3MAKA

Crystal structure of glutathione transferase dmgstd1 from drosophila melanogaster, in complex with glutathione
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
208
structure length
208
Chain Sequence
VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWEENWAGCLEFKKYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase 1-1
publication title Structural evidence for conformational changes of Delta class glutathione transferases after ligand binding
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 78
structure length 208
sequence length 208
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2010-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3makA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3makA01
1SK0A 4Q5NA 4TXOB 2AV4A 2H70A 3UBLA 2NPBA 2LJRA 1M2DA 2XHFA 3DMLA 4IHUA 4O92A 3LEFA 3P8WA 1GUMA 3TKSE 3UARA 3MDKA 4MPFA 3ERWA 4G0KA 4HU9A 4EXJA 4ZILA 3E0UA 1HYUA 1T7PB 2V41A 3VWVA 4MH2A 2C1YA 2HLSA 3MWHA 5HR1A 4HOJA 2JSYA 1PKWA 3K8NA 3A3TA 5J41A 2KP1A 2KUCA 3FZ5A 2VCVA 4PQHA 4NXIA 1XWGA 1DSBA 3I43A 1F9MA 4K7NA 3FZAA 3EU4A 4EL1A 4QQ7A 2LNSA 2L4CA 4IQAA 2BTOT 5ECRB 1Q4JA 2K8VA 2C0GA 2V1MA 4XTSA 2B5XA 5D73A 1Z6MA 4KUNA 4NMUA 5C00A 2MMZA 1SYXA 5L71A 3O3TA 1XWKA 2AB6A 1T1VA 2REMA 3F6FA 3DEXA 2I1UA 5KN2A 3AY8A 3KGKA 6GSUA 3LJRA 3W8SA 2VLUA 1EGOA 2OKAA 2WULA 4JBBA 1T8EB 2B6MA 4N30A 2FWHA 2O89A 4FO5A 3FR3A 1MTCA 3J7Yk 4EC0A 3KCMA 3FK8A 3TOTA 1ZYQB 4ZBAA 4XIHA 2VOCA 2LRCA 5EL8A 4MZWA 3KEBA 3GUSA 5ECKB 3ED3A 3I69A 1UC7A 3LFLA 3ZVJD 3GRXA 4KCEA 3LYKA 1UA5A 4TRXA 1GNEA 2EC4A 1IYHA 3WYWA 1J9BA 2IMDA 5HFIA 8GSSA 2ALBA 4PXOA 5C04A 1SKWB 4MLYA 1EOGA 3BD2A 4NAXA 3BBYA 1BQ7A 3HJMA 2RM6A 4I2UA 1QQ2A 3HY2A 4MA9A 5IIZA 1QUWA 5J9BA 4EUYA 2H75A 3A5WA 4HJMA 1F6MC 1JZDA 1JZOA 1QFNA 1EP8A 2MYGA 1LU4A 2BMXA 3P7XA 5HFGA 1OAZA 4MF7A 3TGZA 1WPIA 3H4KA 2NDOA 1GSQA 2B5YA 1X9WB 3CSHA 1IYIA 4AF2A 1NHYA 2H76A 1EEMA 2NTOA 1THOA 3FZ4A 3WGEA 1ERTA 1V9WA 2J9HA 4BWQA 4ZBBA 2FY6A 3HHVA 3EC3A 3FYGA 4EF0A 2O7KA 4G10A 4AJ7A 3UVTA 1EOHA 3QCPA 1J0FA 3G7JA 1F3AA 2GVPA 2K18A 4OCEA 4HZ2A 3GURA 2HSHA 1X5EA 5FHIA 5ECNB 1WE0A 2KHPA 5IMZA 1GTAA 2WCIA 3ZL5A 3LQ7A 3U6VA 2H1BA 4JR4A 4TXVA 1N2AA 4G2EA 1A0RP 4KDUA 1GLQA 3GSTA 3FR9A 5HR2A 4TN8A 4RUVA 4N11A 1F37A 3TUEA 2H66A 3FR6A 2V6OA 2CV4A 4MDCA 2XC2A 4F2IA 3UBKA 2JSZA 1X0RA 4ZIJA 5D9TA 4XCSA 3F6DA 3TRPA 3IAM2 2LRNA 2A2SA 2VLTA 5CREA 3W6GA 5F06A 1TOFA 3D22A 3TKSA 2H1AA 2WZ9A 1SJZA 3HJOA 1EP7A 1XFLA 1CQGA 3HVXA 3DVWA 5DALA 1A8LA 1FAAA 2VCZA 3NOFA 2YOIA 4PTSA 1GSFA 3RAZA 4I8BA 5ELAA 3VPTA 4BL7B 1K0OA 1HQOA 2FUG2 5ECIB 3A2XA 2H6YA 4IBPA 4LL1B 5ECQB 2IIYA 2H30A 3EWLA 2GSRA 2E2MA 3C73A 4GSTA 2PWJA 2V2GA 5JWQB 2L6CA 2JADA 2IFQB 2O87A 5IO0A 1GSUA 4EVMA 1NM3A 3TKRA 4RQRA 2YANA 4MABA 1XBSA 5JWOB 1YJ6A 3W8JA 2JU5A 3PR8A 1MD3A 1G7OA 4KSOA 1BJXA 2N5AA 1F3BA 1T4YA 4I97A 2GTUA 4JEDA 4BVXB 3FEUA 3Q74A 4F0CA 2QSIA 3ZREA 4K1FA 4MH3A 3JCML 1V57A 3OR5A 1AQVA 5D9WA 3CSIA 1YZXA 4PNGA 2D2ZA 2G0FA 4ZL7A 4LMVA 1Z3EA 2HZEA 3PGTA 2PGTA 1SYRA 4MMMA 1PQNA 3GN3A 3H8QA 4K2DA 4HEA2 4V2MA 2H73A 4K9ZA 2R5GA 3APSA 2CAIA 4L5LA 4IN0A 1QMVA 3L9VA 3MNGA 1R7HA 1SENA 1JFUA 4O32A 1Y25A 3ZRDA 4BPYA 5G30A 4JR6A 1HNCA 4OD7A 4GRFA 5G5EA 1AQXA 4XRDA 2H8LA 4Q5RA 2VD0A 5D93A 3KP8A 3R2QA 1X9SB 4K0GA 2OJLA 3HD5A 1B48A 2B5EA 1MD4A 2NBSA 1BEDA 1GTUA 3GTUA 3D4TA 3L9UA 1T3BA 5CO3A 1SJ6A 9GSSA 4OFMA 2VD1A 3ME8A 4ZL8A 1TK8B 3M3MA 4FH8A 4O7HA 1T4ZA 2C8UA 2HRAA 2A4VA 2YZUA 2AUVA 5ID2B 3WT2A 1FOVA 5H5RA 1PKZA 1GL8A 2YJ7A 2N5BA 1AXDA 2FCHA 2IPAA 3DKSA 1O81A 5CP1A 4WBRD 5DAKA 4JE1A 1TU7A 4QL7A 1OE7A 5D9VA 4GXZA 2LJAA 4HQSA 4GQFA 2L57A 4V1Ag 2F3MA 3S9FA 2WDUA 4XS4B 3QAGA 3G9BA 2DSAA 1I5GA 4CHSA 1Z5YE 4MJEA 1UN2A 2MZCA 1K0AA 3F9UA 3TKPA 4E8EA 4DSSB 3VFIA 2H1DA 2HZFA 3GV1A 4KSMA 1DBYA 3M1GA 2GZPA 5DBQA 2YWOA 4MZCA 1AIUA 4IJ3A 1TI3A 4NHZA 1YEXA 2X99A 3SWLA 3IV4A 1U88A 2H0IA 1MDJA 19GSA 2K6VA 1YY7A 3DGQA 3IOSA 1Z6NA 2KOKA 2V6KA 4J57E 1I9DA 3QD9A 4G0IA 4TKYA 1M7TA 1GP1A 1FO5A 3KJYA 2B7JA 2MBSA 2RLIA 18GSA 4TR1A 3L4NA 3VPQA 2V32A 1GTBA 4RI6A 2LSTA 3EU3A 5ELGA 5LNKe 1K0MA 1ZYEA 3GH6A 2MMAA 5D8IA 4EO3A 1XVQA 2DJ1A 1FVKA 5AISA 5GZZB 2IL3A 2DIZA 5IOWA 4WXTA 1ZMAA 2FNOA 4Q5FA 2HT9A 1NW2A 4J2FA 4BVYA 1AQWA 1R4WA 5GAPD 2WRTA 4ZXGA 5HQPA 2OACA 1UVZA 3Q19A 2DJKA 3UAPA 2PVQA 3C1RA 1VGLA 2J23A 1HD2A 1RQMA 4XRAA 1ABAA 2MMOA 1SD9A 1GUKA 2PPTA 4IQ1A 2B3SA 3GKMA 3SBCA 3HXSA 4LA1A 3WT1A 2RUEA 3G7YA 4F0BA 1TJDA 4KDXA 1ERUA 4POLA 4ACSA 3HA9A 2M80A 2IN3A 2I3YA 4KB3A 1A0FA 3EE2A 4CW9A 1G6YA 2R37A 2EIQA 4KCAA 1G6WA 1B4PA 2HRFA 1BAYA 3D6IA 1M0UA 1LJRA 5A4VA 2H71A 3HVSA 4OFTA 3P2AA 2FWGA 1PSQA 4IW9A 1ZL9A 4PNFA 5DDLA 2C80A 1HNBA 1R5PA 2YV7A 2HYXA 3HZ8A 2DC5A 1PL2A 1SJIA 2H6ZA 1XXUA 4F82A 2C0DA 4NV2A 2GQKA 3TDGA 1CQHA 2IMFA 4MJCA 4ECJA 3GKNA 2M46A 4GTUA 4HUAA 3LGCA 1DE2A 5IMDA 1XCCA 3KD0A 2QC7A 2YN1A 3O6TA 1EV9A 5IOXA 2IWTA 5ECHB 1PD21 2JZRA 2R4VA 4TOPA 1SL0B 3KXOA 2VCWA 3BCKA 2I4AA 4E8HA 2GT5A 2QKEA 3KMOA 1ZZYA 2NVLA 5IMAA 3L9SA 1O8XA 3L78A 3BCIA 4WBJA 1URMA 4F03A 1ILOA 2ZCTA 3C71A 2VLVA 1Z9HA 2KLXA 1G7EA 3U5RE 3FHKA 2PMTA 1QK8A 1K3LA 22GSA 3ZFBA 1GUHA 3FW2A 3IBHA 2LS5A 1B8XA 3GX8A 3QFAC 5AGYA 2VCXA 2FWEA 3KIJA 4YH2A 5HR3A 1PMTA 5ECPB 4LLRA 3E9JB 2JZTA 2LQQA 1C72A 1YKAA 1XVWA 2DMLA 4KGIA 4NHWA 6GSXA 2DJ0A 4EDYA 1N8JA 2RIIA 3TRXA 4WR5A 1XOBA 5AIVA 2LTKA 4RQXA 3GHAA 1NHOA 4RI7A 3DVXA 3KH9A 1OC9A 6GSVA 1HNAA 3UIWA 2OBIA 3HJPA 4FQUA 5F05A 1O73A 10GSA 1B9YC 4YQVA 3C1SA 3E3EA 3UEMA 2PERA 2GQLA 3GYKA 2PUKC 4MJAA 1SKRB 3LWAA 4FYBA 4ECIA 1M2AA 3UOMA 2HFDA 2FA4A 4X1UA 4K7OA 3GA4A 2GDRA 3NZNA 2LRTA 1GSYA 4KA0A 2IMEA 3LSZA 3FY7A 1KEBA 4KW6A 4BA7A 2GQMA 2R3XA 1M9AA 2DMMA 2XPDA 5J5NA 4L8EA 1BG5A 4JZQA 4WKWA 3ZIVA 1O6JA 1XPVA 1H75A 3CBUA 5LD0A 2M72A 4ZBDA 2H1GA 2K9FA 3GKKA 3RHCA 2JACA 3VLNA 4IKHA 2HNLA 3DYRA 2X8CA 3IDVA 5B7CA 3TRQA 5DALB 4EDZA 1SU9A 2LEGA 4OO4A 4ULXA 4N0VA 2HRKA 3GKXA 12GSA 5DJLA 2HSMA 1V58A 2B7KA 4GQCA 2K8SA 3GH9A 2UZ8A 4DEJA 3WGDA 5B8BA 4ISDA 1DUGA 5B8AA 5CRWA 2YV9A 2EIOA 2GSTA 5FWGA 3ZITA 1TI1A 2X8HA 3KM6A 2ZUPA 4PUFC 4K6XA 5F07A 5DCHA 2CVBA 5ECMB 1A2MA 1MDIA 4J56E 4G19A 4GF0A 2DLXA 1WP0A 4V1Ap 3ZZXA 14GSA 4MJBA 5JCWA 4YQMA 1U3AA 1USBA 1WIKA 1YEPA 1U3IA 4WEYA 6GSTA 4OCFA 1A8YA 3EMPA 2FGXA 2GZZA 1FB6A 3TKSC 4TR3A 2F51A 3UVHA 2FA8A 1Z7RA 2VM2A 2P5QA 1W4VA 1Y6EA 2OA7A 3C7MA 1V2AA 5DJMA 3APOA 5CAXA 3IA1A 2P5RA 5DCGA 1XZOA 2G2QA 5IMFA 5G2ZA 2WJUA 3ZFLA 2HZEB 3LXTA 5CRGA 3VWXA 3V1WA 1XW9A 2OE3A 2FD3A 1QXHA 2O8VB 1SKSB 4USSA 1TDIA 1OKDA 1YDKA 2VL2A 1B9XC 3M8NA 1TXXA 1K3YA 5INYA 4JRRA 3ZVJA 1GSDA 3ZMLA 1WWJA 5GSSA 2A2RA 1K0CA 1JZRA 1WMJA 4POBA 3QAVA 3KMNA 2TIRA 2YZHA 3IR4A 1SL1B 16GSA 3HZ4A 1K3OA 4P3YB 3HCZA 3FKFA 4G0LA 3GTUB 1A24A 7GSSA 2AAWA 2JL4A 3P90A 3TJFA 5ECOB 2VCQA 3IRAA 3RDWA 4HQZA 1K0BA 2L5LA 5HFKA 1SK1A 1EGRA 1OC8A 2DBCA 3F63A 4MK3A 3ZYWA 1JZWA 1T00A 4NPBA 1VF4A 4YQUA 5J3RA 2AHEA 4XHMA 2VUPA 3IK7A 5AN1A 1SK2A 2IMKA 2CT6A 1X5CA 5DAKB 1TRWA 3EYTA 3KP9A 1OYJA 4PQIA 2R6KA 1TP9A 4Z7XA 1TK5B 2C0EA 1OVNA 1PGTA 2YJHA 3D0ZA 3D21A 5JCGA 1GSSA 3QPMA 5CRHA 2Z9SA 4IVFA 5AIXA 1VRSD 3L0HA 1V98A 2TRXA 4GLTA 2YP6A 4TXOA 1Z7PA 1PA3A 3GSSA 5GSTA 1F2EA 3F8UA 2AYTA 5IMVA 3IE3A 3EURA 1W89A 3UJ1A 5G31A 1GTIA 4IGJA 2WFCA 2H0GA 2C3NA 3PINA 2H19A 1VF3A 3CTFA 2VAFA 4GSNA 2H72A 5IPGA 1AC1A 3HYPA 4ILFA 2DJJA 5J4UA 3DWVA 4TR1B 2KP2A 1AAZA 4I6XA 1ON4A 2QGVA 3HKRA 3VWWA 2LQOA 6GSSA 1TRSA 3IK9A 3KTBA 3QOUA 3RPNA 2VM1A 13GSA 2HQTA 4HDEA 3ZMKA 5G5FA 2B1KA 1M2BA 4I5QA 4BVYB 1ERVA 4AJ8A 1TW9A 2O85A 3QMXA 4HI7A 3UL3A 3CSJA 2L5OA 3F4RA 1ZGNA 2GT6A 5F0GA 2GSQA 1AUCA 