA 5F07A 1YQ1A 4K5RA 5D9WA 1ZOFA 1SK1A 2VAFA 3TJBA 1JFUA 3KEBA 1SVLA 2CZ2A 5IMZA 2N5AA 2HSYA 4O5UA 4GLTA 6GSWA 4Z2UA 2I4AA 5D8IA 2AB6A 2LQQA 2C0GA 2YJHA 2P31A 1F2EA 2O36A 2H6ZA 4BL7A 4MH2A 1OC9A 1G0TA 3ME7A 4ML6A 4MZBA 4BPYA 2VD1A 2DJ0A 2X8CA 4G2EA 2AAWA 2QKEA 2RUFA 4PTSA 2HSNA 4LMWA 4DVCA 4L0WA 1OKDA 1EV4A 3FR3A 3A2WA 3ED3A 1XW5A 3TUEA 2VM2A 2NTOA 1DBYA 3PINA 5CRWA 4Z2RA 1V57A 3OR5A 3HVVA 3BCIA 1XG8A 1GLPA 3VLNA 2VUPA 3HY2A 4LL4B 5GAND 4KF9A 5E59A 4KA0A 3KGKA 4JR4A 5IMAA 5J40A 3VWVA 2VCQA 4KAEA 3SBCA 1B48A 1GTAA 4RQXA 5G30A 2FWGA 4K0NA 1S3RA 3HVXA 1GLQA 5AGYA 2AV4A 3A5IA 1GL8A 4EUYA 2B5EA 4AKHA 3D4MA 2GSQA 1OYJA 3M0FA 4O92A 1WMJA 3TJKA 4MP4A 3GSTA 4HJ2A 4PI2C 3BD2A 3ZFLA 2RUEA 2PU9C 1BX9A 4E68A 2LKUA 1T1VA 2H19A 3EWLA 4JBBA 2C3NA 5DAKA 1X9WB 1PKWA 2H73A 2MMAA 2X8HA 3KP9A 3HD5A 5KN1A 4ZB9A 3VPTA 1AQVA 5AIVA 3HZ8A 4K8MA 2CAIA 2GLRA 4F2IA 3G7JA 3IAM2 2H0IA 2O89A 2X64A 1SD8A 4J57E 4YH2A 1DE2A 1PKZA 4BL7B 3HJOA 3D6IA 4WF4A 3TJJA 1OC8A 2KP1A 5KN0A 5HR1A 2H74A 4ICYA 1FVJA 3IC4A 3PGTA 2F9SA 2HSNB
chains in the Genus database with same CATH topology
3FHKA 4K2DA 2XC2A 1FW1A 4KDUA 5JCGA 4NAXA 4PURA 3CTGA 3UBKA 2FD3A 2FLSA 4K7OA 2GQMA 4OCEA 4X0XA 2HQTA 5D9TA 1WE0A 2LRTA 1TK8B 3C71A 1R5PA 2C3TA 2EFDA 5GAPD 1TU8A 2GSRA 3L9VA 2B3SA 2VCXA 5EY6A 3DVXA 5IO0A 5G31A 3QFBC 4ILFA 3LW9A 1QXHA 1ERUA 1Z3EA 3EC3A 3NZNA 4BVXA 1LJRA 2PGTA 3UARA 5D9VA 2H01A 3GL5A 2ON7A 3CSJA 1WRYA 3LSZA 3KD0A 1SL2B 3VI7A 4J56E 2XBQA 4MJBA 4ZXGA 1BAYA 2LRNA 1M7TA 3UMAA 2B6MA 4G0IA 2ON5A 4X1UA 3KH7A 2FA8A 3ISOA 1TJDA 4HUAA 1FVKA 4KB3A 3GH9A 5AIXA 1FOVA 2IL3A 3GFKA 2FWHA 3I9V2 4ACSA 4MK3A 3APOA 1QQ2A 3G7YA 3KJYA 5DAKB 1SJIA 1G6YA 4ZILA 4FYBA 3DEXA 1N25A 2GSSA 1CQHA 3Q18A 4I2UA 4O5RA 3MNGA 1OKTA 1GSEA 1EGRA 5D9XA 4EVMA 4HQSA 4Q5RA 1O7UA 3GL3A 3K8NA 4OMVA 3CMIA 2HRFA 4TR1A 18GSA 3DGQA 1ACVA 3HCZA 4HQZA 4MMMA 3CWGA 1OC3A 1S3DA 1AXDA 5B8BA 1F37A 2E2MA 2JL4A 5G5FA 4ZIJA 1T3BA 4MF5A 3RPNA 1H75A 4EIPA 3E0UA 5KEJA 4KE3A 5HR0A 3IBHA 3TRXA 2A4VA 3LYPA 2P5RA 1X5EA 3N9JA 2H8LA 4X43A 4GSSA 3UVHA 5J41A 5J4UA 2BTOT 1K0NA 4FH8A 3FEUA 4MJCA 2BMXA 5GSSA 1PL1A 1TXXA 2B5XA 5B7CA 1MD3A 4GXZA 1PL2A 7GSSA 1H4OA 4POKA 4L5LA 5F8BA 3P2AA 1EEMA 4KSMA 1XZOA 5IM9A 1A23A 3RDWA 2K8SA 3TRQA 3A5WA 1O6JA 1ZYQB 3F3QA 1U87A 4XTSA 2PMTA 1SYXA 3QOUA 3ZIVA 4N3ZA 1SK0A 4MNNA 2ZCTA 4WEYA 3QAWA 1VGLA 3F6FA 5A34A 2L59A 4DSQA 3CSHA 4HI7A 2LJAA 4IS0A 3MWHA 2GDRA 2R2JA 3A2VA 1JHBA 2NBSA 2C0FA 2JACA 1X9MB 2CT6A 4TXOB 2OA7A 4MF6A 2R37A 3GX8A 2H1LA 1R26A 4GWRA 1DE1A 3DMLA 1OE7A 1X9SB 1ZCPA 5DBQA 1THOA 1T7PB 4YKGA 2X8GA 1AC1A 5ECPB 3KP8A 4JRRA 4Z7XA 1M2DA 2C80A 4TR1B 1A8LA 1B8XA 2X4AA 4RUVA 1M2BA 3KIJA 2V6KA 1Y25A 5A1NA 1E2YA 1YEPA 2E0QA 1FB0A 3NIVA 4K2XA 4PX1A 4NV2A 5JWRB 2VIMA 4WR4A 3IC8A 3GKXA 3D5JA 3D4TA 2ES7A 2HRNA 1PA3A 4HDEA 1N8JA 3HKRA 2GT6A 10GSA 5HFIA 3QD9A 4CY6A 4NHZA 1PSQA 2LTKA 4POBA 3UJ1A 4EDZA 5CREA 1GSDA 1GUMA 2G0FA 2L57A 1NSWA 4TN8A 3LFLA 2GT5A 1XFLA 4H86A 2OE3A 1YKAA 2J9HA 2H6XA 2V1MA 4DEJA 1F3AA 4NWYA 3EU3A 5A5HA 1W4VA 4P3YB 5ECKB 4IELA 4XRAA 2YWNA 1LBKA 1GSFA 4TR0A 2WRTA 5C00A 3ZITA 2LSTA 3LJRA 4ISDA 3I6AA 3IXRA 3EURA 3IPZA 2M72A 5CRHA 2OBIA 2REMA 2VCTA 5ECQB 4JZQA 1X5CA 1U3AA 1SKSB 1ZZYA 4USSA 1IYHA 1USBA 5D73A 3WYWA 5A34B 3VI5A 2KHPA 4MH3A 4N0ZA 2F8AA 2LQOA 17GSA 1VF1A 2PPTA 2I81A 4K1FA 2DBCA 1EP8A 3E9JB 1K0AA 5ECMB 5A4WA 2N5FA 4CHSA 3IE3A 4F82A 4TR4A 5ELGA 4K0GA 1FOHA 3CRUA 4KCAA 1T4ZA 2KP2A 3JCML 5ECHB 1R5AA 5H5RA 6GSYA 5IMCA 3LYKA 5A4VA 3P90A 4F0BA 2JZRA 4GTUA 3PR8A 3RBTA 6GSXA 3TOUA 1YDKA 2WDUA 2PN8A 2H66A 2I3YA 4MCUA 4WBJA 3US3A 1SL0B 1E6BA 3M9JA 1B9XC 2DSAA 4AKXB 2MMZA 1F6MC 5DQSA 1ZMAA 3MSZA 1O8WA 1Z5YE 3VWWA 2WS2A 4N11A 1XW6A 1GTBA 12GSA 5KN2A 3RHCA 1AW9A 2JU5A 5A1NB 5F06A 3ERWA 1FAAA 14GSA 1Y6EA 3EYTA 1F9MA 3KCMA 4IP1A 1TU7A 1TW9A 2JZSA 3FW2A 2IFQA 1WWJA 2KUCA 2XPDA 5JCUA 3HMJG 4ZL7A 4LA1A 1T4YA 5A5HB 4G0KA 5J9BA 3LORA 4N30A 2O7KA 3LGCA 1T8EB 2GZPA 3HA9A 1UA5A 3DWVA 4N10A 4AJ7A 1GRXA 1EEJA 4GSTA 1XVWA 1LU4A 2MMNA 2RIIA 5ECLB 4NPBA 1PN9A 2WZ9A 2C1YA 4G01A 3QAVA 3GRXA 4EF0A 4DSSA 1XCCA 1BQ7A 1UVZA 4I97A 2YWIA 2YNXA 4ID0A 4BWQA 5GZZB 4YQUA 4QL9A 1O81A 3VURA 5DJLA 20GSA 4MPGA 5F05A 1FB6A 3QMXA 4ECCA 4NXIA 5BRTA 2E7PA 5IOWA 1U88A 1YVLA 2GS3A 3HXSA 1A2MA 2WJUA 1K3YA 3F4RA 2G2QA 1AQWA 1ZYNA 6GSTA 5DCHA 5E4WA 4AJ6A 3UEMA 2B1KA 2HT9A 4WXTA 1GTUA 1ZL9A 4JEDA 3LEFA 5FHIA 1XIYA 2A2PA 3C7MA 1OC9B 2R6KA 2V6OA 1Q98A 4QMKA 2Z9SA 3GX0A 2DIYA 2VOCA 2GZZA 5AISA 3KMOA 2DKIA 1BJXA 1C72A 1O8XA 2MZCA 2DJ3A 5ECOB 3VK9A 3EU4A 3ZLPA 1AAZA 1RQMA 1ZGNA 3TKPA 4KSOA 4GQFA 2YP6A 3BOAA 4MF7A 2H70A 4XIHA 1R7HA 2IFQB 4KDXA 3CRTA 3IHQA 5ECIB 3F8UA 3TU3B 3KMNA 4N0VA 4IJIA 3QDNA 1XPVA 1RW1A 2R0PA 3UVTA 3ZFBA 3ERGA 1K3OA 2FWFA 2GGTA 2TIRA 2X99A 2VLVA 3IK9A 2O8VB 2M80A 2L5LA 4KW6A 5HQPA 1BYEA 1VRSD 2DC5A 2WCIA 2YWOA 1B4PA 2OACA 1M99A 1GSSA 1YKCA 4W66A 2GQLA 3D22A 3ZL5A 2XBIA 3F4TA 4NHWA 2QA1A 3TJGA 1A2JA 1HNCA 4ECJA 5IMFA 4DSSB 1XWBA 4AI6A 1SL1B 22GSA 3PPUA 4EL1A 2H6YA 3TRPA 3GN3A 1QUWA 5G1KA 3Q19A 1UN2A 2OT3A 1ILOA 3TCOA 3IRAA 4NV5A 3I69A 4ZL8A 1SJZA 1YZXA 4IKHA 4YKFA 3GSSA 2HE3A 3FZ9A 2OJLA 2I9HA 4DSRA 4J2FA 5DVBA 2MMOA 2RM5A 4G10A 3GA4A 2FA4A 2C0EA 1M0UA 1PX7A 2CA8A 5HFKA 2WULA 2EC4A 4IBPA 3KXOA 1TXUA 2HYXA 2FNOA 1JZWA 4KNDA 1WIKA 4IQAA 4I8BA 3L9UA 2A2RA 5KN3A 1X0RA 2QGVA 4CDOA 2TRXA 4KH7A 4TKYA 3BBYA 3FR9A 4OO5A 4WETA 4K7NA 3F4SA 4WBRD 2YV9A 5IIZA 4OD7A 2R4VA 3GYKA 1URMA 1WP0A 5ELAA 1OVNA 4IN0A 3GKMA 4QL7A 3TKSE 2CAQA 2XPEA 5G1LA 4IJ3A 5J9CA 2HRKA 4ZL9A 2QSIA 5DJMA 5B6MA 2H1GA 4BVXB 4OFMA 1PX6A 3CTFA 3IR4A 2MYGA 3IA1A 4O5QA 5FWGA 2VO4A 1K3LA 4HEA2 4D73A 1ZYEA 5H5SA 4O7HA 2VCZA 8GSSA 3FKFA 4F9ZA 1YF0A 2IMFA 2CX4A 1TRUA 1G7EA 11GSA 3UOMA 1IYIA 5ENUA 3HVSA 4AKIA 3H1NA 2VL2A 2LUSA 3BCKA 3M1GA 2NVLA 3TKSA 5B8AA 1BEDA 4EC0A 3J7Yb 4Q5QA 3U5RE 1PN0A 2WGRA 2H1AA 4RI6A 4PNGA 2GVPA 1EP7A 1V9WA 1GSUA 2FGXA 5GSTA 5LCZA 2HRAA 2KLXA 2AJQB 1V58A 4I5QA 1B4QA 3P7XA 4GF0A 1EV9A 3H4KA 1K0MA 1HNBA 5EPFA 5KOWA 3EMXA 4EKZA 1GTIA 2A4HA 1FG4A 5A4UA 3APSA 2VKZG 4IQ1A 1K0BA 2B7KA 5L71A 1AUCA 2RM6A 4YQVA 3ZYWA 5A5KA 3VPQA 2L4QA 4X4JA 3FMWA 3WGDA 4TW5A 3GMFA 3IOSA 2VCWA 3KM6A 1S3AA 2HXKA 4EO3A 4ZBDA 2RLIA 2M46A 4FO5A 4K6XA 4MJAA 5ABRA 5J3RA 4E8HA 4MLYA 4FQUA 4V2NA 3F63A 4ZBAA 2DKHA 4XCSA 2EFHA 2IMIA 3CYNA 2OE0A 3NOFA 4WKWA 5FT3A 2O5VA 2H72A 1SVOA 3DXBA 4EIQA 1DSBA 4PQIA 1SU9A 1QMVA 3TB2A 3W6GA 1A2LA 3LWAA 3S9FA 1SJ6A 3ZREA 2HRKB 1B9YC 5ID2A 3QFAC 4ML1A 2PUKC 5G2ZA 4E8EA 1FHEA 4KDYA 2B5YA 3EMPA 4ZB6A 1QGVA 1MD4A 1PQNA 3TOTA 2VL9A 4PQHA 2LNSA 4CW9A 3MIXA 5DCGA 1WPIA 6GSUA 3HHVA 1PRXA 5IPGA 4FYCA 4D73B 3H79A 5COHA 2DJJA 2YJ7A 1TTZA 2MBTA 2EIQA 2IWTA 4KX4A 1QK8A 4YQMA 6GSSA 3Q6OA 1TI1A 3IAS2 3IV4A 4BWSA 1YF1A 2L5OA 4GSNA 1VF3A 3HDCA 3WD6A 2IN3A 2AHEA 1TRSA 4QQ7A 2YWMA 2DJ2A 3L9SA 2YV7A 1V40A 4OWYA 1EWXA 4BVYA 1BG5A 4ECIA 1XW9A 4WR5A 1RK4A 3LXZA 3F3RA 2AUVA 1V98A 4EE0A 3I43A 2BJXA 4EXJA 5CAXA 3R3EA 2GQKA 3GNJA 1JLWA 1JLVA 4GQCA 5ECRB 4HZ2A 1G7OA 3DYRA 3L78A 2VM1A 5D93A 1JZOA 4L8EA 2LNTA 1XWCA 3FYGA 4TRXA 1O85A 3D0ZA 2XHFA 3QCPA 3VWUA 1J9BA 9GSSA 3RPPA 5IMVA 1ERTA 4POLA 2VD0A 