5A5KA

Atgstf2 from arabidopsis thaliana in complex with camalexin
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
210
Chain Sequence
GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE F2
publication title Structural evidence for Arabidopsis glutathione transferase AtGSTF2 functioning as a transporter of small organic ligands.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 81
structure length 210
sequence length 210
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a5kA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5a5kA01
4BL7A 3N5OA 2OE0A 2CZ3A 3APSA 3D21A 3QDNA 4I2UA 4XRAA 4GQFA 2RM6A 1X9WB 2IFQA 1U3AA 2I81A 1V40A 2OBKA 5G1LA 4HU9A 4TR0A 1EEMA 4ID0A 2IFQB 3IDVA 4AGSA 4NXIA 1MD3A 5IQYA 1AAZA 3ERGA 4HOJA 4EL1A 3HD5A 5B8BA 3KMNA 2YN1A 2K6VA 2B5YA 3HZ4A 2I3YA 1ZGNA 3A2VA 3F9UA 3MNGA 2B7KA 4TR1B 3WT1A 5FT3A 2LRCA 4HI7A 1UA5A 1V98A 4GSNA 3CBUA 4ZIJA 1F6MC 5IMCA 3HYPA 4L0UA 2HSHA 5D9XA 3DXBA 2LJRA 4X0XA 3GTUA 4BA7A 3LWAA 2L4CA 1TK5B 2DJJA 3QAWA 3KIJA 2E7PA 2H66A 2NDOA 4FQUA 2YPMA 2B1LA 4K8MA 3KTLA 1C72A 5DBQA 4KAEA 2BJXA 3PPUA 1OC3A 5CREA 3TJGA 4PQHA 1YEXA 4KH7A 1MDIA 3G7YA 3KXOA 3C1SA 2FWFA 4MK3A 2EIQA 3PR8A 1FOVA 3CXGA 3NIVA 1YZXA 2H73A 4D73A 3H8QA 3ISOA 1O85A 1WP0A 4XTSA 2GT6A 5CRWA 3Q19A 2N5BA 5IPHA 2JSYA 2M72A 4D73B 1EWXA 3KMOA 4OMVA 5B6MA 2H19A 2OACA 3FY7A 3EWLA 1ML6A 1Z5YE 5H5QA 5JWQB 4Q5RA 5INYA 4BVYA 1E6BA 1XWAA 3RHBA 1R4WA 1O7UA 4JR6A 5GSTA 3RHCA 5LD0A 4MA9A 2YV9A 2QKEA 2WRTA 1JZOA 4K7NA 2CZ2A 2H0GA 1PKWA 4ZBDA 4ILFA 4BVYB 3GL3A 1UVZA 5ELGA 4Z7XA 1OKTA 2YANA 3QOUA 4GRFA 1O73A 1DUGA 3UVTA 4YAVA 4NPBA 3DWVA 3P2AA 3VLNA 2GSSA 1S3DA 3TRXA 2HRKA 2K8VA 1TU7A 3IC8A 4NV5A 4LMVA 3LXTA 3QAGA 5IM9A 5DCGA 5HQPA 3LSZA 4ML6A 1O8XA 2HRKB 3VWUA 5J41A 1F9MA 2L57A 3DMLA 2AJQB 1GUKA 3J7Yb 2C3NA 3EINA 3GL5A 2J9HA 2L6DA 4F2IA 3VI7A 1BX9A 5IMDA 3KH9A 4WF5A 1R26A 3TDGA 2VUPA 3C1RA 4E8EA 2F8FA 5AN1A 3Q6OA 4J2FA 3E9JB 2R5GA 2C0DA 4IBPA 2IN3A 3M1GA 3TB2A 2PVOC 5E59A 4PURA 5D9WA 3RDWA 3A2WA 1XWGA 4PQ1A 3VWVA 1QMVA 5JCUA 1QFNA 2R4VA 3MSZA 2FUG2 2V6OA 4EKZA 3TKQA 1HD2A 4YAPA 3TRQA 5CO3A 4V1Ag 4DVCA 2TIRA 5COHA 5G2ZA 2WJUA 4XRDA 1ILOA 2GQLA 4YH2A 4FIWA 2VCZA 11GSA 3GYKA 1M9AA 3HXSA 1O6JA 1XZOA 2ZUPA 4J57E 1PX6A 5EL8A 3FW2A 2VCWA 2CVDA 4RQXA 2K8SA 2I1UA 2GQKA 1B48A 1WWJA 2HSMA 2P0GA 1EP8A 1MEKA 3GN3A 5ECRB 2LNTA 2KUCA 5ELAA 4MMMA 2X8CA 2FD3A 3RPNA 2HSMB 4MLYA 1X5DA 4E8HA 2MMOA 3LORA 3CYNA 4CHSA 1XBSA 4RI7A 3I69A 3M8NA 1UC7A 1MTCA 3CMIA 3GUSA 2CVKA 3CSHA 2NPBA 3HA9A 1B9YC 4IP1A 4WR5A 2IL3A 1EOHA 6GSWA 3E3EA 1K3LA 2R37A 2E2GA 1TRSA 3HZ8A 1XWBA 2AAWA 1SL2B 2PMTA 4KUNA 1U3IA 4HU7A 4GLTA 3F4SA 1TI3A 1A8LA 1SJZA 2H71A 2VL3A 3V1WA 1GSSA 4DSSA 4IELA 3NZNA 2DMLA 1F3BA 3VI5A 1XVWA 2EC4A 5IOXA 4G0KA 3GA4A 4FO5A 2WGRA 5HFKA 2ES7A 4DSSB 1B8XA 1OC8A 2OADA 4F9ZA 2DBCA 1OAZA 3KM6A 2LKUA 4XS6A 2YJ7A 3GFKA 3UEMA 5HFIA 3GURA 4NHZA 4IQAA 4JE1A 2JZSA 1TOFA 4ZBAA 4BVXB 4RUVA 4O32A 4IW9A 3QFAC 4MZCA 2VLVA 3R3EA 1Y6EA 3MAKA 2H74A 1XOBA 2FWEA 4F82A 3FZ4A 2HZEA 4JEDA 1OC9B 1XW6A 2LQQA 2DJKA 5GAND 2L6CA 1I9DA 2H76A 3PINA 2PVQA 3F6DA 3N9JA 2VLTA 2PPTA 4OFNA 1XXUA 4FYBA 3TJJA 4OCEA 1OYJA 3W6GA 4K0GA 4LMWA 5JWRB 3KTBA 4MJEA 3TKPA 1LJRA 5DJMA 2R2JA 3L9VA 2E0QA 4WBJA 5J9CA 3IK9A 1X9MB 1BEDA 3L78A 2LRTA 4POMA 4F0BA 2PN8A 3FR6A 1N8JA 2IMDA 3IOSA 2VM2A 1GULA 4TN8A 2VL9A 2O85A 3TOUA 2C1YA 3TJKA 1KEBA 3GIXA 4MPGA 3DVXA 4O5RA 1ZL9A 2B7JA 3C8EA 4ECIA 2ZCTA 2YV7A 1TRWA 2K9FA 2LQOA 2GSQA 1QQ2A 2PUKC 3UBKA 1SK0A 3KP9A 1Z7PA 4MZBA 2C0EA 2LNSA 5IMFA 4IJIA 3TUEA 5IOWA 4EO3A 2KOKA 3G7IA 1T00A 2R3XA 4ZL8A 3DIEA 2BTOT 5DVBA 1VF4A 4IVFA 3HDCA 3UARA 4WKWA 3H79A 2JL4A 5D93A 5CRHA 4G2EA 2VOCA 2IMFA 3QAVA 2PBJA 4MDCA 2B1KA 1T7PB 12GSA 1YKAA 2G0FA 4PUAA 4WEYA 5FWGA 2HRNA 3C71A 3TJBA 2L4QA 3EMPA 3FZ9A 2H30A 4JU5A 4OFTA 2F3MA 1EV9A 4V2NA 1AC1A 2RLIA 3EVIA 2IJYA 2YWMA 4FH8A 2IMIA 4PXOA 3GX8A 2CVBA 2H1DA 3IE3A 2DJ2A 1EEJA 1H75A 1Z6MA 4IN0A 2O87A 4EUYA 4MF6A 5D96A 2WFCA 2MYGA 2ON5A 4Q5QA 4BL7B 3IXRA 3VWWA 5ECKB 5A4UA 5G30A 3GX0A 5ECMB 2Z9SA 2IMEA 3HJPA 1GL8A 1NM3A 3FK8A 3VPQA 1M2DA 3VWXA 2MZCA 2MMZA 4EDYA 3KP8A 3F0IA 2RUEA 1AQVA 4POKA 4TXVA 5ECIB 3CSJA 4V2MA 2DJ0A 2LSTA 2GS3A 3D4MA 4GXZA 1IYHA 4QL9A 3TKSA 1THOA 2LEGA 2J23A 5GSSA 1VGLA 2YWIA 5ECPB 5A5KA 1AUCA 3HVXA 2PGTA 4KNDA 4OO4A 5ECSA 2HI7A 3C73A 1JZRA 4DEJA 1Y25A 2KP1A 2C3QA 3L0HA 5DJLA 2LTKA 1YQ1A 3GTUB 2CV4A 2I9HA 4GWRA 4JRRA 4K7IA 3H4KA 4H86A 1ERWA 4GSTA 1RK4A 1FAAA 1GSQA 3DVWA 4X1UA 4MJAA 3LFLA 1NHOA 4FYCA 1HNBA 1URMA 1GSYA 3ME7A 3EE2A 1XOAA 2YWNA 4EVMA 1BAYA 3FR9A 4MPFA 2DIZA 3O3TA 5IMVA 4PNFA 3F6FA 2VL2A 3KEBA 4G0IA 4NMUA 1GP1A 4Q5FA 3ZFBA 2H1AA 5H5RA 2YCDA 1QUWA 1BYEA 4TVEA 3BCIA 5F07A 3GMFA 2EIRA 2RM5A 3IA1A 2QC7A 5DQYA 1GNEA 2N5AA 2F8AA 1YF0A 4K2DA 2XPDA 2H8LA 2WZ9A 3UJ1A 1GNWA 3DKSA 2XHFA 5AGYA 2FA8A 2RUFA 3IHQA 2GZPA 1PD21 3VPTA 3BJ5A 1ZCPA 4ZXGA 1V57A 3MDKA 4XS4A 1A2LA 4KF9A 1SKRB 1A2JA 2VD0A 1GTIA 3MWHA 3LYKA 3GKNA 4LLRA 3DEXA 6GSTA 2FHEA 4PQIA 3ZL5A 3ME8A 3BCKA 1NSWA 1PA3A 5G1KA 3LEFA 1X5CA 4HUAA 1JHBA 6GSYA 5EVOA 2OE1A 1Q4JA 2VLUA 3GSSA 3GRXA 2MBTA 2WDUA 3RPPA 2HXKA 5C00A 1T3BA 1TRUA 2FGXA 4G9HA 2O7KA 2GSRA 2YOIA 2HZFA 2PERA 1ZYQB 3Q18A 4BWQA 4F0CA 3KZQA 1XW9A 1FHEA 3H1NA 3RBTA 2BMXA 3L4NA 2AUVA 2CX3A 4KB3A 2VCXA 1TTZA 5IO0A 1T4YA 1M7TA 3LYPA 1MDKA 2KLXA 2X64A 1PMTA 4MF5A 3HY2A 4OCFA 2H70A 3J7Yk 2HNLA 5D73A 1GSUA 3D0ZA 1U87A 4GCIA 4MH3A 3U5RE 2IMKA 4BWSA 4L8EA 4K1FA 5GAPD 1PL2A 4OWYA 5D8IA 4MCUA 1J0FA 4ZB9A 3TGZA 4MF7A 14GSA 4MH2A 3ED3A 5J3RA 1DE2A 2JZTA 1WIKA 3I9V2 4ZILA 3TJFA 1HNAA 2LS5A 3HKRA 1GWCA 1W4VA 2V1MA 4GTUA 5ECHB 2H0HA 2OE3A 1EOGA 4YQMA 1ZOFA 3ERFA 4JBBA 1BQ7A 3DRNA 2YP6A 1OVNA 4ZL7A 2H1GA 2PWJA 2K18A 2LRNA 1AQXA 3UMAA 1S3AA 5CNWA 1KBNA 4DSRA 1G0TA 2V32A 1FVKA 3US3A 5BMUA 3GH9A 1EGRA 2NTOA 1MD4A 3VURA 4HJMA 4WETA 2FY6A 3QMXA 3IC4A 1FO5A 18GSA 3H93A 4EC0A 3TOTA 1PRXA 1SENA 4V2LA 3FZAA 4RQRA 3D4TA 1VF1A 1X5EA 5KN3A 1YF1A 3OR5A 5CP1A 1R5AA 1YJ6A 4ISDA 4I97A 4TKYA 1R7HA 1GLPA 1F37A 2JACA 5JWOB 5KN2A 4WBRD 1V58A 2WCIA 3ZMKA 5A4WA 5HR1A 2CQ9A 4L0WA 4HJ2A 2YJHA 5HR3A 1U6TA 4TXOA 3M9KA 1G7OA 3CTFA 3I43A 1K3OA 1SK1A 2AB6A 2C3TA 4ZL9A 3M3MA 2CAQA 1HNCA 5B6NA 4KDUA 3IV4A 3D5JA 3GKXA 3QPMA 2HQTA 2H75A 4FYUA 1WRYA 2TRCP 1WMJA 1LBKA 1XVQA 3A3TA 4I5QA 3VFIA 4YQUA 1PX7A 1A0RP 5KN1A 2HZEB 1VRSD 2L5OA 2I4AA 4G19A 4HZ4A 1KTEA 5G5EA 1PL1A 4PGTA 1U88A 1K3YA 3EU3A 4IJ3A 4HZ2A 4ULXA 3KCMA 2AYTA 4IS0A 2P5RA 2B3SA 1UN2A 2H01A 3HHVA 2VD1A 2XBQA 5AISA 5G5FA 3TRPA 1XCCA 1YKCA 3I6AA 4HQZA 2GT5A 1R5PA 4LA1A 4KDXA 5DQSA 2HT9A 1SD9A 4ECJA 2FCHA 4AF2A 1SKWB 1J08A 5EY6A 1EV4A 3P7XA 1CQHA 4AJ7A 4QQ7A 1XFLA 4N11A 2JADA 1A2MA 4EF0A 1OE8A 1A0FA 1WE0A 4KA0A 2HE3A 5ECNB 2XPEA 3ZZXA 3APOA 1ZZYA 1IYIA 1NW2A 9GSSA 3WGDA 2WB9A 1A8YA 2P31A 1TK0B 4NHWA 4OD7A 2XC2A 3TKSC 4JZQA 3P8WA 3LGCA 2XBIA 1GTUA 2M80A 2VCTA 1JLWA 5J9BA 4EE0A 4MJCA 1V9WA 1GLQA 1K0NA 1XWCA 3FEUA 2V41A 2DSAA 3KD0A 5G31A 1VF3A 1T1VA 3M0FA 3BD2A 4GF0A 3F4RA 1Z6NA 2L5LA 2LUSA 1M0UA 4O92A 1AW9A 3ZIJA 1GSEA 5C04A 4PX1A 2C80A 4K7OA 2DC5A 2DJ1A 3FZ5A 2H0IA 2FNOA 2VO4A 2QGVA 4MZWA 1RQMA 1FG4A 2F51A 5ECLB 3U6VA 2A2RA 3EURA 3IK7A 1B4PA 17GSA 7GSSA 5J5NA 3ZLPA 2NBSA 2AHEA 5LCZA 2YZUA 2VL2C 2EIOA 4IKHA 1AIUA 1A24A 3O6TA 3UOMA 5E4WA 4ZBBA 5F06A 2ALBA 1SKSB 2LJKA 1G6YA 4TR1A 1GUMA 3GKMA 1JZWA 1F3AA 4KCEA 3LJRA 1TI1A 4MP4A 5AIVA 1GRXA 2DIYA 1ACVA 3F63A 1K0DA 3GHAA 3QR6A 4KGIA 3HCZA 1DE1A 10GSA 3WD6A 4PUFC 5GZZB 2FA4A 5IMAA 1SYXA 2B5XA 4NWYA 3AY8A 1GSFA 3FHKA 1S3CA 4WR4A 1XIYA 1O81A 3A5WA 2WS2A 2GZZA 4F03A 3UBLA 2IIYA 2GGTA 2A4VA 1X0RA 4ACSA 2YWOA 4KDYA 1PKZA 1JFUA 2H72A 4XIHA 4KSOA 4K0NA 3GSTA 2G2QA 2H1BA 3PH9A 3TKSE 3UIWA 2X99A 2OBIA 1FB6A 2DLXA 4ML1A 3HJMA 1SK2A 2WULA 3F8UA 2C8UA 2E2MA 4XCSA 1ERTA 4POLA 2OA7A 5J4UA 2IWTA 3CSIA 3QCPA 1SYRA 5ABRA 4TW5A 3APQA 5HR2A 3M9JA 1RW1A 2HRAA 5LNKe 1F2EA 4KW6A 5JCWA 1PSQA 2H6YA 2M46A 1ZMAA 3K8NA 1TKDB 4YQVA 2JZRA 5JCGA 1TW9A 3KGKA 3O76A 4QL7A 1Z7RA 1AXDA 2ON7A 5ECOB 1H4OA 16GSA 2C0FA 2N5FA 3E0UA 4XS4B 1DBYA 4POBA 1K0BA 3PGTA 3LXZA 4K6XA 1FB0A 1SU9A 4HQSA 1BJXA 1X9SB 3ZTLA 3ZYWA 2V2GA 2HRFA 3DGQA 3WYWA 4N10A 4JR4A 2KP2A 4AJ8A 1ZYEA 3FR3A 1J9BA 1USBA 1QXHA 2FWGA 3IPZA 2CA8A 5DDLA 4EDZA 3VK9A 3ZIVA 3HVSA 3UVHA 3CTGA 1K0CA 4LL1B 1XPVA 3WGXA 1TDIA 4CDOA 1DSBA 13GSA 1MDJA 4I6XA 1G7EA 3L9UA 1SJIA 1PGTA 4K9ZA 4N0VA 3TKRA 1HYUA 3UL3A 1SL1B 3ZFLA 3GKKA 2OKAA 5KN0A 2MMNA 3L9SA 2R6KA 4PTSA 4BPYA 1SL0B 2AV4A 1OE7A 5L71A 5CYYA 3HJOA 1WOUA 4AJ6A 2UZ8A 5ID2A 1QGVA 1A23A 1CQGA 2GTUA 1YEPA 5FHIA 2OJLA 3WT2A 3D6IA 3S9FA 2LV3A 3GNJA 1TP9A 2NVLA 4HS1A 5EPFA 1GH2A 1YY7A 5ID2B 4L5OA 3W8SA 4XHMA 4ZB6A 4I2TA 1NHYA 2D2ZA 4O7HA 3ZVJA 4V1Ap 1M2BA 5IIZA 1W89A 3G9BA 3EC3A 2KHPA 2HSNB 4TOPA 2F9SA 4ECCA 2HSYA 3CRUA 1EGOA 1HQOA 2B6MA 2P5QA 2QSIA 3FRCA 2O89A 3FKFA 3IRAA 5B7CA 2DMMA 3G7JA 2HFDA 4CW9A 3HVVA 1AQWA 3TCOA 1ABAA 2RIIA 4KE3A 4IGJA 1G6WA 4WF4A 4KCAA 2H6XA 2L59A 2GQMA 4N0ZA 3ZREA 1I5GA 5D9TA 5B8AA 1SD8A 5F05A 4X43A 4XS1A 3LQ7A 2FWHA 4MABA 3ZRDA 2LJAA 5DALA 1TU8A 4KX4A 3JCML 4KSMA 4ZB8A 1TRVA 2ZNMA 2PU9C 3C7MA 3NOFA 2GLRA 4HEA2 4OO5A 3IAS2 3LG6A 3DYRA 1FW1A 1VF2A 5DALB 22GSA 2GVPA 2X8GA 4Q5NA 3IBHA 3Q74A 2VCVA 4IHUA 5DCHA 5ENUA 1GUHA 5HFGA 6GSXA 5F0GA 5CRDA 3F4TA 20GSA 1PQNA 1Z3EA 5IMZA 1V2AA 19GSA 1WPIA 5IPGA 1EZKA 3IR4A 4DSQA 1PN9A 3SWLA 2GZYA 4GSSA 6GSSA 3QD9A 1THXA 1T4ZA 1M9BA 1WJKA 2VM1A 5AIXA 1ERVA 2X8HA 5F8BA 3ERWA 4ECBA 1GTAA 4GQCA 4BVXA 4TXOB 1ON4A 2YZHA 3GV1A 4N30A 8GSSA 2GSTA 1SJ6A 1OC9A 2HLSA 4IP6A 3QFBC 4NAXA 4OFMA 5DAKA 4LL4B 2B5EA 3P90A 1TXXA 4P3YB 3RAZA 1N2AA 1O8WA 5KEJA 1TJDA 4RI6A 1QK8A 4TRXA 3ZVJD 2O8VB 5DAKB 3WGEA 2C0GA 2MMAA 2MBSA 4HDEA 1M99A 5H5SA 1B9XC 1EP7A 2VCQA 1M2AA 2JSZA 3A2XA 4J56E 5CRGA 1GTBA 5CAXA 1ST9A 1YDKA 2TRXA 1Z9HA 4USSA 3D22A 2JU5A 4NV2A 1JLVA 6GSVA 4L5LA 5ECQB 3EU4A 1KNGA 2CX4A 1JZDA 2H6ZA 1BG5A 3DD3A 1B4QA 1K0MA 2IPAA 1XWKA 3UAPA 5HR0A 3BBYA 1LU4A 3F3RA 3SBCA 1FVJA 3ZMLA 4PNGA 3EYTA 2A2SA 4MJBA 3KH7A 5D9VA 3IAM2 1T8EB 6GSUA 5IO2A 2YNXA 4G0LA 4EXJA 4G10A 4TR4A 3W8JA 3EMXA 3KJYA 1TK8B 5A4VA 3FYGA 1K0AA 3CRTA 2VIMA 4WXTA 2CAIA 1E2YA 1XW5A 2HYXA 4TR3A 2GDRA 3ZITA 2V6KA 2DJ3A 2REMA 4I8BA 3BOAA 1GSDA 2CT6A 1ERUA 1K0OA 2VAFA 3R2QA 3F3QA 4IQ1A 2FLSA 1Q98A 2C4JA 1OKDA 3GH6A
