4ZB9A

Crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium, with one glutathione disulfide bound per dimer.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
219
Chain Sequence
SHDKQFSLFLHKASAHGWKVAFVLEELSLSYEIVLVDVAKNEQKSPEFMKLNPNGRTPALIDHGNSDFVIWESNAMVQYVADKYDTERKISMAPGTDDFYIQLQWQYFQGTGQGPYFGQLVWFTLYHEEKIPSAVTRYKEEALRVFSVLERVLSNQEWLVGGKMTIADISFVSWNDMIVHFLDNFDFEKEFPATAAWHYKMLKRPTIKRPWDERRKLMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PcUre2p8
publication title Evolutionary divergence of Ure2pA glutathione transferases in wood degrading fungi.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
total genus 78
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4zb9A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zb9A01
4I5QA 3QR6A 2PN8A 3KXOA 5D93A 1SJ6A 3UOMA 4MP4A 5CRDA 5F05A 1GTAA 2F9SA 2GTUA 2RM6A 2RIIA 4FYBA 1EGOA 2I9HA 4BL7B 1MEKA 2M72A 4E8HA 1XOBA 1TTZA 4OFMA 1ZZYA 2C0DA 1PQNA 1AUCA 2N5AA 1N2AA 4N10A 1Z6NA 3HVSA 1GUMA 3C8EA 2YOIA 1VF3A 5IOXA 4ID0A 2WZ9A 3D5JA 3O6TA 4KX4A 3QAVA 4I97A 4NMUA 1X0RA 3VFIA 3TJFA 3GFKA 4NAXA 4TR1A 3VWWA 2A2SA 4ILFA 4KF9A 1THXA 4MJCA 1B9XC 3D0ZA 1XW9A 1M7TA 3CXGA 4E8EA 1I9DA 2HZEB 4RI7A 2E2MA 1Z5YE 4AJ6A 3FHKA 4KNDA 2L4QA 4QL9A 2YWIA 3IE3A 1VF1A 3VWUA 2ZCTA 1SK2A 4EC0A 1FW1A 1E2YA 1QQ2A 2DJ1A 2M80A 2B5EA 2H6YA 1DE1A 3GKMA 3FZ4A 2DMMA 5IMFA 4D73B 1A8YA 1A2MA 3FR6A 2DJKA 2EIRA 2JU5A 2E2GA 3DRNA 2DJJA 3GUSA 3ZIJA 2YPMA 1FO5A 4G0IA 4RQXA 4POLA 3TKPA 2H71A 13GSA 3KEBA 1RK4A 4OO4A 1HNCA 3FR9A 4KDXA 5JCGA 1UVZA 5ECKB 2DIZA 1LU4A 2H66A 3E0UA 3EINA 2I4AA 2FNOA 3QD9A 3NIVA 2H1DA 4IS0A 3HZ4A 5B8AA 2B1LA 1Z7PA 3A5WA 3ZYWA 5HQPA 3TGZA 4BWSA 2GSTA 1BAYA 2NDOA 1T7PB 2MMAA 2LQQA 2O7KA 3TKRA 1TRWA 1YEXA 1PD21 4NWYA 5IPHA 5HR2A 4F82A 3M1GA 1EOGA 1USBA 3TJGA 1PN9A 3RPNA 5J41A 1QMVA 1GSUA 3E9JB 2L5LA 3IPZA 3UVHA 6GSUA 2CA8A 2XPEA 1R5PA 4IP6A 4LL4B 1Y6EA 2KP2A 2YZHA 3P90A 3IRAA 2VCQA 3F3QA 3EE2A 1XIYA 3US3A 1R7HA 1GNEA 1ZYQB 1GULA 1VF2A 4K6XA 2HRNA 1WMJA 4L0UA 4OCFA 3R3EA 2GQMA 1M0UA 2LNTA 3H4KA 5DVBA 2HRKA 5AISA 2ALBA 3KZQA 2MBTA 1DBYA 3GYKA 4AJ8A 3OR5A 2NPBA 5LD0A 2HT9A 5H5RA 2L4CA 1VGLA 5EL8A 2H76A 2GT5A 3KGKA 2CVDA 1ERVA 2IMKA 4ULXA 5G31A 3IBHA 4GWRA 1K0OA 3V1WA 2KP1A 2CX4A 5DAKB 2FD3A 4HU7A 18GSA 5ELGA 4V2NA 2N5FA 5ECHB 5KN2A 3VPTA 2WB9A 1EWXA 1NW2A 3HKRA 2H19A 1GTUA 2Z9SA 2H01A 1J08A 3A2XA 5D9VA 4HZ2A 2FCHA 3M9JA 2OE1A 2HXKA 1RQMA 3IA1A 4NV2A 3ZFLA 1TKDB 1V57A 5COHA 5G30A 4PNGA 3VWXA 2H74A 5CRHA 6GSWA 1FHEA 3N5OA 3L0HA 4KB3A 5F8BA 4HQZA 4NHZA 4ZB6A 2CZ2A 3CTGA 3A2WA 5IMCA 3DMLA 2HI7A 2H30A 4EE0A 5J4UA 3GMFA 5ECPB 3ED3A 2YCDA 4XCSA 2P31A 3GRXA 3IC4A 2DMLA 2GZZA 1ERUA 2FWFA 3ME8A 3P2AA 4USSA 1ABAA 3EWLA 4GQCA 1M9AA 1QFNA 5IIZA 3TJJA 4MMMA 4LMWA 4QQ7A 5A4VA 3GH9A 4RI6A 1MDJA 4HEA2 2VCTA 1NM3A 1TRUA 1TRSA 5ECOB 4F2IA 2JSYA 3ZLPA 1JLWA 4HS1A 5IM9A 1XVWA 2NTOA 2FWGA 4I6XA 3IHQA 2R2JA 3LORA 4G0KA 1JZOA 3BD2A 2ES7A 2LTKA 3I9V2 1GSEA 4OWYA 1UN2A 2E7PA 5CO3A 3I69A 3ZVJA 3RHBA 5J9BA 3SWLA 3LQ7A 1K0BA 2C0EA 3IAS2 3EC3A 1YDKA 2CAIA 2HSNB 2IFQA 4HZ4A 3WD6A 1K3LA 1E6BA 1J9BA 1XW6A 2N5BA 2BJXA 2AHEA 5AN1A 3MNGA 2GSSA 1VF4A 3NZNA 1OYJA 3AY8A 4OCEA 2HRFA 4ML1A 4FO5A 3IDVA 5D8IA 1SK0A 1QK8A 3HVVA 4KDUA 5H5SA 4TR0A 3TKQA 2H75A 4ML6A 2FY6A 2R6KA 1M99A 5EPFA 2AB6A 4TR1B 2B7JA 3DVWA 3TJKA 3Q19A 2H0IA 3WYWA 1ZYEA 2FWHA 2VUPA 2X64A 4K0NA 4KCEA 2VCWA 1PGTA 4HI7A 1PMTA 4TRXA 4WXTA 3GX8A 3RHCA 3F6FA 2FUG2 2F51A 3F4RA 2HSMA 5IO2A 4GTUA 1XZOA 2CVKA 1OC3A 3MDKA 4BVXA 4KW6A 2TRXA 2DJ2A 2GGTA 1PKWA 2VCVA 1WIKA 2JZRA 4DSSA 4YQVA 2L6DA 3MSZA 1R4WA 4N11A 5IMVA 2ZUPA 3C1RA 4EF0A 4IJIA 3KD0A 3FEUA 4WF5A 4ZL7A 1GSSA 16GSA 3NOFA 3H93A 3L9SA 5FWGA 5IOWA 3M9KA 4MA9A 1YY7A 3W8SA 3ZVJD 4ZBDA 3F6DA 1MD3A 2WDUA 3DKSA 1SKWB 4KAEA 3FYGA 1B9YC 1O8WA 2MMNA 2VL3A 3EU4A 2A4VA 2CZ3A 4HUAA 3ZIVA 4EDYA 4FYCA 1FB6A 5CREA 1OKTA 1G0TA 3KTBA 4IJ3A 5GZZB 2K8VA 2O85A 5IMAA 1K3OA 4ECBA 1ERTA 1V98A 1V2AA 2CQ9A 2H70A 2VLTA 3HJOA 4L5LA 4K2DA 3UBKA 2B5YA 4G0LA 5FHIA 2RLIA 3TB2A 2JZTA 4O7HA 2FHEA 3J7Yk 2YV9A 2WRTA 2L59A 2FWEA 1CQGA 2GS3A 2YWMA 3F63A 1K3YA 3GSSA 1I5GA 3C71A 3I6AA 3GL5A 10GSA 5FT3A 4TR3A 4OD7A 1U3IA 1J0FA 3GIXA 4KUNA 3F0IA 3ERFA 1GSDA 3LG6A 3KM6A 4PUFC 1GRXA 4Z7XA 3R2QA 3H79A 2P5RA 4TKYA 5GSTA 4XHMA 3DYRA 4Q5FA 4ISDA 2WULA 3G7IA 9GSSA 1ZMAA 2H1BA 4NXIA 4MF6A 4JR4A 4L8EA 3P7XA 4HJ2A 1A24A 2H6XA 4WF4A 5B8BA 1SL0B 4G9HA 5DQYA 1F2EA 4OMVA 4V2LA 1OVNA 1U6TA 5ID2A 4BA7A 1GWCA 5E59A 2H1AA 5G5EA 2HRKB 5JCUA 1IYIA 4KE3A 2IPAA 3DVXA 1GTBA 1X5CA 1SJZA 1PKZA 1WPIA 4JU5A 3CBUA 1YKAA 2GDRA 1T4YA 5JWOB 1EV9A 3EURA 1F6MC 1FAAA 4YQMA 3WGDA 1SYRA 2AV4A 2M46A 1MTCA 2XBIA 2HNLA 4ZILA 1YF0A 3KMOA 1TU8A 4JE1A 4N30A 4TR4A 2P5QA 4MJEA 2R37A 4QL7A 4GXZA 3VLNA 4MF7A 7GSSA 1K0MA 3ZL5A 5IPGA 3EVIA 1GNWA 3F3RA 2JACA 4G10A 1YF1A 3LGCA 1M2BA 2MZCA 1C72A 1EP7A 1ZCPA 3TCOA 3CRTA 4PURA 2VCZA 4I2UA 2REMA 4KDYA 2LRCA 3GKNA 2GT6A 2KLXA 2HE3A 4EL1A 3GURA 5B6MA 2OKAA 3ZRDA 3UAPA 1TOFA 2GZYA 4KA0A 2F8AA 3GN3A 4MLYA 1GLPA 2LJKA 3HVXA 5INYA 2DLXA 2VIMA 3UEMA 1WJKA 2PBJA 1SYXA 3ZITA 3O76A 5KEJA 2LRNA 1F37A 1ZOFA 2DJ3A 3SBCA 1JZDA 3QFBC 6GSYA 2HFDA 1KNGA 1PSQA 4YH2A 3IR4A 3QMXA 1TI3A 4IHUA 5ENUA 1F9MA 3I43A 5DBQA 4K7IA 5A4UA 5D9XA 4FQUA 2RUEA 2AUVA 4OFNA 1EV4A 4IELA 5HFIA 3TDGA 1WE0A 2V41A 1FVKA 2X8CA 4J56E 5E4WA 5H5QA 1XFLA 5CRWA 5ECLB 5EVOA 2IFQB 1GSFA 2LQOA 4WR4A 3GNJA 5D9WA 1SENA 5EY6A 5ECRB 3G7JA 2KHPA 1URMA 1SD8A 2B5XA 2DBCA 3L78A 1KBNA 2HSHA 1G7OA 4MDCA 1XWKA 3U6VA 1X9SB 2GLRA 5AIVA 1ST9A 3UL3A 3GV1A 2O87A 1A2LA 4Q5QA 4MJAA 6GSXA 3FRCA 2H8LA 5CAXA 2H0GA 1ZGNA 1IYHA 1R26A 3L4NA 1T00A 3LJRA 4IKHA 2D2ZA 2LUSA 1O73A 2IWTA 1Y25A 3IK9A 1Z7RA 3BOAA 1G6WA 1KEBA 4WETA 4F03A 2IN3A 2HSMB 4IVFA 2H72A 4BVXB 2IJYA 1CQHA 1KTEA 2PPTA 4DSSB 17GSA 1TDIA 5DJLA 2C8UA 4GSNA 1AW9A 2WFCA 2FA8A 4ECIA 4EKZA 1A8LA 3BJ5A 3QPMA 2LKUA 5KN0A 2C3QA 2HSYA 3EYTA 3G9BA 1TP9A 3QCPA 3UMAA 4MH2A 2I81A 2NBSA 3QOUA 2PMTA 4MZWA 1ILOA 4YAVA 1A2JA 2PVOC 4KGIA 3VI7A 1EZKA 22GSA 1X9WB 4MABA 4ZB8A 4GF0A 3KJYA 4ZB9A 2C3NA 3Q18A 1A0RP 4JRRA 5CNWA 5CP1A 5B7CA 2VM1A 2LJRA 3FY7A 1HNAA 3S9FA 4G2EA 2OJLA 3ZZXA 1GUKA 3CTFA 4FH8A 3W8JA 3HYPA 4TN8A 1XVQA 2K6VA 1U87A 4IP1A 1QUWA 5DALA 4MCUA 4X0XA 1Q4JA 4LMVA 3EU3A 4IQAA 4O5RA 4JBBA 4KSOA 4HJMA 2YNXA 4POKA 4IW9A 3TKSA 3LWAA 2TIRA 5AGYA 3RBTA 2K8SA 4LLRA 4FIWA 5B6NA 3IC8A 2DSAA 1HYUA 1JHBA 4F9ZA 11GSA 3VI5A 1PRXA 2BTOT 1TI1A 4ECJA 3QAGA 2MMZA 5GAND 1GLQA 3LYKA 8GSSA 2OBKA 4RUVA 4O32A 4JR6A 5ID2B 1H75A 1M2DA 2IL3A 4WBRD 5GSSA 3F4TA 4EDZA 4GRFA 3LEFA 3RAZA 1DSBA 5ECNB 3FW2A 2EIOA 1XW5A 1O85A 2OACA 4I8BA 3KTLA 3PINA 4N0ZA 4TVEA 3CYNA 4P3YB 5JCWA 1XWCA 1F3BA 5DCHA 3VK9A 3O3TA 1TRVA 5F0GA 5KN3A 1SL2B 3PR8A 2X8HA 4MH3A 1ERWA 3TKSC 4XS4A 2ON7A 2GQKA 5HR3A 3M3MA 2GSRA 3KP8A 3HCZA 2H1GA 1GUHA 4X1UA 2L57A 3GSTA 3UIWA 1O7UA 6GSTA 2VM2A 4PQIA 1TXXA 2OA7A 1FG4A 3D22A 1T1VA 3LFLA 2K9FA 2VAFA 5KN1A 3HJMA 2J9HA 1GH2A 4HQSA 2PU9C 5LNKe 2XBQA 4DSQA 4RQRA 4DSRA 3UBLA 4N0VA 3EMPA 3C7MA 2WGRA 4X43A 2H73A 1OC9A 2UZ8A 2YWOA 3CSHA 1UC7A 5G5FA 2G2QA 1BJXA 4PGTA 2PVQA 1THOA 1K0NA 1YEPA 4ZL8A 2CVBA 4WR5A 4PTSA 2JADA 4NPBA 1EGRA 2NVLA 2JSZA 3A3TA 4OO5A 2KUCA 2WJUA 19GSA 3H8QA 4AGSA 4LA1A 5GAPD 5JWQB 4MPFA 3APSA 4ACSA 3KIJA 2R4VA 2QGVA 3WT2A 2MYGA 1TJDA 3ME7A 1SKSB 3APOA 2WS2A 4KCAA 5IMDA 2V6OA 1EOHA 1ON4A 3F8UA 2IMEA 5ECMB 4V2MA 3WGEA 2DC5A 4J2FA 1AC1A 3HDCA 1B4QA 3D21A 2HYXA 1Z9HA 3C73A 1B4PA 4TXOA 4EO3A 1XXUA 2LEGA 3CRUA 3QFAC 4HOJA 3TRPA 4PX1A 4NHWA 4CW9A 1YKCA 5IO0A 1U88A 3IV4A 3U5RE 4MZBA 3LYPA 1SD9A 4XRDA 2I1UA 3UVTA 1XOAA 2WCIA 1FB0A 2FLSA 3TRQA 3UJ1A 5G1KA 4XIHA 1F3AA 3WGXA 3FZAA 1BG5A 3QDNA 1GSYA 2XPDA 3M0FA 2B1KA 4BWQA 1GTIA 1TK5B 2C0FA 2K18A 2YANA 3DIEA 2B7KA 1OE8A 3EMXA 2LS5A 2YP6A 2IMDA 3H1NA 1S3DA 2V1MA 1WRYA 1EEJA 1AIUA 2VD1A 2VO4A 3RDWA 4WKWA 1QGVA 3GHAA 5F06A 3FR3A 1X5EA 2VL2A 4IN0A 3DWVA 2YN1A 2HZFA 4TOPA 2B3SA 5DCGA 3D4MA 4PQ1A 1YQ1A 2KOKA 3ZREA 2X8GA 2LJAA 5AIXA 3GX0A 2VLVA 4GSTA 4KH7A 1XPVA 2DIYA 1Z6MA 4K0GA 3A2VA 4JZQA 1TK8B 4WEYA 2HQTA 3FK8A 1QXHA 3FZ5A 1VRSD 4DEJA 3HHVA 4AF2A 1B48A 4IGJA 3Q6OA 1ACVA 2IMIA 2GSQA 1PX7A 2VD0A 3GA4A 3VWVA 3D6IA 3PH9A 3VPQA 4BVYA 1GL8A 1MD4A 4MF5A 2L5OA 3BCIA 4XTSA 2L6CA 5DALB 4LL1B 3LXTA 1XWBA 3TRXA 1OE7A 1SL1B 2VL2C 1GP1A 4BPYA 2LSTA 4ZBAA 4PUAA 2E0QA 2ZNMA 1O6JA 1A0FA 1HNBA 1EEMA 1OKDA 2YJHA 2O8VB 2GZPA 2G0FA 3RPPA 3ZTLA 4EUYA 2QC7A 3DXBA 3HZ8A 1AQWA 2C0GA 12GSA 1DUGA 3GTUA 2J23A 3IXRA 2LRTA 4NV5A 6GSSA 1V58A 3DEXA 4XS1A 4JEDA 4PQHA 5DDLA 4L5OA 4BL7A 3L9VA 2PWJA 1TK0B 1WWJA 3K8NA 4AJ7A 4L0WA 3E3EA 2IIYA 2OBIA 1V9WA 1AQVA 2X99A 1PA3A 4YAPA 1DE2A 4IQ1A 3F4SA 4XS4B 2JL4A 2VL9A 1X5DA 3FZ9A 3MAKA 1Z3EA 5C00A 2EIQA 3L9UA 2RM5A 5DQSA 1HD2A 3HD5A 4F0CA 1T3BA 2FA4A 3C1SA 4ZL9A 2YZUA 1K0AA 4WBJA 2JZSA 1BYEA 1TU7A 2YJ7A 2HZEA 2V32A 2OE0A 1WOUA 3DGQA 3APQA 2LV3A 1XWGA 1FOVA 2R5GA 1G6YA 2DJ0A 3Q74A 5ECQB 1TW9A 2RUFA 5ELAA 4XRAA 2VCXA 2C1YA 1BQ7A 1H4OA 4TW5A 3D4TA 1OC9B 4D73A 5ECSA 4K8MA 1SJIA 5G1LA 4YQUA 3HXSA 3VURA 1XCCA 1N8JA 3ZFBA 1Q98A 4MPGA 5J3RA 1R5AA 3GH6A 4OFTA 2PGTA 3F9UA 3ISOA 1PL2A 4MZCA 3KMNA 2A2RA 1M2AA 3WT1A 4HU9A 2OADA 3IK7A 3BBYA 1K0DA 4POBA 2F3MA 1O81A 1NSWA 4K7OA 1OC8A 5HFKA 1XWAA 2PERA 3BCKA 5DJMA 4GLTA 5J9CA 1AXDA 5CRGA 3GKXA 2C4JA 1ML6A 1LJRA 3HJPA 4PXOA 5IMZA 3CMIA 5A5KA 4EXJA 1RW1A 4KSMA 4TXOB 1W89A 5HR1A 5JWRB 3KH7A 2V2GA 4K7NA 2AYTA 1NHOA 4G19A 1UA5A 1M9BA 1T8EB 2V6KA 1B8XA 3TKSE 4DVCA 1ZL9A 3ZMLA 1S3AA 4TXVA 5D9TA 1G7EA 1XBSA 2HRAA 2B6MA 4CDOA 20GSA 2O89A 4GCIA 3TOUA 1OAZA 5D96A 3TOTA 2MBSA 1MDKA 2CX3A 1U3AA 1EP8A 3TUEA 1WP0A 2GQLA 4K9ZA 14GSA 2AJQB 3UARA 3KH9A 3ERGA 1PL1A 4F0BA 1SU9A 3CSJA 4Q5NA 3GKKA 1PX6A 1NHYA 3PGTA 3CSIA 1V40A 1HQOA 4ZXGA 4MK3A 3KCMA 2XC2A 2R3XA 1JFUA 4ZIJA 5DAKA 5ECIB 2QSIA 4O92A 2H0HA 3HA9A 2EC4A 1YJ6A 3IAM2 1SK1A 5F07A 3TJBA 2CT6A 1MDIA 4H86A 2P0GA 4PNFA 2IMFA 2H6ZA 2HLSA 4Q5RA 1SKRB 3HY2A 1A23A 2F8FA 6GSVA 2FGXA 4I2TA 5BMUA 2I3YA 4MJBA 1AAZA 2XHFA 4FYUA 5D73A 3N9JA 4K1FA 1O8XA 1BX9A 2AAWA 1W4VA 2OE3A 4V1Ag 3LSZA 3J7Yb 2VOCA 4V1Ap 3G7YA 2YWNA 3P8WA 3JCML 5IQYA 4GQFA 3DD3A 1AQXA 5J5NA 4CHSA 1JLVA 3GL3A 4IBPA 5ABRA 2ON5A 3QAWA 4GSSA 2C80A 4BVYB 2QKEA 5A4WA 3W6GA 4POMA 3ERWA 4J57E 2CAQA 2LNSA 5C04A 3IOSA 1LBKA 3M8NA 1YZXA 3KP9A 2BMXA 5HR0A 4XS6A 2YV7A 3MWHA 3FKFA 1K0CA 2TRCP 2C3TA 1BEDA 1JZWA 2CV4A 3PPUA 3ZMKA 1T4ZA 3LXZA 4HDEA 5LCZA 5HFGA 2MMOA 1FVJA 2VLUA 1JZRA 2GVPA 4ZBBA 5G2ZA 4EVMA 5L71A 1S3CA 1GSQA 4ECCA 5CYYA 3GTUB 1X9MB 2PUKC
