5A5KA

Atgstf2 from arabidopsis thaliana in complex with camalexin
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
210
Chain Sequence
GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE F2
publication title Structural evidence for Arabidopsis glutathione transferase AtGSTF2 functioning as a transporter of small organic ligands.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 81
structure length 210
sequence length 210
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a5kA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5a5kA01
4QL9A 4EE0A 4I97A 4TN8A 2NDOA 3A2WA 4YQMA 3IV4A 4LA1A 5KN3A 1X0RA 2XBQA 2HSYA 2HXKA 3L9SA 3TKSA 2PGTA 4GSSA 3J7Yb 3KMOA 5F05A 4ZL8A 1K0NA 5A4VA 3ZLPA 4IP6A 4POKA 4GCIA 1BEDA 2EC4A 1G0TA 4IGJA 11GSA 3NOFA 5DJLA 4PNGA 2KUCA 4HU9A 3IC8A 5EPFA 2HRKA 4JEDA 2QKEA 1NHOA 3E9JB 5IMFA 5DVBA 1R4WA 1XXUA 4HOJA 4WR4A 3IHQA 3O6TA 2X8HA 1YQ1A 3CTFA 4N30A 2EIOA 3GMFA 1EV4A 1OE8A 3LFLA 3ZIJA 1NW2A 4DVCA 3TB2A 2PVOC 5GSSA 1U3AA 4MF7A 2A2RA 4KDUA 3HVXA 1FW1A 1K3YA 2E0QA 3WGDA 3TUEA 2FY6A 1XFLA 3UAPA 3VWWA 2VCWA 1VF4A 3HJPA 2IWTA 4JU5A 2R5GA 4HZ4A 2JL4A 2H30A 1JHBA 3TKQA 1AXDA 3VPTA 1B9YC 4XCSA 3TGZA 4KAEA 3G9BA 3CSHA 2H01A 3DYRA 3LGCA 2TIRA 3DD3A 2K6VA 1OC9A 3DVWA 1ZCPA 5AISA 3CRUA 1WIKA 3BD2A 1A8YA 2IJYA 4GTUA 3WT1A 5L71A 3F0IA 4IP1A 1TTZA 2D2ZA 2DBCA 2MMOA 4BPYA 2GQMA 4V2MA 1SL2B 5ENUA 4IQAA 2WZ9A 3C73A 1X5CA 1AW9A 2NTOA 2GZZA 1FAAA 2GQLA 3KH7A 1XW9A 5KN1A 3QAVA 5CRGA 3APQA 2DMMA 4EC0A 1SYXA 3OR5A 1OE7A 5AGYA 3CMIA 1HD2A 5D8IA 2M46A 3AY8A 1V58A 4E8HA 3TOUA 3DRNA 3QPMA 1WOUA 5JCUA 4I6XA 1CQGA 5ID2B 2GT5A 4PURA 2KLXA 2YV7A 2E7PA 4GQFA 3RHCA 1ZL9A 1O8XA 5HR0A 1GSDA 1VF2A 1EEMA 2LUSA 5HFKA 1E2YA 1GRXA 1JZOA 5HR2A 4HU7A 4YQUA 4D73B 3QMXA 1M2DA 1UN2A 1TRVA 2H73A 3APSA 2FWGA 1PQNA 5J9CA 4J56E 5F06A 4MH2A 1T7PB 5DDLA 1XWCA 3VPQA 4EUYA 1QQ2A 4MPGA 3UOMA 1GH2A 1IYIA 2H6XA 4OFMA 2GSRA 4N0VA 1VRSD 3WGXA 1THXA 1O81A 1B9XC 3GSTA 4RI7A 3CRTA 1HQOA 4DSQA 2I81A 5G30A 3M1GA 4XIHA 4XHMA 1RW1A 1I5GA 2N5BA 2K9FA 3RDWA 1XZOA 1HNBA 1DE2A 2AHEA 3ED3A 3EC3A 5HR1A 5IOWA 1T3BA 2C3NA 5ECKB 3J7Yk 4K0GA 4L5LA 1H75A 1ERUA 1R5AA 1V2AA 3UJ1A 1NSWA 1GSSA 4F2IA 16GSA 1ST9A 4EDZA 3DVXA 2VL2A 1S3DA 3HYPA 4PTSA 1R5PA 5HQPA 4L5OA 5D73A 4LLRA 1OC3A 5DQSA 1Z7PA 4RQRA 3QFBC 3GHAA 2MZCA 1ZMAA 4NPBA 3E0UA 1X9MB 1Z6MA 2WB9A 2B5EA 3VWUA 4POLA 4ZL9A 2CAQA 5AN1A 5ECLB 7GSSA 4KNDA 2RUFA 4YQVA 2F9SA 1AQVA 2PU9C 4MLYA 1AAZA 1E6BA 20GSA 2IMDA 1SKSB 3ISOA 1B4PA 5HR3A 1GLPA 4KDYA 2H71A 3W8JA 4Q5QA 3D5JA 5IQYA 1N8JA 3N9JA 1TRUA 2OJLA 3A5WA 1GP1A 5B7CA 1SJ6A 1B4QA 5IMAA 2YV9A 4LL4B 3CTGA 2IL3A 4JE1A 4KGIA 3C1SA 2DIZA 4BVYA 3TKSC 1PX6A 3KEBA 1GNEA 1ABAA 2JZTA 4V1Ap 2P5QA 4POBA 1ZYQB 1TI1A 2H1AA 1MDKA 1PGTA 3GX8A 1TK8B 1XW6A 4MZCA 3G7JA 4MF6A 1GULA 1OVNA 2KOKA 5CREA 1JFUA 1SJIA 2YWNA 2VCTA 2DIYA 3TKPA 3HCZA 5ECRB 4ZB6A 3HJOA 4KB3A 4ACSA 1U3IA 3CXGA 3M8NA 1SKRB 5ECQB 2VCZA 3QR6A 1YDKA 1PRXA 3IR4A 3F63A 3U6VA 3FR3A 1PA3A 3DGQA 4GRFA 4K7NA 3F3RA 1FO5A 3A2XA 1A24A 1TXXA 3GNJA 5IMDA 3H1NA 1DE1A 1CQHA 3NIVA 2AV4A 5ECPB 5FT3A 1J08A 2ZNMA 4OCEA 1TW9A 3VWVA 1ILOA 2AAWA 2VOCA 5JWRB 1V9WA 3L9VA 4FYBA 1GTIA 4KDXA 4ZBDA 2LJRA 2O85A 4HQSA 5B6NA 2HE3A 1KTEA 3VURA 2H76A 1VF1A 1SENA 4IS0A 2RM6A 4BWSA 4KH7A 4BVXB 2G2QA 2H1BA 3F6FA 1FVKA 4FH8A 4PUFC 1SK1A 3CYNA 4YAPA 3APOA 1UVZA 2XPEA 4KW6A 4J57E 1UC7A 1TRSA 2HI7A 3KJYA 2IMKA 4OCFA 2HRAA 3US3A 3IXRA 3W6GA 1TDIA 1BQ7A 5CP1A 1GNWA 1YF1A 2WRTA 1ZZYA 4NHWA 5FHIA 2LJKA 1YEXA 4XS6A 1SU9A 4G0KA 2H72A 4L0UA 3GKNA 4WF5A 5D9XA 3GH6A 4DSSB 1I9DA 3L78A 1A8LA 1YEPA 3W8SA 4MZWA 2FWHA 3HKRA 4BWQA 4N11A 4TR1B 2I3YA 3M0FA 9GSSA 1A2MA 3DKSA 1K0DA 4OO4A 4Z7XA 2I4AA 2K8SA 4IJIA 2F8AA 3F4SA 1B8XA 1UA5A 4DSRA 2KP2A 2R37A 3HDCA 3PPUA 1K0CA 1OYJA 1O8WA 2JACA 4PXOA 2I1UA 3D0ZA 1XVQA 2IMEA 3MWHA 4GQCA 1X9WB 5J4UA 2YOIA 2AB6A 3P7XA 3VI7A 2R2JA 3K8NA 4NWYA 2E2GA 4L8EA 4NXIA 4I5QA 2H1DA 4MDCA 4X1UA 2QC7A 2H6YA 1GUMA 4NAXA 4BVYB 1IYHA 1XWAA 1XPVA 2B3SA 3KXOA 1T00A 2LQQA 3TRPA 5IMZA 5DBQA 2GZPA 1GSEA 2ZUPA 2DC5A 3FEUA 1V40A 2RM5A 3M3MA 4OO5A 5EVOA 2CV4A 3ZFLA 2LV3A 3QCPA 3FKFA 2VCXA 3D4TA 1ZGNA 4ZB9A 1FG4A 4OFTA 2V2GA 4TRXA 2FWFA 5ABRA 3EURA 5AIXA 2YANA 2PERA 5JWQB 4F0CA 3E3EA 3BBYA 3MDKA 1SL0B 5J5NA 4L0WA 2MMNA 5IM9A 5KN2A 1BJXA 4ZBBA 3LYKA 4MA9A 2OE1A 5C04A 2BTOT 2IN3A 2B5YA 3G7YA 3IOSA 4I2UA 3IBHA 3TJGA 4IQ1A 2HNLA 2O87A 1AUCA 4NV2A 4TR3A 3RBTA 1JZRA 2PMTA 3D6IA 3GFKA 5DCHA 2LKUA 1PX7A 5H5SA 5LCZA 4FQUA 4HJ2A 5GZZB 1U88A 2OE0A 4MJCA 4QL7A 5ECMB 5ECOB 2H6ZA 1B48A 3Q19A 1ML6A 3S9FA 2WJUA 1K0AA 2VD1A 2B6MA 2DJ3A 2R3XA 1PN9A 1KNGA 3GRXA 2YP6A 3U5RE 4E8EA 4PQHA 4HDEA 1AC1A 1A23A 22GSA 4YH2A 5H5RA 2FLSA 1K3LA 5DJMA 5E59A 3GA4A 3CBUA 2BMXA 3KCMA 2HRFA 3DXBA 5GSTA 3VK9A 6GSVA 1QK8A 2P5RA 1EZKA 1C72A 4ZILA 5E4WA 1TRWA 3IE3A 2C0DA 2O7KA 3ERGA 3L9UA 3EE2A 1TU8A 4KSOA 5G1KA 2B1LA 4KUNA 1YKAA 4F82A 3GL5A 5DALA 2C8UA 2LTKA 2FCHA 2DSAA 3GTUA 2P31A 2H1GA 2C1YA 3KZQA 1YKCA 1A0RP 1PSQA 2FA4A 2H0GA 4NV5A 4BVXA 3GUSA 4KSMA 4EDYA 3GKKA 2LJAA 3GSSA 3KGKA 1EOHA 5D9VA 3IRAA 1ERVA 1K3OA 2F8FA 3VFIA 3ZMKA 2MYGA 1GSYA 5IMCA 4EL1A 3TRXA 2VAFA 2CVKA 2VL9A 2TRXA 2VLUA 2GTUA 2R4VA 3H79A 10GSA 3C1RA 3I43A 4Q5RA 1RQMA 1SK2A 3QAWA 1A0FA 3FZAA 1F2EA 1BG5A 5ECHB 4MH3A 4DSSA 1M2AA 3BOAA 2VLVA 4OD7A 2FD3A 1BYEA 4JR6A 4TR1A 4AJ6A 2A2SA 1G7EA 5HFGA 5D96A 4PNFA 4IW9A 4IBPA 1Y6EA 4AJ8A 2L57A 5C00A 2VM2A 4OFNA 4Q5FA 4K6XA 3CSJA 2C80A 5F8BA 4XS4B 4G0LA 5B6MA 1JZDA 1WWJA 5CRHA 3GX0A 1O7UA 3KIJA 3UEMA 1DBYA 4G19A 4JRRA 1V98A 2GVPA 1M0UA 2XBIA 2E2MA 2GSTA 1FHEA 2VD0A 3A3TA 1XCCA 1PKWA 4WETA 4MJEA 4FYUA 1K0BA 3I6AA 1YZXA 2GDRA 2V6OA 4TOPA 2X8GA 4TW5A 3HY2A 3EMPA 4XTSA 2YWIA 2YJ7A 5GAPD 1Q98A 2O8VB 3HXSA 3HZ4A 3HVSA 2RIIA 3TJJA 2HYXA 5A5KA 3RPPA 2N5AA 1HNCA 1U87A 2KP1A 3FZ4A 3ZMLA 1PD21 1MDIA 4GSTA 2R6KA 4K7IA 3UMAA 4KCEA 3RAZA 4PX1A 2XPDA 3C8EA 3ERFA 2CT6A 2BJXA 2O89A 6GSXA 4WF4A 5D93A 3F3QA 3HA9A 4MCUA 2CX3A 2DJ0A 3TRQA 6GSSA 2GSSA 2F51A 5ECNB 2M72A 2J23A 3QDNA 3FK8A 2C0EA 2A4VA 4DEJA 3ZYWA 2VLTA 3Q6OA 3TDGA 3KD0A 2MBSA 5ECIB 4HS1A 5CO3A 1U6TA 3F4TA 1OKTA 1G6WA 4IN0A 3GH9A 1EGRA 2JU5A 1S3AA 3IA1A 2JADA 3RHBA 1GTBA 2WULA 1SL1B 3KH9A 3UVTA 2OBIA 4ZXGA 2GGTA 5DALB 4MABA 4WBJA 5DCGA 4EKZA 3FHKA 2OADA 1Y25A 1TP9A 2FNOA 3GTUB 3KTLA 2L4QA 1USBA 1XBSA 1OKDA 5HFIA 1FVJA 1V57A 1URMA 2N5FA 4G10A 4XRDA 2C4JA 2CA8A 2H8LA 2V1MA 2LEGA 3DMLA 4FYCA 5B8BA 2X8CA 4ZB8A 3UVHA 4EXJA 2ES7A 2OBKA 2FGXA 2JSYA 1T8EB 1DSBA 3JCML 1EEJA 2NBSA 3I69A 2K18A 3UARA 4X43A 2EIQA 1F3AA 2HZFA 4I2TA 3WGEA 2GLRA 2ALBA 3KTBA 4LMVA 1EWXA 1WP0A 1H4OA 3QD9A 5CNWA 2NVLA 4POMA 1WRYA 4Q5NA 1WJKA 3TKRA 5DAKB 3ERWA 2OACA 8GSSA 4MJBA 2YN1A 4V2NA 4WR5A 2YPMA 2PWJA 2DJ2A 2HQTA 1FB6A 1TKDB 1MEKA 4ECJA 5IIZA 4NHZA 4K7OA 4K8MA 1EV9A 1O73A 3IC4A 4FIWA 3G7IA 3KM6A 4ECIA 1Z5YE 2RLIA 1M9AA 1TJDA 3TOTA 1HYUA 4TR0A 1LU4A 1KBNA 2MMAA 2VO4A 1QGVA 2GSQA 1YY7A 2HT9A 2ON5A 1XWKA 4GSNA 2I9HA 2MMZA 2VM1A 1GSFA 3LG6A 3LJRA 4PQIA 2YWMA 1GTUA 1Z6NA 3P2AA 3QAGA 2HSMB 3ZITA 2DJKA 2LS5A 3FZ9A 5G5EA 3TKSE 3D4MA 2L5OA 4HEA2 3LQ7A 2OKAA 3DWVA 3O76A 5JCGA 4WXTA 1N2AA 1EP8A 1LJRA 3EVIA 3O3TA 1BAYA 3TJFA 2LQOA 3UL3A 2H70A 1M2BA 13GSA 1WPIA 1X5EA 3IK7A 1SYRA 3F6DA 2V32A 1THOA 3ZZXA 1W4VA 3FRCA 4WBRD 1HNAA 2VL2C 1SKWB 3LXZA 14GSA 2L6CA 3I9V2 1JLVA 1JZWA 1W89A 5J9BA 18GSA 3EYTA 5IO2A 1Z7RA 2XHFA 3ZREA 2MBTA 2K8VA 1TU7A 4GF0A 4G9HA 2H0HA 4JBBA 4XS4A 3GN3A 4TXOA 4HZ2A 5D9TA 3MAKA 2H19A 1QUWA 4ID0A 4O92A 2L6DA 5G5FA 3H93A 2REMA 1WE0A 3ZIVA 5CRDA 5A4UA 2QSIA 3SBCA 3C71A 2CZ2A 1FOVA 2WFCA 3LWAA 2P0GA 1PKZA 2JSZA 1SD9A 2TRCP 1TI3A 2L59A 3VI5A 3LXTA 3FR6A 1SD8A 2YZUA 2XC2A 5INYA 4USSA 5F0GA 1GUHA 3DIEA 2DLXA 4GXZA 2YCDA 5B8AA 4EF0A 1F3BA 3M9KA 3EU4A 1F6MC 1X5DA 3MSZA 4O7HA 2UZ8A 4ECBA 3A2VA 1R26A 3NZNA 5ELGA 3ZRDA 4TKYA 3IAS2 12GSA 1F9MA 3ME7A 4G2EA 2H75A 3BCKA 4K2DA 1GWCA 4N10A 2VUPA 1KEBA 2PUKC 3ZTLA 2RUEA 4QQ7A 4MZBA 5CYYA 5IPGA 6GSYA 2DJJA 3Q74A 5KN0A 1MTCA 3ZL5A 4CW9A 4WKWA 1GLQA 3H4KA 2LSTA 1AIUA 3EINA 3UIWA 1J0FA 4F03A 5IOXA 4BL7A 3DEXA 4KA0A 3FW2A 1T4ZA 4J2FA 1NHYA 2IFQB 4KCAA 2GQKA 2PVQA 1GTAA 1XW5A 4N0ZA 4O32A 4P3YB 2LRNA 2LNSA 3LSZA 4YAVA 4GLTA 1T4YA 2AUVA 4KE3A 2YNXA 6GSTA 1T1VA 5DQYA 2C3TA 3F4RA 4HJMA 3GKXA 1MDJA 1XOBA 1MD4A 2HZEB 2CVDA 1SK0A 4WEYA 4OMVA 4MJAA 2CVBA 3D22A 5ELAA 4CDOA 2LNTA 1YJ6A 3EU3A 4H86A 3R2QA 1SJZA 2WS2A 3FYGA 4MK3A 1Q4JA 3LORA 3F8UA 3RPNA 2CAIA 2FUG2 5GAND 4KF9A 4MPFA 3GYKA 2WCIA 1K0OA 5G31A 3HZ8A 3UBKA 6GSWA 2NPBA 4KX4A 2IPAA 3WD6A 1RK4A 2V6KA 3GKMA 2V41A 1QXHA 3VWXA 4MF5A 5DAKA 2VL3A 1M9BA 1ERWA 2H0IA 4RUVA 2CX4A 4ML1A 3GIXA 5LNKe 3IPZA 5EL8A 4AJ7A 1ON4A 4BA7A 3BJ5A 1M7TA 2JZSA 2HRKB 5CAXA 3M9JA 2KHPA 5IMVA 3GL3A 1EGOA 5G2ZA 4MMMA 2FA8A 4PGTA 4ISDA 1BX9A 3LYPA 6GSUA 3ZVJD 4TXOB 2JZRA 19GSA 4FO5A 4IHUA 1GSQA 3F9UA 3PH9A 3TCOA 1TK5B 1VGLA 1XWBA 2CQ9A 3GV1A 1NM3A 1PL1A 4EVMA 5LD0A 2B5XA 4LMWA 4TVEA 4RI6A 2HSMA 5COHA 5H5QA 1OAZA 4V2LA 3IK9A 1FB0A 3N5OA 3Q18A 1LBKA 2C3QA 2H74A 4IJ3A 1S3CA 5D9WA 2VCVA 3SWLA 2HLSA 3C7MA 2B7KA 1YF0A 2GZYA 4XS1A 2HSHA 3PINA 2IMFA 4ZL7A 4F9ZA 3PR8A 3HD5A 2L5LA 3D21A 2B1KA 2PN8A 4RQXA 1OC9B 1JLWA 2IMIA 5G1LA 1ACVA 4K1FA 3ZFBA 3R3EA 1X9SB 5AIVA 4NMUA 3VLNA 3TJKA 17GSA 4K0NA 2DJ1A 2ZCTA 4GWRA 3KP8A 3L4NA 4ZBAA 1DUGA 4AGSA 1GUKA 2HSNB 2HRNA 4OWYA 4AF2A 2VCQA 1G7OA 4EO3A 1A2JA 4ILFA 3KP9A 2F3MA 1M99A 3V1WA 3L0HA 4JZQA 1Z3EA 3MNGA 5JCWA 2GS3A 5CRWA 1ZOFA 4HQZA 5JWOB 5EY6A 4LL1B 2AYTA 4X0XA 1GL8A 2IIYA 1QMVA 3EWLA 4BL7B 1G6YA 2OA7A 2OE3A 3FR9A 5FWGA 1QFNA 4MP4A 4O5RA 3FY7A 4ECCA 1XIYA 1WMJA 3IDVA 4IKHA 3QFAC 4ML6A 5IO0A 1EP7A 2DMLA 2FHEA 1TOFA 4PQ1A 4HI7A 3P90A 2VIMA 2CZ3A 3WT2A 1VF3A 3WYWA 5J41A 4CHSA 4PUAA 5KEJA 1XOAA 4IELA 3P8WA 2GT6A 3QOUA 1R7HA 3FZ5A 2AJQB 1PMTA 1ZYEA 1F37A 3BCIA 2PBJA 3H8QA 1J9BA 2YZHA 4ZIJA 3TJBA 2EIRA 1ERTA 4HUAA 1O6JA 1AQXA 5A4WA 1XVWA 3LEFA 3HVVA 5ECSA 1O85A 2B7JA 2WDUA 3HJMA 2C0FA 2FWEA 5ID2A 3HHVA 1Z9HA 1K0MA 2HFDA 2IFQA 1AQWA 2QGVA 3ZVJA 2YJHA 2Z9SA 2ON7A 5J3RA 4G0IA 3GURA 2YWOA 3EMXA 2LRCA 4XRAA 4D73A 5F07A 4TR4A 4TXVA 3PGTA 1PL2A 2L4CA 4V1Ag 1OC8A 3CSIA 2HZEA 4IVFA 4ULXA 5IPHA 2WGRA 1MD3A 2H66A 2X64A 2M80A 2X99A 3IAM2 1XWGA 4I8BA 2PPTA 4K9ZA 2LRTA 3KMNA 2C0GA 4JR4A 1TK0B 2J9HA 1EOGA 1A2LA 1GSUA 4F0BA 3ME8A 3UBLA 5BMUA 2G0FA