2FWFA 4KAEA 4NWYA 1PN9A 3ERFA 3HDCA 3PPUA 3M0FA 2PU9C 2XBQA 1XW5A 2OE1A 1EWXA 1GLPA 1OE8A 1TRUA 2C0FA 5D96A 2L4QA 3F4SA 3TJJA 1ML6A 5E59A 2AJQB 2X64A 2PBJA 1S3CA 3M9JA 4V2NA 3Q6OA 4MF6A 4WETA 4F9ZA 3VI7A 2RUFA 2H74A 6GSYA 11GSA 4OO5A 3CXGA 5H5SA 5CRDA 1S3DA 4AJ6A 3Q18A 2YNXA 2C3TA 3VK9A 2HE3A 2OBKA 2F9SA 3LYPA 3N9JA 4TW5A 2FHEA 1B4QA 3QDNA 4L0UA 4CDOA 5A4UA 1YQ1A 4WR4A 4LL4B 1ST9A 1XWCA 3APQA 5D9XA 3LORA 2I81A 2EIRA 5DVBA 4IP6A 3FRCA 2P0GA 2HSNB 1X9MB 1FVJA 4I2TA 2OADA 4EE0A 4XS1A 5KN1A 1R5AA 1EZKA 4N0ZA 4QL9A 1TRVA 4OWYA 4PUAA 3TOUA 3PH9A 4JU5A 4XS6A 3TJKA 3GL5A 3GIXA 3RBTA 5KN0A 4LMWA 3A2WA 2JZSA 1BX9A 5LCZA 2YPMA 1V40A 4OFNA 2VIMA 4POMA 2F8AA 3CYNA 4NV5A 1GULA 3EVIA 3LG6A 2OE0A 3IHQA 3CMIA 4V2LA 5CNWA 2CA8A 4K8MA 3BOAA 2ON5A 1GNWA 4AGSA 2H0HA 5GAND 1RK4A 4BWSA 2IMIA 2HXKA 3ERGA 2DIYA 1FW1A 3QAWA 1QGVA 2X8GA 3NIVA 1PX7A 5HR0A 1GRXA 4L0WA 4WF4A 4K7IA 4TVEA 1O7UA 3UMAA 3VURA 5B6MA 2GS3A 5CYYA 3H93A 2CQ9A 2P31A 3I9V2 4YAPA 5KEJA 4Q5QA 5EPFA 2F8FA 2L59A 5G1LA 1KBNA 3VWUA 3DIEA 3GMFA 3DD3A 1KNGA 4D73A 2VCTA 1THXA 5KN3A 1U87A 5ENUA 4PQ1A 3O76A 3N5OA 4ML6A 5EY6A 3HVVA 1X5DA 4ZB9A 4KF9A 2R2JA 2N5FA 1OC9B 2GGTA 2LKUA 3KZQA 2YWMA 2GLRA 3GNJA 6GSWA 4HS1A 3ZIJA 4EKZA 5EVOA 2WGRA 4BL7A 4H86A 4MCUA 3DXBA 4ID0A 1VF2A 4DSRA 5IQYA 2RM5A 2B1LA 5DQYA 5IM9A 4IJIA 4D73B 4X0XA 5ECLB 1OKTA 3QR6A 3VI5A 1J08A 4ZL9A 1OC3A 2MBTA 2IFQA 4ECCA 5FT3A 2IJYA 1SL2B 5ECSA 3TJGA 5IO2A 4N10A 1XWBA 2HSYA 1EV4A 1JLVA 2YWNA 5E4WA 20GSA 4HU7A 3CTGA 4KX4A 3DRNA 3F3QA 4ZB8A 5G1KA 2VO4A 3EMXA 3D5JA 4IELA 3RHBA 1ACVA 2CVKA 4BVXA 3LXZA 2E0QA 5A4WA 2GZYA 2PVOC 4K0NA 3IC4A 1YKCA 4DSQA 1U6TA 2YCDA 4KNDA 2VL3A 4L5OA 2TRCP 3EINA 2L6DA 3ME7A 3WD6A 4DVCA 2XBIA 3BJ5A 2BJXA 3MSZA 1TU8A 5DQSA 3GFKA 1XOAA 3MAKA 2DJ3A 3GX0A 2HRKB 3FZ9A 4MP4A 1LBKA 1TKDB 1FB0A 5IMCA 2HSMB 3I6AA 3F0IA 2LNTA 1NSWA 4FIWA 1AW9A 2E2GA 1RW1A 5JWRB 3F3RA 1FG4A 4GWRA 1E2YA 4MZBA 3QFBC 4KDYA 1TK0B 3ZTLA 1VF1A 1DE1A 2C3QA 2ZNMA 1GSEA 4IP1A 2LUSA 5ABRA 3CRUA 4X43A 17GSA 1H4OA 4OMVA 5A5KA 2ON7A 3GL3A 1A2JA 3TCOA 3KH7A 3A2VA 1PL1A 2YWIA 1PX6A 1K0NA 2GSSA 1YF0A 5H5QA 4KE3A 4PGTA 1ZCPA 3RPPA 4IS0A 2LJKA 2CX3A 5ID2A 4TR0A 1XIYA 1TTZA 1JLWA 1K0DA 3ISOA 2C4JA 1A23A 2CVDA 3IPZA 1M99A 5J9CA 2CZ3A 4FYCA 4PX1A 2LV3A 1ZOFA 3TB2A 4G9HA 1S3AA 2CAQA 2FLSA 4KH7A 1WRYA 1E6BA 4YAVA 4XS4A 4GSSA 2CZ2A 3CRTA 3R3EA 4O5RA 5IPHA 2HI7A 3J7Yb 2VL9A 1WOUA 5BMUA 3WGXA 3H79A 2WB9A 4DSSA 4ML1A 2H01A 1MDKA 2I9HA 1XW6A 3KTLA 5B6NA 1JHBA 4MF5A 4WF5A 5COHA 2XPEA 4TR4A 3IXRA 1FHEA 1EEJA 1O8WA 1A2LA 1WJKA 2H6XA 3H1NA 1YF1A 1ERWA 5F8BA 2E7PA 4FYUA 3IC8A 3D4MA 3IAS2 3C8EA 4HJ2A 4MPGA 1GWCA 5JCUA 1R26A 4ZB6A 1SD8A 4ECBA 1GH2A 3M9KA 3TKQA 1BYEA 1Q98A 2MMNA 1MEKA 3F4TA 1KTEA 1O85A 2CX4A 2VL2C 2WS2A 1G0TA 3US3A 1M9BA 4POKA 3G7IA 2PN8A 1XWAA 3TJBA 1PRXA 2ES7A 4PURA 3ZLPA 4GCIA 4HZ4A 2HRNA 2DJ2A
chains in the Genus database with same CATH superfamily
1SK0A 4Q5NA 4TXOB 2AV4A 2H70A 3UBLA 2NPBA 2LJRA 1M2DA 2XHFA 3DMLA 4IHUA 4O92A 3LEFA 3P8WA 1GUMA 1YVLA 3TKSE 3UARA 3MDKA 4MPFA 3ERWA 4G0KA 4HU9A 4EXJA 4ZILA 3E0UA 1HYUA 1T7PB 2V41A 3VWVA 4MH2A 2C1YA 2HLSA 3MWHA 5HR1A 4HOJA 2JSYA 1PKWA 3K8NA 5BRTA 3A3TA 5J41A 2KP1A 2KUCA 3FZ5A 2VCVA 4PQHA 4NXIA 1XWGA 1DSBA 3I43A 1F9MA 4K7NA 3FZAA 3EU4A 4EL1A 4QQ7A 2LNSA 2L4CA 4IQAA 2BTOT 5ECRB 1Q4JA 2K8VA 2C0GA 2V1MA 4XTSA 1ZYNA 2B5XA 5D73A 1Z6MA 4KUNA 4NMUA 5C00A 2MMZA 1SYXA 5L71A 2DKHA 3O3TA 1XWKA 2AB6A 1T1VA 2REMA 3F6FA 3DEXA 4A5PA 2I1UA 5KN2A 3AY8A 1N25A 3KGKA 6GSUA 3LJRA 2A4HA 3W8SA 2VLUA 3HMJG 1EGOA 2OKAA 2WULA 4JBBA 1T8EB 2B6MA 4ICYA 4N30A 2FWHA 2O89A 4FO5A 3FR3A 1MTCA 3J7Yk 4EC0A 2WW1A 3KCMA 3FK8A 3TOTA 1ZYQB 4ZBAA 4XIHA 2VOCA 2LRCA 5EL8A 4MZWA 3KEBA 4EIQA 3GUSA 5ECKB 3ED3A 3I69A 1UC7A 4YKGA 3LFLA 3ZVJD 3GRXA 4KCEA 3LYKA 1UA5A 4TRXA 1GNEA 2EC4A 1IYHA 3WYWA 1J9BA 2IMDA 5HFIA 1S3RA 8GSSA 2ALBA 4PXOA 5C04A 1SKWB 4MLYA 1EOGA 3BD2A 2OT3A 4NAXA 3BBYA 1BQ7A 3HJMA 2RM6A 4I2UA 1QQ2A 3HY2A 4MA9A 5IIZA 1QUWA 5A1NA 3FMWA 5J9BA 4EUYA 2H75A 3A5WA 4HJMA 2WVXB 1F6MC 1JZDA 1JZOA 1QFNA 1EP8A 2MYGA 1LU4A 2BMXA 3P7XA 5HFGA 1OAZA 4MF7A 3TGZA 1WPIA 3H4KA 2NDOA 1GSQA 2B5YA 1X9WB 3CSHA 1IYIA 2H1LA 4AF2A 1NHYA 2H76A 1EEMA 2NTOA 1THOA 3FZ4A 3WGEA 1ERTA 1V9WA 2J9HA 4BWQA 2R0PA 4ZBBA 2FY6A 1PFOA 3HHVA 3EC3A 3FYGA 4EF0A 2O7KA 4G10A 4AJ7A 3UVTA 1EOHA 3QCPA 1J0FA 3G7JA 1F3AA 2GVPA 2K18A 4OCEA 4HZ2A 3GURA 2HSHA 1X5EA 5FHIA 5ECNB 1WE0A 2KHPA 5IMZA 1GTAA 2WCIA 3ZL5A 3LQ7A 3U6VA 2H1BA 4JR4A 4TXVA 1N2AA 4G2EA 1A0RP 4KDUA 1GLQA 3GSTA 3FR9A 5HR2A 4TN8A 4RUVA 4N11A 1F37A 3TUEA 2H66A 3FR6A 2V6OA 2CV4A 4MDCA 2XC2A 4F2IA 3UBKA 3MYDA 2JSZA 1X0RA 4ZIJA 5D9TA 4XCSA 3F6DA 3TRPA 3IAM2 2LRNA 2A2SA 2VLTA 5CREA 3W6GA 5F06A 1TOFA 3D22A 3TKSA 2H1AA 2WZ9A 1SJZA 3HJOA 4K2XA 1EP7A 1XFLA 1CQGA 3HVXA 3DVWA 5DALA 1A8LA 4AKHA 1FAAA 2VCZA 3NOFA 2YOIA 4PTSA 1GSFA 3RAZA 4I8BA 5ELAA 3VPTA 4BL7B 1K0OA 1HQOA 2FUG2 5ECIB 3A2XA 2H6YA 4IBPA 4LL1B 5ECQB 2IIYA 2H30A 3EWLA 2GSRA 2E2MA 3C73A 4GSTA 2PWJA 2V2GA 5JWQB 2L6CA 2JADA 2IFQB 2O87A 5IO0A 1GSUA 4EVMA 1NM3A 4O5QA 3TKRA 4RQRA 2YANA 4MABA 1XBSA 5JWOB 2WVZA 1YJ6A 3W8JA 2JU5A 3PR8A 1MD3A 1G7OA 4KSOA 1BJXA 2N5AA 1F3BA 1T4YA 4I97A 2GTUA 4JEDA 4BVXB 3FEUA 3Q74A 5J40A 4F0CA 2QSIA 3ZREA 4K1FA 4MH3A 3JCML 1V57A 3OR5A 1AQVA 5D9WA 3CSIA 4EIPA 1YZXA 4PNGA 2D2ZA 2G0FA 4ZL7A 4LMVA 1Z3EA 2HZEA 3PGTA 2PGTA 1SYRA 4MMMA 1PQNA 3GN3A 3H8QA 4K2DA 4HEA2 4V2MA 2H73A 4K9ZA 2R5GA 3APSA 2CAIA 4L5LA 4IN0A 1QMVA 3L9VA 3MNGA 1R7HA 1SENA 1JFUA 4O32A 1Y25A 3ZRDA 4BPYA 5G30A 4JR6A 1HNCA 4OD7A 4GRFA 2R0CA 5G5EA 1PN0A 1AQXA 4XRDA 2H8LA 4Q5RA 2VD0A 5D93A 3KP8A 3R2QA 1X9SB 4K0GA 2OJLA 3HD5A 1B48A 2B5EA 1MD4A 2NBSA 1TXUA 5KOWA 1BEDA 1GTUA 3GTUA 3D4TA 3L9UA 1T3BA 5CO3A 1SJ6A 9GSSA 4W66A 2WZSA 2VD1A 4OFMA 3ME8A 4ZL8A 1TK8B 3M3MA 4FH8A 4O7HA 1T4ZA 2C8UA 2HRAA 2A4VA 2YZUA 2AUVA 5ID2B 3WT2A 1FOVA 5H5RA 1PKZA 1GL8A 2YJ7A 2N5BA 1AXDA 2FCHA 2IPAA 3DKSA 1O81A 5CP1A 4WBRD 5DAKA 4AKGA 4JE1A 1TU7A 4QL7A 1OE7A 5D9VA 4GXZA 2LJAA 4HQSA 4GQFA 2L57A 4V1Ag 2F3MA 3S9FA 2WDUA 4XS4B 3QAGA 3G9BA 2DSAA 1I5GA 4CHSA 1Z5YE 4MJEA 1UN2A 5BMUB 2MZCA 1K0AA 3F9UA 3TKPA 4E8EA 4DSSB 3VFIA 2H1DA 2HZFA 3GV1A 4KSMA 1DBYA 3M1GA 2GZPA 5DBQA 2YWOA 4K5RA 4MZCA 1AIUA 2O3EA 4IJ3A 1TI3A 4NHZA 1YEXA 2X99A 3SWLA 3IV4A 1U88A 2H0IA 1MDJA 19GSA 2K6VA 1YY7A 3DGQA 3IOSA 1Z6NA 2KOKA 2V6KA 4J57E 1I9DA 3QD9A 4G0IA 4TKYA 2EFDA 1M7TA 1GP1A 1FO5A 3KJYA 2B7JA 2MBSA 2RLIA 18GSA 4TR1A 3L4NA 3VPQA 2V32A 1GTBA 4RI6A 2LSTA 3EU3A 5ELGA 5LNKe 1K0MA 1ZYEA 3GH6A 2MMAA 5D8IA 4EO3A 1XVQA 2DJ1A 1FVKA 5AISA 5A34A 5GZZB 2IL3A 2DIZA 5IOWA 4WXTA 5J4YA 2FNOA 4Q5FA 1ZMAA 2HT9A 1NW2A 4J2FA 4BVYA 1AQWA 1R4WA 5GAPD 2WRTA 4ZXGA 5HQPA 2OACA 1UVZA 3Q19A 2DJKA 3UAPA 2PVQA 5J4VA 3C1RA 1ZYPA 1VGLA 2J23A 1HD2A 1RQMA 4XRAA 1ABAA 2MMOA 1SD9A 1GUKA 2PPTA 5A34B 1S4BP 4IQ1A 2B3SA 3GKMA 3SBCA 3HXSA 4LA1A 3WT1A 2RUEA 3G7YA 4F0BA 1TJDA 4KDXA 3EPTA 1SVOA 1ERUA 4POLA 4ACSA 3HA9A 2M80A 2IN3A 2I3YA 4KB3A 1A0FA 3EE2A 4CW9A 1G6YA 2R37A 2EIQA 4KCAA 1G6WA 1B4PA 2HRFA 1BAYA 3D6IA 1M0UA 1LJRA 5A4VA 2H71A 3HVSA 4OFTA 3P2AA 2FWGA 1PSQA 4IW9A 1ZL9A 4PNFA 5DDLA 2C80A 1HNBA 1R5PA 2YV7A 2HYXA 3HZ8A 4G01A 2DC5A 1PL2A 1SJIA 2H6ZA 1XXUA 4F82A 2C0DA 4NV2A 2GQKA 4AKIA 3TDGA 1CQHA 2HSNA 2IMFA 4MJCA 4ECJA 3GKNA 3TU3B 2M46A 4GTUA 4HUAA 3LGCA 1DE2A 5IMDA 1XCCA 3KD0A 2QC7A 2YN1A 3O6TA 1EV9A 5IOXA 2IWTA 5ECHB 1PD21 2JZRA 2R4VA 4TOPA 1SL0B 3KXOA 2VCWA 3BCKA 2I4AA 4E8HA 2GT5A 2QKEA 3KMOA 1ZZYA 2NVLA 5IMAA 3L9SA 1O8XA 3L78A 3BCIA 4WBJA 1URMA 4F03A 1ILOA 2ZCTA 3C71A 2VLVA 1Z9HA 2KLXA 1G7EA 3U5RE 3FHKA 2PMTA 1QK8A 1K3LA 22GSA 3ZFBA 