chains in the Genus database with same CATH superfamily
4I5QA 2A2PA 3QR6A 2PN8A 3KXOA 5D93A 1SJ6A 3UOMA 4MP4A 5CRDA 5F05A 1GTAA 2F9SA 2GTUA 2RM6A 2RIIA 4FYBA 1EGOA 2I9HA 4BL7B 3RFRC 1MEKA 2M72A 4E8HA 1XOBA 1TTZA 2HSNA 4OFMA 1ZZYA 2C0DA 1PQNA 1AUCA 2N5AA 1N2AA 4N10A 1Z6NA 3HVSA 1GUMA 3C8EA 2YOIA 1VF3A 5IOXA 1M3JA 4ID0A 2WZ9A 3D5JA 3O6TA 4KX4A 3QAVA 4I97A 4NMUA 1X0RA 3VFIA 3TJFA 3GFKA 4NAXA 4TR1A 3VWWA 2A2SA 4ILFA 4KF9A 1THXA 4MJCA 1B9XC 4PI2C 3D0ZA 1XW9A 1M7TA 3CXGA 4E8EA 1I9DA 2HZEB 4RI7A 2E2MA 1Z5YE 4AJ6A 3FHKA 4KNDA 2L4QA 4QL9A 2YWIA 3IE3A 1VF1A 3CHXC 3VWUA 2ZCTA 1SK2A 4EC0A 1FW1A 1E2YA 1QQ2A 2DJ1A 2M80A 2B5EA 3HMJG 2H6YA 1ZYNA 1DE1A 3GKMA 3FZ4A 2DMMA 5IMFA 4D73B 1A8YA 1A2MA 3FR6A 2DJKA 2EIRA 2JU5A 2E2GA 3DRNA 2DJJA 3GUSA 3ZIJA 2YPMA 1FO5A 4G0IA 4RQXA 4POLA 3TKPA 2H71A 13GSA 3KEBA 1RK4A 4OO4A 5J4VA 1HNCA 3FR9A 4KDXA 5JCGA 1UVZA 5ECKB 2DIZA 1LU4A 2R0CA 2H66A 3E0UA 3EINA 1BG1A 2I4AA 2FNOA 3QD9A 3NIVA 2H1DA 4IS0A 3HZ4A 5B8AA 2B1LA 1Z7PA 3A5WA 3ZYWA 5HQPA 3TGZA 4BWSA 2GSTA 1BAYA 2NDOA 1T7PB 2MMAA 2LQQA 2O7KA 3TKRA 1TRWA 1YEXA 1PD21 4NWYA 5IPHA 5HR2A 4F82A 3M1GA 2WVXB 1EOGA 1USBA 3TJGA 1PN9A 3RPNA 5J41A 1QMVA 1GSUA 3E9JB 2L5LA 3IPZA 3UVHA 6GSUA 2CA8A 2XPEA 1R5PA 4IP6A 4LL4B 1Y6EA 2KP2A 2YZHA 3P90A 3IRAA 2VCQA 3F3QA 3EE2A 1XIYA 3US3A 1FOHA 1R7HA 1GNEA 1ZYQB 1GULA 1VF2A 4K6XA 2HRNA 1WMJA 4L0UA 4OCFA 3R3EA 2GQMA 1M0UA 2LNTA 3H4KA 1YEWC 5DVBA 2HRKA 5AISA 2ALBA 3A5IA 3KZQA 2MBTA 1DBYA 3GYKA 4AJ8A 3OR5A 2NPBA 5LD0A 2HT9A 5H5RA 2L4CA 1VGLA 5EL8A 2H76A 2GT5A 3KGKA 2CVDA 1Y1UA 1ERVA 2IMKA 3EPTA 4ULXA 5G31A 3IBHA 4GWRA 1K0OA 3V1WA 2KP1A 2CX4A 5DAKB 2FD3A 1SVMA 4HU7A 18GSA 5ELGA 4V2NA 2N5FA 5ECHB 5KN2A 3VPTA 2WB9A 1EWXA 1NW2A 3HKRA 5BMUB 2H19A 4K5RA 1GTUA 2Z9SA 2H01A 1J08A 3A2XA 5D9VA 4HZ2A 2FCHA 3M9JA 2OE1A 2HXKA 1RQMA 3IA1A 4NV2A 3ZFLA 1TKDB 4HSCX 1V57A 5COHA 5G30A 4PNGA 3VWXA 2H74A 5CRHA 6GSWA 1FHEA 3N5OA 3L0HA 4KB3A 5F8BA 4HQZA 4NHZA 4ZB6A 2CZ2A 3CTGA 3A2WA 5IMCA 3DMLA 2HI7A 2H30A 4EE0A 5J4UA 3GMFA 5ECPB 3ED3A 2YCDA 1XG8A 2P31A 4XCSA 3GRXA 3IC4A 2DMLA 2GZZA 1ERUA 2FWFA 3ME8A 3P2AA 4USSA 1ABAA 3EWLA 4GQCA 1M9AA 1QFNA 5IIZA 3TJJA 4MMMA 4LMWA 4QQ7A 5A4VA 3GH9A 4RI6A 1MDJA 4HEA2 2VCTA 1NM3A 1TRUA 1TRSA 5ECOB 4F2IA 2JSYA 3ZLPA 1JLWA 4HS1A 5IM9A 1XVWA 2NTOA 2FWGA 4I6XA 3IHQA 2R2JA 3LORA 4G0KA 1JZOA 3BD2A 2ES7A 2LTKA 3I9V2 1GSEA 4ICYA 4OWYA 1UN2A 2E7PA 5CO3A 3I69A 3ZVJA 3RHBA 5J9BA 3SWLA 3LQ7A 4YKGA 1K0BA 2C0EA 3IAS2 3EC3A 1YDKA 2CAIA 2HSNB 2IFQA 4HZ4A 3WD6A 1K3LA 1E6BA 1J9BA 1XW6A 2N5BA 2BJXA 2AHEA 5AN1A 2DKIA 3MNGA 2GSSA 1VF4A 3NZNA 1OYJA 3AY8A 4OCEA 2HRFA 4ML1A 4FO5A 3IDVA 5D8IA 1SK0A 1QK8A 3HVVA 4KDUA 5H5SA 4TR0A 3TKQA 2H75A 4ML6A 2FY6A 2R6KA 1M99A 5EPFA 5KOWA 2AB6A 4TR1B 2B7JA 3DVWA 3TJKA 3Q19A 2H0IA 3WYWA 1ZYEA 2FWHA 2VUPA 2X64A 4K0NA 4KCEA 2VCWA 1PGTA 4HI7A 1PMTA 4PHZC 4TRXA 4WXTA 3GX8A 3RHCA 3F6FA 2FUG2 2F51A 3F4RA 2HSMA 4EIPA 5IO2A 4GTUA 1XZOA 2CVKA 1OC3A 3MDKA 4BVXA 4KW6A 2TRXA 2DJ2A 2GGTA 1PKWA 2VCVA 1WIKA 2JZRA 4DSSA 4YQVA 2L6DA 3MSZA 1R4WA 4N11A 5IMVA 2ZUPA 3C1RA 4EF0A 4IJIA 3KD0A 3FEUA 4WF5A 4ZL7A 1GSSA 16GSA 3NOFA 3H93A 3L9SA 5FWGA 5IOWA 3M9KA 4MA9A 1YY7A 3W8SA 3ZVJD 4ZBDA 3F6DA 1MD3A 2WDUA 3DKSA 1SKWB 4KAEA 3FYGA 1B9YC 1O8WA 2MMNA 2VL3A 3EU4A 2A4VA 2CZ3A 4HUAA 3ZIVA 4EDYA 4FYCA 1FB6A 5CREA 1OKTA 1G0TA 3KTBA 4IJ3A 5GZZB 2K8VA 2O85A 5IMAA 4AI6A 1K3OA 4ECBA 1ERTA 1V98A 1V2AA 1S4BP 2VLTA 2CQ9A 2H70A 3HJOA 4L5LA 2B5YA 3UBKA 4K2DA 4G0LA 5FHIA 2RLIA 3TB2A 2JZTA 4O7HA 2FHEA 3J7Yk 2YV9A 2WRTA 4Z2UA 2L59A 2FWEA 1CQGA 2GS3A 3CQFA 2YWMA 3F63A 1K3YA 3GSSA 1I5GA 3C71A 3I6AA 3GL5A 10GSA 5FT3A 4TR3A 4OD7A 1U3IA 1J0FA 3GIXA 4KUNA 3F0IA 3ERFA 1GSDA 3LG6A 3KM6A 5BRTA 4PUFC 1GRXA 4Z7XA 3R2QA 2X49A 3H79A 2P5RA 4TKYA 5GSTA 4XHMA 3DYRA 4Q5FA 4ISDA 2WULA 4AKXB 3G7IA 9GSSA 1ZMAA 2H1BA 4NXIA 4MF6A 4JR4A 4L8EA 3P7XA 4HJ2A 1A24A 2H6XA 4WF4A 5B8BA 2WZSA 1SL0B 4G9HA 5DQYA 1F2EA 4OMVA 4V2LA 1OVNA 2WW1A 1U6TA 5ID2A 4BA7A 1GWCA 5E59A 2H1AA 5G5EA 2HRKB 5JCUA 1IYIA 4KE3A 2IPAA 3DVXA 1GTBA 1X5CA 1SJZA 1PKZA 1WPIA 4JU5A 1N25A 3CBUA 1YKAA 2GDRA 1T4YA 5JWOB 1EV9A 3EURA 4AKHA 1F6MC 1FAAA 4YQMA 3WGDA 1SYRA 2AV4A 2M46A 1MTCA 2XBIA 2HNLA 4ZILA 1YF0A 3KMOA 1TU8A 4JE1A 4N30A 4TR4A 2P5QA 4MJEA 2R37A 4QL7A 4GXZA 3VLNA 4MF7A 7GSSA 1K0MA 3ZL5A 5IPGA 3EVIA 1GNWA 2R0PA 3F3RA 2JACA 4G10A 1YF1A 3LGCA 1M2BA 2MZCA 1C72A 1EP7A 2EFHA 2VKZG 1ZCPA 3RGBC 3TCOA 3CRTA 4PURA 2VCZA 4I2UA 2REMA 4KDYA 2LRCA 3GKNA 2GT6A 2KLXA 4MNNA 2HE3A 4EL1A 3GURA 5B6MA 2OKAA 3ZRDA 5J40A 3UAPA 1TOFA 2GZYA 4KA0A 2F8AA 3GN3A 4MLYA 1GLPA 2LJKA 3HVXA 4YKFA 5INYA 2DLXA 2VIMA 3UEMA 1WJKA 2PBJA 1SYXA 3ZITA 1M3IA 3O76A 5KEJA 2LRNA 1F37A 1ZOFA 2DJ3A 3SBCA 1JZDA 3QFBC 6GSYA 2HFDA 1KNGA 1PSQA 4YH2A 3IR4A 3QMXA 1TI3A 4IHUA 5ENUA 1F9MA 3I43A 5DBQA 5A4UA 3FMWA 4K7IA 5D9XA 4FQUA 2RUEA 2AUVA 4OFNA 1EV4A 4IELA 5HFIA 3TDGA 1WE0A 2V41A 1FVKA 2X8CA 4J56E 5E4WA 5H5QA 1XFLA 5CRWA 5ECLB 5EVOA 2IFQB 1GSFA 4W66A 2LQOA 4WR4A 3GNJA 5D9WA 1SENA 5EY6A 5ECRB 3G7JA 1TXUA 1URMA 2KHPA 1SD8A 2B5XA 2DBCA 3L78A 1KBNA 2HSHA 1G7OA 4MDCA 1XWKA 3U6VA 2UV8G 1X9SB 2GLRA 5AIVA 1ST9A 3UL3A 3GV1A 2O87A 1A2LA 4Q5QA 4AKIA 4MJAA 6GSXA 3FRCA 2H8LA 5CAXA 2H0GA 1ZGNA 1IYHA 1R26A 3L4NA 1T00A 3LJRA 4IKHA 2D2ZA 5A5HA 2LUSA 2WW2A 1O73A 2IWTA 1Y25A 3IK9A 4K2XA 1Z7RA 3BOAA 1G6WA 1KEBA 4WETA 4X4JA 4F03A 2IN3A 2HSMB 4IVFA 3IHGA 2H72A 4BVXB 2IJYA 1CQHA 1KTEA 2PPTA 4DSSB 17GSA 1TDIA 5DJLA 2C8UA 4GSNA 1AW9A 2WFCA 2FA8A 4ECIA 4EKZA 1A8LA 3BJ5A 3QPMA 2LKUA 5KN0A 2C3QA 2HSYA 3MYDA 3EYTA 3G9BA 1TP9A 3QCPA 3UMAA 4MH2A 2I81A 2NBSA 3QOUA 2PMTA 4MZWA 1ILOA 4YAVA 1A2JA 2PVOC 2X4AA 4KGIA 3VI7A 1EZKA 22GSA 1X9WB 4MABA 5A34A 2WW3A 4ZB8A 4GF0A 4O5UA 3KJYA 4ZB9A 2C3NA 3Q18A 1A0RP 4JRRA 5CNWA 5CP1A 5B7CA 2VM1A 2LJRA 3FY7A 1HNAA 3S9FA 4G2EA 2OJLA 3ZZXA 1GUKA 3CTFA 4FH8A 3W8JA 3HYPA 4TN8A 1XVQA 2K6VA 1U87A 4IP1A 1QUWA 5DALA 4MCUA 4X0XA 1Q4JA 4LMVA 3EU3A 4IQAA 4O5RA 4JBBA 4KSOA 4HJMA 2DKHA 2YNXA 4POKA 4IW9A 3TKSA 3LWAA 2TIRA 5AGYA 3RBTA 2K8SA 4LLRA 4FIWA 5B6NA 3IC8A 2DSAA 1HYUA 1JHBA 4F9ZA 11GSA 3VI5A 1PRXA 2BTOT 1TI1A 4ECJA 3QAGA 2MMZA 5GAND 1GLQA 3LYKA 8GSSA 2OBKA 4RUVA 4O32A 5A1NA 4JR6A 5ID2B 1H75A 4Z2RA 1M2DA 2IL3A 4WBRD 5GSSA 3F4TA 4EDZA 4GRFA 3LEFA 3RAZA 1DSBA 5ECNB 4CY8A 2WVYA 3FW2A 2EIOA 1XW5A 1O85A 2OACA 4I8BA 3KTLA 3PINA 4N0ZA 4TVEA 3CYNA 4P3YB 5JCWA 1XWCA 1F3BA 5DCHA 3VK9A 3O3TA 2OT3A 1TRVA 5F0GA 5KN3A 2A4HA 1SL2B 3PR8A 2X8HA 4MH3A 1ERWA 3TKSC 4XS4A 2ON7A 2GQKA 5HR3A 3M3MA 2GSRA 3KP8A 3HCZA 2H1GA 1GUHA 4X1UA 2L57A 3GSTA 3UIWA 1O7UA 6GSTA 2VM2A 1PN0A 4PQIA 1PFOA 1TXXA 2OA7A 1FG4A 3LW9A 3D22A 1T1VA 3LFLA 2K9FA 2VAFA 5KN1A 3HJMA 2J9HA 1GH2A 4HQSA 2PU9C 5LNKe 2XBQA 4DSQA 4RQRA 4DSRA 3UBLA 4N0VA 3EMPA 3C7MA 2WGRA 4X43A 2H73A 1OC9A 2UZ8A 2YWOA 3CSHA 1UC7A 2EFCA 5G5FA 2G2QA 1BJXA 4PGTA 2PVQA 1THOA 1K0NA 1YEPA 4ZL8A 2CVBA 4WR5A 4PTSA 2JADA 4NPBA 1EGRA 2NVLA 2JSZA 3A3TA 4OO5A 2KUCA 2WJUA 19GSA 3H8QA 4AGSA 4LA1A 5GAPD 3CWGA 5JWQB 4MPFA 3APSA 4ACSA 3KIJA 2R4VA 2QGVA 3WT2A 2MYGA 1TJDA 3ME7A 1SKSB 3APOA 2WS2A 4KCAA 5IMDA 2V6OA 1EOHA 1ON4A 3F8UA 2IMEA 5ECMB 4QMKA 4V2MA 4EIQA 5J4YA 3WGEA 2DC5A 4J2FA 1AC1A 2WVZA 3HDCA 1B4QA 3D21A 4GDFA 2HYXA 1Z9HA 3C73A 1B4PA 4TXOA 4EO3A 1XXUA 2LEGA 3CRUA 3QFAC 4HOJA 3TRPA 4PX1A 4NHWA 4CW9A 1YKCA 5IO0A 1U88A 3IV4A 3U5RE 4MZBA 3LYPA 2QA2A 1SD9A 4XRDA 2I1UA 3UVTA 1XOAA 2WCIA 1FB0A 2FLSA 3TRQA 3UJ1A 5G1KA 4XIHA 1F3AA 1I1IP 3WGXA 3FZAA 1BG5A 3QDNA 5A5HB 1GSYA 2XPDA 3M0FA 2B1KA 4BWQA 1GTIA 1TK5B 2C0FA 2K18A 2QA1A 2YANA 3DIEA 2B7KA 1OE8A 3EMXA 2LS5A 2YP6A 2IMDA 3MIXA 3H1NA 1S3DA 2V1MA 1WRYA 1EEJA 1AIUA 2VD1A 2VO4A 3RDWA 4WKWA 1QGVA 3GHAA 5F06A 3FR3A 1X5EA 2VL2A 4IN0A 3DWVA 3HVNA 2YN1A 2HZFA 4TOPA 2B3SA 5DCGA 3D4MA 4ZB7A 4PQ1A 1YQ1A 2KOKA 3ZREA 2X8GA 2LJAA 5AIXA 3GX0A 2VLVA 4GSTA 4KH7A 1XPVA 2DIYA 5A34B 1Z6MA 4K0GA 3A2VA 4JZQA 1TK8B 2R0GA 4WEYA 2HQTA 3FK8A 1QXHA 3FZ5A 1VRSD 4DEJA 3HHVA 4AF2A 1B48A 4IGJA 4E68A 3Q6OA 1ACVA 2IMIA 2GSQA 1PX7A 2VD0A 3GA4A 3VWVA 3D6IA 3VPQA 4BVYA 3PH9A 1GL8A 1MD4A 4MF5A 2L5OA 3BCIA 4XTSA 2L6CA 5J47A 5DALB 4K5SA 4LL1B 3LXTA 1XWBA 3TRXA 1OE7A 1SL1B 2VL2C 1GP1A 4BPYA 2LSTA 4ZBAA 4PUAA 2E0QA 2ZNMA 1O6JA 1A0FA 1HNBA 1EEMA 1OKDA 2YJHA 2O8VB 2GZPA 2G0FA 3RPPA 3ZTLA 4EUYA 3TU3B 2QC7A 3DXBA 3HZ8A 1AQWA 2C0GA 12GSA 1DUGA 5A1NB 3GTUA 2J23A 3IXRA 2LRTA 4NV5A 6GSSA 1V58A 3DEXA 4XS1A 4JEDA 4PQHA 5DDLA 4L5OA 4BL7A 3L9VA 2PWJA 1TK0B 1WWJA 3K8NA 4AJ7A 2O36A 4L0WA 3E3EA 2IIYA 2OBIA 1V9WA 1AQVA 2X99A 1PA3A 4YAPA 1DE2A 4IQ1A 4G01A 3F4SA 2EFDA 4XS4B 2JL4A 2VL9A 1X5DA 3FZ9A 3MAKA 1Z3EA 5C00A 2EIQA 3L9UA 2RM5A 5DQSA 1HD2A 3HD5A 4F0CA 1T3BA 2FA4A 3C1SA 4ZL9A 2YZUA 1K0AA 4WBJA 2JZSA 1BYEA 1TU7A 2YJ7A 2HZEA 2V32A 2OE0A 1WOUA 3DGQA 3APQA 2LV3A 1XWGA 1FOVA 2R5GA 1G6YA 2DJ0A 3Q74A 4FXYP 5ECQB 1TW9A 