16GSA 2YOIA 4KGIA 1I9DA 1GSYA 2EFEA 2YCDA 1T00A 2PWJA 1ABAA 2C8UA 2D2ZA 2QA2A 3MDKA 4XRDA 3FZAA 1HD2A 5ID2B 4PQ1A 3ZTLA 5D96A 1O73A 1MEKA 2ALBA 3ERFA 3WT1A 2EFCA 3M9KA 2GTUA 5CRDA 2IMKA 3IHGA 2VL2C 3C1RA 4POMA 5CP1A 3PH9A 1HNAA 3TKSC 1ML6A 5B6NA 1NHOA 1F3BA 1GWCA 5J47A 1KNGA 2QC7A 4FYUA 1TRWA 4TXVA 1YY7A 1EZKA 4GCIA 4KUNA 4OCFA 5CRGA 4ZBBA 1GP1A 1OAZA 1S3CA 3KZQA 1X5DA 4XS1A 2HZEA 3CSIA 1M2AA 3D21A 2VL3A 5J4VA 3EE2A 1GNEA 1K0CA 5CNWA 2FY6A 4K7IA 3KH9A 1Z7PA 2L6CA 4NMUA 1XOBA 2OKAA 3F9UA 1SK2A 2F8FA 3ZRDA 1THXA 3A3TA 2WFCA 4BVYB 4AJ8A 1XOAA 2I1UA 4ECBA 2LRCA 1AQXA 5J4YA 2DMLA 3H8QA 1K0DA 4OFNA 2OADA 1MDJA 5ECNB 4IGJA 3GH6A 4Q5FA 1HYUA 5JWQB 1MDIA 2HSHA 1M9BA 3BJ5A 1V2AA 5ECSA 1SENA 5G5EA 1OE8A 3J7Yk 2A2SA 4JU5A 3QAGA 1GNWA 3TKQA 4HU9A 1J0FA 3WGXA 5LD0A 3O6TA 5H5QA 1TI3A 2DIZA 4PGTA 2V2GA 4IW9A 3DVWA 1QFNA 2IMDA 3HZ4A 1ST9A 2J23A 2YPMA 3EVIA 1A0RP 3FZ4A 1TDIA 5CYYA 1EOGA 3SWLA 3FK8A 2VCVA 1MTCA 4HJMA 5EVOA 1ON4A 2YZHA 4XS4A 4MDCA 1JZRA 4V2LA 2PVOC 2F51A 2K9FA 2H71A 3VFIA 3GTUA 2FCHA 1TRVA 5AN1A 2DMMA 3RAZA 4V1Ap 4F0CA 1VF4A 3HJMA 4MZCA 4XHMA 2HLSA 2HZFA 3ZMLA 2DJ1A 2N5BA 3ME8A 4GDFA 2LS5A 4LLRA 1SKWB 2JZTA 3R2QA 4MZWA 3HYPA 4O32A 3EINA 1J08A 4Q5NA 2HZEB 2VLUA 3QR6A 3H93A 2FWEA 2HI7A 3N5OA 3C73A 3WT2A 4G19A 4XS6A 2ZUPA 4GRFA 1CQGA 4MPFA 3LQ7A 3LG6A 3L4NA 1EOHA 4V1Ag 1EGOA 2P0GA 2H76A 3G9BA 3C8EA 2CVBA 2HSMA 2KOKA 4LMVA 2CX3A 2CQ9A 2H75A 3GIXA 2VLTA 2JSZA 2MBSA 2PERA 2X49A 3TDGA 1TOFA 2L4CA 2JSYA 3HJPA 3CBUA 3F0IA 2R0CA 1FO5A 2F3MA 2IPAA 4OFTA 4YAVA 4TXOA 1UC7A 4TVEA 2IJYA 1R4WA 3O3TA 2HNLA 3AY8A 2C0DA 1Z9HA 2OBKA 3P8WA 1A0FA 2WB9A 1ERWA 5BMUA 4K9ZA 3ZZXA 4TR3A 3G7IA 1GULA 3FRCA 2IMEA 5IMDA 1SD9A 4TOPA 3DKSA 4L5OA 3ZMKA 3IDVA 2EIOA 1GUKA 1YJ6A 3UIWA 1SYRA 4ZB8A 1KTEA 2H1DA 2R0GA 5DALA 1JZDA 5C04A 4Z2TA 3FR6A 1NW2A 1NM3A 4XS4B 3W8SA 2EIRA 2YN1A 1K0OA 1SVMA 3CXGA 1N2AA 1PD21 2PBJA 13GSA 1VF2A 3GTUB 4A5PA 2UZ8A 4PXOA 4RI7A 3TKRA 2O85A 1U6TA 5IOXA 2GSTA 2DJKA 2V41A 2LJRA 2PVQA 3E3EA 4MABA 1Z6MA 4ULXA 5IO2A 4IP6A 2OE1A 4AF2A 4KCEA 1TP9A 5INYA 2C4JA 1MDKA 4LL1B 1XWAA 3C1SA 1TKDB 2YZUA 1I5GA 1TK0B 4IVFA 1XXUA 3MAKA 4PNFA 2B1LA 3WGEA 4CY8A 1M9AA 2CV4A 1PGTA 5JCWA 1XVQA 3GV1A 4JE1A 3IK7A 3ZVJD 3DD3A 3KTLA 3TJFA 3DRNA 1GH2A 6GSVA 2HSMB 3A2XA 2O87A 5LNKe 1ZYPA 3V1WA 3GKKA 3Q74A 2UV8G 3O76A 4I6XA 4AKGA 1A8YA 3GHAA 4RQRA 2IIYA 3ZVJA 2H1BA 4F03A 4MA9A 1GSQA 5DQYA 2V32A 1NHYA 4I2TA 2YANA 4L0UA 1DUGA 3GKNA 5JWOB 1YEXA 2CVKA 2L6DA 2DLXA 5BMUB 3UL3A 4IHUA 3ZIJA 1XWGA 4BA7A 2P5QA 1Z6NA 2H30A 5J5NA 4EDYA 2TRCP 4G9HA 4YAPA 1TK5B 1ERVA 3UAPA 3L0HA 4JR6A 2FHEA 2C3QA 1SKRB 5HR2A 3UBLA 1WOUA 5IPHA 1G6WA 5DALB 4G0LA 5F0GA 3LXTA 2GZYA 3GURA 4K5SA 3APQA 3QPMA 4FIWA 4HS1A 1WJKA 1Y1UA 3M8NA 2HFDA 1KBNA 3FZ5A 2K18A 2ZNMA 5HR3A 4HOJA 4MJEA 2R5GA 2K6VA 2NDOA 1BF5A 5DDLA 2NPBA 2JADA 3F6DA 5IQYA 4OO4A 2LJKA 3W8JA 5EL8A 1HQOA 2FUG2 1Q4JA 5CO3A 3FY7A 4ZB7A 4HU7A 2CVDA 4AGSA 4PUAA 4HZ4A 5KOXA 2E2GA 2K8VA 3EPTA 2H0HA 2R3XA 2AYTA 2B7JA 3DIEA 4WF5A 4V2MA 3VWXA 5HFGA 1KEBA 1A24A 2H0GA 3RHBA 2LEGA 3KTBA 3M3MA 3U6VA 1BG1A 19GSA 3TGZA 1GUHA 2LV3A 1W89A 1U3IA 4PUFC 1Z7RA 1AIUA 1XWKA 2CZ3A 3MYDA 1PMTA 1XBSA 3GUSA 5F07A 1YQ1A 4K5RA 5D9WA 1ZOFA 1SK1A 2VAFA 3TJBA 1JFUA 3KEBA 1SVLA 2CZ2A 5IMZA 2N5AA 2HSYA 4O5UA 4GLTA 6GSWA 4Z2UA 2I4AA 5D8IA 2AB6A 2LQQA 2C0GA 2YJHA 2P31A 1F2EA 2H6ZA 4BL7A 4MH2A 1OC9A 1G0TA 3ME7A 4ML6A 4MZBA 4BPYA 2VD1A 2DJ0A 2X8CA 4G2EA 2AAWA 2QKEA 2RUFA 4PTSA 2HSNA 4LMWA 4DVCA 4L0WA 1OKDA 1EV4A 3FR3A 3A2WA 3ED3A 1XW5A 3TUEA 2VM2A 2NTOA 1DBYA 3PINA 5CRWA 4Z2RA 1V57A 3OR5A 3HVVA 3BCIA 1GLPA 3VLNA 2VUPA 3HY2A 4LL4B 5GAND 4KF9A 5E59A 4KA0A 3KGKA 4JR4A 5IMAA 5J40A 3VWVA 2VCQA 4KAEA 3SBCA 1B48A 1GTAA 4RQXA 5G30A 2FWGA 4K0NA 3HVXA 1GLQA 5AGYA 2AV4A 3A5IA 1GL8A 4EUYA 2B5EA 4AKHA 3D4MA 2GSQA 1OYJA 3M0FA 4O92A 1WMJA 3TJKA 4MP4A 3GSTA 4HJ2A 3BD2A 3ZFLA 2RUEA 2PU9C 1BX9A 4E68A 2LKUA 1T1VA 2H19A 3EWLA 4JBBA 2C3NA 5DAKA 1X9WB 1PKWA 2H73A 2MMAA 2X8HA 3KP9A 3HD5A 5KN1A 4ZB9A 3VPTA 1AQVA 5AIVA 3HZ8A 4K8MA 2CAIA 2GLRA 4F2IA 3G7JA 3IAM2 2H0IA 2O89A 2X64A 1SD8A 4J57E 4YH2A 1DE2A 1PKZA 4BL7B 3HJOA 3D6IA 4WF4A 3TJJA 1OC8A 2KP1A 5KN0A 5HR1A 2H74A 4ICYA 1FVJA 3IC4A 3PGTA 2F9SA 2HSNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHK A;  4K2D A;  2XC2 A;  1FW1 A;  4KDU A;  5JCG A;  4NAX A;  4PUR A;  3CTG A;  3UBK A;  2FD3 A;  2FLS A;  4K7O A;  2GQM A;  4OCE A;  4X0X A;  2HQT A;  5D9T A;  1WE0 A;  2LRT A;  1TK8 B;  3C71 A;  1R5P A;  2C3T A;  5GAP D;  1TU8 A;  2GSR A;  3L9V A;  2B3S A;  2VCX A;  5EY6 A;  3DVX A;  5IO0 A;  5G31 A;  3QFB C;  4ILF A;  1QXH A;  1ERU A;  1Z3E A;  3EC3 A;  3NZN A;  4BVX A;  1LJR A;  2PGT A;  3UAR A;  5D9V A;  2H01 A;  3GL5 A;  2ON7 A;  3CSJ A;  1WRY A;  3LSZ A;  3KD0 A;  1SL2 B;  3VI7 A;  4J56 E;  2XBQ A;  4MJB A;  4ZXG A;  1BAY A;  2LRN A;  1M7T A;  3UMA A;  2B6M A;  4G0I A;  2ON5 A;  4X1U A;  3KH7 A;  2FA8 A;  3ISO A;  1TJD A;  4HUA A;  1FVK A;  4KB3 A;  3GH9 A;  5AIX A;  1FOV A;  2IL3 A;  3GFK A;  2FWH A;  3I9V 2;  4ACS A;  4MK3 A;  3APO A;  1QQ2 A;  3G7Y A;  3KJY A;  5DAK B;  1SJI A;  1G6Y A;  4ZIL A;  4FYB A;  3DEX A;  2GSS A;  1CQH A;  3Q18 A;  4I2U A;  4O5R A;  3MNG A;  1OKT A;  1GSE A;  1EGR A;  5D9X A;  4EVM A;  4HQS A;  4Q5R A;  1O7U A;  3GL3 A;  3K8N A;  4OMV A;  3CMI A;  2HRF A;  4TR1 A;  18GS A;  3DGQ A;  1ACV A;  3HCZ A;  4HQZ A;  4MMM A;  1OC3 A;  1S3D A;  1AXD A;  5B8B A;  1F37 A;  2E2M A;  2JL4 A;  5G5F A;  4ZIJ A;  1T3B A;  4MF5 A;  3RPN A;  1H75 A;  3E0U A;  5KEJ A;  4KE3 A;  5HR0 A;  3IBH A;  3TRX A;  2A4V A;  3LYP A;  2P5R A;  1X5E A;  3N9J A;  2H8L A;  4X43 A;  4GSS A;  3UVH A;  5J41 A;  5J4U A;  2BTO T;  1K0N A;  4FH8 A;  3FEU A;  4MJC A;  2BMX A;  5GSS A;  1PL1 A;  1TXX A;  2B5X A;  5B7C A;  1MD3 A;  4GXZ A;  1PL2 A;  7GSS A;  1H4O A;  4POK A;  4L5L A;  5F8B A;  3P2A A;  1EEM A;  4KSM A;  1XZO A;  5IM9 A;  1A23 A;  3RDW A;  2K8S A;  3TRQ A;  3A5W A;  1O6J A;  1ZYQ B;  3F3Q A;  1U87 A;  4XTS A;  2PMT A;  1SYX A;  3QOU A;  3ZIV A;  1SK0 A;  4WEY A;  2ZCT A;  3QAW A;  1VGL A;  3F6F A;  2L59 A;  4DSQ A;  3CSH A;  4HI7 A;  2LJA A;  4IS0 A;  3MWH A;  2GDR A;  2R2J A;  3A2V A;  1JHB A;  2NBS A;  2C0F A;  2JAC A;  1X9M B;  2CT6 A;  4TXO B;  2OA7 A;  4MF6 A;  2R37 A;  3GX8 A;  1R26 A;  4GWR A;  1DE1 A;  3DML A;  1OE7 A;  1X9S B;  1ZCP A;  5DBQ A;  1THO A;  1T7P B;  2X8G A;  1AC1 A;  5ECP B;  3KP8 A;  4JRR A;  4Z7X A;  1M2D A;  2C80 A;  4TR1 B;  1A8L A;  1B8X A;  4RUV A;  1M2B A;  3KIJ A;  2V6K A;  1Y25 A;  1E2Y A;  1YEP A;  2E0Q A;  1FB0 A;  3NIV A;  4PX1 A;  4NV2 A;  5JWR B;  2VIM A;  4WR4 A;  3IC8 A;  3GKX A;  3D5J A;  3D4T A;  2ES7 A;  2HRN A;  1PA3 A;  4HDE A;  1N8J A;  3HKR A;  2GT6 A;  10GS A;  5HFI A;  3QD9 A;  4NHZ A;  1PSQ A;  2LTK A;  4POB A;  3UJ1 A;  4EDZ A;  5CRE A;  1GSD A;  1GUM A;  2G0F A;  2L57 A;  1NSW A;  4TN8 A;  3LFL A;  2GT5 A;  4H86 A;  1XFL A;  2OE3 A;  1YKA A;  2J9H A;  2H6X A;  2V1M A;  4DEJ A;  1F3A A;  4NWY A;  3EU3 A;  1W4V A;  4P3Y B;  5ECK B;  4IEL A;  4XRA A;  2YWN A;  1LBK A;  1GSF A;  4TR0 A;  2WRT A;  5C00 A;  3ZIT A;  2LST