1GUHA 3FW2A 3IBHA 2LS5A 1B8XA 3GX8A 3QFAC 5AGYA 2VCXA 4O5UA 2FWEA 3KIJA 4YH2A 5HR3A 1PMTA 5ECPB 4LLRA 3E9JB 2JZTA 2LQQA 1C72A 1YKAA 1XVWA 2DMLA 2X49A 4PI0C 4KGIA 4NHWA 6GSXA 5A1NB 2DJ0A 4EDYA 1N8JA 2RIIA 3TRXA 4WR5A 1XOBA 5AIVA 2LTKA 4RQXA 3GHAA 1NHOA 2O5VA 4QMKA 4RI7A 3DVXA 3KH9A 1OC9A 4MNNA 6GSVA 1HNAA 3UIWA 4CY6A 2OBIA 3HJPA 4FQUA 5F05A 1O73A 10GSA 1B9YC 4YQVA 3C1SA 3E3EA 3UEMA 2PERA 2GQLA 3GYKA 2PUKC 4MJAA 1SKRB 3LWAA 4FYBA 4ECIA 1M2AA 3UOMA 2HFDA 2FA4A 4X1UA 4K7OA 3GA4A 4AI6A 2GDRA 3NZNA 2LRTA 1GSYA 4KA0A 2QA1A 2IMEA 3LSZA 3FY7A 1KEBA 4KW6A 4CY8A 4BA7A 2GQMA 2R3XA 1M9AA 2DMMA 2XPDA 3LW9A 5J5NA 4L8EA 1BG5A 4JZQA 4Z2TA 4WKWA 3ZIVA 1O6JA 1XPVA 1H75A 3CBUA 5LD0A 2M72A 4ZBDA 2H1GA 2K9FA 3GKKA 3RHCA 2JACA 3VLNA 4IKHA 2HNLA 3DYRA 2X8CA 3IDVA 5B7CA 3TRQA 1SVMA 5DALB 4EDZA 1SU9A 2LEGA 3RGBC 4OO4A 4ULXA 4N0VA 2HRKA 3GKXA 12GSA 5DJLA 2HSMA 5J47A 1V58A 2B7KA 4GQCA 2K8SA 3GH9A 2UZ8A 4DEJA 3WGDA 5B8BA 4ISDA 1DUGA 5B8AA 5CRWA 2YV9A 2EIOA 2WW2A 2GSTA 5FWGA 3ZITA 1TI1A 2X8HA 3A5IA 3KM6A 2ZUPA 4PUFC 4K6XA 3CHXC 5F07A 5DCHA 2CVBA 5ECMB 1A2MA 1MDIA 4J56E 4G19A 4GF0A 2DLXA 1WP0A 4V1Ap 3ZZXA 14GSA 4MJBA 5JCWA 4YQMA 1U3AA 1USBA 1WIKA 1YEPA 1U3IA 4WEYA 6GSTA 4OCFA 1A8YA 3EMPA 2FGXA 2GZZA 1FB6A 3TKSC 4TR3A 2F51A 3UVHA 2FA8A 1Z7RA 2VM2A 2P5QA 1W4VA 1Y6EA 2OA7A 3C7MA 1V2AA 2DKIA 5DJMA 3APOA 5CAXA 3IA1A 2P5RA 5DCGA 1XZOA 2G2QA 5IMFA 5G2ZA 2WJUA 3ZFLA 2HZEB 3LXTA 2EFHA 5CRGA 3VWXA 3V1WA 1XW9A 2OE3A 2FD3A 1QXHA 2O8VB 1SKSB 4USSA 1TDIA 1OKDA 1YDKA 2VL2A 5A5HA 1B9XC 3M8NA 1TXXA 1K3YA 5INYA 4JRRA 3ZVJA 1GSDA 3ZMLA 1WWJA 5GSSA 2A2RA 1K0CA 1JZRA 1M3IA 1WMJA 4POBA 3QAVA 3KMNA 2TIRA 2YZHA 2WVYA 3IR4A 1SL1B 16GSA 3HZ4A 1K3OA 4GDFA 4K5SA 4P3YB 3HCZA 3FKFA 4G0LA 3GTUB 1A24A 7GSSA 2AAWA 2O36A 2JL4A 3P90A 3TJFA 5A5HB 5ECOB 2VCQA 3IRAA 3RDWA 2X4AA 4HQZA 1K0BA 2L5LA 5KOXA 5HFKA 1SK1A 3CQFA 1EGRA 1OC8A 2DBCA 3F63A 4MK3A 3ZYWA 1JZWA 1T00A 4NPBA 4Z2UA 1VF4A 4YQUA 5J3RA 2AHEA 4XHMA 2VUPA 3IK7A 5AN1A 1SK2A 2IMKA 2CT6A 1X5CA 5DAKB 1TRWA 3EYTA 3KP9A 1OYJA 4PQIA 2R6KA 1TP9A 4Z7XA 1TK5B 2C0EA 1OVNA 1PGTA 2YJHA 3D0ZA 3D21A 5JCGA 1GSSA 3QPMA 5CRHA 2Z9SA 4IVFA 5AIXA 1VRSD 3L0HA 2EFEA 1V98A 2TRXA 4GLTA 2YP6A 4TXOA 1Z7PA 1PA3A 3GSSA 5GSTA 1F2EA 3F8UA 2AYTA 5IMVA 3IE3A 3EURA 3HVNA 1W89A 3UJ1A 5G31A 1GTIA 4IGJA 2WFCA 2H0GA 2C3NA 3PINA 2H19A 1XG8A 1VF3A 3CTFA 2VAFA 4GSNA 2H72A 5IPGA 1AC1A 3HYPA 4ILFA 2DJJA 5J4UA 3DWVA 4TR1B 2KP2A 1AAZA 4I6XA 1ON4A 2QGVA 3HKRA 4Z2RA 3VWWA 2LQOA 6GSSA 1TRSA 4AKXB 3IK9A 3KTBA 3QOUA 3RPNA 2VM1A 13GSA 2HQTA 4HDEA 4FXYP 3ZMKA 5G5FA 2B1KA 1M2BA 4I5QA 4BVYB 1ERVA 4AJ8A 1TW9A 2O85A 3QMXA 4HI7A 3UL3A 3CSJA 2L5OA 3F4RA 1ZGNA 2GT6A 5F0GA 2GSQA 1AUCA 2FWFA 4KAEA 4NWYA 1PN9A 3ERFA 3HDCA 3PPUA 4YKFA 3M0FA 2PU9C 2XBQA 1XW5A 2OE1A 1EWXA 1GLPA 1OE8A 1TRUA 2C0FA 2QA2A 5D96A 2L4QA 3F4SA 3TJJA 1ML6A 5E59A 2AJQB 2X64A 2PBJA 1S3CA 3M9JA 4V2NA 3Q6OA 1I1IP 4MF6A 4WETA 1FOHA 4F9ZA 3VI7A 2RUFA 3IHGA 2H74A 6GSYA 11GSA 4OO5A 3CXGA 5H5SA 5CRDA 1S3DA 4AJ6A 3Q18A 2YNXA 2C3TA 3VK9A 2HE3A 2OBKA 2F9SA 3LYPA 3N9JA 3MIXA 4TW5A 2FHEA 1B4QA 3QDNA 4L0UA 4CDOA 5A4UA 1YQ1A 4WR4A 4LL4B 1ST9A 1XWCA 3APQA 5D9XA 3LORA 2I81A 2EIRA 5DVBA 4IP6A 3FRCA 2P0GA 2HSNB 1X9MB 1FVJA 4I2TA 4X4JA 2OADA 4EE0A 4XS1A 5KN1A 1R5AA 1EZKA 4N3ZA 4N0ZA 2WVXA 4QL9A 1TRVA 4OWYA 4PUAA 3TOUA 3PH9A 4JU5A 4XS6A 3TJKA 3GL5A 3GIXA 3RBTA 5KN0A 4LMWA 3A2WA 2JZSA 1BX9A 4ZB7A 5LCZA 2YPMA 1V40A 4OFNA 2VIMA 4POMA 2F8AA 3CYNA 4NV5A 1GULA 3EVIA 3LG6A 2OE0A 3IHQA 4PI2C 3CMIA 4V2LA 5CNWA 2CA8A 4K8MA 3BOAA 2ON5A 1GNWA 4AGSA 2H0HA 5GAND 4E68A 1RK4A 4BWSA 2IMIA 2WW3A 2HXKA 3ERGA 2DIYA 1FW1A 3QAWA 1QGVA 2X8GA 3NIVA 1PX7A 5HR0A 1GRXA 4L0WA 4WF4A 4K7IA 4TVEA 2UV8G 1O7UA 1SVLA 3UMAA 3VURA 5B6MA 2GS3A 5CYYA 3H93A 2R0GA 2CQ9A 2P31A 3I9V2 4YAPA 5KEJA 4Q5QA 5EPFA 1Y1UA 1YEWC 2F8FA 2L59A 5G1LA 1KBNA 3VWUA 3DIEA 3GMFA 3DD3A 1KNGA 4D73A 2VCTA 1THXA 5KN3A 1U87A 5ENUA 4PQ1A 3O76A 3N5OA 4ML6A 5EY6A 3HVVA 1X5DA 4ZB9A 4KF9A 2R2JA 2N5FA 1OC9B 2GGTA 2LKUA 3KZQA 2YWMA 2GLRA 3GNJA 6GSWA 4HS1A 3ZIJA 4EKZA 5EVOA 2WGRA 4BL7A 4H86A 4MCUA 3DXBA 4ID0A 1VF2A 4DSRA 5IQYA 2RM5A 2B1LA 5DQYA 4BIKA 5IM9A 4IJIA 4D73B 4X0XA 5ECLB 1OKTA 3QR6A 3VI5A 1J08A 4ZL9A 1OC3A 2MBTA 2IFQA 4ECCA 1M3JA 5FT3A 2IJYA 1SL2B 5ECSA 3TJGA 5IO2A 4N10A 1XWBA 2HSYA 1EV4A 1JLVA 2YWNA 5E4WA 20GSA 4HU7A 3CTGA 4PHZC 4KX4A 3DRNA 3F3QA 4ZB8A 5G1KA 2VO4A 3EMXA 3D5JA 4IELA 3RHBA 1ACVA 2CVKA 4BVXA 3LXZA 2E0QA 5A4WA 2GZYA 2PVOC 4K0NA 3IC4A 1YKCA 4DSQA 1U6TA 2YCDA 4KNDA 2VL3A 4L5OA 2TRCP 3EINA 2L6DA 3ME7A 3WD6A 4DVCA 2XBIA 3BJ5A 2BJXA 3MSZA 1TU8A 5DQSA 3GFKA 1XOAA 3MAKA 2DJ3A 3GX0A 2HRKB 1BG1A 4MP4A 1LBKA 3FZ9A 1TKDB 1FB0A 5IMCA 2HSMB 3I6AA 3F0IA 2LNTA 1NSWA 4FIWA 1AW9A 2E2GA 1RW1A 5JWRB 3F3RA 1FG4A 4GWRA 1E2YA 4MZBA 3QFBC 4KDYA 1TK0B 3ZTLA 1VF1A 1DE1A 2C3QA 2ZNMA 1GSEA 4IP1A 4HSCX 2LUSA 5ABRA 3CRUA 4X43A 17GSA 1H4OA 4OMVA 5A5KA 2ON7A 3GL3A 1A2JA 3TCOA 3KH7A 3A2VA 1PL1A 2YWIA 1PX6A 1K0NA 2GSSA 1YF0A 5H5QA 4KE3A 3CWGA 4PGTA 1ZCPA 1BF5A 3RPPA 4IS0A 2LJKA 2CX3A 5ID2A 4TR0A 1XIYA 1TTZA 1JLWA 2VKZG 1K0DA 3ISOA 2C4JA 1A23A 2CVDA 3IPZA 1M99A 5J9CA 2CZ3A 4FYCA 4PX1A 2LV3A 1ZOFA 3TB2A 4G9HA 1S3AA 2CAQA 2FLSA 4KH7A 1WRYA 1E6BA 4YAVA 4XS4A 4GSSA 2CZ2A 3CRTA 3R3EA 4O5RA 5IPHA 2HI7A 3J7Yb 2VL9A 1WOUA 5BMUA 3WGXA 2EFCA 3H79A 2WB9A 4DSSA 4ML1A 2H01A 1MDKA 2I9HA 1XW6A 3KTLA 5B6NA 1JHBA 4MF5A 4WF5A 3RFRC 5COHA 2XPEA 4TR4A 3IXRA 1FHEA 1EEJA 1O8WA 1A2LA 1WJKA 2H6XA 3H1NA 1YF1A 1ERWA 5F8BA 2E7PA 4FYUA 3IC8A 3D4MA 3IAS2 3C8EA 4HJ2A 4MPGA 1GWCA 5JCUA 1R26A 2WW0A 4ZB6A 1SD8A 4ECBA 1GH2A 3M9KA 3TKQA 1BYEA 1Q98A 2MMNA 1MEKA 3F4TA 1KTEA 1O85A 2CX4A 2A2PA 2VL2C 2WS2A 1G0TA 3US3A 1M9BA 4POKA 3G7IA 2PN8A 1XWAA 3TJBA 1PRXA 2ES7A 4PURA 3ZLPA 4GCIA 4HZ4A 2HRNA 2DJ2A
chains in the Genus database with same CATH topology
1SK0A 4Q5NA 4TXOB 2AV4A 2H70A 3UBLA 2NPBA 2LJRA 1M2DA 2XHFA 3DMLA 4IHUA 4O92A 3LEFA 3P8WA 1GUMA 1YVLA 3TKSE 3UARA 3MDKA 4MPFA 3ERWA 4G0KA 4HU9A 4EXJA 4ZILA 3E0UA 1HYUA 1T7PB 2V41A 3VWVA 4MH2A 2C1YA 2HLSA 3MWHA 5HR1A 4HOJA 2JSYA 1PKWA 3K8NA 5BRTA 3A3TA 5J41A 2KP1A 2KUCA 3FZ5A 2VCVA 4PQHA 4NXIA 1XWGA 1DSBA 3I43A 1F9MA 4K7NA 3FZAA 3EU4A 4EL1A 4QQ7A 2LNSA 2L4CA 4IQAA 2BTOT 5ECRB 1Q4JA 2K8VA 2C0GA 2V1MA 4XTSA 1ZYNA 2B5XA 5D73A 1Z6MA 4KUNA 4NMUA 5C00A 2MMZA 1SYXA 5L71A 2DKHA 3O3TA 1XWKA 2AB6A 1T1VA 2REMA 3F6FA 3DEXA 4A5PA 2I1UA 5KN2A 3AY8A 1N25A 3KGKA 6GSUA 3LJRA 2A4HA 3W8SA 2VLUA 3HMJG 1EGOA 2OKAA 2WULA 4JBBA 1T8EB 2B6MA 4ICYA 4N30A 2FWHA 2O89A 4FO5A 3FR3A 1MTCA 3J7Yk 4EC0A 3KCMA 3FK8A 3TOTA 1ZYQB 4ZBAA 4XIHA 2VOCA 2LRCA 5EL8A 4MZWA 3KEBA 4EIQA 3GUSA 5ECKB 3ED3A 3I69A 1UC7A 4YKGA 3LFLA 3ZVJD 3GRXA 4KCEA 3LYKA 1UA5A 4TRXA 1GNEA 2EC4A 1IYHA 3WYWA 1J9BA 2IMDA 5HFIA 8GSSA 2ALBA 4PXOA 5C04A 1SKWB 4MLYA 1EOGA 3BD2A 2OT3A 4NAXA 3BBYA 1BQ7A 3HJMA 2RM6A 4I2UA 1QQ2A 3HY2A 4MA9A 5IIZA 1QUWA 5A1NA 3FMWA 5J9BA 4EUYA 2H75A 3A5WA 4HJMA 1F6MC 1JZDA 1JZOA 1QFNA 1EP8A 2MYGA 1LU4A 2BMXA 3P7XA 5HFGA 1OAZA 4MF7A 3TGZA 1WPIA 3H4KA 2NDOA 1GSQA 2B5YA 1X9WB 3CSHA 1IYIA 2H1LA 4AF2A 1NHYA 2H76A 1EEMA 2NTOA 1THOA 3FZ4A 3WGEA 1ERTA 1V9WA 2J9HA 4BWQA 2R0PA 4ZBBA 2FY6A 3HHVA 3EC3A 3FYGA 4EF0A 2O7KA 4G10A 4AJ7A 3UVTA 1EOHA 3QCPA 1J0FA 3G7JA 1F3AA 2GVPA 2K18A 4OCEA 4HZ2A 3GURA 2HSHA 1X5EA 5FHIA 5ECNB 1WE0A 2KHPA 5IMZA 1GTAA 2WCIA 3ZL5A 3LQ7A 3U6VA 2H1BA 4JR4A 4TXVA 1N2AA 4G2EA 1A0RP 4KDUA 1GLQA 3GSTA 3FR9A 5HR2A 4TN8A 4RUVA 4N11A 1F37A 3TUEA 2H66A 3FR6A 2V6OA 2CV4A 4MDCA 2XC2A 4F2IA 3UBKA 3MYDA 2JSZA 1X0RA 4ZIJA 5D9TA 4XCSA 3F6DA 3TRPA 3IAM2 2LRNA 2A2SA 2VLTA 5CREA 3W6GA 5F06A 1TOFA 3D22A 3TKSA 2H1AA 