2RUFA 5ELAA 4XRAA 2VCXA 2C1YA 1BQ7A 1H4OA 4TW5A 3D4TA 1OC9B 4D73A 5ECSA 4K8MA 5KOXA 1SJIA 5G1LA 4YQUA 3HXSA 3VURA 1XCCA 1N8JA 3ZFBA 1Q98A 4MPGA 5J3RA 1R5AA 3GH6A 4OFTA 2PGTA 3F9UA 3ISOA 1PL2A 2WW0A 4MZCA 3KMNA 2A2RA 1M2AA 3WT1A 4HU9A 2OADA 3IK7A 4PI0C 3BBYA 1K0DA 4POBA 2F3MA 1O81A 1NSWA 4K7OA 1OC8A 5HFKA 1XWAA 2PERA 3BCKA 5DJMA 4GLTA 5J9CA 1AXDA 5CRGA 3GKXA 2C4JA 1ML6A 1LJRA 3HJPA 4PXOA 5IMZA 3CMIA 5A5KA 4EXJA 1RW1A 4KSMA 4TXOB 1W89A 5HR1A 5JWRB 3KH7A 2V2GA 2WVXA 4K7NA 2AYTA 1NHOA 4G19A 1UA5A 1M9BA 1T8EB 2V6KA 1B8XA 3TKSE 4DVCA 1ZL9A 3ZMLA 2EFEA 1S3AA 4TXVA 5D9TA 1G7EA 1XBSA 2HRAA 2B6MA 4CDOA 20GSA 2O89A 4GCIA 3TOUA 1OAZA 4BIKA 5D96A 3TOTA 2MBSA 1MDKA 2CX3A 1U3AA 1EP8A 3TUEA 1WP0A 2GQLA 4AKGA 4K9ZA 14GSA 2AJQB 3UARA 3KH9A 3ERGA 1SVLA 1PL1A 4F0BA 1SU9A 3CSJA 4Q5NA 1BF5A 3GKKA 1PX6A 1NHYA 3PGTA 3CSIA 1V40A 1HQOA 4ZXGA 4MK3A 3KCMA 2XC2A 2R3XA 1YVLA 1JFUA 4Z2TA 4ZIJA 5DAKA 5ECIB 2QSIA 4O92A 2H0HA 2O5VA 3HA9A 2EC4A 1YJ6A 3IAM2 1SK1A 5F07A 3TJBA 2CT6A 1MDIA 4H86A 2P0GA 1S3RA 4PNFA 2IMFA 2H6ZA 4N3ZA 2HLSA 4Q5RA 1SKRB 3HY2A 1A23A 4O5QA 2F8FA 6GSVA 2FGXA 4I2TA 4A5PA 5BMUA 2I3YA 4MJBA 1AAZA 2XHFA 4FYUA 1SVOA 5D73A 3N9JA 4K1FA 1O8XA 1BX9A 2AAWA 1W4VA 2OE3A 4V1Ag 3LSZA 3J7Yb 2VOCA 4V1Ap 3G7YA 2YWNA 3P8WA 3JCML 5IQYA 4GQFA 3DD3A 1AQXA 5J5NA 4CHSA 1JLVA 3GL3A 4IBPA 5ABRA 2ON5A 3QAWA 4GSSA 2C80A 4BVYB 2QKEA 5A4WA 2O3EA 3W6GA 2H1LA 4POMA 3ERWA 4J57E 2CAQA 2LNSA 5C04A 3IOSA 1LBKA 3M8NA 1YZXA 3KP9A 2BMXA 5HR0A 4XS6A 2YV7A 3MWHA 4CY6A 3FKFA 1K0CA 2TRCP 2C3TA 1BEDA 1ZYPA 1JZWA 2CV4A 3PPUA 3ZMKA 1T4ZA 3LXZA 4HDEA 5LCZA 5HFGA 2MMOA 1FVJA 2VLUA 1JZRA 2GVPA 4ZBBA 5G2ZA 4EVMA 5L71A 1S3CA 1GSQA 4ECCA 5CYYA 3GTUB 1X9MB 2PUKC
chains in the Genus database with same CATH topology
4I5QA 2A2PA 3QR6A 2PN8A 3KXOA 5D93A 1SJ6A 3UOMA 4MP4A 5CRDA 5F05A 1GTAA 2F9SA 2GTUA 2RM6A 2RIIA 4FYBA 1EGOA 2I9HA 4BL7B 1MEKA 2M72A 4E8HA 1XOBA 1TTZA 2HSNA 4OFMA 1ZZYA 2C0DA 1PQNA 1AUCA 2N5AA 1N2AA 4N10A 1Z6NA 3HVSA 1GUMA 3C8EA 2YOIA 1VF3A 5IOXA 4ID0A 2WZ9A 3D5JA 3O6TA 4KX4A 3QAVA 4I97A 4NMUA 1X0RA 3VFIA 3TJFA 3GFKA 4NAXA 4TR1A 3VWWA 2A2SA 4ILFA 4KF9A 1THXA 4MJCA 1B9XC 3D0ZA 1XW9A 1M7TA 3CXGA 4E8EA 1I9DA 2HZEB 4RI7A 2E2MA 1Z5YE 4AJ6A 3FHKA 4KNDA 2L4QA 4QL9A 2YWIA 3IE3A 1VF1A 3VWUA 2ZCTA 1SK2A 4EC0A 1FW1A 1E2YA 1QQ2A 2DJ1A 2M80A 2B5EA 3HMJG 2H6YA 1ZYNA 1DE1A 3GKMA 3FZ4A 2DMMA 5IMFA 4D73B 1A8YA 1A2MA 3FR6A 2DJKA 2EIRA 2JU5A 2E2GA 3DRNA 2DJJA 3GUSA 3ZIJA 2YPMA 1FO5A 4G0IA 4RQXA 4POLA 3TKPA 2H71A 13GSA 3KEBA 1RK4A 4OO4A 5J4VA 1HNCA 3FR9A 4KDXA 5JCGA 1UVZA 5ECKB 2DIZA 1LU4A 2R0CA 2H66A 3E0UA 3EINA 1BG1A 2I4AA 2FNOA 3QD9A 3NIVA 2H1DA 4IS0A 3HZ4A 5B8AA 2B1LA 1Z7PA 3A5WA 3ZYWA 5HQPA 3TGZA 4BWSA 2GSTA 1BAYA 2NDOA 1T7PB 2MMAA 2LQQA 2O7KA 3TKRA 1TRWA 1YEXA 1PD21 4NWYA 5IPHA 5HR2A 4F82A 3M1GA 1EOGA 1USBA 3TJGA 1PN9A 3RPNA 5J41A 1QMVA 1GSUA 3E9JB 2L5LA 3IPZA 3UVHA 6GSUA 2CA8A 2XPEA 1R5PA 4IP6A 4LL4B 1Y6EA 2KP2A 2YZHA 3P90A 3IRAA 2VCQA 3F3QA 3EE2A 1XIYA 3US3A 1FOHA 1R7HA 1GNEA 1ZYQB 1GULA 1VF2A 4K6XA 2HRNA 1WMJA 4L0UA 4OCFA 3R3EA 2GQMA 1M0UA 2LNTA 3H4KA 5DVBA 2HRKA 5AISA 2ALBA 3A5IA 3KZQA 2MBTA 1DBYA 3GYKA 4AJ8A 3OR5A 2NPBA 5LD0A 2HT9A 5H5RA 2L4CA 1VGLA 5EL8A 2H76A 2GT5A 3KGKA 2CVDA 1Y1UA 1ERVA 2IMKA 3EPTA 4ULXA 5G31A 3IBHA 4GWRA 1K0OA 3V1WA 2KP1A 2CX4A 5DAKB 2FD3A 1SVMA 4HU7A 18GSA 5ELGA 4V2NA 2N5FA 5ECHB 5KN2A 3VPTA 2WB9A 1EWXA 1NW2A 3HKRA 5BMUB 2H19A 4K5RA 1GTUA 2Z9SA 2H01A 1J08A 3A2XA 5D9VA 4HZ2A 2FCHA 3M9JA 2OE1A 2HXKA 1RQMA 3IA1A 4NV2A 3ZFLA 1TKDB 1V57A 5COHA 5G30A 4PNGA 3VWXA 2H74A 5CRHA 6GSWA 1FHEA 3N5OA 3L0HA 4KB3A 5F8BA 4HQZA 4NHZA 4ZB6A 2CZ2A 3CTGA 3A2WA 5IMCA 3DMLA 2HI7A 2H30A 4EE0A 5J4UA 3GMFA 5ECPB 3ED3A 2YCDA 4XCSA 2P31A 3GRXA 3IC4A 2DMLA 2GZZA 1ERUA 2FWFA 3ME8A 3P2AA 4USSA 1ABAA 3EWLA 4GQCA 1M9AA 1QFNA 5IIZA 3TJJA 4MMMA 4LMWA 4QQ7A 5A4VA 3GH9A 4RI6A 1MDJA 4HEA2 2VCTA 1NM3A 1TRUA 1TRSA 5ECOB 4F2IA 2JSYA 3ZLPA 1JLWA 4HS1A 5IM9A 1XVWA 2NTOA 2FWGA 4I6XA 3IHQA 2R2JA 3LORA 4G0KA 1JZOA 3BD2A 2ES7A 2LTKA 3I9V2 1GSEA 4ICYA 4OWYA 1UN2A 2E7PA 5CO3A 3I69A 3ZVJA 3RHBA 5J9BA 3SWLA 3LQ7A 4YKGA 1K0BA 2C0EA 3IAS2 3EC3A 1YDKA 2CAIA 2HSNB 2IFQA 4HZ4A 3WD6A 1K3LA 1E6BA 1J9BA 1XW6A 2N5BA 2BJXA 2AHEA 5AN1A 2DKIA 3MNGA 2GSSA 1VF4A 3NZNA 1OYJA 3AY8A 4OCEA 2HRFA 4ML1A 4FO5A 3IDVA 5D8IA 1SK0A 1QK8A 3HVVA 4KDUA 5H5SA 4TR0A 3TKQA 2H75A 4ML6A 2FY6A 2R6KA 1M99A 5EPFA 5KOWA 2AB6A 4TR1B 2B7JA 3DVWA 3TJKA 3Q19A 2H0IA 3WYWA 1ZYEA 2FWHA 2VUPA 2X64A 4K0NA 4KCEA 2VCWA 1PGTA 4HI7A 1PMTA 4TRXA 4WXTA 3GX8A 3RHCA 3F6FA 2FUG2 2F51A 3F4RA 2HSMA 4EIPA 5IO2A 4GTUA 1XZOA 2CVKA 1OC3A 3MDKA 4BVXA 4KW6A 2TRXA 2DJ2A 2GGTA 1PKWA 2VCVA 1WIKA 2JZRA 4DSSA 4YQVA 2L6DA 3MSZA 1R4WA 4N11A 5IMVA 2ZUPA 3C1RA 4EF0A 4IJIA 3KD0A 3FEUA 4WF5A 4ZL7A 1GSSA 16GSA 3NOFA 3H93A 3L9SA 5FWGA 5IOWA 3M9KA 4MA9A 1YY7A 3W8SA 3ZVJD 4ZBDA 3F6DA 1MD3A 2WDUA 3DKSA 1SKWB 4KAEA 3FYGA 1B9YC 1O8WA 2MMNA 2VL3A 3EU4A 2A4VA 2CZ3A 4HUAA 3ZIVA 4EDYA 4FYCA 1FB6A 5CREA 1OKTA 1G0TA 3KTBA 4IJ3A 5GZZB 2K8VA 2O85A 5IMAA 4AI6A 1K3OA 4ECBA 1ERTA 1V98A 1V2AA 2CQ9A 2H70A 2VLTA 3HJOA 4L5LA 2B5YA 3UBKA 4K2DA 4G0LA 5FHIA 2RLIA 3TB2A 2JZTA 4O7HA 2FHEA 3J7Yk 2YV9A 2WRTA 4Z2UA 2L59A 2FWEA 1CQGA 2GS3A 2YWMA 3F63A 1K3YA 3GSSA 1I5GA 3C71A 3I6AA 3GL5A 10GSA 5FT3A 4TR3A 4OD7A 1U3IA 1J0FA 3GIXA 4KUNA 3F0IA 3ERFA 1GSDA 3LG6A 3KM6A 5BRTA 4PUFC 1GRXA 4Z7XA 3R2QA 2X49A 3H79A 2P5RA 4TKYA 5GSTA 4XHMA 3DYRA 4Q5FA 4ISDA 2WULA 4AKXB 3G7IA 9GSSA 1ZMAA 2H1BA 4NXIA 4MF6A 4JR4A 4L8EA 3P7XA 4HJ2A 1A24A 2H6XA 4WF4A 5B8BA 1SL0B 4G9HA 5DQYA 1F2EA 4OMVA 4V2LA 1OVNA 1U6TA 5ID2A 4BA7A 1GWCA 5E59A 2H1AA 5G5EA 2HRKB 5JCUA 1IYIA 4KE3A 2IPAA 3DVXA 1GTBA 1X5CA 1SJZA 1PKZA 1WPIA 4JU5A 1N25A 3CBUA 1YKAA 2GDRA 1T4YA 5JWOB 1EV9A 3EURA 4AKHA 1F6MC 1FAAA 4YQMA 3WGDA 1SYRA 2AV4A 2M46A 1MTCA 2XBIA 2HNLA 4ZILA 1YF0A 3KMOA 1TU8A 4JE1A 4N30A 4TR4A 2P5QA 4MJEA 2R37A 4QL7A 4GXZA 3VLNA 4MF7A 7GSSA 1K0MA 3ZL5A 5IPGA 3EVIA 1GNWA 2R0PA 3F3RA 2JACA 4G10A 1YF1A 3LGCA 1M2BA 2MZCA 1C72A 1EP7A 2EFHA 2VKZG 1ZCPA 3TCOA 3CRTA 4PURA 2VCZA 4I2UA 2REMA 4KDYA 2LRCA 3GKNA 2GT6A 2KLXA 4MNNA 2HE3A 4EL1A 3GURA 5B6MA 2OKAA 3ZRDA 5J40A 3UAPA 1TOFA 2GZYA 4KA0A 2F8AA 3GN3A 4MLYA 1GLPA 2LJKA 3HVXA 4YKFA 5INYA 2DLXA 2VIMA 3UEMA 1WJKA 2PBJA 1SYXA 3ZITA 3O76A 5KEJA 2LRNA 1F37A 1ZOFA 2DJ3A 3SBCA 1JZDA 3QFBC 6GSYA 2HFDA 1KNGA 1PSQA 4YH2A 3IR4A 3QMXA 1TI3A 4IHUA 5ENUA 1F9MA 3I43A 5DBQA 5A4UA 3FMWA 4K7IA 5D9XA 4FQUA 2RUEA 2AUVA 4OFNA 1EV4A 4IELA 5HFIA 3TDGA 1WE0A 2V41A 1FVKA 2X8CA 4J56E 5E4WA 5H5QA 1XFLA 5CRWA 5ECLB 5EVOA 2IFQB 1GSFA 4W66A 2LQOA 4WR4A 3GNJA 5D9WA 1SENA 5EY6A 5ECRB 3G7JA 1TXUA 1URMA 2KHPA 1SD8A 2B5XA 2DBCA 3L78A 1KBNA 2HSHA 1G7OA 4MDCA 1XWKA 3U6VA 2UV8G 1X9SB 2GLRA 5AIVA 1ST9A 3UL3A 3GV1A 2O87A 1A2LA 4Q5QA 4AKIA 4MJAA 6GSXA 3FRCA 2H8LA 5CAXA 2H0GA 1ZGNA 1IYHA 1R26A 3L4NA 1T00A 3LJRA 4IKHA 2D2ZA 5A5HA 2LUSA 1O73A 2IWTA 1Y25A 3IK9A 4K2XA 1Z7RA 3BOAA 1G6WA 1KEBA 4WETA 4X4JA 4F03A 2IN3A 2HSMB 4IVFA 3IHGA 2H72A 4BVXB 2IJYA 1CQHA 1KTEA 2PPTA 4DSSB 17GSA 1TDIA 5DJLA 2C8UA 4GSNA 1AW9A 2WFCA 2FA8A 4ECIA 4EKZA 1A8LA 3BJ5A 3QPMA 2LKUA 5KN0A 2C3QA 2HSYA 3MYDA 3EYTA 3G9BA 1TP9A 3QCPA 3UMAA 4MH2A 2I81A 2NBSA 3QOUA 2PMTA 4MZWA 1ILOA 4YAVA 1A2JA 2PVOC 2X4AA 4KGIA 3VI7A 1EZKA 22GSA 1X9WB 4MABA 5A34A 4ZB8A 4GF0A 4O5UA 3KJYA 4ZB9A 2C3NA 3Q18A 1A0RP 4JRRA 5CNWA 5CP1A 5B7CA 2VM1A 2LJRA 3FY7A 1HNAA 3S9FA 4G2EA 2OJLA 3ZZXA 1GUKA 3CTFA 4FH8A 3W8JA 3HYPA 4TN8A 1XVQA 2K6VA 1U87A 4IP1A 1QUWA 5DALA 4MCUA 4X0XA 1Q4JA 4LMVA 3EU3A 4IQAA 4O5RA 4JBBA 4KSOA 4HJMA 2DKHA 2YNXA 4POKA 4IW9A 3TKSA 3LWAA 2TIRA 5AGYA 3RBTA 2K8SA 4LLRA 4FIWA 5B6NA 3IC8A 2DSAA 1HYUA 1JHBA 4F9ZA 11GSA 3VI5A 1PRXA 2BTOT 1TI1A 4ECJA 3QAGA 2MMZA 5GAND 1GLQA 3LYKA 8GSSA 2OBKA 4RUVA 4O32A 5A1NA 4JR6A 5ID2B 1H75A 4Z2RA 1M2DA 2IL3A 4WBRD 5GSSA 3F4TA 4EDZA 4GRFA 3LEFA 3RAZA 1DSBA 5ECNB 4CY8A 3FW2A 2EIOA 1XW5A 1O85A 2OACA 4I8BA 3KTLA 3PINA 4N0ZA 4TVEA 3CYNA 4P3YB 5JCWA 1XWCA 1F3BA 5DCHA 3VK9A 3O3TA 2OT3A 1TRVA 5F0GA 5KN3A 2A4HA 1SL2B 3PR8A 2X8HA 4MH3A 1ERWA 3TKSC 4XS4A 2ON7A 2GQKA 5HR3A 3M3MA 2GSRA 3KP8A 3HCZA 2H1GA 1GUHA 4X1UA 2L57A 3GSTA 3UIWA 1O7UA 6GSTA 2VM2A 1PN0A 4PQIA 1TXXA 2OA7A 1FG4A 3LW9A 3D22A 1T1VA 3LFLA 2K9FA 2VAFA 5KN1A 3HJMA 2J9HA 1GH2A 4HQSA 2PU9C 5LNKe 2XBQA 4DSQA 4RQRA 4DSRA 3UBLA 4N0VA 3EMPA 3C7MA 2WGRA 4X43A 2H73A 1OC9A 2UZ8A 2YWOA 3CSHA 1UC7A 2EFCA 5G5FA 2G2QA 1BJXA 4PGTA 2PVQA 1THOA 1K0NA 1YEPA 4ZL8A 2CVBA 4WR5A 4PTSA 2JADA 4NPBA 1EGRA 2NVLA 2JSZA 3A3TA 4OO5A 2KUCA 2WJUA 19GSA 3H8QA 4AGSA 4LA1A 5GAPD 3CWGA 5JWQB 4MPFA 3APSA 4ACSA 3KIJA 2R4VA 2QGVA 3WT2A 2MYGA 1TJDA 3ME7A 1SKSB 3APOA 2WS2A 4KCAA 5IMDA 2V6OA 1EOHA 1ON4A 3F8UA 2IMEA 5ECMB 4QMKA 4V2MA 4EIQA 5J4YA 3WGEA 2DC5A 4J2FA 1AC1A 3HDCA 1B4QA 3D21A 4GDFA 2HYXA 1Z9HA 3C73A 1B4PA 4TXOA 4EO3A 1XXUA 2LEGA 3CRUA 3QFAC 4HOJA 3TRPA 4PX1A 4NHWA 4CW9A 1YKCA 5IO0A 1U88A 3IV4A 3U5RE 4MZBA 3LYPA 2QA2A 1SD9A 4XRDA 2I1UA 3UVTA 1XOAA 2WCIA 1FB0A 2FLSA 3TRQA 3UJ1A 5G1KA 4XIHA 1F3AA 3WGXA 3FZAA 1BG5A 3QDNA 5A5HB 1GSYA 2XPDA 3M0FA 2B1KA 4BWQA 1GTIA 1TK5B 2C0FA 2K18A 2QA1A 2YANA 3DIEA 2B7KA 1OE8A 3EMXA 2LS5A 2YP6A 2IMDA 3MIXA 3H1NA 1S3DA 2V1MA 1WRYA 1EEJA 1AIUA 2VD1A 2VO4A 3RDWA 4WKWA 1QGVA 3GHAA 5F06A 3FR3A 1X5EA 2VL2A 4IN0A 3DWVA 2YN1A 2HZFA 4TOPA 2B3SA 5DCGA 3D4MA 4ZB7A 4PQ1A 1YQ1A 2KOKA 3ZREA 2X8GA 2LJAA 5AIXA 3GX0A 2VLVA 4GSTA 4KH7A 1XPVA 2DIYA 5A34B 1Z6MA 4K0GA 3A2VA 4JZQA 1TK8B 2R0GA 4WEYA 2HQTA 3FK8A 1QXHA 3FZ5A 1VRSD 4DEJA 3HHVA 4AF2A 1B48A 4IGJA 4E68A 3Q6OA 1ACVA 2IMIA 2GSQA 1PX7A 2VD0A 3GA4A 3VWVA 3D6IA 3VPQA 4BVYA 3PH9A 1GL8A 1MD4A 4MF5A 2L5OA 3BCIA 4XTSA 2L6CA 5J47A 