5A5KA

Atgstf2 from arabidopsis thaliana in complex with camalexin
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
210
Chain Sequence
b'GIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE F2
publication title Structural evidence for Arabidopsis glutathione transferase AtGSTF2 functioning as a transporter of small organic ligands.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 81
structure length 210
sequence length 210
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a5kA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5a5kA01
4NPBA 4OFNA 4ULXA 4JE1A 3UBLA 3MNGA 1F3AA 3DYRA 2I9HA 4CW9A 3GYKA 1GSFA 2PUKC 2VLTA 2MBSA 3ZRDA 2B6MA 2ZUPA 1AAZA 4NHWA 2IL3A 4NAXA 1AXDA 4K0NA 3W8SA 3FHKA 1O7UA 3D22A 5CRHA 5HR0A 3E9JB 1PQNA 4F03A 2XHFA 3CSHA 4MZCA 5FWGA 1XZOA 2X64A 3ME7A 2H75A 3U6VA 1VF3A 2FCHA 1GTUA 4KGIA 3SBCA 5F0GA 4V1Ap 3G7YA 3TOUA 1ACVA 2H1DA 4Q5NA 1BYEA 5ELGA 5J5NA 1V9WA 4X0XA 1QUWA 3RAZA 4EO3A 4IELA 1SENA 1ABAA 1OKDA 3QFBC 4L8EA 4MJBA 4HI7A 5G1KA 3A3TA 2MMZA 5IMAA 4YAPA 4GSTA 2VLUA 4HU9A 3FRCA 4PNFA 3DWVA 3PR8A 3LYPA 3FR6A 1ZYEA 3QMXA 4ACSA 5CREA 4IBPA 3KTLA 5D9XA 1GTAA 3KD0A 3VI7A 4RUVA 1GUHA 1ST9A 1JZOA 1HQOA 1F9MA 2IPAA 4JR6A 4TVEA 4J57E 4O32A 3VK9A 1EGRA 2M72A 4JU5A 1OC9A 1GTBA 4ZL9A 3S9FA 3TKRA 4IW9A 1DSBA 3P7XA 3QAGA 1PN9A 2ZCTA 4ZBAA 5J9BA 1TK0B 2V1MA 2VLVA 3DRNA 2FWFA 1QK8A 2EC4A 2OE0A 3CXGA 4JBBA 1ERUA 2VO4A 4EC0A 3KP9A 4NHZA 3GH6A 1B4PA 2TRCP 4BVXB 2PBJA 3QR6A 4PQIA 2C0FA 4WR5A 2E2MA 4OFTA 3CYNA 3I9V2 1NW2A 1XCCA 4MF5A 1EV9A 1PKWA 2HRKB 4KA0A 3RPPA 3GV1A 2KOKA 4PQ1A 1FO5A 2TIRA 3DVWA 3L9VA 12GSA 5ABRA 4I6XA 3APSA 1WIKA 3M8NA 2CT6A 2JZSA 1A23A 1U88A 1A2MA 3GSTA 3W6GA 1JLWA 2PPTA 4KSOA 2HI7A 2M46A 3H1NA 3EWLA 1X5DA 5H5QA 1AQVA 1SK0A 3Q74A 1Z6MA 4XS6A 3U5RE 4MJAA 1B8XA 3UVTA 2AV4A 3E0UA 3LG6A 4K0GA 1FG4A 4GTUA 5IO2A 2IWTA 4PTSA 3UEMA 1Z5YE 3LXTA 4MH3A 1AC1A 5COHA 5CO3A 4AGSA 4EXJA 5IIZA 2KLXA 1U6TA 2H6ZA 3I6AA 3EC3A 3KH9A 2VAFA 5FHIA 5H5RA 4ZB8A 2FA8A 3IV4A 1THOA 2GZYA 1TTZA 2F8AA 1XWAA 3FYGA 3GKKA 1ZZYA 3MAKA 1XWCA 1OE7A 1TJDA 2VOCA 3ERGA 1YDKA 2L5OA 4X1UA 3A2WA 3VWWA 3FR9A 5IMZA 3O6TA 2X8CA 2JZRA 2AYTA 4TOPA 3EE2A 3HHVA 6GSTA 5DCHA 5G30A 4O5RA 6GSXA 2H71A 5CYYA 3HKRA 1GSQA 2HSHA 4TR1B 1GP1A 4YH2A 5HFGA 4ZILA 3N9JA 3GTUB 3KJYA 4GCIA 4ZXGA 2LS5A 3HJMA 4F9ZA 3WGXA 4MK3A 1DE1A 2H0IA 3LYKA 4YQUA 3WGDA 4KUNA 3TOTA 1FOVA 4TRXA 3C1RA 2CZ2A 3F3QA 3HVVA 3Q19A 2CVBA 1NHOA 1TDIA 17GSA 4TW5A 1YF1A 2FWGA 3D4MA 4XCSA 1O85A 3TJBA 1R5AA 1U3IA 4DSQA 2G2QA 3F6DA 1F2EA 4G9HA 1Z9HA 2R5GA 3ZMLA 2F3MA 3F8UA 1M99A 1EV4A 1HNCA 2CV4A 1T7PB 3LJRA 3GMFA 3ERFA 1MD4A 3VI5A 2XBQA 2LV3A 4FH8A 3EU3A 4FO5A 2HZFA 1SK2A 5IMVA 3PGTA 4PURA 3F0IA 1YJ6A 2WFCA 1G6WA 5HQPA 4GQFA 3GA4A 2WGRA 2XBIA 3HZ4A 3CRUA 1PX7A 2GVPA 2HLSA 1R4WA 4MLYA 1FB0A 1YZXA 5DQYA 3C8EA 1K3LA 1PRXA 1ZCPA 3HJOA 3KP8A 2GSSA 2LQOA 4XRDA 2KHPA 3IE3A 2H74A 3L9UA 5D8IA 2REMA 4XRAA 1T8EB 5AIVA 4KB3A 1A0FA 1GSUA 2CVDA 1M2BA 4I2UA 1FW1A 2HSNB 5AGYA 4KDXA 1G7OA 5ECLB 2HRKA 1TRUA 2N5BA 1C72A 3HJPA 3IPZA 3DVXA 4Z7XA 4HJMA 4E8EA 1ERTA 1NSWA 5ECQB 2V32A 3EU4A 2C1YA 2IIYA 2A2SA 5EL8A 2WCIA 2B7JA 3F4RA 3DD3A 2NDOA 2YANA 3KMNA 1H75A 1ERVA 5J41A 1F6MC 3HVSA 2C80A 3ED3A 4H86A 2K6VA 5GAND 5DJMA 1HNAA 5IQYA 3GFKA 3RDWA 4HQZA 5C00A 2WRTA 3RHCA 16GSA 2VL2C 1R5PA 2HRFA 3US3A 1GSSA 3WYWA 1X5EA 2VL9A 2AAWA 5IMCA 1M9AA 4NV5A 1UC7A 4ECBA 4IP6A 4QQ7A 1EGOA 3NZNA 1HNBA 3HXSA 2GQLA 4PQHA 5IPGA 3ZVJA 4GRFA 3ZL5A 2X8GA 2C0GA 1M0UA 2UZ8A 4TR1A 1F3BA 2DLXA 5H5SA 1X9SB 3CRTA 4K7NA 2P5QA 3VWUA 3GTUA 4IQAA 1VF2A 1SJ6A 4ZL8A 1Z7RA 1WOUA 1GH2A 3D6IA 5JCGA 1ZMAA 4BL7B 1OVNA 2CAIA 3EMPA 1X9MB 2JACA 1XOBA 3H4KA 3UOMA 3BOAA 4IP1A 1UA5A 1PD21 1TW9A 1VRSD 1O8XA 1SK1A 1WP0A 3F6FA 4JZQA 4XS4A 4TR4A 4MH2A 2DJ2A 2K18A 2L4CA 2YWMA 4KX4A 5A5KA 22GSA 2YZUA 3C71A 2ON7A 2VCXA 5J3RA 2ALBA 4MJCA 3LQ7A 3IAM2 3D4TA 4PNGA 1FAAA 1XWBA 5G5EA 1U3AA 1K0AA 3VLNA 2MMOA 3TGZA 3D21A 4XIHA 3IK7A 1TRSA 1BX9A 2CQ9A 2LNTA 3PH9A 4D73B 4FYUA 5CRGA 5LCZA 13GSA 2PMTA 1EP8A 1OYJA 2LEGA 3FZ5A 1XOAA 3ZFLA 2O89A 3H93A 4KF9A 2ES7A 5JWRB 1A2LA 4TXOB 5KN2A 3DEXA 4NWYA 3FR3A 3GNJA 3QD9A 2HSMB 4WF5A 3KZQA 4HS1A 2GT6A 4ILFA 3L9SA 5J4UA 3GHAA 1XBSA 3M1GA 5F07A 8GSSA 1R26A 1YQ1A 4HOJA 3JCML 1WJKA 1XVQA 3KMOA 4G0LA 4HUAA 1DUGA 4XTSA 2C4JA 4JEDA 5KN0A 3ZITA 1K0NA 1JFUA 2P0GA 1S3AA 3J7Yb 4L0WA 7GSSA 3GKNA 5EY6A 4LA1A 4RQRA 4NV2A 2PU9C 2X8HA 1B9YC 4WETA 1GSYA 2YV9A 2KP2A 2H6YA 1CQGA 2B1KA 1M2AA 2DJKA 4I5QA 4MPGA 4FYCA 4N11A 1W4VA 1SU9A 5JCWA 1KTEA 4K7OA 3WT2A 11GSA 3GL3A 2I1UA 4OO4A 1RW1A 5B6MA 4BA7A 4AJ7A 2B7KA 2R6KA 4OWYA 1FHEA 2VIMA 3GL5A 5DALB 4F0BA 2LUSA 1EZKA 2EIOA 4MPFA 1GUMA 3ISOA 4RQXA 4MF7A 1ML6A 3BBYA 3QDNA 2IMFA 1QQ2A 2P5RA 3HCZA 2KP1A 5D9TA 2HE3A 4WBJA 2C0EA 1TK8B 1CQHA 3ZREA 4EDZA 1PA3A 2IMEA 1PGTA 5AN1A 1K0CA 5A4WA 2YWIA 3BCKA 5IMDA 3DKSA 4QL9A 1SL0B 1WWJA 5INYA 3TKQA 3VPTA 4IGJA 4DSSA 3F4TA 2H6XA 4PX1A 2GQMA 2YP6A 3M9JA 3TUEA 3I43A 1AW9A 1BQ7A 4MJEA 1SD9A 4KNDA 2A2RA 3KH7A 4TKYA 2DMLA 1X9WB 1A8LA 2PGTA 3CSIA 2C3TA 3WD6A 4BWQA 3M9KA 4BL7A 2H70A 1ON4A 4WF4A 3ZFBA 2P31A 3D5JA 4ID0A 2IFQB 2BJXA 2H8LA 3LSZA 2LJAA 4TXVA 3ERWA 2F8FA 3TKPA 4X43A 1S3DA 4N30A 5J9CA 2RM6A 3H8QA 3ZYWA 2WJUA 4P3YB 3GUSA 4GQCA 1TI1A 5C04A 3ZIJA 1NM3A 5B6NA 10GSA 3UBKA 1SYRA 1B48A 2DIZA 5CRWA 2RM5A 2GLRA 4D73A 6GSWA 1YKCA 4BVYB 1LU4A 5ECKB 2E7PA 1IYHA 1HD2A 3R2QA 4TXOA 2NTOA 3DMLA 4POBA 2L59A 3TCOA 2HSMA 2E0QA 1KEBA 1ZOFA 1PMTA 2OE1A 3M0FA 2XPDA 2G0FA 3DIEA 1V2AA 2PVOC 2M80A 1K0OA 4AF2A 3TDGA 3GSSA 4L5OA 1OC3A 2GSRA 5ECHB 1G0TA 2YJ7A 2H01A 2O8VB 5IO0A 1T4ZA 3UIWA 1TXXA 4LLRA 2IN3A 2NPBA 3KIJA 4WKWA 4CDOA 5HFKA 4KE3A 6GSUA 2DMMA 3HYPA 2IMKA 2DSAA 4PXOA 3GIXA 5ELAA 3IK9A 5ECMB 5AIXA 3MDKA 2JSYA 4Q5FA 1AQWA 1LJRA 2H76A 4ECCA 2EIQA 4POMA 4ISDA 2HQTA 3KEBA 2L6DA 5DALA 1A2JA 4N0VA 4EKZA 5DBQA 4DSRA 3IXRA 3LWAA 1GLPA 3CTFA 2H1AA 1R7HA 3BJ5A 4L0UA 3UAPA 2VCTA 1JZRA 2R4VA 4EF0A 1W89A 2K8VA 2X99A 1TKDB 4POLA 4JR4A 2N5FA 1K0MA 2OBKA 2B1LA 4IN0A 1Z6NA 3VFIA 4K8MA 4IS0A 2V41A 5CP1A 4ZIJA 5EVOA 5EPFA 2OKAA 4G10A 2YV7A 2WZ9A 4N0ZA 2O87A 3GX0A 2AB6A 2JU5A 4HJ2A 3CBUA 2VL2A 4LL4B 2PWJA 3AY8A 4BVXA 2OJLA 4PUAA 3F9UA 3GN3A 5A4UA 1T4YA 9GSSA 3DGQA 3GURA 1SKRB 3ZZXA 5DVBA 2YOIA 4ZB9A 1TRVA 3WT1A 3H79A 1NHYA 2H0HA 1URMA 4EE0A 3TRXA 3TRPA 1DE2A 3F63A 2D2ZA 4IKHA 1BEDA 3I69A 2HSYA 4K1FA 2IFQA 4MZWA 1PL2A 2E2GA 4YQMA 2QKEA 2R2JA 1GWCA 2CX3A 2ZNMA 5B7CA 2A4VA 2R37A 4V2MA 1GNWA 4HU7A 2DJ3A 2HRAA 1GL8A 4WXTA 3N5OA 2GQKA 4MCUA 1OKTA 1N2AA 14GSA 4K6XA 3FKFA 2VM1A 1MTCA 2K8SA 4PUFC 1MDJA 3O76A 5D73A 5B8AA 1FVKA 1IYIA 1ZYQB 2LRNA 2YN1A 3NIVA 1ILOA 1O8WA 1SJIA 3GKXA 4PGTA 5KN1A 4ECIA 1XIYA 5DQSA 4BVYA 2RUFA 3CSJA 2NBSA 1EWXA 2VCQA 4NXIA 4V2NA 2BTOT 5CNWA 4F82A 1UN2A 2VD1A 2I4AA 3ME8A 2B3SA 1MEKA 3CMIA 3QPMA 2J9HA 1X5CA 1XWKA 3FK8A 3Q6OA 1GSDA 1E2YA 3LGCA 3KCMA 2LJRA 2PERA 1K0BA 4MMMA 5ENUA 2CVKA 2WULA 3G9BA 1I9DA 3NOFA 4AJ6A 3UL3A 5ECPB 2AUVA 5LD0A 3IRAA 5ECNB 3UVHA 4ML6A 2Z9SA 4G0KA 3F3RA 3IDVA 1MD3A 1USBA 1GLQA 1M2DA 3RPNA 4MDCA 1SL1B 4FYBA 4IVFA 5IM9A 1UVZA 2V2GA 3GKMA 1JHBA 2FHEA 2J23A 3IOSA 5JWQB 1AUCA 1HYUA 3EYTA 2OACA 4F2IA 5G1LA 3TB2A 4GWRA 2DJ0A 2VD0A 1YEPA 4OCFA 4JRRA 5HFIA 4LMWA 5FT3A 4F0CA 1JLVA 1V40A 20GSA 2QGVA 4GF0A 1V58A 3F4SA 4HZ4A 1TU8A 2QC7A 3QAVA 3IA1A 3OR5A 3C1SA 3KTBA 1GNEA 3J7Yk 3K8NA 4OCEA 1SKSB 4I2TA 2YPMA 1GSEA 1Y25A 1RQMA 1ZGNA 5ECIB 3FW2A 3TKSE 2QSIA 4G0IA 1KNGA 4K2DA 3ZVJD 2H73A 2GTUA 1TK5B 19GSA 3A2XA 1GUKA 1T3BA 3Q18A 3V1WA 5G31A 2GZZA 5AISA 2RUEA 4Q5RA 2HZEB 5G2ZA 2LNSA 4XS1A 4HDEA 2MMAA 1YF0A 4HZ2A 1EP7A 3EMXA 2IMIA 3L0HA 4MABA 2DBCA 3IR4A 1T00A 4G2EA 3HA9A 2VCWA 4KH7A 1TRWA 3M3MA 1FVJA 2O85A 3KGKA 5IOXA 2H0GA 1E6BA 1EOHA 4KCEA 2DIYA 3VPQA 3DXBA 2HYXA 4LMVA 3QOUA 4IJIA 1QXHA 2L4QA 4TR0A 2GSQA 18GSA 4EUYA 3CTGA 1G7EA 1GRXA 4Q5QA 3L78A 2ON5A 3P2AA 4GXZA 2LKUA 4IQ1A 1JZDA 2V6OA 4MA9A 2RLIA 3ZTLA 1A24A 3A2VA 5F8BA 3VWVA 5IMFA 2H30A 3ZIVA 3UJ1A 2LJKA 3TJFA 3G7IA 5KEJA 3IHQA 2F51A 2AHEA 2OE3A 3P90A 5GAPD 3TKSA 2I3YA 2C3QA 4HEA2 5ID2B 5ECSA 5ECOB 2CZ3A 3A5WA 5CAXA 1THXA 2PN8A 4KCAA 1Q4JA 4G19A 1H4OA 4LL1B 4TN8A 4I97A 5GSTA 3MWHA 1K0DA 2NVLA 5CRDA 1M9BA 5L71A 2VUPA 3IC4A 3GX8A 4GSSA 1O73A 5LNKe 2CA8A 3EINA 4IHUA 2VCZA 2C3NA 1SYXA 3TJJA 4MF6A 4DEJA 2LSTA 1X0RA 3WGEA 3FY7A 2B5YA 1SD8A 4I8BA 1QGVA 4HQSA 3TKSC 1A0RP 4WBRD 1YKAA 2L57A 1V57A 5E4WA 2DC5A 2YJHA 1XPVA 4NMUA 1YEXA 1J08A 4EL1A 1WE0A 4KAEA 3VWXA 2HRNA 4BPYA 1BAYA 2FNOA 1J0FA 3G7JA 4ZL7A 2BMXA 2O7KA 2YWOA 3HDCA 4K9ZA 3ZLPA 4AJ8A 4O7HA 1U87A 5JWOB 4OMVA 3P8WA 1SJZA 2IJYA 1F37A 5HR1A 4ZB6A 2GZPA 4QL7A 2C8UA 2JADA 3HY2A 1RK4A 4V2LA 2WB9A 4POKA 4RI7A 1PX6A 4ML1A 5B8BA 3HZ8A 2OBIA 5D93A 2H1BA 4KW6A 2H72A 2MYGA 5IPHA 4EDYA 3QAWA 4ZBDA 2AJQB 3MSZA 1QMVA 2HNLA 1SL2B 1MDKA 1WMJA 5E59A 2VL3A 2B5EA 5DJLA 4CHSA 1XW5A 1PKZA 2FY6A 3FZ9A 2L6CA 3KXOA 1B4QA 2HZEA 5HR3A 1G6YA 5DAKB 4DVCA 3BD2A 1J9BA 4OO5A 3HD5A 3FZAA 2L5LA 1XFLA 4XS4B 1QFNA 6GSSA 2VM2A 2I81A 3APQA 2LRCA 1XW9A 3UARA 3RHBA 1GTIA 3RBTA 2WS2A 4N10A 1Y6EA 3GH9A 3IC8A 2LQQA 5DCGA 4L5LA 1B9XC 4FIWA 2HXKA 1T1VA 1BG5A 4ZBBA 3VURA 2MMNA 2DJ1A 3D0ZA 2FGXA 2V6KA 5GZZB 3QCPA 4RI6A 1TOFA 4TR3A 2HFDA 1XWGA 3BCIA 3GRXA 2YNXA 1TI3A 5HR2A 5BMUA 3FZ4A 3EURA 4WR4A 4YAVA 1N8JA 1Q98A 4XHMA 3LORA 5ID2A 1ZL9A 2FD3A 2PVQA 2H66A 3PINA 1KBNA 4ECJA 3UMAA 2DJJA 3O3TA 4OD7A 1SKWB 2VCVA 4BWSA 2N5AA 5D9WA 1A8YA 4V1Ag 1K3YA 5D96A 5F06A 3SWLA 3E3EA 2JL4A 1EEMA 1GULA 1S3CA 1PSQA 5A4VA 2YWNA 1OAZA 2FLSA 2FWEA 2B5XA 2JZTA 1K3OA 2XPEA 2GS3A 2RIIA 1V98A 3W8JA 2EIRA 2FUG2 2WDUA 2CX4A 2R3XA 2H19A 1Z7PA 3LFLA 1Z3EA 1TP9A 3ZMKA 1OE8A 3FEUA 2GGTA 6GSVA 2GT5A 4USSA 4EVMA 3TJKA 2C0DA 1OC9B 3IAS2 5DDLA 1XVWA 3APOA 5D9VA 4J2FA 3L4NA 4GLTA 4KDUA 3IBHA 2KUCA 2HT9A 2MBTA 5G5FA 2XC2A 2IMDA 2GDRA 2FWHA 2F9SA 1O6JA 1XXUA 4DSSB 3PPUA 3R3EA 1AQXA 4GSNA 4FQUA 3C7MA 2MZCA 4KDYA 3QFAC 1BJXA 4MZBA 3LEFA 1DBYA 2YCDA 4KSMA 3EVIA 1EEJA 1XW6A 4WEYA 5ECRB 1EOGA 3KM6A 1MDIA 3HVXA 4O92A 4OFMA 4K7IA 1AIUA 5DAKA 3LXZA 1I5GA 5GSSA 2FA4A 2H1GA 6GSYA 2CAQA 1WRYA 1VF1A 1TU7A 2OADA 3TRQA 2TRXA 4IJ3A 5KN3A 1VF4A 1FB6A 2JSZA 4MP4A 4E8HA 2LRTA 1M7TA 5F05A 1LBKA 4YQVA 2OA7A 4J56E 1JZWA 1WPIA 2K9FA 1VGLA 2YZHA 1O81A 1ERWA 3TJGA 2LTKA 1YY7A 2GSTA 3C73A 1PL1A 5JCUA 5IOWA 1OC8A