2WZ9A 1SJZA 3HJOA 4K2XA 1EP7A 1XFLA 1CQGA 3HVXA 3DVWA 5DALA 1A8LA 4AKHA 1FAAA 2VCZA 3NOFA 2YOIA 4PTSA 1GSFA 3RAZA 4I8BA 5ELAA 3VPTA 4BL7B 1K0OA 1HQOA 2FUG2 5ECIB 3A2XA 2H6YA 4IBPA 4LL1B 5ECQB 2IIYA 2H30A 3EWLA 2GSRA 2E2MA 3C73A 4GSTA 2PWJA 2V2GA 5JWQB 2L6CA 2JADA 2IFQB 2O87A 5IO0A 1GSUA 4EVMA 1NM3A 4O5QA 3TKRA 4RQRA 2YANA 4MABA 1XBSA 5JWOB 1YJ6A 3W8JA 2JU5A 3PR8A 1MD3A 1G7OA 4KSOA 1BJXA 2N5AA 1F3BA 1T4YA 4I97A 2GTUA 4JEDA 4BVXB 3FEUA 3Q74A 5J40A 4F0CA 2QSIA 3ZREA 4K1FA 4MH3A 3JCML 1V57A 3OR5A 1AQVA 5D9WA 3CSIA 4EIPA 1YZXA 4PNGA 2D2ZA 2G0FA 4ZL7A 4LMVA 1Z3EA 2HZEA 3PGTA 2PGTA 1SYRA 4MMMA 1PQNA 3GN3A 3H8QA 4K2DA 4HEA2 4V2MA 2H73A 4K9ZA 2R5GA 3APSA 2CAIA 4L5LA 4IN0A 1QMVA 3L9VA 3MNGA 1R7HA 1SENA 1JFUA 4O32A 1Y25A 3ZRDA 4BPYA 5G30A 4JR6A 1HNCA 4OD7A 4GRFA 2R0CA 5G5EA 1PN0A 1AQXA 4XRDA 2H8LA 4Q5RA 2VD0A 5D93A 3KP8A 3R2QA 1X9SB 4K0GA 2OJLA 3HD5A 1B48A 2B5EA 1MD4A 2NBSA 1TXUA 5KOWA 1BEDA 1GTUA 3GTUA 3D4TA 3L9UA 1T3BA 5CO3A 1SJ6A 9GSSA 4W66A 4OFMA 2VD1A 3ME8A 4ZL8A 1TK8B 3M3MA 4FH8A 4O7HA 1T4ZA 2C8UA 2HRAA 2A4VA 2YZUA 2AUVA 5ID2B 3WT2A 1FOVA 5H5RA 1PKZA 1GL8A 2YJ7A 2N5BA 1AXDA 2FCHA 2IPAA 3DKSA 1O81A 5CP1A 4WBRD 5DAKA 4AKGA 4JE1A 1TU7A 4QL7A 1OE7A 5D9VA 4GXZA 2LJAA 4HQSA 4GQFA 2L57A 4V1Ag 2F3MA 3S9FA 2WDUA 4XS4B 3QAGA 3G9BA 2DSAA 1I5GA 4CHSA 1Z5YE 4MJEA 1UN2A 5BMUB 2MZCA 1K0AA 3F9UA 3TKPA 4E8EA 4DSSB 3VFIA 2H1DA 2HZFA 3GV1A 4KSMA 1DBYA 3M1GA 2GZPA 5DBQA 2YWOA 4K5RA 4MZCA 1AIUA 4IJ3A 1TI3A 4NHZA 1YEXA 2X99A 3SWLA 3IV4A 1U88A 2H0IA 1MDJA 19GSA 2K6VA 1YY7A 3DGQA 3IOSA 1Z6NA 2KOKA 2V6KA 4J57E 1I9DA 3QD9A 4G0IA 4TKYA 2EFDA 1M7TA 1GP1A 1FO5A 3KJYA 2B7JA 2MBSA 2RLIA 18GSA 4TR1A 3L4NA 3VPQA 2V32A 1GTBA 4RI6A 2LSTA 3EU3A 5ELGA 5LNKe 1K0MA 1ZYEA 3GH6A 2MMAA 5D8IA 4EO3A 1XVQA 2DJ1A 1FVKA 5AISA 5A34A 5GZZB 2IL3A 2DIZA 5IOWA 4WXTA 5J4YA 2FNOA 4Q5FA 1ZMAA 2HT9A 1NW2A 4J2FA 4BVYA 1AQWA 1R4WA 5GAPD 2WRTA 4ZXGA 5HQPA 2OACA 1UVZA 3Q19A 2DJKA 3UAPA 2PVQA 5J4VA 3C1RA 1ZYPA 1VGLA 2J23A 1HD2A 1RQMA 4XRAA 1ABAA 2MMOA 1SD9A 1GUKA 2PPTA 5A34B 4IQ1A 2B3SA 3GKMA 3SBCA 3HXSA 4LA1A 3WT1A 2RUEA 3G7YA 4F0BA 1TJDA 4KDXA 3EPTA 1SVOA 1ERUA 4POLA 4ACSA 3HA9A 2M80A 2IN3A 2I3YA 4KB3A 1A0FA 3EE2A 4CW9A 1G6YA 2R37A 2EIQA 4KCAA 1G6WA 1B4PA 2HRFA 1BAYA 3D6IA 1M0UA 1LJRA 5A4VA 2H71A 3HVSA 4OFTA 3P2AA 2FWGA 1PSQA 4IW9A 1ZL9A 4PNFA 5DDLA 2C80A 1HNBA 1R5PA 2YV7A 2HYXA 3HZ8A 4G01A 2DC5A 1PL2A 1SJIA 2H6ZA 1XXUA 4F82A 2C0DA 4NV2A 2GQKA 4AKIA 3TDGA 1CQHA 2HSNA 2IMFA 4MJCA 4ECJA 3GKNA 3TU3B 2M46A 4GTUA 4HUAA 3LGCA 1DE2A 5IMDA 1XCCA 3KD0A 2QC7A 2YN1A 3O6TA 1EV9A 5IOXA 2IWTA 5ECHB 1PD21 2JZRA 2R4VA 4TOPA 1SL0B 3KXOA 2VCWA 3BCKA 2I4AA 4E8HA 2GT5A 2QKEA 3KMOA 1ZZYA 2NVLA 5IMAA 3L9SA 1O8XA 3L78A 3BCIA 4WBJA 1URMA 4F03A 1ILOA 2ZCTA 3C71A 2VLVA 1Z9HA 2KLXA 1G7EA 3U5RE 3FHKA 2PMTA 1QK8A 1K3LA 22GSA 3ZFBA 1GUHA 3FW2A 3IBHA 2LS5A 1B8XA 3GX8A 3QFAC 5AGYA 2VCXA 4O5UA 2FWEA 3KIJA 4YH2A 5HR3A 1PMTA 5ECPB 4LLRA 3E9JB 2JZTA 2LQQA 1C72A 1YKAA 1XVWA 2DMLA 2X49A 4KGIA 4NHWA 6GSXA 5A1NB 2DJ0A 4EDYA 1N8JA 2RIIA 3TRXA 4WR5A 1XOBA 5AIVA 2LTKA 4RQXA 3GHAA 1NHOA 2O5VA 4QMKA 4RI7A 3DVXA 3KH9A 1OC9A 4MNNA 6GSVA 1HNAA 3UIWA 4CY6A 2OBIA 3HJPA 4FQUA 5F05A 1O73A 10GSA 1B9YC 4YQVA 3C1SA 3E3EA 3UEMA 2PERA 2GQLA 3GYKA 2PUKC 4MJAA 1SKRB 3LWAA 4FYBA 4ECIA 1M2AA 3UOMA 2HFDA 2FA4A 4X1UA 4K7OA 3GA4A 4AI6A 2GDRA 3NZNA 2LRTA 1GSYA 4KA0A 2QA1A 2IMEA 3LSZA 3FY7A 1KEBA 4KW6A 4CY8A 4BA7A 2GQMA 2R3XA 1M9AA 2DMMA 2XPDA 3LW9A 5J5NA 4L8EA 1BG5A 4JZQA 4Z2TA 4WKWA 3ZIVA 1O6JA 1XPVA 1H75A 3CBUA 5LD0A 2M72A 4ZBDA 2H1GA 2K9FA 3GKKA 3RHCA 2JACA 3VLNA 4IKHA 2HNLA 3DYRA 2X8CA 3IDVA 5B7CA 3TRQA 1SVMA 5DALB 4EDZA 1SU9A 2LEGA 4OO4A 4ULXA 4N0VA 2HRKA 3GKXA 12GSA 5DJLA 2HSMA 5J47A 1V58A 2B7KA 4GQCA 2K8SA 3GH9A 2UZ8A 4DEJA 3WGDA 5B8BA 4ISDA 1DUGA 5B8AA 5CRWA 2YV9A 2EIOA 2GSTA 5FWGA 3ZITA 1TI1A 2X8HA 3A5IA 3KM6A 2ZUPA 4PUFC 4K6XA 5F07A 5DCHA 2CVBA 5ECMB 1A2MA 1MDIA 4J56E 4G19A 4GF0A 2DLXA 1WP0A 4V1Ap 3ZZXA 14GSA 4MJBA 5JCWA 4YQMA 1U3AA 1USBA 1WIKA 1YEPA 1U3IA 4WEYA 6GSTA 4OCFA 1A8YA 3EMPA 2FGXA 2GZZA 1FB6A 3TKSC 4TR3A 2F51A 3UVHA 2FA8A 1Z7RA 2VM2A 2P5QA 1W4VA 1Y6EA 2OA7A 3C7MA 1V2AA 2DKIA 5DJMA 3APOA 5CAXA 3IA1A 2P5RA 5DCGA 1XZOA 2G2QA 5IMFA 5G2ZA 2WJUA 3ZFLA 2HZEB 3LXTA 2EFHA 5CRGA 3VWXA 3V1WA 1XW9A 2OE3A 2FD3A 1QXHA 2O8VB 1SKSB 4USSA 1TDIA 1OKDA 1YDKA 2VL2A 5A5HA 1B9XC 3M8NA 1TXXA 1K3YA 5INYA 4JRRA 3ZVJA 1GSDA 3ZMLA 1WWJA 5GSSA 2A2RA 1K0CA 1JZRA 1WMJA 4POBA 3QAVA 3KMNA 2TIRA 2YZHA 3IR4A 1SL1B 16GSA 3HZ4A 1K3OA 4GDFA 4K5SA 4P3YB 3HCZA 3FKFA 4G0LA 3GTUB 1A24A 7GSSA 2AAWA 2JL4A 3P90A 3TJFA 5A5HB 5ECOB 2VCQA 3IRAA 3RDWA 2X4AA 4HQZA 1K0BA 2L5LA 5KOXA 5HFKA 1SK1A 1EGRA 1OC8A 2DBCA 3F63A 4MK3A 3ZYWA 1JZWA 1T00A 4NPBA 4Z2UA 1VF4A 4YQUA 5J3RA 2AHEA 4XHMA 2VUPA 3IK7A 5AN1A 1SK2A 2IMKA 2CT6A 1X5CA 5DAKB 1TRWA 3EYTA 3KP9A 1OYJA 4PQIA 2R6KA 1TP9A 4Z7XA 1TK5B 2C0EA 1OVNA 1PGTA 2YJHA 3D0ZA 3D21A 5JCGA 1GSSA 3QPMA 5CRHA 2Z9SA 4IVFA 5AIXA 1VRSD 3L0HA 2EFEA 1V98A 2TRXA 4GLTA 2YP6A 4TXOA 1Z7PA 1PA3A 3GSSA 5GSTA 1F2EA 3F8UA 2AYTA 5IMVA 3IE3A 3EURA 1W89A 3UJ1A 5G31A 1GTIA 4IGJA 2WFCA 2H0GA 2C3NA 3PINA 2H19A 1VF3A 3CTFA 2VAFA 4GSNA 2H72A 5IPGA 1AC1A 3HYPA 4ILFA 2DJJA 5J4UA 3DWVA 4TR1B 2KP2A 1AAZA 4I6XA 1ON4A 2QGVA 3HKRA 4Z2RA 3VWWA 2LQOA 6GSSA 1TRSA 4AKXB 3IK9A 3KTBA 3QOUA 3RPNA 2VM1A 13GSA 2HQTA 4HDEA 3ZMKA 5G5FA 2B1KA 1M2BA 4I5QA 4BVYB 1ERVA 4AJ8A 1TW9A 2O85A 3QMXA 4HI7A 3UL3A 3CSJA 2L5OA 3F4RA 1ZGNA 2GT6A 5F0GA 2GSQA 1AUCA 2FWFA 4KAEA 4NWYA 1PN9A 3ERFA 3HDCA 3PPUA 4YKFA 3M0FA 2PU9C 2XBQA 1XW5A 2OE1A 1EWXA 1GLPA 1OE8A 1TRUA 2C0FA 2QA2A 5D96A 2L4QA 3F4SA 3TJJA 1ML6A 5E59A 2AJQB 2X64A 2PBJA 1S3CA 3M9JA 4V2NA 3Q6OA 4MF6A 4WETA 1FOHA 4F9ZA 3VI7A 2RUFA 3IHGA 2H74A 6GSYA 11GSA 4OO5A 3CXGA 5H5SA 5CRDA 1S3DA 4AJ6A 3Q18A 2YNXA 2C3TA 3VK9A 2HE3A 2OBKA 2F9SA 3LYPA 3N9JA 3MIXA 4TW5A 2FHEA 1B4QA 3QDNA 4L0UA 4CDOA 5A4UA 1YQ1A 4WR4A 4LL4B 1ST9A 1XWCA 3APQA 5D9XA 3LORA 2I81A 2EIRA 5DVBA 4IP6A 3FRCA 2P0GA 2HSNB 1X9MB 1FVJA 4I2TA 4X4JA 2OADA 4EE0A 4XS1A 5KN1A 1R5AA 1EZKA 4N3ZA 4N0ZA 4QL9A 1TRVA 4OWYA 4PUAA 3TOUA 3PH9A 4JU5A 4XS6A 3TJKA 3GL5A 3GIXA 3RBTA 5KN0A 4LMWA 3A2WA 2JZSA 1BX9A 4ZB7A 5LCZA 2YPMA 1V40A 4OFNA 2VIMA 4POMA 2F8AA 3CYNA 4NV5A 1GULA 3EVIA 3LG6A 2OE0A 3IHQA 3CMIA 4V2LA 5CNWA 2CA8A 4K8MA 3BOAA 2ON5A 1GNWA 4AGSA 2H0HA 5GAND 4E68A 1RK4A 4BWSA 2IMIA 2HXKA 3ERGA 2DIYA 1FW1A 3QAWA 1QGVA 2X8GA 3NIVA 1PX7A 5HR0A 1GRXA 4L0WA 4WF4A 4K7IA 4TVEA 2UV8G 1O7UA 1SVLA 3UMAA 3VURA 5B6MA 2GS3A 5CYYA 3H93A 2R0GA 2CQ9A 2P31A 3I9V2 4YAPA 5KEJA 4Q5QA 5EPFA 1Y1UA 2F8FA 2L59A 5G1LA 1KBNA 3VWUA 3DIEA 3GMFA 3DD3A 1KNGA 4D73A 2VCTA 1THXA 5KN3A 1U87A 5ENUA 4PQ1A 3O76A 3N5OA 4ML6A 5EY6A 3HVVA 1X5DA 4ZB9A 4KF9A 2R2JA 2N5FA 1OC9B 2GGTA 2LKUA 3KZQA 2YWMA 2GLRA 3GNJA 6GSWA 4HS1A 3ZIJA 4EKZA 5EVOA 2WGRA 4BL7A 4H86A 4MCUA 3DXBA 4ID0A 1VF2A 4DSRA 5IQYA 2RM5A 2B1LA 5DQYA 5IM9A 4IJIA 4D73B 4X0XA 5ECLB 1OKTA 3QR6A 3VI5A 1J08A 4ZL9A 1OC3A 2MBTA 2IFQA 4ECCA 5FT3A 2IJYA 1SL2B 5ECSA 3TJGA 5IO2A 4N10A 1XWBA 2HSYA 1EV4A 1JLVA 2YWNA 5E4WA 20GSA 4HU7A 3CTGA 4KX4A 3DRNA 3F3QA 4ZB8A 5G1KA 2VO4A 3EMXA 3D5JA 4IELA 3RHBA 1ACVA 2CVKA 4BVXA 3LXZA 2E0QA 5A4WA 2GZYA 2PVOC 4K0NA 3IC4A 1YKCA 4DSQA 1U6TA 2YCDA 4KNDA 2VL3A 4L5OA 2TRCP 3EINA 2L6DA 3ME7A 3WD6A 4DVCA 2XBIA 3BJ5A 2BJXA 3MSZA 1TU8A 5DQSA 3GFKA 1XOAA 3MAKA 2DJ3A 3GX0A 2HRKB 1BG1A 4MP4A 1LBKA 3FZ9A 1TKDB 1FB0A 5IMCA 2HSMB 3I6AA 3F0IA 2LNTA 1NSWA 4FIWA 1AW9A 2E2GA 1RW1A 5JWRB 3F3RA 1FG4A 4GWRA 1E2YA 4MZBA 3QFBC 4KDYA 1TK0B 3ZTLA 1VF1A 1DE1A 2C3QA 2ZNMA 1GSEA 4IP1A 2LUSA 5ABRA 3CRUA 4X43A 17GSA 1H4OA 4OMVA 5A5KA 