5DALB 4K5SA 4LL1B 3LXTA 1XWBA 3TRXA 1OE7A 1SL1B 2VL2C 1GP1A 4BPYA 2LSTA 4ZBAA 4PUAA 2E0QA 2ZNMA 1O6JA 1A0FA 1HNBA 1EEMA 1OKDA 2YJHA 2O8VB 2GZPA 2G0FA 3RPPA 3ZTLA 4EUYA 3TU3B 2QC7A 3DXBA 3HZ8A 1AQWA 2C0GA 12GSA 1DUGA 5A1NB 3GTUA 2J23A 3IXRA 2LRTA 4NV5A 6GSSA 1V58A 3DEXA 4XS1A 4JEDA 4PQHA 5DDLA 4L5OA 4BL7A 3L9VA 2PWJA 1TK0B 1WWJA 3K8NA 4AJ7A 4L0WA 3E3EA 2IIYA 2OBIA 1V9WA 1AQVA 2X99A 1PA3A 4YAPA 1DE2A 4IQ1A 4G01A 3F4SA 2EFDA 4XS4B 2JL4A 2VL9A 1X5DA 3FZ9A 3MAKA 1Z3EA 5C00A 2EIQA 3L9UA 2RM5A 5DQSA 1HD2A 3HD5A 4F0CA 1T3BA 2FA4A 3C1SA 4ZL9A 2YZUA 1K0AA 4WBJA 2JZSA 1BYEA 1TU7A 2YJ7A 2HZEA 2V32A 2OE0A 1WOUA 3DGQA 3APQA 2LV3A 1XWGA 1FOVA 2R5GA 1G6YA 2DJ0A 3Q74A 5ECQB 1TW9A 2RUFA 5ELAA 4XRAA 2VCXA 2C1YA 1BQ7A 1H4OA 4TW5A 3D4TA 1OC9B 4D73A 5ECSA 4K8MA 5KOXA 1SJIA 5G1LA 4YQUA 3HXSA 3VURA 1XCCA 1N8JA 3ZFBA 1Q98A 4MPGA 5J3RA 1R5AA 3GH6A 4OFTA 2PGTA 3F9UA 3ISOA 1PL2A 4MZCA 3KMNA 2A2RA 1M2AA 3WT1A 4HU9A 2OADA 3IK7A 3BBYA 1K0DA 4POBA 2F3MA 1O81A 1NSWA 4K7OA 1OC8A 5HFKA 1XWAA 2PERA 3BCKA 5DJMA 4GLTA 5J9CA 1AXDA 5CRGA 3GKXA 2C4JA 1ML6A 1LJRA 3HJPA 4PXOA 5IMZA 3CMIA 5A5KA 4EXJA 1RW1A 4KSMA 4TXOB 1W89A 5HR1A 5JWRB 3KH7A 2V2GA 4K7NA 2AYTA 1NHOA 4G19A 1UA5A 1M9BA 1T8EB 2V6KA 1B8XA 3TKSE 4DVCA 1ZL9A 3ZMLA 2EFEA 1S3AA 4TXVA 5D9TA 1G7EA 1XBSA 2HRAA 2B6MA 4CDOA 20GSA 2O89A 4GCIA 3TOUA 1OAZA 5D96A 3TOTA 2MBSA 1MDKA 2CX3A 1U3AA 1EP8A 3TUEA 1WP0A 2GQLA 4AKGA 4K9ZA 14GSA 2AJQB 3UARA 3KH9A 3ERGA 1SVLA 1PL1A 4F0BA 1SU9A 3CSJA 4Q5NA 1BF5A 3GKKA 1PX6A 1NHYA 3PGTA 3CSIA 1V40A 1HQOA 4ZXGA 4MK3A 3KCMA 2XC2A 2R3XA 1YVLA 1JFUA 4Z2TA 4ZIJA 5DAKA 5ECIB 2QSIA 4O92A 2H0HA 2O5VA 3HA9A 2EC4A 1YJ6A 3IAM2 1SK1A 5F07A 3TJBA 2CT6A 1MDIA 4H86A 2P0GA 4PNFA 2IMFA 2H6ZA 4N3ZA 2HLSA 4Q5RA 1SKRB 3HY2A 1A23A 4O5QA 2F8FA 6GSVA 2FGXA 4I2TA 4A5PA 5BMUA 2I3YA 4MJBA 1AAZA 2XHFA 4FYUA 1SVOA 5D73A 3N9JA 4K1FA 1O8XA 1BX9A 2AAWA 1W4VA 2OE3A 4V1Ag 3LSZA 3J7Yb 2VOCA 4V1Ap 3G7YA 2YWNA 3P8WA 3JCML 5IQYA 4GQFA 3DD3A 1AQXA 5J5NA 4CHSA 1JLVA 3GL3A 4IBPA 5ABRA 2ON5A 3QAWA 4GSSA 2C80A 4BVYB 2QKEA 5A4WA 3W6GA 2H1LA 4POMA 3ERWA 4J57E 2CAQA 2LNSA 5C04A 3IOSA 1LBKA 3M8NA 1YZXA 3KP9A 2BMXA 5HR0A 4XS6A 2YV7A 3MWHA 4CY6A 3FKFA 1K0CA 2TRCP 2C3TA 1BEDA 1ZYPA 1JZWA 2CV4A 3PPUA 3ZMKA 1T4ZA 3LXZA 4HDEA 5LCZA 5HFGA 2MMOA 1FVJA 2VLUA 1JZRA 2GVPA 4ZBBA 5G2ZA 4EVMA 5L71A 1S3CA 1GSQA 4ECCA 5CYYA 3GTUB 1X9MB 2PUKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5Q A;  3QR6 A;  2PN8 A;  3KXO A;  5D93 A;  1SJ6 A;  3UOM A;  4MP4 A;  5CRD A;  5F05 A;  1GTA A;  2F9S A;  2GTU A;  2RM6 A;  2RII A;  4FYB A;  1EGO A;  2I9H A;  4BL7 B;  1MEK A;  2M72 A;  4E8H A;  1XOB A;  1TTZ A;  4OFM A;  1ZZY A;  2C0D A;  1PQN A;  1AUC A;  2N5A A;  1N2A A;  4N10 A;  1Z6N A;  3HVS A;  1GUM A;  3C8E A;  2YOI A;  1VF3 A;  5IOX A;  4ID0 A;  2WZ9 A;  3D5J A;  3O6T A;  4KX4 A;  3QAV A;  4I97 A;  4NMU A;  1X0R A;  3VFI A;  3TJF A;  3GFK A;  4NAX A;  4TR1 A;  3VWW A;  2A2S A;  4ILF A;  4KF9 A;  1THX A;  4MJC A;  1B9X C;  3D0Z A;  1XW9 A;  1M7T A;  3CXG A;  4E8E A;  1I9D A;  2HZE B;  4RI7 A;  2E2M A;  1Z5Y E;  4AJ6 A;  3FHK A;  4KND A;  2L4Q A;  4QL9 A;  2YWI A;  3IE3 A;  1VF1 A;  3VWU A;  2ZCT A;  1SK2 A;  4EC0 A;  1FW1 A;  1E2Y A;  1QQ2 A;  2DJ1 A;  2M80 A;  2B5E A;  2H6Y A;  1DE1 A;  3GKM A;  3FZ4 A;  2DMM A;  5IMF A;  4D73 B;  1A8Y A;  1A2M A;  3FR6 A;  2DJK A;  2EIR A;  2JU5 A;  2E2G A;  3DRN A;  2DJJ A;  3GUS A;  3ZIJ A;  2YPM A;  1FO5 A;  4G0I A;  4RQX A;  4POL A;  3TKP A;  2H71 A;  13GS A;  3KEB A;  1RK4 A;  4OO4 A;  1HNC A;  3FR9 A;  4KDX A;  5JCG A;  1UVZ A;  5ECK B;  2DIZ A;  1LU4 A;  2H66 A;  3E0U A;  3EIN A;  2I4A A;  2FNO A;  3QD9 A;  3NIV A;  2H1D A;  4IS0 A;  3HZ4 A;  5B8A A;  2B1L A;  1Z7P A;  3A5W A;  3ZYW A;  5HQP A;  3TGZ A;  4BWS A;  2GST A;  1BAY A;  2NDO A;  1T7P B;  2MMA A;  2LQQ A;  2O7K A;  3TKR A;  1TRW A;  1YEX A;  1PD2 1;  4NWY A;  5IPH A;  5HR2 A;  4F82 A;  3M1G A;  1EOG A;  1USB A;  3TJG A;  1PN9 A;  3RPN A;  5J41 A;  1QMV A;  1GSU A;  3E9J B;  2L5L A;  3IPZ A;  3UVH A;  6GSU A;  2CA8 A;  2XPE A;  1R5P A;  4IP6 A;  4LL4 B;  1Y6E A;  2KP2 A;  2YZH A;  3P90 A;  3IRA A;  2VCQ A;  3F3Q A;  3EE2 A;  1XIY A;  3US3 A;  1R7H A;  1GNE A;  1ZYQ B;  1GUL A;  1VF2 A;  4K6X A;  2HRN A;  1WMJ A;  4L0U A;  4OCF A;  3R3E A;  2GQM A;  1M0U A;  2LNT A;  3H4K A;  5DVB A;  2HRK A;  5AIS A;  2ALB A;  3KZQ A;  2MBT A;  1DBY A;  3GYK A;  4AJ8 A;  3OR5 A;  2NPB A;  5LD0 A;  2HT9 A;  5H5R A;  2L4C A;  1VGL A;  5EL8 A;  2H76 A;  2GT5 A;  3KGK A;  2CVD A;  1ERV A;  2IMK A;  4ULX A;  5G31 A;  3IBH A;  4GWR A;  1K0O A;  3V1W A;  2KP1 A;  2CX4 A;  5DAK B;  2FD3 A;  4HU7 A;  18GS A;  5ELG A;  4V2N A;  2N5F A;  5ECH B;  5KN2 A;  3VPT A;  2WB9 A;  1EWX A;  1NW2 A;  3HKR A;  2H19 A;  1GTU A;  2Z9S A;  2H01 A;  1J08 A;  3A2X A;  5D9V A;  4HZ2 A;  2FCH A;  3M9J A;  2OE1 A;  2HXK A;  1RQM A;  3IA1 A;  4NV2 A;  3ZFL A;  1TKD B;  1V57 A;  5COH A;  5G30 A;  4PNG A;  3VWX A;  2H74 A;  5CRH A;  6GSW A;  1FHE A;  3N5O A;  3L0H A;  4KB3 A;  5F8B A;  4HQZ A;  4NHZ A;  4ZB6 A;  2CZ2 A;  3CTG A;  3A2W A;  5IMC A;  3DML A;  2HI7 A;  2H30 A;  4EE0 A;  5J4U A;  3GMF A;  5ECP B;  3ED3 A;  2YCD A;  4XCS A;  2P31 A;  3GRX A;  3IC4 A;  2DML A;  2GZZ A;  1ERU A;  2FWF A;  3ME8 A;  3P2A A;  4USS A;  1ABA A;  3EWL A;  4GQC A;  1M9A A;  1QFN A;  5IIZ A;  3TJJ A;  4MMM A;  4LMW A;  4QQ7 A;  5A4V A;  3GH9 A;  4RI6 A;  1MDJ A;  4HEA 2;  2VCT A;  1NM3 A;  1TRU A;  1TRS A;  5ECO B;  4F2I A;  2JSY A;  3ZLP A;  1JLW A;  4HS1 A;  5IM9 A;  1XVW A;  2NTO A;  2FWG A;  4I6X A;  3IHQ A;  2R2J A;  3LOR A;  4G0K A;  1JZO A;  3BD2 A;  2ES7 A;  2LTK A;  3I9V 2;  1GSE A;  4OWY A;  1UN2 A;  2E7P A;  5CO3 A;  3I69 A;  3ZVJ A;  3RHB A;  5J9B A;  3SWL A;  3LQ7 A;  1K0B A;  2C0E A;  3IAS 2;  3EC3 A;  1YDK A;  2CAI A;  2HSN B;  2IFQ A;  4HZ4 A;  3WD6 A;  1K3L A;  1E6B A;  1J9B A;  1XW6 A;  2N5B A;  2BJX A;  2AHE A;  5AN1 A;  3MNG A;  2GSS A;  1VF4 A;  3NZN A;  1OYJ A;  3AY8 A;  4OCE A;  2HRF A;  4ML1 A;  4FO5 A;  3IDV A;  5D8I A;  1SK0 A;  1QK8 A;  3HVV A;  4KDU A;  5H5S A;  4TR0 A;  3TKQ A;  2H75 A;  4ML6 A;  2FY6 A;  2R6K A;  1M99 A;  5EPF A;  2AB6 A;  4TR1 B;  2B7J A;  3DVW A;  3TJK A;  3Q19 A;  2H0I A;  3WYW A;  1ZYE A;  2FWH A;  2VUP A;  2X64 A;  4K0N A;  4KCE A;  2VCW A;  1PGT A;  4HI7 A;  1PMT A;  4TRX A;  4WXT A;  3GX8 A;  3RHC A;  3F6F A;  2FUG 2;  2F51 A;  3F4R A;  2HSM A;  5IO2 A;  4GTU A;  1XZO A;  2CVK A;  1OC3 A;  3MDK A;  4BVX A;  4KW6 A;  2TRX A;  2DJ2 A;  2GGT A;  1PKW A;  2VCV A;  1WIK A;  2JZR A;  4DSS A;  4YQV A;  2L6D A;  3MSZ A;  1R4W A;  4N11 A;  5IMV A;  2ZUP A;  3C1R A;  4EF0 A;  4IJI A;  3KD0 A;  3FEU A;  4WF5 A;  4ZL7 A;  1GSS A;  16GS A;  3NOF A;  3H93 A;  3L9S A;  5FWG A;  5IOW A;  3M9K A;  4MA9 A;  1YY7 A;  3W8S A;  3ZVJ D;  4ZBD A;  3F6D A;  1MD3 A;  2WDU A;  3DKS A;  1SKW B;  4KAE A;  3FYG A;  1B9Y C;  1O8W A;  2MMN A;  2VL3 A;  3EU4 A;  2A4V A;  2CZ3 A;  4HUA A;  3ZIV A;  4EDY A;  4FYC A;  1FB6 A;  5CRE A;  1OKT A;  1G0T A;  3KTB A;  4IJ3 A;  5GZZ B;  2K8V A;  2O85 A;  5IMA A;  1K3O A;  4ECB A;  1ERT A;  1V98 A;  1V2A A;  2CQ9 A;  2H70 A;  2VLT A;  3HJO A;  4L5L A;  4K2D A;  3UBK A;  2B5Y A;  4G0L A;  5FHI A;  2RLI A;  3TB2 A;  2JZT A;  4O7H A;  2FHE A;  3J7Y k;  2YV9 A;  2WRT A;  2L59 A;  2FWE A;  1CQG A;  2GS3 A;  2YWM A;  3F63 A;  1K3Y A;  3GSS A;  1I5G A;  3C71 A;  3I6A A;  3GL5 A;  10GS A;  5FT3 A;  4TR3 A;  4OD7 A;  1U3I A;  1J0F A;  3GIX A;  4KUN A;  3F0I A;  3ERF A;  1GSD A;  3LG6 A;  3KM6 A;  4PUF C;  1GRX A;  4Z7X A;  3R2Q A;  3H79 A;  2P5R A;  4TKY A;  5GST A;  4XHM A;  3DYR A;  4Q5F A;  4ISD A;  2WUL A;  3G7I A;  9GSS A;  1ZMA A;  2H1B A;  4NXI A;  4MF6 A;  4JR4 A;  4L8E A;  3P7X A;  4HJ2 A;  1A24 A;  2H6X A;  4WF4 A;  5B8B A;  1SL0 B;  4G9H A;  5DQY A;  1F2E A;  4OMV A;  4V2L A;  1OVN A;  1U6T A;  5ID2 A;  4BA7 A;  1GWC A;  5E59 A;  2H1A A;  5G5E A;  2HRK B;  5JCU A;  1IYI A;  4KE3 A;  2IPA A;  3DVX A;  1GTB A;  1X5C A;  1SJZ A;  1PKZ A;  1WPI A;  4JU5 A;  3CBU A;  1YKA A;  2GDR A;  1T4Y A;  5JWO B;  1EV9 A;  3EUR A;  1F6M C;  1FAA A;  4YQM A;  3WGD A;  1SYR A;  2AV4 A;  2M46 A;  1MTC A;  2XBI A;  2HNL A;  4ZIL A;  1YF0 A;  3KMO A;  1TU8 A;  4JE1 A;  4N30 A;  4TR4 A;  2P5Q A;  4MJE A;  2R37 A;  4QL7 A;  4GXZ A;  3VLN A;  4MF7 A;  7GSS A;  1K0M A;  3ZL5 A;  5IPG A;  3EVI A;  1GNW A;  3F3R A;  2JAC A;  4G10 A;  1YF1 A;  3LGC A;  1M2B A;  2MZC A;  1C72 A;  1EP7 A;  1ZCP A;  3TCO A;  3CRT A;  4PUR A;  2VCZ A;  4I2U A;  2REM A;  4KDY A;  2LRC A;  3GKN A;  2GT6 A;  2KLX A;  2HE3 A;  4EL1 A;  3GUR A;  5B6M A;  2OKA A;  3ZRD A;  3UAP A;  1TOF A;  2GZY A;  4KA0 A;  2F8A A;  3GN3 A;  4MLY A;  1GLP A;  2LJK A;  3HVX A;  5INY A;  2DLX A;  2VIM A;  3UEM A;  1WJK A;  2PBJ A;  1SYX A;  3ZIT A;  3O76 A;  5KEJ A;  2LRN A;  1F37 A;  1ZOF A;  2DJ3 A;  3SBC A;  1JZD A;  3QFB C;  6GSY A;  2HFD A;  1KNG A;  1PSQ A;  4YH2 A;  3IR4 A;  3QMX A;  1TI3 A;  4IHU A;  5ENU A;  1F9M A;  3I43 A;  5DBQ A;  4K7I A;  5A4U A;  5D9X A;  4FQU A;  2RUE A;  2AUV A;  4OFN A;  1EV4 A;  4IEL A;  5HFI A;  3TDG A;  1WE0 A;  2V41 A;  1FVK A;  2X8C A;  4J56 E;  5E4W A;  5H5Q A;  1XFL A;  5CRW A;  5ECL B;  5EVO A;  2IFQ B;  1GSF A;  2LQO A;  4WR4 A;  3GNJ A;  5D9W A;  1SEN A;  5EY6 A;  5ECR B;  3G7J A;  2KHP A;  1URM A;  1SD8 A;  2B5X A;  2DBC A;  3L78 A;  1KBN A;  2HSH A;  1G7O A;  4MDC A;  1XWK A;  3U6V A;  1X9S B;  2GLR A;  5AIV A;  1ST9 A;  3UL3 A;  3GV1 A;  2O87 A;  1A2L A;  4Q5Q A;  4MJA A;  6GSX A;  3FRC A;  2H8L A;  5CAX