3M0FA

Crystal structure of glutathione s transferase in complex with glutathione from pseudomonas fluorescens
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
203
structure length
203
Chain Sequence
LKLIGMLDSPYVRRVAISLKSLGLPFEHHSLSVFSTFEQFKAINPVVKAPTLVCEGGEVLMDSSLIIDYLETLAGPQRSLMPTALPQRLRELRLVGLALAACEKSVQIVYERNLRPAEKQHGPWLERVGGQLQAAYGELEQELQKQPLPRDGSLGQAGISLAVAWSFSQMMVADQFNPGQFPAVRGFAEYAEQLPVFLATPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords uncharacterized protein GST_N
publication title Crystal structure of Glutathione S Transferase in complex with glutathione from Pseudomonas fluorescens
rcsb
source organism Pseudomonas fluorescens
total genus 70
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3m0fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3m0fA01
2IFQA 2K8VA 5DAKB 1EP8A 1XWCA 1VF4A 3KTLA 1THOA 4XS1A 4ECJA 3KIJA 1EOGA 3I43A 2IMDA 1K0DA 3QR6A 1TW9A 4NPBA 3J7Yk 3IOSA 2IWTA 2L6DA 5HR2A 4PUAA 2VAFA 4IP1A 3IC8A 1M2BA 2P5QA 2X99A 1YJ6A 3FR9A 1H4OA 4F03A 4RI6A 2LRTA 2MYGA 3ED3A 1GUMA 2AJQB 4Q5FA 11GSA 3L4NA 4WR4A 2KLXA 4NHWA 2PN8A 4EVMA 3KEBA 4OO4A 3GUSA 4V1Ap 4BVXB 3F6FA 3GA4A 2VO4A 3GFKA 4BA7A 5G1LA 2C80A 4IJ3A 4IN0A 2DIZA 5ELAA 3WGDA 3HXSA 1SENA 1ZOFA 2OE0A 2I4AA 4FO5A 3KMOA 1YKCA 2R2JA 1BG5A 2OE1A 4YQMA 3DWVA 4MMMA 2KHPA 2YWMA 2H6YA 4MA9A 2FWFA 2X8GA 2BMXA 2WB9A 2OKAA 3HJPA 3UJ1A 1XFLA 2H1BA 4FIWA 5CNWA 3IA1A 3TKRA 1HD2A 2VOCA 1WOUA 3VI7A 2IJYA 2LJRA 1GLQA 5ENUA 3TDGA 4RQXA 4DSSA 2KUCA 1HQOA 2ON7A 5KN0A 3FEUA 1F9MA 3V1WA 4OFNA 5ECQB 4EXJA 2VM2A 2C0EA 2CVDA 3VURA 4I2UA 4Q5NA 3EE2A 3GN3A 4I97A 2HRKA 1PX7A 1PA3A 4GTUA 1XBSA 4HDEA 3TJJA 1TRWA 1EEMA 1TOFA 1UVZA 5HFGA 2CAQA 2LQQA 1WRYA 5JCUA 4OFMA 2R4VA 3KP8A 1O73A 5KN1A 2CA8A 4FYCA 3TKSC 4L5OA 3FR3A 1AC1A 3AY8A 2LNSA 3F3RA 3TB2A 3W8SA 3EMPA 4WF5A 2DMLA 1YF1A 2P5RA 3MNGA 2AHEA 2E0QA 5IOXA 3FZAA 3TKQA 10GSA 2ZNMA 4V2NA 2M46A 2YWIA 4HJMA 3E9JB 1S3AA 1AIUA 1WE0A 4NAXA 2B5XA 1FB6A 3FHKA 1NW2A 1U3IA 4BWQA 2V6OA 4NXIA 3OR5A 3G7YA 1BYEA 2PVQA 4YAPA 2KOKA 2XPEA 4QQ7A 2CQ9A 1OE8A 1ZL9A 4G9HA 3M0FA 4MLYA 4MP4A 3QMXA 1A0FA 3BBYA 2D2ZA 4CW9A 4WR5A 14GSA 1OAZA 3UEMA 5GSSA 1WP0A 2LSTA 3W8JA 4IKHA 1SYXA 3QAVA 3ERWA 1T4YA 3ZIJA 1FB0A 4MF5A 2GTUA 4N10A 6GSUA 3CXGA 1OC3A 3KM6A 3UOMA 3KZQA 4K7NA 3IR4A 2GSSA 5AISA 5F05A 2C0GA 2PERA 4LLRA 2VLVA 4MH3A 1ERWA 3D0ZA 4X0XA 2WFCA 2AUVA 3M9KA 1O8XA 2G2QA 2OBKA 5D8IA 3FR6A 5ECIB 1OC9B 3APQA 4BVYB 2VUPA 1XWAA 4O32A 3UL3A 2HQTA 3IXRA 4IHUA 3UVTA 1J9BA 5B8BA 2JSZA 2DC5A 8GSSA 3ERFA 2GZPA 5DBQA 1EEJA 2C4JA 3CSJA 2R6KA 5G31A 1YF0A 1QK8A 1F6MC 3ZIVA 2A2RA 1Z6MA 2MZCA 2H70A 4KSMA 1Y25A 4HEA2 3TJFA 1T3BA 1A8LA 1XCCA 2X64A 3J7Yb 4LMWA 1K0CA 2JZSA 4TR1B 2YZUA 1GTUA 1RK4A 5ECPB 3VLNA 4BWSA 1AQWA 3FKFA 3ZVJD 6GSVA 2WJUA 5IM9A 2JSYA 1DBYA 1X9WB 5A4VA 3WT2A 3M8NA 3FZ4A 3LYKA 1O81A 2YV7A 1EOHA 4G2EA 1PN9A 5DQYA 1K3OA 1AAZA 4O7HA 5KN2A 5D9VA 3L9SA 3EU4A 4IVFA 2K8SA 2DLXA 3F0IA 1U88A 4PGTA 4DSQA 1PKWA 2EIOA 2GQMA 3O3TA 4I6XA 1B8XA 2YJ7A 5EPFA 2C0FA 3HDCA 4N30A 1X9MB 3MSZA 1M9BA 4G19A 2QGVA 2FLSA 4EC0A 3GIXA 4YH2A 1Z7RA 5IPGA 4TR3A 5ELGA 2XHFA 1DE1A 1O85A 3IAM2 3F3QA 3NOFA 2VLTA 3F4RA 1J0FA 2B5EA 3LQ7A 3BD2A 1XXUA 4KDXA 3I69A 1ZYEA 1TRSA 2O8VB 2K9FA 1YZXA 2DJJA 4AJ6A 3IDVA 3WT1A 4KUNA 2FCHA 3EMXA 2YN1A 3KTBA 4RI7A 5G2ZA 3FRCA 3DD3A 1TTZA 3LORA 2O89A 3SWLA 2GZZA 4TXOA 4TW5A 2HSMA 5INYA 2LTKA 4I8BA 4WBRD 5EVOA 2RLIA 4GXZA 1J08A 4OMVA 1XPVA 2C3NA 1OE7A 4EDYA 4EO3A 4TXOB 4F0CA 4TR4A 3C71A 1K3YA 1X5CA 4JU5A 3EURA 1SJZA 5E4WA 5DALB 1XW5A 1EV4A 1LBKA 5CRWA 2YCDA 4JBBA 3QPMA 4KW6A 2DJ3A 2QKEA 2AYTA 1T7PB 3A2VA 5ABRA 1Z5YE 1TRUA 3GL5A 3EC3A 1C72A 2N5AA 2YP6A 2MBSA 1V2AA 3KJYA 5JWOB 4I2TA 2H0HA 4XS4A 2JU5A 4KNDA 1PL1A 3WD6A 1MTCA 5IMZA 3KH9A 2GSTA 3DVWA 2PGTA 3GH9A 4N11A 1T00A 2MMAA 3ME7A 1SK1A 2PMTA 1OKTA 2VD0A 1JZRA 1SL1B 1T1VA 1KBNA 2CT6A 5ECSA 3FK8A 4WXTA 3KP9A 4FH8A 5E59A 1AQXA 4L8EA 1XOAA 3KGKA 2IMIA 4OD7A 4QL7A 5DAKA 2DIYA 2K6VA 3VWUA 1WMJA 5GAPD 3HY2A 4PURA 3C8EA 1XVQA 5D9XA 5B6NA 2HSHA 1KNGA 2QC7A 5CRHA 3D5JA 1E2YA 5GSTA 1PL2A 4POLA 3FZ9A 1V98A 1NM3A 3O76A 1XWBA 22GSA 3GRXA 2FD3A 1B4QA 5IMDA 4CHSA 4BVXA 4ID0A 2I9HA 1EGRA 4DEJA 3PR8A 3GNJA 1FVKA 4ML6A 4ZB6A 2AV4A 3A2WA 5FT3A 1M0UA 3DIEA 3IC4A 2IMKA 3QAWA 1BAYA 3EYTA 1GLPA 1UA5A 2EIQA 3CSHA 3VPTA 2E2MA 4AJ8A 4ECIA 3RBTA 2DJ1A 3RPPA 4POKA 4POBA 1V40A 5A5KA 4K0NA 3HZ8A 2WRTA 4ZB9A 6GSWA 2TIRA 3M3MA 1S3DA 4KCAA 4AJ7A 3TOUA 1RW1A 1GTIA 3TKSE 2IN3A 1ON4A 3HA9A 5IOWA 2ES7A 3H1NA 1SKWB 1GRXA 5F06A 5CRDA 1B4PA 3P7XA 5J9CA 4OO5A 3BOAA 3TRQA 4IQAA 1SU9A 1ZMAA 3IHQA 1VF3A 1N8JA 5JWRB 4MJCA 3Q74A 4XCSA 4XHMA 1ML6A 2X8CA 5CO3A 6GSTA 2DMMA 4ZIJA 1FAAA 2GSRA 2JACA 4NV5A 2HZFA 1R7HA 1O8WA 4XIHA 2K18A 2IMEA 3N9JA 1NSWA 4ZILA 3ME8A 5GAND 2XC2A 2R37A 4KX4A 2PVOC 3UARA 4N0ZA 1Q4JA 5CREA 5ID2B 2IPAA 3LXZA 5H5RA 2H1DA 2LRCA 5IO0A 2HSYA 3IPZA 3GSSA 2CZ2A 1A0RP 1SJIA 4KF9A 5ECKB 5J41A 5DQSA 1XW9A 4FYBA 3DXBA 4NMUA 5JCGA 3C1RA 1YEXA 1TDIA 4IELA 2FWGA 2H1GA 3PGTA 4LL4B 5IMAA 3L0HA 5CAXA 1WJKA 2VCWA 4MJEA 1FOVA 2LS5A 1K0NA 3LWAA 3LYPA 5B6MA 1SYRA 18GSA 5C00A 4OWYA 2OA7A 3WGEA 1AXDA 3TRPA 4Q5QA 4K7IA 1OYJA 4ISDA 4USSA 1U6TA 2FUG2 4GSNA 1OC8A 2HFDA 5DVBA 4KDYA 4GQFA 1ERUA 1AUCA 5DJLA 2DJ0A 1XWGA 2N5BA 5DJMA 2HZEB 5AIVA 5F07A 2L4CA 4IP6A 1GSDA 2H8LA 1OC9A 4EL1A 4BVYA 3RAZA 5IQYA 5G30A 1Q98A 1ST9A 4XRAA 3L9UA 1JFUA 1K0BA 3QFAC 1H75A 4MH2A 5ECMB 4ECCA 2B1KA 3W6GA 4G0LA 2H72A 4TOPA 2V2GA 3GX0A 3EU3A 4MPFA 5AGYA 5EL8A 3ZREA 2JZRA 1B48A 2NPBA 1PKZA 2MMNA 3QOUA 3VWVA 2F8FA 6GSSA 4H86A 3E3EA 3Q6OA 1FHEA 1W4VA 3DKSA 5D93A 2DSAA 3ZVJA 4PNFA 4POMA 3GX8A 2VD1A 1BX9A 1TXXA 1VF1A 4TR1A 3VWXA 3I9V2 2M80A 5C04A 1QGVA 1GL8A 2JZTA 4V2LA 4JZQA 4TRXA 2GDRA 3WYWA 4ULXA 1GSSA 5ECNB 1X0RA 4MPGA 2HRAA 3M1GA 2V41A 3GKNA 2H1AA 3IK7A 16GSA 3SBCA 4K7OA 3TGZA 4GQCA 4IQ1A 1I9DA 5IMCA 5J5NA 4PX1A 3ZLPA 2H74A 4RUVA 1F37A 2LRNA 1ABAA 4MZCA 4ZB8A 2GT6A 5ECRB 13GSA 2C0DA 3M9JA 4HS1A 2M72A 2MBTA 2B7JA 1WPIA 3KXOA 3US3A 5JCWA 3JCML 1X5EA 7GSSA 1FO5A 4MJAA 4KA0A 3IRAA 1IYHA 4F2IA 3UMAA 1G7OA 3HYPA 4ILFA 3LXTA 1KEBA 3ZMKA 3PH9A 5L71A 1E6BA 1LU4A 2BJXA 2VL2A 5J4UA 4KCEA 1EWXA 4AGSA 1M2DA 4PQIA 4MF7A 2YZHA 4Z7XA 3GYKA 1BQ7A 1G6YA 1PQNA 2YWOA 4ZL7A 3HZ4A 1OVNA 3VFIA 4GF0A 4HQZA 2L4QA 1XIYA 1MD3A 2FA8A 2N5FA 2H75A 3QDNA 2OBIA 3LG6A 1AW9A 2V6KA 3A3TA 2WZ9A 4Q5RA 2OJLA 4JRRA 2F8AA 1PGTA 1FW1A 2HLSA 2E2GA 3F4TA 5FWGA 4BPYA 3D4MA 3U5RE 2OADA 4K0GA 4HUAA 1SKRB 3H8QA 1ACVA 3TCOA 4BL7B 3PINA 4CDOA 1Z6NA 3MAKA 2ZUPA 1A2MA 4FYUA 1GULA 4HI7A 2EIRA 3UBKA 4P3YB 4DVCA 1M2AA 1EP7A 4HZ2A 2HT9A 5DALA 3F6DA 5HR0A 1O6JA 4L5LA 4GCIA 4F9ZA 2TRCP 4ZXGA 5DCHA 1PD21 3GTUB 3CTGA 1U87A 1G6WA 4GLTA 1HYUA 2GS3A 2J23A 3HKRA 2A2SA 3CTFA 2WGRA 1XVWA 1YDKA 1GH2A 1FG4A 3EINA 3A5WA 2JADA 4I5QA 2QSIA 2CZ3A 3UVHA 3GKKA 2HYXA 3VI5A 2H01A 4O92A 6GSXA 1GUHA 5ECLB 4IW9A 2L59A 3CYNA 3D6IA 3TJGA 4YQVA 2HI7A 1ZGNA 4GSSA 2NTOA 3EWLA 3R2QA 4MJBA 1SK2A 3GSTA 4DSRA 1MDJA 3GKXA 1TK5B 1VGLA 1UN2A 2LV3A 3ZYWA 5HR1A 2AB6A 1PMTA 3FW2A 4EE0A 1TK8B 1K0AA 1A2JA 1R5AA 4HJ2A 2CX3A 4G0KA 3TOTA 1U3AA 5J9BA 3NZNA 2V32A 4G10A 4K9ZA 3P8WA 4X1UA 4KE3A 1ERTA 2H0IA 4WEYA 3TRXA 3G7IA 1F3AA 1JZDA 2KP1A 1EZKA 3DGQA 2GQLA 3ZFBA 2P31A 2LJAA 1NHYA 2NDOA 2ALBA 3D4TA 1TKDB 1SL2B 1HNAA 2WS2A 3BJ5A 1GTBA 3LEFA 2LUSA 3G9BA 1JZWA 5D9WA 2GVPA 3ZFLA 4O5RA 3RHCA 3RHBA 3D21A 3GL3A 2XPDA 3ZRDA 1XW6A 1DSBA 1CQGA 1TRVA 1VRSD 2IL3A 1QXHA 4D73B 2RUEA 4MZWA 2VL3A 2IFQB 5HR3A 2ON5A 3CRUA 2RIIA 1QFNA 5FHIA 3TKPA 3CMIA 2C3QA 4KH7A 1X9SB 1M9AA 3GH6A 1URMA 1LJRA 2E7PA 4KSOA 3MDKA 1A24A 2FNOA 2O87A 4EDZA 1BJXA 1GSEA 2B3SA 4K6XA 1HNBA 1WWJA 1A23A 1RQMA 4WKWA 2NVLA 5G1KA 1YQ1A 2L5LA 2WDUA 3VK9A 2MMOA 1T8EB 1GSUA 4HOJA 4EKZA 3TKSA 1VF2A 3HCZA 1Y6EA 2AAWA 3C1SA 3ZMLA 5IMFA 4WF4A 2GQKA 2V1MA 2TRXA 5DCGA 2LKUA 2LQOA 3F4SA 1V57A 5ID2A 1Z9HA 1SK0A 5CP1A 5G5EA 3S9FA 5DDLA 2H71A 4KB3A 1K0OA 1TJDA 5GZZB 2CVBA 2VCXA 1MDIA 3Q18A 2BTOT 2H76A 1A8YA 1XOBA 2I1UA 5A4UA 1GNWA 3NIVA 4DSSB 2YOIA 2RM6A 2YNXA 1BEDA 1DUGA 2FWEA 4JR6A 3GURA 2L5OA 1SKSB 4HZ4A 3IV4A 3TJKA 5IO2A 1ZYQB 4PQHA 2HRKB 4QL9A 4JR4A 2B1LA 3P2AA 3WGXA 5KEJA 4KDUA 2MMZA 4ZBDA 2DJ2A 3IBHA 1M7TA 5LNKe 4HU9A 1K3LA 5H5SA 4K8MA 2YV9A 5G5FA 3K8NA 3QAGA 2H6ZA 3HD5A 4K1FA 2PWJA 5CYYA 2HZEA 1USBA 2PUKC 3H79A 2EC4A 2IIYA 2DBCA 2H30A 5D73A 4XRDA 4ZBBA 3F63A 3R3EA 1XWKA 1V9WA 4X43A 3QCPA 4XS6A 3QD9A 1GNEA 3G7JA 1QUWA 2CV4A 3RDWA 1X5DA 2OE3A 3H93A 1N2AA 1G0TA 3C7MA 1T4ZA 2YWNA 2B5YA 3DMLA 5ECOB 4YAVA 2O7KA 1I5GA 4E8HA 4ZL8A 3C73A 4IS0A 2VCQA 2VCTA 2HNLA 2YPMA 4EUYA 2A4VA 1CQHA 2HE3A 2LJKA 1ILOA 3GMFA 3LJRA 4KAEA 2CX4A 4KGIA 3ZITA 3HVSA 1SD9A 1GSQA 3LSZA 5CRGA 3APOA 4MK3A 1YEPA 1ZZYA 1AQVA 2GZYA 1OKDA 2H73A 2Z9SA 4NV2A 3HHVA 3KH7A 2HSNB 2PBJA 2FWHA 3EVIA 4MCUA 1TU7A 4ML1A 2KP2A 1GWCA 2ZCTA 3A2XA 4J57E 4L0UA 1R4WA 4NWYA 2REMA 3APSA 5BMUA 1DE2A 1Z3EA 3F8UA 1M99A 2X8HA 2PPTA 5IPHA 2IMFA 1WIKA 4ACSA 4FQUA 1B9XC 3KD0A 3ZL5A 2F3MA 3ZTLA 5IMVA 4L0WA 4TKYA 3QFBC 1FVJA 3F9UA 2WCIA 2C3TA 1ZCPA 3GKMA 2LNTA 4GSTA 4IBPA 5F8BA 1O7UA 2JL4A 2VIMA 3P90A 1SJ6A 4RQRA 4JE1A 1B9YC 2GT5A 2R5GA 2YJHA 4LA1A 5B7CA 2O85A 2H6XA 2J9HA 3UIWA 3U6VA 1JHBA 1JLVA 2LEGA 1TI1A 4ZL9A 2G0FA 2HXKA 4NHZA 1THXA 2GSQA 5LCZA 5ECHB 1EGOA 4J56E 2C1YA 5B8AA 3VPQA 2B6MA 1YKAA 1Z7PA 5H5QA 5HQPA 2RUFA 2UZ8A 2CAIA 1TU8A 2VCVA 1GP1A 19GSA 4ZBAA 3ISOA 4PNGA 4PTSA 3VWWA 4LMVA 2HRFA 3CRTA 1A2LA 5HFIA 5D96A 4F0BA 3DEXA 3HJMA 4LL1B 4AF2A 1JLWA 2CVKA 4F82A 5KN3A 4BL7A 1MDKA 3GV1A 3IK9A 5AN1A 2FHEA 2F9SA 4WBJA 3L9VA 2YANA 3FYGA 1GSYA 1PSQA 2VL2C 2RM5A 4OCEA 2FY6A 4GRFA 3ZZXA 2HRNA 1IYIA 1K0MA 1TK0B 4XTSA 2XBQA 1ERVA 4V1Ag 3DRNA 5LD0A 5IIZA 4IGJA 5HFKA 5JWQB 1QMVA 2H66A 3FZ5A 3Q19A 3DYRA 4OFTA 3GTUA 3TJBA 9GSSA 3BCKA 2DJKA 3FY7A 3GHAA 5F0GA 3L78A 4HQSA 3LFLA 2VCZA 1UC7A 3KMNA 3MWHA 1F2EA 2PU9C 2L6CA 4ECBA 3BCIA 4PUFC 3N5OA 3KCMA 4TN8A 12GSA 4GWRA 5EY6A 4TR0A 2FGXA 2C8UA 2R3XA 2H19A 17GSA 4WETA 4TXVA 2HSMB 2OACA 1V58A 4PXOA 2GLRA 1S3CA 3TUEA 2FA4A 4V2MA 4K2DA 5D9TA 3RPNA 1G7EA 1TP9A 5J3RA 2VLUA 1GUKA 2VM1A 5A4WA 20GSA 2GGTA 4E8EA 2H0GA 3UAPA 2F51A 4EF0A 1EV9A 1F3BA 4MF6A 3O6TA 2I81A 4PQ1A 5COHA 2NBSA 1R26A 4YQUA 2WULA 1GSFA 1TI3A 4MABA 1R5PA 3HVXA 4JEDA 3ERGA 3I6AA 2XBIA 3D22A 3HJOA 3HVVA 1SD8A 4MDCA 4G0IA 5AIXA 4XS4B 3CBUA 3LGCA 1PRXA 1MD4A 1MEKA 1XZOA 1W89A 6GSYA 1HNCA 4J2FA 3E0UA 4TVEA 4MZBA 3PPUA 3CSIA 1JZOA 1GTAA 2L57A 4N0VA 4IJIA 3IAS2 1SL0B 1KTEA 3IE3A 3H4KA 3DVXA 1YY7A 2P0GA 2B7KA 4HU7A 4OCFA 1NHOA 3UBLA 1QQ2A 4D73A 1PX6A 2I3YA 2VL9A