A;  3LJR A;  4ISD A;  3I6A A;  3IXR A;  3EUR A;  3IPZ A;  2M72 A;  5CRH A;  2OBI A;  2REM A;  2VCT A;  5ECQ B;  4JZQ A;  1X5C A;  1U3A A;  1SKS B;  1ZZY A;  4USS A;  1IYH A;  1USB A;  5D73 A;  3WYW A;  2KHP A;  3VI5 A;  4MH3 A;  4N0Z A;  2F8A A;  2LQO A;  17GS A;  1VF1 A;  2PPT A;  2I81 A;  4K1F A;  2DBC A;  1EP8 A;  3E9J B;  1K0A A;  5ECM B;  5A4W A;  2N5F A;  4CHS A;  3IE3 A;  4F82 A;  4TR4 A;  5ELG A;  4K0G A;  3CRU A;  4KCA A;  1T4Z A;  2KP2 A;  3JCM L;  5ECH B;  1R5A A;  5H5R A;  6GSY A;  5IMC A;  3LYK A;  5A4V A;  3P90 A;  4F0B A;  2JZR A;  4GTU A;  3PR8 A;  3RBT A;  6GSX A;  3TOU A;  1YDK A;  2WDU A;  2PN8 A;  2H66 A;  2I3Y A;  4MCU A;  4WBJ A;  3US3 A;  1SL0 B;  1E6B A;  3M9J A;  1B9X C;  2DSA A;  2MMZ A;  1F6M C;  5DQS A;  1ZMA A;  3MSZ A;  1O8W A;  1Z5Y E;  3VWW A;  2WS2 A;  4N11 A;  1XW6 A;  1GTB A;  12GS A;  5KN2 A;  3RHC A;  1AW9 A;  2JU5 A;  5F06 A;  3ERW A;  1FAA A;  14GS A;  1Y6E A;  3EYT A;  1F9M A;  3KCM A;  4IP1 A;  1TU7 A;  1TW9 A;  2JZS A;  3FW2 A;  2IFQ A;  1WWJ A;  2KUC A;  2XPD A;  5JCU A;  4ZL7 A;  4LA1 A;  1T4Y A;  4G0K A;  5J9B A;  3LOR A;  4N30 A;  2O7K A;  3LGC A;  1T8E B;  2GZP A;  3HA9 A;  1UA5 A;  3DWV A;  4N10 A;  4AJ7 A;  1GRX A;  1EEJ A;  4GST A;  1XVW A;  1LU4 A;  2MMN A;  2RII A;  5ECL B;  4NPB A;  1PN9 A;  2WZ9 A;  2C1Y A;  3QAV A;  3GRX A;  4EF0 A;  4DSS A;  1XCC A;  1BQ7 A;  1UVZ A;  4I97 A;  2YWI A;  2YNX A;  4ID0 A;  4BWQ A;  5GZZ B;  4YQU A;  4QL9 A;  1O81 A;  3VUR A;  5DJL A;  20GS A;  4MPG A;  5F05 A;  1FB6 A;  3QMX A;  4ECC A;  4NXI A;  2E7P A;  5IOW A;  1U88 A;  2GS3 A;  3HXS A;  1A2M A;  2WJU A;  1K3Y A;  3F4R A;  2G2Q A;  1AQW A;  6GST A;  5DCH A;  5E4W A;  4AJ6 A;  3UEM A;  2B1K A;  2HT9 A;  4WXT A;  1GTU A;  1ZL9 A;  4JED A;  3LEF A;  5FHI A;  1XIY A;  3C7M A;  1OC9 B;  2R6K A;  2V6O A;  1Q98 A;  2Z9S A;  3GX0 A;  2DIY A;  2VOC A;  2GZZ A;  5AIS A;  3KMO A;  1BJX A;  1C72 A;  1O8X A;  2MZC A;  2DJ3 A;  5ECO B;  3VK9 A;  3EU4 A;  3ZLP A;  1AAZ A;  1RQM A;  1ZGN A;  3TKP A;  4KSO A;  4GQF A;  2YP6 A;  3BOA A;  4MF7 A;  2H70 A;  4XIH A;  1R7H A;  2IFQ B;  4KDX A;  3CRT A;  3IHQ A;  5ECI B;  3F8U A;  3KMN A;  4N0V A;  4IJI A;  3QDN A;  1XPV A;  1RW1 A;  3UVT A;  3ZFB A;  3ERG A;  1K3O A;  2FWF A;  2GGT A;  2TIR A;  2X99 A;  2VLV A;  3IK9 A;  2O8V B;  2M80 A;  2L5L A;  4KW6 A;  5HQP A;  1BYE A;  1VRS D;  2DC5 A;  2WCI A;  2YWO A;  1B4P A;  2OAC A;  1M99 A;  1GSS A;  1YKC A;  2GQL A;  3D22 A;  3ZL5 A;  2XBI A;  3F4T A;  4NHW A;  3TJG A;  1A2J A;  1HNC A;  4ECJ A;  5IMF A;  4DSS B;  1XWB A;  1SL1 B;  22GS A;  3PPU A;  4EL1 A;  2H6Y A;  3TRP A;  3GN3 A;  1QUW A;  5G1K A;  3Q19 A;  1UN2 A;  1ILO A;  3TCO A;  3IRA A;  4NV5 A;  3I69 A;  4ZL8 A;  1SJZ A;  1YZX A;  4IKH A;  3GSS A;  2HE3 A;  3FZ9 A;  2OJL A;  2I9H A;  4DSR A;  4J2F A;  5DVB A;  2MMO A;  2RM5 A;  4G10 A;  3GA4 A;  2FA4 A;  2C0E A;  1M0U A;  1PX7 A;  2CA8 A;  5HFK A;  2WUL A;  2EC4 A;  4IBP A;  3KXO A;  2HYX A;  2FNO A;  1JZW A;  4KND A;  1WIK A;  4IQA A;  4I8B A;  3L9U A;  2A2R A;  5KN3 A;  1X0R A;  2QGV A;  4CDO A;  2TRX A;  4KH7 A;  4TKY A;  3BBY A;  3FR9 A;  4OO5 A;  4WET A;  4K7N A;  3F4S A;  4WBR D;  2YV9 A;  5IIZ A;  4OD7 A;  2R4V A;  3GYK A;  1URM A;  1WP0 A;  5ELA A;  1OVN A;  4IN0 A;  3GKM A;  4QL7 A;  3TKS E;  2CAQ A;  2XPE A;  5G1L A;  4IJ3 A;  5J9C A;  2HRK A;  4ZL9 A;  2QSI A;  5DJM A;  5B6M A;  2H1G A;  4BVX B;  4OFM A;  1PX6 A;  3CTF A;  3IR4 A;  2MYG A;  3IA1 A;  5FWG A;  2VO4 A;  1K3L A;  4HEA 2;  4D73 A;  1ZYE A;  5H5S A;  4O7H A;  2VCZ A;  8GSS A;  3FKF A;  4F9Z A;  1YF0 A;  2IMF A;  2CX4 A;  1TRU A;  1G7E A;  11GS A;  3UOM A;  1IYI A;  5ENU A;  3HVS A;  3H1N A;  2VL2 A;  2LUS A;  3BCK A;  3M1G A;  2NVL A;  3TKS A;  5B8A A;  1BED A;  4EC0 A;  3J7Y b;  4Q5Q A;  3U5R E;  2WGR A;  2H1A A;  4RI6 A;  4PNG A;  2GVP A;  1EP7 A;  1V9W A;  1GSU A;  2FGX A;  5GST A;  5LCZ A;  2HRA A;  2KLX A;  2AJQ B;  1V58 A;  4I5Q A;  1B4Q A;  3P7X A;  4GF0 A;  1EV9 A;  3H4K A;  1K0M A;  1HNB A;  5EPF A;  3EMX A;  4EKZ A;  1GTI A;  1FG4 A;  5A4U A;  3APS A;  4IQ1 A;  1K0B A;  2B7K A;  5L71 A;  1AUC A;  2RM6 A;  4YQV A;  3ZYW A;  5A5K A;  3VPQ A;  2L4Q A;  3WGD A;  4TW5 A;  3GMF A;  3IOS A;  2VCW A;  3KM6 A;  1S3A A;  2HXK A;  4EO3 A;  4ZBD A;  2RLI A;  2M46 A;  4FO5 A;  4K6X A;  4MJA A;  5ABR A;  5J3R A;  4E8H A;  4MLY A;  4FQU A;  4V2N A;  3F63 A;  4ZBA A;  4XCS A;  2IMI A;  3NOF A;  3CYN A;  2OE0 A;  4WKW A;  5FT3 A;  2H72 A;  3DXB A;  1DSB A;  4PQI A;  1SU9 A;  1QMV A;  3TB2 A;  3W6G A;  1A2L A;  3LWA A;  3S9F A;  1SJ6 A;  3ZRE A;  2HRK B;  1B9Y C;  5ID2 A;  3QFA C;  4ML1 A;  2PUK C;  5G2Z A;  4E8E A;  1FHE A;  4KDY A;  2B5Y A;  3EMP A;  4ZB6 A;  1QGV A;  1MD4 A;  1PQN A;  3TOT A;  2VL9 A;  4PQH A;  2LNS A;  4CW9 A;  5DCG A;  1WPI A;  6GSU A;  3HHV A;  1PRX A;  5IPG A;  4FYC A;  4D73 B;  3H79 A;  5COH A;  2DJJ A;  2YJ7 A;  1TTZ A;  2MBT A;  2EIQ A;  2IWT A;  4KX4 A;  1QK8 A;  4YQM A;  6GSS A;  3Q6O A;  1TI1 A;  3IAS 2;  3IV4 A;  4BWS A;  1YF1 A;  2L5O A;  4GSN A;  1VF3 A;  3HDC A;  3WD6 A;  2IN3 A;  2AHE A;  1TRS A;  4QQ7 A;  2YWM A;  2DJ2 A;  3L9S A;  2YV7 A;  1V40 A;  4OWY A;  1EWX A;  4BVY A;  1BG5 A;  4ECI A;  1XW9 A;  4WR5 A;  1RK4 A;  3LXZ A;  3F3R A;  2AUV A;  1V98 A;  4EE0 A;  3I43 A;  2BJX A;  4EXJ A;  5CAX A;  3R3E A;  2GQK A;  3GNJ A;  1JLW A;  1JLV A;  4GQC A;  5ECR B;  4HZ2 A;  1G7O A;  3DYR A;  3L78 A;  2VM1 A;  5D93 A;  1JZO A;  4L8E A;  2LNT A;  1XWC A;  3FYG A;  4TRX A;  1O85 A;  3D0Z A;  2XHF A;  3QCP A;  3VWU A;  1J9B A;  9GSS A;  3RPP A;  5IMV A;  1ERT A;  4POL A;  2VD0 A;  16GS A;  2YOI A;  4KGI A;  1I9D A;  1GSY A;  2YCD A;  1T00 A;  2PWJ A;  1ABA A;  2C8U A;  2D2Z A;  3MDK A;  4XRD A;  3FZA A;  1HD2 A;  5ID2 B;  4PQ1 A;  3ZTL A;  5D96 A;  1O73 A;  1MEK A;  2ALB A;  3ERF A;  3WT1 A;  3M9K A;  2GTU A;  5CRD A;  2IMK A;  2VL2 C;  3C1R A;  4POM A;  5CP1 A;  3PH9 A;  1HNA A;  3TKS C;  1ML6 A;  5B6N A;  1NHO A;  1F3B A;  1GWC A;  1KNG A;  2QC7 A;  4FYU A;  1TRW A;  4TXV A;  1YY7 A;  1EZK A;  4GCI A;  4KUN A;  4OCF A;  5CRG A;  4ZBB A;  1GP1 A;  1OAZ A;  1S3C A;  3KZQ A;  1X5D A;  4XS1 A;  2HZE A;  3CSI A;  1M2A A;  3D21 A;  2VL3 A;  3EE2 A;  1GNE A;  1K0C A;  5CNW A;  2FY6 A;  4K7I A;  3KH9 A;  1Z7P A;  2L6C A;  4NMU A;  1XOB A;  2OKA A;  3F9U A;  1SK2 A;  2F8F A;  3ZRD A;  1THX A;  3A3T A;  2WFC A;  4BVY B;  4AJ8 A;  1XOA A;  2I1U A;  4ECB A;  2LRC A;  1AQX A;  2DML A;  3H8Q A;  1K0D A;  4OFN A;  2OAD A;  1MDJ A;  5ECN B;  4IGJ A;  3GH6 A;  4Q5F A;  1HYU A;  5JWQ B;  1MDI A;  2HSH A;  1M9B A;  3BJ5 A;  1V2A A;  5ECS A;  1SEN A;  5G5E A;  1OE8 A;  3J7Y k;  2A2S A;  4JU5 A;  3QAG A;  1GNW A;  3TKQ A;  4HU9 A;  1J0F A;  3WGX A;  5LD0 A;  3O6T A;  5H5Q A;  1TI3 A;  2DIZ A;  4PGT A;  2V2G A;  4IW9 A;  3DVW A;  1QFN A;  2IMD A;  3HZ4 A;  1ST9 A;  2J23 A;  2YPM A;  3EVI A;  1A0R P;  3FZ4 A;  1TDI A;  5CYY A;  1EOG A;  3SWL A;  3FK8 A;  2VCV A;  1MTC A;  4HJM A;  5EVO A;  1ON4 A;  2YZH A;  4XS4 A;  4MDC A;  1JZR A;  4V2L A;  