2ON7A 3GL3A 1A2JA 3TCOA 3KH7A 3A2VA 1PL1A 2YWIA 1PX6A 1K0NA 2GSSA 1YF0A 5H5QA 4KE3A 3CWGA 4PGTA 1ZCPA 1BF5A 3RPPA 4IS0A 2LJKA 2CX3A 5ID2A 4TR0A 1XIYA 1TTZA 1JLWA 2VKZG 1K0DA 3ISOA 2C4JA 1A23A 2CVDA 3IPZA 1M99A 5J9CA 2CZ3A 4FYCA 4PX1A 2LV3A 1ZOFA 3TB2A 4G9HA 1S3AA 2CAQA 2FLSA 4KH7A 1WRYA 1E6BA 4YAVA 4XS4A 4GSSA 2CZ2A 3CRTA 3R3EA 4O5RA 5IPHA 2HI7A 3J7Yb 2VL9A 1WOUA 5BMUA 3WGXA 2EFCA 3H79A 2WB9A 4DSSA 4ML1A 2H01A 1MDKA 2I9HA 1XW6A 3KTLA 5B6NA 1JHBA 4MF5A 4WF5A 5COHA 2XPEA 4TR4A 3IXRA 1FHEA 1EEJA 1O8WA 1A2LA 1WJKA 2H6XA 3H1NA 1YF1A 1ERWA 5F8BA 2E7PA 4FYUA 3IC8A 3D4MA 3IAS2 3C8EA 4HJ2A 4MPGA 1GWCA 5JCUA 1R26A 4ZB6A 1SD8A 4ECBA 1GH2A 3M9KA 3TKQA 1BYEA 1Q98A 2MMNA 1MEKA 3F4TA 1KTEA 1O85A 2CX4A 2A2PA 2VL2C 2WS2A 1G0TA 3US3A 1M9BA 4POKA 3G7IA 2PN8A 1XWAA 3TJBA 1PRXA 2ES7A 4PURA 3ZLPA 4GCIA 4HZ4A 2HRNA 2DJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SK0 A;  4Q5N A;  4TXO B;  2AV4 A;  2H70 A;  3UBL A;  2NPB A;  2LJR A;  1M2D A;  2XHF A;  3DML A;  4IHU A;  4O92 A;  3LEF A;  3P8W A;  1GUM A;  3TKS E;  3UAR A;  3MDK A;  4MPF A;  3ERW A;  4G0K A;  4HU9 A;  4EXJ A;  4ZIL A;  3E0U A;  1HYU A;  1T7P B;  2V41 A;  3VWV A;  4MH2 A;  2C1Y A;  2HLS A;  3MWH A;  5HR1 A;  4HOJ A;  2JSY A;  1PKW A;  3K8N A;  3A3T A;  5J41 A;  2KP1 A;  2KUC A;  3FZ5 A;  2VCV A;  4PQH A;  4NXI A;  1XWG A;  1DSB A;  3I43 A;  1F9M A;  4K7N A;  3FZA A;  3EU4 A;  4EL1 A;  4QQ7 A;  2LNS A;  2L4C A;  4IQA A;  2BTO T;  5ECR B;  1Q4J A;  2K8V A;  2C0G A;  2V1M A;  4XTS A;  2B5X A;  5D73 A;  1Z6M A;  4KUN A;  4NMU A;  5C00 A;  2MMZ A;  1SYX A;  5L71 A;  3O3T A;  1XWK A;  2AB6 A;  1T1V A;  2REM A;  3F6F A;  3DEX A;  2I1U A;  5KN2 A;  3AY8 A;  3KGK A;  6GSU A;  3LJR A;  3W8S A;  2VLU A;  1EGO A;  2OKA A;  2WUL A;  4JBB A;  1T8E B;  2B6M A;  4N30 A;  2FWH A;  2O89 A;  4FO5 A;  3FR3 A;  1MTC A;  3J7Y k;  4EC0 A;  3KCM A;  3FK8 A;  3TOT A;  1ZYQ B;  4ZBA A;  4XIH A;  2VOC A;  2LRC A;  5EL8 A;  4MZW A;  3KEB A;  3GUS A;  5ECK B;  3ED3 A;  3I69 A;  1UC7 A;  3LFL A;  3ZVJ D;  3GRX A;  4KCE A;  3LYK A;  1UA5 A;  4TRX A;  1GNE A;  2EC4 A;  1IYH A;  3WYW A;  1J9B A;  2IMD A;  5HFI A;  8GSS A;  2ALB A;  4PXO A;  5C04 A;  1SKW B;  4MLY A;  1EOG A;  3BD2 A;  4NAX A;  3BBY A;  1BQ7 A;  3HJM A;  2RM6 A;  4I2U A;  1QQ2 A;  3HY2 A;  4MA9 A;  5IIZ A;  1QUW A;  5J9B A;  4EUY A;  2H75 A;  3A5W A;  4HJM A;  1F6M C;  1JZD A;  1JZO A;  1QFN A;  1EP8 A;  2MYG A;  1LU4 A;  2BMX A;  3P7X A;  5HFG A;  1OAZ A;  4MF7 A;  3TGZ A;  1WPI A;  3H4K A;  2NDO A;  1GSQ A;  2B5Y A;  1X9W B;  3CSH A;  1IYI A;  4AF2 A;  1NHY A;  2H76 A;  1EEM A;  2NTO A;  1THO A;  3FZ4 A;  3WGE A;  1ERT A;  1V9W A;  2J9H A;  4BWQ A;  4ZBB A;  2FY6 A;  3HHV A;  3EC3 A;  3FYG A;  4EF0 A;  2O7K A;  4G10 A;  4AJ7 A;  3UVT A;  1EOH A;  3QCP A;  1J0F A;  3G7J A;  1F3A A;  2GVP A;  2K18 A;  4OCE A;  4HZ2 A;  3GUR A;  2HSH A;  1X5E A;  5FHI A;  5ECN B;  1WE0 A;  2KHP A;  5IMZ A;  1GTA A;  2WCI A;  3ZL5 A;  3LQ7 A;  3U6V A;  2H1B A;  4JR4 A;  4TXV A;  1N2A A;  4G2E A;  1A0R P;  4KDU A;  1GLQ A;  3GST A;  3FR9 A;  5HR2 A;  4TN8 A;  4RUV A;  4N11 A;  1F37 A;  3TUE A;  2H66 A;  3FR6 A;  2V6O A;  2CV4 A;  4MDC A;  2XC2 A;  4F2I A;  3UBK A;  2JSZ A;  1X0R A;  4ZIJ A;  5D9T A;  4XCS A;  3F6D A;  3TRP A;  3IAM 2;  2LRN A;  2A2S A;  2VLT A;  5CRE A;  3W6G A;  5F06 A;  1TOF A;  3D22 A;  3TKS A;  2H1A A;  2WZ9 A;  1SJZ A;  3HJO A;  1EP7 A;  1XFL A;  1CQG A;  3HVX A;  3DVW A;  5DAL A;  1A8L A;  1FAA A;  2VCZ A;  3NOF A;  2YOI A;  4PTS A;  1GSF A;  3RAZ A;  4I8B A;  5ELA A;  3VPT A;  4BL7 B;  1K0O A;  1HQO A;  2FUG 2;  5ECI B;  3A2X A;  2H6Y A;  4IBP A;  4LL1 B;  5ECQ B;  2IIY A;  2H30 A;  3EWL A;  2GSR A;  2E2M A;  3C73 A;  4GST A;  2PWJ A;  2V2G A;  5JWQ B;  2L6C A;  2JAD A;  2IFQ B;  2O87 A;  5IO0 A;  1GSU A;  4EVM A;  1NM3 A;  3TKR A;  4RQR A;  2YAN A;  4MAB A;  1XBS A;  5JWO B;  1YJ6 A;  3W8J A;  2JU5 A;  3PR8 A;  1MD3 A;  1G7O A;  4KSO A;  1BJX A;  2N5A A;  1F3B A;  1T4Y A;  4I97 A;  2GTU A;  4JED A;  4BVX B;  3FEU A;  3Q74 A;  4F0C A;  2QSI A;  3ZRE A;  4K1F A;  4MH3 A;  3JCM L;  1V57 A;  3OR5 A;  1AQV A;  5D9W A;  3CSI A;  1YZX A;  4PNG A;  2D2Z A;  2G0F A;  4ZL7 A;  4LMV A;  1Z3E A;  2HZE A;  3PGT A;  2PGT A;  1SYR A;  4MMM A;  1PQN A;  3GN3 A;  3H8Q A;  4K2D A;  4HEA 2;  4V2M A;  2H73 A;  4K9Z A;  2R5G A;  3APS A;  2CAI A;  4L5L A;  4IN0 A;  1QMV A;  3L9V A;  3MNG A;  1R7H A;  1SEN A;  1JFU A;  4O32 A;  1Y25 A;  3ZRD A;  4BPY A;  5G30 A;  4JR6 A;  1HNC A;  4OD7 A;  4GRF A;  5G5E A;  1AQX A;  4XRD A;  2H8L A;  4Q5R A;  2VD0 A;  5D93 A;  3KP8 A;  3R2Q A;  1X9S B;  4K0G A;  2OJL A;  3HD5 A;  1B48 A;  2B5E A;  1MD4 A;  2NBS A;  1BED A;  1GTU A;  3GTU A;  3D4T A;  3L9U A;  1T3B A;  5CO3 A;  1SJ6 A;  9GSS A;  4OFM A;  2VD1 A;  3ME8 A;  4ZL8 A;  1TK8 B;  3M3M A;  4FH8 A;  4O7H A;  1T4Z A;  2C8U A;  2HRA A;  2A4V A;  2YZU A;  2AUV A;  5ID2 B;  3WT2 A;  1FOV A;  5H5R A;  1PKZ A;  1GL8 A;  2YJ7 A;  2N5B A;  1AXD A;  2FCH A;  2IPA A;  3DKS A;  1O81 A;  5CP1 A;  4WBR D;  5DAK A;  4JE1 A;  1TU7 A;  4QL7 A;  1OE7 A;  5D9V A;  4GXZ A;  2LJA A;  4HQS A;  4GQF A;  2L57 A;  4V1A g;  2F3M A;  3S9F A;  2WDU A;  4XS4 B;  3QAG A;  3G9B A;  2DSA A;  1I5G A;  4CHS A;  1Z5Y E;  4MJE A;  1UN2 A;  2MZC A;  1K0A A;  3F9U A;  3TKP A;  4E8E A;  4DSS B;  3VFI A;  2H1D A;  2HZF A;  3GV1 A;  4KSM A;  1DBY A;  3M1G A;  2GZP A;  5DBQ A;  2YWO A;  4MZC A;  1AIU A;  4IJ3 A;  1TI3 A;  4NHZ A;  1YEX A;  2X99 A;  3SWL A;  3IV4 A;  1U88 A;  2H0I A;  1MDJ A;  19GS A;  2K6V A;  1YY7 A;  3DGQ A;  3IOS A;  1Z6N A;  2KOK A;  2V6K A;  4J57 E;  1I9D A;  3QD9 A;  4G0I A;  4TKY A;  1M7T A;  1GP1 A;  1FO5 A;  3KJY A;  2B7J A;  2MBS A;  2RLI A;  18GS A;  4TR1 A;  3L4N A;  3VPQ A;  2V32 A;  1GTB A;  4RI6 A;  2LST A;  3EU3 A;  5ELG A;  5LNK e;  1K0M A;  1ZYE A;  3GH6 A;  2MMA A;  5D8I A;  4EO3 A;  1XVQ A;  2DJ1 A;  1FVK A;  5AIS A;  5GZZ B;  2IL3 A;  2DIZ A;  5IOW A;  4WXT A;  1ZMA A;  2FNO A;  4Q5F A;  2HT9 A;  1NW2 A;  4J2F A;  4BVY A;  1AQW A;  1R4W A;  5GAP D;  2WRT A;  4ZXG A;  5HQP A;  2OAC A;  1UVZ A;  3Q19 A;  2DJK A;  3UAP A;  2PVQ A;  3C1R A;  1VGL A;  2J23 A;  1HD2 A;  1RQM A;  4XRA A;  1ABA A;  2MMO A;  1SD9 A;  1GUK A;  2PPT A;  4IQ1 A;  2B3S A;  3GKM A;  3SBC A;  3HXS A;  4LA1 A;  3WT1 A;  2RUE A;  3G7Y A;  4F0B A;  1TJD A;  4KDX A;  1ERU A;  4POL A;  4ACS A;  3HA9 A;  2M80 A;  2IN3 A;  2I3Y A;  4KB3 A;  1A0F A;  3EE2 A;  4CW9 A;  1G6Y A;  2R37 A;  2EIQ A;  4KCA A;  1G6W A;  1B4P A;  2HRF A;  1BAY A;  3D6I A;  1M0U A;  1LJR A;  5A4V A;  2H71 A;  3HVS A;  4OFT A;  3P2A A;  2FWG A;  1PSQ A;  4IW9 A;  1ZL9 A;  4PNF A;  5DDL A;  2C80 A;  1HNB A;  1R5P A;  2YV7 A;  2HYX A;  3HZ8 A;  2DC5 A;  1PL2 A;  1SJI A;  2H6Z A;  1XXU A;  4F82 A;  2C0D A;  4NV2 A;  2GQK A;  3TDG A;  1CQH A;  2IMF A;  4MJC A;  4ECJ A;  3GKN A;  2M46 A;  4GTU A;  4HUA A;  3LGC A;  1DE2 A;  5IMD A;  1XCC A;  3KD0 A;  2QC7 A;  2YN1 A;  3O6T A;  1EV9 A;  5IOX A;  2IWT A;  5ECH B;  1PD2 1;  2JZR A;  2R4V A;  4TOP A;  1SL0 B;  3KXO A;  2VCW A;  3BCK A;  2I4A A;  4E8H A;  2GT5 A;  2QKE A;  3KMO A;  1ZZY A;  2NVL A;  5IMA A;  3L9S A;  1O8X A;  3L78 A;  3BCI A;  4WBJ A;  1URM A;  4F03 A;  1ILO A;  2ZCT A;  3C71 A;  2VLV A;  1Z9H A;  2KLX A;  1G7E A;  3U5R E;  3FHK A;  2PMT A;  1QK8 A;  1K3L A;  22GS A;  3ZFB A;  1GUH A;  3FW2 A;  3IBH A;  2LS5 A;  1B8X A;  3GX8 A;  3QFA C;  5AGY A;  2VCX A;  2FWE A;  3KIJ A;  4YH2 A;  5HR3 A;  1PMT A;  5ECP B;  4LLR A;  3E9J B;  