chains in the Genus database with same CATH superfamily
2IFQA 2K8VA 5DAKB 1EP8A 1XWCA 1VF4A 3KTLA 1THOA 1M3JA 4XS1A 4ECJA 3KIJA 1EOGA 3I43A 2IMDA 1K0DA 3QR6A 1TW9A 4NPBA 3J7Yk 3IOSA 2IWTA 2L6DA 5HR2A 4PUAA 2VAFA 4IP1A 3IC8A 1M2BA 2P5QA 2X99A 1YJ6A 3FR9A 1H4OA 4F03A 4RI6A 2LRTA 1BG1A 2MYGA 3ED3A 1GUMA 2AJQB 4Q5FA 11GSA 3L4NA 4WR4A 2KLXA 4NHWA 2PN8A 4YKGA 4EVMA 3KEBA 4OO4A 3GUSA 4V1Ap 4BVXB 3F6FA 3GA4A 2VO4A 3GFKA 4BA7A 5G1LA 2C80A 4IJ3A 4IN0A 2DIZA 5ELAA 3HVNA 3WGDA 3HXSA 1SENA 1ZOFA 2OE0A 2I4AA 4FO5A 3KMOA 1YKCA 2R2JA 1BG5A 2OE1A 4YQMA 3DWVA 4MMMA 2KHPA 2YWMA 2H6YA 4MA9A 2FWFA 2X8GA 2BMXA 2WB9A 2OKAA 3HJPA 3UJ1A 1XFLA 2H1BA 4FIWA 5CNWA 3IA1A 3TKRA 1HD2A 2VOCA 1WOUA 3VI7A 2IJYA 2LJRA 1GLQA 5ENUA 3TDGA 4RQXA 4DSSA 2KUCA 1HQOA 2ON7A 5KN0A 3FEUA 1F9MA 3V1WA 4OFNA 5ECQB 4CY6A 4EXJA 2VM2A 2C0EA 2CVDA 3VURA 4I2UA 4Q5NA 3EE2A 3GN3A 4I97A 2HRKA 1PX7A 1PA3A 4GTUA 1XBSA 4HDEA 3TJJA 1TRWA 1ZYPA 1EEMA 1TOFA 1UVZA 4G01A 2CAQA 2O3EA 2LQQA 5HFGA 1WRYA 5JCUA 4OFMA 2R4VA 3KP8A 1O73A 5KN1A 2CA8A 4FYCA 3TKSC 4L5OA 3FR3A 1AC1A 3AY8A 2LNSA 3F3RA 3TB2A 3W8SA 3EMPA 4WF5A 2DMLA 2EFHA 1YF1A 2P5RA 3MNGA 2AHEA 2E0QA 5IOXA 3FZAA 3TKQA 10GSA 2ZNMA 4V2NA 2M46A 2YWIA 4HJMA 3E9JB 1S3AA 1AIUA 1WE0A 4NAXA 2B5XA 1FB6A 3FHKA 1NW2A 1U3IA 3RGBC 4BWQA 2V6OA 4NXIA 3OR5A 3G7YA 1BYEA 2PVQA 4YAPA 2KOKA 2XPEA 4QQ7A 2CQ9A 1OE8A 1ZL9A 4G9HA 3M0FA 3LW9A 4MLYA 4MP4A 3QMXA 1A0FA 3BBYA 2D2ZA 4CW9A 4WR5A 14GSA 1OAZA 3UEMA 5GSSA 1WP0A 2LSTA 3W8JA 4IKHA 1SYXA 3QAVA 3ERWA 3CHXC 1T4YA 3ZIJA 1FB0A 4MF5A 4K5RA 2GTUA 4N10A 1TXUA 6GSUA 3CXGA 1OC3A 3KM6A 3UOMA 3KZQA 4K7NA 3IR4A 3MYDA 2GSSA 5AISA 5F05A 2C0GA 2PERA 4LLRA 2VLVA 4MH3A 1ERWA 3D0ZA 4X0XA 2UV8G 2WFCA 2AUVA 3M9KA 1O8XA 2G2QA 2OBKA 5D8IA 3FR6A 5ECIB 1OC9B 3APQA 4BVYB 2VUPA 1XWAA 4O32A 3UL3A 2HQTA 3IXRA 4IHUA 3UVTA 1PFOA 1J9BA 5B8BA 2JSZA 2DC5A 8GSSA 3ERFA 2GZPA 5DBQA 1EEJA 2C4JA 4Z2TA 3CSJA 2R6KA 5G31A 1YF0A 1QK8A 1F6MC 3ZIVA 2A2RA 1Z6MA 2MZCA 4EIPA 1SVLA 2H70A 4KSMA 1Y25A 4HEA2 3TJFA 1T3BA 1A8LA 1XCCA 2X64A 3J7Yb 4LMWA 1K0CA 2JZSA 4TR1B 2YZUA 1GTUA 1RK4A 5ECPB 3VLNA 4BWSA 2WZSA 1AQWA 3FKFA 3ZVJD 6GSVA 2WW0A 2WJUA 5IM9A 2JSYA 1DBYA 1X9WB 5A4VA 3WT2A 3M8NA 3FZ4A 3LYKA 1O81A 2YV7A 1EOHA 4G2EA 1PN9A 5DQYA 1K3OA 1AAZA 4O7HA 5KN2A 5D9VA 3L9SA 3EU4A 4IVFA 2K8SA 2DLXA 3F0IA 1U88A 4PGTA 4DSQA 1PKWA 2R0GA 2EIOA 2GQMA 3O3TA 4I6XA 1B8XA 2YJ7A 5EPFA 2C0FA 3HDCA 4N30A 1X9MB 3MSZA 2R0PA 1M9BA 1M3IA 4G19A 2QGVA 2FLSA 4EC0A 3GIXA 4YH2A 1Z7RA 5IPGA 4TR3A 5ELGA 2XHFA 1DE1A 1O85A 2WW2A 3IAM2 3F3QA 3NOFA 2VLTA 3F4RA 1J0FA 2B5EA 3LQ7A 3BD2A 1XXUA 4KDXA 3I69A 1ZYEA 1TRSA 2O8VB 2K9FA 1YZXA 2DJJA 4MNNA 4AJ6A 4K5SA 3IDVA 3WT1A 4KUNA 2FCHA 3EMXA 4PI2C 2YN1A 3KTBA 4RI7A 5G2ZA 3FRCA 3DD3A 1TTZA 3LORA 2O89A 3SWLA 2GZZA 4TXOA 4TW5A 2X4AA 2HSMA 2WVXB 5INYA 2LTKA 4I8BA 4WBRD 5EVOA 2RLIA 4GXZA 1J08A 4OMVA 1XPVA 5J47A 2C3NA 1OE7A 4EDYA 4EO3A 4TXOB 4F0CA 4TR4A 3C71A 1K3YA 1X5CA 4JU5A 3EURA 1SJZA 5E4WA 1BF5A 5DALB 1XW5A 1EV4A 1LBKA 5CRWA 2H1LA 2YCDA 4JBBA 3QPMA 4KW6A 2DJ3A 2QKEA 2AYTA 1T7PB 4YKFA 3A2VA 5ABRA 1Z5YE 1TRUA 3GL5A 3EC3A 1C72A 2N5AA 2YP6A 2MBSA 1V2AA 3KJYA 5JWOB 4I2TA 2H0HA 4XS4A 2JU5A 4KNDA 1PL1A 3WD6A 1MTCA 5IMZA 3KH9A 2GSTA 3DVWA 2PGTA 3GH9A 4N11A 1T00A 2MMAA 3ME7A 1S3RA 4CY8A 1SK1A 2PMTA 1OKTA 2VD0A 1JZRA 1SL1B 1T1VA 1KBNA 2CT6A 5ECSA 3FK8A 4WXTA 3KP9A 4FH8A 5E59A 1AQXA 4L8EA 1XOAA 3KGKA 2IMIA 4OD7A 4QL7A 5DAKA 2DIYA 2K6VA 3VWUA 1WMJA 5GAPD 3HY2A 4PURA 3C8EA 1XVQA 5D9XA 5B6NA 2HSHA 2A2PA 1KNGA 2QC7A 5CRHA 3D5JA 1E2YA 5GSTA 1PL2A 4POLA 3FZ9A 1V98A 1NM3A 3O76A 1XWBA 22GSA 3GRXA 2FD3A 1B4QA 5IMDA 4CHSA 4BVXA 4ID0A 2I9HA 1EGRA 4DEJA 3PR8A 3GNJA 1FVKA 4ML6A 4ZB6A 2AV4A 3A2WA 5FT3A 1M0UA 3DIEA 3IC4A 2IMKA 3QAWA 1BAYA 3EYTA 1GLPA 1UA5A 2EIQA 3CSHA 3VPTA 2E2MA 4AJ8A 4ECIA 3RBTA 2DJ1A 3RPPA 4POKA 4POBA 1V40A 5A5KA 4K0NA 3HZ8A 2WRTA 4ZB9A 6GSWA 2TIRA 3M3MA 1S3DA 4KCAA 4AJ7A 3TOUA 1RW1A 1GTIA 3TKSE 2IN3A 1ON4A 3HA9A 5IOWA 2ES7A 3H1NA 1SKWB 1GRXA 5F06A 5CRDA 1B4PA 3P7XA 5J9CA 4OO5A 3BOAA 3TRQA 4N3ZA 4IQAA 1I1IP 1SU9A 1ZMAA 3IHQA 1VF3A 1N8JA 5JWRB 4MJCA 3Q74A 4XCSA 4XHMA 1ML6A 2X8CA 5CO3A 6GSTA 2DMMA 4ZIJA 1FAAA 2GSRA 2JACA 4NV5A 2HZFA 1R7HA 1O8WA 4XIHA 2K18A 2IMEA 3N9JA 1NSWA 4ZILA 3ME8A 5GAND 2XC2A 2R37A 4KX4A 2PVOC 3UARA 4N0ZA 1Q4JA 5J4YA 5CREA 4PI0C 5ID2B 2IPAA 4HSCX 3LXZA 5H5RA 2H1DA 2LRCA 5IO0A 2HSYA 3IPZA 4O5UA 3GSSA 2CZ2A 1A0RP 1SJIA 4KF9A 5ECKB 5J41A 4W66A 5DQSA 1XW9A 4FYBA 3DXBA 4EIQA 4NMUA 5JCGA 3C1RA 1YEXA 1TDIA 4IELA 2FWGA 2H1GA 3PGTA 4LL4B 5IMAA 3L0HA 5CAXA 1WJKA 2VCWA 4MJEA 1FOVA 5KOWA 2LS5A 1K0NA 4FXYP 3A5IA 3LWAA 3LYPA 5B6MA 1SYRA 18GSA 5C00A 3HMJG 4OWYA 2OA7A 3WGEA 1AXDA 3TRPA 4Q5QA 4K7IA 1OYJA 4ISDA 4USSA 1U6TA 2FUG2 4GSNA 1OC8A 2HFDA 5DVBA 4KDYA 4GQFA 1ERUA 1AUCA 5DJLA 2DJ0A 1XWGA 2N5BA 5DJMA 2HZEB 5AIVA 5F07A 2L4CA 4IP6A 1GSDA 2H8LA 1OC9A 4EL1A 4BVYA 1Y1UA 3RAZA 5IQYA 5G30A 1Q98A 1ST9A 4XRAA 3L9UA 1JFUA 1K0BA 3QFAC 1H75A 4MH2A 5ECMB 4ECCA 2B1KA 3W6GA 4G0LA 2O36A 2H72A 4TOPA 2V2GA 3GX0A 3EU3A 4MPFA 5AGYA 5EL8A 3ZREA 2JZRA 1B48A 2NPBA 1PKZA 2MMNA 3QOUA 3VWVA 2F8FA 6GSSA 3E3EA 4H86A 1W4VA 1FHEA 3Q6OA 3DKSA 5D93A 2DSAA 3ZVJA 4PNFA 4POMA 3GX8A 2VD1A 1BX9A 1TXXA 1VF1A 4TR1A 3VWXA 3I9V2 2M80A 5C04A 1QGVA 1GL8A 2JZTA 4V2LA 4JZQA 4TRXA 2GDRA 3WYWA 4ULXA 1GSSA 4Z2UA 5ECNB 1X0RA 4MPGA 2HRAA 3M1GA 2V41A 3GKNA 2H1AA 3IK7A 16GSA 3SBCA 4K7OA 3TGZA 5BMUB 1PN0A 4GQCA 4IQ1A 1I9DA 5IMCA 5J5NA 4PX1A 3ZLPA 2H74A 4RUVA 1F37A 2LRNA 1ABAA 4MZCA 2DKHA 4ZB8A 2GT6A 5ECRB 13GSA 5A1NB 2C0DA 3M9JA 4HS1A 2M72A 2MBTA 2B7JA 1WPIA 3KXOA 3US3A 5JCWA 3JCML 1X5EA 7GSSA 2EFCA 1FO5A 4MJAA 4KA0A 3IRAA 1IYHA 4F2IA 3UMAA 1G7OA 3HYPA 4ILFA 3LXTA 1KEBA 3ZMKA 5BRTA 3PH9A 5L71A 1E6BA 1LU4A 2BJXA 2VL2A 5J4UA 4KCEA 1EWXA 4AGSA 4A5PA 4AI6A 1M2DA 4PQIA 4MF7A 2YZHA 4Z7XA 3GYKA 1BQ7A 1G6YA 1PQNA 2YWOA 4ZL7A 3HZ4A 1OVNA 3VFIA 4GF0A 4HQZA 2L4QA 1XIYA 1MD3A 2VKZG 2FA8A 2N5FA 2H75A 3QDNA 2OBIA 3LG6A 1AW9A 2V6KA 3A3TA 2WZ9A 4Q5RA 2OJLA 1SVMA 4JRRA 2F8AA 1PGTA 5A5HA 1FW1A 2HLSA 2E2GA 3F4TA 5FWGA 4BPYA 3D4MA 3U5RE 2OADA 4K0GA 4HUAA 1SKRB 3H8QA 1ACVA 3TCOA 2WVXA 4BL7B 3PINA 2OT3A 4CDOA 1Z6NA 3MAKA 2ZUPA 5A5HB 1A2MA 4FYUA 1GULA 3IHGA 4HI7A 2EIRA 3UBKA 2WVZA 4P3YB 4DVCA 1M2AA 1EP7A 4HZ2A 2HT9A 5DALA 3F6DA 5HR0A 1O6JA 2WW3A 4L5LA 4GCIA 4F9ZA 2TRCP 4ZXGA 5DCHA 1PD21 3GTUB 3CTGA 1U87A 1G6WA 4GLTA 4AKIA 1HYUA 2GS3A 2J23A 3HKRA 2A2SA 3CTFA 2WGRA 4X4JA 1XVWA 1YDKA 1GH2A 1FG4A 3EINA 3A5WA 2JADA 4I5QA 2QSIA 2CZ3A 3UVHA 3GKKA 2HYXA 3VI5A 1FOHA 2H01A 4O92A 6GSXA 1GUHA 5ECLB 4IW9A 2L59A 3CYNA 3D6IA 3TJGA 4YQVA 2HI7A 1ZGNA 4GSSA 2NTOA 3EWLA 3R2QA 4MJBA 1SK2A 3GSTA 4DSRA 1MDJA 3GKXA 1TK5B 1VGLA 1UN2A 2LV3A 3ZYWA 5HR1A 2EFEA 2AB6A 1PMTA 4PHZC 4EE0A 3FW2A 1TK8B 1K0AA 1A2JA 1R5AA 4HJ2A 2CX3A 4G0KA 3TOTA 1U3AA 5J9BA 2EFDA 3NZNA 2WW1A 1SVOA 2V32A 4G10A 4K9ZA 2X49A 3P8WA 4X1UA 4KE3A 1ERTA 2H0IA 4WEYA 3TRXA 3G7IA 1F3AA 1JZDA 2KP1A 1EZKA 3DGQA 2GQLA 3ZFBA 2P31A 2LJAA 1NHYA 2NDOA 2ALBA 3D4TA 1TKDB 1SL2B 1HNAA 2WS2A 3BJ5A 1GTBA 3LEFA 2LUSA 3G9BA 2DKIA 1JZWA 5D9WA 2GVPA 3ZFLA 4O5RA 3RHCA 5KOXA 4AKHA 3RHBA 3D21A 3GL3A 2XPDA 3ZRDA 1XW6A 1DSBA 1CQGA 1TRVA 1VRSD 2IL3A 1QXHA 5A34B 4Z2RA 4D73B 2RUEA 4MZWA 2VL3A 2IFQB 5HR3A 2ON5A 2WVYA 3CRUA 2RIIA 1QFNA 5FHIA 3TKPA 3CMIA 2C3QA 4KH7A 1X9SB 1M9AA 4AKGA 3GH6A 1URMA 1LJRA 2E7PA 4KSOA 3MDKA 1A24A 2FNOA 1YEWC 2O87A 4EDZA 1BJXA 1GSEA 2QA1A 2B3SA 4K6XA 1HNBA 1WWJA 1A23A 1RQMA 4WKWA 2NVLA 1ZYNA 2O5VA 5G1KA 1YQ1A 2L5LA 2WDUA 3VK9A 2MMOA 1T8EB 1GSUA 4HOJA 4EKZA 3TKSA 3TU3B 1VF2A 3HCZA 1Y6EA 2AAWA 3C1SA 3ZMLA 5IMFA 4WF4A 2GQKA 2V1MA 2TRXA 5DCGA 2LKUA 2LQOA 3F4SA 1V57A 5ID2A 1Z9HA 1SK0A 5CP1A 5G5EA 3S9FA 5DDLA 2H71A 4KB3A 1K0OA 1TJDA 5GZZB 2CVBA 2VCXA 1MDIA 3Q18A 2BTOT 2H76A 1A8YA 1XOBA 2I1UA 5A4UA 1GNWA 3NIVA 4DSSB 2YOIA 2RM6A 2YNXA 1BEDA 1DUGA 2FWEA 4JR6A 3GURA 2L5OA 1SKSB 4HZ4A 3IV4A 3TJKA 5IO2A 1ZYQB 4PQHA 2HRKB 4QL9A 4JR4A 2B1LA 3P2AA 3WGXA 5KEJA 5J4VA 4KDUA 2MMZA 4ZBDA 2DJ2A 3IBHA 3CQFA 1M7TA 5LNKe 4HU9A 1K3LA 5H5SA 4K8MA 2YV9A 5G5FA 3K8NA 3QAGA 2H6ZA 3HD5A 4K1FA 2PWJA 5CYYA 2HZEA 1USBA 2PUKC 3H79A 2EC4A 2IIYA 2DBCA 2H30A 5D73A 4XRDA 4ZBBA 3F63A 3R3EA 1XWKA 1V9WA 4X43A 3QCPA 4XS6A 3QD9A 1GNEA 3G7JA 1QUWA 2CV4A 3RDWA 1X5DA 2OE3A 3H93A 1N2AA 1G0TA 3C7MA 1T4ZA 2YWNA 2B5YA 3DMLA 5ECOB 4YAVA 2O7KA 1I5GA 5J40A 4E8HA 4ZL8A 3C73A 4IS0A 2VCQA 2VCTA 2A4HA 1YVLA 2HNLA 2YPMA 4EUYA 2A4VA 3CWGA 1CQHA 2HE3A 2LJKA 1ILOA 3GMFA 3LJRA 4KAEA 2CX4A 4KGIA 3ZITA 2HSNA 3HVSA 1SD9A 1GSQA 3LSZA 5CRGA 3APOA 4MK3A 1YEPA 1ZZYA 2R0CA 1AQVA 2GZYA 1OKDA 2H73A 2Z9SA 4NV2A 3HHVA 3KH7A 2HSNB 2PBJA 2FWHA 3EVIA 4MCUA 2QA2A 1TU7A 4ML1A 2KP2A 1GWCA 2ZCTA 3A2XA 4J57E 4L0UA 4AKXB 1R4WA 4NWYA 2REMA 3APSA 5BMUA 1DE2A 1Z3EA 3F8UA 1M99A 