chains in the Genus database with same CATH superfamily
4BL7A 3N5OA 2OE0A 2CZ3A 3APSA 3D21A 3QDNA 4I2UA 4XRAA 4GQFA 2RM6A 1X9WB 2IFQA 1U3AA 2I81A 1V40A 2OBKA 5G1LA 4HU9A 3LW9A 4TR0A 1EEMA 4ID0A 2IFQB 3IDVA 4AGSA 4NXIA 1MD3A 5IQYA 1AAZA 3ERGA 4HOJA 4EL1A 3HD5A 5B8BA 1TXUA 3KMNA 2YN1A 2K6VA 2B5YA 3HZ4A 2I3YA 1ZGNA 3A2VA 3F9UA 3MNGA 2B7KA 4TR1B 3WT1A 5FT3A 2LRCA 4HI7A 4QMKA 2WVYA 1UA5A 1V98A 4GSNA 3CBUA 4ZIJA 4A5PA 1F6MC 5IMCA 3HYPA 4L0UA 2HSHA 5D9XA 3DXBA 2LJRA 4X0XA 3GTUA 2A2PA 4BA7A 3LWAA 2L4CA 1TK5B 2DJJA 3QAWA 3KIJA 2E7PA 2H66A 2NDOA 4FQUA 2YPMA 2WZSA 2B1LA 4AKIA 4K8MA 3KTLA 1C72A 5DBQA 4KAEA 2BJXA 3PPUA 1OC3A 5CREA 3TJGA 4AKGA 2R0GA 4PQHA 1YEXA 4KH7A 1MDIA 3G7YA 3KXOA 3C1SA 2FWFA 4MK3A 2EIQA 3PR8A 1FOVA 3CXGA 3NIVA 1BG1A 1YZXA 2H73A 4D73A 3H8QA 3ISOA 1O85A 1WP0A 4XTSA 2GT6A 5CRWA 3Q19A 2N5BA 5IPHA 2JSYA 2M72A 4D73B 1EWXA 3KMOA 4OMVA 5B6MA 2H19A 2OACA 3FY7A 3EWLA 1ML6A 1Z5YE 5H5QA 5JWQB 4Q5RA 5INYA 4BVYA 1E6BA 1XWAA 4K5RA 3RHBA 1R4WA 1O7UA 4JR6A 5GSTA 3RHCA 5LD0A 4MA9A 2YV9A 2QKEA 2WRTA 1JZOA 4K7NA 2CZ2A 2H0GA 1PKWA 4ZBDA 4ILFA 4BVYB 3GL3A 1UVZA 5ELGA 4Z7XA 1OKTA 2YANA 3QOUA 4GRFA 1O73A 1DUGA 3UVTA 4YAVA 4NPBA 3DWVA 3P2AA 3VLNA 2GSSA 1S3DA 3TRXA 2HRKA 2K8VA 1TU7A 3IC8A 4NV5A 4LMVA 3LXTA 3QAGA 5IM9A 5DCGA 5HQPA 3LSZA 4ML6A 1O8XA 2HRKB 3VWUA 2VKZG 5J41A 1F9MA 2L57A 3DMLA 2AJQB 1GUKA 3J7Yb 2C3NA 3EINA 3GL5A 2J9HA 2L6DA 4F2IA 3VI7A 3A5IA 1BX9A 5IMDA 3KH9A 4WF5A 1R26A 3TDGA 2VUPA 3C1RA 4E8EA 2F8FA 5AN1A 3Q6OA 4J2FA 3E9JB 2R5GA 2C0DA 4IBPA 2IN3A 3M1GA 3TU3B 2UV8G 4AI6A 3TB2A 2PVOC 5E59A 4PURA 5D9WA 3RDWA 3A2WA 1XWGA 4PQ1A 3VWVA 1QMVA 5JCUA 1QFNA 2R4VA 3MSZA 2FUG2 2V6OA 4EKZA 3TKQA 1HD2A 4YAPA 3TRQA 5CO3A 4V1Ag 4DVCA 2TIRA 5COHA 5G2ZA 2WJUA 4XRDA 1ILOA 2GQLA 4YH2A 4FIWA 2VCZA 11GSA 3GYKA 1M9AA 3HXSA 1O6JA 1XZOA 2ZUPA 4J57E 1PX6A 5EL8A 3FW2A 2VCWA 2CVDA 4RQXA 2K8SA 2I1UA 2GQKA 1B48A 1WWJA 2HSMA 2P0GA 1EP8A 1MEKA 3GN3A 5ECRB 2LNTA 2KUCA 5ELAA 4MMMA 2X8CA 2FD3A 3RPNA 2HSMB 4MLYA 2O5VA 1X5DA 4E8HA 1FOHA 2MMOA 3LORA 3CYNA 4CHSA 1XBSA 4RI7A 3I69A 3M8NA 1UC7A 1MTCA 3CMIA 3GUSA 2CVKA 3CSHA 2NPBA 4YKFA 3HA9A 1B9YC 4IP1A 4WR5A 2IL3A 1EOHA 6GSWA 3E3EA 1K3LA 2R37A 2O36A 2E2GA 1TRSA 3HZ8A 1XWBA 2AAWA 1SL2B 2PMTA 4KUNA 1U3IA 4HU7A 4GLTA 3F4SA 1TI3A 1A8LA 1SJZA 2H71A 2VL3A 3V1WA 1GSSA 4DSSA 4IELA 3NZNA 2DMLA 1F3BA 3VI5A 1XVWA 2EC4A 5IOXA 4G0KA 3GA4A 4FO5A 2WGRA 5HFKA 2ES7A 4DSSB 3RGBC 1B8XA 4GDFA 2OADA 1OC8A 4F9ZA 2DBCA 1OAZA 3KM6A 2LKUA 4XS6A 2YJ7A 3GFKA 3UEMA 5HFIA 3GURA 4NHZA 4IQAA 4JE1A 2JZSA 1TOFA 4ZBAA 4BVXB 4RUVA 4O32A 4IW9A 3QFAC 4MZCA 2VLVA 3R3EA 1Y6EA 3MAKA 2H74A 1XOBA 2FWEA 4F82A 3FZ4A 2HZEA 4JEDA 1OC9B 1XW6A 2LQQA 2DJKA 5GAND 2L6CA 1I9DA 2H76A 3PINA 2PVQA 3F6DA 3N9JA 2VLTA 2PPTA 4OFNA 1XXUA 4FYBA 3TJJA 4OCEA 1OYJA 3W6GA 4K0GA 4LMWA 5JWRB 3KTBA 4MJEA 3TKPA 1LJRA 5DJMA 2R2JA 3L9VA 2E0QA 4WBJA 5J9CA 3IK9A 1X9MB 1BEDA 3L78A 2LRTA 4POMA 4F0BA 2PN8A 3FR6A 1N8JA 2IMDA 3IOSA 2VM2A 1GULA 4TN8A 2VL9A 2O85A 3TOUA 2C1YA 3TJKA 1KEBA 3GIXA 4MPGA 3DVXA 4O5RA 1ZL9A 2B7JA 3C8EA 4ECIA 2ZCTA 2YV7A 3RFRC 1TRWA 2K9FA 2LQOA 2GSQA 1QQ2A 2PUKC 3UBKA 1SK0A 1S4BP 3KP9A 1Z7PA 4MZBA 2C0EA 2LNSA 5IMFA 4IJIA 3TUEA 5IOWA 4EO3A 2KOKA 3G7IA 1T00A 2R3XA 4ZL8A 3DIEA 2BTOT 5DVBA 1VF4A 4IVFA 3HDCA 3UARA 4WKWA 3H79A 2JL4A 5D93A 5CRHA 4G2EA 2VOCA 2IMFA 3QAVA 2PBJA 4MDCA 3CWGA 2B1KA 1T7PB 5A5HA 12GSA 1YKAA 2G0FA 4PUAA 4WEYA 5FWGA 2HRNA 3C71A 3TJBA 2L4QA 3EMPA 3FZ9A 5A5HB 2H30A 4JU5A 4OFTA 2F3MA 1EV9A 4V2NA 1AC1A 2RLIA 3EVIA 2IJYA 2YWMA 4FH8A 2IMIA 4PXOA 2DKIA 3GX8A 2EFEA 2O3EA 2CVBA 2H1DA 3IE3A 2DJ2A 1EEJA 1H75A 1Z6MA 4IN0A 2O87A 4EUYA 4MF6A 5D96A 2WFCA 2MYGA 2ON5A 4Q5QA 4BL7B 3IXRA 3VWWA 5ECKB 5A4UA 5G30A 3GX0A 5ECMB 2Z9SA 2IMEA 3HJPA 1GL8A 1NM3A 3FK8A 3VPQA 4HSCX 1M2DA 3VWXA 2WVZA 2MZCA 2MMZA 4EDYA 3KP8A 3F0IA 2RUEA 1AQVA 4POKA 4TXVA 5ECIB 3CSJA 4V2MA 2DJ0A 2LSTA 2GS3A 3D4MA 4GXZA 1IYHA 2X4AA 4QL9A 3TKSA 1THOA 2LEGA 2EFCA 2J23A 5GSSA 1VGLA 2YWIA 5ECPB 5A5KA 1AUCA 3HVXA 2PGTA 4KNDA 4OO4A 5ECSA 2HI7A 3C73A 1JZRA 2EFHA 4DEJA 1Y25A 2KP1A 2C3QA 3L0HA 5DJLA 2LTKA 1YQ1A 3GTUB 2CV4A 2I9HA 4GWRA 4JRRA 4K7IA 3H4KA 4H86A 1ERWA 4GSTA 4ZB7A 1RK4A 1FAAA 1GSQA 5J40A 3DVWA 4X1UA 1ZYPA 4MJAA 3LFLA 1NHOA 4FYCA 1HNBA 4FXYP 1URMA 1GSYA 3ME7A 2WVXA 3EE2A 1XOAA 2YWNA 4EVMA 1BAYA 3FR9A 4MPFA 2DIZA 4O5QA 3O3TA 5IMVA 4PNFA 3F6FA 2VL2A 3KEBA 4G0IA 4NMUA 1GP1A 4Q5FA 3ZFBA 2H1AA 2R0PA 2YCDA 1QUWA 1BYEA 4TVEA 3BCIA 5F07A 5H5RA 3GMFA 2EIRA 2RM5A 3IA1A 2QC7A 5DQYA 1GNEA 2N5AA 2F8AA 1YF0A 4K2DA 2XPDA 4EIPA 2H8LA 2WZ9A 3CQFA 1GNWA 3UJ1A 3DKSA 2XHFA 5AGYA 2FA8A 2RUFA 3IHQA 4ICYA 2GZPA 1PD21 3VPTA 3BJ5A 1ZCPA 4ZXGA 1V57A 3MDKA 4XS4A 1A2LA 4KF9A 1SKRB 1A2JA 2VD0A 2DKHA 1GTIA 3MWHA 3LYKA 3GKNA 4LLRA 3DEXA 6GSTA 2FHEA 4PQIA 3ZL5A 3ME8A 3BCKA 1NSWA 1PA3A 5G1KA 3LEFA 1X5CA 4HUAA 1JHBA 6GSYA 5EVOA 2OE1A 1Q4JA 2VLUA 3GSSA 3GRXA 2MBTA 2WDUA 3RPPA 2HXKA 5C00A 1T3BA 1TRUA 2FGXA 4G9HA 2O7KA 2GSRA 2YOIA 2HZFA 2PERA 1ZYQB 3Q18A 4BWQA 4Z2RA 4F0CA 3KZQA 4MNNA 2WW1A 1XW9A 1FHEA 3H1NA 3RBTA 2BMXA 3L4NA 2AUVA 2CX3A 4KB3A 2VCXA 1TTZA 5IO0A 1T4YA 1M7TA 3LYPA 1MDKA 2KLXA 2X64A 1PMTA 4MF5A 3HY2A 4OCFA 2H70A 3J7Yk 2HNLA 5D73A 4X4JA 1GSUA 3D0ZA 4AKHA 1U87A 4GCIA 4MH3A 3U5RE 2IMKA 4BWSA 4L8EA 4K1FA 5GAPD 1PL2A 4OWYA 5D8IA 4MCUA 1J0FA 4ZB9A 3TGZA 4MF7A 14GSA 4MH2A 2WW0A 3ED3A 5J3RA 1DE2A 2JZTA 1WIKA 3I9V2 4ZILA 3TJFA 1HNAA 2LS5A 2HSNA 1GWCA 3HKRA 1W4VA 2V1MA 4GTUA 3IHGA 5ECHB 2H0HA 2OE3A 1EOGA 4YQMA 1ZOFA 3ERFA 4JBBA 1BQ7A 3DRNA 2YP6A 1OVNA 3CHXC 4ZL7A 2H1GA 2PWJA 2K18A 2LRNA 1AQXA 3UMAA 1S3AA 5CNWA 1KBNA 4DSRA 1G0TA 2V32A 3HVNA 1FVKA 3US3A 5BMUA 3GH9A 1EGRA 2NTOA 1MD4A 3VURA 4HJMA 2QA1A 4WETA 2FY6A 3QMXA 5BMUB 3IC4A 1FO5A 18GSA 3H93A 4EC0A 3TOTA 1PRXA 1SENA 4V2LA 3FZAA 4RQRA 3D4TA 1VF1A 1X5EA 5KN3A 1YF1A 3OR5A 5CP1A 1R5AA 1YJ6A 4ISDA 4I97A 1SVMA 4TKYA 1R7HA 1GLPA 1F37A 2JACA 5JWOB 5KN2A 4WBRD 1V58A 2WCIA 3ZMKA 1YVLA 5A4WA 5HR1A 2CQ9A 4L0WA 4HJ2A 2YJHA 5HR3A 1U6TA 4TXOA 1G7OA 3CTFA 3M9KA 3I43A 1K3OA 1SK1A 2AB6A 2C3TA 4ZL9A 3M3MA 2CAQA 1HNCA 2R0CA 5B6NA 4KDUA 3IV4A 3D5JA 3GKXA 3QPMA 2HQTA 2H75A 4FYUA 1WRYA 2TRCP 1WMJA 1LBKA 1XVQA 3A3TA 4I5QA 3VFIA 4YQUA 4Z2TA 1PX7A 1A0RP 5KN1A 2HZEB 1VRSD 2L5OA 2I4AA 2H1LA 4G19A 5J4VA 4HZ4A 1KTEA 4BIKA 5G5EA 1PL1A 4PGTA 1U88A 1K3YA 3EU3A 4IJ3A 4HZ2A 4ULXA 3KCMA 2AYTA 4IS0A 2P5RA 2B3SA 1UN2A 2H01A 3HHVA 2VD1A 2XBQA 5AISA 5G5FA 3TRPA 1XCCA 1YKCA 3I6AA 4HQZA 2GT5A 1R5PA 4LA1A 4KDXA 5DQSA 2HT9A 1SD9A 4ECJA 2FCHA 4AF2A 1SKWB 1PN0A 2X49A 1J08A 5EY6A 1EV4A 3P7XA 1CQHA 4AJ7A 4QQ7A 1XFLA 4N11A 2JADA 1A2MA 4EF0A 1OE8A 1A0FA 1WE0A 4KA0A 2HE3A 5ECNB 2XPEA 3ZZXA 3APOA 1ZZYA 1IYIA 1NW2A 9GSSA 3WGDA 2WB9A 1A8YA 2P31A 1TK0B 4NHWA 4OD7A 2XC2A 3TKSC 5J4YA 4JZQA 3P8WA 3LGCA 2XBIA 1GTUA 2M80A 2VCTA 1JLWA 2OT3A 5J9BA 4EE0A 4MJCA 1V9WA 1GLQA 1K0NA 1XWCA 3FEUA 2V41A 2DSAA 3KD0A 5G31A 1VF3A 1T1VA 3M0FA 3BD2A 4GF0A 3F4RA 1Z6NA 2L5LA 2LUSA 1M0UA 4O92A 1AW9A 3ZIJA 1GSEA 1I1IP 1S3RA 5C04A 4PX1A 2C80A 4K7OA 2DC5A 2DJ1A 3FZ5A 2H0IA 2FNOA 2VO4A 2QGVA 4MZWA 1RQMA 1FG4A 2F51A 5ECLB 3U6VA 2A2RA 3EURA 3IK7A 1B4PA 17GSA 7GSSA 5J5NA 3ZLPA 2NBSA 2AHEA 5LCZA 2YZUA 5KOWA 2VL2C 2EIOA 4IKHA 1AIUA 2QA2A 1A24A 3O6TA 3UOMA 5E4WA 4CY8A 4ZBBA 5F06A 2ALBA 1SKSB 2LJKA 1G6YA 4TR1A 1GUMA 3GKMA 1JZWA 1F3AA 4KCEA 3LJRA 1TI1A 4MP4A 5AIVA 1GRXA 2DIYA 1ACVA 3F63A 1K0DA 3GHAA 3QR6A 4KGIA 3HCZA 1DE1A 10GSA 3WD6A 4PUFC 5GZZB 2FA4A 5IMAA 1SYXA 2B5XA 4NWYA 3AY8A 1GSFA 3FHKA 1S3CA 4WR4A 1XIYA 1O81A 3A5WA 2WS2A 2GZZA 4F03A 4YKGA 3UBLA 2IIYA 2GGTA 2A4VA 1X0RA 4ACSA 2YWOA 4KDYA 1PKZA 1JFUA 2H72A 4XIHA 3MYDA 4KSOA 4K0NA 3GSTA 2G2QA 2WVXB 2H1BA 3PH9A 3TKSE 3UIWA 2X99A 2OBIA 1FB6A 2DLXA 4ML1A 3HJMA 1SK2A 2WULA 2EFDA 3F8UA 2C8UA 2E2MA 4XCSA 1ERTA 4POLA 2OA7A 5J4UA 2IWTA 3CSIA 3QCPA 1SYRA 5ABRA 4TW5A 3APQA 5HR2A 3M9JA 1RW1A 2HRAA 5LNKe 1F2EA 4KW6A 5JCWA 1PSQA 2H6YA 2M46A 1Y1UA 1BF5A 1ZMAA 3K8NA 5BRTA 1TKDB 4YQVA 2JZRA 5JCGA 1TW9A 3KGKA 3O76A 4QL7A 1Z7RA 1AXDA 2ON7A 5ECOB 1H4OA 16GSA 2C0FA 1ZYNA 2N5FA 3E0UA 4XS4B 1DBYA 4POBA 1K0BA 3PGTA 3LXZA 4K6XA 1FB0A 1SU9A 4HQSA 1BJXA 1X9SB 3ZTLA 3ZYWA 5J47A 2V2GA 2HRFA 3DGQA 3WYWA 4N10A 4JR4A 2KP2A 4AJ8A 1ZYEA 3FR3A 1J9BA 1USBA 1QXHA 2FWGA 3IPZA 2CA8A 5DDLA 4EDZA 3VK9A 3ZIVA 3HVSA 3UVHA 3CTGA 2WW2A 1K0CA 4AKXB 4LL1B 1XPVA 3WGXA 1TDIA 4CDOA 1DSBA 13GSA 2A4HA 1MDJA 4I6XA 1G7EA 3L9UA 1SJIA 1PGTA 4K9ZA 4N0VA 3TKRA 1HYUA 3UL3A 1SL1B 3ZFLA 3GKKA 2OKAA 5KN0A 4Z2UA 2MMNA 3L9SA 2R6KA 4PTSA 4BPYA 1SL0B 2AV4A 1OE7A 3FMWA 5L71A 5CYYA 3HJOA 1WOUA 4AJ6A 2UZ8A 5ID2A 1QGVA 1A23A 1CQGA 2GTUA 1YEPA 5FHIA 4CY6A 2OJLA 3WT2A 3D6IA 3S9FA 2LV3A 3GNJA 1TP9A 2NVLA 4HS1A 5EPFA 1GH2A 1YY7A 5ID2B 4L5OA 3W8SA 4XHMA 4ZB6A 4I2TA 1NHYA 2D2ZA 4O7HA 3ZVJA 4V1Ap 1M2BA 5IIZA 1W89A 3G9BA 3EC3A 2KHPA 4O5UA 2HSNB 4TOPA 2F9SA 4ECCA 2HSYA 3CRUA 4E68A 1EGOA 1HQOA 2B6MA 2P5QA 2QSIA 3FRCA 2O89A 3FKFA 3IRAA 5B7CA 2DMMA 3G7JA 2HFDA 4CW9A 3HVVA 1AQWA 3TCOA 