chains in the Genus database with same CATH superfamily
4NPBA 4OFNA 4ULXA 4JE1A 3UBLA 3MNGA 1F3AA 3DYRA 2I9HA 4CW9A 3GYKA 1GSFA 2PUKC 2VLTA 2MBSA 3ZRDA 2B6MA 2ZUPA 1AAZA 4NHWA 2IL3A 4NAXA 1AXDA 4K0NA 3W8SA 3FHKA 1O7UA 3D22A 5CRHA 5HR0A 3E9JB 1PQNA 4F03A 2XHFA 3CSHA 4MZCA 5FWGA 1XZOA 2X64A 1M3JA 3ME7A 2H75A 3U6VA 1VF3A 2FCHA 1GTUA 4KGIA 3SBCA 5F0GA 4V1Ap 1SVMA 3G7YA 3TOUA 1ACVA 4CY6A 2H1DA 4Q5NA 1BYEA 5ELGA 5J5NA 1V9WA 4X0XA 1QUWA 3RAZA 4EO3A 4IELA 1SENA 1ABAA 1OKDA 3QFBC 4L8EA 4MJBA 4HI7A 5G1KA 5J40A 3A3TA 2MMZA 5IMAA 4YAPA 4GSTA 2VLUA 4HU9A 3FRCA 4PNFA 3DWVA 3PR8A 3LYPA 3FR6A 1ZYEA 5J4VA 3QMXA 4ACSA 5CREA 4IBPA 4E68A 3KTLA 5D9XA 1GTAA 3KD0A 3VI7A 4RUVA 1GUHA 1ST9A 1JZOA 1HQOA 1F9MA 2IPAA 4JR6A 4TVEA 4J57E 4O32A 3VK9A 1EGRA 2M72A 4JU5A 1OC9A 1GTBA 4ZL9A 4HSCX 3S9FA 3TKRA 4IW9A 1DSBA 3P7XA 3QAGA 1PN9A 2ZCTA 4ZBAA 5J9BA 1TK0B 2V1MA 2VLVA 4ICYA 3DRNA 2FWFA 1QK8A 2EC4A 2OE0A 3CXGA 4JBBA 1ERUA 2VO4A 4EC0A 3KP9A 4NHZA 3GH6A 1B4PA 2TRCP 4BVXB 2PBJA 3QR6A 4PQIA 2C0FA 4WR5A 2E2MA 4OFTA 3CYNA 3I9V2 1NW2A 1XCCA 4MF5A 1EV9A 1PKWA 2HRKB 4KA0A 3RPPA 1BG1A 3GV1A 2KOKA 4PQ1A 5A34A 4N3ZA 1FO5A 2TIRA 3DVWA 3L9VA 12GSA 5ABRA 4I6XA 5A1NA 3APSA 1WIKA 3M8NA 2CT6A 2JZSA 1A23A 1U88A 1A2MA 3GSTA 5J4YA 1JLWA 3W6GA 2PPTA 4KSOA 2HI7A 4AKHA 2M46A 3H1NA 3EWLA 1X5DA 5H5QA 1AQVA 1SK0A 3Q74A 1Z6MA 4XS6A 3U5RE 4MJAA 1B8XA 2O36A 3UVTA 2AV4A 3E0UA 3LG6A 4K0GA 1FG4A 4GTUA 5IO2A 2IWTA 2WVXA 4PTSA 3UEMA 1Z5YE 3LXTA 4MH3A 1AC1A 5COHA 5CO3A 4AGSA 4EXJA 5IIZA 2KLXA 1U6TA 2H6ZA 3I6AA 3EC3A 3KH9A 2VAFA 5FHIA 5H5RA 4ZB8A 2FA8A 3IV4A 1THOA 2GZYA 1TTZA 2F8AA 1XWAA 3FYGA 3GKKA 1ZZYA 3MAKA 1XWCA 1OE7A 3IHGA 1TJDA 2VOCA 3ERGA 1YDKA 2L5OA 4X1UA 3A2WA 3VWWA 3FR9A 5IMZA 3O6TA 2X8CA 2JZRA 2AYTA 4TOPA 3EE2A 3HHVA 6GSTA 5DCHA 5G30A 4O5RA 6GSXA 2H71A 5CYYA 3HKRA 1GSQA 2HSHA 4TR1B 1GP1A 4YH2A 5HFGA 4ZILA 3N9JA 3GTUB 3KJYA 4GCIA 4ZXGA 2LS5A 3HJMA 4F9ZA 3WGXA 4AI6A 4MK3A 1DE1A 2H0IA 3LYKA 1Y1UA 3HMJG 4YQUA 3WGDA 4KUNA 3TOTA 1FOVA 4TRXA 3C1RA 2CZ2A 3F3QA 3HVVA 3Q19A 2CVBA 1NHOA 1TDIA 17GSA 4TW5A 1YF1A 2FWGA 3D4MA 4XCSA 1O85A 3TJBA 1R5AA 1U3IA 4DSQA 2G2QA 3F6DA 1F2EA 4G9HA 1SVOA 1Z9HA 2R5GA 3ZMLA 2F3MA 3F8UA 1M99A 1EV4A 1HNCA 2CV4A 1T7PB 3LJRA 3GMFA 3ERFA 1MD4A 3VI5A 2XBQA 2LV3A 4FH8A 3EU3A 4FO5A 2HZFA 1SK2A 5IMVA 3PGTA 4PURA 3F0IA 1YJ6A 2WFCA 1G6WA 5HQPA 4GQFA 3GA4A 2WGRA 2XBIA 3HZ4A 3CRUA 1TXUA 1PX7A 2GVPA 2HLSA 4Z2TA 1R4WA 4MLYA 1FB0A 1YZXA 5DQYA 3MYDA 3C8EA 1K3LA 4GDFA 1PRXA 1ZCPA 3HJOA 3KP8A 2GSSA 2LQOA 4XRDA 2KHPA 2R0GA 3IE3A 2H74A 3L9UA 3TU3B 5D8IA 2REMA 4XRAA 1T8EB 5AIVA 4KB3A 1A0FA 1GSUA 2CVDA 1M2BA 4I2UA 1FW1A 2HSNB 5AGYA 4KDXA 1G7OA 5ECLB 2HRKA 1TRUA 2N5BA 1C72A 1YVLA 3HJPA 3IPZA 3DVXA 4Z7XA 4HJMA 4E8EA 1ERTA 1NSWA 5A5HA 5ECQB 2V32A 4QMKA 3EU4A 2C1YA 2IIYA 2A2SA 5EL8A 4O5UA 2WCIA 2B7JA 2QA1A 3F4RA 3DD3A 2NDOA 2YANA 3KMNA 1H75A 1ERVA 5J41A 1F6MC 3CHXC 3HVSA 2C80A 3ED3A 4H86A 2K6VA 5GAND 5DJMA 1HNAA 5IQYA 3GFKA 3RDWA 4HQZA 5C00A 2WRTA 3RHCA 16GSA 2VL2C 1R5PA 2HRFA 3US3A 1GSSA 3WYWA 1X5EA 2VL9A 2AAWA 5IMCA 2QA2A 1M9AA 4NV5A 1UC7A 4ECBA 4IP6A 4QQ7A 1EGOA 3NZNA 1HNBA 3HXSA 2GQLA 4PQHA 5IPGA 3ZVJA 4GRFA 3ZL5A 2X8GA 2C0GA 1M0UA 2UZ8A 4ZB7A 4TR1A 1F3BA 2DLXA 5H5SA 1X9SB 3CRTA 4K7NA 2P5QA 3VWUA 3GTUA 4IQAA 1VF2A 1SJ6A 4ZL8A 1Z7RA 1WOUA 1GH2A 3D6IA 1FOHA 5JCGA 1ZMAA 4BL7B 1OVNA 2CAIA 3EMPA 1X9MB 4MNNA 2JACA 1XOBA 3H4KA 3UOMA 3BOAA 4IP1A 1UA5A 1PD21 1TW9A 1VRSD 1O8XA 1SK1A 1WP0A 3F6FA 4JZQA 4XS4A 4TR4A 4MH2A 2DJ2A 2K18A 2L4CA 2YWMA 4KX4A 5A5KA 22GSA 2YZUA 3C71A 2ON7A 2VCXA 5J3RA 2ALBA 4MJCA 3LQ7A 3IAM2 3D4TA 4PNGA 1FAAA 1XWBA 5G5EA 1U3AA 1K0AA 3VLNA 4AKXB 2MMOA 3TGZA 3D21A 4XIHA 3IK7A 1TRSA 1BX9A 2CQ9A 2LNTA 3PH9A 4D73B 4FYUA 5CRGA 5LCZA 13GSA 2PMTA 1EP8A 1OYJA 2LEGA 3FZ5A 1XOAA 3ZFLA 2O89A 3H93A 4KF9A 2ES7A 5JWRB 1A2LA 4TXOB 5KN2A 3DEXA 4NWYA 3FR3A 3GNJA 4A5PA 3QD9A 2HSMB 4WF5A 3KZQA 4HS1A 2GT6A 4ILFA 3L9SA 5J4UA 3GHAA 1XBSA 3M1GA 4Z2UA 5F07A 8GSSA 1R26A 2A2PA 1YQ1A 4HOJA 3JCML 1WJKA 1XVQA 3KMOA 4G0LA 4HUAA 1DUGA 4XTSA 2C4JA 4JEDA 5KN0A 3ZITA 1K0NA 1JFUA 2P0GA 1S3AA 3J7Yb 4L0WA 7GSSA 3GKNA 5EY6A 4LA1A 4RQRA 4NV2A 2PU9C 2X8HA 1B9YC 4WETA 4YKGA 1GSYA 2YV9A 2KP2A 2H6YA 1CQGA 2B1KA 1M2AA 2DJKA 4I5QA 4MPGA 4FYCA 4N11A 1W4VA 1SU9A 5JCWA 1KTEA 1I1IP 4K7OA 3WT2A 11GSA 3EPTA 3GL3A 2I1UA 4OO4A 1RW1A 5B6MA 4BA7A 4AJ7A 2B7KA 2R6KA 1S3RA 4OWYA 1FHEA 2VIMA 3GL5A 5DALB 4F0BA 2LUSA 1EZKA 2EIOA 4MPFA 4AKGA 1GUMA 3ISOA 4RQXA 2X49A 4MF7A 1ML6A 3BBYA 3QDNA 2IMFA 1QQ2A 2P5RA 3HCZA 2KP1A 4W66A 1SVLA 5D9TA 2HE3A 4WBJA 2C0EA 1TK8B 1CQHA 3ZREA 4EDZA 1PA3A 2IMEA 1PGTA 5AN1A 1K0CA 5A4WA 2YWIA 3BCKA 5IMDA 3DKSA 4QL9A 1SL0B 1WWJA 5INYA 3TKQA 3VPTA 4IGJA 4DSSA 3F4TA 2H6XA 4PX1A 2GQMA 2YP6A 3M9JA 3TUEA 3I43A 1AW9A 1BQ7A 4MJEA 1SD9A 4KNDA 2A2RA 3KH7A 4TKYA 2DMLA 1X9WB 1A8LA 2PGTA 3CSIA 2C3TA 3WD6A 4BWQA 3M9KA 4BL7A 2H70A 1ON4A 4WF4A 3ZFBA 2P31A 3D5JA 4ID0A 2O3EA 2IFQB 2BJXA 2H8LA 3LSZA 2LJAA 4TXVA 3ERWA 2F8FA 3TKPA 4X43A 1S3DA 4N30A 5J9CA 2RM6A 3H8QA 3ZYWA 4X4JA 2WJUA 4P3YB 3GUSA 4GQCA 1TI1A 5C04A 3ZIJA 1NM3A 1BF5A 5B6NA 10GSA 3UBKA 1SYRA 1B48A 5KOXA 2DIZA 5CRWA 2RM5A 2GLRA 4D73A 6GSWA 1YKCA 4BVYB 1LU4A 5ECKB 2E7PA 1IYHA 1HD2A 3R2QA 4PHZC 4TXOA 2NTOA 2WW2A 3DMLA 4POBA 2L59A 3TCOA 2HSMA 2E0QA 1KEBA 1ZOFA 1PMTA 2OE1A 3M0FA 2XPDA 2G0FA 3DIEA 1V2AA 2PVOC 2M80A 1K0OA 4AF2A 3TDGA 3GSSA 4L5OA 1OC3A 2GSRA 5ECHB 1G0TA 2YJ7A 2H01A 2O8VB 5IO0A 1T4ZA 3UIWA 1TXXA 4LLRA 2IN3A 2NPBA 3KIJA 4WKWA 4CDOA 5HFKA 4KE3A 6GSUA 2DMMA 3HYPA 2IMKA 2DSAA 4PXOA 3GIXA 5ELAA 3IK9A 5ECMB 2DKIA 2UV8G 5AIXA 3MDKA 2JSYA 4Q5FA 1AQWA 1LJRA 2H76A 4ECCA 2EIQA 4POMA 4ISDA 2HQTA 3KEBA 2L6DA 5DALA 1A2JA 4N0VA 4EKZA 5DBQA 4DSRA 3IXRA 3LWAA 4Z2RA 1GLPA 3CTFA 5J47A 2H1AA 1PN0A 1R7HA 3BJ5A 4L0UA 3UAPA 2VCTA 1JZRA 2R4VA 4EF0A 1W89A 2K8VA 2X99A 1TKDB 4POLA 4JR4A 2N5FA 1K0MA 2A4HA 2OBKA 2B1LA 4IN0A 1Z6NA 3VFIA 4K8MA 4IS0A 2V41A 5CP1A 4ZIJA 5EVOA 5EPFA 2OKAA 4G10A 2YV7A 2WZ9A 4N0ZA 2O87A 3GX0A 2AB6A 2JU5A 4HJ2A 2WW0A 3CBUA 2VL2A 4LL4B 2PWJA 3AY8A 4BVXA 2OJLA 4PUAA 3F9UA 3GN3A 5A4UA 1T4YA 1XG8A 9GSSA 3DGQA 3GURA 1SKRB 3ZZXA 5DVBA 2YOIA 4ZB9A 1TRVA 3WT1A 3H79A 1NHYA 2H0HA 1URMA 4EE0A 3TRXA 3TRPA 1DE2A 3F63A 2D2ZA 4IKHA 1BEDA 3I69A 2HSYA 4K1FA 2IFQA 4MZWA 1PL2A 2E2GA 4YQMA 2QKEA 2R2JA 1GWCA 2CX3A 2ZNMA 5B7CA 2A4VA 2R37A 4V2MA 1GNWA 4HU7A 2DJ3A 2HRAA 1GL8A 4WXTA 3N5OA 2GQKA 4MCUA 1OKTA 1N2AA 14GSA 4K6XA 3FKFA 2VM1A 1MTCA 2K8SA 4PUFC 1MDJA 3O76A 5D73A 5B8AA 1FVKA 1IYIA 2EFCA 1ZYQB 2LRNA 2WW3A 2YN1A 3NIVA 1ILOA 1O8WA 1SJIA 3GKXA 4PGTA 2R0CA 5KN1A 4ECIA 1XIYA 5DQSA 4BVYA 2RUFA 3CSJA 2NBSA 1EWXA 2VCQA 4NXIA 4V2NA 2BTOT 5CNWA 5KOWA 4F82A 1UN2A 2VD1A 2I4AA 3ME8A 2B3SA 1MEKA 3CMIA 3QPMA 1N25A 2J9HA 1X5CA 1XWKA 3FK8A 4O5QA 1GSDA 1E2YA 3Q6OA 3LGCA 3KCMA 2LJRA 2PERA 1K0BA 4MMMA 1ZYNA 5ENUA 2CVKA 2WULA 5A34B 3G9BA 1I9DA 3NOFA 4AJ6A 3UL3A 5ECPB 2AUVA 5LD0A 4YKFA 3IRAA 5ECNB 3UVHA 4ML6A 2Z9SA 4G0KA 3F3RA 3IDVA 1MD3A 1USBA 1GLQA 1M2DA 3RPNA 4MDCA 1SL1B 4FYBA 4IVFA 5IM9A 1UVZA 2V2GA 3GKMA 1JHBA 2FHEA 2J23A 3IOSA 5JWQB 1AUCA 1HYUA 3EYTA 2WVXB 2OACA 4F2IA 5G1LA 3TB2A 4GWRA 2DJ0A 2WZSA 2VD0A 1YEPA 4OCFA 4JRRA 5HFIA 4LMWA 5FT3A 4F0CA 1JLVA 1V40A 20GSA 2QGVA 4GF0A 1V58A 4EIPA 3F4SA 4HZ4A 1TU8A 2QC7A 3QAVA 3IA1A 3OR5A 3C1SA 3KTBA 1GNEA 3J7Yk 3K8NA 4OCEA 1SKSB 4I2TA 2YPMA 1GSEA 1Y25A 1RQMA 1ZGNA 5ECIB 3FW2A 3TKSE 2QSIA 4G0IA 1KNGA 4K2DA 3ZVJD 2H73A 2GTUA 1TK5B 19GSA 3A2XA 1GUKA 1T3BA 3Q18A 3V1WA 5G31A 2GZZA 5AISA 2HSNA 2RUEA 4Q5RA 2HZEB 5G2ZA 2LNSA 4XS1A 4HDEA 3LW9A 2MMAA 1YF0A 4HZ2A 1EP7A 3EMXA 2IMIA 3L0HA 4MABA 2DBCA 3IR4A 1T00A 4G2EA 3HA9A 4PI2C 2VCWA 4KH7A 1TRWA 3RGBC 3M3MA 1FVJA 2O85A 3KGKA 5IOXA 2H0GA 1E6BA 1EOHA 4KCEA 2DIYA 3CWGA 3VPQA 3DXBA 2HYXA 4LMVA 3QOUA 4IJIA 1QXHA 2L4QA 4TR0A 2GSQA 18GSA 4EUYA 3CTGA 1G7EA 1GRXA 4Q5QA 3A5IA 3L78A 2ON5A 3P2AA 2LKUA 4GXZA 4IQ1A 1JZDA 2V6OA 4MA9A 2RLIA 3ZTLA 1A24A 3A2VA 5F8BA 3VWVA 5IMFA 2H30A 3ZIVA 5BMUB 3UJ1A 2LJKA 3TJFA 3G7IA 5KEJA 3IHQA 2F51A 2AHEA 2OE3A 3P90A 5GAPD 3TKSA 2I3YA 2C3QA 4HEA2 5ID2B 5ECSA 5ECOB 2CZ3A 3A5WA 5CAXA 1THXA 2PN8A 4KCAA 1Q4JA 4G19A 1H4OA 4LL1B 4TN8A 4I97A 5GSTA 3MWHA 1K0DA 2NVLA 5CRDA 1M9BA 5L71A 2VUPA 3IC4A 3GX8A 4GSSA 5A5HB 1O73A 2CA8A 5LNKe 1ZYPA 3EINA 4IHUA 2VCZA 2C3NA 1SYXA 5BRTA 3TJJA 4MF6A 4DEJA 2LSTA 1X0RA 3WGEA 3FY7A 2B5YA 4G01A 1SD8A 4I8BA 1QGVA 4HQSA 3TKSC 4BIKA 1A0RP 4WBRD 1YKAA 1S4BP 1V57A 2L57A 5E4WA 2DC5A 2YJHA 1XPVA 4NMUA 1YEXA 4PI0C 1J08A 4EL1A 4CY8A 1WE0A 4KAEA 3VWXA 2HRNA 4BPYA 1BAYA 2FNOA 1J0FA 3G7JA 4ZL7A 2BMXA 2O7KA 2YWOA 3HDCA 4K9ZA 3ZLPA 4AJ8A 4O7HA 1U87A 5JWOB 4OMVA 3P8WA 1SJZA 2IJYA 1F37A 5HR1A 4ZB6A 2GZPA 4QL7A 2C8UA 2JADA 3HY2A 1RK4A 4V2LA 2WB9A 4POKA 4RI7A 1PX6A 4ML1A 3HVNA 5B8BA 3HZ8A 2OBIA 5D93A 2H1BA 4KW6A 2H72A 2MYGA 5IPHA 4EDYA 3QAWA 4ZBDA 2AJQB 3MSZA 1QMVA 2HNLA 1SL2B 1MDKA 1WMJA 5E59A 2VL3A 2B5EA 5DJLA 4CHSA 1XW5A 1PKZA 2FY6A 3FZ9A 2L6CA 3KXOA 1B4QA 2HZEA 5HR3A 1G6YA 