2X8HA 2PPTA 5IPHA 2IMFA 1WIKA 4ACSA 4FQUA 1B9XC 3KD0A 3ZL5A 2F3MA 3ZTLA 5IMVA 5A1NA 4L0WA 4TKYA 4QMKA 3QFBC 1FVJA 3F9UA 2WCIA 2C3TA 1ZCPA 3GKMA 2LNTA 4GSTA 4IBPA 5F8BA 1O7UA 2JL4A 2VIMA 3P90A 1SJ6A 4RQRA 4JE1A 1B9YC 2GT5A 2R5GA 2YJHA 4LA1A 5B7CA 2O85A 2H6XA 2J9HA 3UIWA 3U6VA 1JHBA 1JLVA 2LEGA 4GDFA 1TI1A 4ZL9A 2G0FA 2HXKA 4NHZA 1THXA 4ICYA 2GSQA 5LCZA 4BIKA 5ECHB 1EGOA 4J56E 2C1YA 5B8AA 3VPQA 2B6MA 1YKAA 3RFRC 1Z7PA 5H5QA 5HQPA 4K2XA 2RUFA 2UZ8A 2CAIA 1TU8A 2VCVA 1GP1A 19GSA 4ZBAA 3ISOA 4PNGA 4PTSA 3VWWA 4LMVA 2HRFA 3CRTA 1A2LA 5HFIA 5D96A 4F0BA 3DEXA 3HJMA 4LL1B 4AF2A 1JLWA 2CVKA 4F82A 5KN3A 4BL7A 1MDKA 3GV1A 3IK9A 5AN1A 2FHEA 2F9SA 4WBJA 3L9VA 2YANA 3FYGA 1GSYA 1PSQA 2VL2C 2RM5A 4OCEA 1XG8A 2FY6A 4GRFA 3ZZXA 2HRNA 1IYIA 1K0MA 1TK0B 4O5QA 4XTSA 2XBQA 1ERVA 4V1Ag 3DRNA 5LD0A 5IIZA 4IGJA 5HFKA 5JWQB 1S4BP 1QMVA 2H66A 3FZ5A 3Q19A 3DYRA 4OFTA 3GTUA 3TJBA 9GSSA 3BCKA 2DJKA 3FY7A 3GHAA 5F0GA 3L78A 4HQSA 3LFLA 2VCZA 1UC7A 3KMNA 3MWHA 1F2EA 2PU9C 2L6CA 4ECBA 3BCIA 4PUFC 3N5OA 3KCMA 3MIXA 4TN8A 12GSA 4GWRA 5EY6A 4TR0A 2FGXA 2C8UA 3FMWA 1N25A 2R3XA 2H19A 17GSA 4WETA 4TXVA 2HSMB 2OACA 1V58A 4PXOA 2GLRA 1S3CA 3TUEA 2FA4A 4V2MA 4K2DA 5D9TA 3RPNA 1G7EA 1TP9A 5J3RA 2VLUA 1GUKA 2VM1A 5A4WA 20GSA 2GGTA 4E8EA 2H0GA 3UAPA 2F51A 4EF0A 1EV9A 1F3BA 4MF6A 3O6TA 2I81A 4PQ1A 5COHA 4E68A 2NBSA 1R26A 4YQUA 2WULA 1GSFA 1TI3A 4MABA 1R5PA 3HVXA 4JEDA 3ERGA 3I6AA 2XBIA 3D22A 3HJOA 3HVVA 1SD8A 4MDCA 4G0IA 5AIXA 4XS4B 3CBUA 3LGCA 4ZB7A 1PRXA 1MD4A 1MEKA 1XZOA 1W89A 6GSYA 1HNCA 4J2FA 3E0UA 4TVEA 4MZBA 3PPUA 3CSIA 1JZOA 1GTAA 2L57A 4N0VA 4IJIA 3EPTA 3IAS2 1SL0B 1KTEA 3IE3A 3H4KA 3DVXA 1YY7A 2P0GA 2B7KA 4HU7A 4OCFA 1NHOA 3UBLA 1QQ2A 5A34A 4D73A 1PX6A 2I3YA 2VL9A
chains in the Genus database with same CATH topology
2IFQA 2K8VA 5DAKB 1EP8A 1XWCA 1VF4A 3KTLA 1THOA 4XS1A 4ECJA 3KIJA 1EOGA 3I43A 2IMDA 1K0DA 3QR6A 1TW9A 4NPBA 3J7Yk 3IOSA 2IWTA 2L6DA 5HR2A 4PUAA 2VAFA 4IP1A 3IC8A 1M2BA 2P5QA 2X99A 1YJ6A 3FR9A 1H4OA 4F03A 4RI6A 2LRTA 1BG1A 2MYGA 3ED3A 1GUMA 2AJQB 4Q5FA 11GSA 3L4NA 4WR4A 2KLXA 4NHWA 2PN8A 4YKGA 4EVMA 3KEBA 4OO4A 3GUSA 4V1Ap 4BVXB 3F6FA 3GA4A 2VO4A 3GFKA 4BA7A 5G1LA 2C80A 4IJ3A 4IN0A 2DIZA 5ELAA 3WGDA 3HXSA 1SENA 1ZOFA 2OE0A 2I4AA 4FO5A 3KMOA 1YKCA 2R2JA 1BG5A 2OE1A 4YQMA 3DWVA 4MMMA 2KHPA 2YWMA 2H6YA 4MA9A 2FWFA 2X8GA 2BMXA 2WB9A 2OKAA 3HJPA 3UJ1A 1XFLA 2H1BA 4FIWA 5CNWA 3IA1A 3TKRA 1HD2A 2VOCA 1WOUA 3VI7A 2IJYA 2LJRA 1GLQA 5ENUA 3TDGA 4RQXA 4DSSA 2KUCA 1HQOA 2ON7A 5KN0A 3FEUA 1F9MA 3V1WA 4OFNA 5ECQB 4CY6A 4EXJA 2VM2A 2C0EA 2CVDA 3VURA 4I2UA 4Q5NA 3EE2A 3GN3A 4I97A 2HRKA 1PX7A 1PA3A 4GTUA 1XBSA 4HDEA 3TJJA 1TRWA 1ZYPA 1EEMA 1TOFA 1UVZA 4G01A 2CAQA 2LQQA 5HFGA 1WRYA 5JCUA 4OFMA 2R4VA 3KP8A 1O73A 5KN1A 2CA8A 4FYCA 3TKSC 4L5OA 3FR3A 1AC1A 3AY8A 2LNSA 3F3RA 3TB2A 3W8SA 3EMPA 4WF5A 2DMLA 2EFHA 1YF1A 2P5RA 3MNGA 2AHEA 2E0QA 5IOXA 3FZAA 3TKQA 10GSA 2ZNMA 4V2NA 2M46A 2YWIA 4HJMA 3E9JB 1S3AA 1AIUA 1WE0A 4NAXA 2B5XA 1FB6A 3FHKA 1NW2A 1U3IA 4BWQA 2V6OA 4NXIA 3OR5A 3G7YA 1BYEA 2PVQA 4YAPA 2KOKA 2XPEA 4QQ7A 2CQ9A 1OE8A 1ZL9A 4G9HA 3M0FA 3LW9A 4MLYA 4MP4A 3QMXA 1A0FA 3BBYA 2D2ZA 4CW9A 4WR5A 14GSA 1OAZA 3UEMA 5GSSA 1WP0A 2LSTA 3W8JA 4IKHA 1SYXA 3QAVA 3ERWA 1T4YA 3ZIJA 1FB0A 4MF5A 4K5RA 2GTUA 4N10A 1TXUA 6GSUA 3CXGA 1OC3A 3KM6A 3UOMA 3KZQA 4K7NA 3IR4A 3MYDA 2GSSA 5AISA 5F05A 2C0GA 2PERA 4LLRA 2VLVA 4MH3A 1ERWA 3D0ZA 4X0XA 2UV8G 2WFCA 2AUVA 3M9KA 1O8XA 2G2QA 2OBKA 5D8IA 3FR6A 5ECIB 1OC9B 3APQA 4BVYB 2VUPA 1XWAA 4O32A 3UL3A 2HQTA 3IXRA 4IHUA 3UVTA 1J9BA 5B8BA 2JSZA 2DC5A 8GSSA 3ERFA 2GZPA 5DBQA 1EEJA 2C4JA 4Z2TA 3CSJA 2R6KA 5G31A 1YF0A 1QK8A 1F6MC 3ZIVA 2A2RA 1Z6MA 2MZCA 4EIPA 1SVLA 2H70A 4KSMA 1Y25A 4HEA2 3TJFA 1T3BA 1A8LA 1XCCA 2X64A 3J7Yb 4LMWA 1K0CA 2JZSA 4TR1B 2YZUA 1GTUA 1RK4A 5ECPB 3VLNA 4BWSA 1AQWA 3FKFA 3ZVJD 6GSVA 2WJUA 5IM9A 2JSYA 1DBYA 1X9WB 5A4VA 3WT2A 3M8NA 3FZ4A 3LYKA 1O81A 2YV7A 1EOHA 4G2EA 1PN9A 5DQYA 1K3OA 1AAZA 4O7HA 5KN2A 5D9VA 3L9SA 3EU4A 4IVFA 2K8SA 2DLXA 3F0IA 1U88A 4PGTA 4DSQA 1PKWA 2R0GA 2EIOA 2GQMA 3O3TA 4I6XA 1B8XA 2YJ7A 5EPFA 2C0FA 3HDCA 4N30A 1X9MB 3MSZA 2R0PA 1M9BA 4G19A 2QGVA 2FLSA 4EC0A 3GIXA 4YH2A 1Z7RA 5IPGA 4TR3A 5ELGA 2XHFA 1DE1A 1O85A 3IAM2 3F3QA 3NOFA 2VLTA 3F4RA 1J0FA 2B5EA 3LQ7A 3BD2A 1XXUA 4KDXA 3I69A 1ZYEA 1TRSA 2O8VB 2K9FA 1YZXA 2DJJA 4MNNA 4AJ6A 4K5SA 3IDVA 3WT1A 4KUNA 2FCHA 3EMXA 2YN1A 3KTBA 4RI7A 5G2ZA 3FRCA 3DD3A 1TTZA 3LORA 2O89A 3SWLA 2GZZA 4TXOA 4TW5A 2X4AA 2HSMA 5INYA 2LTKA 4I8BA 4WBRD 5EVOA 2RLIA 4GXZA 1J08A 4OMVA 1XPVA 5J47A 2C3NA 1OE7A 4EDYA 4EO3A 4TXOB 4F0CA 4TR4A 3C71A 1K3YA 1X5CA 4JU5A 3EURA 1SJZA 5E4WA 1BF5A 5DALB 1XW5A 1EV4A 1LBKA 5CRWA 2H1LA 2YCDA 4JBBA 3QPMA 4KW6A 2DJ3A 2QKEA 2AYTA 1T7PB 4YKFA 3A2VA 5ABRA 1Z5YE 1TRUA 3GL5A 3EC3A 1C72A 2N5AA 2YP6A 2MBSA 1V2AA 3KJYA 5JWOB 4I2TA 2H0HA 4XS4A 2JU5A 4KNDA 1PL1A 3WD6A 1MTCA 5IMZA 3KH9A 2GSTA 3DVWA 2PGTA 3GH9A 4N11A 1T00A 2MMAA 3ME7A 4CY8A 1SK1A 2PMTA 1OKTA 2VD0A 1JZRA 1SL1B 1T1VA 1KBNA 2CT6A 5ECSA 3FK8A 4WXTA 3KP9A 4FH8A 5E59A 1AQXA 4L8EA 1XOAA 3KGKA 2IMIA 4OD7A 4QL7A 5DAKA 2DIYA 2K6VA 3VWUA 1WMJA 5GAPD 3HY2A 4PURA 3C8EA 1XVQA 5D9XA 5B6NA 2HSHA 2A2PA 1KNGA 2QC7A 5CRHA 3D5JA 1E2YA 5GSTA 1PL2A 4POLA 3FZ9A 1V98A 1NM3A 3O76A 1XWBA 22GSA 3GRXA 2FD3A 1B4QA 5IMDA 4CHSA 4BVXA 4ID0A 2I9HA 1EGRA 4DEJA 3PR8A 3GNJA 1FVKA 4ML6A 4ZB6A 2AV4A 3A2WA 5FT3A 1M0UA 3DIEA 3IC4A 2IMKA 3QAWA 1BAYA 3EYTA 1GLPA 1UA5A 2EIQA 3CSHA 3VPTA 2E2MA 4AJ8A 4ECIA 3RBTA 2DJ1A 3RPPA 4POKA 4POBA 1V40A 5A5KA 4K0NA 3HZ8A 2WRTA 4ZB9A 6GSWA 2TIRA 3M3MA 1S3DA 4KCAA 4AJ7A 3TOUA 1RW1A 1GTIA 3TKSE 2IN3A 1ON4A 3HA9A 5IOWA 2ES7A 3H1NA 1SKWB 1GRXA 5F06A 5CRDA 1B4PA 3P7XA 5J9CA 4OO5A 3BOAA 3TRQA 4N3ZA 4IQAA 1SU9A 1ZMAA 3IHQA 1VF3A 1N8JA 5JWRB 4MJCA 3Q74A 4XCSA 4XHMA 1ML6A 2X8CA 5CO3A 6GSTA 2DMMA 4ZIJA 1FAAA 2GSRA 2JACA 4NV5A 2HZFA 1R7HA 1O8WA 4XIHA 2K18A 2IMEA 3N9JA 1NSWA 4ZILA 3ME8A 5GAND 2XC2A 2R37A 4KX4A 2PVOC 3UARA 4N0ZA 1Q4JA 5J4YA 5CREA 5ID2B 2IPAA 3LXZA 5H5RA 2H1DA 2LRCA 5IO0A 2HSYA 3IPZA 4O5UA 3GSSA 2CZ2A 1A0RP 1SJIA 4KF9A 5ECKB 5J41A 4W66A 5DQSA 1XW9A 4FYBA 3DXBA 4EIQA 4NMUA 5JCGA 3C1RA 1YEXA 1TDIA 4IELA 2FWGA 2H1GA 3PGTA 4LL4B 5IMAA 3L0HA 5CAXA 1WJKA 2VCWA 4MJEA 1FOVA 5KOWA 2LS5A 1K0NA 3A5IA 3LWAA 3LYPA 5B6MA 1SYRA 18GSA 5C00A 3HMJG 4OWYA 2OA7A 3WGEA 1AXDA 3TRPA 4Q5QA 4K7IA 1OYJA 4ISDA 4USSA 1U6TA 2FUG2 4GSNA 1OC8A 2HFDA 5DVBA 4KDYA 4GQFA 1ERUA 1AUCA 5DJLA 2DJ0A 1XWGA 2N5BA 5DJMA 2HZEB 5AIVA 5F07A 2L4CA 4IP6A 1GSDA 2H8LA 1OC9A 4EL1A 4BVYA 1Y1UA 3RAZA 5IQYA 5G30A 1Q98A 1ST9A 4XRAA 3L9UA 1JFUA 1K0BA 3QFAC 1H75A 4MH2A 5ECMB 4ECCA 2B1KA 3W6GA 4G0LA 2H72A 4TOPA 2V2GA 3GX0A 3EU3A 4MPFA 5AGYA 5EL8A 3ZREA 2JZRA 1B48A 2NPBA 1PKZA 2MMNA 3QOUA 3VWVA 2F8FA 6GSSA 3E3EA 4H86A 1W4VA 1FHEA 3Q6OA 3DKSA 5D93A 2DSAA 3ZVJA 4PNFA 4POMA 3GX8A 2VD1A 1BX9A 1TXXA 1VF1A 4TR1A 3VWXA 3I9V2 2M80A 5C04A 1QGVA 1GL8A 2JZTA 4V2LA 4JZQA 4TRXA 2GDRA 3WYWA 4ULXA 1GSSA 4Z2UA 5ECNB 1X0RA 4MPGA 2HRAA 3M1GA 2V41A 3GKNA 2H1AA 3IK7A 16GSA 3SBCA 4K7OA 3TGZA 5BMUB 1PN0A 4GQCA 4IQ1A 1I9DA 5IMCA 5J5NA 4PX1A 3ZLPA 2H74A 4RUVA 1F37A 2LRNA 1ABAA 4MZCA 2DKHA 4ZB8A 2GT6A 5ECRB 13GSA 5A1NB 2C0DA 3M9JA 4HS1A 2M72A 2MBTA 2B7JA 1WPIA 3KXOA 3US3A 5JCWA 3JCML 1X5EA 7GSSA 2EFCA 1FO5A 4MJAA 4KA0A 3IRAA 1IYHA 4F2IA 3UMAA 1G7OA 3HYPA 4ILFA 3LXTA 1KEBA 3ZMKA 5BRTA 3PH9A 5L71A 1E6BA 1LU4A 2BJXA 2VL2A 5J4UA 4KCEA 1EWXA 4AGSA 4A5PA 4AI6A 1M2DA 4PQIA 4MF7A 2YZHA 4Z7XA 3GYKA 1BQ7A 1G6YA 1PQNA 2YWOA 4ZL7A 3HZ4A 1OVNA 3VFIA 4GF0A 4HQZA 2L4QA 1XIYA 1MD3A 2VKZG 2FA8A 2N5FA 2H75A 3QDNA 2OBIA 3LG6A 1AW9A 2V6KA 3A3TA 2WZ9A 4Q5RA 2OJLA 1SVMA 4JRRA 2F8AA 1PGTA 5A5HA 1FW1A 2HLSA 2E2GA 3F4TA 5FWGA 4BPYA 3D4MA 3U5RE 2OADA 4K0GA 4HUAA 1SKRB 3H8QA 1ACVA 3TCOA 4BL7B 3PINA 2OT3A 4CDOA 1Z6NA 3MAKA 2ZUPA 5A5HB 1A2MA 4FYUA 1GULA 3IHGA 4HI7A 2EIRA 3UBKA 4P3YB 4DVCA 1M2AA 1EP7A 4HZ2A 2HT9A 5DALA 3F6DA 5HR0A 1O6JA 4L5LA 4GCIA 4F9ZA 2TRCP 4ZXGA 5DCHA 1PD21 3GTUB 3CTGA 1U87A 1G6WA 4GLTA 4AKIA 1HYUA 2GS3A 2J23A 3HKRA 2A2SA 3CTFA 2WGRA 4X4JA 1XVWA 1YDKA 1GH2A 1FG4A 3EINA 3A5WA 2JADA 4I5QA 2QSIA 2CZ3A 3UVHA 3GKKA 2HYXA 3VI5A 1FOHA 2H01A 4O92A 6GSXA 1GUHA 5ECLB 4IW9A 2L59A 3CYNA 3D6IA 3TJGA 4YQVA 2HI7A 1ZGNA 4GSSA 2NTOA 3EWLA 3R2QA 4MJBA 1SK2A 3GSTA 4DSRA 1MDJA 3GKXA 1TK5B 1VGLA 1UN2A 2LV3A 3ZYWA 5HR1A 2EFEA 2AB6A 1PMTA 3FW2A 4EE0A 1TK8B 1K0AA 1A2JA 1R5AA 4HJ2A 2CX3A 4G0KA 3TOTA 1U3AA 5J9BA 2EFDA 3NZNA 2V32A 1SVOA 4G10A 4K9ZA 2X49A 3P8WA 4X1UA 4KE3A 1ERTA 2H0IA 4WEYA 3TRXA 3G7IA 1F3AA 1JZDA 2KP1A 1EZKA 3DGQA 2GQLA 3ZFBA 2P31A 2LJAA 1NHYA 2NDOA 2ALBA 3D4TA 1TKDB 1SL2B 1HNAA 2WS2A 3BJ5A 1GTBA 3LEFA 2LUSA 3G9BA 2DKIA 1JZWA 5D9WA 2GVPA 3ZFLA 4O5RA 3RHCA 5KOXA 4AKHA 3RHBA 3D21A 3GL3A 2XPDA 3ZRDA 1XW6A 1DSBA 1CQGA 1TRVA 1VRSD 2IL3A 1QXHA 5A34B 4Z2RA 4D73B 2RUEA 4MZWA 2VL3A 2IFQB 5HR3A 2ON5A 3CRUA 2RIIA 1QFNA 5FHIA 3TKPA 3CMIA 2C3QA 4KH7A 1X9SB 1M9AA 4AKGA 3GH6A 1URMA 1LJRA 2E7PA 4KSOA 3MDKA 1A24A 2FNOA 2O87A 4EDZA 1BJXA 1GSEA 2QA1A 2B3SA 4K6XA 1HNBA 1WWJA 1A23A 1RQMA 4WKWA 2NVLA 1ZYNA 2O5VA 5G1KA 1YQ1A 2L5LA 2WDUA 3VK9A 2MMOA 1T8EB 1GSUA 4HOJA 4EKZA 3TKSA 3TU3B 1VF2A 3HCZA 1Y6EA 2AAWA 3C1SA 3ZMLA 5IMFA 4WF4A 2GQKA 2V1MA 2TRXA 5DCGA 2LKUA 2LQOA 3F4SA 1V57A 5ID2A 1Z9HA 1SK0A 5CP1A 5G5EA 3S9FA 5DDLA 2H71A 4KB3A 1K0OA 1TJDA 5GZZB 2CVBA 2VCXA 1MDIA 3Q18A 2BTOT 2H76A 1A8YA 1XOBA 2I1UA 5A4UA 1GNWA 3NIVA 4DSSB 2YOIA 2RM6A 2YNXA 1BEDA 1DUGA 2FWEA 4JR6A 3GURA 2L5OA 1SKSB 4HZ4A 3IV4A 3TJKA 5IO2A 1ZYQB 4PQHA 2HRKB 4QL9A 4JR4A 2B1LA 3P2AA 3WGXA 5KEJA 5J4VA 4KDUA 2MMZA 4ZBDA 2DJ2A 3IBHA 1M7TA 5LNKe 4HU9A 1K3LA 5H5SA 4K8MA 2YV9A 5G5FA 3K8NA 3QAGA 2H6ZA 