2PVO C;  2F51 A;  2K9F A;  2H71 A;  3VFI A;  3GTU A;  2FCH A;  1TRV A;  5AN1 A;  2DMM A;  3RAZ A;  4V1A p;  4F0C A;  1VF4 A;  3HJM A;  4MZC A;  4XHM A;  2HLS A;  2HZF A;  3ZML A;  2DJ1 A;  2N5B A;  3ME8 A;  2LS5 A;  4LLR A;  1SKW B;  2JZT A;  3R2Q A;  4MZW A;  3HYP A;  4O32 A;  3EIN A;  1J08 A;  4Q5N A;  2HZE B;  2VLU A;  3QR6 A;  3H93 A;  2FWE A;  2HI7 A;  3N5O A;  3C73 A;  3WT2 A;  4G19 A;  4XS6 A;  2ZUP A;  4GRF A;  1CQG A;  4MPF A;  3LQ7 A;  3LG6 A;  3L4N A;  1EOH A;  4V1A g;  1EGO A;  2P0G A;  2H76 A;  3G9B A;  3C8E A;  2CVB A;  2HSM A;  2KOK A;  4LMV A;  2CX3 A;  2CQ9 A;  2H75 A;  3GIX A;  2VLT A;  2JSZ A;  2MBS A;  2PER A;  3TDG A;  1TOF A;  2L4C A;  2JSY A;  3HJP A;  3CBU A;  3F0I A;  1FO5 A;  2F3M A;  2IPA A;  4OFT A;  4YAV A;  4TXO A;  1UC7 A;  4TVE A;  2IJY A;  1R4W A;  3O3T A;  2HNL A;  3AY8 A;  2C0D A;  1Z9H A;  2OBK A;  3P8W A;  1A0F A;  2WB9 A;  1ERW A;  5BMU A;  4K9Z A;  3ZZX A;  4TR3 A;  3G7I A;  1GUL A;  3FRC A;  2IME A;  5IMD A;  1SD9 A;  4TOP A;  3DKS A;  4L5O A;  3ZMK A;  3IDV A;  2EIO A;  1GUK A;  1YJ6 A;  3UIW A;  1SYR A;  4ZB8 A;  1KTE A;  2H1D A;  5DAL A;  1JZD A;  5C04 A;  3FR6 A;  1NW2 A;  1NM3 A;  4XS4 B;  3W8S A;  2EIR A;  2YN1 A;  1K0O A;  3CXG A;  1N2A A;  1PD2 1;  2PBJ A;  13GS A;  1VF2 A;  3GTU B;  2UZ8 A;  4PXO A;  4RI7 A;  3TKR A;  2O85 A;  1U6T A;  5IOX A;  2GST A;  2DJK A;  2V41 A;  2LJR A;  2PVQ A;  3E3E A;  4MAB A;  1Z6M A;  4ULX A;  5IO2 A;  4IP6 A;  2OE1 A;  4AF2 A;  4KCE A;  1TP9 A;  5INY A;  2C4J A;  1MDK A;  4LL1 B;  1XWA A;  3C1S A;  1TKD B;  2YZU A;  1I5G A;  1TK0 B;  4IVF A;  1XXU A;  3MAK A;  4PNF A;  2B1L A;  3WGE A;  1M9A A;  2CV4 A;  1PGT A;  5JCW A;  1XVQ A;  3GV1 A;  4JE1 A;  3IK7 A;  3ZVJ D;  3DD3 A;  3KTL A;  3TJF A;  3DRN A;  1GH2 A;  6GSV A;  2HSM B;  3A2X A;  2O87 A;  5LNK e;  3V1W A;  3GKK A;  3Q74 A;  3O76 A;  4I6X A;  1A8Y A;  3GHA A;  4RQR A;  2IIY A;  3ZVJ A;  2H1B A;  4F03 A;  4MA9 A;  1GSQ A;  5DQY A;  2V32 A;  1NHY A;  4I2T A;  2YAN A;  4L0U A;  1DUG A;  3GKN A;  5JWO B;  1YEX A;  2CVK A;  2L6D A;  2DLX A;  3UL3 A;  4IHU A;  3ZIJ A;  1XWG A;  4BA7 A;  2P5Q A;  1Z6N A;  2H30 A;  5J5N A;  4EDY A;  2TRC P;  4G9H A;  4YAP A;  1TK5 B;  1ERV A;  3UAP A;  3L0H A;  4JR6 A;  2FHE A;  2C3Q A;  1SKR B;  5HR2 A;  3UBL A;  1WOU A;  5IPH A;  1G6W A;  5DAL B;  4G0L A;  5F0G A;  3LXT A;  2GZY A;  3GUR A;  3APQ A;  3QPM A;  4FIW A;  4HS1 A;  1WJK A;  3M8N A;  2HFD A;  1KBN A;  3FZ5 A;  2K18 A;  2ZNM A;  5HR3 A;  4HOJ A;  4MJE A;  2R5G A;  2K6V A;  2NDO A;  5DDL A;  2NPB A;  2JAD A;  3F6D A;  5IQY A;  4OO4 A;  2LJK A;  3W8J A;  5EL8 A;  1HQO A;  2FUG 2;  1Q4J A;  5CO3 A;  3FY7 A;  4HU7 A;  2CVD A;  4AGS A;  4PUA A;  4HZ4 A;  2E2G A;  2K8V A;  2H0H A;  2R3X A;  2AYT A;  2B7J A;  3DIE A;  4WF5 A;  4V2M A;  3VWX A;  5HFG A;  1KEB A;  1A24 A;  2H0G A;  3RHB A;  2LEG A;  3KTB A;  3M3M A;  3U6V A;  19GS A;  3TGZ A;  1GUH A;  2LV3 A;  1W89 A;  1U3I A;  4PUF C;  1Z7R A;  1AIU A;  1XWK A;  2CZ3 A;  1PMT A;  1XBS A;  3GUS A;  5F07 A;  1YQ1 A;  5D9W A;  1ZOF A;  1SK1 A;  2VAF A;  3TJB A;  1JFU A;  3KEB A;  2CZ2 A;  5IMZ A;  2N5A A;  2HSY A;  4GLT A;  6GSW A;  2I4A A;  5D8I A;  2AB6 A;  2LQQ A;  2C0G A;  2YJH A;  2P31 A;  1F2E A;  2H6Z A;  4BL7 A;  4MH2 A;  1OC9 A;  1G0T A;  3ME7 A;  4ML6 A;  4MZB A;  4BPY A;  2VD1 A;  2DJ0 A;  2X8C A;  4G2E A;  2AAW A;  2QKE A;  2RUF A;  4PTS A;  4LMW A;  4DVC A;  4L0W A;  1OKD A;  1EV4 A;  3FR3 A;  3A2W A;  3ED3 A;  1XW5 A;  3TUE A;  2VM2 A;  2NTO A;  1DBY A;  3PIN A;  5CRW A;  3OR5 A;  1V57 A;  3HVV A;  3BCI A;  1GLP A;  3VLN A;  2VUP A;  3HY2 A;  4LL4 B;  5GAN D;  4KF9 A;  5E59 A;  4KA0 A;  3KGK A;  4JR4 A;  5IMA A;  3VWV A;  2VCQ A;  4KAE A;  3SBC A;  1B48 A;  1GTA A;  4RQX A;  5G30 A;  2FWG A;  4K0N A;  3HVX A;  1GLQ A;  5AGY A;  2AV4 A;  1GL8 A;  4EUY A;  2B5E A;  3D4M A;  2GSQ A;  1OYJ A;  3M0F A;  4O92 A;  1WMJ A;  3TJK A;  4MP4 A;  3GST A;  4HJ2 A;  3BD2 A;  3ZFL A;  2RUE A;  2PU9 C;  1BX9 A;  2LKU A;  1T1V A;  2H19 A;  3EWL A;  4JBB A;  2C3N A;  5DAK A;  1X9W B;  1PKW A;  2H73 A;  2MMA A;  2X8H A;  3KP9 A;  3HD5 A;  5KN1 A;  4ZB9 A;  3VPT A;  1AQV A;  5AIV A;  3HZ8 A;  4K8M A;  2CAI A;  2GLR A;  4F2I A;  3G7J A;  3IAM 2;  2H0I A;  2O89 A;  2X64 A;  1SD8 A;  4J57 E;  4YH2 A;  1DE2 A;  1PKZ A;  4BL7 B;  3HJO A;  3D6I A;  4WF4 A;  3TJJ A;  1OC8 A;  2KP1 A;  5KN0 A;  5HR1 A;  2H74 A;  1FVJ A;  3IC4 A;  3PGT A;  2F9S A;  2HSN B; 
#chains in the Genus database with same CATH topology
 3FHK A;  4K2D A;  2XC2 A;  1FW1 A;  4KDU A;  5JCG A;  4NAX A;  4PUR A;  3CTG A;  3UBK A;  2FD3 A;  2FLS A;  4K7O A;  2GQM A;  4OCE A;  4X0X A;  2HQT A;  5D9T A;  1WE0 A;  2LRT A;  1TK8 B;  3C71 A;  1R5P A;  2C3T A;  2EFD A;  5GAP D;  1TU8 A;  2GSR A;  3L9V A;  2B3S A;  4PHZ C;  2VCX A;  5EY6 A;  3DVX A;  5IO0 A;  5G31 A;  3QFB C;  4ILF A;  3LW9 A;  1QXH A;  1ERU A;  1Z3E A;  3EC3 A;  3NZN A;  4BVX A;  1LJR A;  2PGT A;  3UAR A;  5D9V A;  2H01 A;  3RGB C;  3GL5 A;  2ON7 A;  1YEW C;  3CSJ A;  1WRY A;  3LSZ A;  3KD0 A;  1SL2 B;  3VI7 A;  4J56 E;  2XBQ A;  4MJB A;  4ZXG A;  1BAY A;  2LRN A;  1M7T A;  3UMA A;  2B6M A;  4G0I A;  2ON5 A;  4X1U A;  3KH7 A;  2FA8 A;  3ISO A;  1TJD A;  4HUA A;  1FVK A;  4KB3 A;  3GH9 A;  5AIX A;  1FOV A;  2IL3 A;  3GFK A;  2FWH A;  3I9V 2;  4ACS A;  4MK3 A;  3APO A;  1QQ2 A;  3G7Y A;  3KJY A;  5DAK B;  1SJI A;  1G6Y A;  4ZIL A;  4FYB A;  3DEX A;  1N25 A;  2GSS A;  1CQH A;  3Q18 A;  4I2U A;  4O5R A;  3MNG A;  1OKT A;  1GSE A;  1EGR A;  5D9X A;  4EVM A;  4HQS A;  4Q5R A;  1O7U A;  3GL3 A;  3K8N A;  4OMV A;  3CMI A;  2HRF A;  4TR1 A;  18GS A;  3DGQ A;  1ACV A;  3HCZ A;  4HQZ A;  4MMM A;  3CWG A;  1OC3 A;  1S3D A;  1AXD A;  5B8B A;  1F37 A;  2E2M A;  2JL4 A;  5G5F A;  4ZIJ A;  1T3B A;  4MF5 A;  3RPN A;  1H75 A;  4EIP A;  2WVX A;  3E0U A;  5KEJ A;  4KE3 A;  5HR0 A;  3IBH A;  3TRX A;  2A4V A;  3LYP A;  2P5R A;  1X5E A;  3N9J A;  2H8L A;  4X43 A;  4GSS A;  3UVH A;  5J41 A;  5J4U A;  2BTO T;  1K0N A;  4FH8 A;  3FEU A;  4MJC A;  2BMX A;  5GSS A;  1PL1 A;  1TXX A;  2B5X A;  5B7C A;  1MD3 A;  4GXZ A;  1PL2 A;  7GSS A;  1H4O A;  4POK A;  4L5L A;  5F8B A;  3P2A A;  1EEM A;  4KSM A;  1XZO A;  5IM9 A;  1A23 A;  3RDW A;  2K8S A;  3TRQ A;  3A5W A;  1O6J A;  1ZYQ B;  3F3Q A;  1U87 A;  4XTS A;  2PMT A;  1SYX A;  3QOU A;  3ZIV A;  4N3Z A;  1SK0 A;  4MNN A;  2ZCT A;  4WEY A;  3QAW A;  1VGL A;  3F6F A;  5A34 A;  2L59 A;  4DSQ A;  3CSH A;  4HI7 A;  2LJA A;  4IS0 A;  3MWH A;  2GDR A;  2R2J A;  3A2V A;  1JHB A;  2NBS A;  2C0F A;  2JAC A;  1X9M B;  2CT6 A;  4TXO B;  2OA7 A;  2R37 A;  4MF6 A;  3GX8 A;  2H1L A;  1R26 A;  4GWR A;  1DE1 A;  3DML A;  1OE7 A;  1X9S B;  1ZCP A;  5DBQ A;  1THO A;  1T7P B;  4YKG A;  2X8G A;  1AC1 A;  5ECP B;  3KP8 A;  4JRR A;  4Z7X A;  1M2D A;  2C80 A;  4TR1 B;  1A8L A;  1B8X A;  2X4A A;  4RUV A;  1M2B A;  3KIJ A;  2V6K A;  1Y25 A;  5A1N A;  1E2Y A;  1YEP A;  2E0Q A;  1FB0 A;  3NIV A;  4K2X A;  4PX1 A;  4NV2 A;  5JWR B;  2VIM A;  4WR4 A;  3IC8 A;  3GKX A;  2WVX B;  