2JZT A;  2LQQ A;  1C72 A;  1YKA A;  1XVW A;  2DML A;  4KGI A;  4NHW A;  6GSX A;  2DJ0 A;  4EDY A;  1N8J A;  2RII A;  3TRX A;  4WR5 A;  1XOB A;  5AIV A;  2LTK A;  4RQX A;  3GHA A;  1NHO A;  4RI7 A;  3DVX A;  3KH9 A;  1OC9 A;  6GSV A;  1HNA A;  3UIW A;  2OBI A;  3HJP A;  4FQU A;  5F05 A;  1O73 A;  10GS A;  1B9Y C;  4YQV A;  3C1S A;  3E3E A;  3UEM A;  2PER A;  2GQL A;  3GYK A;  2PUK C;  4MJA A;  1SKR B;  3LWA A;  4FYB A;  4ECI A;  1M2A A;  3UOM A;  2HFD A;  2FA4 A;  4X1U A;  4K7O A;  3GA4 A;  2GDR A;  3NZN A;  2LRT A;  1GSY A;  4KA0 A;  2IME A;  3LSZ A;  3FY7 A;  1KEB A;  4KW6 A;  4BA7 A;  2GQM A;  2R3X A;  1M9A A;  2DMM A;  2XPD A;  5J5N A;  4L8E A;  1BG5 A;  4JZQ A;  4WKW A;  3ZIV A;  1O6J A;  1XPV A;  1H75 A;  3CBU A;  5LD0 A;  2M72 A;  4ZBD A;  2H1G A;  2K9F A;  3GKK A;  3RHC A;  2JAC A;  3VLN A;  4IKH A;  2HNL A;  3DYR A;  2X8C A;  3IDV A;  5B7C A;  3TRQ A;  5DAL B;  4EDZ A;  1SU9 A;  2LEG A;  4OO4 A;  4ULX A;  4N0V A;  2HRK A;  3GKX A;  12GS A;  5DJL A;  2HSM A;  1V58 A;  2B7K A;  4GQC A;  2K8S A;  3GH9 A;  2UZ8 A;  4DEJ A;  3WGD A;  5B8B A;  4ISD A;  1DUG A;  5B8A A;  5CRW A;  2YV9 A;  2EIO A;  2GST A;  5FWG A;  3ZIT A;  1TI1 A;  2X8H A;  3KM6 A;  2ZUP A;  4PUF C;  4K6X A;  5F07 A;  5DCH A;  2CVB A;  5ECM B;  1A2M A;  1MDI A;  4J56 E;  4G19 A;  4GF0 A;  2DLX A;  1WP0 A;  4V1A p;  3ZZX A;  14GS A;  4MJB A;  5JCW A;  4YQM A;  1U3A A;  1USB A;  1WIK A;  1YEP A;  1U3I A;  4WEY A;  6GST A;  4OCF A;  1A8Y A;  3EMP A;  2FGX A;  2GZZ A;  1FB6 A;  3TKS C;  4TR3 A;  2F51 A;  3UVH A;  2FA8 A;  1Z7R A;  2VM2 A;  2P5Q A;  1W4V A;  1Y6E A;  2OA7 A;  3C7M A;  1V2A A;  5DJM A;  3APO A;  5CAX A;  3IA1 A;  2P5R A;  5DCG A;  1XZO A;  2G2Q A;  5IMF A;  5G2Z A;  2WJU A;  3ZFL A;  2HZE B;  3LXT A;  5CRG A;  3VWX A;  3V1W A;  1XW9 A;  2OE3 A;  2FD3 A;  1QXH A;  2O8V B;  1SKS B;  4USS A;  1TDI A;  1OKD A;  1YDK A;  2VL2 A;  1B9X C;  3M8N A;  1TXX A;  1K3Y A;  5INY A;  4JRR A;  3ZVJ A;  1GSD A;  3ZML A;  1WWJ A;  5GSS A;  2A2R A;  1K0C A;  1JZR A;  1WMJ A;  4POB A;  3QAV A;  3KMN A;  2TIR A;  2YZH A;  3IR4 A;  1SL1 B;  16GS A;  3HZ4 A;  1K3O A;  4P3Y B;  3HCZ A;  3FKF A;  4G0L A;  3GTU B;  1A24 A;  7GSS A;  2AAW A;  2JL4 A;  3P90 A;  3TJF A;  5ECO B;  2VCQ A;  3IRA A;  3RDW A;  4HQZ A;  1K0B A;  2L5L A;  5HFK A;  1SK1 A;  1EGR A;  1OC8 A;  2DBC A;  3F63 A;  4MK3 A;  3ZYW A;  1JZW A;  1T00 A;  4NPB A;  1VF4 A;  4YQU A;  5J3R A;  2AHE A;  4XHM A;  2VUP A;  3IK7 A;  5AN1 A;  1SK2 A;  2IMK A;  2CT6 A;  1X5C A;  5DAK B;  1TRW A;  3EYT A;  3KP9 A;  1OYJ A;  4PQI A;  2R6K A;  1TP9 A;  4Z7X A;  1TK5 B;  2C0E A;  1OVN A;  1PGT A;  2YJH A;  3D0Z A;  3D21 A;  5JCG A;  1GSS A;  3QPM A;  5CRH A;  2Z9S A;  4IVF A;  5AIX A;  1VRS D;  3L0H A;  1V98 A;  2TRX A;  4GLT A;  2YP6 A;  4TXO A;  1Z7P A;  1PA3 A;  3GSS A;  5GST A;  1F2E A;  3F8U A;  2AYT A;  5IMV A;  3IE3 A;  3EUR A;  1W89 A;  3UJ1 A;  5G31 A;  1GTI A;  4IGJ A;  2WFC A;  2H0G A;  2C3N A;  3PIN A;  2H19 A;  1VF3 A;  3CTF A;  2VAF A;  4GSN A;  2H72 A;  5IPG A;  1AC1 A;  3HYP A;  4ILF A;  2DJJ A;  5J4U A;  3DWV A;  4TR1 B;  2KP2 A;  1AAZ A;  4I6X A;  1ON4 A;  2QGV A;  3HKR A;  3VWW A;  2LQO A;  6GSS A;  1TRS A;  3IK9 A;  3KTB A;  3QOU A;  3RPN A;  2VM1 A;  13GS A;  2HQT A;  4HDE A;  3ZMK A;  5G5F A;  2B1K A;  1M2B A;  4I5Q A;  4BVY B;  1ERV A;  4AJ8 A;  1TW9 A;  2O85 A;  3QMX A;  4HI7 A;  3UL3 A;  3CSJ A;  2L5O A;  3F4R A;  1ZGN A;  2GT6 A;  5F0G A;  2GSQ A;  1AUC A;  2FWF A;  4KAE A;  4NWY A;  1PN9 A;  3ERF A;  3HDC A;  3PPU A;  3M0F A;  2PU9 C;  2XBQ A;  1XW5 A;  2OE1 A;  1EWX A;  1GLP A;  1OE8 A;  1TRU A;  2C0F A;  5D96 A;  2L4Q A;  3F4S A;  3TJJ A;  1ML6 A;  5E59 A;  2AJQ B;  2X64 A;  2PBJ A;  1S3C A;  3M9J A;  4V2N A;  3Q6O A;  4MF6 A;  4WET A;  4F9Z A;  3VI7 A;  2RUF A;  2H74 A;  6GSY A;  11GS A;  4OO5 A;  3CXG A;  5H5S A;  5CRD A;  1S3D A;  4AJ6 A;  3Q18 A;  2YNX A;  2C3T A;  3VK9 A;  2HE3 A;  2OBK A;  2F9S A;  3LYP A;  3N9J A;  4TW5 A;  2FHE A;  1B4Q A;  3QDN A;  4L0U A;  4CDO A;  5A4U A;  1YQ1 A;  4WR4 A;  4LL4 B;  1ST9 A;  1XWC A;  3APQ A;  5D9X A;  3LOR A;  2I81 A;  2EIR A;  5DVB A;  4IP6 A;  3FRC A;  2P0G A;  2HSN B;  1X9M B;  1FVJ A;  4I2T A;  2OAD A;  4EE0 A;  4XS1 A;  5KN1 A;  1R5A A;  1EZK A;  4N0Z A;  4QL9 A;  1TRV A;  4OWY A;  4PUA A;  3TOU A;  3PH9 A;  4JU5 A;  4XS6 A;  3TJK A;  3GL5 A;  3GIX A;  3RBT A;  5KN0 A;  4LMW A;  3A2W A;  2JZS A;  1BX9 A;  5LCZ A;  2YPM A;  1V40 A;  4OFN A;  2VIM A;  4POM A;  2F8A A;  3CYN A;  4NV5 A;  1GUL A;  3EVI A;  3LG6 A;  2OE0 A;  3IHQ A;  3CMI A;  4V2L A;  5CNW A;  2CA8 A;  4K8M A;  3BOA A;  2ON5 A;  1GNW A;  4AGS A;  2H0H A;  5GAN D;  1RK4 A;  4BWS A;  2IMI A;  2HXK A;  3ERG A;  2DIY A;  1FW1 A;  3QAW A;  1QGV A;  2X8G A;  3NIV A;  1PX7 A;  5HR0 A;  1GRX A;  4L0W A;  4WF4 A;  4K7I A;  4TVE A;  1O7U A;  3UMA A;  3VUR A;  5B6M A;  2GS3 A;  5CYY A;  3H93 A;  2CQ9 A;  2P31 A;  3I9V 2;  4YAP A;  5KEJ A;  4Q5Q A;  5EPF A;  2F8F A;  2L59 A;  5G1L A;  1KBN A;  3VWU A;  3DIE A;  3GMF A;  3DD3 A;  1KNG A;  4D73 A;  2VCT A;  1THX A;  5KN3 A;  1U87 A;  5ENU A;  4PQ1 A;  3O76 A;  3N5O A;  4ML6 A;  5EY6 A;  3HVV A;  1X5D A;  4ZB9 A;  4KF9 A;  2R2J A;  2N5F A;  1OC9 B;  2GGT A;  2LKU A;  3KZQ A;  2YWM A;  2GLR A;  3GNJ A;  6GSW A;  4HS1 A;  3ZIJ A;  4EKZ A;  5EVO A;  2WGR A;  4BL7 A;  4H86 A;  4MCU A;  3DXB A;  4ID0 A;  1VF2 A;  4DSR A;  5IQY A;  2RM5 A;  2B1L A;  5DQY A;  5IM9 A;  4IJI A;  4D73 B;  4X0X A;  5ECL B;  1OKT A;  3QR6 A;  3VI5 A;  1J08 A;  4ZL9 A;  1OC3 A;  2MBT A;  2IFQ A;  4ECC A;  5FT3 A;  2IJY A;  1SL2 B;  5ECS A;  3TJG A;  5IO2 A;  4N10 A;  1XWB A;  2HSY A;  1EV4 A;  1JLV A;  2YWN A;  5E4W A;  20GS A;  4HU7 A;  3CTG A;  4KX4 A;  3DRN A;  3F3Q A;  4ZB8 A;  5G1K A;  2VO4 A;  3EMX A;  3D5J A;  4IEL A;  3RHB A;  1ACV A;  2CVK A;  4BVX A;  3LXZ A;  2E0Q A;  5A4W A;  2GZY A;  2PVO C;  4K0N A;  3IC4 A;  1YKC A;  4DSQ A;  1U6T A;  2YCD A;  4KND A;  2VL3 A;  4L5O A;  2TRC P;  3EIN A;  2L6D A;  3ME7 A;  3WD6 A;  4DVC A;  2XBI A;  3BJ5 A;  2BJX A;  3MSZ A;  1TU8 A;  5DQS A;  3GFK A;  1XOA A;  3MAK A;  2DJ3 A;  3GX0 A;  2HRK B;  3FZ9 A;  4MP4 A;  1LBK A;  1TKD B;  1FB0 A;  5IMC A;  2HSM B;  3I6A A;  3F0I A;  2LNT A;  1NSW A;  4FIW A;  1AW9 A;  2E2G A;  1RW1 A;  5JWR B;  3F3R A;  1FG4 A;  4GWR A;  1E2Y A;  4MZB A;  3QFB C;  4KDY A;  1TK0 B;  3ZTL A;  1VF1 A;  1DE1 A;  2C3Q A;  2ZNM A;  1GSE A;  4IP1 A;  2LUS A;  5ABR A;  3CRU A;  4X43 A;  17GS A;  1H4O A;  4OMV A;  5A5K A;  2ON7 A;  3GL3 A;  1A2J A;  3TCO A;  3KH7 A;  3A2V A;  1PL1 A;  2YWI A;  1PX6 A;  1K0N A;  2GSS A;  1YF0 A;  5H5Q A;  4KE3 A;  4PGT A;  1ZCP A;  3RPP A;  4IS0 A;  2LJK A;  2CX3 A;  5ID2 A;  4TR0 A;  1XIY A;  1TTZ A;  1JLW A;  1K0D A;  3ISO A;  2C4J A;  1A23 A;  2CVD A;  3IPZ A;  1M99 A;  5J9C A;  2CZ3 A;  4FYC A;  4PX1 A;  2LV3 A;  1ZOF A;  3TB2 A;  4G9H A;  1S3A A;  2CAQ A;  2FLS A;  4KH7 A;  1WRY A;  1E6B A;  4YAV A;  4XS4 A;  4GSS A;  2CZ2 A;  3CRT A;  3R3E A;  4O5R A;  5IPH A;  2HI7 A;  3J7Y b;  2VL9 A;  1WOU A;  5BMU A;  3WGX A;  3H79 A;  2WB9 A;  4DSS A;  4ML1 A;  2H01 A;  1MDK A;  2I9H A;  1XW6 A;  3KTL A;  5B6N A;  1JHB A;  4MF5 A;  4WF5 A;  5COH A;  2XPE A;  4TR4 A;  3IXR A;  1FHE A;  1EEJ A;  1O8W A;  1A2L A;  1WJK A;  2H6X A;  3H1N A;  1YF1 A;  1ERW A;  5F8B A;  2E7P A;  4FYU A;  3IC8 A;  3D4M A;  3IAS 2;  3C8E A;  4HJ2 A;  4MPG A;  1GWC A;  5JCU A;  1R26 A;  4ZB6 A;  1SD8 A;  4ECB A;  1GH2 A;  3M9K A;  3TKQ A;  1BYE A;  1Q98 A;  2MMN A;  1MEK A;  3F4T A;  1KTE A;  1O85 A;  2CX4 A;  2VL2 C;  2WS2 A;  1G0T A;  3US3 A;  1M9B A;  4POK A;  3G7I A;  2PN8 A;  1XWA A;  3TJB A;  1PRX A;  2ES7 A;  4PUR A;  3ZLP A;  4GCI A;  4HZ4 A;  2HRN A;  2DJ2 A; 