A;  2H0G A;  1ZGN A;  1IYH A;  1R26 A;  3L4N A;  1T00 A;  3LJR A;  4IKH A;  2D2Z A;  2LUS A;  1O73 A;  2IWT A;  1Y25 A;  3IK9 A;  1Z7R A;  3BOA A;  1G6W A;  1KEB A;  4WET A;  4F03 A;  2IN3 A;  2HSM B;  4IVF A;  2H72 A;  4BVX B;  2IJY A;  1CQH A;  1KTE A;  2PPT A;  4DSS B;  17GS A;  1TDI A;  5DJL A;  2C8U A;  4GSN A;  1AW9 A;  2WFC A;  2FA8 A;  4ECI A;  4EKZ A;  1A8L A;  3BJ5 A;  3QPM A;  2LKU A;  5KN0 A;  2C3Q A;  2HSY A;  3EYT A;  3G9B A;  1TP9 A;  3QCP A;  3UMA A;  4MH2 A;  2I81 A;  2NBS A;  3QOU A;  2PMT A;  4MZW A;  1ILO A;  4YAV A;  1A2J A;  2PVO C;  4KGI A;  3VI7 A;  1EZK A;  22GS A;  1X9W B;  4MAB A;  4ZB8 A;  4GF0 A;  3KJY A;  4ZB9 A;  2C3N A;  3Q18 A;  1A0R P;  4JRR A;  5CNW A;  5CP1 A;  5B7C A;  2VM1 A;  2LJR A;  3FY7 A;  1HNA A;  3S9F A;  4G2E A;  2OJL A;  3ZZX A;  1GUK A;  3CTF A;  4FH8 A;  3W8J A;  3HYP A;  4TN8 A;  1XVQ A;  2K6V A;  1U87 A;  4IP1 A;  1QUW A;  5DAL A;  4MCU A;  4X0X A;  1Q4J A;  4LMV A;  3EU3 A;  4IQA A;  4O5R A;  4JBB A;  4KSO A;  4HJM A;  2YNX A;  4POK A;  4IW9 A;  3TKS A;  3LWA A;  2TIR A;  5AGY A;  3RBT A;  2K8S A;  4LLR A;  4FIW A;  5B6N A;  3IC8 A;  2DSA A;  1HYU A;  1JHB A;  4F9Z A;  11GS A;  3VI5 A;  1PRX A;  2BTO T;  1TI1 A;  4ECJ A;  3QAG A;  2MMZ A;  5GAN D;  1GLQ A;  3LYK A;  8GSS A;  2OBK A;  4RUV A;  4O32 A;  4JR6 A;  5ID2 B;  1H75 A;  1M2D A;  2IL3 A;  4WBR D;  5GSS A;  3F4T A;  4EDZ A;  4GRF A;  3LEF A;  3RAZ A;  1DSB A;  5ECN B;  3FW2 A;  2EIO A;  1XW5 A;  1O85 A;  2OAC A;  4I8B A;  3KTL A;  3PIN A;  4N0Z A;  4TVE A;  3CYN A;  4P3Y B;  5JCW A;  1XWC A;  1F3B A;  5DCH A;  3VK9 A;  3O3T A;  1TRV A;  5F0G A;  5KN3 A;  1SL2 B;  3PR8 A;  2X8H A;  4MH3 A;  1ERW A;  3TKS C;  4XS4 A;  2ON7 A;  2GQK A;  5HR3 A;  3M3M A;  2GSR A;  3KP8 A;  3HCZ A;  2H1G A;  1GUH A;  4X1U A;  2L57 A;  3GST A;  3UIW A;  1O7U A;  6GST A;  2VM2 A;  4PQI A;  1TXX A;  2OA7 A;  1FG4 A;  3D22 A;  1T1V A;  3LFL A;  2K9F A;  2VAF A;  5KN1 A;  3HJM A;  2J9H A;  1GH2 A;  4HQS A;  2PU9 C;  5LNK e;  2XBQ A;  4DSQ A;  4RQR A;  4DSR A;  3UBL A;  4N0V A;  3EMP A;  3C7M A;  2WGR A;  4X43 A;  2H73 A;  1OC9 A;  2UZ8 A;  2YWO A;  3CSH A;  1UC7 A;  5G5F A;  2G2Q A;  1BJX A;  4PGT A;  2PVQ A;  1THO A;  1K0N A;  1YEP A;  4ZL8 A;  2CVB A;  4WR5 A;  4PTS A;  2JAD A;  4NPB A;  1EGR A;  2NVL A;  2JSZ A;  3A3T A;  4OO5 A;  2KUC A;  2WJU A;  19GS A;  3H8Q A;  4AGS A;  4LA1 A;  5GAP D;  5JWQ B;  4MPF A;  3APS A;  4ACS A;  3KIJ A;  2R4V A;  2QGV A;  3WT2 A;  2MYG A;  1TJD A;  3ME7 A;  1SKS B;  3APO A;  2WS2 A;  4KCA A;  5IMD A;  2V6O A;  1EOH A;  1ON4 A;  3F8U A;  2IME A;  5ECM B;  4V2M A;  3WGE A;  2DC5 A;  4J2F A;  1AC1 A;  3HDC A;  1B4Q A;  3D21 A;  2HYX A;  1Z9H A;  3C73 A;  1B4P A;  4TXO A;  4EO3 A;  1XXU A;  2LEG A;  3CRU A;  3QFA C;  4HOJ A;  3TRP A;  4PX1 A;  4NHW A;  4CW9 A;  1YKC A;  5IO0 A;  1U88 A;  3IV4 A;  3U5R E;  4MZB A;  3LYP A;  1SD9 A;  4XRD A;  2I1U A;  3UVT A;  1XOA A;  2WCI A;  1FB0 A;  2FLS A;  3TRQ A;  3UJ1 A;  5G1K A;  4XIH A;  1F3A A;  3WGX A;  3FZA A;  1BG5 A;  3QDN A;  1GSY A;  2XPD A;  3M0F A;  2B1K A;  4BWQ A;  1GTI A;  1TK5 B;  2C0F A;  2K18 A;  2YAN A;  3DIE A;  2B7K A;  1OE8 A;  3EMX A;  2LS5 A;  2YP6 A;  2IMD A;  3H1N A;  1S3D A;  2V1M A;  1WRY A;  1EEJ A;  1AIU A;  2VD1 A;  2VO4 A;  3RDW A;  4WKW A;  1QGV A;  3GHA A;  5F06 A;  3FR3 A;  1X5E A;  2VL2 A;  4IN0 A;  3DWV A;  2YN1 A;  2HZF A;  4TOP A;  2B3S A;  5DCG A;  3D4M A;  4PQ1 A;  1YQ1 A;  2KOK A;  3ZRE A;  2X8G A;  2LJA A;  5AIX A;  3GX0 A;  2VLV A;  4GST A;  4KH7 A;  1XPV A;  2DIY A;  1Z6M A;  4K0G A;  3A2V A;  4JZQ A;  1TK8 B;  4WEY A;  2HQT A;  3FK8 A;  1QXH A;  3FZ5 A;  1VRS D;  4DEJ A;  3HHV A;  4AF2 A;  1B48 A;  4IGJ A;  3Q6O A;  1ACV A;  2IMI A;  2GSQ A;  1PX7 A;  2VD0 A;  3GA4 A;  3VWV A;  3D6I A;  3PH9 A;  3VPQ A;  4BVY A;  1GL8 A;  1MD4 A;  4MF5 A;  2L5O A;  3BCI A;  4XTS A;  2L6C A;  5DAL B;  4LL1 B;  3LXT A;  1XWB A;  3TRX A;  1OE7 A;  1SL1 B;  2VL2 C;  1GP1 A;  4BPY A;  2LST A;  4ZBA A;  4PUA A;  2E0Q A;  2ZNM A;  1O6J A;  1A0F A;  1HNB A;  1EEM A;  1OKD A;  2YJH A;  2O8V B;  2GZP A;  2G0F A;  3RPP A;  3ZTL A;  4EUY A;  2QC7 A;  3DXB A;  3HZ8 A;  1AQW A;  2C0G A;  12GS A;  1DUG A;  3GTU A;  2J23 A;  3IXR A;  2LRT A;  4NV5 A;  6GSS A;  1V58 A;  3DEX A;  4XS1 A;  4JED A;  4PQH A;  5DDL A;  4L5O A;  4BL7 A;  3L9V A;  2PWJ A;  1TK0 B;  1WWJ A;  3K8N A;  4AJ7 A;  4L0W A;  3E3E A;  2IIY A;  2OBI A;  1V9W A;  1AQV A;  2X99 A;  1PA3 A;  4YAP A;  1DE2 A;  4IQ1 A;  3F4S A;  4XS4 B;  2JL4 A;  2VL9 A;  1X5D A;  3FZ9 A;  3MAK A;  1Z3E A;  5C00 A;  2EIQ A;  3L9U A;  2RM5 A;  5DQS A;  1HD2 A;  3HD5 A;  4F0C A;  1T3B A;  2FA4 A;  3C1S A;  4ZL9 A;  2YZU A;  1K0A A;  4WBJ A;  2JZS A;  1BYE A;  1TU7 A;  2YJ7 A;  2HZE A;  2V32 A;  2OE0 A;  1WOU A;  3DGQ A;  3APQ A;  2LV3 A;  1XWG A;  1FOV A;  2R5G A;  1G6Y A;  2DJ0 A;  3Q74 A;  5ECQ B;  1TW9 A;  2RUF A;  5ELA A;  4XRA A;  2VCX A;  2C1Y A;  1BQ7 A;  1H4O A;  4TW5 A;  3D4T A;  1OC9 B;  4D73 A;  5ECS A;  4K8M A;  1SJI A;  5G1L A;  4YQU A;  3HXS A;  3VUR A;  1XCC A;  1N8J A;  3ZFB A;  1Q98 A;  4MPG A;  5J3R A;  1R5A A;  3GH6 A;  4OFT A;  2PGT A;  3F9U A;  3ISO A;  1PL2 A;  4MZC A;  3KMN A;  2A2R A;  1M2A A;  3WT1 A;  4HU9 A;  2OAD A;  3IK7 A;  3BBY A;  1K0D A;  4POB A;  2F3M A;  1O81 A;  1NSW A;  4K7O A;  1OC8 A;  5HFK A;  1XWA A;  2PER A;  3BCK A;  5DJM A;  4GLT A;  5J9C A;  1AXD A;  5CRG A;  3GKX A;  2C4J A;  1ML6 A;  1LJR A;  3HJP A;  4PXO A;  5IMZ A;  3CMI A;  5A5K A;  4EXJ A;  1RW1 A;  4KSM A;  4TXO B;  1W89 A;  5HR1 A;  5JWR B;  3KH7 A;  2V2G A;  4K7N A;  2AYT A;  1NHO A;  4G19 A;  1UA5 A;  1M9B A;  1T8E B;  2V6K A;  1B8X A;  3TKS E;  4DVC A;  1ZL9 A;  3ZML A;  1S3A A;  4TXV A;  5D9T A;  1G7E A;  1XBS A;  2HRA A;  2B6M A;  4CDO A;  20GS A;  2O89 A;  4GCI A;  3TOU A;  1OAZ A;  5D96 A;  3TOT A;  2MBS A;  1MDK A;  2CX3 A;  1U3A A;  1EP8 A;  3TUE A;  1WP0 A;  2GQL A;  4K9Z A;  14GS A;  2AJQ B;  3UAR A;  3KH9 A;  3ERG A;  1PL1 A;  4F0B A;  1SU9 A;  3CSJ A;  4Q5N A;  3GKK A;  1PX6 A;  1NHY A;  3PGT A;  3CSI A;  1V40 A;  1HQO A;  4ZXG A;  4MK3 A;  3KCM A;  2XC2 A;  2R3X A;  1JFU A;  4ZIJ A;  5DAK A;  5ECI B;  2QSI A;  4O92 A;  2H0H A;  3HA9 A;  2EC4 A;  1YJ6 A;  3IAM 2;  1SK1 A;  5F07 A;  3TJB A;  2CT6 A;  1MDI A;  4H86 A;  2P0G A;  4PNF A;  2IMF A;  2H6Z A;  2HLS A;  4Q5R A;  1SKR B;  3HY2 A;  1A23 A;  2F8F A;  6GSV A;  2FGX A;  4I2T A;  5BMU A;  2I3Y A;  4MJB A;  1AAZ A;  2XHF A;  4FYU A;  5D73 A;  3N9J A;  4K1F A;  1O8X A;  1BX9 A;  2AAW A;  1W4V A;  2OE3 A;  4V1A g;  3LSZ A;  3J7Y b;  2VOC A;  4V1A p;  3G7Y A;  2YWN A;  3P8W A;  3JCM L;  5IQY A;  4GQF A;  3DD3 A;  1AQX A;  5J5N A;  4CHS A;  1JLV A;  3GL3 A;  4IBP A;  5ABR A;  2ON5 A;  3QAW A;  4GSS A;  2C80 A;  4BVY B;  2QKE A;  5A4W A;  3W6G A;  4POM A;  3ERW A;  4J57 E;  2CAQ A;  2LNS A;  5C04 A;  3IOS A;  1LBK A;  3M8N A;  1YZX A;  3KP9 A;  2BMX A;  5HR0 A;  4XS6 A;  2YV7 A;  3MWH A;  3FKF A;  1K0C A;  2TRC P;  2C3T A;  1BED A;  1JZW A;  2CV4 A;  3PPU A;  3ZMK A;  1T4Z A;  3LXZ A;  4HDE A;  5LCZ A;  5HFG A;  2MMO A;  1FVJ A;  2VLU A;  1JZR A;  2GVP A;  4ZBB A;  5G2Z A;  4EVM A;  5L71 A;  1S3C A;  1GSQ A;  4ECC A;  5CYY A;  3GTU B;  1X9M B;  2PUK C; 
#chains in the Genus database with same CATH topology
 4I5Q A;  2A2P A;  3QR6 A;  2PN8 A;  3KXO A;  5D93 A;  1SJ6 A;  3UOM A;  4MP4 A;  5CRD A;  5F05 A;  1GTA A;  2F9S A;  2GTU A;  2RM6 A;  2RII A;  4FYB A;  1EGO A;  2I9H A;  4BL7 B;  3RFR C;  1MEK A;  2M72 A;  4E8H A;  1XOB A;  1TTZ A;  2HSN A;  4OFM A;  1ZZY A;  2C0D A;  1PQN A;  1AUC A;  2N5A A;  1N2A A;  4N10 A;  1Z6N A;  3HVS A;  1GUM A;  3C8E A;  2YOI A;  1VF3 A;  5IOX A;  1M3J A;  4ID0 A;  2WZ9 A;  3D5J A;  3O6T A;  4KX4 A;  3QAV A;  4I97 A;  4NMU A;  1X0R A;  3VFI A;  3TJF A;  3GFK A;  4NAX A;  4TR1 A;  3VWW A;  2A2S A;  4ILF A;  4KF9 A;  1THX A;  4MJC A;  1B9X C;  4PI2 C;  3D0Z A;  1XW9 A;  1M7T A;  3CXG A;  4E8E A;  1I9D A;  2HZE B;  4RI7 A;  2E2M A;  1Z5Y E;  4AJ6 A;  3FHK A;  4KND A;  2L4Q A;  4QL9 A;  2YWI A;  3IE3 A;  1VF1 A;  3CHX C;  3VWU A;  2ZCT A;  1SK2 A;  4EC0 A;  1FW1 A;  1E2Y A;  1QQ2 A;  2DJ1 A;  2M80 A;  2B5E A;  3HMJ G;  2H6Y A;  1ZYN A;  1DE1 A;  3GKM A;  3FZ4 A;  2DMM A;  5IMF A;  4D73 B;  1A8Y A;  1A2M A;  3FR6 A;  2DJK A;  2EIR A;  2JU5 A;  2E2G A;  3DRN A;  2DJJ A;  3GUS A;  3ZIJ A;  2YPM A;  1FO5 A;  4G0I A;  4RQX A;  4POL A;  3TKP A;  2H71 A;  13GS A;  3KEB A;  1RK4 A;  4OO4 A;  5J4V A;  1HNC A;  3FR9 A;  4KDX A;  5JCG A;  1UVZ A;  5ECK B;  2DIZ A;  1LU4 A;  2R0C A;  2H66 A;  3E0U A;  3EIN A;  1BG1 A;  2I4A A;  2FNO A;  3QD9 A;  3NIV A;  2H1D A;  4IS0 A;  3HZ4 A;  5B8A A;  2B1L A;  1Z7P A;  3A5W A;  3ZYW A;  5HQP A;  3TGZ A;  4BWS A;  2GST A;  1BAY A;  2NDO A;  1T7P B;  2MMA A;  2LQQ A;  2O7K A;  3TKR A;  1TRW A;  1YEX A;  1PD2 1;  4NWY A;  5IPH A;  5HR2 A;  4F82 A;  3M1G A;  2WVX B;  1EOG A;  1USB A;  3TJG A;  1PN9 A;  3RPN A;  5J41 A;  1QMV A;  1GSU A;  3E9J B;  2L5L A;  3IPZ A;  3UVH A;  6GSU A;  2CA8 A;  2XPE A;  1R5P A;  4IP6 A;  4LL4 B;  1Y6E A;  2KP2 A;  2YZH A;  3P90 A;  3IRA A;  2VCQ A;  3F3Q A;  3EE2 A;  1XIY A;  3US3 A;  1FOH A;  1R7H A;  1GNE A;  1ZYQ B;  1GUL A;  1VF2 A;  4K6X A;  2HRN A;  1WMJ A;  4L0U A;  4OCF A;  3R3E A;  2GQM A;  1M0U A;  2LNT A;  3H4K A;  1YEW C;  5DVB A;  2HRK A;  5AIS A;  2ALB A;  3A5I A;  3KZQ A;  2MBT A;  1DBY A;  3GYK A;  4AJ8 A;  3OR5 A;  2NPB A;  5LD0 A;  2HT9 A;  5H5R A;  2L4C A;  1VGL A;  5EL8 A;  2H76 A;  2GT5 