3D5J A;  3D4T A;  2ES7 A;  2HRN A;  1PA3 A;  4HDE A;  1N8J A;  3HKR A;  2GT6 A;  10GS A;  5HFI A;  3QD9 A;  4CY6 A;  4NHZ A;  2WW1 A;  1M3I A;  1PSQ A;  2LTK A;  4POB A;  3UJ1 A;  4EDZ A;  5CRE A;  1GSD A;  1GUM A;  2G0F A;  2L57 A;  1NSW A;  4TN8 A;  3LFL A;  2GT5 A;  1XFL A;  4H86 A;  2OE3 A;  1YKA A;  2J9H A;  2H6X A;  2V1M A;  4DEJ A;  1F3A A;  4NWY A;  3EU3 A;  5A5H A;  1W4V A;  4P3Y B;  5ECK B;  4IEL A;  4XRA A;  2YWN A;  1LBK A;  1GSF A;  4TR0 A;  2WRT A;  5C00 A;  3ZIT A;  2LST A;  3LJR A;  4ISD A;  3I6A A;  3IXR A;  3EUR A;  3IPZ A;  2M72 A;  5CRH A;  2OBI A;  2REM A;  2VCT A;  5ECQ B;  4JZQ A;  1X5C A;  1U3A A;  1SKS B;  1ZZY A;  4USS A;  1IYH A;  1USB A;  5D73 A;  3WYW A;  5A34 B;  3VI5 A;  2KHP A;  2WW3 A;  4MH3 A;  4N0Z A;  2F8A A;  2LQO A;  17GS A;  1VF1 A;  2PPT A;  2I81 A;  4K1F A;  2DBC A;  1EP8 A;  3E9J B;  1K0A A;  5ECM B;  5A4W A;  2N5F A;  4CHS A;  3IE3 A;  4F82 A;  4TR4 A;  5ELG A;  4K0G A;  1FOH A;  3CRU A;  4KCA A;  1T4Z A;  2KP2 A;  3JCM L;  5ECH B;  1R5A A;  5H5R A;  6GSY A;  5IMC A;  3LYK A;  5A4V A;  3P90 A;  4F0B A;  2JZR A;  4GTU A;  3PR8 A;  3RBT A;  6GSX A;  3TOU A;  1YDK A;  2WDU A;  2PN8 A;  2H66 A;  2I3Y A;  4MCU A;  4WBJ A;  3US3 A;  1SL0 B;  1E6B A;  3M9J A;  1B9X C;  2DSA A;  4AKX B;  2MMZ A;  1F6M C;  5DQS A;  1ZMA A;  3MSZ A;  1O8W A;  1Z5Y E;  3VWW A;  2WS2 A;  4N11 A;  1XW6 A;  1GTB A;  12GS A;  5KN2 A;  3RHC A;  1AW9 A;  2JU5 A;  5A1N B;  5F06 A;  3ERW A;  1FAA A;  14GS A;  1Y6E A;  3EYT A;  1F9M A;  3KCM A;  4IP1 A;  1TU7 A;  1TW9 A;  2JZS A;  3FW2 A;  2IFQ A;  1WWJ A;  2KUC A;  2XPD A;  5JCU A;  3HMJ G;  2WVZ A;  4ZL7 A;  4LA1 A;  1T4Y A;  5A5H B;  4G0K A;  5J9B A;  3LOR A;  4N30 A;  2O7K A;  3LGC A;  1T8E B;  2GZP A;  3HA9 A;  1UA5 A;  3DWV A;  4N10 A;  4AJ7 A;  1GRX A;  1EEJ A;  4GST A;  1XVW A;  1LU4 A;  2MMN A;  2RII A;  5ECL B;  4NPB A;  1PN9 A;  2WZ9 A;  2C1Y A;  4G01 A;  3QAV A;  3GRX A;  4EF0 A;  4DSS A;  1XCC A;  1BQ7 A;  1UVZ A;  4I97 A;  2YWI A;  2YNX A;  4ID0 A;  4BWQ A;  5GZZ B;  4YQU A;  4QL9 A;  1O81 A;  3VUR A;  5DJL A;  1M3J A;  20GS A;  4MPG A;  5F05 A;  3RFR C;  1FB6 A;  3QMX A;  4ECC A;  4NXI A;  5BRT A;  2E7P A;  5IOW A;  1U88 A;  1YVL A;  2GS3 A;  3HXS A;  1A2M A;  2WJU A;  1K3Y A;  3F4R A;  2G2Q A;  1AQW A;  1ZYN A;  6GST A;  5DCH A;  5E4W A;  4AJ6 A;  3UEM A;  2B1K A;  2HT9 A;  4WXT A;  1GTU A;  1ZL9 A;  4JED A;  3LEF A;  5FHI A;  1XIY A;  2A2P A;  3C7M A;  1OC9 B;  2R6K A;  2V6O A;  1Q98 A;  4QMK A;  2Z9S A;  3GX0 A;  2DIY A;  2VOC A;  2GZZ A;  5AIS A;  3KMO A;  2DKI A;  1BJX A;  1C72 A;  1O8X A;  2MZC A;  2DJ3 A;  5ECO B;  3VK9 A;  3EU4 A;  3ZLP A;  1AAZ A;  1RQM A;  1ZGN A;  3TKP A;  4KSO A;  4GQF A;  2YP6 A;  3BOA A;  4MF7 A;  2H70 A;  4XIH A;  1R7H A;  2IFQ B;  4KDX A;  3CRT A;  3IHQ A;  5ECI B;  3F8U A;  3TU3 B;  3KMN A;  4N0V A;  4IJI A;  3QDN A;  1XPV A;  1RW1 A;  2R0P A;  3UVT A;  3ZFB A;  3ERG A;  1K3O A;  2FWF A;  2GGT A;  2WVY A;  2TIR A;  2X99 A;  2VLV A;  3IK9 A;  2O8V B;  2M80 A;  2L5L A;  4KW6 A;  5HQP A;  1BYE A;  1VRS D;  2DC5 A;  2WCI A;  2YWO A;  1B4P A;  2OAC A;  1M99 A;  1GSS A;  1YKC A;  4W66 A;  2GQL A;  3D22 A;  3ZL5 A;  2XBI A;  3F4T A;  4NHW A;  2QA1 A;  3TJG A;  1A2J A;  1HNC A;  4ECJ A;  5IMF A;  4DSS B;  1XWB A;  4AI6 A;  1SL1 B;  22GS A;  3PPU A;  4EL1 A;  2H6Y A;  3TRP A;  3GN3 A;  1QUW A;  5G1K A;  3Q19 A;  1UN2 A;  2OT3 A;  1ILO A;  3TCO A;  3IRA A;  4NV5 A;  3I69 A;  4ZL8 A;  1SJZ A;  1YZX A;  4IKH A;  2O3E A;  4YKF A;  3GSS A;  2HE3 A;  3FZ9 A;  2OJL A;  2I9H A;  4DSR A;  1I1I P;  2WW2 A;  4J2F A;  5DVB A;  2MMO A;  2RM5 A;  4G10 A;  3GA4 A;  2FA4 A;  2C0E A;  1M0U A;  1PX7 A;  2CA8 A;  5HFK A;  2WUL A;  2EC4 A;  4IBP A;  3KXO A;  1TXU A;  2HYX A;  2FNO A;  1JZW A;  4KND A;  1WIK A;  4IQA A;  4I8B A;  3L9U A;  2A2R A;  5KN3 A;  1X0R A;  2QGV A;  4CDO A;  2TRX A;  4KH7 A;  4TKY A;  3BBY A;  3FR9 A;  4OO5 A;  4WET A;  4K7N A;  2WZS A;  3F4S A;  4WBR D;  2YV9 A;  5IIZ A;  4OD7 A;  2R4V A;  3GYK A;  1URM A;  1WP0 A;  5ELA A;  1OVN A;  4IN0 A;  3GKM A;  4QL7 A;  3TKS E;  2CAQ A;  2XPE A;  5G1L A;  4IJ3 A;  5J9C A;  2HRK A;  4ZL9 A;  2QSI A;  5DJM A;  4PI0 C;  5B6M A;  2H1G A;  4BVX B;  4OFM A;  1PX6 A;  3CTF A;  3IR4 A;  2MYG A;  3IA1 A;  4O5Q A;  5FWG A;  2VO4 A;  1K3L A;  4HEA 2;  4D73 A;  1ZYE A;  5H5S A;  4O7H A;  2VCZ A;  8GSS A;  3FKF A;  4F9Z A;  1YF0 A;  2IMF A;  2CX4 A;  1TRU A;  1G7E A;  11GS A;  3UOM A;  1IYI A;  5ENU A;  3HVS A;  4AKI A;  3H1N A;  2VL2 A;  2LUS A;  3BCK A;  3M1G A;  2NVL A;  3TKS A;  5B8A A;  1BED A;  4EC0 A;  3J7Y b;  4Q5Q A;  3U5R E;  1PN0 A;  2WGR A;  2H1A A;  4RI6 A;  4PNG A;  2GVP A;  1EP7 A;  1V9W A;  1GSU A;  2FGX A;  5GST A;  5LCZ A;  2HRA A;  2KLX A;  2AJQ B;  1V58 A;  4I5Q A;  1B4Q A;  3P7X A;  4GF0 A;  1EV9 A;  3H4K A;  1K0M A;  1HNB A;  5EPF A;  5KOW A;  3EMX A;  4EKZ A;  1GTI A;  2A4H A;  1FG4 A;  5A4U A;  3APS A;  2VKZ G;  4IQ1 A;  1K0B A;  2B7K A;  5L71 A;  1AUC A;  2RM6 A;  4YQV A;  3ZYW A;  5A5K A;  3VPQ A;  2L4Q A;  4X4J A;  3FMW A;  3WGD A;  4TW5 A;  3GMF A;  3IOS A;  2VCW A;  3KM6 A;  1S3A A;  2HXK A;  4EO3 A;  4ZBD A;  2RLI A;  2M46 A;  4FO5 A;  4K6X A;  4MJA A;  5ABR A;  5J3R A;  4E8H A;  4MLY A;  4FQU A;  4V2N A;  3F63 A;  4ZBA A;  2DKH A;  4XCS A;  2EFH A;  2IMI A;  3CYN A;  2OE0 A;  3NOF A;  4WKW A;  5FT3 A;  2O5V A;  2H72 A;  1SVO A;  3DXB A;  4EIQ A;  1DSB A;  4PQI A;  1SU9 A;  1QMV A;  3TB2 A;  3W6G A;  1A2L A;  3LWA A;  3HVN A;  3S9F A;  1SJ6 A;  3ZRE A;  4BIK A;  2HRK B;  1B9Y C;  5ID2 A;  3QFA C;  4ML1 A;  2PUK C;  5G2Z A;  4E8E A;  1FHE A;  4KDY A;  2B5Y A;  3EMP A;  4ZB6 A;  1QGV A;  1MD4 A;  1PQN A;  3TOT A;  2VL9 A;  4PQH A;  2LNS A;  4CW9 A;  3MIX A;  5DCG A;  1WPI A;  6GSU A;  3HHV A;  1PRX A;  5IPG A;  4FYC A;  4D73 B;  3H79 A;  5COH A;  2DJJ A;  2YJ7 A;  1TTZ A;  2MBT A;  2EIQ A;  2IWT A;  4KX4 A;  1QK8 A;  4YQM A;  6GSS A;  3Q6O A;  1TI1 A;  3IAS 2;  3IV4 A;  4BWS A;  1YF1 A;  2L5O A;  4GSN A;  1VF3 A;  3HDC A;  3WD6 A;  2IN3 A;  2AHE A;  1TRS A;  4QQ7 A;  2YWM A;  2DJ2 A;  3L9S A;  2YV7 A;  1V40 A;  4OWY A;  1EWX A;  4BVY A;  1BG5 A;  4ECI A;  1XW9 A;  4WR5 A;  1RK4 A;  3LXZ A;  3F3R A;  2AUV A;  1V98 A;  4EE0 A;  3I43 A;  2BJX A;  4EXJ A;  5CAX A;  3R3E A;  2GQK A;  3GNJ A;  1JLW A;  1JLV A;  4GQC A;  5ECR B;  4HZ2 A;  1G7O A;  3DYR A;  3L78 A;  2VM1 A;  5D93 A;  1JZO A;  4L8E A;  2LNT A;  1XWC A;  3FYG A;  4TRX A;  1O85 A;  3D0Z A;  2XHF A;  3QCP A;  3VWU A;  1J9B A;  9GSS A;  3RPP A;  5IMV A;  1ERT A;  4POL A;  2VD0 A;  16GS A;  2YOI A;  4KGI A;  1I9D A;  1GSY A;  2EFE A;  2YCD A;  1T00 A;  2PWJ A;  1ABA A;  2C8U A;  2D2Z A;  2QA2 A;  3MDK A;  4XRD A;  3FZA A;  1HD2 A;  5ID2 B;  4PQ1 A;  3ZTL A;  5D96 A;  1O73 A;  1MEK A;  2ALB A;  3ERF A;  3WT1 A;  2EFC A;  3M9K A;  2GTU A;  5CRD A;  2IMK A;  3IHG A;  2VL2 C;  3C1R A;  4POM A;  5CP1 A;  3PH9 A;  1HNA A;  3TKS C;  1ML6 A;  5B6N A;  1NHO A;  1F3B A;  1GWC A;  5J47 A;  1KNG A;  2QC7 A;  4FYU A;  1TRW A;  3CHX C;  1YY7 A;  