1ABAA 2RIIA 4KE3A 4IGJA 1G6WA 4WF4A 4KCAA 2H6XA 2L59A 2GQMA 4PI0C 4N0ZA 3ZREA 1I5GA 5D9TA 5B8AA 1SD8A 3EPTA 5A1NA 5F05A 4X43A 4XS1A 3LQ7A 2FWHA 4MABA 3ZRDA 2LJAA 5DALA 4G01A 1TU8A 4KX4A 3JCML 4KSMA 4ZB8A 1TRVA 2ZNMA 2PU9C 3C7MA 3NOFA 2GLRA 4HEA2 4OO5A 5A1NB 1XG8A 3IAS2 3LG6A 3DYRA 1FW1A 1VF2A 5DALB 22GSA 5A34A 2GVPA 1M3JA 2X8GA 4Q5NA 3IBHA 2VCVA 3Q74A 4IHUA 5DCHA 5ENUA 1GUHA 5HFGA 5A34B 6GSXA 5F0GA 5CRDA 3F4TA 20GSA 5KOXA 1PQNA 1Z3EA 5IMZA 1V2AA 19GSA 1WPIA 5IPGA 1EZKA 3IR4A 4DSQA 4PI2C 4K5SA 1PN9A 3SWLA 2GZYA 4GSSA 6GSSA 3QD9A 1THXA 1T4ZA 1M9BA 3HMJG 1WJKA 2VM1A 5AIXA 1ERVA 2X8HA 5F8BA 3ERWA 4ECBA 1GTAA 4GQCA 4BVXA 4TXOB 1ON4A 2YZHA 1N25A 3GV1A 4N30A 8GSSA 2GSTA 1SJ6A 1OC9A 2HLSA 4IP6A 3QFBC 4NAXA 4OFMA 5DAKA 4LL4B 2B5EA 3MIXA 3P90A 1TXXA 4P3YB 1PFOA 1N2AA 1O8WA 3RAZA 5KEJA 1TJDA 4RI6A 1QK8A 4TRXA 3ZVJD 2O8VB 5DAKB 3WGEA 2C0GA 2MMAA 2MBSA 4HDEA 1M99A 5H5SA 1B9XC 1EP7A 2VCQA 1M2AA 2JSZA 1YEWC 3A2XA 4J56E 5CRGA 4K2XA 1GTBA 5CAXA 1ST9A 1YDKA 2TRXA 2WW3A 1Z9HA 4USSA 3D22A 2JU5A 4NV2A 1SVOA 1JLVA 6GSVA 4L5LA 4EIQA 5ECQB 3EU4A 1KNGA 2CX4A 1JZDA 2H6ZA 1BG5A 1M3IA 4PHZC 3DD3A 4N3ZA 1B4QA 1K0MA 2IPAA 1XWKA 3UAPA 5HR0A 3BBYA 1LU4A 3F3RA 3SBCA 1FVJA 3ZMLA 4PNGA 1SVLA 3EYTA 2A2SA 4MJBA 3KH7A 5D9VA 3IAM2 1T8EB 6GSUA 5IO2A 2YNXA 4G0LA 4EXJA 4G10A 4TR4A 3W8JA 3EMXA 3KJYA 1TK8B 4W66A 5A4VA 3FYGA 1K0AA 3CRTA 2VIMA 4WXTA 2CAIA 1E2YA 1XW5A 2HYXA 4TR3A 2GDRA 3ZITA 2V6KA 2DJ3A 2REMA 4I8BA 3BOAA 1GSDA 2CT6A 1ERUA 1K0OA 2VAFA 3R2QA 3F3QA 4IQ1A 2FLSA 1Q98A 2C4JA 1OKDA 3GH6A
chains in the Genus database with same CATH topology
4BL7A 3N5OA 2OE0A 2CZ3A 3APSA 3D21A 3QDNA 4I2UA 4XRAA 4GQFA 2RM6A 1X9WB 2IFQA 1U3AA 2I81A 1V40A 2OBKA 5G1LA 4HU9A 3LW9A 4TR0A 1EEMA 4ID0A 2IFQB 3IDVA 4AGSA 4NXIA 1MD3A 5IQYA 1AAZA 3ERGA 4HOJA 4EL1A 3HD5A 5B8BA 1TXUA 3KMNA 2YN1A 2K6VA 2B5YA 3HZ4A 2I3YA 1ZGNA 3A2VA 3F9UA 3MNGA 2B7KA 4TR1B 3WT1A 5FT3A 2LRCA 4HI7A 4QMKA 1UA5A 1V98A 4GSNA 3CBUA 4ZIJA 4A5PA 1F6MC 5IMCA 3HYPA 4L0UA 2HSHA 5D9XA 3DXBA 2LJRA 4X0XA 3GTUA 2A2PA 4BA7A 3LWAA 2L4CA 1TK5B 2DJJA 3QAWA 3KIJA 2E7PA 2H66A 2NDOA 4FQUA 2YPMA 2B1LA 4AKIA 4K8MA 3KTLA 1C72A 5DBQA 4KAEA 2BJXA 3PPUA 1OC3A 5CREA 3TJGA 4AKGA 2R0GA 4PQHA 1YEXA 4KH7A 1MDIA 3G7YA 3KXOA 3C1SA 2FWFA 4MK3A 2EIQA 3PR8A 1FOVA 3CXGA 3NIVA 1BG1A 1YZXA 2H73A 4D73A 3H8QA 3ISOA 1O85A 1WP0A 4XTSA 2GT6A 5CRWA 3Q19A 2N5BA 5IPHA 2JSYA 2M72A 4D73B 1EWXA 3KMOA 4OMVA 5B6MA 2H19A 2OACA 3FY7A 3EWLA 1ML6A 1Z5YE 5H5QA 5JWQB 4Q5RA 5INYA 4BVYA 1E6BA 1XWAA 4K5RA 3RHBA 1R4WA 1O7UA 4JR6A 5GSTA 3RHCA 5LD0A 4MA9A 2YV9A 2QKEA 2WRTA 1JZOA 4K7NA 2CZ2A 2H0GA 1PKWA 4ZBDA 4ILFA 4BVYB 3GL3A 1UVZA 5ELGA 4Z7XA 1OKTA 2YANA 3QOUA 4GRFA 1O73A 1DUGA 3UVTA 4YAVA 4NPBA 3DWVA 3P2AA 3VLNA 2GSSA 1S3DA 3TRXA 2HRKA 2K8VA 1TU7A 3IC8A 4NV5A 4LMVA 3LXTA 3QAGA 5IM9A 5DCGA 5HQPA 3LSZA 4ML6A 1O8XA 2HRKB 3VWUA 2VKZG 5J41A 1F9MA 2L57A 3DMLA 2AJQB 1GUKA 3J7Yb 2C3NA 3EINA 3GL5A 2J9HA 2L6DA 4F2IA 3VI7A 3A5IA 1BX9A 5IMDA 3KH9A 4WF5A 1R26A 3TDGA 2VUPA 3C1RA 4E8EA 2F8FA 5AN1A 3Q6OA 4J2FA 3E9JB 2R5GA 2C0DA 4IBPA 2IN3A 3M1GA 3TU3B 2UV8G 4AI6A 3TB2A 2PVOC 5E59A 4PURA 5D9WA 3RDWA 3A2WA 1XWGA 4PQ1A 3VWVA 1QMVA 5JCUA 1QFNA 2R4VA 3MSZA 2FUG2 2V6OA 4EKZA 3TKQA 1HD2A 4YAPA 3TRQA 5CO3A 4V1Ag 4DVCA 2TIRA 5COHA 5G2ZA 2WJUA 4XRDA 1ILOA 2GQLA 4YH2A 4FIWA 2VCZA 11GSA 3GYKA 1M9AA 3HXSA 1O6JA 1XZOA 2ZUPA 4J57E 1PX6A 5EL8A 3FW2A 2VCWA 2CVDA 4RQXA 2K8SA 2I1UA 2GQKA 1B48A 1WWJA 2HSMA 2P0GA 1EP8A 1MEKA 3GN3A 5ECRB 2LNTA 2KUCA 5ELAA 4MMMA 2X8CA 2FD3A 3RPNA 2HSMB 4MLYA 2O5VA 1X5DA 4E8HA 1FOHA 2MMOA 3LORA 3CYNA 4CHSA 1XBSA 4RI7A 3I69A 3M8NA 1UC7A 1MTCA 3CMIA 3GUSA 2CVKA 3CSHA 2NPBA 4YKFA 3HA9A 1B9YC 4IP1A 4WR5A 2IL3A 1EOHA 6GSWA 3E3EA 1K3LA 2R37A 2E2GA 1TRSA 3HZ8A 1XWBA 2AAWA 1SL2B 2PMTA 4KUNA 1U3IA 4HU7A 4GLTA 3F4SA 1TI3A 1A8LA 1SJZA 2H71A 2VL3A 3V1WA 1GSSA 4DSSA 4IELA 3NZNA 2DMLA 1F3BA 3VI5A 1XVWA 2EC4A 5IOXA 4G0KA 3GA4A 4FO5A 2WGRA 5HFKA 2ES7A 4DSSB 1B8XA 4GDFA 2OADA 1OC8A 4F9ZA 2DBCA 1OAZA 3KM6A 2LKUA 4XS6A 2YJ7A 3GFKA 3UEMA 5HFIA 3GURA 4NHZA 4IQAA 4JE1A 2JZSA 1TOFA 4ZBAA 4BVXB 4RUVA 4O32A 4IW9A 3QFAC 4MZCA 2VLVA 3R3EA 1Y6EA 3MAKA 2H74A 1XOBA 2FWEA 4F82A 3FZ4A 2HZEA 4JEDA 1OC9B 1XW6A 2LQQA 2DJKA 5GAND 2L6CA 1I9DA 2H76A 3PINA 2PVQA 3F6DA 3N9JA 2VLTA 2PPTA 4OFNA 1XXUA 4FYBA 3TJJA 4OCEA 1OYJA 3W6GA 4K0GA 4LMWA 5JWRB 3KTBA 4MJEA 3TKPA 1LJRA 5DJMA 2R2JA 3L9VA 2E0QA 4WBJA 5J9CA 3IK9A 1X9MB 1BEDA 3L78A 2LRTA 4POMA 4F0BA 2PN8A 3FR6A 1N8JA 2IMDA 3IOSA 2VM2A 1GULA 4TN8A 2VL9A 2O85A 3TOUA 2C1YA 3TJKA 1KEBA 3GIXA 4MPGA 3DVXA 4O5RA 1ZL9A 2B7JA 3C8EA 4ECIA 2ZCTA 2YV7A 1TRWA 2K9FA 2LQOA 2GSQA 1QQ2A 2PUKC 3UBKA 1SK0A 3KP9A 1Z7PA 4MZBA 2C0EA 2LNSA 5IMFA 4IJIA 3TUEA 5IOWA 4EO3A 2KOKA 3G7IA 1T00A 2R3XA 4ZL8A 3DIEA 2BTOT 5DVBA 1VF4A 4IVFA 3HDCA 3UARA 4WKWA 3H79A 2JL4A 5D93A 5CRHA 4G2EA 2VOCA 2IMFA 3QAVA 2PBJA 4MDCA 3CWGA 2B1KA 1T7PB 5A5HA 12GSA 1YKAA 2G0FA 4PUAA 4WEYA 5FWGA 2HRNA 3C71A 3TJBA 2L4QA 3EMPA 3FZ9A 5A5HB 2H30A 4JU5A 4OFTA 2F3MA 1EV9A 4V2NA 1AC1A 2RLIA 3EVIA 2IJYA 2YWMA 4FH8A 2IMIA 4PXOA 2DKIA 3GX8A 2EFEA 2CVBA 2H1DA 3IE3A 2DJ2A 1EEJA 1H75A 1Z6MA 4IN0A 2O87A 4EUYA 4MF6A 5D96A 2WFCA 2MYGA 2ON5A 4Q5QA 4BL7B 3IXRA 3VWWA 5ECKB 5A4UA 5G30A 3GX0A 5ECMB 2Z9SA 2IMEA 3HJPA 1GL8A 1NM3A 3FK8A 3VPQA 1M2DA 3VWXA 2MZCA 2MMZA 4EDYA 3KP8A 3F0IA 2RUEA 1AQVA 4POKA 4TXVA 5ECIB 3CSJA 4V2MA 2DJ0A 2LSTA 2GS3A 3D4MA 4GXZA 1IYHA 2X4AA 4QL9A 3TKSA 1THOA 2LEGA 2EFCA 2J23A 5GSSA 1VGLA 2YWIA 5ECPB 5A5KA 1AUCA 3HVXA 2PGTA 4KNDA 4OO4A 5ECSA 2HI7A 3C73A 1JZRA 2EFHA 4DEJA 1Y25A 2KP1A 2C3QA 3L0HA 5DJLA 2LTKA 1YQ1A 3GTUB 2CV4A 2I9HA 4GWRA 4JRRA 4K7IA 3H4KA 4H86A 1ERWA 4GSTA 4ZB7A 1RK4A 1FAAA 1GSQA 5J40A 3DVWA 4X1UA 1ZYPA 4MJAA 3LFLA 1NHOA 4FYCA 1HNBA 1URMA 1GSYA 3ME7A 3EE2A 1XOAA 2YWNA 4EVMA 1BAYA 3FR9A 4MPFA 2DIZA 4O5QA 3O3TA 5IMVA 4PNFA 3F6FA 2VL2A 3KEBA 4G0IA 4NMUA 1GP1A 4Q5FA 3ZFBA 2H1AA 2R0PA 2YCDA 1QUWA 1BYEA 4TVEA 3BCIA 5F07A 5H5RA 3GMFA 2EIRA 2RM5A 3IA1A 2QC7A 5DQYA 1GNEA 2N5AA 2F8AA 1YF0A 4K2DA 2XPDA 4EIPA 2H8LA 2WZ9A 3UJ1A 1GNWA 3DKSA 2XHFA 5AGYA 2FA8A 2RUFA 3IHQA 4ICYA 2GZPA 1PD21 3VPTA 3BJ5A 1ZCPA 4ZXGA 1V57A 3MDKA 4XS4A 1A2LA 4KF9A 1SKRB 1A2JA 2VD0A 2DKHA 1GTIA 3MWHA 3LYKA 3GKNA 4LLRA 3DEXA 6GSTA 2FHEA 4PQIA 3ZL5A 3ME8A 3BCKA 1NSWA 1PA3A 5G1KA 3LEFA 1X5CA 4HUAA 1JHBA 6GSYA 5EVOA 2OE1A 1Q4JA 2VLUA 3GSSA 3GRXA 2MBTA 2WDUA 3RPPA 2HXKA 5C00A 1T3BA 1TRUA 2FGXA 4G9HA 2O7KA 2GSRA 2YOIA 2HZFA 2PERA 1ZYQB 3Q18A 4BWQA 4Z2RA 4F0CA 3KZQA 4MNNA 1XW9A 1FHEA 3H1NA 3RBTA 2BMXA 3L4NA 2AUVA 2CX3A 4KB3A 2VCXA 1TTZA 5IO0A 1T4YA 1M7TA 3LYPA 1MDKA 2KLXA 2X64A 1PMTA 4MF5A 3HY2A 4OCFA 2H70A 3J7Yk 2HNLA 5D73A 4X4JA 1GSUA 3D0ZA 4AKHA 1U87A 4GCIA 4MH3A 3U5RE 2IMKA 4BWSA 4L8EA 4K1FA 5GAPD 1PL2A 4OWYA 5D8IA 4MCUA 1J0FA 4ZB9A 3TGZA 4MF7A 14GSA 4MH2A 3ED3A 5J3RA 1DE2A 2JZTA 1WIKA 3I9V2 4ZILA 3TJFA 1HNAA 2LS5A 2HSNA 1GWCA 3HKRA 1W4VA 2V1MA 4GTUA 3IHGA 5ECHB 2H0HA 2OE3A 1EOGA 4YQMA 1ZOFA 3ERFA 4JBBA 1BQ7A 3DRNA 2YP6A 1OVNA 4ZL7A 2H1GA 2PWJA 2K18A 2LRNA 1AQXA 3UMAA 1S3AA 5CNWA 1KBNA 4DSRA 1G0TA 2V32A 1FVKA 3US3A 5BMUA 3GH9A 1EGRA 2NTOA 1MD4A 3VURA 4HJMA 2QA1A 4WETA 2FY6A 3QMXA 5BMUB 3IC4A 1FO5A 18GSA 3H93A 4EC0A 3TOTA 1PRXA 1SENA 4V2LA 3FZAA 4RQRA 3D4TA 1VF1A 1X5EA 5KN3A 1YF1A 3OR5A 5CP1A 1R5AA 1YJ6A 4ISDA 4I97A 1SVMA 4TKYA 1R7HA 1GLPA 1F37A 2JACA 5JWOB 5KN2A 4WBRD 1V58A 2WCIA 3ZMKA 1YVLA 5A4WA 5HR1A 2CQ9A 4L0WA 4HJ2A 2YJHA 5HR3A 1U6TA 4TXOA 3M9KA 1G7OA 3CTFA 3I43A 1K3OA 1SK1A 2AB6A 2C3TA 4ZL9A 3M3MA 2CAQA 1HNCA 2R0CA 5B6NA 4KDUA 3IV4A 3D5JA 3GKXA 3QPMA 2HQTA 2H75A 4FYUA 1WRYA 2TRCP 1WMJA 1LBKA 1XVQA 3A3TA 4I5QA 3VFIA 4YQUA 4Z2TA 1PX7A 1A0RP 5KN1A 2HZEB 1VRSD 2L5OA 2I4AA 2H1LA 4G19A 5J4VA 4HZ4A 1KTEA 5G5EA 1PL1A 4PGTA 1U88A 1K3YA 3EU3A 4IJ3A 4HZ2A 4ULXA 3KCMA 2AYTA 4IS0A 2P5RA 2B3SA 1UN2A 2H01A 3HHVA 2VD1A 2XBQA 5AISA 5G5FA 3TRPA 1XCCA 1YKCA 3I6AA 4HQZA 2GT5A 1R5PA 4LA1A 4KDXA 5DQSA 2HT9A 1SD9A 4ECJA 2FCHA 4AF2A 1SKWB 1PN0A 2X49A 1J08A 5EY6A 1EV4A 3P7XA 1CQHA 4AJ7A 4QQ7A 1XFLA 4N11A 2JADA 1A2MA 4EF0A 1OE8A 1A0FA 1WE0A 4KA0A 2HE3A 5ECNB 2XPEA 3ZZXA 3APOA 1ZZYA 1IYIA 1NW2A 9GSSA 3WGDA 2WB9A 1A8YA 2P31A 1TK0B 4NHWA 4OD7A 2XC2A 3TKSC 5J4YA 4JZQA 3P8WA 3LGCA 2XBIA 1GTUA 2M80A 2VCTA 1JLWA 2OT3A 5J9BA 4EE0A 4MJCA 1V9WA 1GLQA 1K0NA 1XWCA 3FEUA 2V41A 2DSAA 3KD0A 5G31A 1VF3A 1T1VA 3M0FA 3BD2A 4GF0A 3F4RA 1Z6NA 2L5LA 2LUSA 1M0UA 4O92A 1AW9A 3ZIJA 1GSEA 5C04A 4PX1A 2C80A 4K7OA 2DC5A 2DJ1A 3FZ5A 2H0IA 2FNOA 2VO4A 2QGVA 4MZWA 1RQMA 1FG4A 2F51A 5ECLB 3U6VA 2A2RA 3EURA 3IK7A 1B4PA 17GSA 7GSSA 5J5NA 3ZLPA 2NBSA 2AHEA 5LCZA 2YZUA 5KOWA 2VL2C 2EIOA 4IKHA 1AIUA 2QA2A 1A24A 3O6TA 3UOMA 5E4WA 4CY8A 4ZBBA 5F06A 2ALBA 1SKSB 2LJKA 1G6YA 4TR1A 1GUMA 3GKMA 1JZWA 1F3AA 4KCEA 3LJRA 1TI1A 4MP4A 5AIVA 1GRXA 2DIYA 1ACVA 3F63A 1K0DA 3GHAA 3QR6A 4KGIA 3HCZA 1DE1A 10GSA 3WD6A 4PUFC 5GZZB 2FA4A 5IMAA 1SYXA 2B5XA 4NWYA 3AY8A 1GSFA 3FHKA 1S3CA 4WR4A 1XIYA 1O81A 3A5WA 2WS2A 2GZZA 4F03A 4YKGA 3UBLA 2IIYA 2GGTA 2A4VA 1X0RA 4ACSA 2YWOA 4KDYA 1PKZA 1JFUA 2H72A 4XIHA 3MYDA 4KSOA 4K0NA 3GSTA 2G2QA 2H1BA 3PH9A 3TKSE 3UIWA 2X99A 2OBIA 1FB6A 2DLXA 4ML1A 3HJMA 1SK2A 2WULA 2EFDA 3F8UA 2C8UA 2E2MA 4XCSA 1ERTA 4POLA 2OA7A 5J4UA 2IWTA 3CSIA 3QCPA 1SYRA 5ABRA 4TW5A 3APQA 5HR2A 3M9JA 1RW1A 2HRAA 5LNKe 1F2EA 4KW6A 5JCWA 1PSQA 2H6YA 2M46A 1Y1UA 1BF5A 1ZMAA 3K8NA 5BRTA 1TKDB 4YQVA 2JZRA 5JCGA 1TW9A 3KGKA 3O76A 4QL7A 1Z7RA 1AXDA 2ON7A 5ECOB 1H4OA 16GSA 2C0FA 1ZYNA 2N5FA 3E0UA 4XS4B 1DBYA 4POBA 1K0BA 3PGTA 3LXZA 4K6XA 1FB0A 1SU9A 4HQSA 1BJXA 1X9SB 3ZTLA 3ZYWA 5J47A 2V2GA 2HRFA 3DGQA 3WYWA 4N10A 4JR4A 2KP2A 4AJ8A 