#chains in the Genus database with same CATH topology
 1SK0 A;  4Q5N A;  4TXO B;  2AV4 A;  2H70 A;  3UBL A;  2NPB A;  2LJR A;  1M2D A;  2XHF A;  3DML A;  4IHU A;  4O92 A;  3LEF A;  3P8W A;  1GUM A;  1YVL A;  3TKS E;  3UAR A;  3MDK A;  4MPF A;  3ERW A;  4G0K A;  4HU9 A;  4EXJ A;  4ZIL A;  3E0U A;  1HYU A;  1T7P B;  2V41 A;  3VWV A;  4MH2 A;  2C1Y A;  2HLS A;  3MWH A;  5HR1 A;  4HOJ A;  2JSY A;  1PKW A;  3K8N A;  5BRT A;  3A3T A;  5J41 A;  2KP1 A;  2KUC A;  3FZ5 A;  2VCV A;  4PQH A;  4NXI A;  1XWG A;  1DSB A;  3I43 A;  1F9M A;  4K7N A;  3FZA A;  3EU4 A;  4EL1 A;  4QQ7 A;  2LNS A;  2L4C A;  4IQA A;  2BTO T;  5ECR B;  1Q4J A;  2K8V A;  2C0G A;  2V1M A;  4XTS A;  1ZYN A;  2B5X A;  5D73 A;  1Z6M A;  4KUN A;  4NMU A;  5C00 A;  2MMZ A;  1SYX A;  5L71 A;  2DKH A;  3O3T A;  1XWK A;  2AB6 A;  1T1V A;  2REM A;  3F6F A;  3DEX A;  4A5P A;  2I1U A;  5KN2 A;  3AY8 A;  1N25 A;  3KGK A;  6GSU A;  3LJR A;  2A4H A;  3W8S A;  2VLU A;  3HMJ G;  1EGO A;  2OKA A;  2WUL A;  4JBB A;  1T8E B;  2B6M A;  4ICY A;  4N30 A;  2FWH A;  2O89 A;  4FO5 A;  3FR3 A;  1MTC A;  3J7Y k;  4EC0 A;  2WW1 A;  3KCM A;  3FK8 A;  3TOT A;  1ZYQ B;  4ZBA A;  4XIH A;  2VOC A;  2LRC A;  5EL8 A;  4MZW A;  3KEB A;  4EIQ A;  3GUS A;  5ECK B;  3ED3 A;  3I69 A;  1UC7 A;  4YKG A;  3LFL A;  3ZVJ D;  3GRX A;  4KCE A;  3LYK A;  1UA5 A;  4TRX A;  1GNE A;  2EC4 A;  1IYH A;  3WYW A;  1J9B A;  2IMD A;  5HFI A;  1S3R A;  8GSS A;  2ALB A;  4PXO A;  5C04 A;  1SKW B;  4MLY A;  1EOG A;  3BD2 A;  2OT3 A;  4NAX A;  3BBY A;  1BQ7 A;  3HJM A;  2RM6 A;  4I2U A;  1QQ2 A;  3HY2 A;  4MA9 A;  5IIZ A;  1QUW A;  5A1N A;  3FMW A;  5J9B A;  4EUY A;  2H75 A;  3A5W A;  4HJM A;  2WVX B;  1F6M C;  1JZD A;  1JZO A;  1QFN A;  1EP8 A;  2MYG A;  1LU4 A;  2BMX A;  3P7X A;  5HFG A;  1OAZ A;  4MF7 A;  3TGZ A;  1WPI A;  3H4K A;  2NDO A;  1GSQ A;  2B5Y A;  1X9W B;  3CSH A;  1IYI A;  2H1L A;  4AF2 A;  1NHY A;  2H76 A;  1EEM A;  2NTO A;  1THO A;  3FZ4 A;  3WGE A;  1ERT A;  1V9W A;  2J9H A;  4BWQ A;  2R0P A;  4ZBB A;  2FY6 A;  1PFO A;  3HHV A;  3EC3 A;  3FYG A;  4EF0 A;  2O7K A;  4G10 A;  4AJ7 A;  3UVT A;  1EOH A;  3QCP A;  1J0F A;  3G7J A;  1F3A A;  2GVP A;  2K18 A;  4OCE A;  4HZ2 A;  3GUR A;  2HSH A;  1X5E A;  5FHI A;  5ECN B;  1WE0 A;  2KHP A;  5IMZ A;  1GTA A;  2WCI A;  3ZL5 A;  3LQ7 A;  3U6V A;  2H1B A;  4JR4 A;  4TXV A;  1N2A A;  4G2E A;  1A0R P;  4KDU A;  1GLQ A;  3GST A;  3FR9 A;  5HR2 A;  4TN8 A;  4RUV A;  4N11 A;  1F37 A;  3TUE A;  2H66 A;  3FR6 A;  2V6O A;  2CV4 A;  4MDC A;  2XC2 A;  4F2I A;  3UBK A;  3MYD A;  2JSZ A;  1X0R A;  4ZIJ A;  5D9T A;  4XCS A;  3F6D A;  3TRP A;  3IAM 2;  2LRN A;  2A2S A;  2VLT A;  5CRE A;  3W6G A;  5F06 A;  1TOF A;  3D22 A;  3TKS A;  2H1A A;  2WZ9 A;  1SJZ A;  3HJO A;  4K2X A;  1EP7 A;  1XFL A;  1CQG A;  3HVX A;  3DVW A;  5DAL A;  1A8L A;  4AKH A;  1FAA A;  2VCZ A;  3NOF A;  2YOI A;  4PTS A;  1GSF A;  3RAZ A;  4I8B A;  5ELA A;  3VPT A;  4BL7 B;  1K0O A;  1HQO A;  2FUG 2;  5ECI B;  3A2X A;  2H6Y A;  4IBP A;  4LL1 B;  5ECQ B;  2IIY A;  2H30 A;  3EWL A;  2GSR A;  2E2M A;  3C73 A;  4GST A;  2PWJ A;  2V2G A;  5JWQ B;  2L6C A;  2JAD A;  2IFQ B;  2O87 A;  5IO0 A;  1GSU A;  4EVM A;  1NM3 A;  4O5Q A;  3TKR A;  4RQR A;  2YAN A;  4MAB A;  1XBS A;  5JWO B;  2WVZ A;  1YJ6 A;  3W8J A;  2JU5 A;  3PR8 A;  1MD3 A;  1G7O A;  4KSO A;  1BJX A;  2N5A A;  1F3B A;  1T4Y A;  4I97 A;  2GTU A;  4JED A;  4BVX B;  3FEU A;  3Q74 A;  5J40 A;  4F0C A;  2QSI A;  3ZRE A;  4K1F A;  4MH3 A;  3JCM L;  1V57 A;  3OR5 A;  1AQV A;  5D9W A;  3CSI A;  4EIP A;  1YZX A;  4PNG A;  2D2Z A;  2G0F A;  4ZL7 A;  4LMV A;  1Z3E A;  2HZE A;  3PGT A;  2PGT A;  1SYR A;  4MMM A;  1PQN A;  3GN3 A;  3H8Q A;  4K2D A;  4HEA 2;  4V2M A;  2H73 A;  4K9Z A;  2R5G A;  3APS A;  2CAI A;  4L5L A;  4IN0 A;  1QMV A;  3L9V A;  3MNG A;  1R7H A;  1SEN A;  1JFU A;  4O32 A;  1Y25 A;  3ZRD A;  4BPY A;  5G30 A;  4JR6 A;  1HNC A;  4OD7 A;  4GRF A;  2R0C A;  5G5E A;  1PN0 A;  1AQX A;  4XRD A;  2H8L A;  4Q5R A;  2VD0 A;  5D93 A;  3KP8 A;  3R2Q A;  1X9S B;  4K0G A;  2OJL A;  3HD5 A;  1B48 A;  2B5E A;  1MD4 A;  2NBS A;  1TXU A;  5KOW A;  1BED A;  1GTU A;  3GTU A;  3D4T A;  3L9U A;  1T3B A;  5CO3 A;  1SJ6 A;  9GSS A;  4W66 A;  2WZS A;  2VD1 A;  4OFM A;  3ME8 A;  4ZL8 A;  1TK8 B;  3M3M A;  4FH8 A;  4O7H A;  1T4Z A;  2C8U A;  2HRA A;  2A4V A;  2YZU A;  2AUV A;  5ID2 B;  3WT2 A;  1FOV A;  5H5R A;  1PKZ A;  1GL8 A;  2YJ7 A;  2N5B A;  1AXD A;  2FCH A;  2IPA A;  3DKS A;  1O81 A;  5CP1 A;  4WBR D;  5DAK A;  4AKG A;  4JE1 A;  1TU7 A;  4QL7 A;  1OE7 A;  5D9V A;  4GXZ A;  2LJA A;  4HQS A;  4GQF A;  2L57 A;  4V1A g;  2F3M A;  3S9F A;  2WDU A;  4XS4 B;  3QAG A;  3G9B A;  2DSA A;  1I5G A;  4CHS A;  1Z5Y E;  4MJE A;  1UN2 A;  5BMU B;  2MZC A;  1K0A A;  3F9U A;  3TKP A;  4E8E A;  4DSS B;  3VFI A;  2H1D A;  2HZF A;  3GV1 A;  4KSM A;  1DBY A;  3M1G A;  2GZP A;  5DBQ A;  2YWO A;  4K5R A;  4MZC A;  1AIU A;  2O3E A;  4IJ3 A;  1TI3 A;  4NHZ A;  1YEX A;  2X99 A;  3SWL A;  3IV4 A;  1U88 A;  2H0I A;  1MDJ A;  19GS A;  2K6V A;  1YY7 A;  3DGQ A;  3IOS A;  1Z6N A;  2KOK A;  2V6K A;  4J57 E;  1I9D A;  3QD9 A;  4G0I A;  4TKY A;  2EFD A;  1M7T A;  1GP1 A;  1FO5 A;  3KJY A;  2B7J A;  2MBS A;  2RLI A;  18GS A;  4TR1 A;  3L4N A;  3VPQ A;  2V32 A;  1GTB A;  4RI6 A;  2LST A;  3EU3 A;  5ELG A;  5LNK e;  1K0M A;  1ZYE A;  3GH6 A;  2MMA A;  5D8I A;  4EO3 A;  1XVQ A;  2DJ1 A;  1FVK A;  5AIS A;  5A34 A;  5GZZ B;  2IL3 A;  2DIZ A;  5IOW A;  4WXT A;  5J4Y A;  2FNO A;  4Q5F A;  1ZMA A;  2HT9 A;  1NW2 A;  4J2F A;  4BVY A;  1AQW A;  1R4W A;  5GAP D;  2WRT A;  4ZXG A;  5HQP A;  2OAC A;  1UVZ A;  3Q19 A;  2DJK A;  3UAP A;  2PVQ A;  5J4V A;  3C1R A;  1ZYP A;  1VGL A;  2J23 A;  1HD2 A;  1RQM A;  4XRA A;  1ABA A;  2MMO A;  1SD9 A;  1GUK A;  2PPT A;  5A34 B;  1S4B P;  4IQ1 A;  2B3S A;  3GKM A;  3SBC A;  3HXS A;  4LA1 A;  3WT1 A;  2RUE A;  3G7Y A;  4F0B A;  1TJD A;  4KDX A;  3EPT A;  1SVO A;  1ERU A;  4POL A;  4ACS A;  3HA9 A;  2M80 A;  2IN3 A;  2I3Y A;  4KB3 A;  1A0F A;  3EE2 A;  4CW9 A;  1G6Y A;  2R37 A;  2EIQ A;  4KCA A;  1G6W A;  1B4P A;  2HRF A;  1BAY A;  3D6I A;  1M0U A;  1LJR A;  5A4V A;  2H71 A;  3HVS A;  4OFT A;  3P2A A;  2FWG A;  1PSQ A;  4IW9 A;  1ZL9 A;  4PNF A;  5DDL A;  2C80 A;  1HNB A;  1R5P A;  2YV7 A;  2HYX A;  3HZ8 A;  4G01 A;  2DC5 A;  1PL2 A;  1SJI A;  2H6Z A;  1XXU A;  4F82 A;  2C0D A;  4NV2 A;  2GQK A;  4AKI A;  3TDG A;  1CQH A;  2HSN A;  2IMF A;  4MJC A;  4ECJ A;  3GKN A;  3TU3 B;  2M46 A;  4GTU A;  4HUA A;  3LGC A;  1DE2 A;  5IMD A;  1XCC A;  3KD0 A;  2QC7 A;  2YN1 A;  3O6T A;  1EV9 A;  5IOX A;  2IWT A;  5ECH B;  1PD2 1;  2JZR A;  2R4V A;  4TOP A;  1SL0 B;  3KXO A;  2VCW A;  3BCK A;  2I4A A;  4E8H A;  2GT5 A;  2QKE A;  3KMO A;  1ZZY A;  2NVL A;  5IMA A;  3L9S A;  1O8X A;  3L78 A;  3BCI A;  4WBJ A;  1URM A;  4F03 A;  1ILO A;  2ZCT A;  3C71 A;  2VLV A;  1Z9H A;  2KLX A;  1G7E A;  3U5R E;  3FHK A;  2PMT A;  1QK8 A;  1K3L A;  22GS A;  3ZFB A;  1GUH A;  3FW2 A;  3IBH A;  2LS5 A;  1B8X A;  3GX8 A;  3QFA C;  5AGY A;  2VCX A;  4O5U A;  2FWE A;  3KIJ A;  4YH2 A;  5HR3 A;  1PMT A;  5ECP B;  4LLR A;  3E9J B;  2JZT A;  2LQQ A;  1C72 A;  1YKA A;  1XVW A;  2DML A;  2X49 A;  4PI0 C;  4KGI A;  4NHW A;  6GSX A;  5A1N B;  2DJ0 A;  4EDY A;  