chains in the Genus database with same CATH superfamily
4QL9A 4EE0A 3CHXC 4I97A 4TN8A 2NDOA 3A2WA 4YQMA 3IV4A 4LA1A 5KN3A 1X0RA 2XBQA 2HSYA 2HXKA 3L9SA 3TKSA 2PGTA 4GSSA 3J7Yb 1ZYPA 3KMOA 5F05A 2X49A 1PN0A 4ZL8A 1K0NA 5A4VA 3ZLPA 4IP6A 4POKA 4GCIA 1BEDA 2EC4A 1G0TA 4IGJA 4YKFA 11GSA 3NOFA 5DJLA 2OT3A 4PNGA 2KUCA 4HU9A 3IC8A 5EPFA 1PFOA 2HRKA 4JEDA 2QKEA 1NHOA 3E9JB 5IMFA 5DVBA 1R4WA 1XXUA 4HOJA 4WR4A 3IHQA 3O6TA 2X8HA 1YQ1A 3CTFA 4N30A 2EIOA 3GMFA 1EV4A 1OE8A 3LFLA 3ZIJA 1NW2A 4DVCA 3TB2A 2PVOC 5GSSA 1U3AA 4MF7A 2A2RA 4KDUA 3HVXA 1FW1A 1K3YA 2E0QA 3WGDA 3TUEA 2FY6A 2H1LA 1XFLA 3MYDA 3UAPA 3VWWA 2VCWA 1VF4A 3HJPA 4YKGA 2IWTA 4JU5A 2R5GA 4HZ4A 2JL4A 2O5VA 2H30A 1JHBA 3TKQA 1AXDA 3VPTA 1B9YC 4XCSA 3TGZA 2DKIA 4KAEA 3G9BA 3CSHA 2H01A 3DYRA 3LGCA 4HSCX 2TIRA 1M3IA 3DD3A 2K6VA 1OC9A 3DVWA 1ZCPA 5AISA 3CRUA 1WIKA 3BD2A 1A8YA 2IJYA 4GTUA 3WT1A 5L71A 3F0IA 4IP1A 1TTZA 2D2ZA 2DBCA 2MMOA 4BPYA 2GQMA 4V2MA 1SL2B 5ENUA 2WVYA 4IQAA 2WZ9A 5A34B 3C73A 1X5CA 2HSNA 1AW9A 2NTOA 2GZZA 1FAAA 2GQLA 3KH7A 1XW9A 5KN1A 3QAVA 5CRGA 3APQA 2DMMA 4EC0A 1SYXA 3OR5A 1OE7A 5AGYA 3CMIA 1HD2A 5D8IA 2M46A 3AY8A 1V58A 4E8HA 4AKIA 3TOUA 3DRNA 3QPMA 1WOUA 5JCUA 4I6XA 1CQGA 4X4JA 5ID2B 2GT5A 4PURA 2KLXA 2YV7A 2E7PA 4GQFA 3RHCA 1ZL9A 1O8XA 5HR0A 1GSDA 1VF2A 4Z2RA 1EEMA 2LUSA 5HFKA 1E2YA 1GRXA 1JZOA 5HR2A 4HU7A 4YQUA 4D73B 3QMXA 1M2DA 1UN2A 1TRVA 2H73A 3APSA 2FWGA 1PQNA 5J9CA 4J56E 5F06A 4MH2A 1T7PB 5DDLA 1XWCA 3VPQA 4EUYA 1QQ2A 4MPGA 2QA1A 1SVLA 3UOMA 1GH2A 1IYIA 2H6XA 4OFMA 2GSRA 4N0VA 1VRSD 3WGXA 1THXA 1O81A 1B9XC 3GSTA 4RI7A 3CRTA 1ZYNA 1HQOA 4DSQA 2I81A 5G30A 3M1GA 4XIHA 4XHMA 1RW1A 1I5GA 2N5BA 2K9FA 4CY8A 3RDWA 1XZOA 1HNBA 1DE2A 2AHEA 3ED3A 3EC3A 5HR1A 5IOWA 1T3BA 4PHZC 2C3NA 5ECKB 3J7Yk 4K2XA 4K0GA 4L5LA 1H75A 1ERUA 1R5AA 1V2AA 3UJ1A 1NSWA 1GSSA 4F2IA 4EIPA 16GSA 1ST9A 4EDZA 3DVXA 2VL2A 1S3DA 3HYPA 4PTSA 4FXYP 1R5PA 5HQPA 4L5OA 5D73A 4LLRA 1OC3A 5DQSA 1Z7PA 4RQRA 3QFBC 3GHAA 2MZCA 1ZMAA 4NPBA 3E0UA 1X9MB 1Z6MA 2WB9A 2B5EA 3VWUA 4POLA 4ZL9A 4PI0C 2CAQA 5AN1A 5ECLB 7GSSA 4KNDA 2RUFA 4YQVA 2F9SA 1AQVA 2PU9C 4MLYA 1AAZA 1E6BA 20GSA 2IMDA 1SKSB 3ISOA 1B4PA 5HR3A 1GLPA 4KDYA 2H71A 3W8JA 4Q5QA 3D5JA 5IQYA 1N8JA 3N9JA 1TRUA 2OJLA 3A5WA 1GP1A 5B7CA 1SJ6A 1B4QA 5IMAA 2YV9A 4LL4B 3CTGA 2IL3A 4JE1A 4CY6A 4KGIA 3C1SA 2DIZA 4BVYA 3TKSC 1PX6A 3KEBA 1GNEA 1ABAA 2JZTA 4V1Ap 2P5QA 4POBA 1ZYQB 1TI1A 2H1AA 1MDKA 1PGTA 1S4BP 3GX8A 1TK8B 1XW6A 4MZCA 3G7JA 4MF6A 1GULA 1OVNA 2KOKA 5CREA 1JFUA 1SJIA 2YWNA 4ICYA 2VCTA 2DIYA 3TKPA 3HCZA 5ECRB 4ZB6A 3HJOA 4KB3A 4ACSA 1U3IA 3CXGA 3M8NA 1SKRB 2R0CA 5ECQB 2VCZA 3QR6A 1YDKA 1PRXA 3IR4A 3F63A 3U6VA 4O5UA 3FR3A 1PA3A 3DGQA 4GRFA 4K7NA 3F3RA 1FO5A 3A2XA 1A24A 1TXXA 3GNJA 5IMDA 3EPTA 3H1NA 1DE1A 1CQHA 3NIVA 2AV4A 5ECPB 5FT3A 1J08A 2ZNMA 4OCEA 1TW9A 3VWVA 1ILOA 2AAWA 2VOCA 5JWRB 1N25A 1V9WA 3L9VA 4FYBA 1GTIA 4KDXA 4ZBDA 2LJRA 2O85A 4HQSA 5B6NA 2HE3A 1KTEA 3VURA 2H76A 1VF1A 5J4VA 1SENA 4IS0A 2RM6A 4BWSA 4KH7A 4BVXB 2G2QA 2H1BA 3F6FA 1FVKA 4FH8A 4PUFC 1SK1A 3CYNA 4YAPA 3CQFA 3APOA 1UVZA 2XPEA 4KW6A 4J57E 1UC7A 1TRSA 2HI7A 3KJYA 2IMKA 4OCFA 2HRAA 3US3A 3IXRA 3W6GA 1TDIA 1BQ7A 5CP1A 1GNWA 1YF1A 2WRTA 1ZZYA 4NHWA 5FHIA 2LJKA 1YEXA 4XS6A 2WW0A 1SU9A 4G0KA 2H72A 4L0UA 3GKNA 4WF5A 5D9XA 3GH6A 4DSSB 1I9DA 1A8LA 3L78A 1YEPA 3W8SA 4MZWA 2FWHA 3HKRA 4BWQA 4N11A 4TR1B 3RGBC 3M0FA 2I3YA 9GSSA 1A2MA 3DKSA 1K0DA 4OO4A 4Z7XA 2I4AA 2K8SA 4IJIA 2F8AA 3F4SA 1B8XA 1UA5A 5A5HB 4DSRA 2KP2A 2R37A 3HDCA 3PPUA 1K0CA 1OYJA 1O8WA 2JACA 4PXOA 2I1UA 3D0ZA 1XVQA 2IMEA 3MWHA 4GQCA 1X9WB 5J4UA 2YOIA 2AB6A 3P7XA 3VI7A 2R2JA 4Z2TA 3K8NA 3MIXA 4NWYA 2E2GA 4L8EA 4NXIA 4I5QA 2H1DA 4MDCA 4X1UA 2QC7A 2H6YA 1GUMA 4NAXA 4BVYB 1I1IP 1IYHA 1XWAA 1XPVA 2B3SA 3KXOA 1T00A 2LQQA 4Z2UA 3HVNA 3TRPA 5IMZA 5DBQA 2GZPA 1GSEA 2ZUPA 2DC5A 3FEUA 1V40A 2RM5A 3M3MA 4OO5A 5EVOA 2CV4A 3ZFLA 2LV3A 3QCPA 3FKFA 2VCXA 3D4TA 1ZGNA 4ZB9A 1FG4A 4OFTA 2V2GA 4TRXA 2FWFA 5ABRA 3EURA 5AIXA 2YANA 4K5SA 2PERA 5JWQB 4F0CA 3E3EA 3BBYA 2EFHA 3MDKA 1SL0B 5J5NA 4L0WA 2MMNA 5IM9A 5KN2A 1BJXA 4ZBBA 3LYKA 4MA9A 2OE1A 5C04A 2BTOT 2IN3A 2B5YA 3G7YA 3IOSA 4I2UA 3IBHA 3TJGA 4IQ1A 2O36A 2HNLA 2O87A 1AUCA 4NV2A 4TR3A 3RBTA 1JZRA 2PMTA 3D6IA 3GFKA 5DCHA 2LKUA 1PX7A 5H5SA 5LCZA 4FQUA 4HJ2A 5GZZB 1U88A 1M3JA 2OE0A 4MJCA 4QL7A 5ECMB 5ECOB 2H6ZA 1B48A 2R0PA 3Q19A 1ML6A 3S9FA 1BF5A 2WJUA 1K0AA 2VD1A 2B6MA 2DJ3A 2R3XA 1PN9A 1KNGA 1XG8A 3GRXA 2YP6A 3U5RE 4E8EA 4PQHA 4HDEA 2WW3A 1AC1A 1A23A 22GSA 4YH2A 5H5RA 2FLSA 1K3LA 5DJMA 5E59A 3GA4A 3CBUA 2BMXA 3KCMA 2HRFA 3DXBA 5GSTA 3VK9A 6GSVA 1QK8A 2P5RA 1EZKA 1C72A 4ZILA 5E4WA 1TRWA 3IE3A 2C0DA 2O7KA 3ERGA 3L9UA 3EE2A 1TU8A 4KSOA 5G1KA 2B1LA 4AI6A 4KUNA 1YKAA 4F82A 3GL5A 5DALA 2C8UA 2LTKA 2FCHA 2DKHA 2DSAA 3GTUA 2P31A 2H1GA 2C1YA 3KZQA 1YKCA 1A0RP 1PSQA 2FA4A 4MNNA 2H0GA 4NV5A 4BVXA 3GUSA 4KSMA 2EFDA 1YEWC 4EDYA 5BRTA 3GKKA 2LJAA 3GSSA 3KGKA 1EOHA 5D9VA 3IRAA 1ERVA 1K3OA 2F8FA 3VFIA 3ZMKA 2MYGA 1GSYA 3HMJG 4G01A 5IMCA 4EL1A 3TRXA 2VAFA 2CVKA 2VL9A 2TRXA 2VLUA 2GTUA 2R4VA 3H79A 10GSA 3C1RA 3I43A 4Q5RA 1RQMA 1SK2A 3QAWA 1A0FA 3FZAA 1F2EA 1BG5A 5ECHB 4MH3A 4DSSA 1SVOA 1M2AA 3BOAA 2VLVA 4OD7A 2FD3A 1BYEA 4JR6A 4TR1A 4AJ6A 2A2SA 1G7EA 5HFGA 5D96A 4PNFA 4IW9A 4IBPA 1Y6EA 5A5HA 4AJ8A 2L57A 5C00A 2VM2A 4OFNA 4Q5FA 4K6XA 4AKXB 3CSJA 2C80A 5F8BA 4XS4B 4G0LA 5B6MA 1JZDA 1WWJA 5CRHA 3GX0A 1O7UA 3KIJA 3UEMA 4BIKA 1DBYA 4G19A 4JRRA 1V98A 2GVPA 1M0UA 1S3RA 2XBIA 2E2MA 2GSTA 1FHEA 2VD0A 3A3TA 1XCCA 1PKWA 4WETA 2R0GA 4MJEA 4FYUA 1K0BA 3I6AA 1YZXA 2GDRA 2V6OA 4TOPA 2X8GA 3FMWA 4TW5A 3HY2A 3EMPA 4XTSA 2YWIA 2YJ7A 5GAPD 1Q98A 2O8VB 3HXSA 3HZ4A 3HVSA 2RIIA 3TJJA 2HYXA 5A5KA 3RPPA 2N5AA 1HNCA 1U87A 2KP1A 3FZ4A 3ZMLA 1PD21 1MDIA 4GSTA 2R6KA 4K7IA 4PI2C 4KCEA 3RAZA 4PX1A 3UMAA 2XPDA 3C8EA 3ERFA 2CT6A 2BJXA 2O89A 6GSXA 4WF4A 5D93A 3F3QA 3IHGA 3HA9A 4MCUA 2CX3A 2DJ0A 3TRQA 6GSSA 2GSSA 2F51A 5ECNB 2M72A 2J23A 3QDNA 3FK8A 2C0EA 5A1NA 2A4VA 4DEJA 3ZYWA 2VLTA 3Q6OA 3TDGA 3KD0A 2MBSA 5ECIB 4HS1A 5CO3A 1U6TA 3F4TA 1Y1UA 1OKTA 1G6WA 4IN0A 3GH9A 1EGRA 2JU5A 1S3AA 3IA1A 2JADA 3RHBA 1GTBA 2WULA 1SL1B 3KH9A 3UVTA 2OBIA 4ZXGA 2GGTA 5DALB 4MABA 4WBJA 5DCGA 4EKZA 3FHKA 2OADA 1Y25A 1TP9A 2FNOA 3GTUB 3KTLA 4AKGA 2L4QA 1USBA 1XBSA 1OKDA 5HFIA 1FVJA 1V57A 1URMA 2N5FA 4G10A 4XRDA 2C4JA 2CA8A 2H8LA 2V1MA 2LEGA 3DMLA 4E68A 4FYCA 5B8BA 2X8CA 4ZB8A 3UVHA 4EXJA 2A2PA 2ES7A 2OBKA 2FGXA 2JSYA 1T8EB 1DSBA 3JCML 1EEJA 2NBSA 3I69A 2K18A 3UARA 4X43A 2EIQA 1F3AA 3CWGA 2HZFA 4I2TA 3WGEA 2GLRA 2ALBA 3KTBA 4LMVA 1EWXA 1WP0A 1H4OA 3QD9A 5CNWA 2NVLA 3LW9A 4POMA 1WRYA 4Q5NA 1WJKA 3TKRA 4EIQA 5DAKB 3ERWA 2OACA 8GSSA 4MJBA 2YN1A 4V2NA 4WR5A 2YPMA 2PWJA 2DJ2A 2HQTA 1FB6A 1TKDB 1MEKA 4ECJA 5IIZA 4NHZA 4K7OA 4K8MA 1EV9A 1O73A 3IC4A 4FIWA 3G7IA 3KM6A 4ECIA 1Z5YE 2RLIA 1M9AA 1TJDA 3TOTA 3TU3B 2EFCA 1HYUA 4TR0A 1LU4A 1KBNA 2MMAA 2VO4A 1QGVA 2GSQA 5J40A 1YY7A 2HT9A 2ON5A 1XWKA 4GSNA 2I9HA 2MMZA 2VM1A 1GSFA 3LG6A 3LJRA 4PQIA 2YWMA 1GTUA 1Z6NA 3P2AA 3QAGA 2HSMB 3ZITA 2DJKA 2LS5A 3FZ9A 5G5EA 3TKSE 3D4MA 2L5OA 4HEA2 3LQ7A 2OKAA 3DWVA 3O76A 5JCGA 4WXTA 3RFRC 1N2AA 1EP8A 1LJRA 4O5QA 3EVIA 3O3TA 1BAYA 3TJFA 2LQOA 3UL3A 2H70A 1M2BA 13GSA 1WPIA 1X5EA 3IK7A 1SYRA 3F6DA 2VKZG 2V32A 1THOA 3ZZXA 1W4VA 3FRCA 4WBRD 1HNAA 2VL2C 1SKWB 3LXZA 14GSA 2L6CA 3I9V2 1JLVA 1JZWA 1W89A 5J9BA 18GSA 3EYTA 5IO2A 1Z7RA 2XHFA 3ZREA 2MBTA 2K8VA 1TU7A 4GF0A 4G9HA 2H0HA 4JBBA 4XS4A 3GN3A 4TXOA 4HZ2A 5D9TA 3MAKA 2H19A 1QUWA 4ID0A 5A1NB 4O92A 2L6DA 5G5FA 3H93A 2REMA 1WE0A 5KOXA 3ZIVA 5CRDA 5A4UA 2QSIA 3SBCA 3C71A 2CZ2A 1FOVA 2WFCA 3LWAA 2P0GA 1FOHA 1PKZA 2JSZA 1SD9A 2TRCP 1TI3A 2L59A 1TXUA 3VI5A 3LXTA 3FR6A 1SD8A 2YZUA 2XC2A 5INYA 4USSA 5F0GA 1GUHA 3DIEA 2DLXA 4GXZA 2YCDA 5B8AA 4EF0A 1F3BA 2WVXA 3M9KA 3EU4A 1F6MC 1X5DA 3MSZA 4O7HA 2UZ8A 4ECBA 3A2VA 2WW1A 1R26A 3NZNA 5ELGA 3ZRDA 2O3EA 4TKYA 3IAS2 12GSA 4ZB7A 1F9MA 3ME7A 4G2EA 2H75A 3BCKA 4K2DA 1GWCA 4N10A 4GDFA 1KEBA 2PUKC 2VUPA 3ZTLA 2RUEA 4QQ7A 4MZBA 5CYYA 5IPGA 6GSYA 2DJJA 3Q74A 5KN0A 1MTCA 3ZL5A 4CW9A 4WKWA 1GLQA 3H4KA 4W66A 2LSTA 1AIUA 3EINA 3UIWA 1J0FA 4F03A 5IOXA 4BL7A 3DEXA 4KA0A 3FW2A 1T4ZA 4J2FA 1NHYA 2IFQB 4KCAA 2GQKA 2PVQA 1GTAA 1XW5A 4N0ZA 4O32A 4P3YB 2LRNA 2LNSA 3LSZA 4YAVA 4GLTA 1T4YA 2AUVA 4KE3A 2YNXA 6GSTA 1T1VA 5DQYA 2C3TA 3F4RA 4HJMA 3GKXA 1MDJA 1XOBA 1MD4A 2HZEB 2CVDA 1SK0A 4WEYA 4OMVA 4MJAA 2CVBA 3D22A 5ELAA 4CDOA 2LNTA 1YJ6A 3EU3A 4H86A 3R2QA 1SJZA 2WS2A 3FYGA 4MK3A 1Q4JA 3LORA 3F8UA 3RPNA 2CAIA 2FUG2 5GAND 4KF9A 5BMUB 4MPFA 3GYKA 2WCIA 1K0OA 5G31A 3HZ8A 3UBKA 6GSWA 2NPBA 4KX4A 2IPAA 3WD6A 1RK4A 2V6KA 3GKMA 2V41A 1QXHA 3VWXA 4MF5A 5DAKA 2VL3A 1M9BA 4A5PA 1ERWA 2H0IA 4RUVA 2CX4A 4ML1A 3GIXA 5LNKe 3IPZA 5EL8A 4AJ7A 1ON4A 4BA7A 3BJ5A 1M7TA 2JZSA 2HRKB 5CAXA 3M9JA 2KHPA 5IMVA 3GL3A 2WVZA 1EGOA 5G2ZA 4MMMA 2FA8A 4PGTA 4ISDA 1BX9A 2EFEA 3LYPA 6GSUA 1YVLA 4TXOB 3ZVJD 2JZRA 19GSA 4FO5A 4IHUA 1GSQA 3F9UA 3PH9A 3TCOA 1TK5B 