1ZYEA 3FR3A 1J9BA 1USBA 1QXHA 2FWGA 3IPZA 2CA8A 5DDLA 4EDZA 3VK9A 3ZIVA 3HVSA 3UVHA 3CTGA 1K0CA 4AKXB 4LL1B 1XPVA 3WGXA 1TDIA 4CDOA 1DSBA 13GSA 2A4HA 1MDJA 4I6XA 1G7EA 3L9UA 1SJIA 1PGTA 4K9ZA 4N0VA 3TKRA 1HYUA 3UL3A 1SL1B 3ZFLA 3GKKA 2OKAA 5KN0A 4Z2UA 2MMNA 3L9SA 2R6KA 4PTSA 4BPYA 1SL0B 2AV4A 1OE7A 3FMWA 5L71A 5CYYA 3HJOA 1WOUA 4AJ6A 2UZ8A 5ID2A 1QGVA 1A23A 1CQGA 2GTUA 1YEPA 5FHIA 4CY6A 2OJLA 3WT2A 3D6IA 3S9FA 2LV3A 3GNJA 1TP9A 2NVLA 4HS1A 5EPFA 1GH2A 1YY7A 5ID2B 4L5OA 3W8SA 4XHMA 4ZB6A 4I2TA 1NHYA 2D2ZA 4O7HA 3ZVJA 4V1Ap 1M2BA 5IIZA 1W89A 3G9BA 3EC3A 2KHPA 4O5UA 2HSNB 4TOPA 2F9SA 4ECCA 2HSYA 3CRUA 4E68A 1EGOA 1HQOA 2B6MA 2P5QA 2QSIA 3FRCA 2O89A 3FKFA 3IRAA 5B7CA 2DMMA 3G7JA 2HFDA 4CW9A 3HVVA 1AQWA 3TCOA 1ABAA 2RIIA 4KE3A 4IGJA 1G6WA 4WF4A 4KCAA 2H6XA 2L59A 2GQMA 4N0ZA 3ZREA 1I5GA 5D9TA 5B8AA 1SD8A 3EPTA 5A1NA 5F05A 4X43A 4XS1A 3LQ7A 2FWHA 4MABA 3ZRDA 2LJAA 5DALA 4G01A 1TU8A 4KX4A 3JCML 4KSMA 4ZB8A 1TRVA 2ZNMA 2PU9C 3C7MA 3NOFA 2GLRA 4HEA2 4OO5A 5A1NB 3IAS2 3LG6A 3DYRA 1FW1A 1VF2A 5DALB 22GSA 5A34A 2GVPA 2X8GA 4Q5NA 3IBHA 2VCVA 3Q74A 4IHUA 5DCHA 5ENUA 1GUHA 5HFGA 5A34B 6GSXA 5F0GA 5CRDA 3F4TA 20GSA 5KOXA 1PQNA 1Z3EA 5IMZA 1V2AA 19GSA 1WPIA 5IPGA 1EZKA 3IR4A 4DSQA 4K5SA 1PN9A 3SWLA 2GZYA 4GSSA 6GSSA 3QD9A 1THXA 1T4ZA 1M9BA 3HMJG 1WJKA 2VM1A 5AIXA 1ERVA 2X8HA 5F8BA 3ERWA 4ECBA 1GTAA 4GQCA 4BVXA 4TXOB 1ON4A 2YZHA 1N25A 3GV1A 4N30A 8GSSA 2GSTA 1SJ6A 1OC9A 2HLSA 4IP6A 3QFBC 4NAXA 4OFMA 5DAKA 4LL4B 2B5EA 3MIXA 3P90A 1TXXA 4P3YB 3RAZA 1N2AA 1O8WA 5KEJA 1TJDA 4RI6A 1QK8A 4TRXA 3ZVJD 2O8VB 5DAKB 3WGEA 2C0GA 2MMAA 2MBSA 4HDEA 1M99A 5H5SA 1B9XC 1EP7A 2VCQA 1M2AA 2JSZA 3A2XA 4J56E 5CRGA 4K2XA 1GTBA 5CAXA 1ST9A 1YDKA 2TRXA 1Z9HA 4USSA 3D22A 2JU5A 4NV2A 1SVOA 1JLVA 6GSVA 4L5LA 4EIQA 5ECQB 3EU4A 1KNGA 2CX4A 1JZDA 2H6ZA 1BG5A 3DD3A 4N3ZA 1B4QA 1K0MA 2IPAA 1XWKA 3UAPA 5HR0A 3BBYA 1LU4A 3F3RA 3SBCA 1FVJA 3ZMLA 4PNGA 1SVLA 3EYTA 2A2SA 4MJBA 3KH7A 5D9VA 3IAM2 1T8EB 6GSUA 5IO2A 2YNXA 4G0LA 4EXJA 4G10A 4TR4A 3W8JA 3EMXA 3KJYA 1TK8B 4W66A 5A4VA 3FYGA 1K0AA 3CRTA 2VIMA 4WXTA 2CAIA 1E2YA 1XW5A 2HYXA 4TR3A 2GDRA 3ZITA 2V6KA 2DJ3A 2REMA 4I8BA 3BOAA 1GSDA 2CT6A 1ERUA 1K0OA 2VAFA 3R2QA 3F3QA 4IQ1A 2FLSA 1Q98A 2C4JA 1OKDA 3GH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BL7 A;  3N5O A;  2OE0 A;  2CZ3 A;  3APS A;  3D21 A;  3QDN A;  4I2U A;  4XRA A;  4GQF A;  2RM6 A;  1X9W B;  2IFQ A;  1U3A A;  2I81 A;  1V40 A;  2OBK A;  5G1L A;  4HU9 A;  4TR0 A;  1EEM A;  4ID0 A;  2IFQ B;  3IDV A;  4AGS A;  4NXI A;  1MD3 A;  5IQY A;  1AAZ A;  3ERG A;  4HOJ A;  4EL1 A;  3HD5 A;  5B8B A;  3KMN A;  2YN1 A;  2K6V A;  2B5Y A;  3HZ4 A;  2I3Y A;  1ZGN A;  3A2V A;  3F9U A;  3MNG A;  2B7K A;  4TR1 B;  3WT1 A;  5FT3 A;  2LRC A;  4HI7 A;  1UA5 A;  1V98 A;  4GSN A;  3CBU A;  4ZIJ A;  1F6M C;  5IMC A;  3HYP A;  4L0U A;  2HSH A;  5D9X A;  3DXB A;  2LJR A;  4X0X A;  3GTU A;  4BA7 A;  3LWA A;  2L4C A;  1TK5 B;  2DJJ A;  3QAW A;  3KIJ A;  2E7P A;  2H66 A;  2NDO A;  4FQU A;  2YPM A;  2B1L A;  4K8M A;  3KTL A;  1C72 A;  5DBQ A;  4KAE A;  2BJX A;  3PPU A;  1OC3 A;  5CRE A;  3TJG A;  4PQH A;  1YEX A;  4KH7 A;  1MDI A;  3G7Y A;  3KXO A;  3C1S A;  2FWF A;  4MK3 A;  2EIQ A;  3PR8 A;  1FOV A;  3CXG A;  3NIV A;  1YZX A;  2H73 A;  4D73 A;  3H8Q A;  3ISO A;  1O85 A;  1WP0 A;  4XTS A;  2GT6 A;  5CRW A;  3Q19 A;  2N5B A;  5IPH A;  2JSY A;  2M72 A;  4D73 B;  1EWX A;  3KMO A;  4OMV A;  5B6M A;  2H19 A;  2OAC A;  3FY7 A;  3EWL A;  1ML6 A;  1Z5Y E;  5H5Q A;  5JWQ B;  4Q5R A;  5INY A;  4BVY A;  1E6B A;  1XWA A;  3RHB A;  1R4W A;  1O7U A;  4JR6 A;  5GST A;  3RHC A;  5LD0 A;  4MA9 A;  2YV9 A;  2QKE A;  2WRT A;  1JZO A;  4K7N A;  2CZ2 A;  2H0G A;  1PKW A;  4ZBD A;  4ILF A;  4BVY B;  3GL3 A;  1UVZ A;  5ELG A;  4Z7X A;  1OKT A;  2YAN A;  3QOU A;  4GRF A;  1O73 A;  1DUG A;  3UVT A;  4YAV A;  4NPB A;  3DWV A;  3P2A A;  3VLN A;  2GSS A;  1S3D A;  3TRX A;  2HRK A;  2K8V A;  1TU7 A;  3IC8 A;  4NV5 A;  4LMV A;  3LXT A;  3QAG A;  5IM9 A;  5DCG A;  5HQP A;  3LSZ A;  4ML6 A;  1O8X A;  2HRK B;  3VWU A;  5J41 A;  1F9M A;  2L57 A;  3DML A;  2AJQ B;  1GUK A;  3J7Y b;  2C3N A;  3EIN A;  3GL5 A;  2J9H A;  2L6D A;  4F2I A;  3VI7 A;  1BX9 A;  5IMD A;  3KH9 A;  4WF5 A;  1R26 A;  3TDG A;  2VUP A;  3C1R A;  4E8E A;  2F8F A;  5AN1 A;  3Q6O A;  4J2F A;  3E9J B;  2R5G A;  2C0D A;  4IBP A;  2IN3 A;  3M1G A;  3TB2 A;  2PVO C;  5E59 A;  4PUR A;  5D9W A;  3RDW A;  3A2W A;  1XWG A;  4PQ1 A;  3VWV A;  1QMV A;  5JCU A;  1QFN A;  2R4V A;  3MSZ A;  2FUG 2;  2V6O A;  4EKZ A;  3TKQ A;  1HD2 A;  4YAP A;  3TRQ A;  5CO3 A;  4V1A g;  4DVC A;  2TIR A;  5COH A;  5G2Z A;  2WJU A;  4XRD A;  1ILO A;  2GQL A;  4YH2 A;  4FIW A;  2VCZ A;  11GS A;  3GYK A;  1M9A A;  3HXS A;  1O6J A;  1XZO A;  2ZUP A;  4J57 E;  1PX6 A;  5EL8 A;  3FW2 A;  2VCW A;  2CVD A;  4RQX A;  2K8S A;  2I1U A;  2GQK A;  1B48 A;  1WWJ A;  2HSM A;  2P0G A;  1EP8 A;  1MEK A;  3GN3 A;  5ECR B;  2LNT A;  2KUC A;  5ELA A;  4MMM A;  2X8C A;  2FD3 A;  3RPN A;  2HSM B;  4MLY A;  1X5D A;  4E8H A;  2MMO A;  3LOR A;  3CYN A;  4CHS A;  1XBS A;  4RI7 A;  3I69 A;  3M8N A;  1UC7 A;  1MTC A;  3CMI A;  3GUS A;  2CVK A;  3CSH A;  2NPB A;  3HA9 A;  1B9Y C;  4IP1 A;  4WR5 A;  2IL3 A;  1EOH A;  6GSW A;  3E3E A;  1K3L A;  2R37 A;  2E2G A;  1TRS A;  3HZ8 A;  1XWB A;  2AAW A;  1SL2 B;  2PMT A;  4KUN A;  1U3I A;  4HU7 A;  4GLT A;  3F4S A;  1TI3 A;  1A8L A;  1SJZ A;  2H71 A;  2VL3 A;  3V1W A;  1GSS A;  4DSS A;  4IEL A;  3NZN A;  2DML A;  1F3B A;  3VI5 A;  1XVW A;  2EC4 A;  5IOX A;  4G0K A;  3GA4 A;  4FO5 A;  2WGR A;  5HFK A;  2ES7 A;  4DSS B;  1B8X A;  1OC8 A;  2OAD A;  4F9Z A;  2DBC A;  1OAZ A;  3KM6 A;  2LKU A;  4XS6 A;  2YJ7 A;  3GFK A;  3UEM A;  5HFI A;  3GUR A;  4NHZ A;  4IQA A;  4JE1 A;  2JZS A;  1TOF A;  4ZBA A;  4BVX B;  4RUV A;  4O32 A;  4IW9 A;  3QFA C;  4MZC A;  2VLV A;  3R3E A;  1Y6E A;  3MAK A;  2H74 A;  1XOB A;  2FWE A;  4F82 A;  3FZ4 A;  2HZE A;  4JED A;  1OC9 B;  1XW6 A;  2LQQ A;  2DJK A;  5GAN D;  2L6C A;  1I9D A;  2H76 A;  3PIN A;  2PVQ A;  3F6D A;  3N9J A;  2VLT A;  2PPT A;  4OFN A;  1XXU A;  4FYB A;  3TJJ A;  4OCE A;  1OYJ A;  3W6G A;  4K0G A;  4LMW A;  5JWR B;  3KTB A;  4MJE A;  3TKP A;  1LJR A;  5DJM A;  2R2J A;  3L9V A;  2E0Q A;  4WBJ A;  5J9C A;  3IK9 A;  1X9M B;  1BED A;  3L78 A;  2LRT A;  4POM A;  4F0B A;  2PN8 A;  3FR6 A;  1N8J A;  2IMD A;  3IOS A;  2VM2 A;  1GUL A;  4TN8 A;  2VL9 A;  2O85 A;  3TOU A;  2C1Y A;  3TJK A;  1KEB A;  3GIX A;  4MPG A;  3DVX A;  4O5R A;  1ZL9 A;  2B7J A;  3C8E A;  4ECI A;  2ZCT A;  2YV7 A;  1TRW A;  2K9F A;  2LQO A;  2GSQ A;  1QQ2 A;  2PUK C;  3UBK A;  1SK0 A;  3KP9 A;  1Z7P A;  4MZB A;  2C0E A;  2LNS A;  5IMF A;  4IJI A;  3TUE A;  5IOW A;  4EO3 A;  2KOK A;  3G7I A;  1T00 A;  2R3X A;  4ZL8 A;  3DIE A;  2BTO T;  5DVB A;  1VF4 A;  4IVF A;  3HDC A;  3UAR A;  4WKW A;  3H79 A;  2JL4 A;  5D93 A;  5CRH A;  4G2E A;  2VOC A;  2IMF A;  3QAV A;  2PBJ A;  4MDC A;  2B1K A;  1T7P B;  12GS A;  1YKA A;  2G0F A;  4PUA A;  4WEY A;  5FWG A;  2HRN A;  3C71 A;  3TJB A;  2L4Q A;  3EMP A;  3FZ9 A;  2H30 A;  4JU5 A;  4OFT A;  2F3M A;  1EV9 A;  4V2N A;  1AC1 A;  2RLI A;  3EVI A;  2IJY A;  2YWM A;  4FH8 A;  2IMI A;  4PXO A;  3GX8 A;  2CVB A;  2H1D A;  3IE3 A;  2DJ2 A;  1EEJ A;  1H75 A;  1Z6M A;  4IN0 A;  2O87 A;  4EUY A;  4MF6 A;  5D96 A;  2WFC A;  2MYG A;  2ON5 A;  4Q5Q A;  4BL7 B;  3IXR A;  3VWW A;  5ECK B;  5A4U A;  5G30 A;  3GX0 A;  5ECM B;  2Z9S A;  2IME A;  3HJP A;  1GL8 A;  1NM3 A;  3FK8 A;  3VPQ A;  1M2D A;  3VWX A;  2MZC A;  2MMZ A;  4EDY A;  3KP8 A;  3F0I A;  2RUE A;  1AQV A;  4POK A;  4TXV A;  5ECI B;  3CSJ A;  4V2M A;  2DJ0 A;  2LST A;  2GS3 A;  3D4M A;  4GXZ A;  1IYH A;  4QL9 A;  3TKS A;  1THO A;  2LEG A;  2J23 A;  5GSS A;  1VGL A;  2YWI A;  5ECP B;  5A5K A;  1AUC A;  3HVX A;  2PGT A;  4KND A;  4OO4 A;  5ECS A;  2HI7 A;  3C73 A;  1JZR A;  4DEJ A;  1Y25 A;  2KP1 A;  2C3Q A;  3L0H A;  5DJL A;  2LTK A;  1YQ1 A;  3GTU B;  2CV4 A;  2I9H A;  4GWR A;  4JRR A;  4K7I A;  3H4K A;  4H86 A;  1ERW A;  4GST A;  1RK4 A;  1FAA A;  1GSQ A;  3DVW A;  4X1U A;  4MJA A;  3LFL A;  1NHO A;  4FYC A;  1HNB A;  1URM A;  1GSY A;  3ME7 A;  3EE2 A;  1XOA A;  2YWN A;  4EVM A;  1BAY A;  3FR9 A;  4MPF A;  2DIZ A;  3O3T A;  5IMV A;  4PNF A;  3F6F A;  2VL2 A;  3KEB A;  4G0I A;  4NMU A;  1GP1 A;  4Q5F A;  3ZFB A;  2H1A A;  5H5R A;  2YCD A;  1QUW A;  1BYE A;  4TVE A;  3BCI A;  5F07 A;  3GMF A;  2EIR A;  2RM5 A;  3IA1 A;  2QC7 A;  5DQY A;  1GNE A;  2N5A A;  2F8A A;  1YF0 A;  4K2D A;  2XPD A;  2H8L A;  2WZ9 A;  3UJ1 A;  1GNW A;  3DKS A;  2XHF A;  5AGY A;  2FA8 A;  2RUF A;  3IHQ A;  2GZP A;  1PD2 1;  3VPT A;  3BJ5 A;  1ZCP A;  4ZXG A;  1V57 A;  3MDK A;  4XS4 A;  1A2L A;  4KF9 A;  1SKR B;  1A2J A;  2VD0 A;  1GTI A;  3MWH A;  3LYK A;  3GKN A;  4LLR A;  3DEX A;  6GST A;  2FHE A;  4PQI A;  3ZL5 A;  3ME8 A;  3BCK A;  1NSW A;  1PA3 A;  5G1K A;  3LEF A;  1X5C A;  4HUA A;  1JHB A;  6GSY A;  5EVO A;  2OE1 A;  1Q4J A;  2VLU A;  3GSS A;  3GRX A;  2MBT A;  2WDU A;  3RPP A;  2HXK A;  5C00 A;  1T3B A;  1TRU A;  2FGX A;  4G9H A;  2O7K A;  2GSR A;  2YOI A;  2HZF A;  2PER A;  1ZYQ B;  3Q18 A;  4BWQ A;  4F0C A;  3KZQ A;  1XW9 A;  1FHE A;  3H1N A;  3RBT A;  2BMX A;  3L4N A;  2AUV A;  2CX3 A;  4KB3 A;  2VCX A;  1TTZ A;  5IO0 A;  1T4Y A;  1M7T A;  3LYP A;  1MDK A;  2KLX A;  2X64 A;  1PMT A;  4MF5 A;  3HY2 A;  4OCF A;  2H70 A;  3J7Y k;  2HNL A;  5D73 A;  1GSU A;  3D0Z A;  1U87 A;  4GCI A;  4MH3 A;  3U5R E;  2IMK A;  4BWS A;  4L8E