3HD5A 4K1FA 2PWJA 5CYYA 2HZEA 1USBA 2PUKC 3H79A 2EC4A 2IIYA 2DBCA 2H30A 5D73A 4XRDA 4ZBBA 3F63A 3R3EA 1XWKA 1V9WA 4X43A 3QCPA 4XS6A 3QD9A 1GNEA 3G7JA 1QUWA 2CV4A 3RDWA 1X5DA 2OE3A 3H93A 1N2AA 1G0TA 3C7MA 1T4ZA 2YWNA 2B5YA 3DMLA 5ECOB 4YAVA 2O7KA 1I5GA 5J40A 4E8HA 4ZL8A 3C73A 4IS0A 2VCQA 2VCTA 2A4HA 1YVLA 2HNLA 2YPMA 4EUYA 2A4VA 3CWGA 1CQHA 2HE3A 2LJKA 1ILOA 3GMFA 3LJRA 4KAEA 2CX4A 4KGIA 3ZITA 2HSNA 3HVSA 1SD9A 1GSQA 3LSZA 5CRGA 3APOA 4MK3A 1YEPA 1ZZYA 2R0CA 1AQVA 2GZYA 1OKDA 2H73A 2Z9SA 4NV2A 3HHVA 3KH7A 2HSNB 2PBJA 2FWHA 3EVIA 4MCUA 2QA2A 1TU7A 4ML1A 2KP2A 1GWCA 2ZCTA 3A2XA 4J57E 4L0UA 4AKXB 1R4WA 4NWYA 2REMA 3APSA 5BMUA 1DE2A 1Z3EA 3F8UA 1M99A 2X8HA 2PPTA 5IPHA 2IMFA 1WIKA 4ACSA 4FQUA 1B9XC 3KD0A 3ZL5A 2F3MA 3ZTLA 5IMVA 5A1NA 4L0WA 4TKYA 4QMKA 3QFBC 1FVJA 3F9UA 2WCIA 2C3TA 1ZCPA 3GKMA 2LNTA 4GSTA 4IBPA 5F8BA 1O7UA 2JL4A 2VIMA 3P90A 1SJ6A 4RQRA 4JE1A 1B9YC 2GT5A 2R5GA 2YJHA 4LA1A 5B7CA 2O85A 2H6XA 2J9HA 3UIWA 3U6VA 1JHBA 1JLVA 2LEGA 4GDFA 1TI1A 4ZL9A 2G0FA 2HXKA 4NHZA 1THXA 4ICYA 2GSQA 5LCZA 5ECHB 1EGOA 4J56E 2C1YA 5B8AA 3VPQA 2B6MA 1YKAA 1Z7PA 5H5QA 5HQPA 4K2XA 2RUFA 2UZ8A 2CAIA 1TU8A 2VCVA 1GP1A 19GSA 4ZBAA 3ISOA 4PNGA 4PTSA 3VWWA 4LMVA 2HRFA 3CRTA 1A2LA 5HFIA 5D96A 4F0BA 3DEXA 3HJMA 4LL1B 4AF2A 1JLWA 2CVKA 4F82A 5KN3A 4BL7A 1MDKA 3GV1A 3IK9A 5AN1A 2FHEA 2F9SA 4WBJA 3L9VA 2YANA 3FYGA 1GSYA 1PSQA 2VL2C 2RM5A 4OCEA 2FY6A 4GRFA 3ZZXA 2HRNA 1IYIA 1K0MA 1TK0B 4O5QA 4XTSA 2XBQA 1ERVA 4V1Ag 3DRNA 5LD0A 5IIZA 4IGJA 5HFKA 5JWQB 1QMVA 2H66A 3FZ5A 3Q19A 3DYRA 4OFTA 3GTUA 3TJBA 9GSSA 3BCKA 2DJKA 3FY7A 3GHAA 5F0GA 3L78A 4HQSA 3LFLA 2VCZA 1UC7A 3KMNA 3MWHA 1F2EA 2PU9C 2L6CA 4ECBA 3BCIA 4PUFC 3N5OA 3KCMA 3MIXA 4TN8A 12GSA 4GWRA 5EY6A 4TR0A 2FGXA 2C8UA 3FMWA 1N25A 2R3XA 2H19A 17GSA 4WETA 4TXVA 2HSMB 2OACA 1V58A 4PXOA 2GLRA 1S3CA 3TUEA 2FA4A 4V2MA 4K2DA 5D9TA 3RPNA 1G7EA 1TP9A 5J3RA 2VLUA 1GUKA 2VM1A 5A4WA 20GSA 2GGTA 4E8EA 2H0GA 3UAPA 2F51A 4EF0A 1EV9A 1F3BA 4MF6A 3O6TA 2I81A 4PQ1A 5COHA 4E68A 2NBSA 1R26A 4YQUA 2WULA 1GSFA 1TI3A 4MABA 1R5PA 3HVXA 4JEDA 3ERGA 3I6AA 2XBIA 3D22A 3HJOA 3HVVA 1SD8A 4MDCA 4G0IA 5AIXA 4XS4B 3CBUA 3LGCA 4ZB7A 1PRXA 1MD4A 1MEKA 1XZOA 1W89A 6GSYA 1HNCA 4J2FA 3E0UA 4TVEA 4MZBA 3PPUA 3CSIA 1JZOA 1GTAA 2L57A 4N0VA 4IJIA 3EPTA 3IAS2 1SL0B 1KTEA 3IE3A 3H4KA 3DVXA 1YY7A 2P0GA 2B7KA 4HU7A 4OCFA 1NHOA 3UBLA 1QQ2A 5A34A 4D73A 1PX6A 2I3YA 2VL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFQ A;  2K8V A;  5DAK B;  1EP8 A;  1XWC A;  1VF4 A;  3KTL A;  1THO A;  4XS1 A;  4ECJ A;  3KIJ A;  1EOG A;  3I43 A;  2IMD A;  1K0D A;  3QR6 A;  1TW9 A;  4NPB A;  3J7Y k;  3IOS A;  2IWT A;  2L6D A;  5HR2 A;  4PUA A;  2VAF A;  4IP1 A;  3IC8 A;  1M2B A;  2P5Q A;  2X99 A;  1YJ6 A;  3FR9 A;  1H4O A;  4F03 A;  4RI6 A;  2LRT A;  2MYG A;  3ED3 A;  1GUM A;  2AJQ B;  4Q5F A;  11GS A;  3L4N A;  4WR4 A;  2KLX A;  4NHW A;  2PN8 A;  4EVM A;  3KEB A;  4OO4 A;  3GUS A;  4V1A p;  4BVX B;  3F6F A;  3GA4 A;  2VO4 A;  3GFK A;  4BA7 A;  5G1L A;  2C80 A;  4IJ3 A;  4IN0 A;  2DIZ A;  5ELA A;  3WGD A;  3HXS A;  1SEN A;  1ZOF A;  2OE0 A;  2I4A A;  4FO5 A;  3KMO A;  1YKC A;  2R2J A;  1BG5 A;  2OE1 A;  4YQM A;  3DWV A;  4MMM A;  2KHP A;  2YWM A;  2H6Y A;  4MA9 A;  2FWF A;  2X8G A;  2BMX A;  2WB9 A;  2OKA A;  3HJP A;  3UJ1 A;  1XFL A;  2H1B A;  4FIW A;  5CNW A;  3IA1 A;  3TKR A;  1HD2 A;  2VOC A;  1WOU A;  3VI7 A;  2IJY A;  2LJR A;  1GLQ A;  5ENU A;  3TDG A;  4RQX A;  4DSS A;  2KUC A;  1HQO A;  2ON7 A;  5KN0 A;  3FEU A;  1F9M A;  3V1W A;  4OFN A;  5ECQ B;  4EXJ A;  2VM2 A;  2C0E A;  2CVD A;  3VUR A;  4I2U A;  4Q5N A;  3EE2 A;  3GN3 A;  4I97 A;  2HRK A;  1PX7 A;  1PA3 A;  4GTU A;  1XBS A;  4HDE A;  3TJJ A;  1TRW A;  1EEM A;  1TOF A;  1UVZ A;  5HFG A;  2CAQ A;  2LQQ A;  1WRY A;  5JCU A;  4OFM A;  2R4V A;  3KP8 A;  1O73 A;  5KN1 A;  2CA8 A;  4FYC A;  3TKS C;  4L5O A;  3FR3 A;  1AC1 A;  3AY8 A;  2LNS A;  3F3R A;  3TB2 A;  3W8S A;  3EMP A;  4WF5 A;  2DML A;  1YF1 A;  2P5R A;  3MNG A;  2AHE A;  2E0Q A;  5IOX A;  3FZA A;  3TKQ A;  10GS A;  2ZNM A;  4V2N A;  2M46 A;  2YWI A;  4HJM A;  3E9J B;  1S3A A;  1AIU A;  1WE0 A;  4NAX A;  2B5X A;  1FB6 A;  3FHK A;  1NW2 A;  1U3I A;  4BWQ A;  2V6O A;  4NXI A;  3OR5 A;  3G7Y A;  1BYE A;  2PVQ A;  4YAP A;  2KOK A;  2XPE A;  4QQ7 A;  2CQ9 A;  1OE8 A;  1ZL9 A;  4G9H A;  3M0F A;  4MLY A;  4MP4 A;  3QMX A;  1A0F A;  3BBY A;  2D2Z A;  4CW9 A;  4WR5 A;  14GS A;  1OAZ A;  3UEM A;  5GSS A;  1WP0 A;  2LST A;  3W8J A;  4IKH A;  1SYX A;  3QAV A;  3ERW A;  1T4Y A;  3ZIJ A;  1FB0 A;  4MF5 A;  2GTU A;  4N10 A;  6GSU A;  3CXG A;  1OC3 A;  3KM6 A;  3UOM A;  3KZQ A;  4K7N A;  3IR4 A;  2GSS A;  5AIS A;  5F05 A;  2C0G A;  2PER A;  4LLR A;  2VLV A;  4MH3 A;  1ERW A;  3D0Z A;  4X0X A;  2WFC A;  2AUV A;  3M9K A;  1O8X A;  2G2Q A;  2OBK A;  5D8I A;  3FR6 A;  5ECI B;  1OC9 B;  3APQ A;  4BVY B;  2VUP A;  1XWA A;  4O32 A;  3UL3 A;  2HQT A;  3IXR A;  4IHU A;  3UVT A;  1J9B A;  5B8B A;  2JSZ A;  2DC5 A;  8GSS A;  3ERF A;  2GZP A;  5DBQ A;  1EEJ A;  2C4J A;  3CSJ A;  2R6K A;  5G31 A;  1YF0 A;  1QK8 A;  1F6M C;  3ZIV A;  2A2R A;  1Z6M A;  2MZC A;  2H70 A;  4KSM A;  1Y25 A;  4HEA 2;  3TJF A;  1T3B A;  1A8L A;  1XCC A;  2X64 A;  3J7Y b;  4LMW A;  1K0C A;  2JZS A;  4TR1 B;  2YZU A;  1GTU A;  1RK4 A;  5ECP B;  3VLN A;  4BWS A;  1AQW A;  3FKF A;  3ZVJ D;  6GSV A;  2WJU A;  5IM9 A;  2JSY A;  1DBY A;  1X9W B;  5A4V A;  3WT2 A;  3M8N A;  3FZ4 A;  3LYK A;  1O81 A;  2YV7 A;  1EOH A;  4G2E A;  1PN9 A;  5DQY A;  1K3O A;  1AAZ A;  4O7H A;  5KN2 A;  5D9V A;  3L9S A;  3EU4 A;  4IVF A;  2K8S A;  2DLX A;  3F0I A;  1U88 A;  4PGT A;  4DSQ A;  1PKW A;  2EIO A;  2GQM A;  3O3T A;  4I6X A;  1B8X A;  2YJ7 A;  5EPF A;  2C0F A;  3HDC A;  4N30 A;  1X9M B;  3MSZ A;  1M9B A;  4G19 A;  2QGV A;  2FLS A;  4EC0 A;  3GIX A;  4YH2 A;  1Z7R A;  5IPG A;  4TR3 A;  5ELG A;  2XHF A;  1DE1 A;  1O85 A;  3IAM 2;  3F3Q A;  3NOF A;  2VLT A;  3F4R A;  1J0F A;  2B5E A;  3LQ7 A;  3BD2 A;  1XXU A;  4KDX A;  3I69 A;  1ZYE A;  1TRS A;  2O8V B;  2K9F A;  1YZX A;  2DJJ A;  4AJ6 A;  3IDV A;  3WT1 A;  4KUN A;  2FCH A;  3EMX A;  2YN1 A;  3KTB A;  4RI7 A;  5G2Z A;  3FRC A;  3DD3 A;  1TTZ A;  3LOR A;  2O89 A;  3SWL A;  2GZZ A;  4TXO A;  4TW5 A;  2HSM A;  5INY A;  2LTK A;  4I8B A;  4WBR D;  5EVO A;  2RLI A;  4GXZ A;  1J08 A;  4OMV A;  1XPV A;  2C3N A;  1OE7 A;  4EDY A;  4EO3 A;  4TXO B;  4F0C A;  4TR4 A;  3C71 A;  1K3Y A;  1X5C A;  4JU5 A;  3EUR A;  1SJZ A;  5E4W A;  5DAL B;  1XW5 A;  1EV4 A;  1LBK A;  5CRW A;  2YCD A;  4JBB A;  3QPM A;  4KW6 A;  2DJ3 A;  2QKE A;  2AYT A;  1T7P B;  3A2V A;  5ABR A;  1Z5Y E;  1TRU A;  3GL5 A;  3EC3 A;  1C72 A;  2N5A A;  2YP6 A;  2MBS A;  1V2A A;  3KJY A;  5JWO B;  4I2T A;  2H0H A;  4XS4 A;  2JU5 A;  4KND A;  1PL1 A;  3WD6 A;  1MTC A;  5IMZ A;  3KH9 A;  2GST A;  3DVW A;  2PGT A;  3GH9 A;  4N11 A;  1T00 A;  2MMA A;  3ME7 A;  1SK1 A;  2PMT A;  1OKT A;  2VD0 A;  1JZR A;  1SL1 B;  1T1V A;  1KBN A;  2CT6 A;  5ECS A;  3FK8 A;  4WXT A;  3KP9 A;  4FH8 A;  5E59 A;  1AQX A;  4L8E A;  1XOA A;  3KGK A;  2IMI A;  4OD7 A;  4QL7 A;  5DAK A;  2DIY A;  2K6V A;  3VWU A;  1WMJ A;  5GAP D;  3HY2 A;  4PUR A;  3C8E A;  1XVQ A;  5D9X A;  5B6N A;  2HSH A;  1KNG A;  2QC7 A;  5CRH A;  3D5J A;  1E2Y A;  5GST A;  1PL2 A;  4POL A;  3FZ9 A;  1V98 A;  1NM3 A;  3O76 A;  1XWB A;  22GS A;  3GRX A;  2FD3 A;  1B4Q A;  5IMD A;  4CHS A;  4BVX A;  4ID0 A;  2I9H A;  1EGR A;  4DEJ A;  3PR8 A;  3GNJ A;  1FVK A;  4ML6 A;  4ZB6 A;  2AV4 A;  3A2W A;  5FT3 A;  1M0U A;  3DIE A;  3IC4 A;  2IMK A;  3QAW A;  1BAY A;  3EYT A;  1GLP A;  1UA5 A;  2EIQ A;  3CSH A;  3VPT A;  2E2M A;  4AJ8 A;  4ECI A;  3RBT A;  2DJ1 A;  3RPP A;  4POK A;  4POB A;  1V40 A;  5A5K A;  4K0N A;  3HZ8 A;  2WRT A;  4ZB9 A;  6GSW A;  2TIR A;  3M3M A;  1S3D A;  4KCA A;  4AJ7 A;  3TOU A;  1RW1 A;  1GTI A;  3TKS E;  2IN3 A;  1ON4 A;  3HA9 A;  5IOW A;  2ES7 A;  3H1N A;  1SKW B;  1GRX A;  5F06 A;  5CRD A;  1B4P A;  3P7X A;  5J9C A;  4OO5 A;  3BOA A;  3TRQ A;  4IQA A;  1SU9 A;  1ZMA A;  3IHQ A;  1VF3 A;  1N8J A;  5JWR B;  4MJC A;  3Q74 A;  4XCS A;  4XHM A;  1ML6 A;  2X8C A;  5CO3 A;  6GST A;  2DMM A;  4ZIJ A;  1FAA A;  2GSR A;  2JAC A;  4NV5 A;  2HZF A;  1R7H A;  1O8W A;  4XIH A;  2K18 A;  2IME A;  3N9J A;  1NSW A;  4ZIL A;  3ME8 A;  5GAN D;  2XC2 A;  2R37 A;  4KX4 A;  2PVO C;  3UAR A;  4N0Z A;  1Q4J A;  5CRE A;  5ID2 B;  2IPA A;  3LXZ A;  5H5R A;  2H1D A;  2LRC A;  5IO0 A;  2HSY A;  3IPZ A;  3GSS A;  2CZ2 A;  1A0R P;  1SJI A;  4KF9 A;  5ECK B;  5J41 A;  5DQS A;  1XW9 A;  4FYB A;  3DXB A;  4NMU A;  5JCG A;  3C1R A;  1YEX A;  1TDI A;  4IEL A;  2FWG A;  2H1G A;  3PGT A;  4LL4 B;  5IMA A;  3L0H A;  5CAX A;  1WJK A;  2VCW A;  4MJE A;  1FOV A;  2LS5 A;  1K0N A;  3LWA A;  3LYP A;  5B6M A;  1SYR A;  18GS A;  5C00 A;  4OWY A;  2OA7 A;  3WGE A;  1AXD A;  3TRP A;  4Q5Q A;  4K7I A;  1OYJ A;  4ISD A;  4USS A;  1U6T A;  2FUG 2;  4GSN A;  1OC8 A;  2HFD A;  5DVB A;  4KDY A;  4GQF A;  1ERU A;  1AUC A;  5DJL A;  2DJ0 A;  1XWG A;  2N5B A;  5DJM A;  2HZE B;  5AIV A;  5F07 A;  2L4C A;  4IP6 A;  1GSD A;  2H8L A;  1OC9 A;  4EL1 A;  4BVY A;  3RAZ A;  5IQY A;  5G30 A;  1Q98 A;  1ST9 A;  4XRA A;  3L9U A;  1JFU A;  1K0B A;  3QFA C;  1H75 A;  4MH2 A;  5ECM B;  4ECC A;  2B1K A;  3W6G A;  4G0L A;  2H72 A;  4TOP A;  2V2G A;  3GX0 A;  3EU3 A;  4MPF A;  5AGY A;  5EL8 A;  3ZRE A;  2JZR A;  1B48 A;  2NPB A;  1PKZ A;  2MMN A;  3QOU A;  3VWV A;  2F8F A;  6GSS A;  4H86 A;  3E3E A;  3Q6O A;  1FHE A;  1W4V A;  3DKS A;  5D93 A;  2DSA A;  3ZVJ A;  4PNF