1VGLA 1XWBA 2CQ9A 3GV1A 1SVMA 1NM3A 1PL1A 4EVMA 5LD0A 2B5XA 3A5IA 4LMWA 4TVEA 4RI6A 2HSMA 5COHA 5H5QA 1OAZA 4V2LA 3IK9A 1FB0A 4K5RA 3N5OA 3Q18A 1LBKA 2C3QA 2H74A 4IJ3A 1S3CA 5D9WA 2VCVA 2WZSA 3SWLA 2HLSA 3C7MA 2B7KA 1YF0A 2A4HA 2GZYA 4XS1A 2HSHA 3PINA 2IMFA 4ZL7A 4F9ZA 3PR8A 3HD5A 2L5LA 3D21A 2UV8G 2B1KA 2PN8A 4RQXA 2WVXB 1OC9B 1JLWA 2IMIA 5G1LA 1ACVA 4K1FA 3ZFBA 4AKHA 3R3EA 1X9SB 5AIVA 4NMUA 3VLNA 3TJKA 17GSA 4K0NA 4N3ZA 2DJ1A 2ZCTA 4GWRA 2QA2A 3KP8A 3L4NA 4ZBAA 1DUGA 4AGSA 1GUKA 2HSNB 2HRNA 4OWYA 4AF2A 2VCQA 1G7OA 4EO3A 1A2JA 4ILFA 3KP9A 2F3MA 1M99A 3V1WA 3L0HA 2X4AA 4JZQA 1Z3EA 3MNGA 5JCWA 2GS3A 5CRWA 1ZOFA 4HQZA 5JWOB 5EY6A 4LL1B 2AYTA 4X0XA 5J47A 1GL8A 2IIYA 1QMVA 3EWLA 4BL7B 2WW2A 1G6YA 2OA7A 2OE3A 3FR9A 5FWGA 1QFNA 4MP4A 4O5RA 3FY7A 4ECCA 1XIYA 1WMJA 3IDVA 4IKHA 3QFAC 4ML6A 1BG1A 5IO0A 1EP7A 2DMLA 4QMKA 2FHEA 1TOFA 4PQ1A 4HI7A 3P90A 2VIMA 2CZ3A 3WT2A 1VF3A 3WYWA 5J41A 4CHSA 4PUAA 5J4YA 5KEJA 1XOAA 4IELA 3P8WA 2GT6A 3QOUA 5A34A 1R7HA 3FZ5A 2AJQB 1PMTA 1ZYEA 1F37A 3BCIA 2PBJA 3H8QA 1J9BA 2YZHA 4ZIJA 3TJBA 5KOWA 2EIRA 1ERTA 1O6JA 4HUAA 1AQXA 5A4WA 1XVWA 3LEFA 3HVVA 5ECSA 1O85A 2B7JA 2WDUA 3HJMA 2C0FA 2FWEA 5ID2A 3HHVA 1Z9HA 1K0MA 2HFDA 2IFQA 1AQWA 2QGVA 3ZVJA 2YJHA 2Z9SA 2ON7A 5J3RA 4G0IA 3GURA 2YWOA 3EMXA 2LRCA 4XRAA 4D73A 5F07A 4TR4A 4TXVA 3PGTA 1PL2A 2L4CA 4V1Ag 1OC8A 3CSIA 2HZEA 4IVFA 4ULXA 5IPHA 2WGRA 1MD3A 2H66A 2X64A 2M80A 2X99A 3IAM2 1XWGA 4I8BA 2PPTA 4K9ZA 2LRTA 3KMNA 2C0GA 4JR4A 1TK0B 2J9HA 1EOGA 1A2LA 1GSUA 4F0BA 3ME8A 3UBLA 5BMUA 2G0FA
chains in the Genus database with same CATH topology
4QL9A 4EE0A 4I97A 4TN8A 2NDOA 3A2WA 4YQMA 3IV4A 4LA1A 5KN3A 1X0RA 2XBQA 2HSYA 2HXKA 3L9SA 3TKSA 2PGTA 4GSSA 3J7Yb 1ZYPA 3KMOA 5F05A 2X49A 1PN0A 4ZL8A 1K0NA 5A4VA 3ZLPA 4IP6A 4POKA 4GCIA 1BEDA 2EC4A 1G0TA 4IGJA 4YKFA 11GSA 3NOFA 5DJLA 2OT3A 4PNGA 2KUCA 4HU9A 3IC8A 5EPFA 2HRKA 4JEDA 2QKEA 1NHOA 3E9JB 5IMFA 5DVBA 1R4WA 1XXUA 4HOJA 4WR4A 3IHQA 3O6TA 2X8HA 1YQ1A 3CTFA 4N30A 2EIOA 3GMFA 1EV4A 1OE8A 3LFLA 3ZIJA 1NW2A 4DVCA 3TB2A 2PVOC 5GSSA 1U3AA 4MF7A 2A2RA 4KDUA 3HVXA 1FW1A 1K3YA 2E0QA 3WGDA 3TUEA 2FY6A 2H1LA 1XFLA 3MYDA 3UAPA 3VWWA 2VCWA 1VF4A 3HJPA 4YKGA 2IWTA 4JU5A 2R5GA 4HZ4A 2JL4A 2O5VA 2H30A 1JHBA 3TKQA 1AXDA 3VPTA 1B9YC 4XCSA 3TGZA 2DKIA 4KAEA 3G9BA 3CSHA 2H01A 3DYRA 3LGCA 2TIRA 3DD3A 2K6VA 1OC9A 3DVWA 1ZCPA 5AISA 3CRUA 1WIKA 3BD2A 1A8YA 2IJYA 4GTUA 3WT1A 5L71A 3F0IA 4IP1A 1TTZA 2D2ZA 2DBCA 2MMOA 4BPYA 2GQMA 4V2MA 1SL2B 5ENUA 4IQAA 2WZ9A 5A34B 3C73A 1X5CA 2HSNA 1AW9A 2NTOA 2GZZA 1FAAA 2GQLA 3KH7A 1XW9A 5KN1A 3QAVA 5CRGA 3APQA 2DMMA 4EC0A 1SYXA 3OR5A 1OE7A 5AGYA 3CMIA 1HD2A 5D8IA 2M46A 3AY8A 1V58A 4E8HA 4AKIA 3TOUA 3DRNA 3QPMA 1WOUA 5JCUA 4I6XA 1CQGA 4X4JA 5ID2B 2GT5A 4PURA 2KLXA 2YV7A 2E7PA 4GQFA 3RHCA 1ZL9A 1O8XA 5HR0A 1GSDA 1VF2A 4Z2RA 1EEMA 2LUSA 5HFKA 1E2YA 1GRXA 1JZOA 5HR2A 4HU7A 4YQUA 4D73B 3QMXA 1M2DA 1UN2A 1TRVA 2H73A 3APSA 2FWGA 1PQNA 5J9CA 4J56E 5F06A 4MH2A 1T7PB 5DDLA 1XWCA 3VPQA 4EUYA 1QQ2A 4MPGA 2QA1A 1SVLA 3UOMA 1GH2A 1IYIA 2H6XA 4OFMA 2GSRA 4N0VA 1VRSD 3WGXA 1THXA 1O81A 1B9XC 3GSTA 4RI7A 3CRTA 1ZYNA 1HQOA 4DSQA 2I81A 5G30A 3M1GA 4XIHA 4XHMA 1RW1A 1I5GA 2N5BA 2K9FA 4CY8A 3RDWA 1XZOA 1HNBA 1DE2A 2AHEA 3ED3A 3EC3A 5HR1A 5IOWA 1T3BA 2C3NA 5ECKB 3J7Yk 4K2XA 4K0GA 4L5LA 1H75A 1ERUA 1R5AA 1V2AA 3UJ1A 1NSWA 1GSSA 4F2IA 4EIPA 16GSA 1ST9A 4EDZA 3DVXA 2VL2A 1S3DA 3HYPA 4PTSA 1R5PA 5HQPA 4L5OA 5D73A 4LLRA 1OC3A 5DQSA 1Z7PA 4RQRA 3QFBC 3GHAA 2MZCA 1ZMAA 4NPBA 3E0UA 1X9MB 1Z6MA 2WB9A 2B5EA 3VWUA 4POLA 4ZL9A 2CAQA 5AN1A 5ECLB 7GSSA 4KNDA 2RUFA 4YQVA 2F9SA 1AQVA 2PU9C 4MLYA 1AAZA 1E6BA 20GSA 2IMDA 1SKSB 3ISOA 1B4PA 5HR3A 1GLPA 4KDYA 2H71A 3W8JA 4Q5QA 3D5JA 5IQYA 1N8JA 3N9JA 1TRUA 2OJLA 3A5WA 1GP1A 5B7CA 1SJ6A 1B4QA 5IMAA 2YV9A 4LL4B 3CTGA 2IL3A 4JE1A 4CY6A 4KGIA 3C1SA 2DIZA 4BVYA 3TKSC 1PX6A 3KEBA 1GNEA 1ABAA 2JZTA 4V1Ap 2P5QA 4POBA 1ZYQB 1TI1A 2H1AA 1MDKA 1PGTA 3GX8A 1TK8B 1XW6A 4MZCA 3G7JA 4MF6A 1GULA 1OVNA 2KOKA 5CREA 1JFUA 1SJIA 2YWNA 4ICYA 2VCTA 2DIYA 3TKPA 3HCZA 5ECRB 4ZB6A 3HJOA 4KB3A 4ACSA 1U3IA 3CXGA 3M8NA 1SKRB 2R0CA 5ECQB 2VCZA 3QR6A 1YDKA 1PRXA 3IR4A 3F63A 3U6VA 4O5UA 3FR3A 1PA3A 3DGQA 4GRFA 4K7NA 3F3RA 1FO5A 3A2XA 1A24A 1TXXA 3GNJA 5IMDA 3EPTA 3H1NA 1DE1A 1CQHA 3NIVA 2AV4A 5ECPB 5FT3A 1J08A 2ZNMA 4OCEA 1TW9A 3VWVA 1ILOA 2AAWA 2VOCA 5JWRB 1N25A 1V9WA 3L9VA 4FYBA 1GTIA 4KDXA 4ZBDA 2LJRA 2O85A 4HQSA 5B6NA 2HE3A 1KTEA 3VURA 2H76A 1VF1A 5J4VA 1SENA 4IS0A 2RM6A 4BWSA 4KH7A 4BVXB 2G2QA 2H1BA 3F6FA 1FVKA 4FH8A 4PUFC 1SK1A 3CYNA 4YAPA 3APOA 1UVZA 2XPEA 4KW6A 4J57E 1UC7A 1TRSA 2HI7A 3KJYA 2IMKA 4OCFA 2HRAA 3US3A 3IXRA 3W6GA 1TDIA 1BQ7A 5CP1A 1GNWA 1YF1A 2WRTA 1ZZYA 4NHWA 5FHIA 2LJKA 1YEXA 4XS6A 1SU9A 4G0KA 2H72A 4L0UA 3GKNA 4WF5A 5D9XA 3GH6A 4DSSB 1I9DA 3L78A 1A8LA 1YEPA 3W8SA 4MZWA 2FWHA 3HKRA 4BWQA 4N11A 4TR1B 2I3YA 3M0FA 9GSSA 1A2MA 3DKSA 1K0DA 4OO4A 4Z7XA 2I4AA 2K8SA 4IJIA 2F8AA 3F4SA 1B8XA 1UA5A 5A5HB 4DSRA 2KP2A 2R37A 3HDCA 3PPUA 1K0CA 1OYJA 1O8WA 2JACA 4PXOA 2I1UA 3D0ZA 1XVQA 2IMEA 3MWHA 4GQCA 1X9WB 5J4UA 2YOIA 2AB6A 3P7XA 3VI7A 2R2JA 4Z2TA 3K8NA 3MIXA 4NWYA 2E2GA 4L8EA 4NXIA 4I5QA 2H1DA 4MDCA 4X1UA 2QC7A 2H6YA 1GUMA 4NAXA 4BVYB 1IYHA 1XWAA 1XPVA 2B3SA 3KXOA 1T00A 2LQQA 4Z2UA 3TRPA 5IMZA 5DBQA 2GZPA 1GSEA 2ZUPA 2DC5A 3FEUA 1V40A 2RM5A 3M3MA 4OO5A 5EVOA 2CV4A 3ZFLA 2LV3A 3QCPA 3FKFA 2VCXA 3D4TA 1ZGNA 4ZB9A 1FG4A 4OFTA 2V2GA 4TRXA 2FWFA 5ABRA 3EURA 5AIXA 2YANA 4K5SA 2PERA 5JWQB 4F0CA 3E3EA 3BBYA 2EFHA 3MDKA 1SL0B 5J5NA 4L0WA 2MMNA 5IM9A 5KN2A 1BJXA 4ZBBA 3LYKA 4MA9A 2OE1A 5C04A 2BTOT 2IN3A 2B5YA 3G7YA 3IOSA 4I2UA 3IBHA 3TJGA 4IQ1A 2HNLA 2O87A 1AUCA 4NV2A 4TR3A 3RBTA 1JZRA 2PMTA 3D6IA 3GFKA 5DCHA 2LKUA 1PX7A 5H5SA 5LCZA 4FQUA 4HJ2A 5GZZB 1U88A 2OE0A 4MJCA 4QL7A 5ECMB 5ECOB 2H6ZA 1B48A 2R0PA 3Q19A 1ML6A 3S9FA 1BF5A 2WJUA 1K0AA 2VD1A 2B6MA 2DJ3A 2R3XA 1PN9A 1KNGA 3GRXA 2YP6A 3U5RE 4E8EA 4PQHA 4HDEA 1AC1A 1A23A 22GSA 4YH2A 5H5RA 2FLSA 1K3LA 5DJMA 5E59A 3GA4A 3CBUA 2BMXA 3KCMA 2HRFA 3DXBA 5GSTA 3VK9A 6GSVA 1QK8A 2P5RA 1EZKA 1C72A 4ZILA 5E4WA 1TRWA 3IE3A 2C0DA 2O7KA 3ERGA 3L9UA 3EE2A 1TU8A 4KSOA 5G1KA 2B1LA 4AI6A 4KUNA 1YKAA 4F82A 3GL5A 5DALA 2C8UA 2LTKA 2FCHA 2DKHA 2DSAA 3GTUA 2P31A 2H1GA 2C1YA 3KZQA 1YKCA 1A0RP 1PSQA 2FA4A 4MNNA 2H0GA 4NV5A 4BVXA 3GUSA 4KSMA 2EFDA 4EDYA 5BRTA 3GKKA 2LJAA 3GSSA 3KGKA 1EOHA 5D9VA 3IRAA 1ERVA 1K3OA 2F8FA 3VFIA 3ZMKA 2MYGA 1GSYA 3HMJG 4G01A 5IMCA 4EL1A 3TRXA 2VAFA 2CVKA 2VL9A 2TRXA 2VLUA 2GTUA 2R4VA 3H79A 10GSA 3C1RA 3I43A 4Q5RA 1RQMA 1SK2A 3QAWA 1A0FA 3FZAA 1F2EA 1BG5A 5ECHB 4MH3A 4DSSA 1SVOA 1M2AA 3BOAA 2VLVA 4OD7A 2FD3A 1BYEA 4JR6A 4TR1A 4AJ6A 2A2SA 1G7EA 5HFGA 5D96A 4PNFA 4IW9A 4IBPA 1Y6EA 5A5HA 4AJ8A 2L57A 5C00A 2VM2A 4OFNA 4Q5FA 4K6XA 4AKXB 3CSJA 2C80A 5F8BA 4XS4B 4G0LA 5B6MA 1JZDA 1WWJA 5CRHA 3GX0A 1O7UA 3KIJA 3UEMA 1DBYA 4G19A 4JRRA 1V98A 2GVPA 1M0UA 2XBIA 2E2MA 2GSTA 1FHEA 2VD0A 3A3TA 1XCCA 1PKWA 4WETA 2R0GA 4MJEA 4FYUA 1K0BA 3I6AA 1YZXA 2GDRA 2V6OA 4TOPA 2X8GA 3FMWA 4TW5A 3HY2A 3EMPA 4XTSA 2YWIA 2YJ7A 5GAPD 1Q98A 2O8VB 3HXSA 3HZ4A 3HVSA 2RIIA 3TJJA 2HYXA 5A5KA 3RPPA 2N5AA 1HNCA 1U87A 2KP1A 3FZ4A 3ZMLA 1PD21 1MDIA 4GSTA 2R6KA 4K7IA 3UMAA 4KCEA 3RAZA 4PX1A 2XPDA 3C8EA 3ERFA 2CT6A 2BJXA 2O89A 6GSXA 4WF4A 5D93A 3F3QA 3IHGA 3HA9A 4MCUA 2CX3A 2DJ0A 3TRQA 6GSSA 2GSSA 2F51A 5ECNB 2M72A 2J23A 3QDNA 3FK8A 2C0EA 5A1NA 2A4VA 4DEJA 3ZYWA 2VLTA 3Q6OA 3TDGA 3KD0A 2MBSA 5ECIB 4HS1A 5CO3A 1U6TA 3F4TA 1Y1UA 1OKTA 1G6WA 4IN0A 3GH9A 1EGRA 2JU5A 1S3AA 3IA1A 2JADA 3RHBA 1GTBA 2WULA 1SL1B 3KH9A 3UVTA 2OBIA 4ZXGA 2GGTA 5DALB 4MABA 4WBJA 5DCGA 4EKZA 3FHKA 2OADA 1Y25A 1TP9A 2FNOA 3GTUB 3KTLA 4AKGA 2L4QA 1USBA 1XBSA 1OKDA 5HFIA 1FVJA 1V57A 1URMA 2N5FA 4G10A 4XRDA 2C4JA 2CA8A 2H8LA 2V1MA 2LEGA 3DMLA 4E68A 4FYCA 5B8BA 2X8CA 4ZB8A 3UVHA 4EXJA 2A2PA 2ES7A 2OBKA 2FGXA 2JSYA 1T8EB 1DSBA 3JCML 1EEJA 2NBSA 3I69A 2K18A 3UARA 4X43A 2EIQA 1F3AA 3CWGA 2HZFA 4I2TA 3WGEA 2GLRA 2ALBA 3KTBA 4LMVA 1EWXA 1WP0A 1H4OA 3QD9A 5CNWA 2NVLA 3LW9A 4POMA 1WRYA 4Q5NA 1WJKA 3TKRA 4EIQA 5DAKB 3ERWA 2OACA 8GSSA 4MJBA 2YN1A 4V2NA 4WR5A 2YPMA 2PWJA 2DJ2A 2HQTA 1FB6A 1TKDB 1MEKA 4ECJA 5IIZA 4NHZA 4K7OA 4K8MA 1EV9A 1O73A 3IC4A 4FIWA 3G7IA 3KM6A 4ECIA 1Z5YE 2RLIA 1M9AA 1TJDA 3TOTA 3TU3B 2EFCA 1HYUA 4TR0A 1LU4A 1KBNA 2MMAA 2VO4A 1QGVA 2GSQA 5J40A 1YY7A 2HT9A 2ON5A 1XWKA 4GSNA 2I9HA 2MMZA 2VM1A 1GSFA 3LG6A 3LJRA 4PQIA 2YWMA 1GTUA 1Z6NA 3P2AA 3QAGA 2HSMB 3ZITA 2DJKA 2LS5A 3FZ9A 5G5EA 3TKSE 3D4MA 2L5OA 4HEA2 3LQ7A 2OKAA 3DWVA 3O76A 5JCGA 4WXTA 1N2AA 1EP8A 1LJRA 4O5QA 3EVIA 3O3TA 1BAYA 3TJFA 2LQOA 3UL3A 2H70A 1M2BA 13GSA 1WPIA 1X5EA 3IK7A 1SYRA 3F6DA 2VKZG 2V32A 1THOA 3ZZXA 1W4VA 3FRCA 4WBRD 1HNAA 2VL2C 1SKWB 3LXZA 14GSA 2L6CA 3I9V2 1JLVA 1JZWA 1W89A 5J9BA 18GSA 3EYTA 5IO2A 1Z7RA 2XHFA 3ZREA 2MBTA 2K8VA 1TU7A 4GF0A 4G9HA 2H0HA 4JBBA 4XS4A 3GN3A 4TXOA 4HZ2A 5D9TA 3MAKA 2H19A 1QUWA 4ID0A 5A1NB 4O92A 2L6DA 5G5FA 3H93A 2REMA 1WE0A 5KOXA 3ZIVA 5CRDA 5A4UA 2QSIA 3SBCA 3C71A 2CZ2A 1FOVA 2WFCA 3LWAA 2P0GA 1FOHA 1PKZA 2JSZA 1SD9A 2TRCP 1TI3A 2L59A 1TXUA 3VI5A 3LXTA 3FR6A 1SD8A 2YZUA 2XC2A 5INYA 4USSA 5F0GA 1GUHA 3DIEA 2DLXA 4GXZA 2YCDA 5B8AA 4EF0A 1F3BA 3M9KA 3EU4A 1F6MC 1X5DA 3MSZA 4O7HA 2UZ8A 4ECBA 3A2VA 1R26A 3NZNA 5ELGA 3ZRDA 4TKYA 3IAS2 12GSA 4ZB7A 1F9MA 3ME7A 4G2EA 2H75A 3BCKA 4K2DA 1GWCA 4N10A 4GDFA 1KEBA 2PUKC 2VUPA 3ZTLA 2RUEA 4QQ7A 4MZBA 5CYYA 5IPGA 6GSYA 2DJJA 3Q74A 5KN0A 1MTCA 3ZL5A 4CW9A 4WKWA 1GLQA 3H4KA 4W66A 2LSTA 1AIUA 3EINA 3UIWA 1J0FA 4F03A 5IOXA 4BL7A 3DEXA 4KA0A 3FW2A 1T4ZA 4J2FA 1NHYA 2IFQB 4KCAA 2GQKA 2PVQA 1GTAA 1XW5A 4N0ZA 4O32A 4P3YB 