5DAKB 4DVCA 3BD2A 1J9BA 4OO5A 3HD5A 3FZAA 2L5LA 1XFLA 4XS4B 1QFNA 6GSSA 2VM2A 2I81A 3APQA 2LRCA 1XW9A 3UARA 3RHBA 1GTIA 3RBTA 2WS2A 3CQFA 4N10A 1Y6EA 3GH9A 3IC8A 2LQQA 5DCGA 4L5LA 4FXYP 1B9XC 4FIWA 2HXKA 1T1VA 1BG5A 4ZBBA 2H1LA 3VURA 2MMNA 2DJ1A 3D0ZA 2FGXA 2EFDA 2V6KA 5GZZB 3QCPA 4RI6A 1TOFA 4TR3A 2HFDA 1XWGA 3BCIA 3GRXA 2YNXA 4K5RA 1TI3A 5HR2A 5BMUA 3FZ4A 3EURA 4WR4A 4YAVA 1N8JA 1Q98A 4XHMA 3LORA 5ID2A 1ZL9A 2OT3A 2FD3A 2PVQA 2H66A 3PINA 1KBNA 4ECJA 2VKZG 3UMAA 2DJJA 3O3TA 4OD7A 1SKWB 2VCVA 4BWSA 2N5AA 5D9WA 3FMWA 1A8YA 4V1Ag 1K3YA 5D96A 5F06A 2WW1A 3SWLA 3E3EA 2JL4A 1EEMA 1GULA 1S3CA 1PSQA 5A4VA 2YWNA 1OAZA 2FLSA 2FWEA 2B5XA 2JZTA 1K3OA 2XPEA 2GS3A 2RIIA 1V98A 3W8JA 2O5VA 2EIRA 2FUG2 2WDUA 2CX4A 2R3XA 2H19A 1Z7PA 3LFLA 1Z3EA 2WVYA 1TP9A 3ZMKA 1OE8A 3FEUA 2R0PA 2GGTA 6GSVA 2GT5A 4USSA 4EVMA 3TJKA 2C0DA 1OC9B 3IAS2 5DDLA 1XVWA 3APOA 5D9VA 1M3IA 1PFOA 4J2FA 3L4NA 4GLTA 4KDUA 3IBHA 2KUCA 2HT9A 1YEWC 3RFRC 2MBTA 2DKHA 5G5FA 2XC2A 2IMDA 2GDRA 2FWHA 2F9SA 1O6JA 1XXUA 4DSSB 3PPUA 3R3EA 2X4AA 1AQXA 4GSNA 4FQUA 3C7MA 2MZCA 4KDYA 3QFAC 4EIQA 1BJXA 4MZBA 3LEFA 1DBYA 2YCDA 4KSMA 3EVIA 5A1NB 1EEJA 3MIXA 1XW6A 4WEYA 5ECRB 1EOGA 3KM6A 1MDIA 3HVXA 4O92A 4OFMA 4K7IA 1AIUA 2WVZA 5DAKA 3LXZA 1I5GA 5GSSA 2FA4A 4K2XA 2H1GA 6GSYA 2CAQA 1WRYA 1VF1A 1TU7A 2OADA 3TRQA 2EFHA 2TRXA 4IJ3A 5KN3A 1VF4A 1FB6A 2JSZA 4MP4A 4E8HA 2LRTA 1M7TA 5F05A 1LBKA 4YQVA 2OA7A 4AKIA 4J56E 1JZWA 1WPIA 2EFEA 2K9FA 2YZHA 1VGLA 1O81A 1ERWA 3TJGA 2LTKA 1YY7A 2GSTA 3C73A 1PL1A 5JCUA 4K5SA 5IOWA 1OC8A
chains in the Genus database with same CATH topology
4NPBA 4OFNA 4ULXA 4JE1A 3UBLA 3MNGA 1F3AA 3DYRA 2I9HA 4CW9A 3GYKA 1GSFA 2PUKC 2VLTA 2MBSA 3ZRDA 2B6MA 2ZUPA 1AAZA 4NHWA 2IL3A 4NAXA 1AXDA 4K0NA 3W8SA 3FHKA 1O7UA 3D22A 5CRHA 5HR0A 3E9JB 1PQNA 4F03A 2XHFA 3CSHA 4MZCA 5FWGA 1XZOA 2X64A 3ME7A 2H75A 3U6VA 1VF3A 2FCHA 1GTUA 4KGIA 3SBCA 5F0GA 4V1Ap 1SVMA 3G7YA 3TOUA 1ACVA 4CY6A 2H1DA 4Q5NA 1BYEA 5ELGA 5J5NA 1V9WA 4X0XA 1QUWA 3RAZA 4EO3A 4IELA 1SENA 1ABAA 1OKDA 3QFBC 4L8EA 4MJBA 4HI7A 5G1KA 5J40A 3A3TA 2MMZA 5IMAA 4YAPA 4GSTA 2VLUA 4HU9A 3FRCA 4PNFA 3DWVA 3PR8A 3LYPA 3FR6A 1ZYEA 5J4VA 3QMXA 4ACSA 5CREA 4IBPA 4E68A 3KTLA 5D9XA 1GTAA 3KD0A 3VI7A 4RUVA 1GUHA 1ST9A 1JZOA 1HQOA 1F9MA 2IPAA 4JR6A 4TVEA 4J57E 4O32A 3VK9A 1EGRA 2M72A 4JU5A 1OC9A 1GTBA 4ZL9A 3S9FA 3TKRA 4IW9A 1DSBA 3P7XA 3QAGA 1PN9A 2ZCTA 4ZBAA 5J9BA 1TK0B 2V1MA 2VLVA 4ICYA 3DRNA 2FWFA 1QK8A 2EC4A 2OE0A 3CXGA 4JBBA 1ERUA 2VO4A 4EC0A 3KP9A 4NHZA 3GH6A 1B4PA 2TRCP 4BVXB 2PBJA 3QR6A 4PQIA 2C0FA 4WR5A 2E2MA 4OFTA 3CYNA 3I9V2 1NW2A 1XCCA 4MF5A 1EV9A 1PKWA 2HRKB 4KA0A 3RPPA 1BG1A 3GV1A 2KOKA 4PQ1A 5A34A 4N3ZA 1FO5A 2TIRA 3DVWA 3L9VA 12GSA 5ABRA 4I6XA 5A1NA 3APSA 1WIKA 3M8NA 2CT6A 2JZSA 1A23A 1U88A 1A2MA 3GSTA 5J4YA 1JLWA 3W6GA 2PPTA 4KSOA 2HI7A 4AKHA 2M46A 3H1NA 3EWLA 1X5DA 5H5QA 1AQVA 1SK0A 3Q74A 1Z6MA 4XS6A 3U5RE 4MJAA 1B8XA 3UVTA 2AV4A 3E0UA 3LG6A 4K0GA 1FG4A 4GTUA 5IO2A 2IWTA 4PTSA 3UEMA 1Z5YE 3LXTA 4MH3A 1AC1A 5COHA 5CO3A 4AGSA 4EXJA 5IIZA 2KLXA 1U6TA 2H6ZA 3I6AA 3EC3A 3KH9A 2VAFA 5FHIA 5H5RA 4ZB8A 2FA8A 3IV4A 1THOA 2GZYA 1TTZA 2F8AA 1XWAA 3FYGA 3GKKA 1ZZYA 3MAKA 1XWCA 1OE7A 3IHGA 1TJDA 2VOCA 3ERGA 1YDKA 2L5OA 4X1UA 3A2WA 3VWWA 3FR9A 5IMZA 3O6TA 2X8CA 2JZRA 2AYTA 4TOPA 3EE2A 3HHVA 6GSTA 5DCHA 5G30A 4O5RA 6GSXA 2H71A 5CYYA 3HKRA 1GSQA 2HSHA 4TR1B 1GP1A 4YH2A 5HFGA 4ZILA 3N9JA 3GTUB 3KJYA 4GCIA 4ZXGA 2LS5A 3HJMA 4F9ZA 3WGXA 4AI6A 4MK3A 1DE1A 2H0IA 3LYKA 1Y1UA 3HMJG 4YQUA 3WGDA 4KUNA 3TOTA 1FOVA 4TRXA 3C1RA 2CZ2A 3F3QA 3HVVA 3Q19A 2CVBA 1NHOA 1TDIA 17GSA 4TW5A 1YF1A 2FWGA 3D4MA 4XCSA 1O85A 3TJBA 1R5AA 1U3IA 4DSQA 2G2QA 3F6DA 1F2EA 4G9HA 1SVOA 1Z9HA 2R5GA 3ZMLA 2F3MA 3F8UA 1M99A 1EV4A 1HNCA 2CV4A 1T7PB 3LJRA 3GMFA 3ERFA 1MD4A 3VI5A 2XBQA 2LV3A 4FH8A 3EU3A 4FO5A 2HZFA 1SK2A 5IMVA 3PGTA 4PURA 3F0IA 1YJ6A 2WFCA 1G6WA 5HQPA 4GQFA 3GA4A 2WGRA 2XBIA 3HZ4A 3CRUA 1TXUA 1PX7A 2GVPA 2HLSA 4Z2TA 1R4WA 4MLYA 1FB0A 1YZXA 5DQYA 3MYDA 3C8EA 1K3LA 4GDFA 1PRXA 1ZCPA 3HJOA 3KP8A 2GSSA 2LQOA 4XRDA 2KHPA 2R0GA 3IE3A 2H74A 3L9UA 3TU3B 5D8IA 2REMA 4XRAA 1T8EB 5AIVA 4KB3A 1A0FA 1GSUA 2CVDA 1M2BA 4I2UA 1FW1A 2HSNB 5AGYA 4KDXA 1G7OA 5ECLB 2HRKA 1TRUA 2N5BA 1C72A 1YVLA 3HJPA 3IPZA 3DVXA 4Z7XA 4HJMA 4E8EA 1ERTA 1NSWA 5A5HA 5ECQB 2V32A 4QMKA 3EU4A 2C1YA 2IIYA 2A2SA 5EL8A 4O5UA 2WCIA 2B7JA 2QA1A 3F4RA 3DD3A 2NDOA 2YANA 3KMNA 1H75A 1ERVA 5J41A 1F6MC 3HVSA 2C80A 3ED3A 4H86A 2K6VA 5GAND 5DJMA 1HNAA 5IQYA 3GFKA 3RDWA 4HQZA 5C00A 2WRTA 3RHCA 16GSA 2VL2C 1R5PA 2HRFA 3US3A 1GSSA 3WYWA 1X5EA 2VL9A 2AAWA 5IMCA 2QA2A 1M9AA 4NV5A 1UC7A 4ECBA 4IP6A 4QQ7A 1EGOA 3NZNA 1HNBA 3HXSA 2GQLA 4PQHA 5IPGA 3ZVJA 4GRFA 3ZL5A 2X8GA 2C0GA 1M0UA 2UZ8A 4ZB7A 4TR1A 1F3BA 2DLXA 5H5SA 1X9SB 3CRTA 4K7NA 2P5QA 3VWUA 3GTUA 4IQAA 1VF2A 1SJ6A 4ZL8A 1Z7RA 1WOUA 1GH2A 3D6IA 1FOHA 5JCGA 1ZMAA 4BL7B 1OVNA 2CAIA 3EMPA 1X9MB 4MNNA 2JACA 1XOBA 3H4KA 3UOMA 3BOAA 4IP1A 1UA5A 1PD21 1TW9A 1VRSD 1O8XA 1SK1A 1WP0A 3F6FA 4JZQA 4XS4A 4TR4A 4MH2A 2DJ2A 2K18A 2L4CA 2YWMA 4KX4A 5A5KA 22GSA 2YZUA 3C71A 2ON7A 2VCXA 5J3RA 2ALBA 4MJCA 3LQ7A 3IAM2 3D4TA 4PNGA 1FAAA 1XWBA 5G5EA 1U3AA 1K0AA 3VLNA 4AKXB 2MMOA 3TGZA 3D21A 4XIHA 3IK7A 1TRSA 1BX9A 2CQ9A 2LNTA 3PH9A 4D73B 4FYUA 5CRGA 5LCZA 13GSA 2PMTA 1EP8A 1OYJA 2LEGA 3FZ5A 1XOAA 3ZFLA 2O89A 3H93A 4KF9A 2ES7A 5JWRB 1A2LA 4TXOB 5KN2A 3DEXA 4NWYA 3FR3A 3GNJA 4A5PA 3QD9A 2HSMB 4WF5A 3KZQA 4HS1A 2GT6A 4ILFA 3L9SA 5J4UA 3GHAA 1XBSA 3M1GA 4Z2UA 5F07A 8GSSA 1R26A 2A2PA 1YQ1A 4HOJA 3JCML 1WJKA 1XVQA 3KMOA 4G0LA 4HUAA 1DUGA 4XTSA 2C4JA 4JEDA 5KN0A 3ZITA 1K0NA 1JFUA 2P0GA 1S3AA 3J7Yb 4L0WA 7GSSA 3GKNA 5EY6A 4LA1A 4RQRA 4NV2A 2PU9C 2X8HA 1B9YC 4WETA 4YKGA 1GSYA 2YV9A 2KP2A 2H6YA 1CQGA 2B1KA 1M2AA 2DJKA 4I5QA 4MPGA 4FYCA 4N11A 1W4VA 1SU9A 5JCWA 1KTEA 4K7OA 3WT2A 11GSA 3EPTA 3GL3A 2I1UA 4OO4A 1RW1A 5B6MA 4BA7A 4AJ7A 2B7KA 2R6KA 4OWYA 1FHEA 2VIMA 3GL5A 5DALB 4F0BA 2LUSA 1EZKA 2EIOA 4MPFA 4AKGA 1GUMA 3ISOA 4RQXA 2X49A 4MF7A 1ML6A 3BBYA 3QDNA 2IMFA 1QQ2A 2P5RA 3HCZA 2KP1A 4W66A 1SVLA 5D9TA 2HE3A 4WBJA 2C0EA 1TK8B 1CQHA 3ZREA 4EDZA 1PA3A 2IMEA 1PGTA 5AN1A 1K0CA 5A4WA 2YWIA 3BCKA 5IMDA 3DKSA 4QL9A 1SL0B 1WWJA 5INYA 3TKQA 3VPTA 4IGJA 4DSSA 3F4TA 2H6XA 4PX1A 2GQMA 2YP6A 3M9JA 3TUEA 3I43A 1AW9A 1BQ7A 4MJEA 1SD9A 4KNDA 2A2RA 3KH7A 4TKYA 2DMLA 1X9WB 1A8LA 2PGTA 3CSIA 2C3TA 3WD6A 4BWQA 3M9KA 4BL7A 2H70A 1ON4A 4WF4A 3ZFBA 2P31A 3D5JA 4ID0A 2IFQB 2BJXA 2H8LA 3LSZA 2LJAA 4TXVA 3ERWA 2F8FA 3TKPA 4X43A 1S3DA 4N30A 5J9CA 2RM6A 3H8QA 3ZYWA 4X4JA 2WJUA 4P3YB 3GUSA 4GQCA 1TI1A 5C04A 3ZIJA 1NM3A 1BF5A 5B6NA 10GSA 3UBKA 1SYRA 1B48A 5KOXA 2DIZA 5CRWA 2RM5A 2GLRA 4D73A 6GSWA 1YKCA 4BVYB 1LU4A 5ECKB 2E7PA 1IYHA 1HD2A 3R2QA 4TXOA 2NTOA 3DMLA 4POBA 2L59A 3TCOA 2HSMA 2E0QA 1KEBA 1ZOFA 1PMTA 2OE1A 3M0FA 2XPDA 2G0FA 3DIEA 1V2AA 2PVOC 2M80A 1K0OA 4AF2A 3TDGA 3GSSA 4L5OA 1OC3A 2GSRA 5ECHB 1G0TA 2YJ7A 2H01A 2O8VB 5IO0A 1T4ZA 3UIWA 1TXXA 4LLRA 2IN3A 2NPBA 3KIJA 4WKWA 4CDOA 5HFKA 4KE3A 6GSUA 2DMMA 3HYPA 2IMKA 2DSAA 4PXOA 3GIXA 5ELAA 3IK9A 5ECMB 2DKIA 2UV8G 5AIXA 3MDKA 2JSYA 4Q5FA 1AQWA 1LJRA 2H76A 4ECCA 2EIQA 4POMA 4ISDA 2HQTA 3KEBA 2L6DA 5DALA 1A2JA 4N0VA 4EKZA 5DBQA 4DSRA 3IXRA 3LWAA 4Z2RA 1GLPA 3CTFA 5J47A 2H1AA 1PN0A 1R7HA 3BJ5A 4L0UA 3UAPA 2VCTA 1JZRA 2R4VA 4EF0A 1W89A 2K8VA 2X99A 1TKDB 4POLA 4JR4A 2N5FA 1K0MA 2A4HA 2OBKA 2B1LA 4IN0A 1Z6NA 3VFIA 4K8MA 4IS0A 2V41A 5CP1A 4ZIJA 5EVOA 5EPFA 2OKAA 4G10A 2YV7A 2WZ9A 4N0ZA 2O87A 3GX0A 2AB6A 2JU5A 4HJ2A 3CBUA 2VL2A 4LL4B 2PWJA 3AY8A 4BVXA 2OJLA 4PUAA 3F9UA 3GN3A 5A4UA 1T4YA 9GSSA 3DGQA 3GURA 1SKRB 3ZZXA 5DVBA 2YOIA 4ZB9A 1TRVA 3WT1A 3H79A 1NHYA 2H0HA 1URMA 4EE0A 3TRXA 3TRPA 1DE2A 3F63A 2D2ZA 4IKHA 1BEDA 3I69A 2HSYA 4K1FA 2IFQA 4MZWA 1PL2A 2E2GA 4YQMA 2QKEA 2R2JA 1GWCA 2CX3A 2ZNMA 5B7CA 2A4VA 2R37A 4V2MA 1GNWA 4HU7A 2DJ3A 2HRAA 1GL8A 4WXTA 3N5OA 2GQKA 4MCUA 1OKTA 1N2AA 14GSA 4K6XA 3FKFA 2VM1A 1MTCA 2K8SA 4PUFC 1MDJA 3O76A 5D73A 5B8AA 1FVKA 1IYIA 2EFCA 1ZYQB 2LRNA 2YN1A 3NIVA 1ILOA 1O8WA 1SJIA 3GKXA 4PGTA 2R0CA 5KN1A 4ECIA 1XIYA 5DQSA 4BVYA 2RUFA 3CSJA 2NBSA 1EWXA 2VCQA 4NXIA 4V2NA 2BTOT 5CNWA 5KOWA 4F82A 1UN2A 2VD1A 2I4AA 3ME8A 2B3SA 1MEKA 3CMIA 3QPMA 1N25A 2J9HA 1X5CA 1XWKA 3FK8A 4O5QA 1GSDA 1E2YA 3Q6OA 3LGCA 3KCMA 2LJRA 2PERA 1K0BA 4MMMA 1ZYNA 5ENUA 2CVKA 2WULA 5A34B 3G9BA 1I9DA 3NOFA 4AJ6A 3UL3A 5ECPB 2AUVA 5LD0A 4YKFA 3IRAA 5ECNB 3UVHA 4ML6A 2Z9SA 4G0KA 3F3RA 3IDVA 1MD3A 1USBA 1GLQA 1M2DA 3RPNA 4MDCA 1SL1B 4FYBA 4IVFA 5IM9A 1UVZA 2V2GA 3GKMA 1JHBA 2FHEA 2J23A 3IOSA 5JWQB 1AUCA 1HYUA 3EYTA 2OACA 4F2IA 5G1LA 3TB2A 4GWRA 2DJ0A 2VD0A 1YEPA 4OCFA 4JRRA 5HFIA 4LMWA 5FT3A 4F0CA 1JLVA 1V40A 20GSA 2QGVA 4GF0A 1V58A 4EIPA 3F4SA 4HZ4A 1TU8A 2QC7A 3QAVA 3IA1A 3OR5A 3C1SA 3KTBA 1GNEA 3J7Yk 3K8NA 4OCEA 1SKSB 4I2TA 2YPMA 1GSEA 1Y25A 1RQMA 1ZGNA 5ECIB 3FW2A 3TKSE 2QSIA 4G0IA 1KNGA 4K2DA 3ZVJD 2H73A 2GTUA 1TK5B 19GSA 3A2XA 1GUKA 1T3BA 3Q18A 3V1WA 5G31A 2GZZA 5AISA 2HSNA 2RUEA 4Q5RA 2HZEB 5G2ZA 2LNSA 4XS1A 4HDEA 3LW9A 2MMAA 1YF0A 4HZ2A 1EP7A 3EMXA 2IMIA 3L0HA 4MABA 2DBCA 3IR4A 1T00A 4G2EA 3HA9A 2VCWA 4KH7A 1TRWA 3M3MA 1FVJA 2O85A 3KGKA 5IOXA 2H0GA 1E6BA 1EOHA 4KCEA 2DIYA 3CWGA 3VPQA 3DXBA 2HYXA 4LMVA 3QOUA 4IJIA 1QXHA 2L4QA 4TR0A 2GSQA 18GSA 4EUYA 3CTGA 1G7EA 1GRXA 4Q5QA 3A5IA 3L78A 2ON5A 3P2AA 2LKUA 4GXZA 4IQ1A 1JZDA 2V6OA 4MA9A 2RLIA 3ZTLA 1A24A 3A2VA 5F8BA 3VWVA 5IMFA 2H30A 3ZIVA 5BMUB 3UJ1A 2LJKA 3TJFA 3G7IA 5KEJA 3IHQA 2F51A 2AHEA 2OE3A 3P90A 5GAPD 3TKSA 2I3YA 2C3QA 4HEA2 5ID2B 5ECSA 5ECOB 2CZ3A 3A5WA 5CAXA 1THXA 2PN8A 4KCAA 1Q4JA 4G19A 1H4OA 4LL1B 4TN8A 4I97A 5GSTA 3MWHA 1K0DA 2NVLA 