4TXV A;  1EZK A;  4GCI A;  4KUN A;  4OCF A;  5CRG A;  4ZBB A;  1GP1 A;  1OAZ A;  1S3C A;  3KZQ A;  1X5D A;  4XS1 A;  2HZE A;  3CSI A;  1M2A A;  3D21 A;  2VL3 A;  5J4V A;  3EE2 A;  1GNE A;  1K0C A;  5CNW A;  2FY6 A;  4K7I A;  3KH9 A;  1Z7P A;  2L6C A;  4NMU A;  1XOB A;  2OKA A;  3F9U A;  1SK2 A;  2F8F A;  3ZRD A;  1THX A;  3A3T A;  2WFC A;  4BVY B;  4AJ8 A;  1XOA A;  2I1U A;  4ECB A;  2LRC A;  1AQX A;  5J4Y A;  2DML A;  3H8Q A;  1K0D A;  4OFN A;  2OAD A;  1MDJ A;  5ECN B;  4IGJ A;  3GH6 A;  4Q5F A;  1HYU A;  5JWQ B;  1MDI A;  2HSH A;  1M9B A;  3BJ5 A;  1V2A A;  5ECS A;  1SEN A;  5G5E A;  1OE8 A;  3J7Y k;  2A2S A;  4JU5 A;  3QAG A;  1GNW A;  3TKQ A;  4HU9 A;  2WW0 A;  1J0F A;  3WGX A;  5LD0 A;  3O6T A;  5H5Q A;  1TI3 A;  2DIZ A;  4PGT A;  2V2G A;  4IW9 A;  3DVW A;  1QFN A;  2IMD A;  3HZ4 A;  1ST9 A;  2J23 A;  2YPM A;  3EVI A;  1A0R P;  3FZ4 A;  1TDI A;  5CYY A;  1EOG A;  3SWL A;  3FK8 A;  2VCV A;  1MTC A;  4HJM A;  5EVO A;  1ON4 A;  2YZH A;  4XS4 A;  4MDC A;  1JZR A;  4V2L A;  2PVO C;  2F51 A;  2K9F A;  2H71 A;  4HSC X;  3VFI A;  3GTU A;  2FCH A;  1TRV A;  5AN1 A;  2DMM A;  3RAZ A;  4V1A p;  4F0C A;  1VF4 A;  3HJM A;  4MZC A;  4XHM A;  2HLS A;  2HZF A;  3ZML A;  2DJ1 A;  2N5B A;  3ME8 A;  4GDF A;  2LS5 A;  4LLR A;  1SKW B;  2JZT A;  3R2Q A;  4MZW A;  3HYP A;  4O32 A;  3EIN A;  1J08 A;  4Q5N A;  2HZE B;  2VLU A;  3QR6 A;  3H93 A;  2FWE A;  2HI7 A;  3N5O A;  3C73 A;  3WT2 A;  4G19 A;  4XS6 A;  2ZUP A;  4GRF A;  1CQG A;  4MPF A;  3LQ7 A;  3LG6 A;  3L4N A;  1EOH A;  4V1A g;  1EGO A;  2P0G A;  2H76 A;  3G9B A;  3C8E A;  2CVB A;  2HSM A;  2KOK A;  4LMV A;  2CX3 A;  2CQ9 A;  2H75 A;  3GIX A;  2VLT A;  2JSZ A;  2MBS A;  2PER A;  2X49 A;  3TDG A;  1TOF A;  2L4C A;  2JSY A;  3HJP A;  3CBU A;  3F0I A;  2R0C A;  1FO5 A;  2F3M A;  2IPA A;  4OFT A;  4YAV A;  4TXO A;  1UC7 A;  4TVE A;  2IJY A;  1R4W A;  3O3T A;  2HNL A;  3AY8 A;  2C0D A;  1Z9H A;  2OBK A;  4FXY P;  3P8W A;  1A0F A;  2WB9 A;  1ERW A;  5BMU A;  4K9Z A;  3ZZX A;  4TR3 A;  3G7I A;  1GUL A;  3FRC A;  2IME A;  5IMD A;  1SD9 A;  4TOP A;  3DKS A;  4L5O A;  3ZMK A;  3IDV A;  2EIO A;  1GUK A;  1YJ6 A;  3UIW A;  1SYR A;  1PFO A;  4ZB8 A;  1KTE A;  2H1D A;  2R0G A;  5DAL A;  1JZD A;  5C04 A;  4Z2T A;  3FR6 A;  1NW2 A;  1NM3 A;  4XS4 B;  3W8S A;  2EIR A;  2YN1 A;  1K0O A;  1SVM A;  3CXG A;  1N2A A;  1PD2 1;  2PBJ A;  13GS A;  1VF2 A;  3GTU B;  4A5P A;  2UZ8 A;  4PXO A;  4RI7 A;  3TKR A;  2O85 A;  1U6T A;  5IOX A;  2GST A;  2DJK A;  2V41 A;  2LJR A;  2PVQ A;  3E3E A;  4MAB A;  1Z6M A;  4ULX A;  5IO2 A;  4IP6 A;  2OE1 A;  4AF2 A;  4KCE A;  1TP9 A;  5INY A;  2C4J A;  1MDK A;  4LL1 B;  1XWA A;  3C1S A;  1TKD B;  2YZU A;  1I5G A;  1TK0 B;  4IVF A;  1XXU A;  3MAK A;  4PNF A;  2B1L A;  3WGE A;  4CY8 A;  3CQF A;  1M9A A;  2CV4 A;  1PGT A;  5JCW A;  1XVQ A;  3GV1 A;  4JE1 A;  3IK7 A;  3ZVJ D;  3DD3 A;  3KTL A;  3TJF A;  3DRN A;  1GH2 A;  6GSV A;  2HSM B;  3A2X A;  2O87 A;  5LNK e;  1ZYP A;  3V1W A;  3GKK A;  3Q74 A;  2UV8 G;  3O76 A;  4I6X A;  4AKG A;  1A8Y A;  3GHA A;  4RQR A;  2IIY A;  3ZVJ A;  2H1B A;  4F03 A;  4MA9 A;  1GSQ A;  5DQY A;  2V32 A;  1NHY A;  4I2T A;  2YAN A;  4L0U A;  1DUG A;  3GKN A;  5JWO B;  1YEX A;  2CVK A;  2L6D A;  2DLX A;  5BMU B;  3UL3 A;  4IHU A;  3ZIJ A;  1XWG A;  4BA7 A;  2P5Q A;  1Z6N A;  2H30 A;  5J5N A;  4EDY A;  2TRC P;  4G9H A;  4YAP A;  1TK5 B;  1ERV A;  3UAP A;  3L0H A;  4JR6 A;  2FHE A;  2C3Q A;  1SKR B;  5HR2 A;  3UBL A;  1WOU A;  5IPH A;  1G6W A;  5DAL B;  4G0L A;  5F0G A;  3LXT A;  2GZY A;  3GUR A;  4K5S A;  3APQ A;  3QPM A;  4FIW A;  4HS1 A;  1WJK A;  1Y1U A;  3M8N A;  2HFD A;  1KBN A;  3FZ5 A;  2K18 A;  2ZNM A;  5HR3 A;  4HOJ A;  4MJE A;  2R5G A;  2K6V A;  2NDO A;  1BF5 A;  5DDL A;  2NPB A;  2JAD A;  1S4B P;  3F6D A;  5IQY A;  4OO4 A;  2LJK A;  3W8J A;  5EL8 A;  1HQO A;  2FUG 2;  1Q4J A;  5CO3 A;  3FY7 A;  4ZB7 A;  4HU7 A;  2CVD A;  4AGS A;  4PUA A;  4HZ4 A;  5KOX A;  2E2G A;  2K8V A;  3EPT A;  2H0H A;  2R3X A;  2AYT A;  2B7J A;  3DIE A;  4WF5 A;  4V2M A;  3VWX A;  5HFG A;  1KEB A;  1A24 A;  2H0G A;  3RHB A;  2LEG A;  3KTB A;  3M3M A;  3U6V A;  1BG1 A;  19GS A;  3TGZ A;  1GUH A;  2LV3 A;  1W89 A;  1U3I A;  4PUF C;  1Z7R A;  1AIU A;  1XWK A;  2CZ3 A;  1PMT A;  3MYD A;  1XBS A;  3GUS A;  5F07 A;  1YQ1 A;  4K5R A;  5D9W A;  1ZOF A;  1SK1 A;  2VAF A;  3TJB A;  1JFU A;  3KEB A;  1SVL A;  2CZ2 A;  5IMZ A;  2N5A A;  2HSY A;  4O5U A;  4GLT A;  6GSW A;  4Z2U A;  2I4A A;  5D8I A;  2AB6 A;  2LQQ A;  2C0G A;  2YJH A;  2P31 A;  1F2E A;  2O36 A;  2H6Z A;  4BL7 A;  4MH2 A;  1OC9 A;  1G0T A;  3ME7 A;  4ML6 A;  4MZB A;  4BPY A;  2VD1 A;  2DJ0 A;  2X8C A;  4G2E A;  2AAW A;  2QKE A;  2RUF A;  4PTS A;  2HSN A;  4LMW A;  4DVC A;  4L0W A;  1OKD A;  1EV4 A;  3FR3 A;  3A2W A;  3ED3 A;  1XW5 A;  3TUE A;  2VM2 A;  2NTO A;  1DBY A;  3PIN A;  5CRW A;  4Z2R A;  1V57 A;  3OR5 A;  3HVV A;  3BCI A;  1XG8 A;  1GLP A;  3VLN A;  2VUP A;  3HY2 A;  4LL4 B;  5GAN D;  4KF9 A;  5E59 A;  4KA0 A;  3KGK A;  4JR4 A;  5IMA A;  5J40 A;  3VWV A;  2VCQ A;  4KAE A;  3SBC A;  1B48 A;  1GTA A;  4RQX A;  5G30 A;  2FWG A;  4K0N A;  1S3R A;  3HVX A;  1GLQ A;  5AGY A;  2AV4 A;  3A5I A;  1GL8 A;  4EUY A;  2B5E A;  4AKH A;  3D4M A;  2GSQ A;  1OYJ A;  3M0F A;  4O92 A;  1WMJ A;  3TJK A;  4MP4 A;  3GST A;  4HJ2 A;  4PI2 C;  3BD2 A;  3ZFL A;  2RUE A;  2PU9 C;  1BX9 A;  4E68 A;  2LKU A;  1T1V A;  2H19 A;  3EWL A;  4JBB A;  2C3N A;  5DAK A;  1X9W B;  1PKW A;  2H73 A;  2MMA A;  2X8H A;  3KP9 A;  3HD5 A;  5KN1 A;  4ZB9 A;  3VPT A;  1AQV A;  5AIV A;  3HZ8 A;  4K8M A;  2CAI A;  2GLR A;  4F2I A;  3G7J A;  3IAM 2;  2H0I A;  2O89 A;  2X64 A;  1SD8 A;  4J57 E;  4YH2 A;  1DE2 A;  1PKZ A;  4BL7 B;  3HJO A;  3D6I A;  4WF4 A;  3TJJ A;  1OC8 A;  2KP1 A;  5KN0 A;  5HR1 A;  2H74 A;  4ICY A;  1FVJ A;  3IC4 A;  3PGT A;  2F9S A;  2HSN B; 
#chains in the Genus database with same CATH homology
 3FHK A;  4K2D A;  2XC2 A;  1FW1 A;  4KDU A;  5JCG A;  4NAX A;  4PUR A;  3CTG A;  3UBK A;  2FD3 A;  2FLS A;  4K7O A;  2GQM A;  4OCE A;  4X0X A;  2HQT A;  5D9T A;  1WE0 A;  2LRT A;  1TK8 B;  3C71 A;  1R5P A;  2C3T A;  2EFD A;  5GAP D;  1TU8 A;  2GSR A;  3L9V A;  2B3S A;  2VCX A;  5EY6 A;  3DVX A;  5IO0 A;  5G31 A;  3QFB C;  4ILF A;  3LW9 A;  1QXH A;  1ERU A;  1Z3E A;  3EC3 A;  3NZN A;  4BVX A;  1LJR A;  2PGT A;  3UAR A;  5D9V A;  2H01 A;  3GL5 A;  2ON7 A;  3CSJ A;  1WRY A;  3LSZ A;  3KD0 A;  1SL2 B;  3VI7 A;  4J56 E;  2XBQ A;  4MJB A;  4ZXG A;  1BAY A;  2LRN A;  1M7T A;  3UMA A;  2B6M A;  4G0I A;  2ON5 A;  4X1U A;  3KH7 A;  2FA8 A;  3ISO A;  1TJD A;  4HUA A;  1FVK A;  4KB3 A;  3GH9 A;  5AIX A;  1FOV A;  2IL3 A;  3GFK A;  2FWH A;  3I9V 2;  4ACS A;  4MK3 A;  3APO A;  1QQ2 A;  3G7Y A;  3KJY A;  5DAK B;  1SJI A;  1G6Y A;  4ZIL A;  4FYB A;  3DEX A;  1N25 A;  2GSS A;  1CQH A;  3Q18 A;  4I2U A;  4O5R A;  3MNG A;  1OKT A;  1GSE A;  1EGR A;  5D9X A;  4EVM A;  4HQS A;  4Q5R A;  1O7U A;  3GL3 A;  3K8N A;  4OMV A;  3CMI A;  2HRF A;  4TR1 A;  18GS A;  3DGQ A;  1ACV A;  3HCZ A;  