A;  4K1F A;  5GAP D;  1PL2 A;  4OWY A;  5D8I A;  4MCU A;  1J0F A;  4ZB9 A;  3TGZ A;  4MF7 A;  14GS A;  4MH2 A;  3ED3 A;  5J3R A;  1DE2 A;  2JZT A;  1WIK A;  3I9V 2;  4ZIL A;  3TJF A;  1HNA A;  2LS5 A;  3HKR A;  1GWC A;  1W4V A;  2V1M A;  4GTU A;  5ECH B;  2H0H A;  2OE3 A;  1EOG A;  4YQM A;  1ZOF A;  3ERF A;  4JBB A;  1BQ7 A;  3DRN A;  2YP6 A;  1OVN A;  4ZL7 A;  2H1G A;  2PWJ A;  2K18 A;  2LRN A;  1AQX A;  3UMA A;  1S3A A;  5CNW A;  1KBN A;  4DSR A;  1G0T A;  2V32 A;  1FVK A;  3US3 A;  5BMU A;  3GH9 A;  1EGR A;  2NTO A;  1MD4 A;  3VUR A;  4HJM A;  4WET A;  2FY6 A;  3QMX A;  3IC4 A;  1FO5 A;  18GS A;  3H93 A;  4EC0 A;  3TOT A;  1PRX A;  1SEN A;  4V2L A;  3FZA A;  4RQR A;  3D4T A;  1VF1 A;  1X5E A;  5KN3 A;  1YF1 A;  3OR5 A;  5CP1 A;  1R5A A;  1YJ6 A;  4ISD A;  4I97 A;  4TKY A;  1R7H A;  1GLP A;  1F37 A;  2JAC A;  5JWO B;  5KN2 A;  4WBR D;  1V58 A;  2WCI A;  3ZMK A;  5A4W A;  5HR1 A;  2CQ9 A;  4L0W A;  4HJ2 A;  2YJH A;  5HR3 A;  1U6T A;  4TXO A;  3M9K A;  1G7O A;  3CTF A;  3I43 A;  1K3O A;  1SK1 A;  2AB6 A;  2C3T A;  4ZL9 A;  3M3M A;  2CAQ A;  1HNC A;  5B6N A;  4KDU A;  3IV4 A;  3D5J A;  3GKX A;  3QPM A;  2HQT A;  2H75 A;  4FYU A;  1WRY A;  2TRC P;  1WMJ A;  1LBK A;  1XVQ A;  3A3T A;  4I5Q A;  3VFI A;  4YQU A;  1PX7 A;  1A0R P;  5KN1 A;  2HZE B;  1VRS D;  2L5O A;  2I4A A;  4G19 A;  4HZ4 A;  1KTE A;  5G5E A;  1PL1 A;  4PGT A;  1U88 A;  1K3Y A;  3EU3 A;  4IJ3 A;  4HZ2 A;  4ULX A;  3KCM A;  2AYT A;  4IS0 A;  2P5R A;  2B3S A;  1UN2 A;  2H01 A;  3HHV A;  2VD1 A;  2XBQ A;  5AIS A;  5G5F A;  3TRP A;  1XCC A;  1YKC A;  3I6A A;  4HQZ A;  2GT5 A;  1R5P A;  4LA1 A;  4KDX A;  5DQS A;  2HT9 A;  1SD9 A;  4ECJ A;  2FCH A;  4AF2 A;  1SKW B;  1J08 A;  5EY6 A;  1EV4 A;  3P7X A;  1CQH A;  4AJ7 A;  4QQ7 A;  1XFL A;  4N11 A;  2JAD A;  1A2M A;  4EF0 A;  1OE8 A;  1A0F A;  1WE0 A;  4KA0 A;  2HE3 A;  5ECN B;  2XPE A;  3ZZX A;  3APO A;  1ZZY A;  1IYI A;  1NW2 A;  9GSS A;  3WGD A;  2WB9 A;  1A8Y A;  2P31 A;  1TK0 B;  4NHW A;  4OD7 A;  2XC2 A;  3TKS C;  4JZQ A;  3P8W A;  3LGC A;  2XBI A;  1GTU A;  2M80 A;  2VCT A;  1JLW A;  5J9B A;  4EE0 A;  4MJC A;  1V9W A;  1GLQ A;  1K0N A;  1XWC A;  3FEU A;  2V41 A;  2DSA A;  3KD0 A;  5G31 A;  1VF3 A;  1T1V A;  3M0F A;  3BD2 A;  4GF0 A;  3F4R A;  1Z6N A;  2L5L A;  2LUS A;  1M0U A;  4O92 A;  1AW9 A;  3ZIJ A;  1GSE A;  5C04 A;  4PX1 A;  2C80 A;  4K7O A;  2DC5 A;  2DJ1 A;  3FZ5 A;  2H0I A;  2FNO A;  2VO4 A;  2QGV A;  4MZW A;  1RQM A;  1FG4 A;  2F51 A;  5ECL B;  3U6V A;  2A2R A;  3EUR A;  3IK7 A;  1B4P A;  17GS A;  7GSS A;  5J5N A;  3ZLP A;  2NBS A;  2AHE A;  5LCZ A;  2YZU A;  2VL2 C;  2EIO A;  4IKH A;  1AIU A;  1A24 A;  3O6T A;  3UOM A;  5E4W A;  4ZBB A;  5F06 A;  2ALB A;  1SKS B;  2LJK A;  1G6Y A;  4TR1 A;  1GUM A;  3GKM A;  1JZW A;  1F3A A;  4KCE A;  3LJR A;  1TI1 A;  4MP4 A;  5AIV A;  1GRX A;  2DIY A;  1ACV A;  3F63 A;  1K0D A;  3GHA A;  3QR6 A;  4KGI A;  3HCZ A;  1DE1 A;  10GS A;  3WD6 A;  4PUF C;  5GZZ B;  2FA4 A;  5IMA A;  1SYX A;  2B5X A;  4NWY A;  3AY8 A;  1GSF A;  3FHK A;  1S3C A;  4WR4 A;  1XIY A;  1O81 A;  3A5W A;  2WS2 A;  2GZZ A;  4F03 A;  3UBL A;  2IIY A;  2GGT A;  2A4V A;  1X0R A;  4ACS A;  2YWO A;  4KDY A;  1PKZ A;  1JFU A;  2H72 A;  4XIH A;  4KSO A;  4K0N A;  3GST A;  2G2Q A;  2H1B A;  3PH9 A;  3TKS E;  3UIW A;  2X99 A;  2OBI A;  1FB6 A;  2DLX A;  4ML1 A;  3HJM A;  1SK2 A;  2WUL A;  3F8U A;  2C8U A;  2E2M A;  4XCS A;  1ERT A;  4POL A;  2OA7 A;  5J4U A;  2IWT A;  3CSI A;  3QCP A;  1SYR A;  5ABR A;  4TW5 A;  3APQ A;  5HR2 A;  3M9J A;  1RW1 A;  2HRA A;  5LNK e;  1F2E A;  4KW6 A;  5JCW A;  1PSQ A;  2H6Y A;  2M46 A;  1ZMA A;  3K8N A;  1TKD B;  4YQV A;  2JZR A;  5JCG A;  1TW9 A;  3KGK A;  3O76 A;  4QL7 A;  1Z7R A;  1AXD A;  2ON7 A;  5ECO B;  1H4O A;  16GS A;  2C0F A;  2N5F A;  3E0U A;  4XS4 B;  1DBY A;  4POB A;  1K0B A;  3PGT A;  3LXZ A;  4K6X A;  1FB0 A;  1SU9 A;  4HQS A;  1BJX A;  1X9S B;  3ZTL A;  3ZYW A;  2V2G A;  2HRF A;  3DGQ A;  3WYW A;  4N10 A;  4JR4 A;  2KP2 A;  4AJ8 A;  1ZYE A;  3FR3 A;  1J9B A;  1USB A;  1QXH A;  2FWG A;  3IPZ A;  2CA8 A;  5DDL A;  4EDZ A;  3VK9 A;  3ZIV A;  3HVS A;  3UVH A;  3CTG A;  1K0C A;  4LL1 B;  1XPV A;  3WGX A;  1TDI A;  4CDO A;  1DSB A;  13GS A;  1MDJ A;  4I6X A;  1G7E A;  3L9U A;  1SJI A;  1PGT A;  4K9Z A;  4N0V A;  3TKR A;  1HYU A;  3UL3 A;  1SL1 B;  3ZFL A;  3GKK A;  2OKA A;  5KN0 A;  2MMN A;  3L9S A;  2R6K A;  4PTS A;  4BPY A;  1SL0 B;  2AV4 A;  1OE7 A;  5L71 A;  5CYY A;  3HJO A;  1WOU A;  4AJ6 A;  2UZ8 A;  5ID2 A;  1QGV A;  1A23 A;  1CQG A;  2GTU A;  1YEP A;  5FHI A;  2OJL A;  3WT2 A;  3D6I A;  3S9F A;  2LV3 A;  3GNJ A;  1TP9 A;  2NVL A;  4HS1 A;  5EPF A;  1GH2 A;  1YY7 A;  5ID2 B;  4L5O A;  3W8S A;  4XHM A;  4ZB6 A;  4I2T A;  1NHY A;  2D2Z A;  4O7H A;  3ZVJ A;  4V1A p;  1M2B A;  5IIZ A;  1W89 A;  3G9B A;  3EC3 A;  2KHP A;  2HSN B;  4TOP A;  2F9S A;  4ECC A;  2HSY A;  3CRU A;  1EGO A;  1HQO A;  2B6M A;  2P5Q A;  2QSI A;  3FRC A;  2O89 A;  3FKF A;  3IRA A;  5B7C A;  2DMM A;  3G7J A;  2HFD A;  4CW9 A;  3HVV A;  1AQW A;  3TCO A;  1ABA A;  2RII A;  4KE3 A;  4IGJ A;  1G6W A;  4WF4 A;  4KCA A;  2H6X A;  2L59 A;  2GQM A;  4N0Z A;  3ZRE A;  1I5G A;  5D9T A;  5B8A A;  1SD8 A;  5F05 A;  4X43 A;  4XS1 A;  3LQ7 A;  2FWH A;  4MAB A;  3ZRD A;  2LJA A;  5DAL A;  1TU8 A;  4KX4 A;  3JCM L;  4KSM A;  4ZB8 A;  1TRV A;  2ZNM A;  2PU9 C;  3C7M A;  3NOF A;  2GLR A;  4HEA 2;  4OO5 A;  3IAS 2;  3LG6 A;  3DYR A;  1FW1 A;  1VF2 A;  5DAL B;  22GS A;  2GVP A;  2X8G A;  4Q5N A;  3IBH A;  3Q74 A;  2VCV A;  4IHU A;  5DCH A;  5ENU A;  1GUH A;  5HFG A;  6GSX A;  5F0G A;  5CRD A;  3F4T A;  20GS A;  1PQN A;  1Z3E A;  5IMZ A;  1V2A A;  19GS A;  1WPI A;  5IPG A;  1EZK A;  3IR4 A;  4DSQ A;  1PN9 A;  3SWL A;  2GZY A;  4GSS A;  6GSS A;  3QD9 A;  1THX A;  1T4Z A;  1M9B A;  1WJK A;  2VM1 A;  5AIX A;  1ERV A;  2X8H A;  5F8B A;  3ERW A;  4ECB A;  1GTA A;  4GQC A;  4BVX A;  4TXO B;  1ON4 A;  2YZH A;  3GV1 A;  4N30 A;  8GSS A;  2GST A;  1SJ6 A;  1OC9 A;  2HLS A;  4IP6 A;  3QFB C;  4NAX A;  4OFM A;  5DAK A;  4LL4 B;  2B5E A;  3P90 A;  1TXX A;  4P3Y B;  3RAZ A;  1N2A A;  1O8W A;  5KEJ A;  1TJD A;  4RI6 A;  1QK8 A;  4TRX A;  3ZVJ D;  2O8V B;  5DAK B;  3WGE A;  2C0G A;  2MMA A;  2MBS A;  4HDE A;  1M99 A;  5H5S A;  1B9X C;  1EP7 A;  2VCQ A;  1M2A A;  2JSZ A;  3A2X A;  4J56 E;  5CRG A;  1GTB A;  5CAX A;  1ST9 A;  1YDK A;  2TRX A;  1Z9H A;  4USS A;  3D22 A;  2JU5 A;  4NV2 A;  1JLV A;  6GSV A;  4L5L A;  5ECQ B;  3EU4 A;  1KNG A;  2CX4 A;  1JZD A;  2H6Z A;  1BG5 A;  3DD3 A;  1B4Q A;  1K0M A;  2IPA A;  1XWK A;  3UAP A;  5HR0 A;  3BBY A;  1LU4 A;  3F3R A;  3SBC A;  1FVJ A;  3ZML A;  4PNG A;  3EYT A;  2A2S A;  4MJB A;  3KH7 A;  5D9V A;  3IAM 2;  1T8E B;  6GSU A;  5IO2 A;  2YNX A;  4G0L A;  4EXJ A;  4G10 A;  4TR4 A;  3W8J A;  3EMX A;  3KJY A;  1TK8 B;  5A4V A;  3FYG A;  1K0A A;  3CRT A;  2VIM A;  4WXT A;  2CAI A;  1E2Y A;  1XW5 A;  2HYX A;  4TR3 A;  2GDR A;  3ZIT A;  2V6K A;  2DJ3 A;  2REM A;  4I8B A;  3BOA A;  1GSD A;  2CT6 A;  1ERU A;  1K0O A;  2VAF A;  3R2Q A;  3F3Q A;  4IQ1 A;  2FLS A;  1Q98 A;  2C4J A;  1OKD A;  3GH6 A; 
#chains in the Genus database with same CATH topology
 4BL7 A;  3N5O A;  2OE0 A;  2CZ3 A;  3APS A;  3D21 A;  3QDN A;  4I2U A;  4XRA A;  4GQF A;  2RM6 A;  1X9W B;  2IFQ A;  1U3A A;  2I81 A;  1V40 A;  2OBK A;  5G1L A;  4HU9 A;  3LW9 A;  4TR0 A;  1EEM A;  4ID0 A;  2IFQ B;  3IDV A;  4AGS A;  4NXI A;  1MD3 A;  5IQY A;  1AAZ A;  3ERG A;  4HOJ A;  4EL1 A;  3HD5 A;  5B8B A;  1TXU A;  3KMN A;  2YN1 A;  2K6V A;  2B5Y A;  3HZ4 A;  2I3Y A;  1ZGN A;  3A2V A;  3F9U A;  3MNG A;  2B7K A;  4TR1 B;  3WT1 A;  5FT3 A;  2LRC A;  4HI7 A;  4QMK A;  2WVY A;  1UA5 A;  1V98 A;  4GSN A;  3CBU A;  4ZIJ A;  4A5P A;  1F6M C;  5IMC A;  3HYP A;  4L0U A;  2HSH A;  5D9X A;  3DXB A;  2LJR A;  4X0X A;  3GTU A;  2A2P A;  4BA7 A;  3LWA A;  2L4C A;  1TK5 B;  2DJJ A;  3QAW A;  3KIJ A;  2E7P A;  2H66 A;  2NDO A;  4FQU A;  2YPM A;  2WZS A;  2B1L A;  4AKI A;  4K8M A;  3KTL A;  1C72 A;  5DBQ A;  4KAE A;  2BJX A;  3PPU A;  1OC3 A;  5CRE A;  3TJG A;  4AKG A;  2R0G A;  4PQH A;  1YEX A;  4KH7 A;  1MDI A;  3G7Y A;  3KXO A;  3C1S A;  2FWF A;  4MK3 A;  2EIQ A;  3PR8 A;  1FOV A;  3CXG A;  3NIV A;  1BG1 A;  1YZX A;  2H73 A;  4D73 A;  3H8Q A;  3ISO A;  1O85 A;  1WP0 A;  4XTS A;  2GT6 A;  5CRW A;  3Q19 A;  2N5B A;  5IPH A;  2JSY A;  2M72 A;  4D73 B;  1EWX A;  3KMO A;  4OMV A;  5B6M A;  2H19 A;  2OAC A;  3FY7 A;  3EWL A;  1ML6 A;  1Z5Y E;  5H5Q A;  5JWQ B;  4Q5R A;  5INY A;  4BVY A;  1E6B A;  1XWA A;  4K5R A;  3RHB A;  1R4W A;  1O7U A;  4JR6 A;  5GST A;  3RHC A;  5LD0 A;  4MA9 A;  2YV9 A;  2QKE A;  2WRT A;  1JZO A;  4K7N A;  2CZ2 A;  2H0G A;  1PKW A;  4ZBD A;  4ILF A;  4BVY B;  3GL3 A;  1UVZ A;  5ELG A;  4Z7X A;  1OKT A;  2YAN A;  3QOU A;  4GRF A;  1O73 A;  1DUG A;  3UVT A;  4YAV A;  4NPB A;  3DWV A;  3P2A A;  3VLN A;  2GSS A;  1S3D A;  3TRX A;  2HRK A;  2K8V A;  1TU7 A;  3IC8 A;  4NV5 A;  4LMV A;  3LXT A;  3QAG A;  5IM9 A;  5DCG A;  5HQP A;  3LSZ A;  4ML6 A;  1O8X A;  2HRK B;  3VWU A;  2VKZ G;  5J41 A;  1F9M A;  2L57 A;  3DML A;  2AJQ B;  1GUK A;  3J7Y b;  2C3N A;  3EIN A;  3GL5 A;  2J9H A;  2L6D A;  4F2I A;  3VI7 A;  3A5I A;  1BX9 A;  5IMD A;  3KH9 A;  4WF5 A;  1R26 A;  3TDG A;  2VUP A;  3C1R A;  4E8E A;  2F8F A;  5AN1 A;  3Q6O A;  4J2F A;  3E9J B;  2R5G A;  2C0D A;  4IBP A;  2IN3 A;  3M1G A;  3TU3 B;  2UV8 G;  4AI6 A;  3TB2 A;  2PVO C;  5E59 A;  4PUR A;  5D9W A;  