5CRDA 1M9BA 5L71A 2VUPA 3IC4A 3GX8A 4GSSA 5A5HB 1O73A 2CA8A 5LNKe 1ZYPA 3EINA 4IHUA 2VCZA 2C3NA 1SYXA 5BRTA 3TJJA 4MF6A 4DEJA 2LSTA 1X0RA 3WGEA 3FY7A 2B5YA 4G01A 1SD8A 4I8BA 1QGVA 4HQSA 3TKSC 1A0RP 4WBRD 1YKAA 2L57A 1V57A 5E4WA 2DC5A 2YJHA 1XPVA 4NMUA 1YEXA 1J08A 4EL1A 4CY8A 1WE0A 4KAEA 3VWXA 2HRNA 4BPYA 1BAYA 2FNOA 1J0FA 3G7JA 4ZL7A 2BMXA 2O7KA 2YWOA 3HDCA 4K9ZA 3ZLPA 4AJ8A 4O7HA 1U87A 5JWOB 4OMVA 3P8WA 1SJZA 2IJYA 1F37A 5HR1A 4ZB6A 2GZPA 4QL7A 2C8UA 2JADA 3HY2A 1RK4A 4V2LA 2WB9A 4POKA 4RI7A 1PX6A 4ML1A 5B8BA 3HZ8A 2OBIA 5D93A 2H1BA 4KW6A 2H72A 2MYGA 5IPHA 4EDYA 3QAWA 4ZBDA 2AJQB 3MSZA 1QMVA 2HNLA 1SL2B 1MDKA 1WMJA 5E59A 2VL3A 2B5EA 5DJLA 4CHSA 1XW5A 1PKZA 2FY6A 3FZ9A 2L6CA 3KXOA 1B4QA 2HZEA 5HR3A 1G6YA 5DAKB 4DVCA 3BD2A 1J9BA 4OO5A 3HD5A 3FZAA 2L5LA 1XFLA 4XS4B 1QFNA 6GSSA 2VM2A 2I81A 3APQA 2LRCA 1XW9A 3UARA 3RHBA 1GTIA 3RBTA 2WS2A 4N10A 1Y6EA 3GH9A 3IC8A 2LQQA 5DCGA 4L5LA 1B9XC 4FIWA 2HXKA 1T1VA 1BG5A 4ZBBA 2H1LA 3VURA 2MMNA 2DJ1A 3D0ZA 2FGXA 2EFDA 2V6KA 5GZZB 3QCPA 4RI6A 1TOFA 4TR3A 2HFDA 1XWGA 3BCIA 3GRXA 2YNXA 4K5RA 1TI3A 5HR2A 5BMUA 3FZ4A 3EURA 4WR4A 4YAVA 1N8JA 1Q98A 4XHMA 3LORA 5ID2A 1ZL9A 2OT3A 2FD3A 2PVQA 2H66A 3PINA 1KBNA 4ECJA 2VKZG 3UMAA 2DJJA 3O3TA 4OD7A 1SKWB 2VCVA 4BWSA 2N5AA 5D9WA 3FMWA 1A8YA 4V1Ag 1K3YA 5D96A 5F06A 3SWLA 3E3EA 2JL4A 1EEMA 1GULA 1S3CA 1PSQA 5A4VA 2YWNA 1OAZA 2FLSA 2FWEA 2B5XA 2JZTA 1K3OA 2XPEA 2GS3A 2RIIA 1V98A 3W8JA 2O5VA 2EIRA 2FUG2 2WDUA 2CX4A 2R3XA 2H19A 1Z7PA 3LFLA 1Z3EA 1TP9A 3ZMKA 1OE8A 3FEUA 2R0PA 2GGTA 6GSVA 2GT5A 4USSA 4EVMA 3TJKA 2C0DA 1OC9B 3IAS2 5DDLA 1XVWA 3APOA 5D9VA 4J2FA 3L4NA 4GLTA 4KDUA 3IBHA 2KUCA 2HT9A 2MBTA 2DKHA 5G5FA 2XC2A 2IMDA 2GDRA 2FWHA 2F9SA 1O6JA 1XXUA 4DSSB 3PPUA 3R3EA 2X4AA 1AQXA 4GSNA 4FQUA 3C7MA 2MZCA 4KDYA 3QFAC 4EIQA 1BJXA 4MZBA 3LEFA 1DBYA 2YCDA 4KSMA 3EVIA 5A1NB 1EEJA 3MIXA 1XW6A 4WEYA 5ECRB 1EOGA 3KM6A 1MDIA 3HVXA 4O92A 4OFMA 4K7IA 1AIUA 5DAKA 3LXZA 1I5GA 5GSSA 2FA4A 4K2XA 2H1GA 6GSYA 2CAQA 1WRYA 1VF1A 1TU7A 2OADA 3TRQA 2EFHA 2TRXA 4IJ3A 5KN3A 1VF4A 1FB6A 2JSZA 4MP4A 4E8HA 2LRTA 1M7TA 5F05A 1LBKA 4YQVA 2OA7A 4AKIA 4J56E 1JZWA 1WPIA 2EFEA 2K9FA 2YZHA 1VGLA 1O81A 1ERWA 3TJGA 2LTKA 1YY7A 2GSTA 3C73A 1PL1A 5JCUA 4K5SA 5IOWA 1OC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPB A;  4OFN A;  4ULX A;  4JE1 A;  3UBL A;  3MNG A;  1F3A A;  3DYR A;  2I9H A;  4CW9 A;  3GYK A;  1GSF A;  2PUK C;  2VLT A;  2MBS A;  3ZRD A;  2B6M A;  2ZUP A;  1AAZ A;  4NHW A;  2IL3 A;  4NAX A;  1AXD A;  4K0N A;  3W8S A;  3FHK A;  1O7U A;  3D22 A;  5CRH A;  5HR0 A;  3E9J B;  1PQN A;  4F03 A;  2XHF A;  3CSH A;  4MZC A;  5FWG A;  1XZO A;  2X64 A;  3ME7 A;  2H75 A;  3U6V A;  1VF3 A;  2FCH A;  1GTU A;  4KGI A;  3SBC A;  5F0G A;  4V1A p;  3G7Y A;  3TOU A;  1ACV A;  2H1D A;  4Q5N A;  1BYE A;  5ELG A;  5J5N A;  1V9W A;  4X0X A;  1QUW A;  3RAZ A;  4EO3 A;  4IEL A;  1SEN A;  1ABA A;  1OKD A;  3QFB C;  4L8E A;  4MJB A;  4HI7 A;  5G1K A;  3A3T A;  2MMZ A;  5IMA A;  4YAP A;  4GST A;  2VLU A;  4HU9 A;  3FRC A;  4PNF A;  3DWV A;  3PR8 A;  3LYP A;  3FR6 A;  1ZYE A;  3QMX A;  4ACS A;  5CRE A;  4IBP A;  3KTL A;  5D9X A;  1GTA A;  3KD0 A;  3VI7 A;  4RUV A;  1GUH A;  1ST9 A;  1JZO A;  1HQO A;  1F9M A;  2IPA A;  4JR6 A;  4TVE A;  4J57 E;  4O32 A;  3VK9 A;  1EGR A;  2M72 A;  4JU5 A;  1OC9 A;  1GTB A;  4ZL9 A;  3S9F A;  3TKR A;  4IW9 A;  1DSB A;  3P7X A;  3QAG A;  1PN9 A;  2ZCT A;  4ZBA A;  5J9B A;  1TK0 B;  2V1M A;  2VLV A;  3DRN A;  2FWF A;  1QK8 A;  2EC4 A;  2OE0 A;  3CXG A;  4JBB A;  1ERU A;  2VO4 A;  4EC0 A;  3KP9 A;  4NHZ A;  3GH6 A;  1B4P A;  2TRC P;  4BVX B;  2PBJ A;  3QR6 A;  4PQI A;  2C0F A;  4WR5 A;  2E2M A;  4OFT A;  3CYN A;  3I9V 2;  1NW2 A;  1XCC A;  4MF5 A;  1EV9 A;  1PKW A;  2HRK B;  4KA0 A;  3RPP A;  3GV1 A;  2KOK A;  4PQ1 A;  1FO5 A;  2TIR A;  3DVW A;  3L9V A;  12GS A;  5ABR A;  4I6X A;  3APS A;  1WIK A;  3M8N A;  2CT6 A;  2JZS A;  1A23 A;  1U88 A;  1A2M A;  3GST A;  3W6G A;  1JLW A;  2PPT A;  4KSO A;  2HI7 A;  2M46 A;  3H1N A;  3EWL A;  1X5D A;  5H5Q A;  1AQV A;  1SK0 A;  3Q74 A;  1Z6M A;  4XS6 A;  3U5R E;  4MJA A;  1B8X A;  3UVT A;  2AV4 A;  3E0U A;  3LG6 A;  4K0G A;  1FG4 A;  4GTU A;  5IO2 A;  2IWT A;  4PTS A;  3UEM A;  1Z5Y E;  3LXT A;  4MH3 A;  1AC1 A;  5COH A;  5CO3 A;  4AGS A;  4EXJ A;  5IIZ A;  2KLX A;  1U6T A;  2H6Z A;  3I6A A;  3EC3 A;  3KH9 A;  2VAF A;  5FHI A;  5H5R A;  4ZB8 A;  2FA8 A;  3IV4 A;  1THO A;  2GZY A;  1TTZ A;  2F8A A;  1XWA A;  3FYG A;  3GKK A;  1ZZY A;  3MAK A;  1XWC A;  1OE7 A;  1TJD A;  2VOC A;  3ERG A;  1YDK A;  2L5O A;  4X1U A;  3A2W A;  3VWW A;  3FR9 A;  5IMZ A;  3O6T A;  2X8C A;  2JZR A;  2AYT A;  4TOP A;  3EE2 A;  3HHV A;  6GST A;  5DCH A;  5G30 A;  4O5R A;  6GSX A;  2H71 A;  5CYY A;  3HKR A;  1GSQ A;  2HSH A;  4TR1 B;  1GP1 A;  4YH2 A;  5HFG A;  4ZIL A;  3N9J A;  3GTU B;  3KJY A;  4GCI A;  4ZXG A;  2LS5 A;  3HJM A;  4F9Z A;  3WGX A;  4MK3 A;  1DE1 A;  2H0I A;  3LYK A;  4YQU A;  3WGD A;  4KUN A;  3TOT A;  1FOV A;  4TRX A;  3C1R A;  2CZ2 A;  3F3Q A;  3HVV A;  3Q19 A;  2CVB A;  1NHO A;  1TDI A;  17GS A;  4TW5 A;  1YF1 A;  2FWG A;  3D4M A;  4XCS A;  1O85 A;  3TJB A;  1R5A A;  1U3I A;  4DSQ A;  2G2Q A;  3F6D A;  1F2E A;  4G9H A;  1Z9H A;  2R5G A;  3ZML A;  2F3M A;  3F8U A;  1M99 A;  1EV4 A;  1HNC A;  2CV4 A;  1T7P B;  3LJR A;  3GMF A;  3ERF A;  1MD4 A;  3VI5 A;  2XBQ A;  2LV3 A;  4FH8 A;  3EU3 A;  4FO5 A;  2HZF A;  1SK2 A;  5IMV A;  3PGT A;  4PUR A;  3F0I A;  1YJ6 A;  2WFC A;  1G6W A;  5HQP A;  4GQF A;  3GA4 A;  2WGR A;  2XBI A;  3HZ4 A;  3CRU A;  1PX7 A;  2GVP A;  2HLS A;  1R4W A;  4MLY A;  1FB0 A;  1YZX A;  5DQY A;  3C8E A;  1K3L A;  1PRX A;  1ZCP A;  3HJO A;  3KP8 A;  2GSS A;  2LQO A;  4XRD A;  2KHP A;  3IE3 A;  2H74 A;  3L9U A;  5D8I A;  2REM A;  4XRA A;  1T8E B;  5AIV A;  4KB3 A;  1A0F A;  1GSU A;  2CVD A;  1M2B A;  4I2U A;  1FW1 A;  2HSN B;  5AGY A;  4KDX A;  1G7O A;  5ECL B;  2HRK A;  1TRU A;  2N5B A;  1C72 A;  3HJP A;  3IPZ A;  3DVX A;  4Z7X A;  4HJM A;  4E8E A;  1ERT A;  1NSW A;  5ECQ B;  2V32 A;  3EU4 A;  2C1Y A;  2IIY A;  2A2S A;  5EL8 A;  2WCI A;  2B7J A;  3F4R A;  3DD3 A;  2NDO A;  2YAN A;  3KMN A;  1H75 A;  1ERV A;  5J41 A;  1F6M C;  3HVS A;  2C80 A;  3ED3 A;  4H86 A;  2K6V A;  5GAN D;  5DJM A;  1HNA A;  5IQY A;  3GFK A;  3RDW A;  4HQZ A;  5C00 A;  2WRT A;  3RHC A;  16GS A;  2VL2 C;  1R5P A;  2HRF A;  3US3 A;  1GSS A;  3WYW A;  1X5E A;  2VL9 A;  2AAW A;  5IMC A;  1M9A A;  4NV5 A;  1UC7 A;  4ECB A;  4IP6 A;  4QQ7 A;  1EGO A;  3NZN A;  1HNB A;  3HXS A;  2GQL A;  4PQH A;  5IPG A;  3ZVJ A;  4GRF A;  3ZL5 A;  2X8G A;  2C0G A;  1M0U A;  2UZ8 A;  4TR1 A;  1F3B A;  2DLX A;  5H5S A;  1X9S B;  3CRT A;  4K7N A;  2P5Q A;  3VWU A;  3GTU A;  4IQA A;  1VF2 A;  1SJ6 A;  4ZL8 A;  1Z7R A;  1WOU A;  1GH2 A;  3D6I A;  5JCG A;  1ZMA A;  4BL7 B;  1OVN A;  2CAI A;  3EMP A;  1X9M B;  2JAC A;  1XOB A;  3H4K A;  3UOM A;  3BOA A;  4IP1 A;  1UA5 A;  1PD2 1;  1TW9 A;  1VRS D;  1O8X A;  1SK1 A;  1WP0 A;  3F6F A;  4JZQ A;  4XS4 A;  4TR4 A;  4MH2 A;  2DJ2 A;  2K18 A;  2L4C A;  2YWM A;  4KX4 A;  5A5K A;  22GS A;  2YZU A;  3C71 A;  2ON7 A;  2VCX A;  5J3R A;  2ALB A;  4MJC A;  3LQ7 A;  3IAM 2;  3D4T A;  4PNG A;  1FAA A;  1XWB A;  5G5E A;  1U3A A;  1K0A A;  3VLN A;  2MMO A;  3TGZ A;  3D21 A;  4XIH A;  3IK7 A;  1TRS A;  1BX9 A;  2CQ9 A;  2LNT A;  3PH9 A;  4D73 B;  4FYU A;  5CRG A;  5LCZ A;  13GS A;  2PMT A;  1EP8 A;  1OYJ A;  2LEG A;  3FZ5 A;  1XOA A;  3ZFL A;  2O89 A;  3H93 A;  4KF9 A;  2ES7 A;  5JWR B;  1A2L A;  4TXO B;  5KN2 A;  3DEX A;  4NWY A;  3FR3 A;  3GNJ A;  3QD9 A;  2HSM B;  4WF5 A;  3KZQ A;  4HS1 A;  2GT6 A;  4ILF A;  3L9S A;  5J4U A;  3GHA A;  1XBS A;  3M1G A;  5F07 A;  8GSS A;  1R26 A;  1YQ1 A;  4HOJ A;  3JCM L;  1WJK A;  1XVQ A;  3KMO A;  4G0L A;  4HUA A;  1DUG A;  4XTS A;  2C4J A;  4JED A;  5KN0 A;  3ZIT A;  1K0N A;  1JFU A;  2P0G A;  1S3A A;  3J7Y b;  4L0W A;  7GSS A;  3GKN A;  5EY6 A;  4LA1 A;  4RQR A;  4NV2 A;  2PU9 C;  2X8H A;  1B9Y C;  4WET A;  1GSY A;  2YV9 A;  2KP2 A;  2H6Y A;  1CQG A;  2B1K A;  1M2A A;  2DJK A;  4I5Q A;  4MPG A;  4FYC A;  4N11 A;  1W4V A;  1SU9 A;  5JCW A;  1KTE A;  4K7O A;  3WT2 A;  11GS A;  3GL3 A;  2I1U A;  4OO4 A;  1RW1 A;  5B6M A;  4BA7 A;  4AJ7 A;  2B7K A;  2R6K A;  4OWY A;  1FHE A;  2VIM A;  3GL5 A;  5DAL B;  4F0B A;  2LUS A;  1EZK A;  2EIO A;  4MPF A;  1GUM A;  3ISO A;  4RQX A;  4MF7 A;  1ML6 A;  3BBY A;  3QDN A;  2IMF A;  1QQ2 A;  2P5R A;  3HCZ A;  2KP1 A;  5D9T A;  2HE3 A;  4WBJ A;  2C0E A;  1TK8 B;  1CQH A;  3ZRE A;  4EDZ A;  1PA3 A;  2IME A;  1PGT A;  5AN1 A;  1K0C A;  5A4W A;  2YWI A;  3BCK A;  5IMD A;  3DKS A;  4QL9 A;  1SL0 B;  1WWJ A;  5INY A;  3TKQ A;  3VPT A;  4IGJ A;  4DSS A;  3F4T A;  2H6X A;  4PX1 A;  2GQM A;  2YP6 A;  3M9J A;  3TUE A;  3I43 A;  1AW9 A;  1BQ7 A;  4MJE A;  1SD9 A;  4KND A;  2A2R A;  3KH7 A;  4TKY A;  2DML A;  1X9W B;  1A8L A;  2PGT A;  3CSI A;  2C3T A;  3WD6 A;  4BWQ A;  3M9K A;  4BL7 A;  2H70 A;  1ON4 A;  4WF4 A;  3ZFB A;  2P31 A;  3D5J A;  4ID0 A;  2IFQ B;  2BJX A;  2H8L A;  3LSZ A;  2LJA A;  4TXV A;  3ERW A;  2F8F A;  3TKP A;  4X43 A;  1S3D A;  4N30 A;  5J9C A;  2RM6 A;  3H8Q A;  3ZYW A;  2WJU A;  4P3Y B;  3GUS A;  4GQC A;  1TI1 A;  5C04 A;  3ZIJ A;  1NM3 A;  5B6N A;  10GS A;  3UBK A;  1SYR A;  1B48 A;  2DIZ A;  5CRW A;  2RM5 A;  2GLR A;  4D73 A;  6GSW A;  1YKC A;  4BVY B;  1LU4 A;  5ECK B;  2E7P A;  1IYH A;  1HD2 A;  3R2Q A;  4TXO A;  2NTO A;  3DML A;  4POB A;  2L59 A;  3TCO A;  2HSM A;  2E0Q A;  1KEB