4HQZ A;  4MMM A;  3CWG A;  1OC3 A;  1S3D A;  1AXD A;  5B8B A;  1F37 A;  2E2M A;  2JL4 A;  5G5F A;  4ZIJ A;  1T3B A;  4MF5 A;  3RPN A;  1H75 A;  4EIP A;  3E0U A;  5KEJ A;  4KE3 A;  5HR0 A;  3IBH A;  3TRX A;  2A4V A;  3LYP A;  2P5R A;  1X5E A;  3N9J A;  2H8L A;  4X43 A;  4GSS A;  3UVH A;  5J41 A;  5J4U A;  2BTO T;  1K0N A;  4FH8 A;  3FEU A;  4MJC A;  2BMX A;  5GSS A;  1PL1 A;  1TXX A;  2B5X A;  5B7C A;  1MD3 A;  4GXZ A;  1PL2 A;  7GSS A;  1H4O A;  4POK A;  4L5L A;  5F8B A;  3P2A A;  1EEM A;  4KSM A;  1XZO A;  5IM9 A;  1A23 A;  3RDW A;  2K8S A;  3TRQ A;  3A5W A;  1O6J A;  1ZYQ B;  3F3Q A;  1U87 A;  4XTS A;  2PMT A;  1SYX A;  3QOU A;  3ZIV A;  4N3Z A;  1SK0 A;  4MNN A;  2ZCT A;  4WEY A;  3QAW A;  1VGL A;  3F6F A;  5A34 A;  2L59 A;  4DSQ A;  3CSH A;  4HI7 A;  2LJA A;  4IS0 A;  3MWH A;  2GDR A;  2R2J A;  3A2V A;  1JHB A;  2NBS A;  2C0F A;  2JAC A;  1X9M B;  2CT6 A;  4TXO B;  2OA7 A;  4MF6 A;  2R37 A;  3GX8 A;  2H1L A;  1R26 A;  4GWR A;  1DE1 A;  3DML A;  1OE7 A;  1X9S B;  1ZCP A;  5DBQ A;  1THO A;  1T7P B;  4YKG A;  2X8G A;  1AC1 A;  5ECP B;  3KP8 A;  4JRR A;  4Z7X A;  1M2D A;  2C80 A;  4TR1 B;  1A8L A;  1B8X A;  2X4A A;  4RUV A;  1M2B A;  3KIJ A;  2V6K A;  1Y25 A;  5A1N A;  1E2Y A;  1YEP A;  2E0Q A;  1FB0 A;  3NIV A;  4K2X A;  4PX1 A;  4NV2 A;  5JWR B;  2VIM A;  4WR4 A;  3IC8 A;  3GKX A;  3D5J A;  3D4T A;  2ES7 A;  2HRN A;  1PA3 A;  4HDE A;  1N8J A;  3HKR A;  2GT6 A;  10GS A;  5HFI A;  3QD9 A;  4CY6 A;  4NHZ A;  1PSQ A;  2LTK A;  4POB A;  3UJ1 A;  4EDZ A;  5CRE A;  1GSD A;  1GUM A;  2G0F A;  2L57 A;  1NSW A;  4TN8 A;  3LFL A;  2GT5 A;  1XFL A;  4H86 A;  2OE3 A;  1YKA A;  2J9H A;  2H6X A;  2V1M A;  4DEJ A;  1F3A A;  4NWY A;  3EU3 A;  5A5H A;  1W4V A;  4P3Y B;  5ECK B;  4IEL A;  4XRA A;  2YWN A;  1LBK A;  1GSF A;  4TR0 A;  2WRT A;  5C00 A;  3ZIT A;  2LST A;  3LJR A;  4ISD A;  3I6A A;  3IXR A;  3EUR A;  3IPZ A;  2M72 A;  5CRH A;  2OBI A;  2REM A;  2VCT A;  5ECQ B;  4JZQ A;  1X5C A;  1U3A A;  1SKS B;  1ZZY A;  4USS A;  1IYH A;  1USB A;  5D73 A;  3WYW A;  5A34 B;  3VI5 A;  2KHP A;  4MH3 A;  4N0Z A;  2F8A A;  2LQO A;  17GS A;  1VF1 A;  2PPT A;  2I81 A;  4K1F A;  2DBC A;  1EP8 A;  3E9J B;  1K0A A;  5ECM B;  5A4W A;  2N5F A;  4CHS A;  3IE3 A;  4F82 A;  4TR4 A;  5ELG A;  4K0G A;  1FOH A;  3CRU A;  4KCA A;  1T4Z A;  2KP2 A;  3JCM L;  5ECH B;  1R5A A;  5H5R A;  6GSY A;  5IMC A;  3LYK A;  5A4V A;  3P90 A;  4F0B A;  2JZR A;  4GTU A;  3PR8 A;  3RBT A;  6GSX A;  3TOU A;  1YDK A;  2WDU A;  2PN8 A;  2H66 A;  2I3Y A;  4MCU A;  4WBJ A;  3US3 A;  1SL0 B;  1E6B A;  3M9J A;  1B9X C;  2DSA A;  4AKX B;  2MMZ A;  1F6M C;  5DQS A;  1ZMA A;  3MSZ A;  1O8W A;  1Z5Y E;  3VWW A;  2WS2 A;  4N11 A;  1XW6 A;  1GTB A;  12GS A;  5KN2 A;  3RHC A;  1AW9 A;  2JU5 A;  5A1N B;  5F06 A;  3ERW A;  1FAA A;  14GS A;  1Y6E A;  3EYT A;  1F9M A;  3KCM A;  4IP1 A;  1TU7 A;  1TW9 A;  2JZS A;  3FW2 A;  2IFQ A;  1WWJ A;  2KUC A;  2XPD A;  5JCU A;  3HMJ G;  4ZL7 A;  4LA1 A;  1T4Y A;  5A5H B;  4G0K A;  5J9B A;  3LOR A;  4N30 A;  2O7K A;  3LGC A;  1T8E B;  2GZP A;  3HA9 A;  1UA5 A;  3DWV A;  4N10 A;  4AJ7 A;  1GRX A;  1EEJ A;  4GST A;  1XVW A;  1LU4 A;  2MMN A;  2RII A;  5ECL B;  4NPB A;  1PN9 A;  2WZ9 A;  2C1Y A;  4G01 A;  3QAV A;  3GRX A;  4EF0 A;  4DSS A;  1XCC A;  1BQ7 A;  1UVZ A;  4I97 A;  2YWI A;  2YNX A;  4ID0 A;  4BWQ A;  5GZZ B;  4YQU A;  4QL9 A;  1O81 A;  3VUR A;  5DJL A;  20GS A;  4MPG A;  5F05 A;  1FB6 A;  3QMX A;  4ECC A;  4NXI A;  5BRT A;  2E7P A;  5IOW A;  1U88 A;  1YVL A;  2GS3 A;  3HXS A;  1A2M A;  2WJU A;  1K3Y A;  3F4R A;  2G2Q A;  1AQW A;  1ZYN A;  6GST A;  5DCH A;  5E4W A;  4AJ6 A;  3UEM A;  2B1K A;  2HT9 A;  4WXT A;  1GTU A;  1ZL9 A;  4JED A;  3LEF A;  5FHI A;  1XIY A;  2A2P A;  3C7M A;  1OC9 B;  2R6K A;  2V6O A;  1Q98 A;  4QMK A;  2Z9S A;  3GX0 A;  2DIY A;  2VOC A;  2GZZ A;  5AIS A;  3KMO A;  2DKI A;  1BJX A;  1C72 A;  1O8X A;  2MZC A;  2DJ3 A;  5ECO B;  3VK9 A;  3EU4 A;  3ZLP A;  1AAZ A;  1RQM A;  1ZGN A;  3TKP A;  4KSO A;  4GQF A;  2YP6 A;  3BOA A;  4MF7 A;  2H70 A;  4XIH A;  1R7H A;  2IFQ B;  4KDX A;  3CRT A;  3IHQ A;  5ECI B;  3F8U A;  3TU3 B;  3KMN A;  4N0V A;  4IJI A;  3QDN A;  1XPV A;  1RW1 A;  2R0P A;  3UVT A;  3ZFB A;  3ERG A;  1K3O A;  2FWF A;  2GGT A;  2TIR A;  2X99 A;  2VLV A;  3IK9 A;  2O8V B;  2M80 A;  2L5L A;  4KW6 A;  5HQP A;  1BYE A;  1VRS D;  2DC5 A;  2WCI A;  2YWO A;  1B4P A;  2OAC A;  1M99 A;  1GSS A;  1YKC A;  4W66 A;  2GQL A;  3D22 A;  3ZL5 A;  2XBI A;  3F4T A;  4NHW A;  2QA1 A;  3TJG A;  1A2J A;  1HNC A;  4ECJ A;  5IMF A;  4DSS B;  1XWB A;  4AI6 A;  1SL1 B;  22GS A;  3PPU A;  4EL1 A;  2H6Y A;  3TRP A;  3GN3 A;  1QUW A;  5G1K A;  3Q19 A;  1UN2 A;  2OT3 A;  1ILO A;  3TCO A;  3IRA A;  4NV5 A;  3I69 A;  4ZL8 A;  1SJZ A;  1YZX A;  4IKH A;  4YKF A;  3GSS A;  2HE3 A;  3FZ9 A;  2OJL A;  2I9H A;  4DSR A;  4J2F A;  5DVB A;  2MMO A;  2RM5 A;  4G10 A;  3GA4 A;  2FA4 A;  2C0E A;  1M0U A;  1PX7 A;  2CA8 A;  5HFK A;  2WUL A;  2EC4 A;  4IBP A;  3KXO A;  1TXU A;  2HYX A;  2FNO A;  1JZW A;  4KND A;  1WIK A;  4IQA A;  4I8B A;  3L9U A;  2A2R A;  5KN3 A;  1X0R A;  2QGV A;  4CDO A;  2TRX A;  4KH7 A;  4TKY A;  3BBY A;  3FR9 A;  4OO5 A;  4WET A;  4K7N A;  3F4S A;  4WBR D;  2YV9 A;  5IIZ A;  4OD7 A;  2R4V A;  3GYK A;  1URM A;  1WP0 A;  5ELA A;  1OVN A;  4IN0 A;  3GKM A;  4QL7 A;  3TKS E;  2CAQ A;  2XPE A;  5G1L A;  4IJ3 A;  5J9C A;  2HRK A;  4ZL9 A;  2QSI A;  5DJM A;  5B6M A;  2H1G A;  4BVX B;  4OFM A;  1PX6 A;  3CTF A;  3IR4 A;  2MYG A;  3IA1 A;  4O5Q A;  5FWG A;  2VO4 A;  1K3L A;  4HEA 2;  4D73 A;  1ZYE A;  5H5S A;  4O7H A;  2VCZ A;  8GSS A;  3FKF A;  4F9Z A;  1YF0 A;  2IMF A;  2CX4 A;  1TRU A;  1G7E A;  11GS A;  3UOM A;  1IYI A;  5ENU A;  3HVS A;  4AKI A;  3H1N A;  2VL2 A;  2LUS A;  3BCK A;  3M1G A;  2NVL A;  3TKS A;  5B8A A;  1BED A;  4EC0 A;  3J7Y b;  4Q5Q A;  3U5R E;  1PN0 A;  2WGR A;  2H1A A;  4RI6 A;  4PNG A;  2GVP A;  1EP7 A;  1V9W A;  1GSU A;  2FGX A;  5GST A;  5LCZ A;  2HRA A;  2KLX A;  2AJQ B;  1V58 A;  4I5Q A;  1B4Q A;  3P7X A;  4GF0 A;  1EV9 A;  3H4K A;  1K0M A;  1HNB A;  5EPF A;  5KOW A;  3EMX A;  4EKZ A;  1GTI A;  2A4H A;  1FG4 A;  5A4U A;  3APS A;  2VKZ G;  4IQ1 A;  1K0B A;  2B7K A;  5L71 A;  1AUC A;  2RM6 A;  4YQV A;  3ZYW A;  5A5K A;  3VPQ A;  2L4Q A;  4X4J A;  3FMW A;  3WGD A;  4TW5 A;  3GMF A;  3IOS A;  2VCW A;  3KM6 A;  1S3A A;  2HXK A;  4EO3 A;  4ZBD A;  2RLI A;  2M46 A;  4FO5 A;  4K6X A;  4MJA A;  5ABR A;  5J3R A;  4E8H A;  4MLY A;  4FQU A;  4V2N A;  3F63 A;  4ZBA A;  2DKH A;  4XCS A;  2EFH A;  2IMI A;  3CYN A;  2OE0 A;  3NOF A;  4WKW A;  5FT3 A;  2O5V A;  2H72 A;  1SVO A;  3DXB A;  4EIQ A;  1DSB A;  4PQI A;  1SU9 A;  1QMV A;  3TB2 A;  3W6G A;  1A2L A;  3LWA A;  3S9F A;  1SJ6 A;  3ZRE A;  2HRK B;  1B9Y C;  5ID2 A;  3QFA C;  4ML1 A;  2PUK C;  5G2Z A;  4E8E A;  1FHE A;  4KDY A;  2B5Y A;  3EMP A;  4ZB6 A;  1QGV A;  1MD4 A;  1PQN A;  3TOT A;  2VL9 A;  4PQH A;  2LNS A;  4CW9 A;  3MIX A;  5DCG A;  1WPI A;  6GSU A;  3HHV A;  1PRX A;  5IPG A;  4FYC A;  4D73 