A;  4POM A;  3GX8 A;  2VD1 A;  1BX9 A;  1TXX A;  1VF1 A;  4TR1 A;  3VWX A;  3I9V 2;  2M80 A;  5C04 A;  1QGV A;  1GL8 A;  2JZT A;  4V2L A;  4JZQ A;  4TRX A;  2GDR A;  3WYW A;  4ULX A;  1GSS A;  5ECN B;  1X0R A;  4MPG A;  2HRA A;  3M1G A;  2V41 A;  3GKN A;  2H1A A;  3IK7 A;  16GS A;  3SBC A;  4K7O A;  3TGZ A;  4GQC A;  4IQ1 A;  1I9D A;  5IMC A;  5J5N A;  4PX1 A;  3ZLP A;  2H74 A;  4RUV A;  1F37 A;  2LRN A;  1ABA A;  4MZC A;  4ZB8 A;  2GT6 A;  5ECR B;  13GS A;  2C0D A;  3M9J A;  4HS1 A;  2M72 A;  2MBT A;  2B7J A;  1WPI A;  3KXO A;  3US3 A;  5JCW A;  3JCM L;  1X5E A;  7GSS A;  1FO5 A;  4MJA A;  4KA0 A;  3IRA A;  1IYH A;  4F2I A;  3UMA A;  1G7O A;  3HYP A;  4ILF A;  3LXT A;  1KEB A;  3ZMK A;  3PH9 A;  5L71 A;  1E6B A;  1LU4 A;  2BJX A;  2VL2 A;  5J4U A;  4KCE A;  1EWX A;  4AGS A;  1M2D A;  4PQI A;  4MF7 A;  2YZH A;  4Z7X A;  3GYK A;  1BQ7 A;  1G6Y A;  1PQN A;  2YWO A;  4ZL7 A;  3HZ4 A;  1OVN A;  3VFI A;  4GF0 A;  4HQZ A;  2L4Q A;  1XIY A;  1MD3 A;  2FA8 A;  2N5F A;  2H75 A;  3QDN A;  2OBI A;  3LG6 A;  1AW9 A;  2V6K A;  3A3T A;  2WZ9 A;  4Q5R A;  2OJL A;  4JRR A;  2F8A A;  1PGT A;  1FW1 A;  2HLS A;  2E2G A;  3F4T A;  5FWG A;  4BPY A;  3D4M A;  3U5R E;  2OAD A;  4K0G A;  4HUA A;  1SKR B;  3H8Q A;  1ACV A;  3TCO A;  4BL7 B;  3PIN A;  4CDO A;  1Z6N A;  3MAK A;  2ZUP A;  1A2M A;  4FYU A;  1GUL A;  4HI7 A;  2EIR A;  3UBK A;  4P3Y B;  4DVC A;  1M2A A;  1EP7 A;  4HZ2 A;  2HT9 A;  5DAL A;  3F6D A;  5HR0 A;  1O6J A;  4L5L A;  4GCI A;  4F9Z A;  2TRC P;  4ZXG A;  5DCH A;  1PD2 1;  3GTU B;  3CTG A;  1U87 A;  1G6W A;  4GLT A;  1HYU A;  2GS3 A;  2J23 A;  3HKR A;  2A2S A;  3CTF A;  2WGR A;  1XVW A;  1YDK A;  1GH2 A;  1FG4 A;  3EIN A;  3A5W A;  2JAD A;  4I5Q A;  2QSI A;  2CZ3 A;  3UVH A;  3GKK A;  2HYX A;  3VI5 A;  2H01 A;  4O92 A;  6GSX A;  1GUH A;  5ECL B;  4IW9 A;  2L59 A;  3CYN A;  3D6I A;  3TJG A;  4YQV A;  2HI7 A;  1ZGN A;  4GSS A;  2NTO A;  3EWL A;  3R2Q A;  4MJB A;  1SK2 A;  3GST A;  4DSR A;  1MDJ A;  3GKX A;  1TK5 B;  1VGL A;  1UN2 A;  2LV3 A;  3ZYW A;  5HR1 A;  2AB6 A;  1PMT A;  3FW2 A;  4EE0 A;  1TK8 B;  1K0A A;  1A2J A;  1R5A A;  4HJ2 A;  2CX3 A;  4G0K A;  3TOT A;  1U3A A;  5J9B A;  3NZN A;  2V32 A;  4G10 A;  4K9Z A;  3P8W A;  4X1U A;  4KE3 A;  1ERT A;  2H0I A;  4WEY A;  3TRX A;  3G7I A;  1F3A A;  1JZD A;  2KP1 A;  1EZK A;  3DGQ A;  2GQL A;  3ZFB A;  2P31 A;  2LJA A;  1NHY A;  2NDO A;  2ALB A;  3D4T A;  1TKD B;  1SL2 B;  1HNA A;  2WS2 A;  3BJ5 A;  1GTB A;  3LEF A;  2LUS A;  3G9B A;  1JZW A;  5D9W A;  2GVP A;  3ZFL A;  4O5R A;  3RHC A;  3RHB A;  3D21 A;  3GL3 A;  2XPD A;  3ZRD A;  1XW6 A;  1DSB A;  1CQG A;  1TRV A;  1VRS D;  2IL3 A;  1QXH A;  4D73 B;  2RUE A;  4MZW A;  2VL3 A;  2IFQ B;  5HR3 A;  2ON5 A;  3CRU A;  2RII A;  1QFN A;  5FHI A;  3TKP A;  3CMI A;  2C3Q A;  4KH7 A;  1X9S B;  1M9A A;  3GH6 A;  1URM A;  1LJR A;  2E7P A;  4KSO A;  3MDK A;  1A24 A;  2FNO A;  2O87 A;  4EDZ A;  1BJX A;  1GSE A;  2B3S A;  4K6X A;  1HNB A;  1WWJ A;  1A23 A;  1RQM A;  4WKW A;  2NVL A;  5G1K A;  1YQ1 A;  2L5L A;  2WDU A;  3VK9 A;  2MMO A;  1T8E B;  1GSU A;  4HOJ A;  4EKZ A;  3TKS A;  1VF2 A;  3HCZ A;  1Y6E A;  2AAW A;  3C1S A;  3ZML A;  5IMF A;  4WF4 A;  2GQK A;  2V1M A;  2TRX A;  5DCG A;  2LKU A;  2LQO A;  3F4S A;  1V57 A;  5ID2 A;  1Z9H A;  1SK0 A;  5CP1 A;  5G5E A;  3S9F A;  5DDL A;  2H71 A;  4KB3 A;  1K0O A;  1TJD A;  5GZZ B;  2CVB A;  2VCX A;  1MDI A;  3Q18 A;  2BTO T;  2H76 A;  1A8Y A;  1XOB A;  2I1U A;  5A4U A;  1GNW A;  3NIV A;  4DSS B;  2YOI A;  2RM6 A;  2YNX A;  1BED A;  1DUG A;  2FWE A;  4JR6 A;  3GUR A;  2L5O A;  1SKS B;  4HZ4 A;  3IV4 A;  3TJK A;  5IO2 A;  1ZYQ B;  4PQH A;  2HRK B;  4QL9 A;  4JR4 A;  2B1L A;  3P2A A;  3WGX A;  5KEJ A;  4KDU A;  2MMZ A;  4ZBD A;  2DJ2 A;  3IBH A;  1M7T A;  5LNK e;  4HU9 A;  1K3L A;  5H5S A;  4K8M A;  2YV9 A;  5G5F A;  3K8N A;  3QAG A;  2H6Z A;  3HD5 A;  4K1F A;  2PWJ A;  5CYY A;  2HZE A;  1USB A;  2PUK C;  3H79 A;  2EC4 A;  2IIY A;  2DBC A;  2H30 A;  5D73 A;  4XRD A;  4ZBB A;  3F63 A;  3R3E A;  1XWK A;  1V9W A;  4X43 A;  3QCP A;  4XS6 A;  3QD9 A;  1GNE A;  3G7J A;  1QUW A;  2CV4 A;  3RDW A;  1X5D A;  2OE3 A;  3H93 A;  1N2A A;  1G0T A;  3C7M A;  1T4Z A;  2YWN A;  2B5Y A;  3DML A;  5ECO B;  4YAV A;  2O7K A;  1I5G A;  4E8H A;  4ZL8 A;  3C73 A;  4IS0 A;  2VCQ A;  2VCT A;  2HNL A;  2YPM A;  4EUY A;  2A4V A;  1CQH A;  2HE3 A;  2LJK A;  1ILO A;  3GMF A;  3LJR A;  4KAE A;  2CX4 A;  4KGI A;  3ZIT A;  3HVS A;  1SD9 A;  1GSQ A;  3LSZ A;  5CRG A;  3APO A;  4MK3 A;  1YEP A;  1ZZY A;  1AQV A;  2GZY A;  1OKD A;  2H73 A;  2Z9S A;  4NV2 A;  3HHV A;  3KH7 A;  2HSN B;  2PBJ A;  2FWH A;  3EVI A;  4MCU A;  1TU7 A;  4ML1 A;  2KP2 A;  1GWC A;  2ZCT A;  3A2X A;  4J57 E;  4L0U A;  1R4W A;  4NWY A;  2REM A;  3APS A;  5BMU A;  1DE2 A;  1Z3E A;  3F8U A;  1M99 A;  2X8H A;  2PPT A;  5IPH A;  2IMF A;  1WIK A;  4ACS A;  4FQU A;  1B9X C;  3KD0 A;  3ZL5 A;  2F3M A;  3ZTL A;  5IMV A;  4L0W A;  4TKY A;  3QFB C;  1FVJ A;  3F9U A;  2WCI A;  2C3T A;  1ZCP A;  3GKM A;  2LNT A;  4GST A;  4IBP A;  5F8B A;  1O7U A;  2JL4 A;  2VIM A;  3P90 A;  1SJ6 A;  4RQR A;  4JE1 A;  1B9Y C;  2GT5 A;  2R5G A;  2YJH A;  4LA1 A;  5B7C A;  2O85 A;  2H6X A;  2J9H A;  3UIW A;  3U6V A;  1JHB A;  1JLV A;  2LEG A;  1TI1 A;  4ZL9 A;  2G0F A;  2HXK A;  4NHZ A;  1THX A;  2GSQ A;  5LCZ A;  5ECH B;  1EGO A;  4J56 E;  2C1Y A;  5B8A A;  3VPQ A;  2B6M A;  1YKA A;  1Z7P A;  5H5Q A;  5HQP A;  2RUF A;  2UZ8 A;  2CAI A;  1TU8 A;  2VCV A;  1GP1 A;  19GS A;  4ZBA A;  3ISO A;  4PNG A;  4PTS A;  3VWW A;  4LMV A;  2HRF A;  3CRT A;  1A2L A;  5HFI A;  5D96 A;  4F0B A;  3DEX A;  3HJM A;  4LL1 B;  4AF2 A;  1JLW A;  2CVK A;  4F82 A;  5KN3 A;  4BL7 A;  1MDK A;  3GV1 A;  3IK9 A;  5AN1 A;  2FHE A;  2F9S A;  4WBJ A;  3L9V A;  2YAN A;  3FYG A;  1GSY A;  1PSQ A;  2VL2 C;  2RM5 A;  4OCE A;  2FY6 A;  4GRF A;  3ZZX A;  2HRN A;  1IYI A;  1K0M A;  1TK0 B;  4XTS A;  2XBQ A;  1ERV A;  4V1A g;  3DRN A;  5LD0 A;  5IIZ A;  4IGJ A;  5HFK A;  5JWQ B;  1QMV A;  2H66 A;  3FZ5 A;  3Q19 A;  3DYR A;  4OFT A;  3GTU A;  3TJB A;  9GSS A;  3BCK A;  2DJK A;  3FY7 A;  3GHA A;  5F0G A;  3L78 A;  4HQS A;  3LFL A;  2VCZ A;  1UC7 A;  3KMN A;  3MWH A;  1F2E A;  2PU9 C;  2L6C A;  4ECB A;  3BCI A;  4PUF C;  3N5O A;  3KCM A;  4TN8 A;  12GS A;  4GWR A;  5EY6 A;  4TR0 A;  2FGX A;  2C8U A;  2R3X A;  2H19 A;  17GS A;  4WET A;  4TXV A;  2HSM B;  2OAC A;  1V58 A;  4PXO A;  2GLR A;  1S3C A;  3TUE A;  2FA4 A;  4V2M A;  4K2D A;  5D9T A;  3RPN A;  1G7E A;  1TP9 A;  5J3R A;  2VLU A;  1GUK A;  2VM1 A;  5A4W A;  20GS A;  2GGT A;  4E8E A;  2H0G A;  3UAP A;  2F51 A;  4EF0 A;  1EV9 A;  1F3B A;  4MF6 A;  3O6T A;  2I81 A;  4PQ1 A;  5COH A;  2NBS A;  1R26 A;  4YQU A;  2WUL A;  1GSF A;  1TI3 A;  4MAB A;  1R5P A;  3HVX A;  4JED A;  3ERG A;  3I6A A;  2XBI A;  3D22 A;  3HJO A;  3HVV A;  1SD8 A;  4MDC A;  4G0I A;  5AIX A;  4XS4 B;  3CBU A;  3LGC A;  1PRX A;  1MD4 A;  1MEK A;  1XZO A;  1W89 A;  6GSY A;  1HNC A;  4J2F A;  3E0U A;  4TVE A;  4MZB A;  3PPU A;  3CSI A;  1JZO A;  1GTA A;  2L57 A;  4N0V A;  4IJI A;  3IAS 2;  1SL0 B;  1KTE A;  3IE3 A;  3H4K A;  3DVX A;  1YY7 A;  2P0G A;  2B7K A;  4HU7 A;  4OCF A;  1NHO A;  3UBL A;  1QQ2 A;  4D73 A;  1PX6 A;  2I3Y A;  2VL9 A; 
#chains in the Genus database with same CATH topology
 2IFQ A;  2K8V A;  5DAK B;  1EP8 A;  1XWC A;  1VF4 A;  3KTL A;  1THO A;  1M3J A;  4XS1 A;  4ECJ A;  3KIJ A;  1EOG A;  3I43 A;  2IMD A;  1K0D A;  3QR6 A;  1TW9 A;  4NPB A;  3J7Y k;  3IOS A;  2IWT A;  2L6D A;  5HR2 A;  4PUA A;  2VAF A;  4IP1 A;  3IC8 A;  1M2B A;  2P5Q A;  2X99 A;  1YJ6 A;  3FR9 A;  1H4O A;  4F03 A;  4RI6 A;  2LRT A;  1BG1 A;  2MYG A;  3ED3 A;  1GUM A;  2AJQ B;  4Q5F A;  11GS A;  3L4N A;  4WR4 A;  2KLX A;  4NHW A;  2PN8 A;  4YKG A;  4EVM A;  3KEB A;  4OO4 A;  3GUS A;  4V1A p;  4BVX B;  3F6F A;  3GA4 A;  2VO4 A;  3GFK A;  4BA7 A;  5G1L A;  2C80 A;  4IJ3 A;  4IN0 A;  2DIZ A;  5ELA A;  3HVN A;  3WGD A;  3HXS A;  1SEN A;  1ZOF A;  2OE0 A;  2I4A A;  4FO5 A;  3KMO A;  1YKC A;  2R2J A;  1BG5 A;  2OE1 A;  4YQM A;  3DWV A;  4MMM A;  2KHP A;  2YWM A;  2H6Y A;  4MA9 A;  2FWF A;  2X8G A;  2BMX A;  2WB9 A;  2OKA A;  3HJP A;  3UJ1 A;  1XFL A;  2H1B A;  4FIW A;  5CNW A;  3IA1 A;  3TKR A;  1HD2 A;  2VOC A;  1WOU A;  3VI7 A;  2IJY A;  2LJR A;  1GLQ A;  5ENU A;  3TDG A;  4RQX A;  4DSS A;  2KUC A;  1HQO A;  2ON7 A;  5KN0 A;  3FEU A;  1F9M A;  3V1W A;  4OFN A;  5ECQ B;  4CY6 A;  4EXJ A;  2VM2 A;  2C0E A;  2CVD A;  3VUR A;  4I2U A;  4Q5N A;  3EE2 A;  3GN3 A;  4I97 A;  2HRK A;  1PX7 A;  1PA3 A;  4GTU A;  1XBS A;  4HDE A;  3TJJ A;  1TRW A;  1ZYP A;  1EEM A;  1TOF A;  1UVZ A;  4G01 A;  2CAQ A;  2O3E A;  2LQQ A;  5HFG A;  1WRY A;  5JCU A;  4OFM A;  2R4V A;  3KP8 A;  1O73 A;  5KN1 A;  2CA8 A;  4FYC A;  3TKS C;  4L5O A;  3FR3 A;  1AC1 A;  3AY8 A;  2LNS A;  3F3R A;  3TB2 A;  3W8S A;  3EMP A;  4WF5 A;  2DML A;  2EFH A;  1YF1 A;  2P5R A;  3MNG A;  2AHE A;  2E0Q A;  5IOX A;  3FZA A;  3TKQ A;  10GS A;  2ZNM A;  4V2N A;  2M46 A;  2YWI A;  4HJM A;  3E9J B;  1S3A A;  1AIU A;  1WE0 A;  4NAX A;  2B5X A;  1FB6 A;  3FHK A;  1NW2 A;  1U3I A;  3RGB C;  4BWQ A;  2V6O A;  4NXI A;  3OR5 A;  3G7Y A;  1BYE A;  2PVQ A;  4YAP A;  2KOK A;  2XPE A;  4QQ7 A;  2CQ9 A;  1OE8 A;  1ZL9 A;  4G9H A;  3M0F A;  3LW9 A;  4MLY A;  4MP4 A;  3QMX A;  1A0F A;  3BBY A;  2D2Z A;  4CW9 A;  4WR5 A;  14GS A;  1OAZ A;  3UEM A;  5GSS A;  1WP0 A;  2LST A;  3W8J A;  4IKH A;  1SYX A;  3QAV A;  3ERW A;  3CHX C;  1T4Y A;  3ZIJ A;  