A;  1ZOF A;  1PMT A;  2OE1 A;  3M0F A;  2XPD A;  2G0F A;  3DIE A;  1V2A A;  2PVO C;  2M80 A;  1K0O A;  4AF2 A;  3TDG A;  3GSS A;  4L5O A;  1OC3 A;  2GSR A;  5ECH B;  1G0T A;  2YJ7 A;  2H01 A;  2O8V B;  5IO0 A;  1T4Z A;  3UIW A;  1TXX A;  4LLR A;  2IN3 A;  2NPB A;  3KIJ A;  4WKW A;  4CDO A;  5HFK A;  4KE3 A;  6GSU A;  2DMM A;  3HYP A;  2IMK A;  2DSA A;  4PXO A;  3GIX A;  5ELA A;  3IK9 A;  5ECM B;  5AIX A;  3MDK A;  2JSY A;  4Q5F A;  1AQW A;  1LJR A;  2H76 A;  4ECC A;  2EIQ A;  4POM A;  4ISD A;  2HQT A;  3KEB A;  2L6D A;  5DAL A;  1A2J A;  4N0V A;  4EKZ A;  5DBQ A;  4DSR A;  3IXR A;  3LWA A;  1GLP A;  3CTF A;  2H1A A;  1R7H A;  3BJ5 A;  4L0U A;  3UAP A;  2VCT A;  1JZR A;  2R4V A;  4EF0 A;  1W89 A;  2K8V A;  2X99 A;  1TKD B;  4POL A;  4JR4 A;  2N5F A;  1K0M A;  2OBK A;  2B1L A;  4IN0 A;  1Z6N A;  3VFI A;  4K8M A;  4IS0 A;  2V41 A;  5CP1 A;  4ZIJ A;  5EVO A;  5EPF A;  2OKA A;  4G10 A;  2YV7 A;  2WZ9 A;  4N0Z A;  2O87 A;  3GX0 A;  2AB6 A;  2JU5 A;  4HJ2 A;  3CBU A;  2VL2 A;  4LL4 B;  2PWJ A;  3AY8 A;  4BVX A;  2OJL A;  4PUA A;  3F9U A;  3GN3 A;  5A4U A;  1T4Y A;  9GSS A;  3DGQ A;  3GUR A;  1SKR B;  3ZZX A;  5DVB A;  2YOI A;  4ZB9 A;  1TRV A;  3WT1 A;  3H79 A;  1NHY A;  2H0H A;  1URM A;  4EE0 A;  3TRX A;  3TRP A;  1DE2 A;  3F63 A;  2D2Z A;  4IKH A;  1BED A;  3I69 A;  2HSY A;  4K1F A;  2IFQ A;  4MZW A;  1PL2 A;  2E2G A;  4YQM A;  2QKE A;  2R2J A;  1GWC A;  2CX3 A;  2ZNM A;  5B7C A;  2A4V A;  2R37 A;  4V2M A;  1GNW A;  4HU7 A;  2DJ3 A;  2HRA A;  1GL8 A;  4WXT A;  3N5O A;  2GQK A;  4MCU A;  1OKT A;  1N2A A;  14GS A;  4K6X A;  3FKF A;  2VM1 A;  1MTC A;  2K8S A;  4PUF C;  1MDJ A;  3O76 A;  5D73 A;  5B8A A;  1FVK A;  1IYI A;  1ZYQ B;  2LRN A;  2YN1 A;  3NIV A;  1ILO A;  1O8W A;  1SJI A;  3GKX A;  4PGT A;  5KN1 A;  4ECI A;  1XIY A;  5DQS A;  4BVY A;  2RUF A;  3CSJ A;  2NBS A;  1EWX A;  2VCQ A;  4NXI A;  4V2N A;  2BTO T;  5CNW A;  4F82 A;  1UN2 A;  2VD1 A;  2I4A A;  3ME8 A;  2B3S A;  1MEK A;  3CMI A;  3QPM A;  2J9H A;  1X5C A;  1XWK A;  3FK8 A;  3Q6O A;  1GSD A;  1E2Y A;  3LGC A;  3KCM A;  2LJR A;  2PER A;  1K0B A;  4MMM A;  5ENU A;  2CVK A;  2WUL A;  3G9B A;  1I9D A;  3NOF A;  4AJ6 A;  3UL3 A;  5ECP B;  2AUV A;  5LD0 A;  3IRA A;  5ECN B;  3UVH A;  4ML6 A;  2Z9S A;  4G0K A;  3F3R A;  3IDV A;  1MD3 A;  1USB A;  1GLQ A;  1M2D A;  3RPN A;  4MDC A;  1SL1 B;  4FYB A;  4IVF A;  5IM9 A;  1UVZ A;  2V2G A;  3GKM A;  1JHB A;  2FHE A;  2J23 A;  3IOS A;  5JWQ B;  1AUC A;  1HYU A;  3EYT A;  2OAC A;  4F2I A;  5G1L A;  3TB2 A;  4GWR A;  2DJ0 A;  2VD0 A;  1YEP A;  4OCF A;  4JRR A;  5HFI A;  4LMW A;  5FT3 A;  4F0C A;  1JLV A;  1V40 A;  20GS A;  2QGV A;  4GF0 A;  1V58 A;  3F4S A;  4HZ4 A;  1TU8 A;  2QC7 A;  3QAV A;  3IA1 A;  3OR5 A;  3C1S A;  3KTB A;  1GNE A;  3J7Y k;  3K8N A;  4OCE A;  1SKS B;  4I2T A;  2YPM A;  1GSE A;  1Y25 A;  1RQM A;  1ZGN A;  5ECI B;  3FW2 A;  3TKS E;  2QSI A;  4G0I A;  1KNG A;  4K2D A;  3ZVJ D;  2H73 A;  2GTU A;  1TK5 B;  19GS A;  3A2X A;  1GUK A;  1T3B A;  3Q18 A;  3V1W A;  5G31 A;  2GZZ A;  5AIS A;  2RUE A;  4Q5R A;  2HZE B;  5G2Z A;  2LNS A;  4XS1 A;  4HDE A;  2MMA A;  1YF0 A;  4HZ2 A;  1EP7 A;  3EMX A;  2IMI A;  3L0H A;  4MAB A;  2DBC A;  3IR4 A;  1T00 A;  4G2E A;  3HA9 A;  2VCW A;  4KH7 A;  1TRW A;  3M3M A;  1FVJ A;  2O85 A;  3KGK A;  5IOX A;  2H0G A;  1E6B A;  1EOH A;  4KCE A;  2DIY A;  3VPQ A;  3DXB A;  2HYX A;  4LMV A;  3QOU A;  4IJI A;  1QXH A;  2L4Q A;  4TR0 A;  2GSQ A;  18GS A;  4EUY A;  3CTG A;  1G7E A;  1GRX A;  4Q5Q A;  3L78 A;  2ON5 A;  3P2A A;  4GXZ A;  2LKU A;  4IQ1 A;  1JZD A;  2V6O A;  4MA9 A;  2RLI A;  3ZTL A;  1A24 A;  3A2V A;  5F8B A;  3VWV A;  5IMF A;  2H30 A;  3ZIV A;  3UJ1 A;  2LJK A;  3TJF A;  3G7I A;  5KEJ A;  3IHQ A;  2F51 A;  2AHE A;  2OE3 A;  3P90 A;  5GAP D;  3TKS A;  2I3Y A;  2C3Q A;  4HEA 2;  5ID2 B;  5ECS A;  5ECO B;  2CZ3 A;  3A5W A;  5CAX A;  1THX A;  2PN8 A;  4KCA A;  1Q4J A;  4G19 A;  1H4O A;  4LL1 B;  4TN8 A;  4I97 A;  5GST A;  3MWH A;  1K0D A;  2NVL A;  5CRD A;  1M9B A;  5L71 A;  2VUP A;  3IC4 A;  3GX8 A;  4GSS A;  1O73 A;  5LNK e;  2CA8 A;  3EIN A;  4IHU A;  2VCZ A;  2C3N A;  1SYX A;  3TJJ A;  4MF6 A;  4DEJ A;  2LST A;  1X0R A;  3WGE A;  3FY7 A;  2B5Y A;  1SD8 A;  4I8B A;  1QGV A;  4HQS A;  3TKS C;  1A0R P;  4WBR D;  1YKA A;  2L57 A;  1V57 A;  5E4W A;  2DC5 A;  2YJH A;  1XPV A;  4NMU A;  1YEX A;  1J08 A;  4EL1 A;  1WE0 A;  4KAE A;  3VWX A;  2HRN A;  4BPY A;  1BAY A;  2FNO A;  1J0F A;  3G7J A;  4ZL7 A;  2BMX A;  2O7K A;  2YWO A;  3HDC A;  4K9Z A;  3ZLP A;  4AJ8 A;  4O7H A;  1U87 A;  5JWO B;  4OMV A;  3P8W A;  1SJZ A;  2IJY A;  1F37 A;  5HR1 A;  4ZB6 A;  2GZP A;  4QL7 A;  2C8U A;  2JAD A;  3HY2 A;  1RK4 A;  4V2L A;  2WB9 A;  4POK A;  4RI7 A;  1PX6 A;  4ML1 A;  5B8B A;  3HZ8 A;  2OBI A;  5D93 A;  2H1B A;  4KW6 A;  2H72 A;  2MYG A;  5IPH A;  4EDY A;  3QAW A;  4ZBD A;  2AJQ B;  3MSZ A;  1QMV A;  2HNL A;  1SL2 B;  1MDK A;  1WMJ A;  5E59 A;  2VL3 A;  2B5E A;  5DJL A;  4CHS A;  1XW5 A;  1PKZ A;  2FY6 A;  3FZ9 A;  2L6C A;  3KXO A;  1B4Q A;  2HZE A;  5HR3 A;  1G6Y A;  5DAK B;  4DVC A;  3BD2 A;  1J9B A;  4OO5 A;  3HD5 A;  3FZA A;  2L5L A;  1XFL A;  4XS4 B;  1QFN A;  6GSS A;  2VM2 A;  2I81 A;  3APQ A;  2LRC A;  1XW9 A;  3UAR A;  3RHB A;  1GTI A;  3RBT A;  2WS2 A;  4N10 A;  1Y6E A;  3GH9 A;  3IC8 A;  2LQQ A;  5DCG A;  4L5L A;  1B9X C;  4FIW A;  2HXK A;  1T1V A;  1BG5 A;  4ZBB A;  3VUR A;  2MMN A;  2DJ1 A;  3D0Z A;  2FGX A;  2V6K A;  5GZZ B;  3QCP A;  4RI6 A;  1TOF A;  4TR3 A;  2HFD A;  1XWG A;  3BCI A;  3GRX A;  2YNX A;  1TI3 A;  5HR2 A;  5BMU A;  3FZ4 A;  3EUR A;  4WR4 A;  4YAV A;  1N8J A;  1Q98 A;  4XHM A;  3LOR A;  5ID2 A;  1ZL9 A;  2FD3 A;  2PVQ A;  2H66 A;  3PIN A;  1KBN A;  4ECJ A;  3UMA A;  2DJJ A;  3O3T A;  4OD7 A;  1SKW B;  2VCV A;  4BWS A;  2N5A A;  5D9W A;  1A8Y A;  4V1A g;  1K3Y A;  5D96 A;  5F06 A;  3SWL A;  3E3E A;  2JL4 A;  1EEM A;  1GUL A;  1S3C A;  1PSQ A;  5A4V A;  2YWN A;  1OAZ A;  2FLS A;  2FWE A;  2B5X A;  2JZT A;  1K3O A;  2XPE A;  2GS3 A;  2RII A;  1V98 A;  3W8J A;  2EIR A;  2FUG 2;  2WDU A;  2CX4 A;  2R3X A;  2H19 A;  1Z7P A;  3LFL A;  1Z3E A;  1TP9 A;  3ZMK A;  1OE8 A;  3FEU A;  2GGT A;  6GSV A;  2GT5 A;  4USS A;  4EVM A;  3TJK A;  2C0D A;  1OC9 B;  3IAS 2;  5DDL A;  1XVW A;  3APO A;  5D9V A;  4J2F A;  3L4N A;  4GLT A;  4KDU A;  3IBH A;  2KUC A;  2HT9 A;  2MBT A;  5G5F A;  2XC2 A;  2IMD A;  2GDR A;  2FWH A;  2F9S A;  1O6J A;  1XXU A;  4DSS B;  3PPU A;  3R3E A;  1AQX A;  4GSN A;  4FQU A;  3C7M A;  2MZC A;  4KDY A;  3QFA C;  1BJX A;  4MZB A;  3LEF A;  1DBY A;  2YCD A;  4KSM A;  3EVI A;  1EEJ A;  1XW6 A;  4WEY A;  5ECR B;  1EOG A;  3KM6 A;  1MDI A;  3HVX A;  4O92 A;  4OFM A;  4K7I A;  1AIU A;  5DAK A;  3LXZ A;  1I5G A;  5GSS A;  2FA4 A;  2H1G A;  6GSY A;  2CAQ A;  1WRY A;  1VF1 A;  1TU7 A;  2OAD A;  3TRQ A;  2TRX A;  4IJ3 A;  5KN3 A;  1VF4 A;  1FB6 A;  2JSZ A;  4MP4 A;  4E8H A;  2LRT A;  1M7T A;  5F05 A;  1LBK A;  4YQV A;  2OA7 A;  4J56 E;  1JZW A;  1WPI A;  2K9F A;  1VGL A;  2YZH A;  1O81 A;  1ERW A;  3TJG A;  2LTK A;  1YY7 A;  2GST A;  3C73 A;  1PL1 A;  5JCU A;  5IOW A;  1OC8 A; 
#chains in the Genus database with same CATH topology
 4NPB A;  4OFN A;  4ULX A;  4JE1 A;  3UBL A;  3MNG A;  1F3A A;  3DYR A;  2I9H A;  4CW9 A;  3GYK A;  1GSF A;  2PUK C;  2VLT A;  2MBS A;  3ZRD A;  2B6M A;  2ZUP A;  1AAZ A;  4NHW A;  2IL3 A;  4NAX A;  1AXD A;  4K0N A;  3W8S A;  3FHK A;  1O7U A;  3D22 A;  5CRH A;  5HR0 A;  3E9J B;  1PQN A;  4F03 A;  2XHF A;  3CSH A;  4MZC A;  5FWG A;  1XZO A;  2X64 A;  1M3J A;  3ME7 A;  2H75 A;  3U6V A;  1VF3 A;  2FCH A;  1GTU A;  4KGI A;  3SBC A;  5F0G A;  4V1A p;  1SVM A;  3G7Y A;  3TOU A;  1ACV A;  4CY6 A;  2H1D A;  4Q5N A;  1BYE A;  5ELG A;  5J5N A;  1V9W A;  4X0X A;  1QUW A;  3RAZ A;  4EO3 A;  4IEL A;  1SEN A;  1ABA A;  1OKD A;  3QFB C;  4L8E A;  4MJB A;  4HI7 A;  5G1K A;  5J40 A;  3A3T A;  2MMZ A;  5IMA A;  4YAP A;  4GST A;  2VLU A;  4HU9 A;  3FRC A;  4PNF A;  3DWV A;  3PR8 A;  3LYP A;  3FR6 A;  1ZYE A;  5J4V A;  3QMX A;  4ACS A;  5CRE A;  4IBP A;  4E68 A;  3KTL A;  5D9X A;  1GTA A;  3KD0 A;  3VI7 A;  4RUV A;  1GUH A;  1ST9 A;  1JZO A;  1HQO A;  1F9M A;  2IPA A;  4JR6 A;  4TVE A;  4J57 E;  4O32 A;  3VK9 A;  1EGR A;  2M72 A;  4JU5 A;  1OC9 A;  1GTB A;  4ZL9 A;  4HSC X;  3S9F A;  3TKR A;  4IW9 A;  1DSB A;  3P7X A;  3QAG A;  1PN9 A;  2ZCT A;  4ZBA A;  5J9B A;  1TK0 B;  2V1M A;  2VLV A;  4ICY A;  3DRN A;  2FWF A;  1QK8 A;  2EC4 A;  2OE0 A;  3CXG A;  4JBB A;  1ERU A;  2VO4 A;  4EC0 A;  3KP9 A;  4NHZ A;  3GH6 A;  1B4P A;  2TRC P;  4BVX B;  2PBJ A;  3QR6 A;  4PQI A;  2C0F A;  4WR5 A;  2E2M A;  4OFT A;  3CYN A;  3I9V 2;  1NW2 A;  1XCC A;  4MF5 A;  1EV9 A;  1PKW A;  2HRK B;  4KA0 A;  3RPP A;  1BG1 A;  3GV1 A;  2KOK A;  4PQ1 A;  5A34 A;  4N3Z A;  1FO5 A;  2TIR A;  3DVW A;  3L9V A;  12GS A;  5ABR A;  4I6X A;  5A1N A;  3APS A;  1WIK A;  3M8N A;  2CT6 A;  2JZS A;  1A23 A;  1U88 A;  1A2M A;  3GST A;  5J4Y A;  1JLW A;  3W6G A;  2PPT A;  4KSO A;  2HI7 A;  4AKH A;  2M46 A;  3H1N A;  3EWL A;  1X5D A;  5H5Q A;  1AQV A;  1SK0 A;  3Q74 A;  1Z6M A;  4XS6 A;  3U5R E;  4MJA A;  1B8X A;  2O36 A;  3UVT A;  2AV4 A;  3E0U A;  3LG6 A;  4K0G A;  1FG4 A;  4GTU A;  5IO2 A;  2IWT A;  2WVX A;  4PTS A;  3UEM A;  1Z5Y E;  3LXT A;  4MH3 A;  1AC1 A;  5COH A;  5CO3 A;  4AGS A;  4EXJ A;  5IIZ A;  2KLX A;  1U6T A;  2H6Z A;  3I6A A;  3EC3 A;  3KH9 A;  2VAF A;  5FHI A;  5H5R A;  4ZB8 A;  2FA8 A;  3IV4 A;  1THO