2LRNA 2LNSA 3LSZA 4YAVA 4GLTA 1T4YA 2AUVA 4KE3A 2YNXA 6GSTA 1T1VA 5DQYA 2C3TA 3F4RA 4HJMA 3GKXA 1MDJA 1XOBA 1MD4A 2HZEB 2CVDA 1SK0A 4WEYA 4OMVA 4MJAA 2CVBA 3D22A 5ELAA 4CDOA 2LNTA 1YJ6A 3EU3A 4H86A 3R2QA 1SJZA 2WS2A 3FYGA 4MK3A 1Q4JA 3LORA 3F8UA 3RPNA 2CAIA 2FUG2 5GAND 4KF9A 5BMUB 4MPFA 3GYKA 2WCIA 1K0OA 5G31A 3HZ8A 3UBKA 6GSWA 2NPBA 4KX4A 2IPAA 3WD6A 1RK4A 2V6KA 3GKMA 2V41A 1QXHA 3VWXA 4MF5A 5DAKA 2VL3A 1M9BA 4A5PA 1ERWA 2H0IA 4RUVA 2CX4A 4ML1A 3GIXA 5LNKe 3IPZA 5EL8A 4AJ7A 1ON4A 4BA7A 3BJ5A 1M7TA 2JZSA 2HRKB 5CAXA 3M9JA 2KHPA 5IMVA 3GL3A 1EGOA 5G2ZA 4MMMA 2FA8A 4PGTA 4ISDA 1BX9A 2EFEA 3LYPA 6GSUA 1YVLA 4TXOB 3ZVJD 2JZRA 19GSA 4FO5A 4IHUA 1GSQA 3F9UA 3PH9A 3TCOA 1TK5B 1VGLA 1XWBA 2CQ9A 3GV1A 1SVMA 1NM3A 1PL1A 4EVMA 5LD0A 2B5XA 3A5IA 4LMWA 4TVEA 4RI6A 2HSMA 5COHA 5H5QA 1OAZA 4V2LA 3IK9A 1FB0A 4K5RA 3N5OA 3Q18A 1LBKA 2C3QA 2H74A 4IJ3A 1S3CA 5D9WA 2VCVA 3SWLA 2HLSA 3C7MA 2B7KA 1YF0A 2A4HA 2GZYA 4XS1A 2HSHA 3PINA 2IMFA 4ZL7A 4F9ZA 3PR8A 3HD5A 2L5LA 3D21A 2UV8G 2B1KA 2PN8A 4RQXA 1OC9B 1JLWA 2IMIA 5G1LA 1ACVA 4K1FA 3ZFBA 4AKHA 3R3EA 1X9SB 5AIVA 4NMUA 3VLNA 3TJKA 17GSA 4K0NA 4N3ZA 2DJ1A 2ZCTA 4GWRA 2QA2A 3KP8A 3L4NA 4ZBAA 1DUGA 4AGSA 1GUKA 2HSNB 2HRNA 4OWYA 4AF2A 2VCQA 1G7OA 4EO3A 1A2JA 4ILFA 3KP9A 2F3MA 1M99A 3V1WA 3L0HA 2X4AA 4JZQA 1Z3EA 3MNGA 5JCWA 2GS3A 5CRWA 1ZOFA 4HQZA 5JWOB 5EY6A 4LL1B 2AYTA 4X0XA 5J47A 1GL8A 2IIYA 1QMVA 3EWLA 4BL7B 1G6YA 2OA7A 2OE3A 3FR9A 5FWGA 1QFNA 4MP4A 4O5RA 3FY7A 4ECCA 1XIYA 1WMJA 3IDVA 4IKHA 3QFAC 4ML6A 1BG1A 5IO0A 1EP7A 2DMLA 4QMKA 2FHEA 1TOFA 4PQ1A 4HI7A 3P90A 2VIMA 2CZ3A 3WT2A 1VF3A 3WYWA 5J41A 4CHSA 4PUAA 5J4YA 5KEJA 1XOAA 4IELA 3P8WA 2GT6A 3QOUA 5A34A 1R7HA 3FZ5A 2AJQB 1PMTA 1ZYEA 1F37A 3BCIA 2PBJA 3H8QA 1J9BA 2YZHA 4ZIJA 3TJBA 5KOWA 2EIRA 1ERTA 1O6JA 4HUAA 1AQXA 5A4WA 1XVWA 3LEFA 3HVVA 5ECSA 1O85A 2B7JA 2WDUA 3HJMA 2C0FA 2FWEA 5ID2A 3HHVA 1Z9HA 1K0MA 2HFDA 2IFQA 1AQWA 2QGVA 3ZVJA 2YJHA 2Z9SA 2ON7A 5J3RA 4G0IA 3GURA 2YWOA 3EMXA 2LRCA 4XRAA 4D73A 5F07A 4TR4A 4TXVA 3PGTA 1PL2A 2L4CA 4V1Ag 1OC8A 3CSIA 2HZEA 4IVFA 4ULXA 5IPHA 2WGRA 1MD3A 2H66A 2X64A 2M80A 2X99A 3IAM2 1XWGA 4I8BA 2PPTA 4K9ZA 2LRTA 3KMNA 2C0GA 4JR4A 1TK0B 2J9HA 1EOGA 1A2LA 1GSUA 4F0BA 3ME8A 3UBLA 5BMUA 2G0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QL9 A;  4EE0 A;  4I97 A;  4TN8 A;  2NDO A;  3A2W A;  4YQM A;  3IV4 A;  4LA1 A;  5KN3 A;  1X0R A;  2XBQ A;  2HSY A;  2HXK A;  3L9S A;  3TKS A;  2PGT A;  4GSS A;  3J7Y b;  3KMO A;  5F05 A;  4ZL8 A;  1K0N A;  5A4V A;  3ZLP A;  4IP6 A;  4POK A;  4GCI A;  1BED A;  2EC4 A;  1G0T A;  4IGJ A;  11GS A;  3NOF A;  5DJL A;  4PNG A;  2KUC A;  4HU9 A;  3IC8 A;  5EPF A;  2HRK A;  4JED A;  2QKE A;  1NHO A;  3E9J B;  5IMF A;  5DVB A;  1R4W A;  1XXU A;  4HOJ A;  4WR4 A;  3IHQ A;  3O6T A;  2X8H A;  1YQ1 A;  3CTF A;  4N30 A;  2EIO A;  3GMF A;  1EV4 A;  1OE8 A;  3LFL A;  3ZIJ A;  1NW2 A;  4DVC A;  3TB2 A;  2PVO C;  5GSS A;  1U3A A;  4MF7 A;  2A2R A;  4KDU A;  3HVX A;  1FW1 A;  1K3Y A;  2E0Q A;  3WGD A;  3TUE A;  2FY6 A;  1XFL A;  3UAP A;  3VWW A;  2VCW A;  1VF4 A;  3HJP A;  2IWT A;  4JU5 A;  2R5G A;  4HZ4 A;  2JL4 A;  2H30 A;  1JHB A;  3TKQ A;  1AXD A;  3VPT A;  1B9Y C;  4XCS A;  3TGZ A;  4KAE A;  3G9B A;  3CSH A;  2H01 A;  3DYR A;  3LGC A;  2TIR A;  3DD3 A;  2K6V A;  1OC9 A;  3DVW A;  1ZCP A;  5AIS A;  3CRU A;  1WIK A;  3BD2 A;  1A8Y A;  2IJY A;  4GTU A;  3WT1 A;  5L71 A;  3F0I A;  4IP1 A;  1TTZ A;  2D2Z A;  2DBC A;  2MMO A;  4BPY A;  2GQM A;  4V2M A;  1SL2 B;  5ENU A;  4IQA A;  2WZ9 A;  3C73 A;  1X5C A;  1AW9 A;  2NTO A;  2GZZ A;  1FAA A;  2GQL A;  3KH7 A;  1XW9 A;  5KN1 A;  3QAV A;  5CRG A;  3APQ A;  2DMM A;  4EC0 A;  1SYX A;  3OR5 A;  1OE7 A;  5AGY A;  3CMI A;  1HD2 A;  5D8I A;  2M46 A;  3AY8 A;  1V58 A;  4E8H A;  3TOU A;  3DRN A;  3QPM A;  1WOU A;  5JCU A;  4I6X A;  1CQG A;  5ID2 B;  2GT5 A;  4PUR A;  2KLX A;  2YV7 A;  2E7P A;  4GQF A;  3RHC A;  1ZL9 A;  1O8X A;  5HR0 A;  1GSD A;  1VF2 A;  1EEM A;  2LUS A;  5HFK A;  1E2Y A;  1GRX A;  1JZO A;  5HR2 A;  4HU7 A;  4YQU A;  4D73 B;  3QMX A;  1M2D A;  1UN2 A;  1TRV A;  2H73 A;  3APS A;  2FWG A;  1PQN A;  5J9C A;  4J56 E;  5F06 A;  4MH2 A;  1T7P B;  5DDL A;  1XWC A;  3VPQ A;  4EUY A;  1QQ2 A;  4MPG A;  3UOM A;  1GH2 A;  1IYI A;  2H6X A;  4OFM A;  2GSR A;  4N0V A;  1VRS D;  3WGX A;  1THX A;  1O81 A;  1B9X C;  3GST A;  4RI7 A;  3CRT A;  1HQO A;  4DSQ A;  2I81 A;  5G30 A;  3M1G A;  4XIH A;  4XHM A;  1RW1 A;  1I5G A;  2N5B A;  2K9F A;  3RDW A;  1XZO A;  1HNB A;  1DE2 A;  2AHE A;  3ED3 A;  3EC3 A;  5HR1 A;  5IOW A;  1T3B A;  2C3N A;  5ECK B;  3J7Y k;  4K0G A;  4L5L A;  1H75 A;  1ERU A;  1R5A A;  1V2A A;  3UJ1 A;  1NSW A;  1GSS A;  4F2I A;  16GS A;  1ST9 A;  4EDZ A;  3DVX A;  2VL2 A;  1S3D A;  3HYP A;  4PTS A;  1R5P A;  5HQP A;  4L5O A;  5D73 A;  4LLR A;  1OC3 A;  5DQS A;  1Z7P A;  4RQR A;  3QFB C;  3GHA A;  2MZC A;  1ZMA A;  4NPB A;  3E0U A;  1X9M B;  1Z6M A;  2WB9 A;  2B5E A;  3VWU A;  4POL A;  4ZL9 A;  2CAQ A;  5AN1 A;  5ECL B;  7GSS A;  4KND A;  2RUF A;  4YQV A;  2F9S A;  1AQV A;  2PU9 C;  4MLY A;  1AAZ A;  1E6B A;  20GS A;  2IMD A;  1SKS B;  3ISO A;  1B4P A;  5HR3 A;  1GLP A;  4KDY A;  2H71 A;  3W8J A;  4Q5Q A;  3D5J A;  5IQY A;  1N8J A;  3N9J A;  1TRU A;  2OJL A;  3A5W A;  1GP1 A;  5B7C A;  1SJ6 A;  1B4Q A;  5IMA A;  2YV9 A;  4LL4 B;  3CTG A;  2IL3 A;  4JE1 A;  4KGI A;  3C1S A;  2DIZ A;  4BVY A;  3TKS C;  1PX6 A;  3KEB A;  1GNE A;  1ABA A;  2JZT A;  4V1A p;  2P5Q A;  4POB A;  1ZYQ B;  1TI1 A;  2H1A A;  1MDK A;  1PGT A;  3GX8 A;  1TK8 B;  1XW6 A;  4MZC A;  3G7J A;  4MF6 A;  1GUL A;  1OVN A;  2KOK A;  5CRE A;  1JFU A;  1SJI A;  2YWN A;  2VCT A;  2DIY A;  3TKP A;  3HCZ A;  5ECR B;  4ZB6 A;  3HJO A;  4KB3 A;  4ACS A;  1U3I A;  3CXG A;  3M8N A;  1SKR B;  5ECQ B;  2VCZ A;  3QR6 A;  1YDK A;  1PRX A;  3IR4 A;  3F63 A;  3U6V A;  3FR3 A;  1PA3 A;  3DGQ A;  4GRF A;  4K7N A;  3F3R A;  1FO5 A;  3A2X A;  1A24 A;  1TXX A;  3GNJ A;  5IMD A;  3H1N A;  1DE1 A;  1CQH A;  3NIV A;  2AV4 A;  5ECP B;  5FT3 A;  1J08 A;  2ZNM A;  4OCE A;  1TW9 A;  3VWV A;  1ILO A;  2AAW A;  2VOC A;  5JWR B;  1V9W A;  3L9V A;  4FYB A;  1GTI A;  4KDX A;  4ZBD A;  2LJR A;  2O85 A;  4HQS A;  5B6N A;  2HE3 A;  1KTE A;  3VUR A;  2H76 A;  1VF1 A;  1SEN A;  4IS0 A;  2RM6 A;  4BWS A;  4KH7 A;  4BVX B;  2G2Q A;  2H1B A;  3F6F A;  1FVK A;  4FH8 A;  4PUF C;  1SK1 A;  3CYN A;  4YAP A;  3APO A;  1UVZ A;  2XPE A;  4KW6 A;  4J57 E;  1UC7 A;  1TRS A;  2HI7 A;  3KJY A;  2IMK A;  4OCF A;  2HRA A;  3US3 A;  3IXR A;  3W6G A;  1TDI A;  1BQ7 A;  5CP1 A;  1GNW A;  1YF1 A;  2WRT A;  1ZZY A;  4NHW A;  5FHI A;  2LJK A;  1YEX A;  4XS6 A;  1SU9 A;  4G0K A;  2H72 A;  4L0U A;  3GKN A;  4WF5 A;  5D9X A;  3GH6 A;  4DSS B;  1I9D A;  3L78 A;  1A8L A;  1YEP A;  3W8S A;  4MZW A;  2FWH A;  3HKR A;  4BWQ A;  4N11 A;  4TR1 B;  2I3Y A;  3M0F A;  9GSS A;  1A2M A;  3DKS A;  1K0D A;  4OO4 A;  4Z7X A;  2I4A A;  2K8S A;  4IJI A;  2F8A A;  3F4S A;  1B8X A;  1UA5 A;  4DSR A;  2KP2 A;  2R37 A;  3HDC A;  3PPU A;  1K0C A;  1OYJ A;  1O8W A;  2JAC A;  4PXO A;  2I1U A;  3D0Z A;  1XVQ A;  2IME A;  3MWH A;  4GQC A;  1X9W B;  5J4U A;  2YOI A;  2AB6 A;  3P7X A;  3VI7 A;  2R2J A;  3K8N A;  4NWY A;  2E2G A;  4L8E A;  4NXI A;  4I5Q A;  2H1D A;  4MDC A;  4X1U A;  2QC7 A;  2H6Y A;  1GUM A;  4NAX A;  4BVY B;  1IYH A;  1XWA A;  1XPV A;  2B3S A;  3KXO A;  1T00 A;  2LQQ A;  3TRP A;  5IMZ A;  5DBQ A;  2GZP A;  1GSE A;  2ZUP A;  2DC5 A;  3FEU A;  1V40 A;  2RM5 A;  3M3M A;  4OO5 A;  5EVO A;  2CV4 A;  3ZFL A;  2LV3 A;  3QCP A;  3FKF A;  2VCX A;  3D4T A;  1ZGN A;  4ZB9 A;  1FG4 A;  4OFT A;  2V2G A;  4TRX A;  2FWF A;  5ABR A;  3EUR A;  5AIX A;  2YAN A;  2PER A;  5JWQ B;  4F0C A;  3E3E A;  3BBY A;  3MDK A;  1SL0 B;  5J5N A;  4L0W A;  2MMN A;  5IM9 A;  5KN2 A;  1BJX A;  4ZBB A;  3LYK A;  4MA9 A;  2OE1 A;  5C04 A;  2BTO T;  2IN3 A;  2B5Y A;  3G7Y A;  3IOS A;  4I2U A;  3IBH A;  3TJG A;  4IQ1 A;  2HNL A;  2O87 A;  1AUC A;  4NV2 A;  4TR3 A;  3RBT A;  1JZR A;  2PMT A;  3D6I A;  3GFK A;  5DCH A;  2LKU A;  1PX7 A;  5H5S A;  5LCZ A;  4FQU A;  4HJ2 A;  5GZZ B;  1U88 A;  2OE0 A;  4MJC A;  4QL7 A;  5ECM B;  5ECO B;  2H6Z A;  1B48 A;  3Q19 A;  1ML6 A;  3S9F A;  2WJU A;  1K0A A;  2VD1 A;  2B6M A;  2DJ3 A;  2R3X A;  1PN9 A;  1KNG A;  3GRX A;  2YP6 A;  3U5R E;  4E8E A;  4PQH A;  4HDE A;  1AC1 A;  1A23 A;  22GS A;  4YH2 A;  5H5R A;  2FLS A;  1K3L A;  5DJM A;  5E59 A;  3GA4 A;  3CBU A;  2BMX A;  3KCM A;  2HRF A;  3DXB A;  5GST A;  3VK9 A;  6GSV A;  1QK8 A;  2P5R A;  1EZK A;  1C72 A;  4ZIL A;  5E4W A;  1TRW A;  3IE3 A;  2C0D A;  2O7K A;  3ERG A;  3L9U A;  3EE2 A;  1TU8 A;  4KSO A;  5G1K A;  2B1L A;  4KUN A;  1YKA A;  4F82 A;  3GL5 A;  5DAL A;  2C8U A;  2LTK A;  2FCH A;  2DSA A;  3GTU A;  2P31 A;  2H1G A;  2C1Y A;  3KZQ A;  1YKC A;  1A0R P;  1PSQ A;  2FA4 A;  2H0G A;  4NV5 A;  4BVX A;  3GUS A;  4KSM A;  4EDY A;  3GKK A;  2LJA A;  3GSS A;  3KGK A;  1EOH A;  5D9V A;  3IRA A;  1ERV A;  1K3O A;  2F8F A;  3VFI A;  3ZMK A;  2MYG A;  1GSY A;  5IMC A;  4EL1 A;  3TRX A;  2VAF A;  2CVK A;  2VL9 A;  2TRX A;  2VLU A;  2GTU A;  2R4V A;  3H79 A;  10GS A;  3C1R A;  3I43 A;  4Q5R A;  1RQM A;  1SK2 A;  3QAW A;  1A0F A;  3FZA A;  1F2E A;  1BG5 A;  5ECH B;  4MH3 A;  4DSS A;  1M2A A;  3BOA A;  2VLV A;  4OD7 A;  2FD3 A;  1BYE A;  4JR6 A;  4TR1 A;  4AJ6 A;  2A2S A;  1G7E A;  5HFG A;  5D96 A;  4PNF A;  4IW9 A;  4IBP A;  1Y6E A;  4AJ8 A;  2L57 A;  5C00 A;  2VM2 A;  4OFN A;  4Q5F A;  4K6X A;  3CSJ A;  2C80 A;  5F8B