1FB0 A;  4MF5 A;  4K5R A;  2GTU A;  4N10 A;  1TXU A;  6GSU A;  3CXG A;  1OC3 A;  3KM6 A;  3UOM A;  3KZQ A;  4K7N A;  3IR4 A;  3MYD A;  2GSS A;  5AIS A;  5F05 A;  2C0G A;  2PER A;  4LLR A;  2VLV A;  4MH3 A;  1ERW A;  3D0Z A;  4X0X A;  2UV8 G;  2WFC A;  2AUV A;  3M9K A;  1O8X A;  2G2Q A;  2OBK A;  5D8I A;  3FR6 A;  5ECI B;  1OC9 B;  3APQ A;  4BVY B;  2VUP A;  1XWA A;  4O32 A;  3UL3 A;  2HQT A;  3IXR A;  4IHU A;  3UVT A;  1PFO A;  1J9B A;  5B8B A;  2JSZ A;  2DC5 A;  8GSS A;  3ERF A;  2GZP A;  5DBQ A;  1EEJ A;  2C4J A;  4Z2T A;  3CSJ A;  2R6K A;  5G31 A;  1YF0 A;  1QK8 A;  1F6M C;  3ZIV A;  2A2R A;  1Z6M A;  2MZC A;  4EIP A;  1SVL A;  2H70 A;  4KSM A;  1Y25 A;  4HEA 2;  3TJF A;  1T3B A;  1A8L A;  1XCC A;  2X64 A;  3J7Y b;  4LMW A;  1K0C A;  2JZS A;  4TR1 B;  2YZU A;  1GTU A;  1RK4 A;  5ECP B;  3VLN A;  4BWS A;  2WZS A;  1AQW A;  3FKF A;  3ZVJ D;  6GSV A;  2WW0 A;  2WJU A;  5IM9 A;  2JSY A;  1DBY A;  1X9W B;  5A4V A;  3WT2 A;  3M8N A;  3FZ4 A;  3LYK A;  1O81 A;  2YV7 A;  1EOH A;  4G2E A;  1PN9 A;  5DQY A;  1K3O A;  1AAZ A;  4O7H A;  5KN2 A;  5D9V A;  3L9S A;  3EU4 A;  4IVF A;  2K8S A;  2DLX A;  3F0I A;  1U88 A;  4PGT A;  4DSQ A;  1PKW A;  2R0G A;  2EIO A;  2GQM A;  3O3T A;  4I6X A;  1B8X A;  2YJ7 A;  5EPF A;  2C0F A;  3HDC A;  4N30 A;  1X9M B;  3MSZ A;  2R0P A;  1M9B A;  1M3I A;  4G19 A;  2QGV A;  2FLS A;  4EC0 A;  3GIX A;  4YH2 A;  1Z7R A;  5IPG A;  4TR3 A;  5ELG A;  2XHF A;  1DE1 A;  1O85 A;  2WW2 A;  3IAM 2;  3F3Q A;  3NOF A;  2VLT A;  3F4R A;  1J0F A;  2B5E A;  3LQ7 A;  3BD2 A;  1XXU A;  4KDX A;  3I69 A;  1ZYE A;  1TRS A;  2O8V B;  2K9F A;  1YZX A;  2DJJ A;  4MNN A;  4AJ6 A;  4K5S A;  3IDV A;  3WT1 A;  4KUN A;  2FCH A;  3EMX A;  4PI2 C;  2YN1 A;  3KTB A;  4RI7 A;  5G2Z A;  3FRC A;  3DD3 A;  1TTZ A;  3LOR A;  2O89 A;  3SWL A;  2GZZ A;  4TXO A;  4TW5 A;  2X4A A;  2HSM A;  2WVX B;  5INY A;  2LTK A;  4I8B A;  4WBR D;  5EVO A;  2RLI A;  4GXZ A;  1J08 A;  4OMV A;  1XPV A;  5J47 A;  2C3N A;  1OE7 A;  4EDY A;  4EO3 A;  4TXO B;  4F0C A;  4TR4 A;  3C71 A;  1K3Y A;  1X5C A;  4JU5 A;  3EUR A;  1SJZ A;  5E4W A;  1BF5 A;  5DAL B;  1XW5 A;  1EV4 A;  1LBK A;  5CRW A;  2H1L A;  2YCD A;  4JBB A;  3QPM A;  4KW6 A;  2DJ3 A;  2QKE A;  2AYT A;  1T7P B;  4YKF A;  3A2V A;  5ABR A;  1Z5Y E;  1TRU A;  3GL5 A;  3EC3 A;  1C72 A;  2N5A A;  2YP6 A;  2MBS A;  1V2A A;  3KJY A;  5JWO B;  4I2T A;  2H0H A;  4XS4 A;  2JU5 A;  4KND A;  1PL1 A;  3WD6 A;  1MTC A;  5IMZ A;  3KH9 A;  2GST A;  3DVW A;  2PGT A;  3GH9 A;  4N11 A;  1T00 A;  2MMA A;  3ME7 A;  1S3R A;  4CY8 A;  1SK1 A;  2PMT A;  1OKT A;  2VD0 A;  1JZR A;  1SL1 B;  1T1V A;  1KBN A;  2CT6 A;  5ECS A;  3FK8 A;  4WXT A;  3KP9 A;  4FH8 A;  5E59 A;  1AQX A;  4L8E A;  1XOA A;  3KGK A;  2IMI A;  4OD7 A;  4QL7 A;  5DAK A;  2DIY A;  2K6V A;  3VWU A;  1WMJ A;  5GAP D;  3HY2 A;  4PUR A;  3C8E A;  1XVQ A;  5D9X A;  5B6N A;  2HSH A;  2A2P A;  1KNG A;  2QC7 A;  5CRH A;  3D5J A;  1E2Y A;  5GST A;  1PL2 A;  4POL A;  3FZ9 A;  1V98 A;  1NM3 A;  3O76 A;  1XWB A;  22GS A;  3GRX A;  2FD3 A;  1B4Q A;  5IMD A;  4CHS A;  4BVX A;  4ID0 A;  2I9H A;  1EGR A;  4DEJ A;  3PR8 A;  3GNJ A;  1FVK A;  4ML6 A;  4ZB6 A;  2AV4 A;  3A2W A;  5FT3 A;  1M0U A;  3DIE A;  3IC4 A;  2IMK A;  3QAW A;  1BAY A;  3EYT A;  1GLP A;  1UA5 A;  2EIQ A;  3CSH A;  3VPT A;  2E2M A;  4AJ8 A;  4ECI A;  3RBT A;  2DJ1 A;  3RPP A;  4POK A;  4POB A;  1V40 A;  5A5K A;  4K0N A;  3HZ8 A;  2WRT A;  4ZB9 A;  6GSW A;  2TIR A;  3M3M A;  1S3D A;  4KCA A;  4AJ7 A;  3TOU A;  1RW1 A;  1GTI A;  3TKS E;  2IN3 A;  1ON4 A;  3HA9 A;  5IOW A;  2ES7 A;  3H1N A;  1SKW B;  1GRX A;  5F06 A;  5CRD A;  1B4P A;  3P7X A;  5J9C A;  4OO5 A;  3BOA A;  3TRQ A;  4N3Z A;  4IQA A;  1I1I P;  1SU9 A;  1ZMA A;  3IHQ A;  1VF3 A;  1N8J A;  5JWR B;  4MJC A;  3Q74 A;  4XCS A;  4XHM A;  1ML6 A;  2X8C A;  5CO3 A;  6GST A;  2DMM A;  4ZIJ A;  1FAA A;  2GSR A;  2JAC A;  4NV5 A;  2HZF A;  1R7H A;  1O8W A;  4XIH A;  2K18 A;  2IME A;  3N9J A;  1NSW A;  4ZIL A;  3ME8 A;  5GAN D;  2XC2 A;  2R37 A;  4KX4 A;  2PVO C;  3UAR A;  4N0Z A;  1Q4J A;  5J4Y A;  5CRE A;  4PI0 C;  5ID2 B;  2IPA A;  4HSC X;  3LXZ A;  5H5R A;  2H1D A;  2LRC A;  5IO0 A;  2HSY A;  3IPZ A;  4O5U A;  3GSS A;  2CZ2 A;  1A0R P;  1SJI A;  4KF9 A;  5ECK B;  5J41 A;  4W66 A;  5DQS A;  1XW9 A;  4FYB A;  3DXB A;  4EIQ A;  4NMU A;  5JCG A;  3C1R A;  1YEX A;  1TDI A;  4IEL A;  2FWG A;  2H1G A;  3PGT A;  4LL4 B;  5IMA A;  3L0H A;  5CAX A;  1WJK A;  2VCW A;  4MJE A;  1FOV A;  5KOW A;  2LS5 A;  1K0N A;  4FXY P;  3A5I A;  3LWA A;  3LYP A;  5B6M A;  1SYR A;  18GS A;  5C00 A;  3HMJ G;  4OWY A;  2OA7 A;  3WGE A;  1AXD A;  3TRP A;  4Q5Q A;  4K7I A;  1OYJ A;  4ISD A;  4USS A;  1U6T A;  2FUG 2;  4GSN A;  1OC8 A;  2HFD A;  5DVB A;  4KDY A;  4GQF A;  1ERU A;  1AUC A;  5DJL A;  2DJ0 A;  1XWG A;  2N5B A;  5DJM A;  2HZE B;  5AIV A;  5F07 A;  2L4C A;  4IP6 A;  1GSD A;  2H8L A;  1OC9 A;  4EL1 A;  4BVY A;  1Y1U A;  3RAZ A;  5IQY A;  5G30 A;  1Q98 A;  1ST9 A;  4XRA A;  3L9U A;  1JFU A;  1K0B A;  3QFA C;  1H75 A;  4MH2 A;  5ECM B;  4ECC A;  2B1K A;  3W6G A;  4G0L A;  2O36 A;  2H72 A;  4TOP A;  2V2G A;  3GX0 A;  3EU3 A;  4MPF A;  5AGY A;  5EL8 A;  3ZRE A;  2JZR A;  1B48 A;  2NPB A;  1PKZ A;  2MMN A;  3QOU A;  3VWV A;  2F8F A;  6GSS A;  3E3E A;  4H86 A;  1W4V A;  1FHE A;  3Q6O A;  3DKS A;  5D93 A;  2DSA A;  3ZVJ A;  4PNF A;  4POM A;  3GX8 A;  2VD1 A;  1BX9 A;  1TXX A;  1VF1 A;  4TR1 A;  3VWX A;  3I9V 2;  2M80 A;  5C04 A;  1QGV A;  1GL8 A;  2JZT A;  4V2L A;  4JZQ A;  4TRX A;  2GDR A;  3WYW A;  4ULX A;  1GSS A;  4Z2U A;  5ECN B;  1X0R A;  4MPG A;  2HRA A;  3M1G A;  2V41 A;  3GKN A;  2H1A A;  3IK7 A;  16GS A;  3SBC A;  4K7O A;  3TGZ A;  5BMU B;  1PN0 A;  4GQC A;  4IQ1 A;  1I9D A;  5IMC A;  5J5N A;  4PX1 A;  3ZLP A;  2H74 A;  4RUV A;  1F37 A;  2LRN A;  1ABA A;  4MZC A;  2DKH A;  4ZB8 A;  2GT6 A;  5ECR B;  13GS A;  5A1N B;  2C0D A;  3M9J A;  4HS1 A;  2M72 A;  2MBT A;  2B7J A;  1WPI A;  3KXO A;  3US3 A;  5JCW A;  3JCM L;  1X5E A;  7GSS A;  2EFC A;  1FO5 A;  4MJA A;  4KA0 A;  3IRA A;  1IYH A;  4F2I A;  3UMA A;  1G7O A;  3HYP A;  4ILF A;  3LXT A;  1KEB A;  3ZMK A;  5BRT A;  3PH9 A;  5L71 A;  1E6B A;  1LU4 A;  2BJX A;  2VL2 A;  5J4U A;  4KCE A;  1EWX A;  4AGS A;  4A5P A;  4AI6 A;  1M2D A;  4PQI A;  4MF7 A;  2YZH A;  4Z7X A;  3GYK A;  1BQ7 A;  1G6Y A;  1PQN A;  2YWO A;  4ZL7 A;  3HZ4 A;  1OVN A;  3VFI A;  4GF0 A;  4HQZ A;  2L4Q A;  1XIY A;  1MD3 A;  2VKZ G;  2FA8 A;  2N5F A;  2H75 A;  3QDN A;  2OBI A;  3LG6 A;  1AW9 A;  2V6K A;  3A3T A;  2WZ9 A;  4Q5R A;  2OJL A;  1SVM A;  4JRR A;  2F8A A;  1PGT A;  5A5H A;  1FW1 A;  2HLS A;  2E2G A;  3F4T A;  5FWG A;  4BPY A;  3D4M A;  3U5R E;  2OAD A;  4K0G A;  4HUA A;  1SKR B;  3H8Q A;  1ACV A;  3TCO A;  2WVX A;  4BL7 B;  3PIN A;  2OT3 A;  4CDO A;  1Z6N A;  3MAK A;  2ZUP A;  5A5H B;  1A2M A;  4FYU A;  1GUL A;  3IHG A;  4HI7 A;  2EIR A;  3UBK A;  2WVZ A;  4P3Y B;  4DVC A;  1M2A A;  1EP7 A;  4HZ2 A;  2HT9 A;  5DAL A;  3F6D A;  5HR0 A;  1O6J A;  2WW3 A;  4L5L A;  4GCI A;  4F9Z A;  2TRC P;  4ZXG A;  5DCH A;  1PD2 1;  3GTU B;  3CTG A;  1U87 A;  1G6W A;  4GLT A;  4AKI A;  1HYU A;  2GS3 A;  2J23 A;  3HKR A;  2A2S A;  3CTF A;  2WGR A;  4X4J A;  1XVW A;  1YDK A;  1GH2 A;  1FG4 A;  3EIN A;  3A5W A;  2JAD A;  4I5Q A;  2QSI A;  2CZ3 A;  3UVH A;  3GKK A;  2HYX A;  3VI5 A;  1FOH A;  2H01 A;  4O92 A;  6GSX A;  1GUH A;  5ECL B;  4IW9 A;  2L59 A;  3CYN A;  3D6I A;  3TJG A;  4YQV A;  2HI7 A;  1ZGN A;  4GSS A;  2NTO A;  3EWL A;  3R2Q A;  4MJB A;  1SK2 A;  3GST A;  4DSR A;  1MDJ A;  3GKX A;  1TK5 B;  1VGL A;  1UN2 A;  2LV3 A;  3ZYW A;  5HR1 A;  2EFE A;  2AB6 A;  1PMT A;  4PHZ C;  4EE0 A;  3FW2 A;  1TK8 B;  1K0A A;  1A2J A;  1R5A A;  4HJ2 A;  2CX3 A;  4G0K A;  3TOT A;  1U3A A;  5J9B A;  2EFD A;  3NZN A;  2WW1 A;  1SVO A;  2V32 A;  4G10 A;  4K9Z A;  2X49 A;  3P8W A;  4X1U A;  4KE3 A;  1ERT A;  2H0I A;  4WEY A;  3TRX A;  3G7I A;  1F3A A;  1JZD A;  2KP1 A;  1EZK A;  3DGQ A;  2GQL A;  3ZFB A;  2P31 A;  2LJA A;  1NHY A;  2NDO A;  2ALB A;  3D4T A;  1TKD B;  1SL2 B;  1HNA A;  2WS2 A;  3BJ5 A;  1GTB A;  3LEF A;  2LUS A;  3G9B A;  2DKI A;  1JZW A;  5D9W A;  2GVP A;  3ZFL A;  4O5R A;  3RHC A;  5KOX A;  4AKH A;  3RHB A;  3D21 A;  3GL3 A;  2XPD A;  3ZRD A;  1XW6 A;  1DSB A;  1CQG A;  1TRV A;  1VRS D;  2IL3 A;  1QXH A;  5A34 B;  4Z2R A;  4D73 B;  2RUE A;  4MZW A;  2VL3 A;  2IFQ B;  5HR3 A;  2ON5 A;  2WVY A;  3CRU A;  2RII A;  1QFN A;  5FHI A;  3TKP A;  3CMI A;  2C3Q A;  4KH7 A;  1X9S B;  1M9A A;  4AKG A;  3GH6 A;  1URM A;  1LJR A;  2E7P A;  4KSO A;  3MDK A;  1A24 A;  2FNO A;  1YEW C;  2O87 A;  4EDZ A;  1BJX A;  1GSE A;  2QA1 A;  2B3S A;  4K6X A;  1HNB A;  1WWJ A;  1A23 A;  1RQM A;  4WKW A;  2NVL A;  1ZYN A;  2O5V A;  5G1K A;  1YQ1 A;  2L5L A;  2WDU A;  3VK9 A;  2MMO A;  1T8E B;  1GSU A;  4HOJ A;  4EKZ A;  3TKS A;  3TU3 B;  1VF2 A;  3HCZ A;  1Y6E A;  2AAW A;  3C1S A;  3ZML A;  5IMF A;  4WF4 A;  2GQK A;  2V1M A;  2TRX A;  5DCG A;  2LKU A;  2LQO A;  3F4S A;  1V57 A;  5ID2 A;  1Z9H A;  1SK0 A;  5CP1 A;  5G5E A;  3S9F A;  5DDL A;  2H71 A;  4KB3 A;  1K0O A;  1TJD A;  5GZZ B;  2CVB A;  2VCX A;  1MDI A;  3Q18 A;  2BTO T;  2H76 A;  1A8Y A;  1XOB A;  2I1U A;  5A4U A;  1GNW A;  3NIV A;  4DSS B;  2YOI A;  2RM6 A;  2YNX A;  1BED A;  1DUG A;  2FWE A;  4JR6 A;  3GUR A;  2L5O A;  1SKS B;  4HZ4 A;  3IV4 A;  3TJK A;  5IO2 A;  1ZYQ B;  4PQH A;  2HRK B;  4QL9 A;  4JR4 A;  2B1L A;  3P2A A;  3WGX A;  5KEJ A;  5J4V A;  4KDU A;  2MMZ A;  4ZBD