A;  2GZY A;  1TTZ A;  2F8A A;  1XWA A;  3FYG A;  3GKK A;  1ZZY A;  3MAK A;  1XWC A;  1OE7 A;  3IHG A;  1TJD A;  2VOC A;  3ERG A;  1YDK A;  2L5O A;  4X1U A;  3A2W A;  3VWW A;  3FR9 A;  5IMZ A;  3O6T A;  2X8C A;  2JZR A;  2AYT A;  4TOP A;  3EE2 A;  3HHV A;  6GST A;  5DCH A;  5G30 A;  4O5R A;  6GSX A;  2H71 A;  5CYY A;  3HKR A;  1GSQ A;  2HSH A;  4TR1 B;  1GP1 A;  4YH2 A;  5HFG A;  4ZIL A;  3N9J A;  3GTU B;  3KJY A;  4GCI A;  4ZXG A;  2LS5 A;  3HJM A;  4F9Z A;  3WGX A;  4AI6 A;  4MK3 A;  1DE1 A;  2H0I A;  3LYK A;  1Y1U A;  3HMJ G;  4YQU A;  3WGD A;  4KUN A;  3TOT A;  1FOV A;  4TRX A;  3C1R A;  2CZ2 A;  3F3Q A;  3HVV A;  3Q19 A;  2CVB A;  1NHO A;  1TDI A;  17GS A;  4TW5 A;  1YF1 A;  2FWG A;  3D4M A;  4XCS A;  1O85 A;  3TJB A;  1R5A A;  1U3I A;  4DSQ A;  2G2Q A;  3F6D A;  1F2E A;  4G9H A;  1SVO A;  1Z9H A;  2R5G A;  3ZML A;  2F3M A;  3F8U A;  1M99 A;  1EV4 A;  1HNC A;  2CV4 A;  1T7P B;  3LJR A;  3GMF A;  3ERF A;  1MD4 A;  3VI5 A;  2XBQ A;  2LV3 A;  4FH8 A;  3EU3 A;  4FO5 A;  2HZF A;  1SK2 A;  5IMV A;  3PGT A;  4PUR A;  3F0I A;  1YJ6 A;  2WFC A;  1G6W A;  5HQP A;  4GQF A;  3GA4 A;  2WGR A;  2XBI A;  3HZ4 A;  3CRU A;  1TXU A;  1PX7 A;  2GVP A;  2HLS A;  4Z2T A;  1R4W A;  4MLY A;  1FB0 A;  1YZX A;  5DQY A;  3MYD A;  3C8E A;  1K3L A;  4GDF A;  1PRX A;  1ZCP A;  3HJO A;  3KP8 A;  2GSS A;  2LQO A;  4XRD A;  2KHP A;  2R0G A;  3IE3 A;  2H74 A;  3L9U A;  3TU3 B;  5D8I A;  2REM A;  4XRA A;  1T8E B;  5AIV A;  4KB3 A;  1A0F A;  1GSU A;  2CVD A;  1M2B A;  4I2U A;  1FW1 A;  2HSN B;  5AGY A;  4KDX A;  1G7O A;  5ECL B;  2HRK A;  1TRU A;  2N5B A;  1C72 A;  1YVL A;  3HJP A;  3IPZ A;  3DVX A;  4Z7X A;  4HJM A;  4E8E A;  1ERT A;  1NSW A;  5A5H A;  5ECQ B;  2V32 A;  4QMK A;  3EU4 A;  2C1Y A;  2IIY A;  2A2S A;  5EL8 A;  4O5U A;  2WCI A;  2B7J A;  2QA1 A;  3F4R A;  3DD3 A;  2NDO A;  2YAN A;  3KMN A;  1H75 A;  1ERV A;  5J41 A;  1F6M C;  3CHX C;  3HVS A;  2C80 A;  3ED3 A;  4H86 A;  2K6V A;  5GAN D;  5DJM A;  1HNA A;  5IQY A;  3GFK A;  3RDW A;  4HQZ A;  5C00 A;  2WRT A;  3RHC A;  16GS A;  2VL2 C;  1R5P A;  2HRF A;  3US3 A;  1GSS A;  3WYW A;  1X5E A;  2VL9 A;  2AAW A;  5IMC A;  2QA2 A;  1M9A A;  4NV5 A;  1UC7 A;  4ECB A;  4IP6 A;  4QQ7 A;  1EGO A;  3NZN A;  1HNB A;  3HXS A;  2GQL A;  4PQH A;  5IPG A;  3ZVJ A;  4GRF A;  3ZL5 A;  2X8G A;  2C0G A;  1M0U A;  2UZ8 A;  4ZB7 A;  4TR1 A;  1F3B A;  2DLX A;  5H5S A;  1X9S B;  3CRT A;  4K7N A;  2P5Q A;  3VWU A;  3GTU A;  4IQA A;  1VF2 A;  1SJ6 A;  4ZL8 A;  1Z7R A;  1WOU A;  1GH2 A;  3D6I A;  1FOH A;  5JCG A;  1ZMA A;  4BL7 B;  1OVN A;  2CAI A;  3EMP A;  1X9M B;  4MNN A;  2JAC A;  1XOB A;  3H4K A;  3UOM A;  3BOA A;  4IP1 A;  1UA5 A;  1PD2 1;  1TW9 A;  1VRS D;  1O8X A;  1SK1 A;  1WP0 A;  3F6F A;  4JZQ A;  4XS4 A;  4TR4 A;  4MH2 A;  2DJ2 A;  2K18 A;  2L4C A;  2YWM A;  4KX4 A;  5A5K A;  22GS A;  2YZU A;  3C71 A;  2ON7 A;  2VCX A;  5J3R A;  2ALB A;  4MJC A;  3LQ7 A;  3IAM 2;  3D4T A;  4PNG A;  1FAA A;  1XWB A;  5G5E A;  1U3A A;  1K0A A;  3VLN A;  4AKX B;  2MMO A;  3TGZ A;  3D21 A;  4XIH A;  3IK7 A;  1TRS A;  1BX9 A;  2CQ9 A;  2LNT A;  3PH9 A;  4D73 B;  4FYU A;  5CRG A;  5LCZ A;  13GS A;  2PMT A;  1EP8 A;  1OYJ A;  2LEG A;  3FZ5 A;  1XOA A;  3ZFL A;  2O89 A;  3H93 A;  4KF9 A;  2ES7 A;  5JWR B;  1A2L A;  4TXO B;  5KN2 A;  3DEX A;  4NWY A;  3FR3 A;  3GNJ A;  4A5P A;  3QD9 A;  2HSM B;  4WF5 A;  3KZQ A;  4HS1 A;  2GT6 A;  4ILF A;  3L9S A;  5J4U A;  3GHA A;  1XBS A;  3M1G A;  4Z2U A;  5F07 A;  8GSS A;  1R26 A;  2A2P A;  1YQ1 A;  4HOJ A;  3JCM L;  1WJK A;  1XVQ A;  3KMO A;  4G0L A;  4HUA A;  1DUG A;  4XTS A;  2C4J A;  4JED A;  5KN0 A;  3ZIT A;  1K0N A;  1JFU A;  2P0G A;  1S3A A;  3J7Y b;  4L0W A;  7GSS A;  3GKN A;  5EY6 A;  4LA1 A;  4RQR A;  4NV2 A;  2PU9 C;  2X8H A;  1B9Y C;  4WET A;  4YKG A;  1GSY A;  2YV9 A;  2KP2 A;  2H6Y A;  1CQG A;  2B1K A;  1M2A A;  2DJK A;  4I5Q A;  4MPG A;  4FYC A;  4N11 A;  1W4V A;  1SU9 A;  5JCW A;  1KTE A;  1I1I P;  4K7O A;  3WT2 A;  11GS A;  3EPT A;  3GL3 A;  2I1U A;  4OO4 A;  1RW1 A;  5B6M A;  4BA7 A;  4AJ7 A;  2B7K A;  2R6K A;  1S3R A;  4OWY A;  1FHE A;  2VIM A;  3GL5 A;  5DAL B;  4F0B A;  2LUS A;  1EZK A;  2EIO A;  4MPF A;  4AKG A;  1GUM A;  3ISO A;  4RQX A;  2X49 A;  4MF7 A;  1ML6 A;  3BBY A;  3QDN A;  2IMF A;  1QQ2 A;  2P5R A;  3HCZ A;  2KP1 A;  4W66 A;  1SVL A;  5D9T A;  2HE3 A;  4WBJ A;  2C0E A;  1TK8 B;  1CQH A;  3ZRE A;  4EDZ A;  1PA3 A;  2IME A;  1PGT A;  5AN1 A;  1K0C A;  5A4W A;  2YWI A;  3BCK A;  5IMD A;  3DKS A;  4QL9 A;  1SL0 B;  1WWJ A;  5INY A;  3TKQ A;  3VPT A;  4IGJ A;  4DSS A;  3F4T A;  2H6X A;  4PX1 A;  2GQM A;  2YP6 A;  3M9J A;  3TUE A;  3I43 A;  1AW9 A;  1BQ7 A;  4MJE A;  1SD9 A;  4KND A;  2A2R A;  3KH7 A;  4TKY A;  2DML A;  1X9W B;  1A8L A;  2PGT A;  3CSI A;  2C3T A;  3WD6 A;  4BWQ A;  3M9K A;  4BL7 A;  2H70 A;  1ON4 A;  4WF4 A;  3ZFB A;  2P31 A;  3D5J A;  4ID0 A;  2O3E A;  2IFQ B;  2BJX A;  2H8L A;  3LSZ A;  2LJA A;  4TXV A;  3ERW A;  2F8F A;  3TKP A;  4X43 A;  1S3D A;  4N30 A;  5J9C A;  2RM6 A;  3H8Q A;  3ZYW A;  4X4J A;  2WJU A;  4P3Y B;  3GUS A;  4GQC A;  1TI1 A;  5C04 A;  3ZIJ A;  1NM3 A;  1BF5 A;  5B6N A;  10GS A;  3UBK A;  1SYR A;  1B48 A;  5KOX A;  2DIZ A;  5CRW A;  2RM5 A;  2GLR A;  4D73 A;  6GSW A;  1YKC A;  4BVY B;  1LU4 A;  5ECK B;  2E7P A;  1IYH A;  1HD2 A;  3R2Q A;  4PHZ C;  4TXO A;  2NTO A;  2WW2 A;  3DML A;  4POB A;  2L59 A;  3TCO A;  2HSM A;  2E0Q A;  1KEB A;  1ZOF A;  1PMT A;  2OE1 A;  3M0F A;  2XPD A;  2G0F A;  3DIE A;  1V2A A;  2PVO C;  2M80 A;  1K0O A;  4AF2 A;  3TDG A;  3GSS A;  4L5O A;  1OC3 A;  2GSR A;  5ECH B;  1G0T A;  2YJ7 A;  2H01 A;  2O8V B;  5IO0 A;  1T4Z A;  3UIW A;  1TXX A;  4LLR A;  2IN3 A;  2NPB A;  3KIJ A;  4WKW A;  4CDO A;  5HFK A;  4KE3 A;  6GSU A;  2DMM A;  3HYP A;  2IMK A;  2DSA A;  4PXO A;  3GIX A;  5ELA A;  3IK9 A;  5ECM B;  2DKI A;  2UV8 G;  5AIX A;  3MDK A;  2JSY A;  4Q5F A;  1AQW A;  1LJR A;  2H76 A;  4ECC A;  2EIQ A;  4POM A;  4ISD A;  2HQT A;  3KEB A;  2L6D A;  5DAL A;  1A2J A;  4N0V A;  4EKZ A;  5DBQ A;  4DSR A;  3IXR A;  3LWA A;  4Z2R A;  1GLP A;  3CTF A;  5J47 A;  2H1A A;  1PN0 A;  1R7H A;  3BJ5 A;  4L0U A;  3UAP A;  2VCT A;  1JZR A;  2R4V A;  4EF0 A;  1W89 A;  2K8V A;  2X99 A;  1TKD B;  4POL A;  4JR4 A;  2N5F A;  1K0M A;  2A4H A;  2OBK A;  2B1L A;  4IN0 A;  1Z6N A;  3VFI A;  4K8M A;  4IS0 A;  2V41 A;  5CP1 A;  4ZIJ A;  5EVO A;  5EPF A;  2OKA A;  4G10 A;  2YV7 A;  2WZ9 A;  4N0Z A;  2O87 A;  3GX0 A;  2AB6 A;  2JU5 A;  4HJ2 A;  2WW0 A;  3CBU A;  2VL2 A;  4LL4 B;  2PWJ A;  3AY8 A;  4BVX A;  2OJL A;  4PUA A;  3F9U A;  3GN3 A;  5A4U A;  1T4Y A;  1XG8 A;  9GSS A;  3DGQ A;  3GUR A;  1SKR B;  3ZZX A;  5DVB A;  2YOI A;  4ZB9 A;  1TRV A;  3WT1 A;  3H79 A;  1NHY A;  2H0H A;  1URM A;  4EE0 A;  3TRX A;  3TRP A;  1DE2 A;  3F63 A;  2D2Z A;  4IKH A;  1BED A;  3I69 A;  2HSY A;  4K1F A;  2IFQ A;  4MZW A;  1PL2 A;  2E2G A;  4YQM A;  2QKE A;  2R2J A;  1GWC A;  2CX3 A;  2ZNM A;  5B7C A;  2A4V A;  2R37 A;  4V2M A;  1GNW A;  4HU7 A;  2DJ3 A;  2HRA A;  1GL8 A;  4WXT A;  3N5O A;  2GQK A;  4MCU A;  1OKT A;  1N2A A;  14GS A;  4K6X A;  3FKF A;  2VM1 A;  1MTC A;  2K8S A;  4PUF C;  1MDJ A;  3O76 A;  5D73 A;  5B8A A;  1FVK A;  1IYI A;  2EFC A;  1ZYQ B;  2LRN A;  2WW3 A;  2YN1 A;  3NIV A;  1ILO A;  1O8W A;  1SJI A;  3GKX A;  4PGT A;  2R0C A;  5KN1 A;  4ECI A;  1XIY A;  5DQS A;  4BVY A;  2RUF A;  3CSJ A;  2NBS A;  1EWX A;  2VCQ A;  4NXI A;  4V2N A;  2BTO T;  5CNW A;  5KOW A;  4F82 A;  1UN2 A;  2VD1 A;  2I4A A;  3ME8 A;  2B3S A;  1MEK A;  3CMI A;  3QPM A;  1N25 A;  2J9H A;  1X5C A;  1XWK A;  3FK8 A;  4O5Q A;  1GSD A;  1E2Y A;  3Q6O A;  3LGC A;  3KCM A;  2LJR A;  2PER A;  1K0B A;  4MMM A;  1ZYN A;  5ENU A;  2CVK A;  2WUL A;  5A34 B;  3G9B A;  1I9D A;  3NOF A;  4AJ6 A;  3UL3 A;  5ECP B;  2AUV A;  5LD0 A;  4YKF A;  3IRA A;  5ECN B;  3UVH A;  4ML6 A;  2Z9S A;  4G0K A;  3F3R A;  3IDV A;  1MD3 A;  1USB A;  1GLQ A;  1M2D A;  3RPN A;  4MDC A;  1SL1 B;  4FYB A;  4IVF A;  5IM9 A;  1UVZ A;  2V2G A;  3GKM A;  1JHB A;  2FHE A;  2J23 A;  3IOS A;  5JWQ B;  1AUC A;  1HYU A;  3EYT A;  2WVX B;  2OAC A;  4F2I A;  5G1L A;  3TB2 A;  4GWR A;  2DJ0 A;  2WZS A;  2VD0 A;  1YEP A;  4OCF A;  4JRR A;  5HFI A;  4LMW A;  5FT3 A;  4F0C A;  1JLV A;  1V40 A;  20GS A;  2QGV A;  4GF0 A;  1V58 A;  4EIP A;  3F4S A;  4HZ4 A;  1TU8 A;  2QC7 A;  3QAV A;  3IA1 A;  3OR5 A;  3C1S A;  3KTB A;  1GNE A;  3J7Y k;  3K8N A;  4OCE A;  1SKS B;  4I2T A;  2YPM A;  1GSE A;  1Y25 A;  1RQM A;  1ZGN A;  5ECI B;  3FW2 A;  3TKS E;  2QSI A;  4G0I A;  1KNG A;  4K2D A;  3ZVJ D;  2H73 A;  2GTU A;  1TK5 B;  19GS A;  3A2X A;  1GUK A;  1T3B A;  3Q18 A;  3V1W A;  5G31 A;  2GZZ A;  5AIS A;  2HSN A;  2RUE A;  4Q5R A;  2HZE B;  5G2Z A;  2LNS A;  4XS1 A;  4HDE A;  3LW9 A;  2MMA A;  1YF0 A;  4HZ2 A;  1EP7 A;  3EMX A;  2IMI A;  3L0H A;  4MAB A;  2DBC A;  3IR4 A;  1T00 A;  4G2E A;  3HA9 A;  4PI2 C;  2VCW A;  4KH7 A;  1TRW A;  3RGB C;  3M3M A;  1FVJ A;  2O85 A;  3KGK A;  5IOX A;  2H0G A;  1E6B A;  1EOH A;  4KCE A;  2DIY A;  3CWG A;  3VPQ A;  3DXB A;  2HYX A;  4LMV A;  3QOU A;  4IJI A;  1QXH A;  2L4Q A;  4TR0 A;  2GSQ A;  18GS A;  4EUY A;  3CTG A;  1G7E A;  1GRX A;  4Q5Q A;  3A5I A;  3L78 A;  2ON5 A;  3P2A A;  2LKU A;  4GXZ A;  4IQ1 A;  1JZD A;  2V6O A;  4MA9 A;  2RLI A;  3ZTL A;  1A24 A;  3A2V A;  5F8B A;  3VWV A;  5IMF A;  2H30 A;  3ZIV A;  5BMU B;  3UJ1 A;  2LJK A;  3TJF A;  3G7I A;  5KEJ A;  3IHQ A;  2F51 A;  2AHE A;  2OE3 A;  3P90 A;  