A;  4XS4 B;  4G0L A;  5B6M A;  1JZD A;  1WWJ A;  5CRH A;  3GX0 A;  1O7U A;  3KIJ A;  3UEM A;  1DBY A;  4G19 A;  4JRR A;  1V98 A;  2GVP A;  1M0U A;  2XBI A;  2E2M A;  2GST A;  1FHE A;  2VD0 A;  3A3T A;  1XCC A;  1PKW A;  4WET A;  4MJE A;  4FYU A;  1K0B A;  3I6A A;  1YZX A;  2GDR A;  2V6O A;  4TOP A;  2X8G A;  4TW5 A;  3HY2 A;  3EMP A;  4XTS A;  2YWI A;  2YJ7 A;  5GAP D;  1Q98 A;  2O8V B;  3HXS A;  3HZ4 A;  3HVS A;  2RII A;  3TJJ A;  2HYX A;  5A5K A;  3RPP A;  2N5A A;  1HNC A;  1U87 A;  2KP1 A;  3FZ4 A;  3ZML A;  1PD2 1;  1MDI A;  4GST A;  2R6K A;  4K7I A;  3UMA A;  4KCE A;  3RAZ A;  4PX1 A;  2XPD A;  3C8E A;  3ERF A;  2CT6 A;  2BJX A;  2O89 A;  6GSX A;  4WF4 A;  5D93 A;  3F3Q A;  3HA9 A;  4MCU A;  2CX3 A;  2DJ0 A;  3TRQ A;  6GSS A;  2GSS A;  2F51 A;  5ECN B;  2M72 A;  2J23 A;  3QDN A;  3FK8 A;  2C0E A;  2A4V A;  4DEJ A;  3ZYW A;  2VLT A;  3Q6O A;  3TDG A;  3KD0 A;  2MBS A;  5ECI B;  4HS1 A;  5CO3 A;  1U6T A;  3F4T A;  1OKT A;  1G6W A;  4IN0 A;  3GH9 A;  1EGR A;  2JU5 A;  1S3A A;  3IA1 A;  2JAD A;  3RHB A;  1GTB A;  2WUL A;  1SL1 B;  3KH9 A;  3UVT A;  2OBI A;  4ZXG A;  2GGT A;  5DAL B;  4MAB A;  4WBJ A;  5DCG A;  4EKZ A;  3FHK A;  2OAD A;  1Y25 A;  1TP9 A;  2FNO A;  3GTU B;  3KTL A;  2L4Q A;  1USB A;  1XBS A;  1OKD A;  5HFI A;  1FVJ A;  1V57 A;  1URM A;  2N5F A;  4G10 A;  4XRD A;  2C4J A;  2CA8 A;  2H8L A;  2V1M A;  2LEG A;  3DML A;  4FYC A;  5B8B A;  2X8C A;  4ZB8 A;  3UVH A;  4EXJ A;  2ES7 A;  2OBK A;  2FGX A;  2JSY A;  1T8E B;  1DSB A;  3JCM L;  1EEJ A;  2NBS A;  3I69 A;  2K18 A;  3UAR A;  4X43 A;  2EIQ A;  1F3A A;  2HZF A;  4I2T A;  3WGE A;  2GLR A;  2ALB A;  3KTB A;  4LMV A;  1EWX A;  1WP0 A;  1H4O A;  3QD9 A;  5CNW A;  2NVL A;  4POM A;  1WRY A;  4Q5N A;  1WJK A;  3TKR A;  5DAK B;  3ERW A;  2OAC A;  8GSS A;  4MJB A;  2YN1 A;  4V2N A;  4WR5 A;  2YPM A;  2PWJ A;  2DJ2 A;  2HQT A;  1FB6 A;  1TKD B;  1MEK A;  4ECJ A;  5IIZ A;  4NHZ A;  4K7O A;  4K8M A;  1EV9 A;  1O73 A;  3IC4 A;  4FIW A;  3G7I A;  3KM6 A;  4ECI A;  1Z5Y E;  2RLI A;  1M9A A;  1TJD A;  3TOT A;  1HYU A;  4TR0 A;  1LU4 A;  1KBN A;  2MMA A;  2VO4 A;  1QGV A;  2GSQ A;  1YY7 A;  2HT9 A;  2ON5 A;  1XWK A;  4GSN A;  2I9H A;  2MMZ A;  2VM1 A;  1GSF A;  3LG6 A;  3LJR A;  4PQI A;  2YWM A;  1GTU A;  1Z6N A;  3P2A A;  3QAG A;  2HSM B;  3ZIT A;  2DJK A;  2LS5 A;  3FZ9 A;  5G5E A;  3TKS E;  3D4M A;  2L5O A;  4HEA 2;  3LQ7 A;  2OKA A;  3DWV A;  3O76 A;  5JCG A;  4WXT A;  1N2A A;  1EP8 A;  1LJR A;  3EVI A;  3O3T A;  1BAY A;  3TJF A;  2LQO A;  3UL3 A;  2H70 A;  1M2B A;  13GS A;  1WPI A;  1X5E A;  3IK7 A;  1SYR A;  3F6D A;  2V32 A;  1THO A;  3ZZX A;  1W4V A;  3FRC A;  4WBR D;  1HNA A;  2VL2 C;  1SKW B;  3LXZ A;  14GS A;  2L6C A;  3I9V 2;  1JLV A;  1JZW A;  1W89 A;  5J9B A;  18GS A;  3EYT A;  5IO2 A;  1Z7R A;  2XHF A;  3ZRE A;  2MBT A;  2K8V A;  1TU7 A;  4GF0 A;  4G9H A;  2H0H A;  4JBB A;  4XS4 A;  3GN3 A;  4TXO A;  4HZ2 A;  5D9T A;  3MAK A;  2H19 A;  1QUW A;  4ID0 A;  4O92 A;  2L6D A;  5G5F A;  3H93 A;  2REM A;  1WE0 A;  3ZIV A;  5CRD A;  5A4U A;  2QSI A;  3SBC A;  3C71 A;  2CZ2 A;  1FOV A;  2WFC A;  3LWA A;  2P0G A;  1PKZ A;  2JSZ A;  1SD9 A;  2TRC P;  1TI3 A;  2L59 A;  3VI5 A;  3LXT A;  3FR6 A;  1SD8 A;  2YZU A;  2XC2 A;  5INY A;  4USS A;  5F0G A;  1GUH A;  3DIE A;  2DLX A;  4GXZ A;  2YCD A;  5B8A A;  4EF0 A;  1F3B A;  3M9K A;  3EU4 A;  1F6M C;  1X5D A;  3MSZ A;  4O7H A;  2UZ8 A;  4ECB A;  3A2V A;  1R26 A;  3NZN A;  5ELG A;  3ZRD A;  4TKY A;  3IAS 2;  12GS A;  1F9M A;  3ME7 A;  4G2E A;  2H75 A;  3BCK A;  4K2D A;  1GWC A;  4N10 A;  2VUP A;  1KEB A;  2PUK C;  3ZTL A;  2RUE A;  4QQ7 A;  4MZB A;  5CYY A;  5IPG A;  6GSY A;  2DJJ A;  3Q74 A;  5KN0 A;  1MTC A;  3ZL5 A;  4CW9 A;  4WKW A;  1GLQ A;  3H4K A;  2LST A;  1AIU A;  3EIN A;  3UIW A;  1J0F A;  4F03 A;  5IOX A;  4BL7 A;  3DEX A;  4KA0 A;  3FW2 A;  1T4Z A;  4J2F A;  1NHY A;  2IFQ B;  4KCA A;  2GQK A;  2PVQ A;  1GTA A;  1XW5 A;  4N0Z A;  4O32 A;  4P3Y B;  2LRN A;  2LNS A;  3LSZ A;  4YAV A;  4GLT A;  1T4Y A;  2AUV A;  4KE3 A;  2YNX A;  6GST A;  1T1V A;  5DQY A;  2C3T A;  3F4R A;  4HJM A;  3GKX A;  1MDJ A;  1XOB A;  1MD4 A;  2HZE B;  2CVD A;  1SK0 A;  4WEY A;  4OMV A;  4MJA A;  2CVB A;  3D22 A;  5ELA A;  4CDO A;  2LNT A;  1YJ6 A;  3EU3 A;  4H86 A;  3R2Q A;  1SJZ A;  2WS2 A;  3FYG A;  4MK3 A;  1Q4J A;  3LOR A;  3F8U A;  3RPN A;  2CAI A;  2FUG 2;  5GAN D;  4KF9 A;  4MPF A;  3GYK A;  2WCI A;  1K0O A;  5G31 A;  3HZ8 A;  3UBK A;  6GSW A;  2NPB A;  4KX4 A;  2IPA A;  3WD6 A;  1RK4 A;  2V6K A;  3GKM A;  2V41 A;  1QXH A;  3VWX A;  4MF5 A;  5DAK A;  2VL3 A;  1M9B A;  1ERW A;  2H0I A;  4RUV A;  2CX4 A;  4ML1 A;  3GIX A;  5LNK e;  3IPZ A;  5EL8 A;  4AJ7 A;  1ON4 A;  4BA7 A;  3BJ5 A;  1M7T A;  2JZS A;  2HRK B;  5CAX A;  3M9J A;  2KHP A;  5IMV A;  3GL3 A;  1EGO A;  5G2Z A;  4MMM A;  2FA8 A;  4PGT A;  4ISD A;  1BX9 A;  3LYP A;  6GSU A;  3ZVJ D;  4TXO B;  2JZR A;  19GS A;  4FO5 A;  4IHU A;  1GSQ A;  3F9U A;  3PH9 A;  3TCO A;  1TK5 B;  1VGL A;  1XWB A;  2CQ9 A;  3GV1 A;  1NM3 A;  1PL1 A;  4EVM A;  5LD0 A;  2B5X A;  4LMW A;  4TVE A;  4RI6 A;  2HSM A;  5COH A;  5H5Q A;  1OAZ A;  4V2L A;  3IK9 A;  1FB0 A;  3N5O A;  3Q18 A;  1LBK A;  2C3Q A;  2H74 A;  4IJ3 A;  1S3C A;  5D9W A;  2VCV A;  3SWL A;  2HLS A;  3C7M A;  2B7K A;  1YF0 A;  2GZY A;  4XS1 A;  2HSH A;  3PIN A;  2IMF A;  4ZL7 A;  4F9Z A;  3PR8 A;  3HD5 A;  2L5L A;  3D21 A;  2B1K A;  2PN8 A;  4RQX A;  1OC9 B;  1JLW A;  2IMI A;  5G1L A;  1ACV A;  4K1F A;  3ZFB A;  3R3E A;  1X9S B;  5AIV A;  4NMU A;  3VLN A;  3TJK A;  17GS A;  4K0N A;  2DJ1 A;  2ZCT A;  4GWR A;  3KP8 A;  3L4N A;  4ZBA A;  1DUG A;  4AGS A;  1GUK A;  2HSN B;  2HRN A;  4OWY A;  4AF2 A;  2VCQ A;  1G7O A;  4EO3 A;  1A2J A;  4ILF A;  3KP9 A;  2F3M A;  1M99 A;  3V1W A;  3L0H A;  4JZQ A;  1Z3E A;  3MNG A;  5JCW A;  2GS3 A;  5CRW A;  1ZOF A;  4HQZ A;  5JWO B;  5EY6 A;  4LL1 B;  2AYT A;  4X0X A;  1GL8 A;  2IIY A;  1QMV A;  3EWL A;  4BL7 B;  1G6Y A;  2OA7 A;  2OE3 A;  3FR9 A;  5FWG A;  1QFN A;  4MP4 A;  4O5R A;  3FY7 A;  4ECC A;  1XIY A;  1WMJ A;  3IDV A;  4IKH A;  3QFA C;  4ML6 A;  5IO0 A;  1EP7 A;  2DML A;  2FHE A;  1TOF A;  4PQ1 A;  4HI7 A;  3P90 A;  2VIM A;  2CZ3 A;  3WT2 A;  1VF3 A;  3WYW A;  5J41 A;  4CHS A;  4PUA A;  5KEJ A;  1XOA A;  4IEL A;  3P8W A;  2GT6 A;  3QOU A;  1R7H A;  3FZ5 A;  2AJQ B;  1PMT A;  1ZYE A;  1F37 A;  3BCI A;  2PBJ A;  3H8Q A;  1J9B A;  2YZH A;  4ZIJ A;  3TJB A;  2EIR A;  1ERT A;  4HUA A;  1O6J A;  1AQX A;  5A4W A;  1XVW A;  3LEF A;  3HVV A;  5ECS A;  1O85 A;  2B7J A;  2WDU A;  3HJM A;  2C0F A;  2FWE A;  5ID2 A;  3HHV A;  1Z9H A;  1K0M A;  2HFD A;  2IFQ A;  1AQW A;  2QGV A;  3ZVJ A;  2YJH A;  2Z9S A;  2ON7 A;  5J3R A;  4G0I A;  3GUR A;  2YWO A;  3EMX A;  2LRC A;  4XRA A;  4D73 A;  5F07 A;  4TR4 A;  4TXV A;  3PGT A;  1PL2 A;  2L4C A;  4V1A g;  1OC8 A;  3CSI A;  2HZE A;  4IVF A;  4ULX A;  5IPH A;  2WGR A;  1MD3 A;  2H66 A;  2X64 A;  2M80 A;  2X99 A;  3IAM 2;  1XWG A;  4I8B A;  2PPT A;  4K9Z A;  2LRT A;  3KMN A;  2C0G A;  4JR4 A;  1TK0 B;  2J9H A;  1EOG A;  1A2L A;  1GSU A;  4F0B A;  3ME8 A;  3UBL A;  5BMU A;  2G0F A; 
#chains in the Genus database with same CATH topology
 4QL9 A;  4EE0 A;  3CHX C;  4I97 A;  4TN8 A;  2NDO A;  3A2W A;  4YQM A;  3IV4 A;  4LA1 A;  5KN3 A;  1X0R A;  2XBQ A;  2HSY A;  2HXK A;  3L9S A;  3TKS A;  2PGT A;  4GSS A;  3J7Y b;  1ZYP A;  3KMO A;  5F05 A;  2X49 A;  1PN0 A;  4ZL8 A;  1K0N A;  5A4V A;  3ZLP A;  4IP6 A;  4POK A;  4GCI A;  1BED A;  2EC4 A;  1G0T A;  4IGJ A;  4YKF A;  11GS A;  3NOF A;  5DJL A;  2OT3 A;  4PNG A;  2KUC A;  4HU9 A;  3IC8 A;  5EPF A;  1PFO A;  2HRK A;  4JED A;  2QKE A;  1NHO A;  3E9J B;  5IMF A;  5DVB A;  1R4W A;  1XXU A;  4HOJ A;  4WR4 A;  3IHQ A;  3O6T A;  2X8H A;  1YQ1 A;  3CTF A;  4N30 A;  2EIO A;  3GMF A;  1EV4 A;  1OE8 A;  3LFL A;  3ZIJ A;  1NW2 A;  4DVC A;  3TB2 A;  2PVO C;  5GSS A;  1U3A A;  4MF7 A;  2A2R A;  4KDU A;  3HVX A;  1FW1 A;  1K3Y A;  2E0Q A;  3WGD A;  3TUE A;  2FY6 A;  2H1L A;  1XFL A;  3MYD A;  3UAP A;  3VWW A;  2VCW A;  1VF4 A;  3HJP A;  4YKG A;  2IWT A;  4JU5 A;  2R5G A;  4HZ4 A;  2JL4 A;  2O5V A;  2H30 A;  1JHB A;  3TKQ A;  1AXD A;  3VPT A;  1B9Y C;  4XCS A;  3TGZ A;  2DKI A;  4KAE A;  3G9B A;  3CSH A;  2H01 A;  3DYR A;  3LGC A;  4HSC X;  2TIR A;  1M3I A;  3DD3 A;  2K6V A;  1OC9 A;  3DVW A;  1ZCP A;  5AIS A;  3CRU A;  1WIK A;  3BD2 A;  1A8Y A;  2IJY A;  4GTU A;  3WT1 A;  5L71 A;  3F0I A;  4IP1 A;  1TTZ A;  2D2Z A;  2DBC A;  2MMO A;  4BPY A;  2GQM A;  4V2M A;  1SL2 B;  5ENU A;  2WVY A;  4IQA A;  2WZ9 A;  5A34 B;  3C73 A;  1X5C A;  2HSN A;  1AW9 A;  2NTO A;  2GZZ A;  1FAA A;  2GQL A;  3KH7 A;  1XW9 A;  5KN1 A;  3QAV A;  5CRG A;  3APQ A;  2DMM A;  4EC0 A;  1SYX A;  3OR5 A;  1OE7 A;  5AGY A;  3CMI A;  1HD2 A;  5D8I A;  2M46 A;  3AY8 A;  1V58 A;  4E8H A;  4AKI A;  3TOU A;  3DRN A;  3QPM A;  1WOU A;  5JCU A;  4I6X A;  1CQG A;  4X4J A;  5ID2 B;  2GT5 A;  4PUR A;  2KLX A;  2YV7 A;  2E7P A;  4GQF A;  3RHC A;  1ZL9 A;  1O8X A;  5HR0 A;  1GSD A;  1VF2 A;  4Z2R A;  1EEM A;  2LUS A;  5HFK A;  1E2Y A;  1GRX A;  1JZO A;  5HR2 A;  4HU7 A;  4YQU A;  4D73 B;  3QMX A;  1M2D A;  1UN2 A;  1TRV A;  2H73 A;  3APS A;  2FWG A;  1PQN A;  5J9C A;  4J56 E;  5F06 A;  4MH2 A;  1T7P B;  5DDL A;  1XWC A;  3VPQ A;  4EUY A;  1QQ2 A;  4MPG A;  2QA1 A;  1SVL A;  3UOM A;  1GH2 A;  1IYI A;  2H6X A;  4OFM A;  2GSR A;  4N0V A;  1VRS D;  3WGX A;  1THX A;  1O81 A;  1B9X C;  3GST A;  4RI7 A;  3CRT A;  