A;  2DJ2 A;  3IBH A;  3CQF A;  1M7T A;  5LNK e;  4HU9 A;  1K3L A;  5H5S A;  4K8M A;  2YV9 A;  5G5F A;  3K8N A;  3QAG A;  2H6Z A;  3HD5 A;  4K1F A;  2PWJ A;  5CYY A;  2HZE A;  1USB A;  2PUK C;  3H79 A;  2EC4 A;  2IIY A;  2DBC A;  2H30 A;  5D73 A;  4XRD A;  4ZBB A;  3F63 A;  3R3E A;  1XWK A;  1V9W A;  4X43 A;  3QCP A;  4XS6 A;  3QD9 A;  1GNE A;  3G7J A;  1QUW A;  2CV4 A;  3RDW A;  1X5D A;  2OE3 A;  3H93 A;  1N2A A;  1G0T A;  3C7M A;  1T4Z A;  2YWN A;  2B5Y A;  3DML A;  5ECO B;  4YAV A;  2O7K A;  1I5G A;  5J40 A;  4E8H A;  4ZL8 A;  3C73 A;  4IS0 A;  2VCQ A;  2VCT A;  2A4H A;  1YVL A;  2HNL A;  2YPM A;  4EUY A;  2A4V A;  3CWG A;  1CQH A;  2HE3 A;  2LJK A;  1ILO A;  3GMF A;  3LJR A;  4KAE A;  2CX4 A;  4KGI A;  3ZIT A;  2HSN A;  3HVS A;  1SD9 A;  1GSQ A;  3LSZ A;  5CRG A;  3APO A;  4MK3 A;  1YEP A;  1ZZY A;  2R0C A;  1AQV A;  2GZY A;  1OKD A;  2H73 A;  2Z9S A;  4NV2 A;  3HHV A;  3KH7 A;  2HSN B;  2PBJ A;  2FWH A;  3EVI A;  4MCU A;  2QA2 A;  1TU7 A;  4ML1 A;  2KP2 A;  1GWC A;  2ZCT A;  3A2X A;  4J57 E;  4L0U A;  4AKX B;  1R4W A;  4NWY A;  2REM A;  3APS A;  5BMU A;  1DE2 A;  1Z3E A;  3F8U A;  1M99 A;  2X8H A;  2PPT A;  5IPH A;  2IMF A;  1WIK A;  4ACS A;  4FQU A;  1B9X C;  3KD0 A;  3ZL5 A;  2F3M A;  3ZTL A;  5IMV A;  5A1N A;  4L0W A;  4TKY A;  4QMK A;  3QFB C;  1FVJ A;  3F9U A;  2WCI A;  2C3T A;  1ZCP A;  3GKM A;  2LNT A;  4GST A;  4IBP A;  5F8B A;  1O7U A;  2JL4 A;  2VIM A;  3P90 A;  1SJ6 A;  4RQR A;  4JE1 A;  1B9Y C;  2GT5 A;  2R5G A;  2YJH A;  4LA1 A;  5B7C A;  2O85 A;  2H6X A;  2J9H A;  3UIW A;  3U6V A;  1JHB A;  1JLV A;  2LEG A;  4GDF A;  1TI1 A;  4ZL9 A;  2G0F A;  2HXK A;  4NHZ A;  1THX A;  4ICY A;  2GSQ A;  5LCZ A;  4BIK A;  5ECH B;  1EGO A;  4J56 E;  2C1Y A;  5B8A A;  3VPQ A;  2B6M A;  1YKA A;  3RFR C;  1Z7P A;  5H5Q A;  5HQP A;  4K2X A;  2RUF A;  2UZ8 A;  2CAI A;  1TU8 A;  2VCV A;  1GP1 A;  19GS A;  4ZBA A;  3ISO A;  4PNG A;  4PTS A;  3VWW A;  4LMV A;  2HRF A;  3CRT A;  1A2L A;  5HFI A;  5D96 A;  4F0B A;  3DEX A;  3HJM A;  4LL1 B;  4AF2 A;  1JLW A;  2CVK A;  4F82 A;  5KN3 A;  4BL7 A;  1MDK A;  3GV1 A;  3IK9 A;  5AN1 A;  2FHE A;  2F9S A;  4WBJ A;  3L9V A;  2YAN A;  3FYG A;  1GSY A;  1PSQ A;  2VL2 C;  2RM5 A;  4OCE A;  1XG8 A;  2FY6 A;  4GRF A;  3ZZX A;  2HRN A;  1IYI A;  1K0M A;  1TK0 B;  4O5Q A;  4XTS A;  2XBQ A;  1ERV A;  4V1A g;  3DRN A;  5LD0 A;  5IIZ A;  4IGJ A;  5HFK A;  5JWQ B;  1S4B P;  1QMV A;  2H66 A;  3FZ5 A;  3Q19 A;  3DYR A;  4OFT A;  3GTU A;  3TJB A;  9GSS A;  3BCK A;  2DJK A;  3FY7 A;  3GHA A;  5F0G A;  3L78 A;  4HQS A;  3LFL A;  2VCZ A;  1UC7 A;  3KMN A;  3MWH A;  1F2E A;  2PU9 C;  2L6C A;  4ECB A;  3BCI A;  4PUF C;  3N5O A;  3KCM A;  3MIX A;  4TN8 A;  12GS A;  4GWR A;  5EY6 A;  4TR0 A;  2FGX A;  2C8U A;  3FMW A;  1N25 A;  2R3X A;  2H19 A;  17GS A;  4WET A;  4TXV A;  2HSM B;  2OAC A;  1V58 A;  4PXO A;  2GLR A;  1S3C A;  3TUE A;  2FA4 A;  4V2M A;  4K2D A;  5D9T A;  3RPN A;  1G7E A;  1TP9 A;  5J3R A;  2VLU A;  1GUK A;  2VM1 A;  5A4W A;  20GS A;  2GGT A;  4E8E A;  2H0G A;  3UAP A;  2F51 A;  4EF0 A;  1EV9 A;  1F3B A;  4MF6 A;  3O6T A;  2I81 A;  4PQ1 A;  5COH A;  4E68 A;  2NBS A;  1R26 A;  4YQU A;  2WUL A;  1GSF A;  1TI3 A;  4MAB A;  1R5P A;  3HVX A;  4JED A;  3ERG A;  3I6A A;  2XBI A;  3D22 A;  3HJO A;  3HVV A;  1SD8 A;  4MDC A;  4G0I A;  5AIX A;  4XS4 B;  3CBU A;  3LGC A;  4ZB7 A;  1PRX A;  1MD4 A;  1MEK A;  1XZO A;  1W89 A;  6GSY A;  1HNC A;  4J2F A;  3E0U A;  4TVE A;  4MZB A;  3PPU A;  3CSI A;  1JZO A;  1GTA A;  2L57 A;  4N0V A;  4IJI A;  3EPT A;  3IAS 2;  1SL0 B;  1KTE A;  3IE3 A;  3H4K A;  3DVX A;  1YY7 A;  2P0G A;  2B7K A;  4HU7 A;  4OCF A;  1NHO A;  3UBL A;  1QQ2 A;  5A34 A;  4D73 A;  1PX6 A;  2I3Y A;  2VL9 A; 
#chains in the Genus database with same CATH homology
 2IFQ A;  2K8V A;  5DAK B;  1EP8 A;  1XWC A;  1VF4 A;  3KTL A;  1THO A;  4XS1 A;  4ECJ A;  3KIJ A;  1EOG A;  3I43 A;  2IMD A;  1K0D A;  3QR6 A;  1TW9 A;  4NPB A;  3J7Y k;  3IOS A;  2IWT A;  2L6D A;  5HR2 A;  4PUA A;  2VAF A;  4IP1 A;  3IC8 A;  1M2B A;  2P5Q A;  2X99 A;  1YJ6 A;  3FR9 A;  1H4O A;  4F03 A;  4RI6 A;  2LRT A;  1BG1 A;  2MYG A;  3ED3 A;  1GUM A;  2AJQ B;  4Q5F A;  11GS A;  3L4N A;  4WR4 A;  2KLX A;  4NHW A;  2PN8 A;  4YKG A;  4EVM A;  3KEB A;  4OO4 A;  3GUS A;  4V1A p;  4BVX B;  3F6F A;  3GA4 A;  2VO4 A;  3GFK A;  4BA7 A;  5G1L A;  2C80 A;  4IJ3 A;  4IN0 A;  2DIZ A;  5ELA A;  3WGD A;  3HXS A;  1SEN A;  1ZOF A;  2OE0 A;  2I4A A;  4FO5 A;  3KMO A;  1YKC A;  2R2J A;  1BG5 A;  2OE1 A;  4YQM A;  3DWV A;  4MMM A;  2KHP A;  2YWM A;  2H6Y A;  4MA9 A;  2FWF A;  2X8G A;  2BMX A;  2WB9 A;  2OKA A;  3HJP A;  3UJ1 A;  1XFL A;  2H1B A;  4FIW A;  5CNW A;  3IA1 A;  3TKR A;  1HD2 A;  2VOC A;  1WOU A;  3VI7 A;  2IJY A;  2LJR A;  1GLQ A;  5ENU A;  3TDG A;  4RQX A;  4DSS A;  2KUC A;  1HQO A;  2ON7 A;  5KN0 A;  3FEU A;  1F9M A;  3V1W A;  4OFN A;  5ECQ B;  4CY6 A;  4EXJ A;  2VM2 A;  2C0E A;  2CVD A;  3VUR A;  4I2U A;  4Q5N A;  3EE2 A;  3GN3 A;  4I97 A;  2HRK A;  1PX7 A;  1PA3 A;  4GTU A;  1XBS A;  4HDE A;  3TJJ A;  1TRW A;  1ZYP A;  1EEM A;  1TOF A;  1UVZ A;  4G01 A;  2CAQ A;  2LQQ A;  5HFG A;  1WRY A;  5JCU A;  4OFM A;  2R4V A;  3KP8 A;  1O73 A;  5KN1 A;  2CA8 A;  4FYC A;  3TKS C;  4L5O A;  3FR3 A;  1AC1 A;  3AY8 A;  2LNS A;  3F3R A;  3TB2 A;  3W8S A;  3EMP A;  4WF5 A;  2DML A;  2EFH A;  1YF1 A;  2P5R A;  3MNG A;  2AHE A;  2E0Q A;  5IOX A;  3FZA A;  3TKQ A;  10GS A;  2ZNM A;  4V2N A;  2M46 A;  2YWI A;  4HJM A;  3E9J B;  1S3A A;  1AIU A;  1WE0 A;  4NAX A;  2B5X A;  1FB6 A;  3FHK A;  1NW2 A;  1U3I A;  4BWQ A;  2V6O A;  4NXI A;  3OR5 A;  3G7Y A;  1BYE A;  2PVQ A;  4YAP A;  2KOK A;  2XPE A;  4QQ7 A;  2CQ9 A;  1OE8 A;  1ZL9 A;  4G9H A;  3M0F A;  3LW9 A;  4MLY A;  4MP4 A;  3QMX A;  1A0F A;  3BBY A;  2D2Z A;  4CW9 A;  4WR5 A;  14GS A;  1OAZ A;  3UEM A;  5GSS A;  1WP0 A;  2LST A;  3W8J A;  4IKH A;  1SYX A;  3QAV A;  3ERW A;  1T4Y A;  3ZIJ A;  1FB0 A;  4MF5 A;  4K5R A;  2GTU A;  4N10 A;  1TXU A;  6GSU A;  3CXG A;  1OC3 A;  3KM6 A;  3UOM A;  3KZQ A;  4K7N A;  3IR4 A;  3MYD A;  2GSS A;  5AIS A;  5F05 A;  2C0G A;  2PER A;  4LLR A;  2VLV A;  4MH3 A;  1ERW A;  3D0Z A;  4X0X A;  2UV8 G;  2WFC A;  2AUV A;  3M9K A;  1O8X A;  2G2Q A;  2OBK A;  5D8I A;  3FR6 A;  5ECI B;  1OC9 B;  3APQ A;  4BVY B;  2VUP A;  1XWA A;  4O32 A;  3UL3 A;  2HQT A;  3IXR A;  4IHU A;  3UVT A;  1J9B A;  5B8B A;  2JSZ A;  2DC5 A;  8GSS A;  3ERF A;  2GZP A;  5DBQ A;  1EEJ A;  2C4J A;  4Z2T A;  3CSJ A;  2R6K A;  5G31 A;  1YF0 A;  1QK8 A;  1F6M C;  3ZIV A;  2A2R A;  1Z6M A;  2MZC A;  4EIP A;  1SVL A;  2H70 A;  4KSM A;  1Y25 A;  4HEA 2;  3TJF A;  1T3B A;  1A8L A;  1XCC A;  2X64 A;  3J7Y b;  4LMW A;  1K0C A;  2JZS A;  4TR1 B;  2YZU A;  1GTU A;  1RK4 A;  5ECP B;  3VLN A;  4BWS A;  1AQW A;  3FKF A;  3ZVJ D;  6GSV A;  2WJU A;  5IM9 A;  2JSY A;  1DBY A;  1X9W B;  5A4V A;  3WT2 A;  3M8N A;  3FZ4 A;  3LYK A;  1O81 A;  2YV7 A;  1EOH A;  4G2E A;  1PN9 A;  5DQY A;  1K3O A;  1AAZ A;  4O7H A;  5KN2 A;  5D9V A;  3L9S A;  3EU4 A;  4IVF A;  2K8S A;  2DLX A;  3F0I A;  1U88 A;  4PGT A;  4DSQ A;  1PKW A;  2R0G A;  2EIO A;  2GQM A;  3O3T A;  4I6X A;  1B8X A;  2YJ7 A;  5EPF A;  2C0F A;  3HDC A;  4N30 A;  1X9M B;  3MSZ A;  2R0P A;  1M9B A;  4G19 A;  2QGV A;  2FLS A;  4EC0 A;  3GIX A;  4YH2 A;  1Z7R A;  5IPG A;  4TR3 A;  5ELG A;  2XHF A;  1DE1 A;  1O85 A;  3IAM 2;  3F3Q A;  3NOF A;  2VLT A;  3F4R A;  1J0F A;  2B5E A;  3LQ7 A;  3BD2 A;  1XXU A;  4KDX A;  3I69 A;  1ZYE A;  1TRS A;  2O8V B;  2K9F A;  1YZX A;  2DJJ A;  4MNN A;  4AJ6 A;  4K5S A;  3IDV A;  3WT1 A;  4KUN A;  2FCH A;  3EMX A;  2YN1 A;  3KTB A;  4RI7 A;  5G2Z A;  3FRC A;  3DD3 A;  1TTZ A;  3LOR A;  2O89 A;  3SWL A;  2GZZ A;  4TXO A;  4TW5 A;  2X4A A;  2HSM A;  5INY A;  2LTK A;  4I8B A;  4WBR D;  5EVO A;  2RLI A;  4GXZ A;  1J08 A;  4OMV A;  1XPV A;  5J47 A;  2C3N A;  1OE7 A;  4EDY A;  4EO3 A;  4TXO B;  4F0C A;  4TR4 A;  3C71 A;  1K3Y A;  1X5C A;  4JU5 A;  3EUR A;  1SJZ A;  5E4W A;  1BF5 A;  5DAL B;  1XW5 A;  1EV4 A;  1LBK A;  5CRW A;  2H1L A;  2YCD A;  4JBB A;  3QPM A;  4KW6 A;  2DJ3 A;  2QKE A;  2AYT A;  1T7P B;  4YKF A;  3A2V A;  5ABR A;  1Z5Y E;  1TRU A;  3GL5 A;  3EC3 A;  1C72 A;  2N5A A;  2YP6 A;  2MBS A;  1V2A A;  3KJY A;  5JWO B;  4I2T A;  2H0H A;  4XS4 A;  2JU5 A;  4KND A;  1PL1 A;  3WD6 A;  1MTC A;  5IMZ A;  3KH9 A;  2GST A;  3DVW A;  2PGT A;  3GH9 A;  4N11 A;  1T00 A;  2MMA A;  3ME7 A;  4CY8 A;  1SK1 A;  2PMT A;  1OKT A;  2VD0 A;  1JZR A;  1SL1 B;  1T1V A;  1KBN A;  2CT6 A;  5ECS A;  3FK8 A;  4WXT A;  3KP9 A;  4FH8 A;  5E59 A;  1AQX A;  4L8E A;  1XOA A;  3KGK A;  2IMI A;  4OD7 A;  4QL7 A;  5DAK A;  2DIY A;  2K6V A;  3VWU A;  1WMJ A;  5GAP D;  3HY2 A;  4PUR A;  3C8E A;  1XVQ A;  5D9X A;  5B6N A;  2HSH A;  2A2P A;  1KNG A;  2QC7 A;  5CRH A;  3D5J A;  1E2Y A;  5GST A;  1PL2 A;  4POL A;  3FZ9 A;  1V98 A;  1NM3 A;  3O76 A;  1XWB A;  22GS A;  3GRX A;  2FD3 A;  1B4Q A;  5IMD A;  4CHS A;  4BVX A;  4ID0 A;  2I9H A;  1EGR A;  4DEJ A;  3PR8 A;  3GNJ A;  1FVK A;  4ML6 A;  4ZB6 A;  2AV4 A;  3A2W A;  5FT3 A;  1M0U A;  3DIE A;  3IC4 A;  2IMK A;  3QAW A;  1BAY A;  3EYT A;  1GLP A;  1UA5 A;  2EIQ A;  3CSH A;  3VPT A;  2E2M A;  4AJ8 A;  4ECI A;  3RBT A;  2DJ1 A;  3RPP A;  4POK A;  4POB A;  1V40 A;  5A5K A;  4K0N A;  3HZ8 A;  2WRT A;  4ZB9 A;  6GSW A;  2TIR A;  3M3M A;  1S3D A;  4KCA A;  4AJ7 A;  3TOU A;  1RW1 A;  1GTI A;  3TKS E;  2IN3 A;  1ON4 A;  3HA9 A;  5IOW A;  2ES7 A;  3H1N A;  1SKW B;  1GRX A;  5F06 A;  