5GAP D;  3TKS A;  2I3Y A;  2C3Q A;  4HEA 2;  5ID2 B;  5ECS A;  5ECO B;  2CZ3 A;  3A5W A;  5CAX A;  1THX A;  2PN8 A;  4KCA A;  1Q4J A;  4G19 A;  1H4O A;  4LL1 B;  4TN8 A;  4I97 A;  5GST A;  3MWH A;  1K0D A;  2NVL A;  5CRD A;  1M9B A;  5L71 A;  2VUP A;  3IC4 A;  3GX8 A;  4GSS A;  5A5H B;  1O73 A;  2CA8 A;  5LNK e;  1ZYP A;  3EIN A;  4IHU A;  2VCZ A;  2C3N A;  1SYX A;  5BRT A;  3TJJ A;  4MF6 A;  4DEJ A;  2LST A;  1X0R A;  3WGE A;  3FY7 A;  2B5Y A;  4G01 A;  1SD8 A;  4I8B A;  1QGV A;  4HQS A;  3TKS C;  4BIK A;  1A0R P;  4WBR D;  1YKA A;  1S4B P;  1V57 A;  2L57 A;  5E4W A;  2DC5 A;  2YJH A;  1XPV A;  4NMU A;  1YEX A;  4PI0 C;  1J08 A;  4EL1 A;  4CY8 A;  1WE0 A;  4KAE A;  3VWX A;  2HRN A;  4BPY A;  1BAY A;  2FNO A;  1J0F A;  3G7J A;  4ZL7 A;  2BMX A;  2O7K A;  2YWO A;  3HDC A;  4K9Z A;  3ZLP A;  4AJ8 A;  4O7H A;  1U87 A;  5JWO B;  4OMV A;  3P8W A;  1SJZ A;  2IJY A;  1F37 A;  5HR1 A;  4ZB6 A;  2GZP A;  4QL7 A;  2C8U A;  2JAD A;  3HY2 A;  1RK4 A;  4V2L A;  2WB9 A;  4POK A;  4RI7 A;  1PX6 A;  4ML1 A;  3HVN A;  5B8B A;  3HZ8 A;  2OBI A;  5D93 A;  2H1B A;  4KW6 A;  2H72 A;  2MYG A;  5IPH A;  4EDY A;  3QAW A;  4ZBD A;  2AJQ B;  3MSZ A;  1QMV A;  2HNL A;  1SL2 B;  1MDK A;  1WMJ A;  5E59 A;  2VL3 A;  2B5E A;  5DJL A;  4CHS A;  1XW5 A;  1PKZ A;  2FY6 A;  3FZ9 A;  2L6C A;  3KXO A;  1B4Q A;  2HZE A;  5HR3 A;  1G6Y A;  5DAK B;  4DVC A;  3BD2 A;  1J9B A;  4OO5 A;  3HD5 A;  3FZA A;  2L5L A;  1XFL A;  4XS4 B;  1QFN A;  6GSS A;  2VM2 A;  2I81 A;  3APQ A;  2LRC A;  1XW9 A;  3UAR A;  3RHB A;  1GTI A;  3RBT A;  2WS2 A;  3CQF A;  4N10 A;  1Y6E A;  3GH9 A;  3IC8 A;  2LQQ A;  5DCG A;  4L5L A;  4FXY P;  1B9X C;  4FIW A;  2HXK A;  1T1V A;  1BG5 A;  4ZBB A;  2H1L A;  3VUR A;  2MMN A;  2DJ1 A;  3D0Z A;  2FGX A;  2EFD A;  2V6K A;  5GZZ B;  3QCP A;  4RI6 A;  1TOF A;  4TR3 A;  2HFD A;  1XWG A;  3BCI A;  3GRX A;  2YNX A;  4K5R A;  1TI3 A;  5HR2 A;  5BMU A;  3FZ4 A;  3EUR A;  4WR4 A;  4YAV A;  1N8J A;  1Q98 A;  4XHM A;  3LOR A;  5ID2 A;  1ZL9 A;  2OT3 A;  2FD3 A;  2PVQ A;  2H66 A;  3PIN A;  1KBN A;  4ECJ A;  2VKZ G;  3UMA A;  2DJJ A;  3O3T A;  4OD7 A;  1SKW B;  2VCV A;  4BWS A;  2N5A A;  5D9W A;  3FMW A;  1A8Y A;  4V1A g;  1K3Y A;  5D96 A;  5F06 A;  2WW1 A;  3SWL A;  3E3E A;  2JL4 A;  1EEM A;  1GUL A;  1S3C A;  1PSQ A;  5A4V A;  2YWN A;  1OAZ A;  2FLS A;  2FWE A;  2B5X A;  2JZT A;  1K3O A;  2XPE A;  2GS3 A;  2RII A;  1V98 A;  3W8J A;  2O5V A;  2EIR A;  2FUG 2;  2WDU A;  2CX4 A;  2R3X A;  2H19 A;  1Z7P A;  3LFL A;  1Z3E A;  2WVY A;  1TP9 A;  3ZMK A;  1OE8 A;  3FEU A;  2R0P A;  2GGT A;  6GSV A;  2GT5 A;  4USS A;  4EVM A;  3TJK A;  2C0D A;  1OC9 B;  3IAS 2;  5DDL A;  1XVW A;  3APO A;  5D9V A;  1M3I A;  1PFO A;  4J2F A;  3L4N A;  4GLT A;  4KDU A;  3IBH A;  2KUC A;  2HT9 A;  1YEW C;  3RFR C;  2MBT A;  2DKH A;  5G5F A;  2XC2 A;  2IMD A;  2GDR A;  2FWH A;  2F9S A;  1O6J A;  1XXU A;  4DSS B;  3PPU A;  3R3E A;  2X4A A;  1AQX A;  4GSN A;  4FQU A;  3C7M A;  2MZC A;  4KDY A;  3QFA C;  4EIQ A;  1BJX A;  4MZB A;  3LEF A;  1DBY A;  2YCD A;  4KSM A;  3EVI A;  5A1N B;  1EEJ A;  3MIX A;  1XW6 A;  4WEY A;  5ECR B;  1EOG A;  3KM6 A;  1MDI A;  3HVX A;  4O92 A;  4OFM A;  4K7I A;  1AIU A;  2WVZ A;  5DAK A;  3LXZ A;  1I5G A;  5GSS A;  2FA4 A;  4K2X A;  2H1G A;  6GSY A;  2CAQ A;  1WRY A;  1VF1 A;  1TU7 A;  2OAD A;  3TRQ A;  2EFH A;  2TRX A;  4IJ3 A;  5KN3 A;  1VF4 A;  1FB6 A;  2JSZ A;  4MP4 A;  4E8H A;  2LRT A;  1M7T A;  5F05 A;  1LBK A;  4YQV A;  2OA7 A;  4AKI A;  4J56 E;  1JZW A;  1WPI A;  2EFE A;  2K9F A;  2YZH A;  1VGL A;  1O81 A;  1ERW A;  3TJG A;  2LTK A;  1YY7 A;  2GST A;  3C73 A;  1PL1 A;  5JCU A;  4K5S A;  5IOW A;  1OC8 A; 
#chains in the Genus database with same CATH homology
 4NPB A;  4OFN A;  4ULX A;  4JE1 A;  3UBL A;  3MNG A;  1F3A A;  3DYR A;  2I9H A;  4CW9 A;  3GYK A;  1GSF A;  2PUK C;  2VLT A;  2MBS A;  3ZRD A;  2B6M A;  2ZUP A;  1AAZ A;  4NHW A;  2IL3 A;  4NAX A;  1AXD A;  4K0N A;  3W8S A;  3FHK A;  1O7U A;  3D22 A;  5CRH A;  5HR0 A;  3E9J B;  1PQN A;  4F03 A;  2XHF A;  3CSH A;  4MZC A;  5FWG A;  1XZO A;  2X64 A;  3ME7 A;  2H75 A;  3U6V A;  1VF3 A;  2FCH A;  1GTU A;  4KGI A;  3SBC A;  5F0G A;  4V1A p;  1SVM A;  3G7Y A;  3TOU A;  1ACV A;  4CY6 A;  2H1D A;  4Q5N A;  1BYE A;  5ELG A;  5J5N A;  1V9W A;  4X0X A;  1QUW A;  3RAZ A;  4EO3 A;  4IEL A;  1SEN A;  1ABA A;  1OKD A;  3QFB C;  4L8E A;  4MJB A;  4HI7 A;  5G1K A;  5J40 A;  3A3T A;  2MMZ A;  5IMA A;  4YAP A;  4GST A;  2VLU A;  4HU9 A;  3FRC A;  4PNF A;  3DWV A;  3PR8 A;  3LYP A;  3FR6 A;  1ZYE A;  5J4V A;  3QMX A;  4ACS A;  5CRE A;  4IBP A;  4E68 A;  3KTL A;  5D9X A;  1GTA A;  3KD0 A;  3VI7 A;  4RUV A;  1GUH A;  1ST9 A;  1JZO A;  1HQO A;  1F9M A;  2IPA A;  4JR6 A;  4TVE A;  4J57 E;  4O32 A;  3VK9 A;  1EGR A;  2M72 A;  4JU5 A;  1OC9 A;  1GTB A;  4ZL9 A;  3S9F A;  3TKR A;  4IW9 A;  1DSB A;  3P7X A;  3QAG A;  1PN9 A;  2ZCT A;  4ZBA A;  5J9B A;  1TK0 B;  2V1M A;  2VLV A;  4ICY A;  3DRN A;  2FWF A;  1QK8 A;  2EC4 A;  2OE0 A;  3CXG A;  4JBB A;  1ERU A;  2VO4 A;  4EC0 A;  3KP9 A;  4NHZ A;  3GH6 A;  1B4P A;  2TRC P;  4BVX B;  2PBJ A;  3QR6 A;  4PQI A;  2C0F A;  4WR5 A;  2E2M A;  4OFT A;  3CYN A;  3I9V 2;  1NW2 A;  1XCC A;  4MF5 A;  1EV9 A;  1PKW A;  2HRK B;  4KA0 A;  3RPP A;  1BG1 A;  3GV1 A;  2KOK A;  4PQ1 A;  5A34 A;  4N3Z A;  1FO5 A;  2TIR A;  3DVW A;  3L9V A;  12GS A;  5ABR A;  4I6X A;  5A1N A;  3APS A;  1WIK A;  3M8N A;  2CT6 A;  2JZS A;  1A23 A;  1U88 A;  1A2M A;  3GST A;  5J4Y A;  1JLW A;  3W6G A;  2PPT A;  4KSO A;  2HI7 A;  4AKH A;  2M46 A;  3H1N A;  3EWL A;  1X5D A;  5H5Q A;  1AQV A;  1SK0 A;  3Q74 A;  1Z6M A;  4XS6 A;  3U5R E;  4MJA A;  1B8X A;  3UVT A;  2AV4 A;  3E0U A;  3LG6 A;  4K0G A;  1FG4 A;  4GTU A;  5IO2 A;  2IWT A;  4PTS A;  3UEM A;  1Z5Y E;  3LXT A;  4MH3 A;  1AC1 A;  5COH A;  5CO3 A;  4AGS A;  4EXJ A;  5IIZ A;  2KLX A;  1U6T A;  2H6Z A;  3I6A A;  3EC3 A;  3KH9 A;  2VAF A;  5FHI A;  5H5R A;  4ZB8 A;  2FA8 A;  3IV4 A;  1THO A;  2GZY A;  1TTZ A;  2F8A A;  1XWA A;  3FYG A;  3GKK A;  1ZZY A;  3MAK A;  1XWC A;  1OE7 A;  3IHG A;  1TJD A;  2VOC A;  3ERG A;  1YDK A;  2L5O A;  4X1U A;  3A2W A;  3VWW A;  3FR9 A;  5IMZ A;  3O6T A;  2X8C A;  2JZR A;  2AYT A;  4TOP A;  3EE2 A;  3HHV A;  6GST A;  5DCH A;  5G30 A;  4O5R A;  6GSX A;  2H71 A;  5CYY A;  3HKR A;  1GSQ A;  2HSH A;  4TR1 B;  1GP1 A;  4YH2 A;  5HFG A;  4ZIL A;  3N9J A;  3GTU B;  3KJY A;  4GCI A;  4ZXG A;  2LS5 A;  3HJM A;  4F9Z A;  3WGX A;  4AI6 A;  4MK3 A;  1DE1 A;  2H0I A;  3LYK A;  1Y1U A;  3HMJ G;  4YQU A;  3WGD A;  4KUN A;  3TOT A;  1FOV A;  4TRX A;  3C1R A;  2CZ2 A;  3F3Q A;  3HVV A;  3Q19 A;  2CVB A;  1NHO A;  1TDI A;  17GS A;  4TW5 A;  1YF1 A;  2FWG A;  3D4M A;  4XCS A;  1O85 A;  3TJB A;  1R5A A;  1U3I A;  4DSQ A;  2G2Q A;  3F6D A;  1F2E A;  4G9H A;  1SVO A;  1Z9H A;  2R5G A;  3ZML A;  2F3M A;  3F8U A;  1M99 A;  1EV4 A;  1HNC A;  2CV4 A;  1T7P B;  3LJR A;  3GMF A;  3ERF A;  1MD4 A;  3VI5 A;  2XBQ A;  2LV3 A;  4FH8 A;  3EU3 A;  4FO5 A;  2HZF A;  1SK2 A;  5IMV A;  3PGT A;  4PUR A;  3F0I A;  1YJ6 A;  2WFC A;  1G6W A;  5HQP A;  4GQF A;  3GA4 A;  2WGR A;  2XBI A;  3HZ4 A;  3CRU A;  1TXU A;  1PX7 A;  2GVP A;  2HLS A;  4Z2T A;  1R4W A;  4MLY A;  1FB0 A;  1YZX A;  5DQY A;  3MYD A;  3C8E A;  1K3L A;  4GDF A;  1PRX A;  1ZCP A;  3HJO A;  3KP8 A;  2GSS A;  2LQO A;  4XRD A;  2KHP A;  2R0G A;  3IE3 A;  2H74 A;  3L9U A;  3TU3 B;  5D8I A;  2REM A;  4XRA A;  1T8E B;  5AIV A;  4KB3 A;  1A0F A;  1GSU A;  2CVD A;  1M2B A;  4I2U A;  1FW1 A;  2HSN B;  5AGY A;  4KDX A;  1G7O A;  5ECL B;  2HRK A;  1TRU A;  2N5B A;  1C72 A;  1YVL A;  3HJP A;  3IPZ A;  3DVX A;  4Z7X A;  4HJM A;  4E8E A;  1ERT A;  1NSW A;  5A5H A;  5ECQ B;  2V32 A;  4QMK A;  3EU4 A;  2C1Y A;  2IIY A;  2A2S A;  5EL8 A;  4O5U A;  2WCI A;  2B7J A;  2QA1 A;  3F4R A;  3DD3 A;  2NDO A;  2YAN A;  3KMN A;  1H75 A;  1ERV A;  5J41 A;  1F6M C;  3HVS A;  2C80 A;  3ED3 A;  4H86 A;  2K6V A;  5GAN D;  5DJM A;  1HNA A;  5IQY A;  3GFK A;  3RDW A;  4HQZ A;  5C00 A;  2WRT A;  3RHC A;  16GS A;  2VL2 C;  1R5P A;  2HRF A;  3US3 A;  1GSS A;  3WYW A;  1X5E A;  2VL9 A;  2AAW A;  5IMC A;  2QA2 A;  1M9A A;  4NV5 A;  1UC7 A;  4ECB A;  4IP6 A;  4QQ7 A;  1EGO A;  3NZN A;  1HNB A;  3HXS A;  2GQL A;  4PQH A;  5IPG A;  3ZVJ A;  4GRF A;  3ZL5 A;  2X8G A;  2C0G A;  1M0U A;  2UZ8 A;  4ZB7 A;  4TR1 A;  1F3B A;  2DLX A;  5H5S A;  1X9S B;  3CRT A;  4K7N A;  2P5Q A;  3VWU A;  3GTU A;  4IQA A;  1VF2 A;  1SJ6 A;  4ZL8 A;  1Z7R A;  1WOU A;  1GH2 A;  3D6I A;  1FOH A;  5JCG A;  1ZMA A;  4BL7 B;  1OVN A;  2CAI A;  3EMP A;  1X9M B;  4MNN A;  2JAC A;  1XOB A;  3H4K A;  3UOM A;  3BOA A;  4IP1 A;  1UA5 A;  1PD2 1;  1TW9 A;  1VRS D;  1O8X A;  1SK1 A;  1WP0 A;  3F6F A;  4JZQ A;  4XS4 A;  4TR4 A;  4MH2 A;  2DJ2 A;  2K18 A;  2L4C A;  2YWM A;  4KX4 A;  5A5K A;  22GS A;  2YZU A;  3C71 A;  2ON7 A;  2VCX A;  5J3R A;  2ALB A;  4MJC A;  3LQ7 A;  3IAM 2;  3D4T A;  4PNG A;  1FAA A;  1XWB A;  5G5E A;  1U3A A;  1K0A A;  3VLN A;  4AKX B;  2MMO A;  3TGZ A;  3D21 A;  4XIH A;  3IK7 A;  1TRS A;  1BX9 A;  2CQ9 A;  2LNT A;  3PH9 A;  4D73 B;  4FYU A;  5CRG A;  5LCZ A;  13GS A;  2PMT A;  1EP8 A;  1OYJ A;  2LEG A;  3FZ5 A;  1XOA A;  3ZFL A;  2O89 A;  3H93 A;  4KF9 A;  2ES7 A;  5JWR B;  1A2L A;  4TXO B;  5KN2 A;  3DEX A;  4NWY A;  3FR3 A;  3GNJ A;  4A5P A;  3QD9 A;  2HSM B;  4WF5 A;  3KZQ A;  4HS1 A;  2GT6 A;  4ILF A;  3L9S A;  5J4U A;  3GHA A;  1XBS A;  3M1G A;  4Z2U A;  5F07 A;  8GSS A;  