3RDW A;  3A2W A;  1XWG A;  4PQ1 A;  3VWV A;  1QMV A;  5JCU A;  1QFN A;  2R4V A;  3MSZ A;  2FUG 2;  2V6O A;  4EKZ A;  3TKQ A;  1HD2 A;  4YAP A;  3TRQ A;  5CO3 A;  4V1A g;  4DVC A;  2TIR A;  5COH A;  5G2Z A;  2WJU A;  4XRD A;  1ILO A;  2GQL A;  4YH2 A;  4FIW A;  2VCZ A;  11GS A;  3GYK A;  1M9A A;  3HXS A;  1O6J A;  1XZO A;  2ZUP A;  4J57 E;  1PX6 A;  5EL8 A;  3FW2 A;  2VCW A;  2CVD A;  4RQX A;  2K8S A;  2I1U A;  2GQK A;  1B48 A;  1WWJ A;  2HSM A;  2P0G A;  1EP8 A;  1MEK A;  3GN3 A;  5ECR B;  2LNT A;  2KUC A;  5ELA A;  4MMM A;  2X8C A;  2FD3 A;  3RPN A;  2HSM B;  4MLY A;  2O5V A;  1X5D A;  4E8H A;  1FOH A;  2MMO A;  3LOR A;  3CYN A;  4CHS A;  1XBS A;  4RI7 A;  3I69 A;  3M8N A;  1UC7 A;  1MTC A;  3CMI A;  3GUS A;  2CVK A;  3CSH A;  2NPB A;  4YKF A;  3HA9 A;  1B9Y C;  4IP1 A;  4WR5 A;  2IL3 A;  1EOH A;  6GSW A;  3E3E A;  1K3L A;  2R37 A;  2O36 A;  2E2G A;  1TRS A;  3HZ8 A;  1XWB A;  2AAW A;  1SL2 B;  2PMT A;  4KUN A;  1U3I A;  4HU7 A;  4GLT A;  3F4S A;  1TI3 A;  1A8L A;  1SJZ A;  2H71 A;  2VL3 A;  3V1W A;  1GSS A;  4DSS A;  4IEL A;  3NZN A;  2DML A;  1F3B A;  3VI5 A;  1XVW A;  2EC4 A;  5IOX A;  4G0K A;  3GA4 A;  4FO5 A;  2WGR A;  5HFK A;  2ES7 A;  4DSS B;  3RGB C;  1B8X A;  4GDF A;  2OAD A;  1OC8 A;  4F9Z A;  2DBC A;  1OAZ A;  3KM6 A;  2LKU A;  4XS6 A;  2YJ7 A;  3GFK A;  3UEM A;  5HFI A;  3GUR A;  4NHZ A;  4IQA A;  4JE1 A;  2JZS A;  1TOF A;  4ZBA A;  4BVX B;  4RUV A;  4O32 A;  4IW9 A;  3QFA C;  4MZC A;  2VLV A;  3R3E A;  1Y6E A;  3MAK A;  2H74 A;  1XOB A;  2FWE A;  4F82 A;  3FZ4 A;  2HZE A;  4JED A;  1OC9 B;  1XW6 A;  2LQQ A;  2DJK A;  5GAN D;  2L6C A;  1I9D A;  2H76 A;  3PIN A;  2PVQ A;  3F6D A;  3N9J A;  2VLT A;  2PPT A;  4OFN A;  1XXU A;  4FYB A;  3TJJ A;  4OCE A;  1OYJ A;  3W6G A;  4K0G A;  4LMW A;  5JWR B;  3KTB A;  4MJE A;  3TKP A;  1LJR A;  5DJM A;  2R2J A;  3L9V A;  2E0Q A;  4WBJ A;  5J9C A;  3IK9 A;  1X9M B;  1BED A;  3L78 A;  2LRT A;  4POM A;  4F0B A;  2PN8 A;  3FR6 A;  1N8J A;  2IMD A;  3IOS A;  2VM2 A;  1GUL A;  4TN8 A;  2VL9 A;  2O85 A;  3TOU A;  2C1Y A;  3TJK A;  1KEB A;  3GIX A;  4MPG A;  3DVX A;  4O5R A;  1ZL9 A;  2B7J A;  3C8E A;  4ECI A;  2ZCT A;  2YV7 A;  3RFR C;  1TRW A;  2K9F A;  2LQO A;  2GSQ A;  1QQ2 A;  2PUK C;  3UBK A;  1SK0 A;  1S4B P;  3KP9 A;  1Z7P A;  4MZB A;  2C0E A;  2LNS A;  5IMF A;  4IJI A;  3TUE A;  5IOW A;  4EO3 A;  2KOK A;  3G7I A;  1T00 A;  2R3X A;  4ZL8 A;  3DIE A;  2BTO T;  5DVB A;  1VF4 A;  4IVF A;  3HDC A;  3UAR A;  4WKW A;  3H79 A;  2JL4 A;  5D93 A;  5CRH A;  4G2E A;  2VOC A;  2IMF A;  3QAV A;  2PBJ A;  4MDC A;  3CWG A;  2B1K A;  1T7P B;  5A5H A;  12GS A;  1YKA A;  2G0F A;  4PUA A;  4WEY A;  5FWG A;  2HRN A;  3C71 A;  3TJB A;  2L4Q A;  3EMP A;  3FZ9 A;  5A5H B;  2H30 A;  4JU5 A;  4OFT A;  2F3M A;  1EV9 A;  4V2N A;  1AC1 A;  2RLI A;  3EVI A;  2IJY A;  2YWM A;  4FH8 A;  2IMI A;  4PXO A;  2DKI A;  3GX8 A;  2EFE A;  2O3E A;  2CVB A;  2H1D A;  3IE3 A;  2DJ2 A;  1EEJ A;  1H75 A;  1Z6M A;  4IN0 A;  2O87 A;  4EUY A;  4MF6 A;  5D96 A;  2WFC A;  2MYG A;  2ON5 A;  4Q5Q A;  4BL7 B;  3IXR A;  3VWW A;  5ECK B;  5A4U A;  5G30 A;  3GX0 A;  5ECM B;  2Z9S A;  2IME A;  3HJP A;  1GL8 A;  1NM3 A;  3FK8 A;  3VPQ A;  4HSC X;  1M2D A;  3VWX A;  2WVZ A;  2MZC A;  2MMZ A;  4EDY A;  3KP8 A;  3F0I A;  2RUE A;  1AQV A;  4POK A;  4TXV A;  5ECI B;  3CSJ A;  4V2M A;  2DJ0 A;  2LST A;  2GS3 A;  3D4M A;  4GXZ A;  1IYH A;  2X4A A;  4QL9 A;  3TKS A;  1THO A;  2LEG A;  2EFC A;  2J23 A;  5GSS A;  1VGL A;  2YWI A;  5ECP B;  5A5K A;  1AUC A;  3HVX A;  2PGT A;  4KND A;  4OO4 A;  5ECS A;  2HI7 A;  3C73 A;  1JZR A;  2EFH A;  4DEJ A;  1Y25 A;  2KP1 A;  2C3Q A;  3L0H A;  5DJL A;  2LTK A;  1YQ1 A;  3GTU B;  2CV4 A;  2I9H A;  4GWR A;  4JRR A;  4K7I A;  3H4K A;  4H86 A;  1ERW A;  4GST A;  4ZB7 A;  1RK4 A;  1FAA A;  1GSQ A;  5J40 A;  3DVW A;  4X1U A;  1ZYP A;  4MJA A;  3LFL A;  1NHO A;  4FYC A;  1HNB A;  4FXY P;  1URM A;  1GSY A;  3ME7 A;  2WVX A;  3EE2 A;  1XOA A;  2YWN A;  4EVM A;  1BAY A;  3FR9 A;  4MPF A;  2DIZ A;  4O5Q A;  3O3T A;  5IMV A;  4PNF A;  3F6F A;  2VL2 A;  3KEB A;  4G0I A;  4NMU A;  1GP1 A;  4Q5F A;  3ZFB A;  2H1A A;  2R0P A;  2YCD A;  1QUW A;  1BYE A;  4TVE A;  3BCI A;  5F07 A;  5H5R A;  3GMF A;  2EIR A;  2RM5 A;  3IA1 A;  2QC7 A;  5DQY A;  1GNE A;  2N5A A;  2F8A A;  1YF0 A;  4K2D A;  2XPD A;  4EIP A;  2H8L A;  2WZ9 A;  3CQF A;  1GNW A;  3UJ1 A;  3DKS A;  2XHF A;  5AGY A;  2FA8 A;  2RUF A;  3IHQ A;  4ICY A;  2GZP A;  1PD2 1;  3VPT A;  3BJ5 A;  1ZCP A;  4ZXG A;  1V57 A;  3MDK A;  4XS4 A;  1A2L A;  4KF9 A;  1SKR B;  1A2J A;  2VD0 A;  2DKH A;  1GTI A;  3MWH A;  3LYK A;  3GKN A;  4LLR A;  3DEX A;  6GST A;  2FHE A;  4PQI A;  3ZL5 A;  3ME8 A;  3BCK A;  1NSW A;  1PA3 A;  5G1K A;  3LEF A;  1X5C A;  4HUA A;  1JHB A;  6GSY A;  5EVO A;  2OE1 A;  1Q4J A;  2VLU A;  3GSS A;  3GRX A;  2MBT A;  2WDU A;  3RPP A;  2HXK A;  5C00 A;  1T3B A;  1TRU A;  2FGX A;  4G9H A;  2O7K A;  2GSR A;  2YOI A;  2HZF A;  2PER A;  1ZYQ B;  3Q18 A;  4BWQ A;  4Z2R A;  4F0C A;  3KZQ A;  4MNN A;  2WW1 A;  1XW9 A;  1FHE A;  3H1N A;  3RBT A;  2BMX A;  3L4N A;  2AUV A;  2CX3 A;  4KB3 A;  2VCX A;  1TTZ A;  5IO0 A;  1T4Y A;  1M7T A;  3LYP A;  1MDK A;  2KLX A;  2X64 A;  1PMT A;  4MF5 A;  3HY2 A;  4OCF A;  2H70 A;  3J7Y k;  2HNL A;  5D73 A;  4X4J A;  1GSU A;  3D0Z A;  4AKH A;  1U87 A;  4GCI A;  4MH3 A;  3U5R E;  2IMK A;  4BWS A;  4L8E A;  4K1F A;  5GAP D;  1PL2 A;  4OWY A;  5D8I A;  4MCU A;  1J0F A;  4ZB9 A;  3TGZ A;  4MF7 A;  14GS A;  4MH2 A;  2WW0 A;  3ED3 A;  5J3R A;  1DE2 A;  2JZT A;  1WIK A;  3I9V 2;  4ZIL A;  3TJF A;  1HNA A;  2LS5 A;  2HSN A;  1GWC A;  3HKR A;  1W4V A;  2V1M A;  4GTU A;  3IHG A;  5ECH B;  2H0H A;  2OE3 A;  1EOG A;  4YQM A;  1ZOF A;  3ERF A;  4JBB A;  1BQ7 A;  3DRN A;  2YP6 A;  1OVN A;  3CHX C;  4ZL7 A;  2H1G A;  2PWJ A;  2K18 A;  2LRN A;  1AQX A;  3UMA A;  1S3A A;  5CNW A;  1KBN A;  4DSR A;  1G0T A;  2V32 A;  3HVN A;  1FVK A;  3US3 A;  5BMU A;  3GH9 A;  1EGR A;  2NTO A;  1MD4 A;  3VUR A;  4HJM A;  2QA1 A;  4WET A;  2FY6 A;  3QMX A;  5BMU B;  3IC4 A;  1FO5 A;  18GS A;  3H93 A;  4EC0 A;  3TOT A;  1PRX A;  1SEN A;  4V2L A;  3FZA A;  4RQR A;  3D4T A;  1VF1 A;  1X5E A;  5KN3 A;  1YF1 A;  3OR5 A;  5CP1 A;  1R5A A;  1YJ6 A;  4ISD A;  4I97 A;  1SVM A;  4TKY A;  1R7H A;  1GLP A;  1F37 A;  2JAC A;  5JWO B;  5KN2 A;  4WBR D;  1V58 A;  2WCI A;  3ZMK A;  1YVL A;  5A4W A;  5HR1 A;  2CQ9 A;  4L0W A;  4HJ2 A;  2YJH A;  5HR3 A;  1U6T A;  4TXO A;  1G7O A;  3CTF A;  3M9K A;  3I43 A;  1K3O A;  1SK1 A;  2AB6 A;  2C3T A;  4ZL9 A;  3M3M A;  2CAQ A;  1HNC A;  2R0C A;  5B6N A;  4KDU A;  3IV4 A;  3D5J A;  3GKX A;  3QPM A;  2HQT A;  2H75 A;  4FYU A;  1WRY A;  2TRC P;  1WMJ A;  1LBK A;  1XVQ A;  3A3T A;  4I5Q A;  3VFI A;  4YQU A;  4Z2T A;  1PX7 A;  1A0R P;  5KN1 A;  2HZE B;  1VRS D;  2L5O A;  2I4A A;  2H1L A;  4G19 A;  5J4V A;  4HZ4 A;  1KTE A;  4BIK A;  5G5E A;  1PL1 A;  4PGT A;  1U88 A;  1K3Y A;  3EU3 A;  4IJ3 A;  4HZ2 A;  4ULX A;  3KCM A;  2AYT A;  4IS0 A;  2P5R A;  2B3S A;  1UN2 A;  2H01 A;  3HHV A;  2VD1 A;  2XBQ A;  5AIS A;  5G5F A;  3TRP A;  1XCC A;  1YKC A;  3I6A A;  4HQZ A;  2GT5 A;  1R5P A;  4LA1 A;  4KDX A;  5DQS A;  2HT9 A;  1SD9 A;  4ECJ A;  2FCH A;  4AF2 A;  1SKW B;  1PN0 A;  2X49 A;  1J08 A;  5EY6 A;  1EV4 A;  3P7X A;  1CQH A;  4AJ7 A;  4QQ7 A;  1XFL A;  4N11 A;  2JAD A;  1A2M A;  4EF0 A;  1OE8 A;  1A0F A;  1WE0 A;  4KA0 A;  2HE3 A;  5ECN B;  2XPE A;  3ZZX A;  3APO A;  1ZZY A;  1IYI A;  1NW2 A;  9GSS A;  3WGD A;  2WB9 A;  1A8Y A;  2P31 A;  1TK0 B;  4NHW A;  4OD7 A;  2XC2 A;  3TKS C;  5J4Y A;  4JZQ A;  3P8W A;  3LGC A;  2XBI A;  1GTU A;  2M80 A;  2VCT A;  1JLW A;  2OT3 A;  5J9B A;  4EE0 A;  4MJC A;  1V9W A;  1GLQ A;  1K0N A;  1XWC A;  3FEU A;  2V41 A;  2DSA A;  3KD0 A;  5G31 A;  1VF3 A;  1T1V A;  3M0F A;  3BD2 A;  4GF0 A;  3F4R A;  1Z6N A;  2L5L A;  2LUS A;  1M0U A;  4O92 A;  1AW9 A;  3ZIJ A;  1GSE A;  1I1I P;  1S3R A;  5C04 A;  4PX1 A;  2C80 A;  4K7O A;  2DC5 A;  2DJ1 A;  3FZ5 A;  2H0I A;  2FNO A;  2VO4 A;  2QGV A;  4MZW A;  1RQM A;  1FG4 A;  2F51 A;  5ECL B;  3U6V A;  2A2R A;  3EUR A;  3IK7 A;  1B4P A;  17GS A;  7GSS A;  5J5N A;  3ZLP A;  2NBS A;  2AHE A;  5LCZ A;  2YZU A;  5KOW A;  2VL2 C;  2EIO A;  4IKH A;  1AIU A;  2QA2 A;  1A24 A;  3O6T A;  3UOM A;  5E4W A;  4CY8 A;  4ZBB A;  5F06 A;  2ALB A;  1SKS B;  2LJK A;  1G6Y A;  4TR1 A;  1GUM A;  3GKM A;  1JZW A;  1F3A A;  4KCE A;  3LJR A;  1TI1 A;  4MP4 A;  5AIV A;  1GRX A;  2DIY A;  1ACV A;  3F63 A;  1K0D A;  3GHA A;  3QR6 A;  4KGI A;  3HCZ A;  1DE1 A;  10GS A;  3WD6 A;  4PUF C;  5GZZ B;  2FA4 A;  5IMA A;  1SYX A;  2B5X A;  4NWY A;  3AY8 A;  1GSF A;  3FHK A;  1S3C A;  4WR4 A;  1XIY A;  1O81 A;  3A5W A;  2WS2 A;  2GZZ A;  4F03 A;  4YKG A;  3UBL A;  2IIY A;  2GGT A;  2A4V A;  1X0R A;  4ACS A;  2YWO A;  4KDY A;  1PKZ A;  1JFU A;  2H72 A;  4XIH A;  3MYD A;  4KSO A;  4K0N A;  3GST A;  2G2Q A;  2WVX B;  2H1B A;  3PH9 A;  3TKS E;  3UIW A;  2X99 A;  2OBI A;  1FB6 A;  2DLX A;  4ML1 A;  3HJM A;  1SK2 A;  2WUL A;  2EFD A;  3F8U A;  2C8U A;  2E2M A;  4XCS A;  1ERT A;  4POL A;  2OA7 A;  5J4U A;  2IWT A;  3CSI A;  3QCP A;  1SYR A;  5ABR A;  4TW5 A;  3APQ A;  5HR2 A;  3M9J A;  1RW1 A;  2HRA A;  5LNK e;  1F2E A;  4KW6 A;  5JCW A;  1PSQ A;  2H6Y A;  2M46 A;  1Y1U A;  1BF5 A;  1ZMA A;  3K8N A;  5BRT A;  1TKD B;  4YQV A;  2JZR A;  5JCG A;  1TW9 A;  3KGK A;  3O76 A;  4QL7 A;  1Z7R A;  1AXD A;  2ON7 A;  5ECO B;  1H4O A;  16GS A;  