1ZYN A;  1HQO A;  4DSQ A;  2I81 A;  5G30 A;  3M1G A;  4XIH A;  4XHM A;  1RW1 A;  1I5G A;  2N5B A;  2K9F A;  4CY8 A;  3RDW A;  1XZO A;  1HNB A;  1DE2 A;  2AHE A;  3ED3 A;  3EC3 A;  5HR1 A;  5IOW A;  1T3B A;  4PHZ C;  2C3N A;  5ECK B;  3J7Y k;  4K2X A;  4K0G A;  4L5L A;  1H75 A;  1ERU A;  1R5A A;  1V2A A;  3UJ1 A;  1NSW A;  1GSS A;  4F2I A;  4EIP A;  16GS A;  1ST9 A;  4EDZ A;  3DVX A;  2VL2 A;  1S3D A;  3HYP A;  4PTS A;  4FXY P;  1R5P A;  5HQP A;  4L5O A;  5D73 A;  4LLR A;  1OC3 A;  5DQS A;  1Z7P A;  4RQR A;  3QFB C;  3GHA A;  2MZC A;  1ZMA A;  4NPB A;  3E0U A;  1X9M B;  1Z6M A;  2WB9 A;  2B5E A;  3VWU A;  4POL A;  4ZL9 A;  4PI0 C;  2CAQ A;  5AN1 A;  5ECL B;  7GSS A;  4KND A;  2RUF A;  4YQV A;  2F9S A;  1AQV A;  2PU9 C;  4MLY A;  1AAZ A;  1E6B A;  20GS A;  2IMD A;  1SKS B;  3ISO A;  1B4P A;  5HR3 A;  1GLP A;  4KDY A;  2H71 A;  3W8J A;  4Q5Q A;  3D5J A;  5IQY A;  1N8J A;  3N9J A;  1TRU A;  2OJL A;  3A5W A;  1GP1 A;  5B7C A;  1SJ6 A;  1B4Q A;  5IMA A;  2YV9 A;  4LL4 B;  3CTG A;  2IL3 A;  4JE1 A;  4CY6 A;  4KGI A;  3C1S A;  2DIZ A;  4BVY A;  3TKS C;  1PX6 A;  3KEB A;  1GNE A;  1ABA A;  2JZT A;  4V1A p;  2P5Q A;  4POB A;  1ZYQ B;  1TI1 A;  2H1A A;  1MDK A;  1PGT A;  1S4B P;  3GX8 A;  1TK8 B;  1XW6 A;  4MZC A;  3G7J A;  4MF6 A;  1GUL A;  1OVN A;  2KOK A;  5CRE A;  1JFU A;  1SJI A;  2YWN A;  4ICY A;  2VCT A;  2DIY A;  3TKP A;  3HCZ A;  5ECR B;  4ZB6 A;  3HJO A;  4KB3 A;  4ACS A;  1U3I A;  3CXG A;  3M8N A;  1SKR B;  2R0C A;  5ECQ B;  2VCZ A;  3QR6 A;  1YDK A;  1PRX A;  3IR4 A;  3F63 A;  3U6V A;  4O5U A;  3FR3 A;  1PA3 A;  3DGQ A;  4GRF A;  4K7N A;  3F3R A;  1FO5 A;  3A2X A;  1A24 A;  1TXX A;  3GNJ A;  5IMD A;  3EPT A;  3H1N A;  1DE1 A;  1CQH A;  3NIV A;  2AV4 A;  5ECP B;  5FT3 A;  1J08 A;  2ZNM A;  4OCE A;  1TW9 A;  3VWV A;  1ILO A;  2AAW A;  2VOC A;  5JWR B;  1N25 A;  1V9W A;  3L9V A;  4FYB A;  1GTI A;  4KDX A;  4ZBD A;  2LJR A;  2O85 A;  4HQS A;  5B6N A;  2HE3 A;  1KTE A;  3VUR A;  2H76 A;  1VF1 A;  5J4V A;  1SEN A;  4IS0 A;  2RM6 A;  4BWS A;  4KH7 A;  4BVX B;  2G2Q A;  2H1B A;  3F6F A;  1FVK A;  4FH8 A;  4PUF C;  1SK1 A;  3CYN A;  4YAP A;  3CQF A;  3APO A;  1UVZ A;  2XPE A;  4KW6 A;  4J57 E;  1UC7 A;  1TRS A;  2HI7 A;  3KJY A;  2IMK A;  4OCF A;  2HRA A;  3US3 A;  3IXR A;  3W6G A;  1TDI A;  1BQ7 A;  5CP1 A;  1GNW A;  1YF1 A;  2WRT A;  1ZZY A;  4NHW A;  5FHI A;  2LJK A;  1YEX A;  4XS6 A;  2WW0 A;  1SU9 A;  4G0K A;  2H72 A;  4L0U A;  3GKN A;  4WF5 A;  5D9X A;  3GH6 A;  4DSS B;  1I9D A;  1A8L A;  3L78 A;  1YEP A;  3W8S A;  4MZW A;  2FWH A;  3HKR A;  4BWQ A;  4N11 A;  4TR1 B;  3RGB C;  3M0F A;  2I3Y A;  9GSS A;  1A2M A;  3DKS A;  1K0D A;  4OO4 A;  4Z7X A;  2I4A A;  2K8S A;  4IJI A;  2F8A A;  3F4S A;  1B8X A;  1UA5 A;  5A5H B;  4DSR A;  2KP2 A;  2R37 A;  3HDC A;  3PPU A;  1K0C A;  1OYJ A;  1O8W A;  2JAC A;  4PXO A;  2I1U A;  3D0Z A;  1XVQ A;  2IME A;  3MWH A;  4GQC A;  1X9W B;  5J4U A;  2YOI A;  2AB6 A;  3P7X A;  3VI7 A;  2R2J A;  4Z2T A;  3K8N A;  3MIX A;  4NWY A;  2E2G A;  4L8E A;  4NXI A;  4I5Q A;  2H1D A;  4MDC A;  4X1U A;  2QC7 A;  2H6Y A;  1GUM A;  4NAX A;  4BVY B;  1I1I P;  1IYH A;  1XWA A;  1XPV A;  2B3S A;  3KXO A;  1T00 A;  2LQQ A;  4Z2U A;  3HVN A;  3TRP A;  5IMZ A;  5DBQ A;  2GZP A;  1GSE A;  2ZUP A;  2DC5 A;  3FEU A;  1V40 A;  2RM5 A;  3M3M A;  4OO5 A;  5EVO A;  2CV4 A;  3ZFL A;  2LV3 A;  3QCP A;  3FKF A;  2VCX A;  3D4T A;  1ZGN A;  4ZB9 A;  1FG4 A;  4OFT A;  2V2G A;  4TRX A;  2FWF A;  5ABR A;  3EUR A;  5AIX A;  2YAN A;  4K5S A;  2PER A;  5JWQ B;  4F0C A;  3E3E A;  3BBY A;  2EFH A;  3MDK A;  1SL0 B;  5J5N A;  4L0W A;  2MMN A;  5IM9 A;  5KN2 A;  1BJX A;  4ZBB A;  3LYK A;  4MA9 A;  2OE1 A;  5C04 A;  2BTO T;  2IN3 A;  2B5Y A;  3G7Y A;  3IOS A;  4I2U A;  3IBH A;  3TJG A;  4IQ1 A;  2O36 A;  2HNL A;  2O87 A;  1AUC A;  4NV2 A;  4TR3 A;  3RBT A;  1JZR A;  2PMT A;  3D6I A;  3GFK A;  5DCH A;  2LKU A;  1PX7 A;  5H5S A;  5LCZ A;  4FQU A;  4HJ2 A;  5GZZ B;  1U88 A;  1M3J A;  2OE0 A;  4MJC A;  4QL7 A;  5ECM B;  5ECO B;  2H6Z A;  1B48 A;  2R0P A;  3Q19 A;  1ML6 A;  3S9F A;  1BF5 A;  2WJU A;  1K0A A;  2VD1 A;  2B6M A;  2DJ3 A;  2R3X A;  1PN9 A;  1KNG A;  1XG8 A;  3GRX A;  2YP6 A;  3U5R E;  4E8E A;  4PQH A;  4HDE A;  2WW3 A;  1AC1 A;  1A23 A;  22GS A;  4YH2 A;  5H5R A;  2FLS A;  1K3L A;  5DJM A;  5E59 A;  3GA4 A;  3CBU A;  2BMX A;  3KCM A;  2HRF A;  3DXB A;  5GST A;  3VK9 A;  6GSV A;  1QK8 A;  2P5R A;  1EZK A;  1C72 A;  4ZIL A;  5E4W A;  1TRW A;  3IE3 A;  2C0D A;  2O7K A;  3ERG A;  3L9U A;  3EE2 A;  1TU8 A;  4KSO A;  5G1K A;  2B1L A;  4AI6 A;  4KUN A;  1YKA A;  4F82 A;  3GL5 A;  5DAL A;  2C8U A;  2LTK A;  2FCH A;  2DKH A;  2DSA A;  3GTU A;  2P31 A;  2H1G A;  2C1Y A;  3KZQ A;  1YKC A;  1A0R P;  1PSQ A;  2FA4 A;  4MNN A;  2H0G A;  4NV5 A;  4BVX A;  3GUS A;  4KSM A;  2EFD A;  1YEW C;  4EDY A;  5BRT A;  3GKK A;  2LJA A;  3GSS A;  3KGK A;  1EOH A;  5D9V A;  3IRA A;  1ERV A;  1K3O A;  2F8F A;  3VFI A;  3ZMK A;  2MYG A;  1GSY A;  3HMJ G;  4G01 A;  5IMC A;  4EL1 A;  3TRX A;  2VAF A;  2CVK A;  2VL9 A;  2TRX A;  2VLU A;  2GTU A;  2R4V A;  3H79 A;  10GS A;  3C1R A;  3I43 A;  4Q5R A;  1RQM A;  1SK2 A;  3QAW A;  1A0F A;  3FZA A;  1F2E A;  1BG5 A;  5ECH B;  4MH3 A;  4DSS A;  1SVO A;  1M2A A;  3BOA A;  2VLV A;  4OD7 A;  2FD3 A;  1BYE A;  4JR6 A;  4TR1 A;  4AJ6 A;  2A2S A;  1G7E A;  5HFG A;  5D96 A;  4PNF A;  4IW9 A;  4IBP A;  1Y6E A;  5A5H A;  4AJ8 A;  2L57 A;  5C00 A;  2VM2 A;  4OFN A;  4Q5F A;  4K6X A;  4AKX B;  3CSJ A;  2C80 A;  5F8B A;  4XS4 B;  4G0L A;  5B6M A;  1JZD A;  1WWJ A;  5CRH A;  3GX0 A;  1O7U A;  3KIJ A;  3UEM A;  4BIK A;  1DBY A;  4G19 A;  4JRR A;  1V98 A;  2GVP A;  1M0U A;  1S3R A;  2XBI A;  2E2M A;  2GST A;  1FHE A;  2VD0 A;  3A3T A;  1XCC A;  1PKW A;  4WET A;  2R0G A;  4MJE A;  4FYU A;  1K0B A;  3I6A A;  1YZX A;  2GDR A;  2V6O A;  4TOP A;  2X8G A;  3FMW A;  4TW5 A;  3HY2 A;  3EMP A;  4XTS A;  2YWI A;  2YJ7 A;  5GAP D;  1Q98 A;  2O8V B;  3HXS A;  3HZ4 A;  3HVS A;  2RII A;  3TJJ A;  2HYX A;  5A5K A;  3RPP A;  2N5A A;  1HNC A;  1U87 A;  2KP1 A;  3FZ4 A;  3ZML A;  1PD2 1;  1MDI A;  4GST A;  2R6K A;  4K7I A;  4PI2 C;  4KCE A;  3RAZ A;  4PX1 A;  3UMA A;  2XPD A;  3C8E A;  3ERF A;  2CT6 A;  2BJX A;  2O89 A;  6GSX A;  4WF4 A;  5D93 A;  3F3Q A;  3IHG A;  3HA9 A;  4MCU A;  2CX3 A;  2DJ0 A;  3TRQ A;  6GSS A;  2GSS A;  2F51 A;  5ECN B;  2M72 A;  2J23 A;  3QDN A;  3FK8 A;  2C0E A;  5A1N A;  2A4V A;  4DEJ A;  3ZYW A;  2VLT A;  3Q6O A;  3TDG A;  3KD0 A;  2MBS A;  5ECI B;  4HS1 A;  5CO3 A;  1U6T A;  3F4T A;  1Y1U A;  1OKT A;  1G6W A;  4IN0 A;  3GH9 A;  1EGR A;  2JU5 A;  1S3A A;  3IA1 A;  2JAD A;  3RHB A;  1GTB A;  2WUL A;  1SL1 B;  3KH9 A;  3UVT A;  2OBI A;  4ZXG A;  2GGT A;  5DAL B;  4MAB A;  4WBJ A;  5DCG A;  4EKZ A;  3FHK A;  2OAD A;  1Y25 A;  1TP9 A;  2FNO A;  3GTU B;  3KTL A;  4AKG A;  2L4Q A;  1USB A;  1XBS A;  1OKD A;  5HFI A;  1FVJ A;  1V57 A;  1URM A;  2N5F A;  4G10 A;  4XRD A;  2C4J A;  2CA8 A;  2H8L A;  2V1M A;  2LEG A;  3DML A;  4E68 A;  4FYC A;  5B8B A;  2X8C A;  4ZB8 A;  3UVH A;  4EXJ A;  2A2P A;  2ES7 A;  2OBK A;  2FGX A;  2JSY A;  1T8E B;  1DSB A;  3JCM L;  1EEJ A;  2NBS A;  3I69 A;  2K18 A;  3UAR A;  4X43 A;  2EIQ A;  1F3A A;  3CWG A;  2HZF A;  4I2T A;  3WGE A;  2GLR A;  2ALB A;  3KTB A;  4LMV A;  1EWX A;  1WP0 A;  1H4O A;  3QD9 A;  5CNW A;  2NVL A;  3LW9 A;  4POM A;  1WRY A;  4Q5N A;  1WJK A;  3TKR A;  4EIQ A;  5DAK B;  3ERW A;  2OAC A;  8GSS A;  4MJB A;  2YN1 A;  4V2N A;  4WR5 A;  2YPM A;  2PWJ A;  2DJ2 A;  2HQT A;  1FB6 A;  1TKD B;  1MEK A;  4ECJ A;  5IIZ A;  4NHZ A;  4K7O A;  4K8M A;  1EV9 A;  1O73 A;  3IC4 A;  4FIW A;  3G7I A;  3KM6 A;  4ECI A;  1Z5Y E;  2RLI A;  1M9A A;  1TJD A;  3TOT A;  3TU3 B;  2EFC A;  1HYU A;  4TR0 A;  1LU4 A;  1KBN A;  2MMA A;  2VO4 A;  1QGV A;  2GSQ A;  5J40 A;  1YY7 A;  2HT9 A;  2ON5 A;  1XWK A;  4GSN A;  2I9H A;  2MMZ A;  2VM1 A;  1GSF A;  3LG6 A;  3LJR A;  4PQI A;  2YWM A;  1GTU A;  1Z6N A;  3P2A A;  3QAG A;  2HSM B;  3ZIT A;  2DJK A;  2LS5 A;  3FZ9 A;  5G5E A;  3TKS E;  3D4M A;  2L5O A;  4HEA 2;  3LQ7 A;  2OKA A;  3DWV A;  3O76 A;  5JCG A;  4WXT A;  3RFR C;  1N2A A;  1EP8 A;  1LJR A;  4O5Q A;  3EVI A;  3O3T A;  1BAY A;  3TJF A;  2LQO A;  3UL3 A;  2H70 A;  1M2B A;  13GS A;  1WPI A;  1X5E A;  3IK7 A;  1SYR A;  3F6D A;  2VKZ G;  2V32 A;  1THO A;  3ZZX A;  1W4V A;  3FRC A;  4WBR D;  1HNA A;  2VL2 C;  1SKW B;  3LXZ A;  14GS A;  2L6C A;  3I9V 2;  1JLV A;  1JZW A;  1W89 A;  5J9B A;  18GS A;  3EYT A;  5IO2 A;  1Z7R A;  2XHF A;  3ZRE A;  2MBT A;  2K8V A;  1TU7 A;  4GF0 A;  4G9H A;  2H0H A;  4JBB A;  4XS4 A;  3GN3 A;  4TXO A;  4HZ2 A;  5D9T A;  3MAK A;  2H19 A;  1QUW A;  4ID0 A;  5A1N B;  4O92 A;  2L6D A;  5G5F A;  3H93 A;  2REM A;  1WE0 A;  5KOX A;  3ZIV A;  5CRD A;  5A4U A;  2QSI A;  3SBC A;  3C71 A;  2CZ2 A;  1FOV A;  2WFC A;  3LWA A;  2P0G A;  1FOH A;  1PKZ A;  2JSZ A;  1SD9 A;  2TRC P;  1TI3 A;  2L59 A;  1TXU A;  3VI5 A;  3LXT A;  3FR6 A;  1SD8 A;  2YZU A;  2XC2 A;  5INY A;  4USS A;  5F0G A;  1GUH A;  3DIE A;  2DLX A;  4GXZ A;  2YCD A;  5B8A A;  4EF0 A;  1F3B A;  2WVX A;  3M9K A;  3EU4 A;  1F6M C;  1X5D A;  3MSZ A;  4O7H A;  2UZ8 A;  4ECB A;  3A2V A;  2WW1 A;  1R26 A;  3NZN A;  5ELG A;  3ZRD A;  2O3E A;  4TKY A;  3IAS 2;  12GS A;  4ZB7 A;  1F9M A;  3ME7 A;  4G2E A;  2H75 A;  3BCK A;  4K2D A;  1GWC A;  4N10 A;  4GDF A;  1KEB A;  2PUK C;  2VUP A;  3ZTL A;  2RUE A;  4QQ7 A;  4MZB A;  5CYY A;  5IPG A;  6GSY A;  