1R26 A;  2A2P A;  1YQ1 A;  4HOJ A;  3JCM L;  1WJK A;  1XVQ A;  3KMO A;  4G0L A;  4HUA A;  1DUG A;  4XTS A;  2C4J A;  4JED A;  5KN0 A;  3ZIT A;  1K0N A;  1JFU A;  2P0G A;  1S3A A;  3J7Y b;  4L0W A;  7GSS A;  3GKN A;  5EY6 A;  4LA1 A;  4RQR A;  4NV2 A;  2PU9 C;  2X8H A;  1B9Y C;  4WET A;  4YKG A;  1GSY A;  2YV9 A;  2KP2 A;  2H6Y A;  1CQG A;  2B1K A;  1M2A A;  2DJK A;  4I5Q A;  4MPG A;  4FYC A;  4N11 A;  1W4V A;  1SU9 A;  5JCW A;  1KTE A;  4K7O A;  3WT2 A;  11GS A;  3EPT A;  3GL3 A;  2I1U A;  4OO4 A;  1RW1 A;  5B6M A;  4BA7 A;  4AJ7 A;  2B7K A;  2R6K A;  4OWY A;  1FHE A;  2VIM A;  3GL5 A;  5DAL B;  4F0B A;  2LUS A;  1EZK A;  2EIO A;  4MPF A;  4AKG A;  1GUM A;  3ISO A;  4RQX A;  2X49 A;  4MF7 A;  1ML6 A;  3BBY A;  3QDN A;  2IMF A;  1QQ2 A;  2P5R A;  3HCZ A;  2KP1 A;  4W66 A;  1SVL A;  5D9T A;  2HE3 A;  4WBJ A;  2C0E A;  1TK8 B;  1CQH A;  3ZRE A;  4EDZ A;  1PA3 A;  2IME A;  1PGT A;  5AN1 A;  1K0C A;  5A4W A;  2YWI A;  3BCK A;  5IMD A;  3DKS A;  4QL9 A;  1SL0 B;  1WWJ A;  5INY A;  3TKQ A;  3VPT A;  4IGJ A;  4DSS A;  3F4T A;  2H6X A;  4PX1 A;  2GQM A;  2YP6 A;  3M9J A;  3TUE A;  3I43 A;  1AW9 A;  1BQ7 A;  4MJE A;  1SD9 A;  4KND A;  2A2R A;  3KH7 A;  4TKY A;  2DML A;  1X9W B;  1A8L A;  2PGT A;  3CSI A;  2C3T A;  3WD6 A;  4BWQ A;  3M9K A;  4BL7 A;  2H70 A;  1ON4 A;  4WF4 A;  3ZFB A;  2P31 A;  3D5J A;  4ID0 A;  2IFQ B;  2BJX A;  2H8L A;  3LSZ A;  2LJA A;  4TXV A;  3ERW A;  2F8F A;  3TKP A;  4X43 A;  1S3D A;  4N30 A;  5J9C A;  2RM6 A;  3H8Q A;  3ZYW A;  4X4J A;  2WJU A;  4P3Y B;  3GUS A;  4GQC A;  1TI1 A;  5C04 A;  3ZIJ A;  1NM3 A;  1BF5 A;  5B6N A;  10GS A;  3UBK A;  1SYR A;  1B48 A;  5KOX A;  2DIZ A;  5CRW A;  2RM5 A;  2GLR A;  4D73 A;  6GSW A;  1YKC A;  4BVY B;  1LU4 A;  5ECK B;  2E7P A;  1IYH A;  1HD2 A;  3R2Q A;  4TXO A;  2NTO A;  3DML A;  4POB A;  2L59 A;  3TCO A;  2HSM A;  2E0Q A;  1KEB A;  1ZOF A;  1PMT A;  2OE1 A;  3M0F A;  2XPD A;  2G0F A;  3DIE A;  1V2A A;  2PVO C;  2M80 A;  1K0O A;  4AF2 A;  3TDG A;  3GSS A;  4L5O A;  1OC3 A;  2GSR A;  5ECH B;  1G0T A;  2YJ7 A;  2H01 A;  2O8V B;  5IO0 A;  1T4Z A;  3UIW A;  1TXX A;  4LLR A;  2IN3 A;  2NPB A;  3KIJ A;  4WKW A;  4CDO A;  5HFK A;  4KE3 A;  6GSU A;  2DMM A;  3HYP A;  2IMK A;  2DSA A;  4PXO A;  3GIX A;  5ELA A;  3IK9 A;  5ECM B;  2DKI A;  2UV8 G;  5AIX A;  3MDK A;  2JSY A;  4Q5F A;  1AQW A;  1LJR A;  2H76 A;  4ECC A;  2EIQ A;  4POM A;  4ISD A;  2HQT A;  3KEB A;  2L6D A;  5DAL A;  1A2J A;  4N0V A;  4EKZ A;  5DBQ A;  4DSR A;  3IXR A;  3LWA A;  4Z2R A;  1GLP A;  3CTF A;  5J47 A;  2H1A A;  1PN0 A;  1R7H A;  3BJ5 A;  4L0U A;  3UAP A;  2VCT A;  1JZR A;  2R4V A;  4EF0 A;  1W89 A;  2K8V A;  2X99 A;  1TKD B;  4POL A;  4JR4 A;  2N5F A;  1K0M A;  2A4H A;  2OBK A;  2B1L A;  4IN0 A;  1Z6N A;  3VFI A;  4K8M A;  4IS0 A;  2V41 A;  5CP1 A;  4ZIJ A;  5EVO A;  5EPF A;  2OKA A;  4G10 A;  2YV7 A;  2WZ9 A;  4N0Z A;  2O87 A;  3GX0 A;  2AB6 A;  2JU5 A;  4HJ2 A;  3CBU A;  2VL2 A;  4LL4 B;  2PWJ A;  3AY8 A;  4BVX A;  2OJL A;  4PUA A;  3F9U A;  3GN3 A;  5A4U A;  1T4Y A;  9GSS A;  3DGQ A;  3GUR A;  1SKR B;  3ZZX A;  5DVB A;  2YOI A;  4ZB9 A;  1TRV A;  3WT1 A;  3H79 A;  1NHY A;  2H0H A;  1URM A;  4EE0 A;  3TRX A;  3TRP A;  1DE2 A;  3F63 A;  2D2Z A;  4IKH A;  1BED A;  3I69 A;  2HSY A;  4K1F A;  2IFQ A;  4MZW A;  1PL2 A;  2E2G A;  4YQM A;  2QKE A;  2R2J A;  1GWC A;  2CX3 A;  2ZNM A;  5B7C A;  2A4V A;  2R37 A;  4V2M A;  1GNW A;  4HU7 A;  2DJ3 A;  2HRA A;  1GL8 A;  4WXT A;  3N5O A;  2GQK A;  4MCU A;  1OKT A;  1N2A A;  14GS A;  4K6X A;  3FKF A;  2VM1 A;  1MTC A;  2K8S A;  4PUF C;  1MDJ A;  3O76 A;  5D73 A;  5B8A A;  1FVK A;  1IYI A;  2EFC A;  1ZYQ B;  2LRN A;  2YN1 A;  3NIV A;  1ILO A;  1O8W A;  1SJI A;  3GKX A;  4PGT A;  2R0C A;  5KN1 A;  4ECI A;  1XIY A;  5DQS A;  4BVY A;  2RUF A;  3CSJ A;  2NBS A;  1EWX A;  2VCQ A;  4NXI A;  4V2N A;  2BTO T;  5CNW A;  5KOW A;  4F82 A;  1UN2 A;  2VD1 A;  2I4A A;  3ME8 A;  2B3S A;  1MEK A;  3CMI A;  3QPM A;  1N25 A;  2J9H A;  1X5C A;  1XWK A;  3FK8 A;  4O5Q A;  1GSD A;  1E2Y A;  3Q6O A;  3LGC A;  3KCM A;  2LJR A;  2PER A;  1K0B A;  4MMM A;  1ZYN A;  5ENU A;  2CVK A;  2WUL A;  5A34 B;  3G9B A;  1I9D A;  3NOF A;  4AJ6 A;  3UL3 A;  5ECP B;  2AUV A;  5LD0 A;  4YKF A;  3IRA A;  5ECN B;  3UVH A;  4ML6 A;  2Z9S A;  4G0K A;  3F3R A;  3IDV A;  1MD3 A;  1USB A;  1GLQ A;  1M2D A;  3RPN A;  4MDC A;  1SL1 B;  4FYB A;  4IVF A;  5IM9 A;  1UVZ A;  2V2G A;  3GKM A;  1JHB A;  2FHE A;  2J23 A;  3IOS A;  5JWQ B;  1AUC A;  1HYU A;  3EYT A;  2OAC A;  4F2I A;  5G1L A;  3TB2 A;  4GWR A;  2DJ0 A;  2VD0 A;  1YEP A;  4OCF A;  4JRR A;  5HFI A;  4LMW A;  5FT3 A;  4F0C A;  1JLV A;  1V40 A;  20GS A;  2QGV A;  4GF0 A;  1V58 A;  4EIP A;  3F4S A;  4HZ4 A;  1TU8 A;  2QC7 A;  3QAV A;  3IA1 A;  3OR5 A;  3C1S A;  3KTB A;  1GNE A;  3J7Y k;  3K8N A;  4OCE A;  1SKS B;  4I2T A;  2YPM A;  1GSE A;  1Y25 A;  1RQM A;  1ZGN A;  5ECI B;  3FW2 A;  3TKS E;  2QSI A;  4G0I A;  1KNG A;  4K2D A;  3ZVJ D;  2H73 A;  2GTU A;  1TK5 B;  19GS A;  3A2X A;  1GUK A;  1T3B A;  3Q18 A;  3V1W A;  5G31 A;  2GZZ A;  5AIS A;  2HSN A;  2RUE A;  4Q5R A;  2HZE B;  5G2Z A;  2LNS A;  4XS1 A;  4HDE A;  3LW9 A;  2MMA A;  1YF0 A;  4HZ2 A;  1EP7 A;  3EMX A;  2IMI A;  3L0H A;  4MAB A;  2DBC A;  3IR4 A;  1T00 A;  4G2E A;  3HA9 A;  2VCW A;  4KH7 A;  1TRW A;  3M3M A;  1FVJ A;  2O85 A;  3KGK A;  5IOX A;  2H0G A;  1E6B A;  1EOH A;  4KCE A;  2DIY A;  3CWG A;  3VPQ A;  3DXB A;  2HYX A;  4LMV A;  3QOU A;  4IJI A;  1QXH A;  2L4Q A;  4TR0 A;  2GSQ A;  18GS A;  4EUY A;  3CTG A;  1G7E A;  1GRX A;  4Q5Q A;  3A5I A;  3L78 A;  2ON5 A;  3P2A A;  2LKU A;  4GXZ A;  4IQ1 A;  1JZD A;  2V6O A;  4MA9 A;  2RLI A;  3ZTL A;  1A24 A;  3A2V A;  5F8B A;  3VWV A;  5IMF A;  2H30 A;  3ZIV A;  5BMU B;  3UJ1 A;  2LJK A;  3TJF A;  3G7I A;  5KEJ A;  3IHQ A;  2F51 A;  2AHE A;  2OE3 A;  3P90 A;  5GAP D;  3TKS A;  2I3Y A;  2C3Q A;  4HEA 2;  5ID2 B;  5ECS A;  5ECO B;  2CZ3 A;  3A5W A;  5CAX A;  1THX A;  2PN8 A;  4KCA A;  1Q4J A;  4G19 A;  1H4O A;  4LL1 B;  4TN8 A;  4I97 A;  5GST A;  3MWH A;  1K0D A;  2NVL A;  5CRD A;  1M9B A;  5L71 A;  2VUP A;  3IC4 A;  3GX8 A;  4GSS A;  5A5H B;  1O73 A;  2CA8 A;  5LNK e;  1ZYP A;  3EIN A;  4IHU A;  2VCZ A;  2C3N A;  1SYX A;  5BRT A;  3TJJ A;  4MF6 A;  4DEJ A;  2LST A;  1X0R A;  3WGE A;  3FY7 A;  2B5Y A;  4G01 A;  1SD8 A;  4I8B A;  1QGV A;  4HQS A;  3TKS C;  1A0R P;  4WBR D;  1YKA A;  2L57 A;  1V57 A;  5E4W A;  2DC5 A;  2YJH A;  1XPV A;  4NMU A;  1YEX A;  1J08 A;  4EL1 A;  4CY8 A;  1WE0 A;  4KAE A;  3VWX A;  2HRN A;  4BPY A;  1BAY A;  2FNO A;  1J0F A;  3G7J A;  4ZL7 A;  2BMX A;  2O7K A;  2YWO A;  3HDC A;  4K9Z A;  3ZLP A;  4AJ8 A;  4O7H A;  1U87 A;  5JWO B;  4OMV A;  3P8W A;  1SJZ A;  2IJY A;  1F37 A;  5HR1 A;  4ZB6 A;  2GZP A;  4QL7 A;  2C8U A;  2JAD A;  3HY2 A;  1RK4 A;  4V2L A;  2WB9 A;  4POK A;  4RI7 A;  1PX6 A;  4ML1 A;  5B8B A;  3HZ8 A;  2OBI A;  5D93 A;  2H1B A;  4KW6 A;  2H72 A;  2MYG A;  5IPH A;  4EDY A;  3QAW A;  4ZBD A;  2AJQ B;  3MSZ A;  1QMV A;  2HNL A;  1SL2 B;  1MDK A;  1WMJ A;  5E59 A;  2VL3 A;  2B5E A;  5DJL A;  4CHS A;  1XW5 A;  1PKZ A;  2FY6 A;  3FZ9 A;  2L6C A;  3KXO A;  1B4Q A;  2HZE A;  5HR3 A;  1G6Y A;  5DAK B;  4DVC A;  3BD2 A;  1J9B A;  4OO5 A;  3HD5 A;  3FZA A;  2L5L A;  1XFL A;  4XS4 B;  1QFN A;  6GSS A;  2VM2 A;  2I81 A;  3APQ A;  2LRC A;  1XW9 A;  3UAR A;  3RHB A;  1GTI A;  3RBT A;  2WS2 A;  4N10 A;  1Y6E A;  3GH9 A;  3IC8 A;  2LQQ A;  5DCG A;  4L5L A;  1B9X C;  4FIW A;  2HXK A;  1T1V A;  1BG5 A;  4ZBB A;  2H1L A;  3VUR A;  2MMN A;  2DJ1 A;  3D0Z A;  2FGX A;  2EFD A;  2V6K A;  5GZZ B;  3QCP A;  4RI6 A;  1TOF A;  4TR3 A;  2HFD A;  1XWG A;  3BCI A;  3GRX A;  2YNX A;  4K5R A;  1TI3 A;  5HR2 A;  5BMU A;  3FZ4 A;  3EUR A;  4WR4 A;  4YAV A;  1N8J A;  1Q98 A;  4XHM A;  3LOR A;  5ID2 A;  1ZL9 A;  2OT3 A;  2FD3 A;  2PVQ A;  2H66 A;  3PIN A;  1KBN A;  4ECJ A;  2VKZ G;  3UMA A;  2DJJ A;  3O3T A;  4OD7 A;  1SKW B;  2VCV A;  4BWS A;  2N5A A;  5D9W A;  3FMW A;  1A8Y A;  4V1A g;  1K3Y A;  5D96 A;  5F06 A;  3SWL A;  3E3E A;  2JL4 A;  1EEM A;  1GUL A;  1S3C A;  1PSQ A;  5A4V A;  2YWN A;  1OAZ A;  2FLS A;  2FWE A;  2B5X A;  2JZT A;  1K3O A;  2XPE A;  2GS3 A;  2RII A;  1V98 A;  3W8J A;  2O5V A;  2EIR A;  2FUG 2;  2WDU A;  2CX4 A;  2R3X A;  2H19 A;  1Z7P A;  3LFL A;  1Z3E A;  1TP9 A;  3ZMK A;  1OE8 A;  3FEU A;  2R0P A;  2GGT A;  6GSV A;  2GT5 A;  4USS A;  4EVM A;  3TJK A;  2C0D A;  1OC9 B;  3IAS 2;  5DDL A;  1XVW A;  3APO A;  5D9V A;  4J2F A;  3L4N A;  4GLT A;  4KDU A;  3IBH A;  2KUC A;  2HT9 A;  2MBT A;  2DKH A;  5G5F A;  2XC2 A;  2IMD A;  2GDR A;  2FWH A;  2F9S A;  1O6J A;  1XXU A;  4DSS B;  3PPU A;  3R3E A;  2X4A A;  1AQX A;  4GSN A;  4FQU A;  3C7M A;  2MZC A;  4KDY A;  3QFA C;  4EIQ A;  1BJX A;  4MZB A;  3LEF A;  1DBY A;  2YCD A;  4KSM A;  3EVI A;  5A1N B;  1EEJ A;  3MIX A;  1XW6 A;  4WEY A;  5ECR B;  1EOG A;  3KM6 A;  1MDI A;  3HVX A;  4O92 A;  4OFM A;  4K7I A;  1AIU A;  5DAK A;  3LXZ A;  1I5G A;  5GSS A;  2FA4 A;  4K2X A;  2H1G A;  6GSY A;  2CAQ A;  1WRY A;  1VF1 A;  1TU7 A;  2OAD A;  3TRQ A;  2EFH A;  2TRX A;  4IJ3 A;  5KN3 A;  1VF4 A;  1FB6 A;  2JSZ A;  4MP4 A;  4E8H A;  2LRT A;  1M7T A;  5F05 A;  1LBK A;  4YQV A;  2OA7 A;  4AKI A;  4J56 E;  1JZW A;  1WPI A;  2EFE A;  2K9F A;  2YZH A;  1VGL A;  1O81 A;  1ERW A;  3TJG A;  2LTK A;  1YY7 A;  2GST A;  3C73 A;  1PL1 A;  5JCU A;  4K5S A;  5IOW A;  1OC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...