2C0F A;  1ZYN A;  2N5F A;  3E0U A;  4XS4 B;  1DBY A;  4POB A;  1K0B A;  3PGT A;  3LXZ A;  4K6X A;  1FB0 A;  1SU9 A;  4HQS A;  1BJX A;  1X9S B;  3ZTL A;  3ZYW A;  5J47 A;  2V2G A;  2HRF A;  3DGQ A;  3WYW A;  4N10 A;  4JR4 A;  2KP2 A;  4AJ8 A;  1ZYE A;  3FR3 A;  1J9B A;  1USB A;  1QXH A;  2FWG A;  3IPZ A;  2CA8 A;  5DDL A;  4EDZ A;  3VK9 A;  3ZIV A;  3HVS A;  3UVH A;  3CTG A;  2WW2 A;  1K0C A;  4AKX B;  4LL1 B;  1XPV A;  3WGX A;  1TDI A;  4CDO A;  1DSB A;  13GS A;  2A4H A;  1MDJ A;  4I6X A;  1G7E A;  3L9U A;  1SJI A;  1PGT A;  4K9Z A;  4N0V A;  3TKR A;  1HYU A;  3UL3 A;  1SL1 B;  3ZFL A;  3GKK A;  2OKA A;  5KN0 A;  4Z2U A;  2MMN A;  3L9S A;  2R6K A;  4PTS A;  4BPY A;  1SL0 B;  2AV4 A;  1OE7 A;  3FMW A;  5L71 A;  5CYY A;  3HJO A;  1WOU A;  4AJ6 A;  2UZ8 A;  5ID2 A;  1QGV A;  1A23 A;  1CQG A;  2GTU A;  1YEP A;  5FHI A;  4CY6 A;  2OJL A;  3WT2 A;  3D6I A;  3S9F A;  2LV3 A;  3GNJ A;  1TP9 A;  2NVL A;  4HS1 A;  5EPF A;  1GH2 A;  1YY7 A;  5ID2 B;  4L5O A;  3W8S A;  4XHM A;  4ZB6 A;  4I2T A;  1NHY A;  2D2Z A;  4O7H A;  3ZVJ A;  4V1A p;  1M2B A;  5IIZ A;  1W89 A;  3G9B A;  3EC3 A;  2KHP A;  4O5U A;  2HSN B;  4TOP A;  2F9S A;  4ECC A;  2HSY A;  3CRU A;  4E68 A;  1EGO A;  1HQO A;  2B6M A;  2P5Q A;  2QSI A;  3FRC A;  2O89 A;  3FKF A;  3IRA A;  5B7C A;  2DMM A;  3G7J A;  2HFD A;  4CW9 A;  3HVV A;  1AQW A;  3TCO A;  1ABA A;  2RII A;  4KE3 A;  4IGJ A;  1G6W A;  4WF4 A;  4KCA A;  2H6X A;  2L59 A;  2GQM A;  4PI0 C;  4N0Z A;  3ZRE A;  1I5G A;  5D9T A;  5B8A A;  1SD8 A;  3EPT A;  5A1N A;  5F05 A;  4X43 A;  4XS1 A;  3LQ7 A;  2FWH A;  4MAB A;  3ZRD A;  2LJA A;  5DAL A;  4G01 A;  1TU8 A;  4KX4 A;  3JCM L;  4KSM A;  4ZB8 A;  1TRV A;  2ZNM A;  2PU9 C;  3C7M A;  3NOF A;  2GLR A;  4HEA 2;  4OO5 A;  5A1N B;  1XG8 A;  3IAS 2;  3LG6 A;  3DYR A;  1FW1 A;  1VF2 A;  5DAL B;  22GS A;  5A34 A;  2GVP A;  1M3J A;  2X8G A;  4Q5N A;  3IBH A;  2VCV A;  3Q74 A;  4IHU A;  5DCH A;  5ENU A;  1GUH A;  5HFG A;  5A34 B;  6GSX A;  5F0G A;  5CRD A;  3F4T A;  20GS A;  5KOX A;  1PQN A;  1Z3E A;  5IMZ A;  1V2A A;  19GS A;  1WPI A;  5IPG A;  1EZK A;  3IR4 A;  4DSQ A;  4PI2 C;  4K5S A;  1PN9 A;  3SWL A;  2GZY A;  4GSS A;  6GSS A;  3QD9 A;  1THX A;  1T4Z A;  1M9B A;  3HMJ G;  1WJK A;  2VM1 A;  5AIX A;  1ERV A;  2X8H A;  5F8B A;  3ERW A;  4ECB A;  1GTA A;  4GQC A;  4BVX A;  4TXO B;  1ON4 A;  2YZH A;  1N25 A;  3GV1 A;  4N30 A;  8GSS A;  2GST A;  1SJ6 A;  1OC9 A;  2HLS A;  4IP6 A;  3QFB C;  4NAX A;  4OFM A;  5DAK A;  4LL4 B;  2B5E A;  3MIX A;  3P90 A;  1TXX A;  4P3Y B;  1PFO A;  1N2A A;  1O8W A;  3RAZ A;  5KEJ A;  1TJD A;  4RI6 A;  1QK8 A;  4TRX A;  3ZVJ D;  2O8V B;  5DAK B;  3WGE A;  2C0G A;  2MMA A;  2MBS A;  4HDE A;  1M99 A;  5H5S A;  1B9X C;  1EP7 A;  2VCQ A;  1M2A A;  2JSZ A;  1YEW C;  3A2X A;  4J56 E;  5CRG A;  4K2X A;  1GTB A;  5CAX A;  1ST9 A;  1YDK A;  2TRX A;  2WW3 A;  1Z9H A;  4USS A;  3D22 A;  2JU5 A;  4NV2 A;  1SVO A;  1JLV A;  6GSV A;  4L5L A;  4EIQ A;  5ECQ B;  3EU4 A;  1KNG A;  2CX4 A;  1JZD A;  2H6Z A;  1BG5 A;  1M3I A;  4PHZ C;  3DD3 A;  4N3Z A;  1B4Q A;  1K0M A;  2IPA A;  1XWK A;  3UAP A;  5HR0 A;  3BBY A;  1LU4 A;  3F3R A;  3SBC A;  1FVJ A;  3ZML A;  4PNG A;  1SVL A;  3EYT A;  2A2S A;  4MJB A;  3KH7 A;  5D9V A;  3IAM 2;  1T8E B;  6GSU A;  5IO2 A;  2YNX A;  4G0L A;  4EXJ A;  4G10 A;  4TR4 A;  3W8J A;  3EMX A;  3KJY A;  1TK8 B;  4W66 A;  5A4V A;  3FYG A;  1K0A A;  3CRT A;  2VIM A;  4WXT A;  2CAI A;  1E2Y A;  1XW5 A;  2HYX A;  4TR3 A;  2GDR A;  3ZIT A;  2V6K A;  2DJ3 A;  2REM A;  4I8B A;  3BOA A;  1GSD A;  2CT6 A;  1ERU A;  1K0O A;  2VAF A;  3R2Q A;  3F3Q A;  4IQ1 A;  2FLS A;  1Q98 A;  2C4J A;  1OKD A;  3GH6 A; 
#chains in the Genus database with same CATH homology
 4BL7 A;  3N5O A;  2OE0 A;  2CZ3 A;  3APS A;  3D21 A;  3QDN A;  4I2U A;  4XRA A;  4GQF A;  2RM6 A;  1X9W B;  2IFQ A;  1U3A A;  2I81 A;  1V40 A;  2OBK A;  5G1L A;  4HU9 A;  3LW9 A;  4TR0 A;  1EEM A;  4ID0 A;  2IFQ B;  3IDV A;  4AGS A;  4NXI A;  1MD3 A;  5IQY A;  1AAZ A;  3ERG A;  4HOJ A;  4EL1 A;  3HD5 A;  5B8B A;  1TXU A;  3KMN A;  2YN1 A;  2K6V A;  2B5Y A;  3HZ4 A;  2I3Y A;  1ZGN A;  3A2V A;  3F9U A;  3MNG A;  2B7K A;  4TR1 B;  3WT1 A;  5FT3 A;  2LRC A;  4HI7 A;  4QMK A;  1UA5 A;  1V98 A;  4GSN A;  3CBU A;  4ZIJ A;  4A5P A;  1F6M C;  5IMC A;  3HYP A;  4L0U A;  2HSH A;  5D9X A;  3DXB A;  2LJR A;  4X0X A;  3GTU A;  2A2P A;  4BA7 A;  3LWA A;  2L4C A;  1TK5 B;  2DJJ A;  3QAW A;  3KIJ A;  2E7P A;  2H66 A;  2NDO A;  4FQU A;  2YPM A;  2B1L A;  4AKI A;  4K8M A;  3KTL A;  1C72 A;  5DBQ A;  4KAE A;  2BJX A;  3PPU A;  1OC3 A;  5CRE A;  3TJG A;  4AKG A;  2R0G A;  4PQH A;  1YEX A;  4KH7 A;  1MDI A;  3G7Y A;  3KXO A;  3C1S A;  2FWF A;  4MK3 A;  2EIQ A;  3PR8 A;  1FOV A;  3CXG A;  3NIV A;  1BG1 A;  1YZX A;  2H73 A;  4D73 A;  3H8Q A;  3ISO A;  1O85 A;  1WP0 A;  4XTS A;  2GT6 A;  5CRW A;  3Q19 A;  2N5B A;  5IPH A;  2JSY A;  2M72 A;  4D73 B;  1EWX A;  3KMO A;  4OMV A;  5B6M A;  2H19 A;  2OAC A;  3FY7 A;  3EWL A;  1ML6 A;  1Z5Y E;  5H5Q A;  5JWQ B;  4Q5R A;  5INY A;  4BVY A;  1E6B A;  1XWA A;  4K5R A;  3RHB A;  1R4W A;  1O7U A;  4JR6 A;  5GST A;  3RHC A;  5LD0 A;  4MA9 A;  2YV9 A;  2QKE A;  2WRT A;  1JZO A;  4K7N A;  2CZ2 A;  2H0G A;  1PKW A;  4ZBD A;  4ILF A;  4BVY B;  3GL3 A;  1UVZ A;  5ELG A;  4Z7X A;  1OKT A;  2YAN A;  3QOU A;  4GRF A;  1O73 A;  1DUG A;  3UVT A;  4YAV A;  4NPB A;  3DWV A;  3P2A A;  3VLN A;  2GSS A;  1S3D A;  3TRX A;  2HRK A;  2K8V A;  1TU7 A;  3IC8 A;  4NV5 A;  4LMV A;  3LXT A;  3QAG A;  5IM9 A;  5DCG A;  5HQP A;  3LSZ A;  4ML6 A;  1O8X A;  2HRK B;  3VWU A;  2VKZ G;  5J41 A;  1F9M A;  2L57 A;  3DML A;  2AJQ B;  1GUK A;  3J7Y b;  2C3N A;  3EIN A;  3GL5 A;  2J9H A;  2L6D A;  4F2I A;  3VI7 A;  3A5I A;  1BX9 A;  5IMD A;  3KH9 A;  4WF5 A;  1R26 A;  3TDG A;  2VUP A;  3C1R A;  4E8E A;  2F8F A;  5AN1 A;  3Q6O A;  4J2F A;  3E9J B;  2R5G A;  2C0D A;  4IBP A;  2IN3 A;  3M1G A;  3TU3 B;  2UV8 G;  4AI6 A;  3TB2 A;  2PVO C;  5E59 A;  4PUR A;  5D9W A;  3RDW A;  3A2W A;  1XWG A;  4PQ1 A;  3VWV A;  1QMV A;  5JCU A;  1QFN A;  2R4V A;  3MSZ A;  2FUG 2;  2V6O A;  4EKZ A;  3TKQ A;  1HD2 A;  4YAP A;  3TRQ A;  5CO3 A;  4V1A g;  4DVC A;  2TIR A;  5COH A;  5G2Z A;  2WJU A;  4XRD A;  1ILO A;  2GQL A;  4YH2 A;  4FIW A;  2VCZ A;  11GS A;  3GYK A;  1M9A A;  3HXS A;  1O6J A;  1XZO A;  2ZUP A;  4J57 E;  1PX6 A;  5EL8 A;  3FW2 A;  2VCW A;  2CVD A;  4RQX A;  2K8S A;  2I1U A;  2GQK A;  1B48 A;  1WWJ A;  2HSM A;  2P0G A;  1EP8 A;  1MEK A;  3GN3 A;  5ECR B;  2LNT A;  2KUC A;  5ELA A;  4MMM A;  2X8C A;  2FD3 A;  3RPN A;  2HSM B;  4MLY A;  2O5V A;  1X5D A;  4E8H A;  1FOH A;  2MMO A;  3LOR A;  3CYN A;  4CHS A;  1XBS A;  4RI7 A;  3I69 A;  3M8N A;  1UC7 A;  1MTC A;  3CMI A;  3GUS A;  2CVK A;  3CSH A;  2NPB A;  4YKF A;  3HA9 A;  1B9Y C;  4IP1 A;  4WR5 A;  2IL3 A;  1EOH A;  6GSW A;  3E3E A;  1K3L A;  2R37 A;  2E2G A;  1TRS A;  3HZ8 A;  1XWB A;  2AAW A;  1SL2 B;  2PMT A;  4KUN A;  1U3I A;  4HU7 A;  4GLT A;  3F4S A;  1TI3 A;  1A8L A;  1SJZ A;  2H71 A;  2VL3 A;  3V1W A;  1GSS A;  4DSS A;  4IEL A;  3NZN A;  2DML A;  1F3B A;  3VI5 A;  1XVW A;  2EC4 A;  5IOX A;  4G0K A;  3GA4 A;  4FO5 A;  2WGR A;  5HFK A;  2ES7 A;  4DSS B;  1B8X A;  4GDF A;  2OAD A;  1OC8 A;  4F9Z A;  2DBC A;  1OAZ A;  3KM6 A;  2LKU A;  4XS6 A;  2YJ7 A;  3GFK A;  3UEM A;  5HFI A;  3GUR A;  4NHZ A;  4IQA A;  4JE1 A;  2JZS A;  1TOF A;  4ZBA A;  4BVX B;  4RUV A;  4O32 A;  4IW9 A;  3QFA C;  4MZC A;  2VLV A;  3R3E A;  1Y6E A;  3MAK A;  2H74 A;  1XOB A;  2FWE A;  4F82 A;  3FZ4 A;  2HZE A;  4JED A;  1OC9 B;  1XW6 A;  2LQQ A;  2DJK A;  5GAN D;  2L6C A;  1I9D A;  2H76 A;  3PIN A;  2PVQ A;  3F6D A;  3N9J A;  2VLT A;  2PPT A;  4OFN A;  1XXU A;  4FYB A;  3TJJ A;  4OCE A;  1OYJ A;  3W6G A;  4K0G A;  4LMW A;  5JWR B;  3KTB A;  4MJE A;  3TKP A;  1LJR A;  5DJM A;  2R2J A;  3L9V A;  2E0Q A;  4WBJ A;  5J9C A;  3IK9 A;  1X9M B;  1BED A;  3L78 A;  2LRT A;  4POM A;  4F0B A;  2PN8 A;  3FR6 A;  1N8J A;  2IMD A;  3IOS A;  2VM2 A;  1GUL A;  4TN8 A;  2VL9 A;  2O85 A;  3TOU A;  2C1Y A;  3TJK A;  1KEB A;  3GIX A;  4MPG A;  3DVX A;  4O5R A;  1ZL9 A;  2B7J A;  3C8E A;  4ECI A;  2ZCT A;  2YV7 A;  1TRW A;  2K9F A;  2LQO A;  2GSQ A;  1QQ2 A;  2PUK C;  3UBK A;  1SK0 A;  3KP9 A;  1Z7P A;  4MZB A;  2C0E A;  2LNS A;  5IMF A;  4IJI A;  3TUE A;  5IOW A;  4EO3 A;  2KOK A;  3G7I A;  1T00 A;  2R3X A;  4ZL8 A;  3DIE A;  2BTO T;  5DVB A;  1VF4 A;  4IVF A;  3HDC A;  3UAR A;  4WKW A;  3H79 A;  2JL4 A;  5D93 A;  5CRH A;  4G2E A;  2VOC A;  2IMF A;  3QAV A;  2PBJ A;  4MDC A;  3CWG A;  2B1K A;  1T7P B;  5A5H A;  12GS A;  1YKA A;  2G0F A;  4PUA A;  4WEY A;  5FWG A;  2HRN A;  3C71 A;  3TJB A;  2L4Q A;  3EMP A;  3FZ9 A;  5A5H B;  2H30 A;  4JU5 A;  4OFT A;  2F3M A;  1EV9 A;  4V2N A;  1AC1 A;  2RLI A;  3EVI A;  2IJY A;  2YWM A;  4FH8 A;  2IMI A;  4PXO A;  2DKI A;  3GX8 A;  2EFE A;  2CVB A;  2H1D A;  3IE3 A;  2DJ2 A;  1EEJ A;  1H75 A;  1Z6M A;  4IN0 A;  2O87 A;  4EUY A;  4MF6 A;  5D96 A;  2WFC A;  2MYG A;  2ON5 A;  4Q5Q A;  4BL7 B;  3IXR A;  3VWW A;  5ECK B;  5A4U A;  5G30 A;  3GX0 A;  5ECM B;  2Z9S A;  2IME A;  3HJP A;  1GL8 A;  1NM3 A;  3FK8 A;  3VPQ A;  1M2D A;  3VWX A;  2MZC A;  2MMZ A;  4EDY A;  3KP8 A;  3F0I A;  2RUE A;  1AQV A;  4POK A;  4TXV A;  5ECI B;  3CSJ A;  4V2M A;  2DJ0 A;  2LST A;  2GS3 A;  3D4M A;  4GXZ A;  1IYH A;  2X4A A;  4QL9 A;  3TKS A;  1THO A;  2LEG A;  2EFC A;  2J23 A;  5GSS A;  1VGL A;  2YWI A;  5ECP B;  5A5K A;  