2DJJ A;  3Q74 A;  5KN0 A;  1MTC A;  3ZL5 A;  4CW9 A;  4WKW A;  1GLQ A;  3H4K A;  4W66 A;  2LST A;  1AIU A;  3EIN A;  3UIW A;  1J0F A;  4F03 A;  5IOX A;  4BL7 A;  3DEX A;  4KA0 A;  3FW2 A;  1T4Z A;  4J2F A;  1NHY A;  2IFQ B;  4KCA A;  2GQK A;  2PVQ A;  1GTA A;  1XW5 A;  4N0Z A;  4O32 A;  4P3Y B;  2LRN A;  2LNS A;  3LSZ A;  4YAV A;  4GLT A;  1T4Y A;  2AUV A;  4KE3 A;  2YNX A;  6GST A;  1T1V A;  5DQY A;  2C3T A;  3F4R A;  4HJM A;  3GKX A;  1MDJ A;  1XOB A;  1MD4 A;  2HZE B;  2CVD A;  1SK0 A;  4WEY A;  4OMV A;  4MJA A;  2CVB A;  3D22 A;  5ELA A;  4CDO A;  2LNT A;  1YJ6 A;  3EU3 A;  4H86 A;  3R2Q A;  1SJZ A;  2WS2 A;  3FYG A;  4MK3 A;  1Q4J A;  3LOR A;  3F8U A;  3RPN A;  2CAI A;  2FUG 2;  5GAN D;  4KF9 A;  5BMU B;  4MPF A;  3GYK A;  2WCI A;  1K0O A;  5G31 A;  3HZ8 A;  3UBK A;  6GSW A;  2NPB A;  4KX4 A;  2IPA A;  3WD6 A;  1RK4 A;  2V6K A;  3GKM A;  2V41 A;  1QXH A;  3VWX A;  4MF5 A;  5DAK A;  2VL3 A;  1M9B A;  4A5P A;  1ERW A;  2H0I A;  4RUV A;  2CX4 A;  4ML1 A;  3GIX A;  5LNK e;  3IPZ A;  5EL8 A;  4AJ7 A;  1ON4 A;  4BA7 A;  3BJ5 A;  1M7T A;  2JZS A;  2HRK B;  5CAX A;  3M9J A;  2KHP A;  5IMV A;  3GL3 A;  2WVZ A;  1EGO A;  5G2Z A;  4MMM A;  2FA8 A;  4PGT A;  4ISD A;  1BX9 A;  2EFE A;  3LYP A;  6GSU A;  1YVL A;  4TXO B;  3ZVJ D;  2JZR A;  19GS A;  4FO5 A;  4IHU A;  1GSQ A;  3F9U A;  3PH9 A;  3TCO A;  1TK5 B;  1VGL A;  1XWB A;  2CQ9 A;  3GV1 A;  1SVM A;  1NM3 A;  1PL1 A;  4EVM A;  5LD0 A;  2B5X A;  3A5I A;  4LMW A;  4TVE A;  4RI6 A;  2HSM A;  5COH A;  5H5Q A;  1OAZ A;  4V2L A;  3IK9 A;  1FB0 A;  4K5R A;  3N5O A;  3Q18 A;  1LBK A;  2C3Q A;  2H74 A;  4IJ3 A;  1S3C A;  5D9W A;  2VCV A;  2WZS A;  3SWL A;  2HLS A;  3C7M A;  2B7K A;  1YF0 A;  2A4H A;  2GZY A;  4XS1 A;  2HSH A;  3PIN A;  2IMF A;  4ZL7 A;  4F9Z A;  3PR8 A;  3HD5 A;  2L5L A;  3D21 A;  2UV8 G;  2B1K A;  2PN8 A;  4RQX A;  2WVX B;  1OC9 B;  1JLW A;  2IMI A;  5G1L A;  1ACV A;  4K1F A;  3ZFB A;  4AKH A;  3R3E A;  1X9S B;  5AIV A;  4NMU A;  3VLN A;  3TJK A;  17GS A;  4K0N A;  4N3Z A;  2DJ1 A;  2ZCT A;  4GWR A;  2QA2 A;  3KP8 A;  3L4N A;  4ZBA A;  1DUG A;  4AGS A;  1GUK A;  2HSN B;  2HRN A;  4OWY A;  4AF2 A;  2VCQ A;  1G7O A;  4EO3 A;  1A2J A;  4ILF A;  3KP9 A;  2F3M A;  1M99 A;  3V1W A;  3L0H A;  2X4A A;  4JZQ A;  1Z3E A;  3MNG A;  5JCW A;  2GS3 A;  5CRW A;  1ZOF A;  4HQZ A;  5JWO B;  5EY6 A;  4LL1 B;  2AYT A;  4X0X A;  5J47 A;  1GL8 A;  2IIY A;  1QMV A;  3EWL A;  4BL7 B;  2WW2 A;  1G6Y A;  2OA7 A;  2OE3 A;  3FR9 A;  5FWG A;  1QFN A;  4MP4 A;  4O5R A;  3FY7 A;  4ECC A;  1XIY A;  1WMJ A;  3IDV A;  4IKH A;  3QFA C;  4ML6 A;  1BG1 A;  5IO0 A;  1EP7 A;  2DML A;  4QMK A;  2FHE A;  1TOF A;  4PQ1 A;  4HI7 A;  3P90 A;  2VIM A;  2CZ3 A;  3WT2 A;  1VF3 A;  3WYW A;  5J41 A;  4CHS A;  4PUA A;  5J4Y A;  5KEJ A;  1XOA A;  4IEL A;  3P8W A;  2GT6 A;  3QOU A;  5A34 A;  1R7H A;  3FZ5 A;  2AJQ B;  1PMT A;  1ZYE A;  1F37 A;  3BCI A;  2PBJ A;  3H8Q A;  1J9B A;  2YZH A;  4ZIJ A;  3TJB A;  5KOW A;  2EIR A;  1ERT A;  1O6J A;  4HUA A;  1AQX A;  5A4W A;  1XVW A;  3LEF A;  3HVV A;  5ECS A;  1O85 A;  2B7J A;  2WDU A;  3HJM A;  2C0F A;  2FWE A;  5ID2 A;  3HHV A;  1Z9H A;  1K0M A;  2HFD A;  2IFQ A;  1AQW A;  2QGV A;  3ZVJ A;  2YJH A;  2Z9S A;  2ON7 A;  5J3R A;  4G0I A;  3GUR A;  2YWO A;  3EMX A;  2LRC A;  4XRA A;  4D73 A;  5F07 A;  4TR4 A;  4TXV A;  3PGT A;  1PL2 A;  2L4C A;  4V1A g;  1OC8 A;  3CSI A;  2HZE A;  4IVF A;  4ULX A;  5IPH A;  2WGR A;  1MD3 A;  2H66 A;  2X64 A;  2M80 A;  2X99 A;  3IAM 2;  1XWG A;  4I8B A;  2PPT A;  4K9Z A;  2LRT A;  3KMN A;  2C0G A;  4JR4 A;  1TK0 B;  2J9H A;  1EOG A;  1A2L A;  1GSU A;  4F0B A;  3ME8 A;  3UBL A;  5BMU A;  2G0F A; 
#chains in the Genus database with same CATH homology
 4QL9 A;  4EE0 A;  4I97 A;  4TN8 A;  2NDO A;  3A2W A;  4YQM A;  3IV4 A;  4LA1 A;  5KN3 A;  1X0R A;  2XBQ A;  2HSY A;  2HXK A;  3L9S A;  3TKS A;  2PGT A;  4GSS A;  3J7Y b;  1ZYP A;  3KMO A;  5F05 A;  2X49 A;  1PN0 A;  4ZL8 A;  1K0N A;  5A4V A;  3ZLP A;  4IP6 A;  4POK A;  4GCI A;  1BED A;  2EC4 A;  1G0T A;  4IGJ A;  4YKF A;  11GS A;  3NOF A;  5DJL A;  2OT3 A;  4PNG A;  2KUC A;  4HU9 A;  3IC8 A;  5EPF A;  2HRK A;  4JED A;  2QKE A;  1NHO A;  3E9J B;  5IMF A;  5DVB A;  1R4W A;  1XXU A;  4HOJ A;  4WR4 A;  3IHQ A;  3O6T A;  2X8H A;  1YQ1 A;  3CTF A;  4N30 A;  2EIO A;  3GMF A;  1EV4 A;  1OE8 A;  3LFL A;  3ZIJ A;  1NW2 A;  4DVC A;  3TB2 A;  2PVO C;  5GSS A;  1U3A A;  4MF7 A;  2A2R A;  4KDU A;  3HVX A;  1FW1 A;  1K3Y A;  2E0Q A;  3WGD A;  3TUE A;  2FY6 A;  2H1L A;  1XFL A;  3MYD A;  3UAP A;  3VWW A;  2VCW A;  1VF4 A;  3HJP A;  4YKG A;  2IWT A;  4JU5 A;  2R5G A;  4HZ4 A;  2JL4 A;  2O5V A;  2H30 A;  1JHB A;  3TKQ A;  1AXD A;  3VPT A;  1B9Y C;  4XCS A;  3TGZ A;  2DKI A;  4KAE A;  3G9B A;  3CSH A;  2H01 A;  3DYR A;  3LGC A;  2TIR A;  3DD3 A;  2K6V A;  1OC9 A;  3DVW A;  1ZCP A;  5AIS A;  3CRU A;  1WIK A;  3BD2 A;  1A8Y A;  2IJY A;  4GTU A;  3WT1 A;  5L71 A;  3F0I A;  4IP1 A;  1TTZ A;  2D2Z A;  2DBC A;  2MMO A;  4BPY A;  2GQM A;  4V2M A;  1SL2 B;  5ENU A;  4IQA A;  2WZ9 A;  5A34 B;  3C73 A;  1X5C A;  2HSN A;  1AW9 A;  2NTO A;  2GZZ A;  1FAA A;  2GQL A;  3KH7 A;  1XW9 A;  5KN1 A;  3QAV A;  5CRG A;  3APQ A;  2DMM A;  4EC0 A;  1SYX A;  3OR5 A;  1OE7 A;  5AGY A;  3CMI A;  1HD2 A;  5D8I A;  2M46 A;  3AY8 A;  1V58 A;  4E8H A;  4AKI A;  3TOU A;  3DRN A;  3QPM A;  1WOU A;  5JCU A;  4I6X A;  1CQG A;  4X4J A;  5ID2 B;  2GT5 A;  4PUR A;  2KLX A;  2YV7 A;  2E7P A;  4GQF A;  3RHC A;  1ZL9 A;  1O8X A;  5HR0 A;  1GSD A;  1VF2 A;  4Z2R A;  1EEM A;  2LUS A;  5HFK A;  1E2Y A;  1GRX A;  1JZO A;  5HR2 A;  4HU7 A;  4YQU A;  4D73 B;  3QMX A;  1M2D A;  1UN2 A;  1TRV A;  2H73 A;  3APS A;  2FWG A;  1PQN A;  5J9C A;  4J56 E;  5F06 A;  4MH2 A;  1T7P B;  5DDL A;  1XWC A;  3VPQ A;  4EUY A;  1QQ2 A;  4MPG A;  2QA1 A;  1SVL A;  3UOM A;  1GH2 A;  1IYI A;  2H6X A;  4OFM A;  2GSR A;  4N0V A;  1VRS D;  3WGX A;  1THX A;  1O81 A;  1B9X C;  3GST A;  4RI7 A;  3CRT A;  1ZYN A;  1HQO A;  4DSQ A;  2I81 A;  5G30 A;  3M1G A;  4XIH A;  4XHM A;  1RW1 A;  1I5G A;  2N5B A;  2K9F A;  4CY8 A;  3RDW A;  1XZO A;  1HNB A;  1DE2 A;  2AHE A;  3ED3 A;  3EC3 A;  5HR1 A;  5IOW A;  1T3B A;  2C3N A;  5ECK B;  3J7Y k;  4K2X A;  4K0G A;  4L5L A;  1H75 A;  1ERU A;  1R5A A;  1V2A A;  3UJ1 A;  1NSW A;  1GSS A;  4F2I A;  4EIP A;  16GS A;  1ST9 A;  4EDZ A;  3DVX A;  2VL2 A;  1S3D A;  3HYP A;  4PTS A;  1R5P A;  5HQP A;  4L5O A;  5D73 A;  4LLR A;  1OC3 A;  5DQS A;  1Z7P A;  4RQR A;  3QFB C;  3GHA A;  2MZC A;  1ZMA A;  4NPB A;  3E0U A;  1X9M B;  1Z6M A;  2WB9 A;  2B5E A;  3VWU A;  4POL A;  4ZL9 A;  2CAQ A;  5AN1 A;  5ECL B;  7GSS A;  4KND A;  2RUF A;  4YQV A;  2F9S A;  1AQV A;  2PU9 C;  4MLY A;  1AAZ A;  1E6B A;  20GS A;  2IMD A;  1SKS B;  3ISO A;  1B4P A;  5HR3 A;  1GLP A;  4KDY A;  2H71 A;  3W8J A;  4Q5Q A;  3D5J A;  5IQY A;  1N8J A;  3N9J A;  1TRU A;  2OJL A;  3A5W A;  1GP1 A;  5B7C A;  1SJ6 A;  1B4Q A;  5IMA A;  2YV9 A;  4LL4 B;  3CTG A;  2IL3 A;  4JE1 A;  4CY6 A;  4KGI A;  3C1S A;  2DIZ A;  4BVY A;  3TKS C;  1PX6 A;  3KEB A;  1GNE A;  1ABA A;  2JZT A;  4V1A p;  2P5Q A;  4POB A;  1ZYQ B;  1TI1 A;  2H1A A;  1MDK A;  1PGT A;  3GX8 A;  1TK8 B;  1XW6 A;  4MZC A;  3G7J A;  4MF6 A;  1GUL A;  1OVN A;  2KOK A;  5CRE A;  1JFU A;  1SJI A;  2YWN A;  4ICY A;  2VCT A;  2DIY A;  3TKP A;  3HCZ A;  5ECR B;  4ZB6 A;  3HJO A;  4KB3 A;  4ACS A;  1U3I A;  3CXG A;  3M8N A;  1SKR B;  2R0C A;  5ECQ B;  2VCZ A;  3QR6 A;  1YDK A;  1PRX A;  3IR4 A;  3F63 A;  3U6V A;  4O5U A;  3FR3 A;  1PA3 A;  3DGQ A;  4GRF A;  4K7N A;  3F3R A;  1FO5 A;  3A2X A;  1A24 A;  1TXX A;  3GNJ A;  5IMD A;  3EPT A;  3H1N A;  1DE1 A;  1CQH A;  3NIV A;  2AV4 A;  5ECP B;  5FT3 A;  1J08 A;  2ZNM A;  4OCE A;  1TW9 A;  3VWV A;  1ILO A;  2AAW A;  2VOC A;  5JWR B;  1N25 A;  1V9W A;  3L9V A;  4FYB A;  1GTI A;  4KDX A;  4ZBD A;  2LJR A;  2O85 A;  4HQS A;  5B6N A;  2HE3 A;  1KTE A;  3VUR A;  2H76 A;  1VF1 A;  5J4V A;  1SEN A;  4IS0 A;  2RM6 A;  4BWS A;  4KH7 A;  4BVX B;  2G2Q A;  2H1B A;  3F6F A;  1FVK A;  4FH8 A;  4PUF C;  1SK1 A;  3CYN A;  4YAP A;  3APO A;  1UVZ A;  2XPE A;  4KW6 A;  4J57 E;  1UC7 A;  1TRS A;  2HI7 A;  3KJY A;  2IMK A;  4OCF A;  2HRA A;  3US3 A;  3IXR A;  3W6G A;  1TDI A;  1BQ7 A;  5CP1 A;  1GNW A;  1YF1 A;  2WRT A;  1ZZY A;  4NHW A;  5FHI A;  2LJK A;  1YEX A;  4XS6 A;  1SU9 A;  4G0K A;  2H72 A;  4L0U A;  3GKN A;  4WF5 A;  5D9X A;  3GH6 A;  4DSS B;  1I9D A;  3L78 A;  1A8L A;  1YEP A;  3W8S A;  4MZW A;  2FWH A;  3HKR A;  4BWQ A;  4N11 A;  4TR1 B;  2I3Y A;  3M0F A;  9GSS A;  1A2M A;  3DKS A;  1K0D A;  4OO4 A;  4Z7X A;  2I4A A;  2K8S A;  4IJI A;  2F8A A;  3F4S A;  1B8X A;  1UA5 A;  5A5H B;  4DSR A;  2KP2 A;  2R37 A;  3HDC A;  3PPU A;  1K0C A;  1OYJ A;  1O8W A;  2JAC A;  4PXO A;  2I1U A;  3D0Z A;  1XVQ A;  2IME A;  3MWH A;  4GQC A;  1X9W B;  5J4U A;  2YOI A;  2AB6 A;  3P7X A;  3VI7 A;  2R2J A;  4Z2T A;  3K8N A;  3MIX A;  4NWY A;  2E2G A;  4L8E A;  4NXI A;  4I5Q A;  2H1D A;  4MDC A;  4X1U A;  2QC7 A;  2H6Y A;  1GUM A;  4NAX A;  4BVY B;  1IYH A;  1XWA A;  1XPV A;  2B3S A;  3KXO A;  1T00 A;  2LQQ A;  4Z2U A;  3TRP A;  5IMZ A;  5DBQ A;  2GZP A;  1GSE A;  2ZUP A;  2DC5 A;  3FEU A;  1V40 A;  2RM5 A;  3M3M A;  4OO5 A;  5EVO A;  2CV4 A;  3ZFL A;  2LV3 A;  3QCP A;  3FKF A;  2VCX A;  3D4T A;  1ZGN A;  4ZB9 A;  1FG4 A;  4OFT A;  2V2G A;  4TRX A;  2FWF A;  5ABR A;  3EUR A;  5AIX A;  2YAN A;  4K5S A;  2PER A;  5JWQ B;  4F0C A;  3E3E A;  3BBY A;  