A;  3KGK A;  2CVD A;  1Y1U A;  1ERV A;  2IMK A;  3EPT A;  4ULX A;  5G31 A;  3IBH A;  4GWR A;  1K0O A;  3V1W A;  2KP1 A;  2CX4 A;  5DAK B;  2FD3 A;  1SVM A;  4HU7 A;  18GS A;  5ELG A;  4V2N A;  2N5F A;  5ECH B;  5KN2 A;  3VPT A;  2WB9 A;  1EWX A;  1NW2 A;  3HKR A;  5BMU B;  2H19 A;  4K5R A;  1GTU A;  2Z9S A;  2H01 A;  1J08 A;  3A2X A;  5D9V A;  4HZ2 A;  2FCH A;  3M9J A;  2OE1 A;  2HXK A;  1RQM A;  3IA1 A;  4NV2 A;  3ZFL A;  1TKD B;  4HSC X;  1V57 A;  5COH A;  5G30 A;  4PNG A;  3VWX A;  2H74 A;  5CRH A;  6GSW A;  1FHE A;  3N5O A;  3L0H A;  4KB3 A;  5F8B A;  4HQZ A;  4NHZ A;  4ZB6 A;  2CZ2 A;  3CTG A;  3A2W A;  5IMC A;  3DML A;  2HI7 A;  2H30 A;  4EE0 A;  5J4U A;  3GMF A;  5ECP B;  3ED3 A;  2YCD A;  1XG8 A;  2P31 A;  4XCS A;  3GRX A;  3IC4 A;  2DML A;  2GZZ A;  1ERU A;  2FWF A;  3ME8 A;  3P2A A;  4USS A;  1ABA A;  3EWL A;  4GQC A;  1M9A A;  1QFN A;  5IIZ A;  3TJJ A;  4MMM A;  4LMW A;  4QQ7 A;  5A4V A;  3GH9 A;  4RI6 A;  1MDJ A;  4HEA 2;  2VCT A;  1NM3 A;  1TRU A;  1TRS A;  5ECO B;  4F2I A;  2JSY A;  3ZLP A;  1JLW A;  4HS1 A;  5IM9 A;  1XVW A;  2NTO A;  2FWG A;  4I6X A;  3IHQ A;  2R2J A;  3LOR A;  4G0K A;  1JZO A;  3BD2 A;  2ES7 A;  2LTK A;  3I9V 2;  1GSE A;  4ICY A;  4OWY A;  1UN2 A;  2E7P A;  5CO3 A;  3I69 A;  3ZVJ A;  3RHB A;  5J9B A;  3SWL A;  3LQ7 A;  4YKG A;  1K0B A;  2C0E A;  3IAS 2;  3EC3 A;  1YDK A;  2CAI A;  2HSN B;  2IFQ A;  4HZ4 A;  3WD6 A;  1K3L A;  1E6B A;  1J9B A;  1XW6 A;  2N5B A;  2BJX A;  2AHE A;  5AN1 A;  2DKI A;  3MNG A;  2GSS A;  1VF4 A;  3NZN A;  1OYJ A;  3AY8 A;  4OCE A;  2HRF A;  4ML1 A;  4FO5 A;  3IDV A;  5D8I A;  1SK0 A;  1QK8 A;  3HVV A;  4KDU A;  5H5S A;  4TR0 A;  3TKQ A;  2H75 A;  4ML6 A;  2FY6 A;  2R6K A;  1M99 A;  5EPF A;  5KOW A;  2AB6 A;  4TR1 B;  2B7J A;  3DVW A;  3TJK A;  3Q19 A;  2H0I A;  3WYW A;  1ZYE A;  2FWH A;  2VUP A;  2X64 A;  4K0N A;  4KCE A;  2VCW A;  1PGT A;  4HI7 A;  1PMT A;  4PHZ C;  4TRX A;  4WXT A;  3GX8 A;  3RHC A;  3F6F A;  2FUG 2;  2F51 A;  3F4R A;  2HSM A;  4EIP A;  5IO2 A;  4GTU A;  1XZO A;  2CVK A;  1OC3 A;  3MDK A;  4BVX A;  4KW6 A;  2TRX A;  2DJ2 A;  2GGT A;  1PKW A;  2VCV A;  1WIK A;  2JZR A;  4DSS A;  4YQV A;  2L6D A;  3MSZ A;  1R4W A;  4N11 A;  5IMV A;  2ZUP A;  3C1R A;  4EF0 A;  4IJI A;  3KD0 A;  3FEU A;  4WF5 A;  4ZL7 A;  1GSS A;  16GS A;  3NOF A;  3H93 A;  3L9S A;  5FWG A;  5IOW A;  3M9K A;  4MA9 A;  1YY7 A;  3W8S A;  3ZVJ D;  4ZBD A;  3F6D A;  1MD3 A;  2WDU A;  3DKS A;  1SKW B;  4KAE A;  3FYG A;  1B9Y C;  1O8W A;  2MMN A;  2VL3 A;  3EU4 A;  2A4V A;  2CZ3 A;  4HUA A;  3ZIV A;  4EDY A;  4FYC A;  1FB6 A;  5CRE A;  1OKT A;  1G0T A;  3KTB A;  4IJ3 A;  5GZZ B;  2K8V A;  2O85 A;  5IMA A;  4AI6 A;  1K3O A;  4ECB A;  1ERT A;  1V98 A;  1V2A A;  1S4B P;  2VLT A;  2CQ9 A;  2H70 A;  3HJO A;  4L5L A;  2B5Y A;  3UBK A;  4K2D A;  4G0L A;  5FHI A;  2RLI A;  3TB2 A;  2JZT A;  4O7H A;  2FHE A;  3J7Y k;  2YV9 A;  2WRT A;  4Z2U A;  2L59 A;  2FWE A;  1CQG A;  2GS3 A;  3CQF A;  2YWM A;  3F63 A;  1K3Y A;  3GSS A;  1I5G A;  3C71 A;  3I6A A;  3GL5 A;  10GS A;  5FT3 A;  4TR3 A;  4OD7 A;  1U3I A;  1J0F A;  3GIX A;  4KUN A;  3F0I A;  3ERF A;  1GSD A;  3LG6 A;  3KM6 A;  5BRT A;  4PUF C;  1GRX A;  4Z7X A;  3R2Q A;  2X49 A;  3H79 A;  2P5R A;  4TKY A;  5GST A;  4XHM A;  3DYR A;  4Q5F A;  4ISD A;  2WUL A;  4AKX B;  3G7I A;  9GSS A;  1ZMA A;  2H1B A;  4NXI A;  4MF6 A;  4JR4 A;  4L8E A;  3P7X A;  4HJ2 A;  1A24 A;  2H6X A;  4WF4 A;  5B8B A;  2WZS A;  1SL0 B;  4G9H A;  5DQY A;  1F2E A;  4OMV A;  4V2L A;  1OVN A;  2WW1 A;  1U6T A;  5ID2 A;  4BA7 A;  1GWC A;  5E59 A;  2H1A A;  5G5E A;  2HRK B;  5JCU A;  1IYI A;  4KE3 A;  2IPA A;  3DVX A;  1GTB A;  1X5C A;  1SJZ A;  1PKZ A;  1WPI A;  4JU5 A;  1N25 A;  3CBU A;  1YKA A;  2GDR A;  1T4Y A;  5JWO B;  1EV9 A;  3EUR A;  4AKH A;  1F6M C;  1FAA A;  4YQM A;  3WGD A;  1SYR A;  2AV4 A;  2M46 A;  1MTC A;  2XBI A;  2HNL A;  4ZIL A;  1YF0 A;  3KMO A;  1TU8 A;  4JE1 A;  4N30 A;  4TR4 A;  2P5Q A;  4MJE A;  2R37 A;  4QL7 A;  4GXZ A;  3VLN A;  4MF7 A;  7GSS A;  1K0M A;  3ZL5 A;  5IPG A;  3EVI A;  1GNW A;  2R0P A;  3F3R A;  2JAC A;  4G10 A;  1YF1 A;  3LGC A;  1M2B A;  2MZC A;  1C72 A;  1EP7 A;  2EFH A;  2VKZ G;  1ZCP A;  3RGB C;  3TCO A;  3CRT A;  4PUR A;  2VCZ A;  4I2U A;  2REM A;  4KDY A;  2LRC A;  3GKN A;  2GT6 A;  2KLX A;  4MNN A;  2HE3 A;  4EL1 A;  3GUR A;  5B6M A;  2OKA A;  3ZRD A;  5J40 A;  3UAP A;  1TOF A;  2GZY A;  4KA0 A;  2F8A A;  3GN3 A;  4MLY A;  1GLP A;  2LJK A;  3HVX A;  4YKF A;  5INY A;  2DLX A;  2VIM A;  3UEM A;  1WJK A;  2PBJ A;  1SYX A;  3ZIT A;  1M3I A;  3O76 A;  5KEJ A;  2LRN A;  1F37 A;  1ZOF A;  2DJ3 A;  3SBC A;  1JZD A;  3QFB C;  6GSY A;  2HFD A;  1KNG A;  1PSQ A;  4YH2 A;  3IR4 A;  3QMX A;  1TI3 A;  4IHU A;  5ENU A;  1F9M A;  3I43 A;  5DBQ A;  5A4U A;  3FMW A;  4K7I A;  5D9X A;  4FQU A;  2RUE A;  2AUV A;  4OFN A;  1EV4 A;  4IEL A;  5HFI A;  3TDG A;  1WE0 A;  2V41 A;  1FVK A;  2X8C A;  4J56 E;  5E4W A;  5H5Q A;  1XFL A;  5CRW A;  5ECL B;  5EVO A;  2IFQ B;  1GSF A;  4W66 A;  2LQO A;  4WR4 A;  3GNJ A;  5D9W A;  1SEN A;  5EY6 A;  5ECR B;  3G7J A;  1TXU A;  1URM A;  2KHP A;  1SD8 A;  2B5X A;  2DBC A;  3L78 A;  1KBN A;  2HSH A;  1G7O A;  4MDC A;  1XWK A;  3U6V A;  2UV8 G;  1X9S B;  2GLR A;  5AIV A;  1ST9 A;  3UL3 A;  3GV1 A;  2O87 A;  1A2L A;  4Q5Q A;  4AKI A;  4MJA A;  6GSX A;  3FRC A;  2H8L A;  5CAX A;  2H0G A;  1ZGN A;  1IYH A;  1R26 A;  3L4N A;  1T00 A;  3LJR A;  4IKH A;  2D2Z A;  5A5H A;  2LUS A;  2WW2 A;  1O73 A;  2IWT A;  1Y25 A;  3IK9 A;  4K2X A;  1Z7R A;  3BOA A;  1G6W A;  1KEB A;  4WET A;  4X4J A;  4F03 A;  2IN3 A;  2HSM B;  4IVF A;  3IHG A;  2H72 A;  4BVX B;  2IJY A;  1CQH A;  1KTE A;  2PPT A;  4DSS B;  17GS A;  1TDI A;  5DJL A;  2C8U A;  4GSN A;  1AW9 A;  2WFC A;  2FA8 A;  4ECI A;  4EKZ A;  1A8L A;  3BJ5 A;  3QPM A;  2LKU A;  5KN0 A;  2C3Q A;  2HSY A;  3MYD A;  3EYT A;  3G9B A;  1TP9 A;  3QCP A;  3UMA A;  4MH2 A;  2I81 A;  2NBS A;  3QOU A;  2PMT A;  4MZW A;  1ILO A;  4YAV A;  1A2J A;  2PVO C;  2X4A A;  4KGI A;  3VI7 A;  1EZK A;  22GS A;  1X9W B;  4MAB A;  5A34 A;  2WW3 A;  4ZB8 A;  4GF0 A;  4O5U A;  3KJY A;  4ZB9 A;  2C3N A;  3Q18 A;  1A0R P;  4JRR A;  5CNW A;  5CP1 A;  5B7C A;  2VM1 A;  2LJR A;  3FY7 A;  1HNA A;  3S9F A;  4G2E A;  2OJL A;  3ZZX A;  1GUK A;  3CTF A;  4FH8 A;  3W8J A;  3HYP A;  4TN8 A;  1XVQ A;  2K6V A;  1U87 A;  4IP1 A;  1QUW A;  5DAL A;  4MCU A;  4X0X A;  1Q4J A;  4LMV A;  3EU3 A;  4IQA A;  4O5R A;  4JBB A;  4KSO A;  4HJM A;  2DKH A;  2YNX A;  4POK A;  4IW9 A;  3TKS A;  3LWA A;  2TIR A;  5AGY A;  3RBT A;  2K8S A;  4LLR A;  4FIW A;  5B6N A;  3IC8 A;  2DSA A;  1HYU A;  1JHB A;  4F9Z A;  11GS A;  3VI5 A;  1PRX A;  2BTO T;  1TI1 A;  4ECJ A;  3QAG A;  2MMZ A;  5GAN D;  1GLQ A;  3LYK A;  8GSS A;  2OBK A;  4RUV A;  4O32 A;  5A1N A;  4JR6 A;  5ID2 B;  1H75 A;  4Z2R A;  1M2D A;  2IL3 A;  4WBR D;  5GSS A;  3F4T A;  4EDZ A;  4GRF A;  3LEF A;  3RAZ A;  1DSB A;  5ECN B;  4CY8 A;  2WVY A;  3FW2 A;  2EIO A;  1XW5 A;  1O85 A;  2OAC A;  4I8B A;  3KTL A;  3PIN A;  4N0Z A;  4TVE A;  3CYN A;  4P3Y B;  5JCW A;  1XWC A;  1F3B A;  5DCH A;  3VK9 A;  3O3T A;  2OT3 A;  1TRV A;  5F0G A;  5KN3 A;  2A4H A;  1SL2 B;  3PR8 A;  2X8H A;  4MH3 A;  1ERW A;  3TKS C;  4XS4 A;  2ON7 A;  2GQK A;  5HR3 A;  3M3M A;  2GSR A;  3KP8 A;  3HCZ A;  2H1G A;  1GUH A;  4X1U A;  2L57 A;  3GST A;  3UIW A;  1O7U A;  6GST A;  2VM2 A;  1PN0 A;  4PQI A;  1PFO A;  1TXX A;  2OA7 A;  1FG4 A;  3LW9 A;  3D22 A;  1T1V A;  3LFL A;  2K9F A;  2VAF A;  5KN1 A;  3HJM A;  2J9H A;  1GH2 A;  4HQS A;  2PU9 C;  5LNK e;  2XBQ A;  4DSQ A;  4RQR A;  4DSR A;  3UBL A;  4N0V A;  3EMP A;  3C7M A;  2WGR A;  4X43 A;  2H73 A;  1OC9 A;  2UZ8 A;  2YWO A;  3CSH A;  1UC7 A;  2EFC A;  5G5F A;  2G2Q A;  1BJX A;  4PGT A;  2PVQ A;  1THO A;  1K0N A;  1YEP A;  4ZL8 A;  2CVB A;  4WR5 A;  4PTS A;  2JAD A;  4NPB A;  1EGR A;  2NVL A;  2JSZ A;  3A3T A;  4OO5 A;  2KUC A;  2WJU A;  19GS A;  3H8Q A;  4AGS A;  4LA1 A;  5GAP D;  3CWG A;  5JWQ B;  4MPF A;  3APS A;  4ACS A;  3KIJ A;  2R4V A;  2QGV A;  3WT2 A;  2MYG A;  1TJD A;  3ME7 A;  1SKS B;  3APO A;  2WS2 A;  4KCA A;  5IMD A;  2V6O A;  1EOH A;  1ON4 A;  3F8U A;  2IME A;  5ECM B;  4QMK A;  4V2M A;  4EIQ A;  5J4Y A;  3WGE A;  2DC5 A;  4J2F A;  1AC1 A;  2WVZ A;  3HDC A;  1B4Q A;  3D21 A;  4GDF A;  2HYX A;  1Z9H A;  3C73 A;  1B4P A;  4TXO A;  4EO3 A;  1XXU A;  2LEG A;  3CRU A;  3QFA C;  4HOJ A;  3TRP A;  4PX1 A;  4NHW A;  4CW9 A;  1YKC A;  5IO0 A;  1U88 A;  3IV4 A;  3U5R E;  4MZB A;  3LYP A;  2QA2 A;  1SD9 A;  4XRD A;  2I1U A;  3UVT A;  1XOA A;  2WCI A;  1FB0 A;  2FLS A;  3TRQ A;  3UJ1 A;  5G1K A;  4XIH A;  1F3A A;  1I1I P;  3WGX A;  3FZA A;  1BG5 A;  3QDN A;  5A5H B;  1GSY A;  2XPD A;  3M0F A;  2B1K A;  4BWQ A;  1GTI A;  1TK5 B;  2C0F A;  2K18 A;  2QA1 A;  2YAN A;  3DIE A;  2B7K A;  1OE8 A;  3EMX A;  2LS5 A;  2YP6 A;  2IMD A;  3MIX A;  3H1N A;  1S3D A;  2V1M A;  1WRY A;  1EEJ A;  1AIU A;  2VD1 A;  2VO4 A;  3RDW A;  4WKW A;  1QGV A;  3GHA A;  5F06 A;  3FR3 A;  1X5E A;  2VL2 A;  4IN0 A;  3DWV A;  3HVN A;  2YN1 A;  2HZF A;  4TOP A;  2B3S A;  5DCG A;  3D4M A;  4ZB7 A;  4PQ1 A;  1YQ1 A;  2KOK A;  3ZRE A;  2X8G A;  2LJA A;  5AIX A;  3GX0 A;  2VLV A;  4GST A;  4KH7 A;  1XPV A;  2DIY A;  5A34 B;  1Z6M A;  4K0G A;  3A2V A;  4JZQ A;  1TK8 B;  2R0G A;  4WEY A;  2HQT A;  3FK8 A;  1QXH A;  3FZ5 A;  1VRS D;  4DEJ A;  3HHV A;  4AF2 A;  1B48 A;  4IGJ A;  4E68 A;  3Q6O A;  1ACV A;  2IMI A;  2GSQ A;  1PX7 A;  2VD0 A;  3GA4 