5CRD A;  1B4P A;  3P7X A;  5J9C A;  4OO5 A;  3BOA A;  3TRQ A;  4N3Z A;  4IQA A;  1SU9 A;  1ZMA A;  3IHQ A;  1VF3 A;  1N8J A;  5JWR B;  4MJC A;  3Q74 A;  4XCS A;  4XHM A;  1ML6 A;  2X8C A;  5CO3 A;  6GST A;  2DMM A;  4ZIJ A;  1FAA A;  2GSR A;  2JAC A;  4NV5 A;  2HZF A;  1R7H A;  1O8W A;  4XIH A;  2K18 A;  2IME A;  3N9J A;  1NSW A;  4ZIL A;  3ME8 A;  5GAN D;  2XC2 A;  2R37 A;  4KX4 A;  2PVO C;  3UAR A;  4N0Z A;  1Q4J A;  5J4Y A;  5CRE A;  5ID2 B;  2IPA A;  3LXZ A;  5H5R A;  2H1D A;  2LRC A;  5IO0 A;  2HSY A;  3IPZ A;  4O5U A;  3GSS A;  2CZ2 A;  1A0R P;  1SJI A;  4KF9 A;  5ECK B;  5J41 A;  4W66 A;  5DQS A;  1XW9 A;  4FYB A;  3DXB A;  4EIQ A;  4NMU A;  5JCG A;  3C1R A;  1YEX A;  1TDI A;  4IEL A;  2FWG A;  2H1G A;  3PGT A;  4LL4 B;  5IMA A;  3L0H A;  5CAX A;  1WJK A;  2VCW A;  4MJE A;  1FOV A;  5KOW A;  2LS5 A;  1K0N A;  3A5I A;  3LWA A;  3LYP A;  5B6M A;  1SYR A;  18GS A;  5C00 A;  3HMJ G;  4OWY A;  2OA7 A;  3WGE A;  1AXD A;  3TRP A;  4Q5Q A;  4K7I A;  1OYJ A;  4ISD A;  4USS A;  1U6T A;  2FUG 2;  4GSN A;  1OC8 A;  2HFD A;  5DVB A;  4KDY A;  4GQF A;  1ERU A;  1AUC A;  5DJL A;  2DJ0 A;  1XWG A;  2N5B A;  5DJM A;  2HZE B;  5AIV A;  5F07 A;  2L4C A;  4IP6 A;  1GSD A;  2H8L A;  1OC9 A;  4EL1 A;  4BVY A;  1Y1U A;  3RAZ A;  5IQY A;  5G30 A;  1Q98 A;  1ST9 A;  4XRA A;  3L9U A;  1JFU A;  1K0B A;  3QFA C;  1H75 A;  4MH2 A;  5ECM B;  4ECC A;  2B1K A;  3W6G A;  4G0L A;  2H72 A;  4TOP A;  2V2G A;  3GX0 A;  3EU3 A;  4MPF A;  5AGY A;  5EL8 A;  3ZRE A;  2JZR A;  1B48 A;  2NPB A;  1PKZ A;  2MMN A;  3QOU A;  3VWV A;  2F8F A;  6GSS A;  3E3E A;  4H86 A;  1W4V A;  1FHE A;  3Q6O A;  3DKS A;  5D93 A;  2DSA A;  3ZVJ A;  4PNF A;  4POM A;  3GX8 A;  2VD1 A;  1BX9 A;  1TXX A;  1VF1 A;  4TR1 A;  3VWX A;  3I9V 2;  2M80 A;  5C04 A;  1QGV A;  1GL8 A;  2JZT A;  4V2L A;  4JZQ A;  4TRX A;  2GDR A;  3WYW A;  4ULX A;  1GSS A;  4Z2U A;  5ECN B;  1X0R A;  4MPG A;  2HRA A;  3M1G A;  2V41 A;  3GKN A;  2H1A A;  3IK7 A;  16GS A;  3SBC A;  4K7O A;  3TGZ A;  5BMU B;  1PN0 A;  4GQC A;  4IQ1 A;  1I9D A;  5IMC A;  5J5N A;  4PX1 A;  3ZLP A;  2H74 A;  4RUV A;  1F37 A;  2LRN A;  1ABA A;  4MZC A;  2DKH A;  4ZB8 A;  2GT6 A;  5ECR B;  13GS A;  5A1N B;  2C0D A;  3M9J A;  4HS1 A;  2M72 A;  2MBT A;  2B7J A;  1WPI A;  3KXO A;  3US3 A;  5JCW A;  3JCM L;  1X5E A;  7GSS A;  2EFC A;  1FO5 A;  4MJA A;  4KA0 A;  3IRA A;  1IYH A;  4F2I A;  3UMA A;  1G7O A;  3HYP A;  4ILF A;  3LXT A;  1KEB A;  3ZMK A;  5BRT A;  3PH9 A;  5L71 A;  1E6B A;  1LU4 A;  2BJX A;  2VL2 A;  5J4U A;  4KCE A;  1EWX A;  4AGS A;  4A5P A;  4AI6 A;  1M2D A;  4PQI A;  4MF7 A;  2YZH A;  4Z7X A;  3GYK A;  1BQ7 A;  1G6Y A;  1PQN A;  2YWO A;  4ZL7 A;  3HZ4 A;  1OVN A;  3VFI A;  4GF0 A;  4HQZ A;  2L4Q A;  1XIY A;  1MD3 A;  2VKZ G;  2FA8 A;  2N5F A;  2H75 A;  3QDN A;  2OBI A;  3LG6 A;  1AW9 A;  2V6K A;  3A3T A;  2WZ9 A;  4Q5R A;  2OJL A;  1SVM A;  4JRR A;  2F8A A;  1PGT A;  5A5H A;  1FW1 A;  2HLS A;  2E2G A;  3F4T A;  5FWG A;  4BPY A;  3D4M A;  3U5R E;  2OAD A;  4K0G A;  4HUA A;  1SKR B;  3H8Q A;  1ACV A;  3TCO A;  4BL7 B;  3PIN A;  2OT3 A;  4CDO A;  1Z6N A;  3MAK A;  2ZUP A;  5A5H B;  1A2M A;  4FYU A;  1GUL A;  3IHG A;  4HI7 A;  2EIR A;  3UBK A;  4P3Y B;  4DVC A;  1M2A A;  1EP7 A;  4HZ2 A;  2HT9 A;  5DAL A;  3F6D A;  5HR0 A;  1O6J A;  4L5L A;  4GCI A;  4F9Z A;  2TRC P;  4ZXG A;  5DCH A;  1PD2 1;  3GTU B;  3CTG A;  1U87 A;  1G6W A;  4GLT A;  4AKI A;  1HYU A;  2GS3 A;  2J23 A;  3HKR A;  2A2S A;  3CTF A;  2WGR A;  4X4J A;  1XVW A;  1YDK A;  1GH2 A;  1FG4 A;  3EIN A;  3A5W A;  2JAD A;  4I5Q A;  2QSI A;  2CZ3 A;  3UVH A;  3GKK A;  2HYX A;  3VI5 A;  1FOH A;  2H01 A;  4O92 A;  6GSX A;  1GUH A;  5ECL B;  4IW9 A;  2L59 A;  3CYN A;  3D6I A;  3TJG A;  4YQV A;  2HI7 A;  1ZGN A;  4GSS A;  2NTO A;  3EWL A;  3R2Q A;  4MJB A;  1SK2 A;  3GST A;  4DSR A;  1MDJ A;  3GKX A;  1TK5 B;  1VGL A;  1UN2 A;  2LV3 A;  3ZYW A;  5HR1 A;  2EFE A;  2AB6 A;  1PMT A;  3FW2 A;  4EE0 A;  1TK8 B;  1K0A A;  1A2J A;  1R5A A;  4HJ2 A;  2CX3 A;  4G0K A;  3TOT A;  1U3A A;  5J9B A;  2EFD A;  3NZN A;  2V32 A;  1SVO A;  4G10 A;  4K9Z A;  2X49 A;  3P8W A;  4X1U A;  4KE3 A;  1ERT A;  2H0I A;  4WEY A;  3TRX A;  3G7I A;  1F3A A;  1JZD A;  2KP1 A;  1EZK A;  3DGQ A;  2GQL A;  3ZFB A;  2P31 A;  2LJA A;  1NHY A;  2NDO A;  2ALB A;  3D4T A;  1TKD B;  1SL2 B;  1HNA A;  2WS2 A;  3BJ5 A;  1GTB A;  3LEF A;  2LUS A;  3G9B A;  2DKI A;  1JZW A;  5D9W A;  2GVP A;  3ZFL A;  4O5R A;  3RHC A;  5KOX A;  4AKH A;  3RHB A;  3D21 A;  3GL3 A;  2XPD A;  3ZRD A;  1XW6 A;  1DSB A;  1CQG A;  1TRV A;  1VRS D;  2IL3 A;  1QXH A;  5A34 B;  4Z2R A;  4D73 B;  2RUE A;  4MZW A;  2VL3 A;  2IFQ B;  5HR3 A;  2ON5 A;  3CRU A;  2RII A;  1QFN A;  5FHI A;  3TKP A;  3CMI A;  2C3Q A;  4KH7 A;  1X9S B;  1M9A A;  4AKG A;  3GH6 A;  1URM A;  1LJR A;  2E7P A;  4KSO A;  3MDK A;  1A24 A;  2FNO A;  2O87 A;  4EDZ A;  1BJX A;  1GSE A;  2QA1 A;  2B3S A;  4K6X A;  1HNB A;  1WWJ A;  1A23 A;  1RQM A;  4WKW A;  2NVL A;  1ZYN A;  2O5V A;  5G1K A;  1YQ1 A;  2L5L A;  2WDU A;  3VK9 A;  2MMO A;  1T8E B;  1GSU A;  4HOJ A;  4EKZ A;  3TKS A;  3TU3 B;  1VF2 A;  3HCZ A;  1Y6E A;  2AAW A;  3C1S A;  3ZML A;  5IMF A;  4WF4 A;  2GQK A;  2V1M A;  2TRX A;  5DCG A;  2LKU A;  2LQO A;  3F4S A;  1V57 A;  5ID2 A;  1Z9H A;  1SK0 A;  5CP1 A;  5G5E A;  3S9F A;  5DDL A;  2H71 A;  4KB3 A;  1K0O A;  1TJD A;  5GZZ B;  2CVB A;  2VCX A;  1MDI A;  3Q18 A;  2BTO T;  2H76 A;  1A8Y A;  1XOB A;  2I1U A;  5A4U A;  1GNW A;  3NIV A;  4DSS B;  2YOI A;  2RM6 A;  2YNX A;  1BED A;  1DUG A;  2FWE A;  4JR6 A;  3GUR A;  2L5O A;  1SKS B;  4HZ4 A;  3IV4 A;  3TJK A;  5IO2 A;  1ZYQ B;  4PQH A;  2HRK B;  4QL9 A;  4JR4 A;  2B1L A;  3P2A A;  3WGX A;  5KEJ A;  5J4V A;  4KDU A;  2MMZ A;  4ZBD A;  2DJ2 A;  3IBH A;  1M7T A;  5LNK e;  4HU9 A;  1K3L A;  5H5S A;  4K8M A;  2YV9 A;  5G5F A;  3K8N A;  3QAG A;  2H6Z A;  3HD5 A;  4K1F A;  2PWJ A;  5CYY A;  2HZE A;  1USB A;  2PUK C;  3H79 A;  2EC4 A;  2IIY A;  2DBC A;  2H30 A;  5D73 A;  4XRD A;  4ZBB A;  3F63 A;  3R3E A;  1XWK A;  1V9W A;  4X43 A;  3QCP A;  4XS6 A;  3QD9 A;  1GNE A;  3G7J A;  1QUW A;  2CV4 A;  3RDW A;  1X5D A;  2OE3 A;  3H93 A;  1N2A A;  1G0T A;  3C7M A;  1T4Z A;  2YWN A;  2B5Y A;  3DML A;  5ECO B;  4YAV A;  2O7K A;  1I5G A;  5J40 A;  4E8H A;  4ZL8 A;  3C73 A;  4IS0 A;  2VCQ A;  2VCT A;  2A4H A;  1YVL A;  2HNL A;  2YPM A;  4EUY A;  2A4V A;  3CWG A;  1CQH A;  2HE3 A;  2LJK A;  1ILO A;  3GMF A;  3LJR A;  4KAE A;  2CX4 A;  4KGI A;  3ZIT A;  2HSN A;  3HVS A;  1SD9 A;  1GSQ A;  3LSZ A;  5CRG A;  3APO A;  4MK3 A;  1YEP A;  1ZZY A;  2R0C A;  1AQV A;  2GZY A;  1OKD A;  2H73 A;  2Z9S A;  4NV2 A;  3HHV A;  3KH7 A;  2HSN B;  2PBJ A;  2FWH A;  3EVI A;  4MCU A;  2QA2 A;  1TU7 A;  4ML1 A;  2KP2 A;  1GWC A;  2ZCT A;  3A2X A;  4J57 E;  4L0U A;  4AKX B;  1R4W A;  4NWY A;  2REM A;  3APS A;  5BMU A;  1DE2 A;  1Z3E A;  3F8U A;  1M99 A;  2X8H A;  2PPT A;  5IPH A;  2IMF A;  1WIK A;  4ACS A;  4FQU A;  1B9X C;  3KD0 A;  3ZL5 A;  2F3M A;  3ZTL A;  5IMV A;  5A1N A;  4L0W A;  4TKY A;  4QMK A;  3QFB C;  1FVJ A;  3F9U A;  2WCI A;  2C3T A;  1ZCP A;  3GKM A;  2LNT A;  4GST A;  4IBP A;  5F8B A;  1O7U A;  2JL4 A;  2VIM A;  3P90 A;  1SJ6 A;  4RQR A;  4JE1 A;  1B9Y C;  2GT5 A;  2R5G A;  2YJH A;  4LA1 A;  5B7C A;  2O85 A;  2H6X A;  2J9H A;  3UIW A;  3U6V A;  1JHB A;  1JLV A;  2LEG A;  4GDF A;  1TI1 A;  4ZL9 A;  2G0F A;  2HXK A;  4NHZ A;  1THX A;  4ICY A;  2GSQ A;  5LCZ A;  5ECH B;  1EGO A;  4J56 E;  2C1Y A;  5B8A A;  3VPQ A;  2B6M A;  1YKA A;  1Z7P A;  5H5Q A;  5HQP A;  4K2X A;  2RUF A;  2UZ8 A;  2CAI A;  1TU8 A;  2VCV A;  1GP1 A;  19GS A;  4ZBA A;  3ISO A;  4PNG A;  4PTS A;  3VWW A;  4LMV A;  2HRF A;  3CRT A;  1A2L A;  5HFI A;  5D96 A;  4F0B A;  3DEX A;  3HJM A;  4LL1 B;  4AF2 A;  1JLW A;  2CVK A;  4F82 A;  5KN3 A;  4BL7 A;  1MDK A;  3GV1 A;  3IK9 A;  5AN1 A;  2FHE A;  2F9S A;  4WBJ A;  3L9V A;  2YAN A;  3FYG A;  1GSY A;  1PSQ A;  2VL2 C;  2RM5 A;  4OCE A;  2FY6 A;  4GRF A;  3ZZX A;  2HRN A;  1IYI A;  1K0M A;  1TK0 B;  4O5Q A;  4XTS A;  2XBQ A;  1ERV A;  4V1A g;  3DRN A;  5LD0 A;  5IIZ A;  4IGJ A;  5HFK A;  5JWQ B;  1QMV A;  2H66 A;  3FZ5 A;  3Q19 A;  3DYR A;  4OFT A;  3GTU A;  3TJB A;  9GSS A;  3BCK A;  2DJK A;  3FY7 A;  3GHA A;  5F0G A;  3L78 A;  4HQS A;  3LFL A;  2VCZ A;  1UC7 A;  3KMN A;  3MWH A;  1F2E A;  2PU9 C;  2L6C A;  4ECB A;  3BCI A;  4PUF C;  3N5O A;  3KCM A;  3MIX A;  4TN8 A;  12GS A;  4GWR A;  5EY6 A;  4TR0 A;  2FGX A;  2C8U A;  3FMW A;  1N25 A;  2R3X A;  2H19 A;  17GS A;  4WET A;  4TXV A;  2HSM B;  2OAC A;  1V58 A;  4PXO A;  2GLR A;  1S3C A;  3TUE A;  2FA4 A;  4V2M A;  4K2D A;  5D9T A;  3RPN A;  1G7E A;  1TP9 A;  5J3R A;  2VLU A;  1GUK A;  2VM1 A;  5A4W A;  20GS A;  2GGT A;  4E8E A;  2H0G A;  3UAP A;  2F51 A;  4EF0 A;  1EV9 A;  1F3B A;  4MF6 A;  3O6T A;  2I81 A;  4PQ1 A;  5COH A;  4E68 A;  2NBS A;  1R26 A;  4YQU A;  2WUL A;  1GSF A;  1TI3 A;  4MAB A;  1R5P A;  3HVX A;  4JED A;  3ERG A;  3I6A A;  2XBI A;  3D22 A;  3HJO A;  3HVV A;  1SD8 A;  4MDC A;  4G0I A;  5AIX A;  4XS4 B;  3CBU A;  3LGC A;  4ZB7 A;  1PRX A;  1MD4 A;  1MEK A;  1XZO A;  1W89 A;  6GSY A;  1HNC A;  4J2F A;  3E0U A;  4TVE A;  4MZB A;  3PPU A;  3CSI A;  1JZO A;  1GTA A;  2L57 A;  4N0V A;  4IJI A;  3EPT A;  3IAS 2;  1SL0 B;  1KTE A;  3IE3 A;  3H4K A;  3DVX A;  1YY7 A;  2P0G A;  2B7K A;  4HU7 A;  4OCF A;  1NHO A;  3UBL A;  1QQ2 A;  5A34 A;  4D73 A;  1PX6 A;  2I3Y A;  2VL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...