2EFH A;  3MDK A;  1SL0 B;  5J5N A;  4L0W A;  2MMN A;  5IM9 A;  5KN2 A;  1BJX A;  4ZBB A;  3LYK A;  4MA9 A;  2OE1 A;  5C04 A;  2BTO T;  2IN3 A;  2B5Y A;  3G7Y A;  3IOS A;  4I2U A;  3IBH A;  3TJG A;  4IQ1 A;  2HNL A;  2O87 A;  1AUC A;  4NV2 A;  4TR3 A;  3RBT A;  1JZR A;  2PMT A;  3D6I A;  3GFK A;  5DCH A;  2LKU A;  1PX7 A;  5H5S A;  5LCZ A;  4FQU A;  4HJ2 A;  5GZZ B;  1U88 A;  2OE0 A;  4MJC A;  4QL7 A;  5ECM B;  5ECO B;  2H6Z A;  1B48 A;  2R0P A;  3Q19 A;  1ML6 A;  3S9F A;  1BF5 A;  2WJU A;  1K0A A;  2VD1 A;  2B6M A;  2DJ3 A;  2R3X A;  1PN9 A;  1KNG A;  3GRX A;  2YP6 A;  3U5R E;  4E8E A;  4PQH A;  4HDE A;  1AC1 A;  1A23 A;  22GS A;  4YH2 A;  5H5R A;  2FLS A;  1K3L A;  5DJM A;  5E59 A;  3GA4 A;  3CBU A;  2BMX A;  3KCM A;  2HRF A;  3DXB A;  5GST A;  3VK9 A;  6GSV A;  1QK8 A;  2P5R A;  1EZK A;  1C72 A;  4ZIL A;  5E4W A;  1TRW A;  3IE3 A;  2C0D A;  2O7K A;  3ERG A;  3L9U A;  3EE2 A;  1TU8 A;  4KSO A;  5G1K A;  2B1L A;  4AI6 A;  4KUN A;  1YKA A;  4F82 A;  3GL5 A;  5DAL A;  2C8U A;  2LTK A;  2FCH A;  2DKH A;  2DSA A;  3GTU A;  2P31 A;  2H1G A;  2C1Y A;  3KZQ A;  1YKC A;  1A0R P;  1PSQ A;  2FA4 A;  4MNN A;  2H0G A;  4NV5 A;  4BVX A;  3GUS A;  4KSM A;  2EFD A;  4EDY A;  5BRT A;  3GKK A;  2LJA A;  3GSS A;  3KGK A;  1EOH A;  5D9V A;  3IRA A;  1ERV A;  1K3O A;  2F8F A;  3VFI A;  3ZMK A;  2MYG A;  1GSY A;  3HMJ G;  4G01 A;  5IMC A;  4EL1 A;  3TRX A;  2VAF A;  2CVK A;  2VL9 A;  2TRX A;  2VLU A;  2GTU A;  2R4V A;  3H79 A;  10GS A;  3C1R A;  3I43 A;  4Q5R A;  1RQM A;  1SK2 A;  3QAW A;  1A0F A;  3FZA A;  1F2E A;  1BG5 A;  5ECH B;  4MH3 A;  4DSS A;  1SVO A;  1M2A A;  3BOA A;  2VLV A;  4OD7 A;  2FD3 A;  1BYE A;  4JR6 A;  4TR1 A;  4AJ6 A;  2A2S A;  1G7E A;  5HFG A;  5D96 A;  4PNF A;  4IW9 A;  4IBP A;  1Y6E A;  5A5H A;  4AJ8 A;  2L57 A;  5C00 A;  2VM2 A;  4OFN A;  4Q5F A;  4K6X A;  4AKX B;  3CSJ A;  2C80 A;  5F8B A;  4XS4 B;  4G0L A;  5B6M A;  1JZD A;  1WWJ A;  5CRH A;  3GX0 A;  1O7U A;  3KIJ A;  3UEM A;  1DBY A;  4G19 A;  4JRR A;  1V98 A;  2GVP A;  1M0U A;  2XBI A;  2E2M A;  2GST A;  1FHE A;  2VD0 A;  3A3T A;  1XCC A;  1PKW A;  4WET A;  2R0G A;  4MJE A;  4FYU A;  1K0B A;  3I6A A;  1YZX A;  2GDR A;  2V6O A;  4TOP A;  2X8G A;  3FMW A;  4TW5 A;  3HY2 A;  3EMP A;  4XTS A;  2YWI A;  2YJ7 A;  5GAP D;  1Q98 A;  2O8V B;  3HXS A;  3HZ4 A;  3HVS A;  2RII A;  3TJJ A;  2HYX A;  5A5K A;  3RPP A;  2N5A A;  1HNC A;  1U87 A;  2KP1 A;  3FZ4 A;  3ZML A;  1PD2 1;  1MDI A;  4GST A;  2R6K A;  4K7I A;  3UMA A;  4KCE A;  3RAZ A;  4PX1 A;  2XPD A;  3C8E A;  3ERF A;  2CT6 A;  2BJX A;  2O89 A;  6GSX A;  4WF4 A;  5D93 A;  3F3Q A;  3IHG A;  3HA9 A;  4MCU A;  2CX3 A;  2DJ0 A;  3TRQ A;  6GSS A;  2GSS A;  2F51 A;  5ECN B;  2M72 A;  2J23 A;  3QDN A;  3FK8 A;  2C0E A;  5A1N A;  2A4V A;  4DEJ A;  3ZYW A;  2VLT A;  3Q6O A;  3TDG A;  3KD0 A;  2MBS A;  5ECI B;  4HS1 A;  5CO3 A;  1U6T A;  3F4T A;  1Y1U A;  1OKT A;  1G6W A;  4IN0 A;  3GH9 A;  1EGR A;  2JU5 A;  1S3A A;  3IA1 A;  2JAD A;  3RHB A;  1GTB A;  2WUL A;  1SL1 B;  3KH9 A;  3UVT A;  2OBI A;  4ZXG A;  2GGT A;  5DAL B;  4MAB A;  4WBJ A;  5DCG A;  4EKZ A;  3FHK A;  2OAD A;  1Y25 A;  1TP9 A;  2FNO A;  3GTU B;  3KTL A;  4AKG A;  2L4Q A;  1USB A;  1XBS A;  1OKD A;  5HFI A;  1FVJ A;  1V57 A;  1URM A;  2N5F A;  4G10 A;  4XRD A;  2C4J A;  2CA8 A;  2H8L A;  2V1M A;  2LEG A;  3DML A;  4E68 A;  4FYC A;  5B8B A;  2X8C A;  4ZB8 A;  3UVH A;  4EXJ A;  2A2P A;  2ES7 A;  2OBK A;  2FGX A;  2JSY A;  1T8E B;  1DSB A;  3JCM L;  1EEJ A;  2NBS A;  3I69 A;  2K18 A;  3UAR A;  4X43 A;  2EIQ A;  1F3A A;  3CWG A;  2HZF A;  4I2T A;  3WGE A;  2GLR A;  2ALB A;  3KTB A;  4LMV A;  1EWX A;  1WP0 A;  1H4O A;  3QD9 A;  5CNW A;  2NVL A;  3LW9 A;  4POM A;  1WRY A;  4Q5N A;  1WJK A;  3TKR A;  4EIQ A;  5DAK B;  3ERW A;  2OAC A;  8GSS A;  4MJB A;  2YN1 A;  4V2N A;  4WR5 A;  2YPM A;  2PWJ A;  2DJ2 A;  2HQT A;  1FB6 A;  1TKD B;  1MEK A;  4ECJ A;  5IIZ A;  4NHZ A;  4K7O A;  4K8M A;  1EV9 A;  1O73 A;  3IC4 A;  4FIW A;  3G7I A;  3KM6 A;  4ECI A;  1Z5Y E;  2RLI A;  1M9A A;  1TJD A;  3TOT A;  3TU3 B;  2EFC A;  1HYU A;  4TR0 A;  1LU4 A;  1KBN A;  2MMA A;  2VO4 A;  1QGV A;  2GSQ A;  5J40 A;  1YY7 A;  2HT9 A;  2ON5 A;  1XWK A;  4GSN A;  2I9H A;  2MMZ A;  2VM1 A;  1GSF A;  3LG6 A;  3LJR A;  4PQI A;  2YWM A;  1GTU A;  1Z6N A;  3P2A A;  3QAG A;  2HSM B;  3ZIT A;  2DJK A;  2LS5 A;  3FZ9 A;  5G5E A;  3TKS E;  3D4M A;  2L5O A;  4HEA 2;  3LQ7 A;  2OKA A;  3DWV A;  3O76 A;  5JCG A;  4WXT A;  1N2A A;  1EP8 A;  1LJR A;  4O5Q A;  3EVI A;  3O3T A;  1BAY A;  3TJF A;  2LQO A;  3UL3 A;  2H70 A;  1M2B A;  13GS A;  1WPI A;  1X5E A;  3IK7 A;  1SYR A;  3F6D A;  2VKZ G;  2V32 A;  1THO A;  3ZZX A;  1W4V A;  3FRC A;  4WBR D;  1HNA A;  2VL2 C;  1SKW B;  3LXZ A;  14GS A;  2L6C A;  3I9V 2;  1JLV A;  1JZW A;  1W89 A;  5J9B A;  18GS A;  3EYT A;  5IO2 A;  1Z7R A;  2XHF A;  3ZRE A;  2MBT A;  2K8V A;  1TU7 A;  4GF0 A;  4G9H A;  2H0H A;  4JBB A;  4XS4 A;  3GN3 A;  4TXO A;  4HZ2 A;  5D9T A;  3MAK A;  2H19 A;  1QUW A;  4ID0 A;  5A1N B;  4O92 A;  2L6D A;  5G5F A;  3H93 A;  2REM A;  1WE0 A;  5KOX A;  3ZIV A;  5CRD A;  5A4U A;  2QSI A;  3SBC A;  3C71 A;  2CZ2 A;  1FOV A;  2WFC A;  3LWA A;  2P0G A;  1FOH A;  1PKZ A;  2JSZ A;  1SD9 A;  2TRC P;  1TI3 A;  2L59 A;  1TXU A;  3VI5 A;  3LXT A;  3FR6 A;  1SD8 A;  2YZU A;  2XC2 A;  5INY A;  4USS A;  5F0G A;  1GUH A;  3DIE A;  2DLX A;  4GXZ A;  2YCD A;  5B8A A;  4EF0 A;  1F3B A;  3M9K A;  3EU4 A;  1F6M C;  1X5D A;  3MSZ A;  4O7H A;  2UZ8 A;  4ECB A;  3A2V A;  1R26 A;  3NZN A;  5ELG A;  3ZRD A;  4TKY A;  3IAS 2;  12GS A;  4ZB7 A;  1F9M A;  3ME7 A;  4G2E A;  2H75 A;  3BCK A;  4K2D A;  1GWC A;  4N10 A;  4GDF A;  1KEB A;  2PUK C;  2VUP A;  3ZTL A;  2RUE A;  4QQ7 A;  4MZB A;  5CYY A;  5IPG A;  6GSY A;  2DJJ A;  3Q74 A;  5KN0 A;  1MTC A;  3ZL5 A;  4CW9 A;  4WKW A;  1GLQ A;  3H4K A;  4W66 A;  2LST A;  1AIU A;  3EIN A;  3UIW A;  1J0F A;  4F03 A;  5IOX A;  4BL7 A;  3DEX A;  4KA0 A;  3FW2 A;  1T4Z A;  4J2F A;  1NHY A;  2IFQ B;  4KCA A;  2GQK A;  2PVQ A;  1GTA A;  1XW5 A;  4N0Z A;  4O32 A;  4P3Y B;  2LRN A;  2LNS A;  3LSZ A;  4YAV A;  4GLT A;  1T4Y A;  2AUV A;  4KE3 A;  2YNX A;  6GST A;  1T1V A;  5DQY A;  2C3T A;  3F4R A;  4HJM A;  3GKX A;  1MDJ A;  1XOB A;  1MD4 A;  2HZE B;  2CVD A;  1SK0 A;  4WEY A;  4OMV A;  4MJA A;  2CVB A;  3D22 A;  5ELA A;  4CDO A;  2LNT A;  1YJ6 A;  3EU3 A;  4H86 A;  3R2Q A;  1SJZ A;  2WS2 A;  3FYG A;  4MK3 A;  1Q4J A;  3LOR A;  3F8U A;  3RPN A;  2CAI A;  2FUG 2;  5GAN D;  4KF9 A;  5BMU B;  4MPF A;  3GYK A;  2WCI A;  1K0O A;  5G31 A;  3HZ8 A;  3UBK A;  6GSW A;  2NPB A;  4KX4 A;  2IPA A;  3WD6 A;  1RK4 A;  2V6K A;  3GKM A;  2V41 A;  1QXH A;  3VWX A;  4MF5 A;  5DAK A;  2VL3 A;  1M9B A;  4A5P A;  1ERW A;  2H0I A;  4RUV A;  2CX4 A;  4ML1 A;  3GIX A;  5LNK e;  3IPZ A;  5EL8 A;  4AJ7 A;  1ON4 A;  4BA7 A;  3BJ5 A;  1M7T A;  2JZS A;  2HRK B;  5CAX A;  3M9J A;  2KHP A;  5IMV A;  3GL3 A;  1EGO A;  5G2Z A;  4MMM A;  2FA8 A;  4PGT A;  4ISD A;  1BX9 A;  2EFE A;  3LYP A;  6GSU A;  1YVL A;  4TXO B;  3ZVJ D;  2JZR A;  19GS A;  4FO5 A;  4IHU A;  1GSQ A;  3F9U A;  3PH9 A;  3TCO A;  1TK5 B;  1VGL A;  1XWB A;  2CQ9 A;  3GV1 A;  1SVM A;  1NM3 A;  1PL1 A;  4EVM A;  5LD0 A;  2B5X A;  3A5I A;  4LMW A;  4TVE A;  4RI6 A;  2HSM A;  5COH A;  5H5Q A;  1OAZ A;  4V2L A;  3IK9 A;  1FB0 A;  4K5R A;  3N5O A;  3Q18 A;  1LBK A;  2C3Q A;  2H74 A;  4IJ3 A;  1S3C A;  5D9W A;  2VCV A;  3SWL A;  2HLS A;  3C7M A;  2B7K A;  1YF0 A;  2A4H A;  2GZY A;  4XS1 A;  2HSH A;  3PIN A;  2IMF A;  4ZL7 A;  4F9Z A;  3PR8 A;  3HD5 A;  2L5L A;  3D21 A;  2UV8 G;  2B1K A;  2PN8 A;  4RQX A;  1OC9 B;  1JLW A;  2IMI A;  5G1L A;  1ACV A;  4K1F A;  3ZFB A;  4AKH A;  3R3E A;  1X9S B;  5AIV A;  4NMU A;  3VLN A;  3TJK A;  17GS A;  4K0N A;  4N3Z A;  2DJ1 A;  2ZCT A;  4GWR A;  2QA2 A;  3KP8 A;  3L4N A;  4ZBA A;  1DUG A;  4AGS A;  1GUK A;  2HSN B;  2HRN A;  4OWY A;  4AF2 A;  2VCQ A;  1G7O A;  4EO3 A;  1A2J A;  4ILF A;  3KP9 A;  2F3M A;  1M99 A;  3V1W A;  3L0H A;  2X4A A;  4JZQ A;  1Z3E A;  3MNG A;  5JCW A;  2GS3 A;  5CRW A;  1ZOF A;  4HQZ A;  5JWO B;  5EY6 A;  4LL1 B;  2AYT A;  4X0X A;  5J47 A;  1GL8 A;  2IIY A;  1QMV A;  3EWL A;  4BL7 B;  1G6Y A;  2OA7 A;  2OE3 A;  3FR9 A;  5FWG A;  1QFN A;  4MP4 A;  4O5R A;  3FY7 A;  4ECC A;  1XIY A;  1WMJ A;  3IDV A;  4IKH A;  3QFA C;  4ML6 A;  1BG1 A;  5IO0 A;  1EP7 A;  2DML A;  4QMK A;  2FHE A;  1TOF A;  4PQ1 A;  4HI7 A;  3P90 A;  2VIM A;  2CZ3 A;  3WT2 A;  1VF3 A;  3WYW A;  5J41 A;  4CHS A;  4PUA A;  5J4Y A;  5KEJ A;  1XOA A;  4IEL A;  3P8W A;  2GT6 A;  3QOU A;  5A34 A;  1R7H A;  3FZ5 A;  2AJQ B;  1PMT A;  1ZYE A;  1F37 A;  3BCI A;  2PBJ A;  3H8Q A;  1J9B A;  2YZH A;  4ZIJ A;  3TJB A;  5KOW A;  2EIR A;  1ERT A;  1O6J A;  4HUA A;  1AQX A;  5A4W A;  1XVW A;  3LEF A;  3HVV A;  5ECS A;  1O85 A;  2B7J A;  2WDU A;  3HJM A;  2C0F A;  2FWE A;  5ID2 A;  3HHV A;  1Z9H A;  1K0M A;  2HFD A;  2IFQ A;  1AQW A;  2QGV A;  3ZVJ A;  2YJH A;  2Z9S A;  2ON7 A;  5J3R A;  4G0I A;  3GUR A;  2YWO A;  3EMX A;  2LRC A;  4XRA A;  4D73 A;  5F07 A;  4TR4 A;  4TXV A;  3PGT A;  1PL2 A;  2L4C A;  4V1A g;  1OC8 A;  3CSI A;  2HZE A;  4IVF A;  4ULX A;  5IPH A;  2WGR A;  1MD3 A;  2H66 A;  2X64 A;  2M80 A;  2X99 A;  3IAM 2;  1XWG A;  4I8B A;  2PPT A;  4K9Z A;  2LRT A;  3KMN A;  2C0G A;  4JR4 A;  1TK0 B;  2J9H A;  1EOG A;  1A2L A;  1GSU A;  4F0B A;  3ME8 A;  3UBL A;  5BMU A;  2G0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...