A;  3VWV A;  3D6I A;  3VPQ A;  4BVY A;  3PH9 A;  1GL8 A;  1MD4 A;  4MF5 A;  2L5O A;  3BCI A;  4XTS A;  2L6C A;  5J47 A;  5DAL B;  4K5S A;  4LL1 B;  3LXT A;  1XWB A;  3TRX A;  1OE7 A;  1SL1 B;  2VL2 C;  1GP1 A;  4BPY A;  2LST A;  4ZBA A;  4PUA A;  2E0Q A;  2ZNM A;  1O6J A;  1A0F A;  1HNB A;  1EEM A;  1OKD A;  2YJH A;  2O8V B;  2GZP A;  2G0F A;  3RPP A;  3ZTL A;  4EUY A;  3TU3 B;  2QC7 A;  3DXB A;  3HZ8 A;  1AQW A;  2C0G A;  12GS A;  1DUG A;  5A1N B;  3GTU A;  2J23 A;  3IXR A;  2LRT A;  4NV5 A;  6GSS A;  1V58 A;  3DEX A;  4XS1 A;  4JED A;  4PQH A;  5DDL A;  4L5O A;  4BL7 A;  3L9V A;  2PWJ A;  1TK0 B;  1WWJ A;  3K8N A;  4AJ7 A;  2O36 A;  4L0W A;  3E3E A;  2IIY A;  2OBI A;  1V9W A;  1AQV A;  2X99 A;  1PA3 A;  4YAP A;  1DE2 A;  4IQ1 A;  4G01 A;  3F4S A;  2EFD A;  4XS4 B;  2JL4 A;  2VL9 A;  1X5D A;  3FZ9 A;  3MAK A;  1Z3E A;  5C00 A;  2EIQ A;  3L9U A;  2RM5 A;  5DQS A;  1HD2 A;  3HD5 A;  4F0C A;  1T3B A;  2FA4 A;  3C1S A;  4ZL9 A;  2YZU A;  1K0A A;  4WBJ A;  2JZS A;  1BYE A;  1TU7 A;  2YJ7 A;  2HZE A;  2V32 A;  2OE0 A;  1WOU A;  3DGQ A;  3APQ A;  2LV3 A;  1XWG A;  1FOV A;  2R5G A;  1G6Y A;  2DJ0 A;  3Q74 A;  4FXY P;  5ECQ B;  1TW9 A;  2RUF A;  5ELA A;  4XRA A;  2VCX A;  2C1Y A;  1BQ7 A;  1H4O A;  4TW5 A;  3D4T A;  1OC9 B;  4D73 A;  5ECS A;  4K8M A;  5KOX A;  1SJI A;  5G1L A;  4YQU A;  3HXS A;  3VUR A;  1XCC A;  1N8J A;  3ZFB A;  1Q98 A;  4MPG A;  5J3R A;  1R5A A;  3GH6 A;  4OFT A;  2PGT A;  3F9U A;  3ISO A;  1PL2 A;  2WW0 A;  4MZC A;  3KMN A;  2A2R A;  1M2A A;  3WT1 A;  4HU9 A;  2OAD A;  3IK7 A;  4PI0 C;  3BBY A;  1K0D A;  4POB A;  2F3M A;  1O81 A;  1NSW A;  4K7O A;  1OC8 A;  5HFK A;  1XWA A;  2PER A;  3BCK A;  5DJM A;  4GLT A;  5J9C A;  1AXD A;  5CRG A;  3GKX A;  2C4J A;  1ML6 A;  1LJR A;  3HJP A;  4PXO A;  5IMZ A;  3CMI A;  5A5K A;  4EXJ A;  1RW1 A;  4KSM A;  4TXO B;  1W89 A;  5HR1 A;  5JWR B;  3KH7 A;  2V2G A;  2WVX A;  4K7N A;  2AYT A;  1NHO A;  4G19 A;  1UA5 A;  1M9B A;  1T8E B;  2V6K A;  1B8X A;  3TKS E;  4DVC A;  1ZL9 A;  3ZML A;  2EFE A;  1S3A A;  4TXV A;  5D9T A;  1G7E A;  1XBS A;  2HRA A;  2B6M A;  4CDO A;  20GS A;  2O89 A;  4GCI A;  3TOU A;  1OAZ A;  4BIK A;  5D96 A;  3TOT A;  2MBS A;  1MDK A;  2CX3 A;  1U3A A;  1EP8 A;  3TUE A;  1WP0 A;  2GQL A;  4AKG A;  4K9Z A;  14GS A;  2AJQ B;  3UAR A;  3KH9 A;  3ERG A;  1SVL A;  1PL1 A;  4F0B A;  1SU9 A;  3CSJ A;  4Q5N A;  1BF5 A;  3GKK A;  1PX6 A;  1NHY A;  3PGT A;  3CSI A;  1V40 A;  1HQO A;  4ZXG A;  4MK3 A;  3KCM A;  2XC2 A;  2R3X A;  1YVL A;  1JFU A;  4Z2T A;  4ZIJ A;  5DAK A;  5ECI B;  2QSI A;  4O92 A;  2H0H A;  2O5V A;  3HA9 A;  2EC4 A;  1YJ6 A;  3IAM 2;  1SK1 A;  5F07 A;  3TJB A;  2CT6 A;  1MDI A;  4H86 A;  2P0G A;  1S3R A;  4PNF A;  2IMF A;  2H6Z A;  4N3Z A;  2HLS A;  4Q5R A;  1SKR B;  3HY2 A;  1A23 A;  4O5Q A;  2F8F A;  6GSV A;  2FGX A;  4I2T A;  4A5P A;  5BMU A;  2I3Y A;  4MJB A;  1AAZ A;  2XHF A;  4FYU A;  1SVO A;  5D73 A;  3N9J A;  4K1F A;  1O8X A;  1BX9 A;  2AAW A;  1W4V A;  2OE3 A;  4V1A g;  3LSZ A;  3J7Y b;  2VOC A;  4V1A p;  3G7Y A;  2YWN A;  3P8W A;  3JCM L;  5IQY A;  4GQF A;  3DD3 A;  1AQX A;  5J5N A;  4CHS A;  1JLV A;  3GL3 A;  4IBP A;  5ABR A;  2ON5 A;  3QAW A;  4GSS A;  2C80 A;  4BVY B;  2QKE A;  5A4W A;  2O3E A;  3W6G A;  2H1L A;  4POM A;  3ERW A;  4J57 E;  2CAQ A;  2LNS A;  5C04 A;  3IOS A;  1LBK A;  3M8N A;  1YZX A;  3KP9 A;  2BMX A;  5HR0 A;  4XS6 A;  2YV7 A;  3MWH A;  4CY6 A;  3FKF A;  1K0C A;  2TRC P;  2C3T A;  1BED A;  1ZYP A;  1JZW A;  2CV4 A;  3PPU A;  3ZMK A;  1T4Z A;  3LXZ A;  4HDE A;  5LCZ A;  5HFG A;  2MMO A;  1FVJ A;  2VLU A;  1JZR A;  2GVP A;  4ZBB A;  5G2Z A;  4EVM A;  5L71 A;  1S3C A;  1GSQ A;  4ECC A;  5CYY A;  3GTU B;  1X9M B;  2PUK C; 
#chains in the Genus database with same CATH homology
 4I5Q A;  2A2P A;  3QR6 A;  2PN8 A;  3KXO A;  5D93 A;  1SJ6 A;  3UOM A;  4MP4 A;  5CRD A;  5F05 A;  1GTA A;  2F9S A;  2GTU A;  2RM6 A;  2RII A;  4FYB A;  1EGO A;  2I9H A;  4BL7 B;  1MEK A;  2M72 A;  4E8H A;  1XOB A;  1TTZ A;  2HSN A;  4OFM A;  1ZZY A;  2C0D A;  1PQN A;  1AUC A;  2N5A A;  1N2A A;  4N10 A;  1Z6N A;  3HVS A;  1GUM A;  3C8E A;  2YOI A;  1VF3 A;  5IOX A;  4ID0 A;  2WZ9 A;  3D5J A;  3O6T A;  4KX4 A;  3QAV A;  4I97 A;  4NMU A;  1X0R A;  3VFI A;  3TJF A;  3GFK A;  4NAX A;  4TR1 A;  3VWW A;  2A2S A;  4ILF A;  4KF9 A;  1THX A;  4MJC A;  1B9X C;  3D0Z A;  1XW9 A;  1M7T A;  3CXG A;  4E8E A;  1I9D A;  2HZE B;  4RI7 A;  2E2M A;  1Z5Y E;  4AJ6 A;  3FHK A;  4KND A;  2L4Q A;  4QL9 A;  2YWI A;  3IE3 A;  1VF1 A;  3VWU A;  2ZCT A;  1SK2 A;  4EC0 A;  1FW1 A;  1E2Y A;  1QQ2 A;  2DJ1 A;  2M80 A;  2B5E A;  3HMJ G;  2H6Y A;  1ZYN A;  1DE1 A;  3GKM A;  3FZ4 A;  2DMM A;  5IMF A;  4D73 B;  1A8Y A;  1A2M A;  3FR6 A;  2DJK A;  2EIR A;  2JU5 A;  2E2G A;  3DRN A;  2DJJ A;  3GUS A;  3ZIJ A;  2YPM A;  1FO5 A;  4G0I A;  4RQX A;  4POL A;  3TKP A;  2H71 A;  13GS A;  3KEB A;  1RK4 A;  4OO4 A;  5J4V A;  1HNC A;  3FR9 A;  4KDX A;  5JCG A;  1UVZ A;  5ECK B;  2DIZ A;  1LU4 A;  2R0C A;  2H66 A;  3E0U A;  3EIN A;  1BG1 A;  2I4A A;  2FNO A;  3QD9 A;  3NIV A;  2H1D A;  4IS0 A;  3HZ4 A;  5B8A A;  2B1L A;  1Z7P A;  3A5W A;  3ZYW A;  5HQP A;  3TGZ A;  4BWS A;  2GST A;  1BAY A;  2NDO A;  1T7P B;  2MMA A;  2LQQ A;  2O7K A;  3TKR A;  1TRW A;  1YEX A;  1PD2 1;  4NWY A;  5IPH A;  5HR2 A;  4F82 A;  3M1G A;  1EOG A;  1USB A;  3TJG A;  1PN9 A;  3RPN A;  5J41 A;  1QMV A;  1GSU A;  3E9J B;  2L5L A;  3IPZ A;  3UVH A;  6GSU A;  2CA8 A;  2XPE A;  1R5P A;  4IP6 A;  4LL4 B;  1Y6E A;  2KP2 A;  2YZH A;  3P90 A;  3IRA A;  2VCQ A;  3F3Q A;  3EE2 A;  1XIY A;  3US3 A;  1FOH A;  1R7H A;  1GNE A;  1ZYQ B;  1GUL A;  1VF2 A;  4K6X A;  2HRN A;  1WMJ A;  4L0U A;  4OCF A;  3R3E A;  2GQM A;  1M0U A;  2LNT A;  3H4K A;  5DVB A;  2HRK A;  5AIS A;  2ALB A;  3A5I A;  3KZQ A;  2MBT A;  1DBY A;  3GYK A;  4AJ8 A;  3OR5 A;  2NPB A;  5LD0 A;  2HT9 A;  5H5R A;  2L4C A;  1VGL A;  5EL8 A;  2H76 A;  2GT5 A;  3KGK A;  2CVD A;  1Y1U A;  1ERV A;  2IMK A;  3EPT A;  4ULX A;  5G31 A;  3IBH A;  4GWR A;  1K0O A;  3V1W A;  2KP1 A;  2CX4 A;  5DAK B;  2FD3 A;  1SVM A;  4HU7 A;  18GS A;  5ELG A;  4V2N A;  2N5F A;  5ECH B;  5KN2 A;  3VPT A;  2WB9 A;  1EWX A;  1NW2 A;  3HKR A;  5BMU B;  2H19 A;  4K5R A;  1GTU A;  2Z9S A;  2H01 A;  1J08 A;  3A2X A;  5D9V A;  4HZ2 A;  2FCH A;  3M9J A;  2OE1 A;  2HXK A;  1RQM A;  3IA1 A;  4NV2 A;  3ZFL A;  1TKD B;  1V57 A;  5COH A;  5G30 A;  4PNG A;  3VWX A;  2H74 A;  5CRH A;  6GSW A;  1FHE A;  3N5O A;  3L0H A;  4KB3 A;  5F8B A;  4HQZ A;  4NHZ A;  4ZB6 A;  2CZ2 A;  3CTG A;  3A2W A;  5IMC A;  3DML A;  2HI7 A;  2H30 A;  4EE0 A;  5J4U A;  3GMF A;  5ECP B;  3ED3 A;  2YCD A;  4XCS A;  2P31 A;  3GRX A;  3IC4 A;  2DML A;  2GZZ A;  1ERU A;  2FWF A;  3ME8 A;  3P2A A;  4USS A;  1ABA A;  3EWL A;  4GQC A;  1M9A A;  1QFN A;  5IIZ A;  3TJJ A;  4MMM A;  4LMW A;  4QQ7 A;  5A4V A;  3GH9 A;  4RI6 A;  1MDJ A;  4HEA 2;  2VCT A;  1NM3 A;  1TRU A;  1TRS A;  5ECO B;  4F2I A;  2JSY A;  3ZLP A;  1JLW A;  4HS1 A;  5IM9 A;  1XVW A;  2NTO A;  2FWG A;  4I6X A;  3IHQ A;  2R2J A;  3LOR A;  4G0K A;  1JZO A;  3BD2 A;  2ES7 A;  2LTK A;  3I9V 2;  1GSE A;  4ICY A;  4OWY A;  1UN2 A;  2E7P A;  5CO3 A;  3I69 A;  3ZVJ A;  3RHB A;  5J9B A;  3SWL A;  3LQ7 A;  4YKG A;  1K0B A;  2C0E A;  3IAS 2;  3EC3 A;  1YDK A;  2CAI A;  2HSN B;  2IFQ A;  4HZ4 A;  3WD6 A;  1K3L A;  1E6B A;  1J9B A;  1XW6 A;  2N5B A;  2BJX A;  2AHE A;  5AN1 A;  2DKI A;  3MNG A;  2GSS A;  1VF4 A;  3NZN A;  1OYJ A;  3AY8 A;  4OCE A;  2HRF A;  4ML1 A;  4FO5 A;  3IDV A;  5D8I A;  1SK0 A;  1QK8 A;  3HVV A;  4KDU A;  5H5S A;  4TR0 A;  3TKQ A;  2H75 A;  4ML6 A;  2FY6 A;  2R6K A;  1M99 A;  5EPF A;  5KOW A;  2AB6 A;  4TR1 B;  2B7J A;  3DVW A;  3TJK A;  3Q19 A;  2H0I A;  3WYW A;  1ZYE A;  2FWH A;  2VUP A;  2X64 A;  4K0N A;  4KCE A;  2VCW A;  1PGT A;  4HI7 A;  1PMT A;  4TRX A;  4WXT A;  3GX8 A;  3RHC A;  3F6F A;  2FUG 2;  2F51 A;  3F4R A;  2HSM A;  4EIP A;  5IO2 A;  4GTU A;  1XZO A;  2CVK A;  1OC3 A;  3MDK A;  4BVX A;  4KW6 A;  2TRX A;  2DJ2 A;  2GGT A;  1PKW A;  2VCV A;  1WIK A;  2JZR A;  4DSS A;  4YQV A;  2L6D A;  3MSZ A;  1R4W A;  4N11 A;  5IMV A;  2ZUP A;  3C1R A;  4EF0 A;  4IJI A;  3KD0 A;  3FEU A;  4WF5 A;  4ZL7 A;  1GSS A;  16GS A;  3NOF A;  3H93 A;  3L9S A;  5FWG A;  5IOW A;  3M9K A;  4MA9 A;  1YY7 A;  3W8S A;  3ZVJ D;  4ZBD A;  3F6D A;  1MD3 A;  2WDU A;  3DKS A;  1SKW B;  4KAE A;  3FYG A;  1B9Y C;  1O8W A;  2MMN A;  2VL3 A;  3EU4 A;  2A4V A;  2CZ3 A;  4HUA A;  3ZIV A;  4EDY A;  4FYC A;  1FB6 A;  5CRE A;  1OKT A;  1G0T A;  3KTB A;  4IJ3 A;  5GZZ B;  2K8V A;  2O85 A;  5IMA A;  4AI6 A;  1K3O A;  4ECB A;  1ERT A;  1V98 A;  1V2A A;  2CQ9 A;  2H70 A;  2VLT A;  3HJO A;  4L5L A;  2B5Y A;  3UBK A;  4K2D A;  4G0L A;  5FHI A;  2RLI A;  3TB2 A;  2JZT A;  4O7H A;  2FHE A;  3J7Y k;  2YV9 A;  2WRT A;  4Z2U A;  2L59 A;  2FWE A;  1CQG A;  2GS3 A;  2YWM A;  3F63 A;  1K3Y A;  3GSS A;  1I5G A;  3C71 A;  3I6A A;  3GL5 A;  10GS A;  5FT3 A;  4TR3 A;  4OD7 A;  1U3I A;  1J0F A;  3GIX A;  4KUN A;  3F0I A;  3ERF A;  1GSD A;  3LG6 A;  3KM6 A;  5BRT A;  4PUF C;  1GRX A;  4Z7X A;  3R2Q A;  2X49 A;  3H79 A;  2P5R A;  4TKY A;  5GST A;  4XHM A;  3DYR A;  4Q5F A;  4ISD A;  2WUL A;  4AKX B;  3G7I A;  9GSS A;  1ZMA A;  2H1B A;  4NXI A;  4MF6 A;  4JR4 A;  4L8E A;  3P7X A;  4HJ2 A;  1A24 A;  2H6X A;  4WF4 A;  5B8B A;  1SL0 B;  4G9H A;  5DQY A;  1F2E A;  4OMV A;  4V2L A;  1OVN A;  1U6T A;  5ID2 A;  4BA7 A;  1GWC A;  5E59 A;  2H1A A;  5G5E A;  2HRK B;  5JCU