1AUC A;  3HVX A;  2PGT A;  4KND A;  4OO4 A;  5ECS A;  2HI7 A;  3C73 A;  1JZR A;  2EFH A;  4DEJ A;  1Y25 A;  2KP1 A;  2C3Q A;  3L0H A;  5DJL A;  2LTK A;  1YQ1 A;  3GTU B;  2CV4 A;  2I9H A;  4GWR A;  4JRR A;  4K7I A;  3H4K A;  4H86 A;  1ERW A;  4GST A;  4ZB7 A;  1RK4 A;  1FAA A;  1GSQ A;  5J40 A;  3DVW A;  4X1U A;  1ZYP A;  4MJA A;  3LFL A;  1NHO A;  4FYC A;  1HNB A;  1URM A;  1GSY A;  3ME7 A;  3EE2 A;  1XOA A;  2YWN A;  4EVM A;  1BAY A;  3FR9 A;  4MPF A;  2DIZ A;  4O5Q A;  3O3T A;  5IMV A;  4PNF A;  3F6F A;  2VL2 A;  3KEB A;  4G0I A;  4NMU A;  1GP1 A;  4Q5F A;  3ZFB A;  2H1A A;  2R0P A;  2YCD A;  1QUW A;  1BYE A;  4TVE A;  3BCI A;  5F07 A;  5H5R A;  3GMF A;  2EIR A;  2RM5 A;  3IA1 A;  2QC7 A;  5DQY A;  1GNE A;  2N5A A;  2F8A A;  1YF0 A;  4K2D A;  2XPD A;  4EIP A;  2H8L A;  2WZ9 A;  3UJ1 A;  1GNW A;  3DKS A;  2XHF A;  5AGY A;  2FA8 A;  2RUF A;  3IHQ A;  4ICY A;  2GZP A;  1PD2 1;  3VPT A;  3BJ5 A;  1ZCP A;  4ZXG A;  1V57 A;  3MDK A;  4XS4 A;  1A2L A;  4KF9 A;  1SKR B;  1A2J A;  2VD0 A;  2DKH A;  1GTI A;  3MWH A;  3LYK A;  3GKN A;  4LLR A;  3DEX A;  6GST A;  2FHE A;  4PQI A;  3ZL5 A;  3ME8 A;  3BCK A;  1NSW A;  1PA3 A;  5G1K A;  3LEF A;  1X5C A;  4HUA A;  1JHB A;  6GSY A;  5EVO A;  2OE1 A;  1Q4J A;  2VLU A;  3GSS A;  3GRX A;  2MBT A;  2WDU A;  3RPP A;  2HXK A;  5C00 A;  1T3B A;  1TRU A;  2FGX A;  4G9H A;  2O7K A;  2GSR A;  2YOI A;  2HZF A;  2PER A;  1ZYQ B;  3Q18 A;  4BWQ A;  4Z2R A;  4F0C A;  3KZQ A;  4MNN A;  1XW9 A;  1FHE A;  3H1N A;  3RBT A;  2BMX A;  3L4N A;  2AUV A;  2CX3 A;  4KB3 A;  2VCX A;  1TTZ A;  5IO0 A;  1T4Y A;  1M7T A;  3LYP A;  1MDK A;  2KLX A;  2X64 A;  1PMT A;  4MF5 A;  3HY2 A;  4OCF A;  2H70 A;  3J7Y k;  2HNL A;  5D73 A;  4X4J A;  1GSU A;  3D0Z A;  4AKH A;  1U87 A;  4GCI A;  4MH3 A;  3U5R E;  2IMK A;  4BWS A;  4L8E A;  4K1F A;  5GAP D;  1PL2 A;  4OWY A;  5D8I A;  4MCU A;  1J0F A;  4ZB9 A;  3TGZ A;  4MF7 A;  14GS A;  4MH2 A;  3ED3 A;  5J3R A;  1DE2 A;  2JZT A;  1WIK A;  3I9V 2;  4ZIL A;  3TJF A;  1HNA A;  2LS5 A;  2HSN A;  1GWC A;  3HKR A;  1W4V A;  2V1M A;  4GTU A;  3IHG A;  5ECH B;  2H0H A;  2OE3 A;  1EOG A;  4YQM A;  1ZOF A;  3ERF A;  4JBB A;  1BQ7 A;  3DRN A;  2YP6 A;  1OVN A;  4ZL7 A;  2H1G A;  2PWJ A;  2K18 A;  2LRN A;  1AQX A;  3UMA A;  1S3A A;  5CNW A;  1KBN A;  4DSR A;  1G0T A;  2V32 A;  1FVK A;  3US3 A;  5BMU A;  3GH9 A;  1EGR A;  2NTO A;  1MD4 A;  3VUR A;  4HJM A;  2QA1 A;  4WET A;  2FY6 A;  3QMX A;  5BMU B;  3IC4 A;  1FO5 A;  18GS A;  3H93 A;  4EC0 A;  3TOT A;  1PRX A;  1SEN A;  4V2L A;  3FZA A;  4RQR A;  3D4T A;  1VF1 A;  1X5E A;  5KN3 A;  1YF1 A;  3OR5 A;  5CP1 A;  1R5A A;  1YJ6 A;  4ISD A;  4I97 A;  1SVM A;  4TKY A;  1R7H A;  1GLP A;  1F37 A;  2JAC A;  5JWO B;  5KN2 A;  4WBR D;  1V58 A;  2WCI A;  3ZMK A;  1YVL A;  5A4W A;  5HR1 A;  2CQ9 A;  4L0W A;  4HJ2 A;  2YJH A;  5HR3 A;  1U6T A;  4TXO A;  3M9K A;  1G7O A;  3CTF A;  3I43 A;  1K3O A;  1SK1 A;  2AB6 A;  2C3T A;  4ZL9 A;  3M3M A;  2CAQ A;  1HNC A;  2R0C A;  5B6N A;  4KDU A;  3IV4 A;  3D5J A;  3GKX A;  3QPM A;  2HQT A;  2H75 A;  4FYU A;  1WRY A;  2TRC P;  1WMJ A;  1LBK A;  1XVQ A;  3A3T A;  4I5Q A;  3VFI A;  4YQU A;  4Z2T A;  1PX7 A;  1A0R P;  5KN1 A;  2HZE B;  1VRS D;  2L5O A;  2I4A A;  2H1L A;  4G19 A;  5J4V A;  4HZ4 A;  1KTE A;  5G5E A;  1PL1 A;  4PGT A;  1U88 A;  1K3Y A;  3EU3 A;  4IJ3 A;  4HZ2 A;  4ULX A;  3KCM A;  2AYT A;  4IS0 A;  2P5R A;  2B3S A;  1UN2 A;  2H01 A;  3HHV A;  2VD1 A;  2XBQ A;  5AIS A;  5G5F A;  3TRP A;  1XCC A;  1YKC A;  3I6A A;  4HQZ A;  2GT5 A;  1R5P A;  4LA1 A;  4KDX A;  5DQS A;  2HT9 A;  1SD9 A;  4ECJ A;  2FCH A;  4AF2 A;  1SKW B;  1PN0 A;  2X49 A;  1J08 A;  5EY6 A;  1EV4 A;  3P7X A;  1CQH A;  4AJ7 A;  4QQ7 A;  1XFL A;  4N11 A;  2JAD A;  1A2M A;  4EF0 A;  1OE8 A;  1A0F A;  1WE0 A;  4KA0 A;  2HE3 A;  5ECN B;  2XPE A;  3ZZX A;  3APO A;  1ZZY A;  1IYI A;  1NW2 A;  9GSS A;  3WGD A;  2WB9 A;  1A8Y A;  2P31 A;  1TK0 B;  4NHW A;  4OD7 A;  2XC2 A;  3TKS C;  5J4Y A;  4JZQ A;  3P8W A;  3LGC A;  2XBI A;  1GTU A;  2M80 A;  2VCT A;  1JLW A;  2OT3 A;  5J9B A;  4EE0 A;  4MJC A;  1V9W A;  1GLQ A;  1K0N A;  1XWC A;  3FEU A;  2V41 A;  2DSA A;  3KD0 A;  5G31 A;  1VF3 A;  1T1V A;  3M0F A;  3BD2 A;  4GF0 A;  3F4R A;  1Z6N A;  2L5L A;  2LUS A;  1M0U A;  4O92 A;  1AW9 A;  3ZIJ A;  1GSE A;  5C04 A;  4PX1 A;  2C80 A;  4K7O A;  2DC5 A;  2DJ1 A;  3FZ5 A;  2H0I A;  2FNO A;  2VO4 A;  2QGV A;  4MZW A;  1RQM A;  1FG4 A;  2F51 A;  5ECL B;  3U6V A;  2A2R A;  3EUR A;  3IK7 A;  1B4P A;  17GS A;  7GSS A;  5J5N A;  3ZLP A;  2NBS A;  2AHE A;  5LCZ A;  2YZU A;  5KOW A;  2VL2 C;  2EIO A;  4IKH A;  1AIU A;  2QA2 A;  1A24 A;  3O6T A;  3UOM A;  5E4W A;  4CY8 A;  4ZBB A;  5F06 A;  2ALB A;  1SKS B;  2LJK A;  1G6Y A;  4TR1 A;  1GUM A;  3GKM A;  1JZW A;  1F3A A;  4KCE A;  3LJR A;  1TI1 A;  4MP4 A;  5AIV A;  1GRX A;  2DIY A;  1ACV A;  3F63 A;  1K0D A;  3GHA A;  3QR6 A;  4KGI A;  3HCZ A;  1DE1 A;  10GS A;  3WD6 A;  4PUF C;  5GZZ B;  2FA4 A;  5IMA A;  1SYX A;  2B5X A;  4NWY A;  3AY8 A;  1GSF A;  3FHK A;  1S3C A;  4WR4 A;  1XIY A;  1O81 A;  3A5W A;  2WS2 A;  2GZZ A;  4F03 A;  4YKG A;  3UBL A;  2IIY A;  2GGT A;  2A4V A;  1X0R A;  4ACS A;  2YWO A;  4KDY A;  1PKZ A;  1JFU A;  2H72 A;  4XIH A;  3MYD A;  4KSO A;  4K0N A;  3GST A;  2G2Q A;  2H1B A;  3PH9 A;  3TKS E;  3UIW A;  2X99 A;  2OBI A;  1FB6 A;  2DLX A;  4ML1 A;  3HJM A;  1SK2 A;  2WUL A;  2EFD A;  3F8U A;  2C8U A;  2E2M A;  4XCS A;  1ERT A;  4POL A;  2OA7 A;  5J4U A;  2IWT A;  3CSI A;  3QCP A;  1SYR A;  5ABR A;  4TW5 A;  3APQ A;  5HR2 A;  3M9J A;  1RW1 A;  2HRA A;  5LNK e;  1F2E A;  4KW6 A;  5JCW A;  1PSQ A;  2H6Y A;  2M46 A;  1Y1U A;  1BF5 A;  1ZMA A;  3K8N A;  5BRT A;  1TKD B;  4YQV A;  2JZR A;  5JCG A;  1TW9 A;  3KGK A;  3O76 A;  4QL7 A;  1Z7R A;  1AXD A;  2ON7 A;  5ECO B;  1H4O A;  16GS A;  2C0F A;  1ZYN A;  2N5F A;  3E0U A;  4XS4 B;  1DBY A;  4POB A;  1K0B A;  3PGT A;  3LXZ A;  4K6X A;  1FB0 A;  1SU9 A;  4HQS A;  1BJX A;  1X9S B;  3ZTL A;  3ZYW A;  5J47 A;  2V2G A;  2HRF A;  3DGQ A;  3WYW A;  4N10 A;  4JR4 A;  2KP2 A;  4AJ8 A;  1ZYE A;  3FR3 A;  1J9B A;  1USB A;  1QXH A;  2FWG A;  3IPZ A;  2CA8 A;  5DDL A;  4EDZ A;  3VK9 A;  3ZIV A;  3HVS A;  3UVH A;  3CTG A;  1K0C A;  4AKX B;  4LL1 B;  1XPV A;  3WGX A;  1TDI A;  4CDO A;  1DSB A;  13GS A;  2A4H A;  1MDJ A;  4I6X A;  1G7E A;  3L9U A;  1SJI A;  1PGT A;  4K9Z A;  4N0V A;  3TKR A;  1HYU A;  3UL3 A;  1SL1 B;  3ZFL A;  3GKK A;  2OKA A;  5KN0 A;  4Z2U A;  2MMN A;  3L9S A;  2R6K A;  4PTS A;  4BPY A;  1SL0 B;  2AV4 A;  1OE7 A;  3FMW A;  5L71 A;  5CYY A;  3HJO A;  1WOU A;  4AJ6 A;  2UZ8 A;  5ID2 A;  1QGV A;  1A23 A;  1CQG A;  2GTU A;  1YEP A;  5FHI A;  4CY6 A;  2OJL A;  3WT2 A;  3D6I A;  3S9F A;  2LV3 A;  3GNJ A;  1TP9 A;  2NVL A;  4HS1 A;  5EPF A;  1GH2 A;  1YY7 A;  5ID2 B;  4L5O A;  3W8S A;  4XHM A;  4ZB6 A;  4I2T A;  1NHY A;  2D2Z A;  4O7H A;  3ZVJ A;  4V1A p;  1M2B A;  5IIZ A;  1W89 A;  3G9B A;  3EC3 A;  2KHP A;  4O5U A;  2HSN B;  4TOP A;  2F9S A;  4ECC A;  2HSY A;  3CRU A;  4E68 A;  1EGO A;  1HQO A;  2B6M A;  2P5Q A;  2QSI A;  3FRC A;  2O89 A;  3FKF A;  3IRA A;  5B7C A;  2DMM A;  3G7J A;  2HFD A;  4CW9 A;  3HVV A;  1AQW A;  3TCO A;  1ABA A;  2RII A;  4KE3 A;  4IGJ A;  1G6W A;  4WF4 A;  4KCA A;  2H6X A;  2L59 A;  2GQM A;  4N0Z A;  3ZRE A;  1I5G A;  5D9T A;  5B8A A;  1SD8 A;  3EPT A;  5A1N A;  5F05 A;  4X43 A;  4XS1 A;  3LQ7 A;  2FWH A;  4MAB A;  3ZRD A;  2LJA A;  5DAL A;  4G01 A;  1TU8 A;  4KX4 A;  3JCM L;  4KSM A;  4ZB8 A;  1TRV A;  2ZNM A;  2PU9 C;  3C7M A;  3NOF A;  2GLR A;  4HEA 2;  4OO5 A;  5A1N B;  3IAS 2;  3LG6 A;  3DYR A;  1FW1 A;  1VF2 A;  5DAL B;  22GS A;  5A34 A;  2GVP A;  2X8G A;  4Q5N A;  3IBH A;  2VCV A;  3Q74 A;  4IHU A;  5DCH A;  5ENU A;  1GUH A;  5HFG A;  5A34 B;  6GSX A;  5F0G A;  5CRD A;  3F4T A;  20GS A;  5KOX A;  1PQN A;  1Z3E A;  5IMZ A;  1V2A A;  19GS A;  1WPI A;  5IPG A;  1EZK A;  3IR4 A;  4DSQ A;  4K5S A;  1PN9 A;  3SWL A;  2GZY A;  4GSS A;  6GSS A;  3QD9 A;  1THX A;  1T4Z A;  1M9B A;  3HMJ G;  1WJK A;  2VM1 A;  5AIX A;  1ERV A;  2X8H A;  5F8B A;  3ERW A;  4ECB A;  1GTA A;  4GQC A;  4BVX A;  4TXO B;  1ON4 A;  2YZH A;  1N25 A;  3GV1 A;  4N30 A;  8GSS A;  2GST A;  1SJ6 A;  1OC9 A;  2HLS A;  4IP6 A;  3QFB C;  4NAX A;  4OFM A;  5DAK A;  4LL4 B;  2B5E A;  3MIX A;  3P90 A;  1TXX A;  4P3Y B;  3RAZ A;  1N2A A;  1O8W A;  5KEJ A;  1TJD A;  4RI6 A;  1QK8 A;  4TRX A;  3ZVJ D;  2O8V B;  5DAK B;  3WGE A;  2C0G A;  2MMA A;  2MBS A;  4HDE A;  1M99 A;  5H5S A;  1B9X C;  1EP7 A;  2VCQ A;  1M2A A;  2JSZ A;  3A2X A;  4J56 E;  5CRG A;  4K2X A;  1GTB A;  5CAX A;  1ST9 A;  1YDK A;  2TRX A;  1Z9H A;  4USS A;  3D22 A;  2JU5 A;  4NV2 A;  1SVO A;  1JLV A;  6GSV A;  4L5L A;  4EIQ A;  5ECQ B;  3EU4 A;  1KNG A;  2CX4 A;  1JZD A;  2H6Z A;  1BG5 A;  3DD3 A;  4N3Z A;  1B4Q A;  1K0M A;  2IPA A;  1XWK A;  3UAP A;  5HR0 A;  3BBY A;  1LU4 A;  3F3R A;  3SBC A;  1FVJ A;  3ZML A;  4PNG A;  1SVL A;  3EYT A;  2A2S A;  4MJB A;  3KH7 A;  5D9V A;  3IAM 2;  1T8E B;  6GSU A;  5IO2 A;  2YNX A;  4G0L A;  4EXJ A;  4G10 A;  4TR4 A;  3W8J A;  3EMX A;  3KJY A;  1TK8 B;  4W66 A;  5A4V A;  3FYG A;  1K0A A;  3CRT A;  2VIM A;  4WXT A;  2CAI A;  1E2Y A;  1XW5 A;  2HYX A;  4TR3 A;  2GDR A;  3ZIT A;  2V6K A;  2DJ3 A;  2REM A;  4I8B A;  3BOA A;  1GSD A;  2CT6 A;  1ERU A;  1K0O A;  2VAF A;  3R2Q A;  3F3Q A;  4IQ1 A;  2FLS A;  1Q98 A;  2C4J A;  1OKD A;  3GH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...