B;  3H79 A;  5COH A;  2DJJ A;  2YJ7 A;  1TTZ A;  2MBT A;  2EIQ A;  2IWT A;  4KX4 A;  1QK8 A;  4YQM A;  6GSS A;  3Q6O A;  1TI1 A;  3IAS 2;  3IV4 A;  4BWS A;  1YF1 A;  2L5O A;  4GSN A;  1VF3 A;  3HDC A;  3WD6 A;  2IN3 A;  2AHE A;  1TRS A;  4QQ7 A;  2YWM A;  2DJ2 A;  3L9S A;  2YV7 A;  1V40 A;  4OWY A;  1EWX A;  4BVY A;  1BG5 A;  4ECI A;  1XW9 A;  4WR5 A;  1RK4 A;  3LXZ A;  3F3R A;  2AUV A;  1V98 A;  4EE0 A;  3I43 A;  2BJX A;  4EXJ A;  5CAX A;  3R3E A;  2GQK A;  3GNJ A;  1JLW A;  1JLV A;  4GQC A;  5ECR B;  4HZ2 A;  1G7O A;  3DYR A;  3L78 A;  2VM1 A;  5D93 A;  1JZO A;  4L8E A;  2LNT A;  1XWC A;  3FYG A;  4TRX A;  1O85 A;  3D0Z A;  2XHF A;  3QCP A;  3VWU A;  1J9B A;  9GSS A;  3RPP A;  5IMV A;  1ERT A;  4POL A;  2VD0 A;  16GS A;  2YOI A;  4KGI A;  1I9D A;  1GSY A;  2EFE A;  2YCD A;  1T00 A;  2PWJ A;  1ABA A;  2C8U A;  2D2Z A;  2QA2 A;  3MDK A;  4XRD A;  3FZA A;  1HD2 A;  5ID2 B;  4PQ1 A;  3ZTL A;  5D96 A;  1O73 A;  1MEK A;  2ALB A;  3ERF A;  3WT1 A;  2EFC A;  3M9K A;  2GTU A;  5CRD A;  2IMK A;  3IHG A;  2VL2 C;  3C1R A;  4POM A;  5CP1 A;  3PH9 A;  1HNA A;  3TKS C;  1ML6 A;  5B6N A;  1NHO A;  1F3B A;  1GWC A;  5J47 A;  1KNG A;  2QC7 A;  4FYU A;  1TRW A;  4TXV A;  1YY7 A;  1EZK A;  4GCI A;  4KUN A;  4OCF A;  5CRG A;  4ZBB A;  1GP1 A;  1OAZ A;  1S3C A;  3KZQ A;  1X5D A;  4XS1 A;  2HZE A;  3CSI A;  1M2A A;  3D21 A;  2VL3 A;  5J4V A;  3EE2 A;  1GNE A;  1K0C A;  5CNW A;  2FY6 A;  4K7I A;  3KH9 A;  1Z7P A;  2L6C A;  4NMU A;  1XOB A;  2OKA A;  3F9U A;  1SK2 A;  2F8F A;  3ZRD A;  1THX A;  3A3T A;  2WFC A;  4BVY B;  4AJ8 A;  1XOA A;  2I1U A;  4ECB A;  2LRC A;  1AQX A;  5J4Y A;  2DML A;  3H8Q A;  1K0D A;  4OFN A;  2OAD A;  1MDJ A;  5ECN B;  4IGJ A;  3GH6 A;  4Q5F A;  1HYU A;  5JWQ B;  1MDI A;  2HSH A;  1M9B A;  3BJ5 A;  1V2A A;  5ECS A;  1SEN A;  5G5E A;  1OE8 A;  3J7Y k;  2A2S A;  4JU5 A;  3QAG A;  1GNW A;  3TKQ A;  4HU9 A;  1J0F A;  3WGX A;  5LD0 A;  3O6T A;  5H5Q A;  1TI3 A;  2DIZ A;  4PGT A;  2V2G A;  4IW9 A;  3DVW A;  1QFN A;  2IMD A;  3HZ4 A;  1ST9 A;  2J23 A;  2YPM A;  3EVI A;  1A0R P;  3FZ4 A;  1TDI A;  5CYY A;  1EOG A;  3SWL A;  3FK8 A;  2VCV A;  1MTC A;  4HJM A;  5EVO A;  1ON4 A;  2YZH A;  4XS4 A;  4MDC A;  1JZR A;  4V2L A;  2PVO C;  2F51 A;  2K9F A;  2H71 A;  3VFI A;  3GTU A;  2FCH A;  1TRV A;  5AN1 A;  2DMM A;  3RAZ A;  4V1A p;  4F0C A;  1VF4 A;  3HJM A;  4MZC A;  4XHM A;  2HLS A;  2HZF A;  3ZML A;  2DJ1 A;  2N5B A;  3ME8 A;  4GDF A;  2LS5 A;  4LLR A;  1SKW B;  2JZT A;  3R2Q A;  4MZW A;  3HYP A;  4O32 A;  3EIN A;  1J08 A;  4Q5N A;  2HZE B;  2VLU A;  3QR6 A;  3H93 A;  2FWE A;  2HI7 A;  3N5O A;  3C73 A;  3WT2 A;  4G19 A;  4XS6 A;  2ZUP A;  4GRF A;  1CQG A;  4MPF A;  3LQ7 A;  3LG6 A;  3L4N A;  1EOH A;  4V1A g;  1EGO A;  2P0G A;  2H76 A;  3G9B A;  3C8E A;  2CVB A;  2HSM A;  2KOK A;  4LMV A;  2CX3 A;  2CQ9 A;  2H75 A;  3GIX A;  2VLT A;  2JSZ A;  2MBS A;  2PER A;  2X49 A;  3TDG A;  1TOF A;  2L4C A;  2JSY A;  3HJP A;  3CBU A;  3F0I A;  2R0C A;  1FO5 A;  2F3M A;  2IPA A;  4OFT A;  4YAV A;  4TXO A;  1UC7 A;  4TVE A;  2IJY A;  1R4W A;  3O3T A;  2HNL A;  3AY8 A;  2C0D A;  1Z9H A;  2OBK A;  3P8W A;  1A0F A;  2WB9 A;  1ERW A;  5BMU A;  4K9Z A;  3ZZX A;  4TR3 A;  3G7I A;  1GUL A;  3FRC A;  2IME A;  5IMD A;  1SD9 A;  4TOP A;  3DKS A;  4L5O A;  3ZMK A;  3IDV A;  2EIO A;  1GUK A;  1YJ6 A;  3UIW A;  1SYR A;  4ZB8 A;  1KTE A;  2H1D A;  2R0G A;  5DAL A;  1JZD A;  5C04 A;  4Z2T A;  3FR6 A;  1NW2 A;  1NM3 A;  4XS4 B;  3W8S A;  2EIR A;  2YN1 A;  1K0O A;  1SVM A;  3CXG A;  1N2A A;  1PD2 1;  2PBJ A;  13GS A;  1VF2 A;  3GTU B;  4A5P A;  2UZ8 A;  4PXO A;  4RI7 A;  3TKR A;  2O85 A;  1U6T A;  5IOX A;  2GST A;  2DJK A;  2V41 A;  2LJR A;  2PVQ A;  3E3E A;  4MAB A;  1Z6M A;  4ULX A;  5IO2 A;  4IP6 A;  2OE1 A;  4AF2 A;  4KCE A;  1TP9 A;  5INY A;  2C4J A;  1MDK A;  4LL1 B;  1XWA A;  3C1S A;  1TKD B;  2YZU A;  1I5G A;  1TK0 B;  4IVF A;  1XXU A;  3MAK A;  4PNF A;  2B1L A;  3WGE A;  4CY8 A;  1M9A A;  2CV4 A;  1PGT A;  5JCW A;  1XVQ A;  3GV1 A;  4JE1 A;  3IK7 A;  3ZVJ D;  3DD3 A;  3KTL A;  3TJF A;  3DRN A;  1GH2 A;  6GSV A;  2HSM B;  3A2X A;  2O87 A;  5LNK e;  1ZYP A;  3V1W A;  3GKK A;  3Q74 A;  2UV8 G;  3O76 A;  4I6X A;  4AKG A;  1A8Y A;  3GHA A;  4RQR A;  2IIY A;  3ZVJ A;  2H1B A;  4F03 A;  4MA9 A;  1GSQ A;  5DQY A;  2V32 A;  1NHY A;  4I2T A;  2YAN A;  4L0U A;  1DUG A;  3GKN A;  5JWO B;  1YEX A;  2CVK A;  2L6D A;  2DLX A;  5BMU B;  3UL3 A;  4IHU A;  3ZIJ A;  1XWG A;  4BA7 A;  2P5Q A;  1Z6N A;  2H30 A;  5J5N A;  4EDY A;  2TRC P;  4G9H A;  4YAP A;  1TK5 B;  1ERV A;  3UAP A;  3L0H A;  4JR6 A;  2FHE A;  2C3Q A;  1SKR B;  5HR2 A;  3UBL A;  1WOU A;  5IPH A;  1G6W A;  5DAL B;  4G0L A;  5F0G A;  3LXT A;  2GZY A;  3GUR A;  4K5S A;  3APQ A;  3QPM A;  4FIW A;  4HS1 A;  1WJK A;  1Y1U A;  3M8N A;  2HFD A;  1KBN A;  3FZ5 A;  2K18 A;  2ZNM A;  5HR3 A;  4HOJ A;  4MJE A;  2R5G A;  2K6V A;  2NDO A;  1BF5 A;  5DDL A;  2NPB A;  2JAD A;  3F6D A;  5IQY A;  4OO4 A;  2LJK A;  3W8J A;  5EL8 A;  1HQO A;  2FUG 2;  1Q4J A;  5CO3 A;  3FY7 A;  4ZB7 A;  4HU7 A;  2CVD A;  4AGS A;  4PUA A;  4HZ4 A;  5KOX A;  2E2G A;  2K8V A;  3EPT A;  2H0H A;  2R3X A;  2AYT A;  2B7J A;  3DIE A;  4WF5 A;  4V2M A;  3VWX A;  5HFG A;  1KEB A;  1A24 A;  2H0G A;  3RHB A;  2LEG A;  3KTB A;  3M3M A;  3U6V A;  1BG1 A;  19GS A;  3TGZ A;  1GUH A;  2LV3 A;  1W89 A;  1U3I A;  4PUF C;  1Z7R A;  1AIU A;  1XWK A;  2CZ3 A;  3MYD A;  1PMT A;  1XBS A;  3GUS A;  5F07 A;  1YQ1 A;  4K5R A;  5D9W A;  1ZOF A;  1SK1 A;  2VAF A;  3TJB A;  1JFU A;  3KEB A;  1SVL A;  2CZ2 A;  5IMZ A;  2N5A A;  2HSY A;  4O5U A;  4GLT A;  6GSW A;  4Z2U A;  2I4A A;  5D8I A;  2AB6 A;  2LQQ A;  2C0G A;  2YJH A;  2P31 A;  1F2E A;  2H6Z A;  4BL7 A;  4MH2 A;  1OC9 A;  1G0T A;  3ME7 A;  4ML6 A;  4MZB A;  4BPY A;  2VD1 A;  2DJ0 A;  2X8C A;  4G2E A;  2AAW A;  2QKE A;  2RUF A;  4PTS A;  2HSN A;  4LMW A;  4DVC A;  4L0W A;  1OKD A;  1EV4 A;  3FR3 A;  3A2W A;  3ED3 A;  1XW5 A;  3TUE A;  2VM2 A;  2NTO A;  1DBY A;  3PIN A;  5CRW A;  4Z2R A;  1V57 A;  3OR5 A;  3HVV A;  3BCI A;  1GLP A;  3VLN A;  2VUP A;  3HY2 A;  4LL4 B;  5GAN D;  4KF9 A;  5E59 A;  4KA0 A;  3KGK A;  4JR4 A;  5IMA A;  5J40 A;  3VWV A;  2VCQ A;  4KAE A;  3SBC A;  1B48 A;  1GTA A;  4RQX A;  5G30 A;  2FWG A;  4K0N A;  3HVX A;  1GLQ A;  5AGY A;  2AV4 A;  3A5I A;  1GL8 A;  4EUY A;  2B5E A;  4AKH A;  3D4M A;  2GSQ A;  1OYJ A;  3M0F A;  4O92 A;  1WMJ A;  3TJK A;  4MP4 A;  3GST A;  4HJ2 A;  3BD2 A;  3ZFL A;  2RUE A;  2PU9 C;  1BX9 A;  4E68 A;  2LKU A;  1T1V A;  2H19 A;  3EWL A;  4JBB A;  2C3N A;  5DAK A;  1X9W B;  1PKW A;  2H73 A;  2MMA A;  2X8H A;  3KP9 A;  3HD5 A;  5KN1 A;  4ZB9 A;  3VPT A;  1AQV A;  5AIV A;  3HZ8 A;  4K8M A;  2CAI A;  2GLR A;  4F2I A;  3G7J A;  3IAM 2;  2H0I A;  2O89 A;  2X64 A;  1SD8 A;  4J57 E;  4YH2 A;  1DE2 A;  1PKZ A;  4BL7 B;  3HJO A;  3D6I A;  4WF4 A;  3TJJ A;  1OC8 A;  2KP1 A;  5KN0 A;  5HR1 A;  2H74 A;  4ICY A;  1FVJ A;  3IC4 A;  3PGT A;  2F9S A;  2HSN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...