A;  1IYI A;  4KE3 A;  2IPA A;  3DVX A;  1GTB A;  1X5C A;  1SJZ A;  1PKZ A;  1WPI A;  4JU5 A;  1N25 A;  3CBU A;  1YKA A;  2GDR A;  1T4Y A;  5JWO B;  1EV9 A;  3EUR A;  4AKH A;  1F6M C;  1FAA A;  4YQM A;  3WGD A;  1SYR A;  2AV4 A;  2M46 A;  1MTC A;  2XBI A;  2HNL A;  4ZIL A;  1YF0 A;  3KMO A;  1TU8 A;  4JE1 A;  4N30 A;  4TR4 A;  2P5Q A;  4MJE A;  2R37 A;  4QL7 A;  4GXZ A;  3VLN A;  4MF7 A;  7GSS A;  1K0M A;  3ZL5 A;  5IPG A;  3EVI A;  1GNW A;  2R0P A;  3F3R A;  2JAC A;  4G10 A;  1YF1 A;  3LGC A;  1M2B A;  2MZC A;  1C72 A;  1EP7 A;  2EFH A;  2VKZ G;  1ZCP A;  3TCO A;  3CRT A;  4PUR A;  2VCZ A;  4I2U A;  2REM A;  4KDY A;  2LRC A;  3GKN A;  2GT6 A;  2KLX A;  4MNN A;  2HE3 A;  4EL1 A;  3GUR A;  5B6M A;  2OKA A;  3ZRD A;  5J40 A;  3UAP A;  1TOF A;  2GZY A;  4KA0 A;  2F8A A;  3GN3 A;  4MLY A;  1GLP A;  2LJK A;  3HVX A;  4YKF A;  5INY A;  2DLX A;  2VIM A;  3UEM A;  1WJK A;  2PBJ A;  1SYX A;  3ZIT A;  3O76 A;  5KEJ A;  2LRN A;  1F37 A;  1ZOF A;  2DJ3 A;  3SBC A;  1JZD A;  3QFB C;  6GSY A;  2HFD A;  1KNG A;  1PSQ A;  4YH2 A;  3IR4 A;  3QMX A;  1TI3 A;  4IHU A;  5ENU A;  1F9M A;  3I43 A;  5DBQ A;  5A4U A;  3FMW A;  4K7I A;  5D9X A;  4FQU A;  2RUE A;  2AUV A;  4OFN A;  1EV4 A;  4IEL A;  5HFI A;  3TDG A;  1WE0 A;  2V41 A;  1FVK A;  2X8C A;  4J56 E;  5E4W A;  5H5Q A;  1XFL A;  5CRW A;  5ECL B;  5EVO A;  2IFQ B;  1GSF A;  4W66 A;  2LQO A;  4WR4 A;  3GNJ A;  5D9W A;  1SEN A;  5EY6 A;  5ECR B;  3G7J A;  1TXU A;  1URM A;  2KHP A;  1SD8 A;  2B5X A;  2DBC A;  3L78 A;  1KBN A;  2HSH A;  1G7O A;  4MDC A;  1XWK A;  3U6V A;  2UV8 G;  1X9S B;  2GLR A;  5AIV A;  1ST9 A;  3UL3 A;  3GV1 A;  2O87 A;  1A2L A;  4Q5Q A;  4AKI A;  4MJA A;  6GSX A;  3FRC A;  2H8L A;  5CAX A;  2H0G A;  1ZGN A;  1IYH A;  1R26 A;  3L4N A;  1T00 A;  3LJR A;  4IKH A;  2D2Z A;  5A5H A;  2LUS A;  1O73 A;  2IWT A;  1Y25 A;  3IK9 A;  4K2X A;  1Z7R A;  3BOA A;  1G6W A;  1KEB A;  4WET A;  4X4J A;  4F03 A;  2IN3 A;  2HSM B;  4IVF A;  3IHG A;  2H72 A;  4BVX B;  2IJY A;  1CQH A;  1KTE A;  2PPT A;  4DSS B;  17GS A;  1TDI A;  5DJL A;  2C8U A;  4GSN A;  1AW9 A;  2WFC A;  2FA8 A;  4ECI A;  4EKZ A;  1A8L A;  3BJ5 A;  3QPM A;  2LKU A;  5KN0 A;  2C3Q A;  2HSY A;  3MYD A;  3EYT A;  3G9B A;  1TP9 A;  3QCP A;  3UMA A;  4MH2 A;  2I81 A;  2NBS A;  3QOU A;  2PMT A;  4MZW A;  1ILO A;  4YAV A;  1A2J A;  2PVO C;  2X4A A;  4KGI A;  3VI7 A;  1EZK A;  22GS A;  1X9W B;  4MAB A;  5A34 A;  4ZB8 A;  4GF0 A;  4O5U A;  3KJY A;  4ZB9 A;  2C3N A;  3Q18 A;  1A0R P;  4JRR A;  5CNW A;  5CP1 A;  5B7C A;  2VM1 A;  2LJR A;  3FY7 A;  1HNA A;  3S9F A;  4G2E A;  2OJL A;  3ZZX A;  1GUK A;  3CTF A;  4FH8 A;  3W8J A;  3HYP A;  4TN8 A;  1XVQ A;  2K6V A;  1U87 A;  4IP1 A;  1QUW A;  5DAL A;  4MCU A;  4X0X A;  1Q4J A;  4LMV A;  3EU3 A;  4IQA A;  4O5R A;  4JBB A;  4KSO A;  4HJM A;  2DKH A;  2YNX A;  4POK A;  4IW9 A;  3TKS A;  3LWA A;  2TIR A;  5AGY A;  3RBT A;  2K8S A;  4LLR A;  4FIW A;  5B6N A;  3IC8 A;  2DSA A;  1HYU A;  1JHB A;  4F9Z A;  11GS A;  3VI5 A;  1PRX A;  2BTO T;  1TI1 A;  4ECJ A;  3QAG A;  2MMZ A;  5GAN D;  1GLQ A;  3LYK A;  8GSS A;  2OBK A;  4RUV A;  4O32 A;  5A1N A;  4JR6 A;  5ID2 B;  1H75 A;  4Z2R A;  1M2D A;  2IL3 A;  4WBR D;  5GSS A;  3F4T A;  4EDZ A;  4GRF A;  3LEF A;  3RAZ A;  1DSB A;  5ECN B;  4CY8 A;  3FW2 A;  2EIO A;  1XW5 A;  1O85 A;  2OAC A;  4I8B A;  3KTL A;  3PIN A;  4N0Z A;  4TVE A;  3CYN A;  4P3Y B;  5JCW A;  1XWC A;  1F3B A;  5DCH A;  3VK9 A;  3O3T A;  2OT3 A;  1TRV A;  5F0G A;  5KN3 A;  2A4H A;  1SL2 B;  3PR8 A;  2X8H A;  4MH3 A;  1ERW A;  3TKS C;  4XS4 A;  2ON7 A;  2GQK A;  5HR3 A;  3M3M A;  2GSR A;  3KP8 A;  3HCZ A;  2H1G A;  1GUH A;  4X1U A;  2L57 A;  3GST A;  3UIW A;  1O7U A;  6GST A;  2VM2 A;  1PN0 A;  4PQI A;  1TXX A;  2OA7 A;  1FG4 A;  3LW9 A;  3D22 A;  1T1V A;  3LFL A;  2K9F A;  2VAF A;  5KN1 A;  3HJM A;  2J9H A;  1GH2 A;  4HQS A;  2PU9 C;  5LNK e;  2XBQ A;  4DSQ A;  4RQR A;  4DSR A;  3UBL A;  4N0V A;  3EMP A;  3C7M A;  2WGR A;  4X43 A;  2H73 A;  1OC9 A;  2UZ8 A;  2YWO A;  3CSH A;  1UC7 A;  2EFC A;  5G5F A;  2G2Q A;  1BJX A;  4PGT A;  2PVQ A;  1THO A;  1K0N A;  1YEP A;  4ZL8 A;  2CVB A;  4WR5 A;  4PTS A;  2JAD A;  4NPB A;  1EGR A;  2NVL A;  2JSZ A;  3A3T A;  4OO5 A;  2KUC A;  2WJU A;  19GS A;  3H8Q A;  4AGS A;  4LA1 A;  5GAP D;  3CWG A;  5JWQ B;  4MPF A;  3APS A;  4ACS A;  3KIJ A;  2R4V A;  2QGV A;  3WT2 A;  2MYG A;  1TJD A;  3ME7 A;  1SKS B;  3APO A;  2WS2 A;  4KCA A;  5IMD A;  2V6O A;  1EOH A;  1ON4 A;  3F8U A;  2IME A;  5ECM B;  4QMK A;  4V2M A;  4EIQ A;  5J4Y A;  3WGE A;  2DC5 A;  4J2F A;  1AC1 A;  3HDC A;  1B4Q A;  3D21 A;  4GDF A;  2HYX A;  1Z9H A;  3C73 A;  1B4P A;  4TXO A;  4EO3 A;  1XXU A;  2LEG A;  3CRU A;  3QFA C;  4HOJ A;  3TRP A;  4PX1 A;  4NHW A;  4CW9 A;  1YKC A;  5IO0 A;  1U88 A;  3IV4 A;  3U5R E;  4MZB A;  3LYP A;  2QA2 A;  1SD9 A;  4XRD A;  2I1U A;  3UVT A;  1XOA A;  2WCI A;  1FB0 A;  2FLS A;  3TRQ A;  3UJ1 A;  5G1K A;  4XIH A;  1F3A A;  3WGX A;  3FZA A;  1BG5 A;  3QDN A;  5A5H B;  1GSY A;  2XPD A;  3M0F A;  2B1K A;  4BWQ A;  1GTI A;  1TK5 B;  2C0F A;  2K18 A;  2QA1 A;  2YAN A;  3DIE A;  2B7K A;  1OE8 A;  3EMX A;  2LS5 A;  2YP6 A;  2IMD A;  3MIX A;  3H1N A;  1S3D A;  2V1M A;  1WRY A;  1EEJ A;  1AIU A;  2VD1 A;  2VO4 A;  3RDW A;  4WKW A;  1QGV A;  3GHA A;  5F06 A;  3FR3 A;  1X5E A;  2VL2 A;  4IN0 A;  3DWV A;  2YN1 A;  2HZF A;  4TOP A;  2B3S A;  5DCG A;  3D4M A;  4ZB7 A;  4PQ1 A;  1YQ1 A;  2KOK A;  3ZRE A;  2X8G A;  2LJA A;  5AIX A;  3GX0 A;  2VLV A;  4GST A;  4KH7 A;  1XPV A;  2DIY A;  5A34 B;  1Z6M A;  4K0G A;  3A2V A;  4JZQ A;  1TK8 B;  2R0G A;  4WEY A;  2HQT A;  3FK8 A;  1QXH A;  3FZ5 A;  1VRS D;  4DEJ A;  3HHV A;  4AF2 A;  1B48 A;  4IGJ A;  4E68 A;  3Q6O A;  1ACV A;  2IMI A;  2GSQ A;  1PX7 A;  2VD0 A;  3GA4 A;  3VWV A;  3D6I A;  3VPQ A;  4BVY A;  3PH9 A;  1GL8 A;  1MD4 A;  4MF5 A;  2L5O A;  3BCI A;  4XTS A;  2L6C A;  5J47 A;  5DAL B;  4K5S A;  4LL1 B;  3LXT A;  1XWB A;  3TRX A;  1OE7 A;  1SL1 B;  2VL2 C;  1GP1 A;  4BPY A;  2LST A;  4ZBA A;  4PUA A;  2E0Q A;  2ZNM A;  1O6J A;  1A0F A;  1HNB A;  1EEM A;  1OKD A;  2YJH A;  2O8V B;  2GZP A;  2G0F A;  3RPP A;  3ZTL A;  4EUY A;  3TU3 B;  2QC7 A;  3DXB A;  3HZ8 A;  1AQW A;  2C0G A;  12GS A;  1DUG A;  5A1N B;  3GTU A;  2J23 A;  3IXR A;  2LRT A;  4NV5 A;  6GSS A;  1V58 A;  3DEX A;  4XS1 A;  4JED A;  4PQH A;  5DDL A;  4L5O A;  4BL7 A;  3L9V A;  2PWJ A;  1TK0 B;  1WWJ A;  3K8N A;  4AJ7 A;  4L0W A;  3E3E A;  2IIY A;  2OBI A;  1V9W A;  1AQV A;  2X99 A;  1PA3 A;  4YAP A;  1DE2 A;  4IQ1 A;  4G01 A;  3F4S A;  2EFD A;  4XS4 B;  2JL4 A;  2VL9 A;  1X5D A;  3FZ9 A;  3MAK A;  1Z3E A;  5C00 A;  2EIQ A;  3L9U A;  2RM5 A;  5DQS A;  1HD2 A;  3HD5 A;  4F0C A;  1T3B A;  2FA4 A;  3C1S A;  4ZL9 A;  2YZU A;  1K0A A;  4WBJ A;  2JZS A;  1BYE A;  1TU7 A;  2YJ7 A;  2HZE A;  2V32 A;  2OE0 A;  1WOU A;  3DGQ A;  3APQ A;  2LV3 A;  1XWG A;  1FOV A;  2R5G A;  1G6Y A;  2DJ0 A;  3Q74 A;  5ECQ B;  1TW9 A;  2RUF A;  5ELA A;  4XRA A;  2VCX A;  2C1Y A;  1BQ7 A;  1H4O A;  4TW5 A;  3D4T A;  1OC9 B;  4D73 A;  5ECS A;  4K8M A;  5KOX A;  1SJI A;  5G1L A;  4YQU A;  3HXS A;  3VUR A;  1XCC A;  1N8J A;  3ZFB A;  1Q98 A;  4MPG A;  5J3R A;  1R5A A;  3GH6 A;  4OFT A;  2PGT A;  3F9U A;  3ISO A;  1PL2 A;  4MZC A;  3KMN A;  2A2R A;  1M2A A;  3WT1 A;  4HU9 A;  2OAD A;  3IK7 A;  3BBY A;  1K0D A;  4POB A;  2F3M A;  1O81 A;  1NSW A;  4K7O A;  1OC8 A;  5HFK A;  1XWA A;  2PER A;  3BCK A;  5DJM A;  4GLT A;  5J9C A;  1AXD A;  5CRG A;  3GKX A;  2C4J A;  1ML6 A;  1LJR A;  3HJP A;  4PXO A;  5IMZ A;  3CMI A;  5A5K A;  4EXJ A;  1RW1 A;  4KSM A;  4TXO B;  1W89 A;  5HR1 A;  5JWR B;  3KH7 A;  2V2G A;  4K7N A;  2AYT A;  1NHO A;  4G19 A;  1UA5 A;  1M9B A;  1T8E B;  2V6K A;  1B8X A;  3TKS E;  4DVC A;  1ZL9 A;  3ZML A;  2EFE A;  1S3A A;  4TXV A;  5D9T A;  1G7E A;  1XBS A;  2HRA A;  2B6M A;  4CDO A;  20GS A;  2O89 A;  4GCI A;  3TOU A;  1OAZ A;  5D96 A;  3TOT A;  2MBS A;  1MDK A;  2CX3 A;  1U3A A;  1EP8 A;  3TUE A;  1WP0 A;  2GQL A;  4AKG A;  4K9Z A;  14GS A;  2AJQ B;  3UAR A;  3KH9 A;  3ERG A;  1SVL A;  1PL1 A;  4F0B A;  1SU9 A;  3CSJ A;  4Q5N A;  1BF5 A;  3GKK A;  1PX6 A;  1NHY A;  3PGT A;  3CSI A;  1V40 A;  1HQO A;  4ZXG A;  4MK3 A;  3KCM A;  2XC2 A;  2R3X A;  1YVL A;  1JFU A;  4Z2T A;  4ZIJ A;  5DAK A;  5ECI B;  2QSI A;  4O92 A;  2H0H A;  2O5V A;  3HA9 A;  2EC4 A;  1YJ6 A;  3IAM 2;  1SK1 A;  5F07 A;  3TJB A;  2CT6 A;  1MDI A;  4H86 A;  2P0G A;  4PNF A;  2IMF A;  2H6Z A;  4N3Z A;  2HLS A;  4Q5R A;  1SKR B;  3HY2 A;  1A23 A;  4O5Q A;  2F8F A;  6GSV A;  2FGX A;  4I2T A;  4A5P A;  5BMU A;  2I3Y A;  4MJB A;  1AAZ A;  2XHF A;  4FYU A;  1SVO A;  5D73 A;  3N9J A;  4K1F A;  1O8X A;  1BX9 A;  2AAW A;  1W4V A;  2OE3 A;  4V1A g;  3LSZ A;  3J7Y b;  2VOC A;  4V1A p;  3G7Y A;  2YWN A;  3P8W A;  3JCM L;  5IQY A;  4GQF A;  3DD3 A;  1AQX A;  5J5N A;  4CHS A;  1JLV A;  3GL3 A;  4IBP A;  5ABR A;  2ON5 A;  3QAW A;  4GSS A;  2C80 A;  4BVY B;  2QKE A;  5A4W A;  3W6G A;  2H1L A;  4POM A;  3ERW A;  4J57 E;  2CAQ A;  2LNS A;  5C04 A;  3IOS A;  1LBK A;  3M8N A;  1YZX A;  3KP9 A;  2BMX A;  5HR0 A;  4XS6 A;  2YV7 A;  3MWH A;  4CY6 A;  3FKF A;  1K0C A;  2TRC P;  2C3T A;  1BED A;  1ZYP A;  1JZW A;  2CV4 A;  3PPU A;  3ZMK A;  1T4Z A;  3LXZ A;  4HDE A;  5LCZ A;  5HFG A;  2MMO A;  1FVJ A;  2VLU A;  1JZR A;  2GVP A;  4ZBB A;  5G2Z A;  4EVM A;  5L71 A;  1S3C A;  1GSQ A;  4ECC A;  5CYY A;  3GTU B;  1X9M B;  2PUK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...