1N8J A;  2RII A;  3TRX A;  4WR5 A;  1XOB A;  5AIV A;  2LTK A;  4RQX A;  3GHA A;  1NHO A;  2O5V A;  4QMK A;  4RI7 A;  3DVX A;  3KH9 A;  1OC9 A;  4MNN A;  6GSV A;  1HNA A;  3UIW A;  4CY6 A;  2OBI A;  3HJP A;  4FQU A;  5F05 A;  1O73 A;  10GS A;  1B9Y C;  4YQV A;  3C1S A;  3E3E A;  3UEM A;  2PER A;  2GQL A;  3GYK A;  2PUK C;  4MJA A;  1SKR B;  3LWA A;  4FYB A;  4ECI A;  1M2A A;  3UOM A;  2HFD A;  2FA4 A;  4X1U A;  4K7O A;  3GA4 A;  4AI6 A;  2GDR A;  3NZN A;  2LRT A;  1GSY A;  4KA0 A;  2QA1 A;  2IME A;  3LSZ A;  3FY7 A;  1KEB A;  4KW6 A;  4CY8 A;  4BA7 A;  2GQM A;  2R3X A;  1M9A A;  2DMM A;  2XPD A;  3LW9 A;  5J5N A;  4L8E A;  1BG5 A;  4JZQ A;  4Z2T A;  4WKW A;  3ZIV A;  1O6J A;  1XPV A;  1H75 A;  3CBU A;  5LD0 A;  2M72 A;  4ZBD A;  2H1G A;  2K9F A;  3GKK A;  3RHC A;  2JAC A;  3VLN A;  4IKH A;  2HNL A;  3DYR A;  2X8C A;  3IDV A;  5B7C A;  3TRQ A;  1SVM A;  5DAL B;  4EDZ A;  1SU9 A;  2LEG A;  3RGB C;  4OO4 A;  4ULX A;  4N0V A;  2HRK A;  3GKX A;  12GS A;  5DJL A;  2HSM A;  5J47 A;  1V58 A;  2B7K A;  4GQC A;  2K8S A;  3GH9 A;  2UZ8 A;  4DEJ A;  3WGD A;  5B8B A;  4ISD A;  1DUG A;  5B8A A;  5CRW A;  2YV9 A;  2EIO A;  2WW2 A;  2GST A;  5FWG A;  3ZIT A;  1TI1 A;  2X8H A;  3A5I A;  3KM6 A;  2ZUP A;  4PUF C;  4K6X A;  3CHX C;  5F07 A;  5DCH A;  2CVB A;  5ECM B;  1A2M A;  1MDI A;  4J56 E;  4G19 A;  4GF0 A;  2DLX A;  1WP0 A;  4V1A p;  3ZZX A;  14GS A;  4MJB A;  5JCW A;  4YQM A;  1U3A A;  1USB A;  1WIK A;  1YEP A;  1U3I A;  4WEY A;  6GST A;  4OCF A;  1A8Y A;  3EMP A;  2FGX A;  2GZZ A;  1FB6 A;  3TKS C;  4TR3 A;  2F51 A;  3UVH A;  2FA8 A;  1Z7R A;  2VM2 A;  2P5Q A;  1W4V A;  1Y6E A;  2OA7 A;  3C7M A;  1V2A A;  2DKI A;  5DJM A;  3APO A;  5CAX A;  3IA1 A;  2P5R A;  5DCG A;  1XZO A;  2G2Q A;  5IMF A;  5G2Z A;  2WJU A;  3ZFL A;  2HZE B;  3LXT A;  2EFH A;  5CRG A;  3VWX A;  3V1W A;  1XW9 A;  2OE3 A;  2FD3 A;  1QXH A;  2O8V B;  1SKS B;  4USS A;  1TDI A;  1OKD A;  1YDK A;  2VL2 A;  5A5H A;  1B9X C;  3M8N A;  1TXX A;  1K3Y A;  5INY A;  4JRR A;  3ZVJ A;  1GSD A;  3ZML A;  1WWJ A;  5GSS A;  2A2R A;  1K0C A;  1JZR A;  1M3I A;  1WMJ A;  4POB A;  3QAV A;  3KMN A;  2TIR A;  2YZH A;  2WVY A;  3IR4 A;  1SL1 B;  16GS A;  3HZ4 A;  1K3O A;  4GDF A;  4K5S A;  4P3Y B;  3HCZ A;  3FKF A;  4G0L A;  3GTU B;  1A24 A;  7GSS A;  2AAW A;  2O36 A;  2JL4 A;  3P90 A;  3TJF A;  5A5H B;  5ECO B;  2VCQ A;  3IRA A;  3RDW A;  2X4A A;  4HQZ A;  1K0B A;  2L5L A;  5KOX A;  5HFK A;  1SK1 A;  3CQF A;  1EGR A;  1OC8 A;  2DBC A;  3F63 A;  4MK3 A;  3ZYW A;  1JZW A;  1T00 A;  4NPB A;  4Z2U A;  1VF4 A;  4YQU A;  5J3R A;  2AHE A;  4XHM A;  2VUP A;  3IK7 A;  5AN1 A;  1SK2 A;  2IMK A;  2CT6 A;  1X5C A;  5DAK B;  1TRW A;  3EYT A;  3KP9 A;  1OYJ A;  4PQI A;  2R6K A;  1TP9 A;  4Z7X A;  1TK5 B;  2C0E A;  1OVN A;  1PGT A;  2YJH A;  3D0Z A;  3D21 A;  5JCG A;  1GSS A;  3QPM A;  5CRH A;  2Z9S A;  4IVF A;  5AIX A;  1VRS D;  3L0H A;  2EFE A;  1V98 A;  2TRX A;  4GLT A;  2YP6 A;  4TXO A;  1Z7P A;  1PA3 A;  3GSS A;  5GST A;  1F2E A;  3F8U A;  2AYT A;  5IMV A;  3IE3 A;  3EUR A;  3HVN A;  1W89 A;  3UJ1 A;  5G31 A;  1GTI A;  4IGJ A;  2WFC A;  2H0G A;  2C3N A;  3PIN A;  2H19 A;  1XG8 A;  1VF3 A;  3CTF A;  2VAF A;  4GSN A;  2H72 A;  5IPG A;  1AC1 A;  3HYP A;  4ILF A;  2DJJ A;  5J4U A;  3DWV A;  4TR1 B;  2KP2 A;  1AAZ A;  4I6X A;  1ON4 A;  2QGV A;  3HKR A;  4Z2R A;  3VWW A;  2LQO A;  6GSS A;  1TRS A;  4AKX B;  3IK9 A;  3KTB A;  3QOU A;  3RPN A;  2VM1 A;  13GS A;  2HQT A;  4HDE A;  4FXY P;  3ZMK A;  5G5F A;  2B1K A;  1M2B A;  4I5Q A;  4BVY B;  1ERV A;  4AJ8 A;  1TW9 A;  2O85 A;  3QMX A;  4HI7 A;  3UL3 A;  3CSJ A;  2L5O A;  3F4R A;  1ZGN A;  2GT6 A;  5F0G A;  2GSQ A;  1AUC A;  2FWF A;  4KAE A;  4NWY A;  1PN9 A;  3ERF A;  3HDC A;  3PPU A;  4YKF A;  3M0F A;  2PU9 C;  2XBQ A;  1XW5 A;  2OE1 A;  1EWX A;  1GLP A;  1OE8 A;  1TRU A;  2C0F A;  2QA2 A;  5D96 A;  2L4Q A;  3F4S A;  3TJJ A;  1ML6 A;  5E59 A;  2AJQ B;  2X64 A;  2PBJ A;  1S3C A;  3M9J A;  4V2N A;  3Q6O A;  1I1I P;  4MF6 A;  4WET A;  1FOH A;  4F9Z A;  3VI7 A;  2RUF A;  3IHG A;  2H74 A;  6GSY A;  11GS A;  4OO5 A;  3CXG A;  5H5S A;  5CRD A;  1S3D A;  4AJ6 A;  3Q18 A;  2YNX A;  2C3T A;  3VK9 A;  2HE3 A;  2OBK A;  2F9S A;  3LYP A;  3N9J A;  3MIX A;  4TW5 A;  2FHE A;  1B4Q A;  3QDN A;  4L0U A;  4CDO A;  5A4U A;  1YQ1 A;  4WR4 A;  4LL4 B;  1ST9 A;  1XWC A;  3APQ A;  5D9X A;  3LOR A;  2I81 A;  2EIR A;  5DVB A;  4IP6 A;  3FRC A;  2P0G A;  2HSN B;  1X9M B;  1FVJ A;  4I2T A;  4X4J A;  2OAD A;  4EE0 A;  4XS1 A;  5KN1 A;  1R5A A;  1EZK A;  4N3Z A;  4N0Z A;  2WVX A;  4QL9 A;  1TRV A;  4OWY A;  4PUA A;  3TOU A;  3PH9 A;  4JU5 A;  4XS6 A;  3TJK A;  3GL5 A;  3GIX A;  3RBT A;  5KN0 A;  4LMW A;  3A2W A;  2JZS A;  1BX9 A;  4ZB7 A;  5LCZ A;  2YPM A;  1V40 A;  4OFN A;  2VIM A;  4POM A;  2F8A A;  3CYN A;  4NV5 A;  1GUL A;  3EVI A;  3LG6 A;  2OE0 A;  3IHQ A;  4PI2 C;  3CMI A;  4V2L A;  5CNW A;  2CA8 A;  4K8M A;  3BOA A;  2ON5 A;  1GNW A;  4AGS A;  2H0H A;  5GAN D;  4E68 A;  1RK4 A;  4BWS A;  2IMI A;  2WW3 A;  2HXK A;  3ERG A;  2DIY A;  1FW1 A;  3QAW A;  1QGV A;  2X8G A;  3NIV A;  1PX7 A;  5HR0 A;  1GRX A;  4L0W A;  4WF4 A;  4K7I A;  4TVE A;  2UV8 G;  1O7U A;  1SVL A;  3UMA A;  3VUR A;  5B6M A;  2GS3 A;  5CYY A;  3H93 A;  2R0G A;  2CQ9 A;  2P31 A;  3I9V 2;  4YAP A;  5KEJ A;  4Q5Q A;  5EPF A;  1Y1U A;  1YEW C;  2F8F A;  2L59 A;  5G1L A;  1KBN A;  3VWU A;  3DIE A;  3GMF A;  3DD3 A;  1KNG A;  4D73 A;  2VCT A;  1THX A;  5KN3 A;  1U87 A;  5ENU A;  4PQ1 A;  3O76 A;  3N5O A;  4ML6 A;  5EY6 A;  3HVV A;  1X5D A;  4ZB9 A;  4KF9 A;  2R2J A;  2N5F A;  1OC9 B;  2GGT A;  2LKU A;  3KZQ A;  2YWM A;  2GLR A;  3GNJ A;  6GSW A;  4HS1 A;  3ZIJ A;  4EKZ A;  5EVO A;  2WGR A;  4BL7 A;  4H86 A;  4MCU A;  3DXB A;  4ID0 A;  1VF2 A;  4DSR A;  5IQY A;  2RM5 A;  2B1L A;  5DQY A;  4BIK A;  5IM9 A;  4IJI A;  4D73 B;  4X0X A;  5ECL B;  1OKT A;  3QR6 A;  3VI5 A;  1J08 A;  4ZL9 A;  1OC3 A;  2MBT A;  2IFQ A;  4ECC A;  1M3J A;  5FT3 A;  2IJY A;  1SL2 B;  5ECS A;  3TJG A;  5IO2 A;  4N10 A;  1XWB A;  2HSY A;  1EV4 A;  1JLV A;  2YWN A;  5E4W A;  20GS A;  4HU7 A;  3CTG A;  4PHZ C;  4KX4 A;  3DRN A;  3F3Q A;  4ZB8 A;  5G1K A;  2VO4 A;  3EMX A;  3D5J A;  4IEL A;  3RHB A;  1ACV A;  2CVK A;  4BVX A;  3LXZ A;  2E0Q A;  5A4W A;  2GZY A;  2PVO C;  4K0N A;  3IC4 A;  1YKC A;  4DSQ A;  1U6T A;  2YCD A;  4KND A;  2VL3 A;  4L5O A;  2TRC P;  3EIN A;  2L6D A;  3ME7 A;  3WD6 A;  4DVC A;  2XBI A;  3BJ5 A;  2BJX A;  3MSZ A;  1TU8 A;  5DQS A;  3GFK A;  1XOA A;  3MAK A;  2DJ3 A;  3GX0 A;  2HRK B;  1BG1 A;  4MP4 A;  1LBK A;  3FZ9 A;  1TKD B;  1FB0 A;  5IMC A;  2HSM B;  3I6A A;  3F0I A;  2LNT A;  1NSW A;  4FIW A;  1AW9 A;  2E2G A;  1RW1 A;  5JWR B;  3F3R A;  1FG4 A;  4GWR A;  1E2Y A;  4MZB A;  3QFB C;  4KDY A;  1TK0 B;  3ZTL A;  1VF1 A;  1DE1 A;  2C3Q A;  2ZNM A;  1GSE A;  4IP1 A;  4HSC X;  2LUS A;  5ABR A;  3CRU A;  4X43 A;  17GS A;  1H4O A;  4OMV A;  5A5K A;  2ON7 A;  3GL3 A;  1A2J A;  3TCO A;  3KH7 A;  3A2V A;  1PL1 A;  2YWI A;  1PX6 A;  1K0N A;  2GSS A;  1YF0 A;  5H5Q A;  4KE3 A;  3CWG A;  4PGT A;  1ZCP A;  1BF5 A;  3RPP A;  4IS0 A;  2LJK A;  2CX3 A;  5ID2 A;  4TR0 A;  1XIY A;  1TTZ A;  1JLW A;  2VKZ G;  1K0D A;  3ISO A;  2C4J A;  1A23 A;  2CVD A;  3IPZ A;  1M99 A;  5J9C A;  2CZ3 A;  4FYC A;  4PX1 A;  2LV3 A;  1ZOF A;  3TB2 A;  4G9H A;  1S3A A;  2CAQ A;  2FLS A;  4KH7 A;  1WRY A;  1E6B A;  4YAV A;  4XS4 A;  4GSS A;  2CZ2 A;  3CRT A;  3R3E A;  4O5R A;  5IPH A;  2HI7 A;  3J7Y b;  2VL9 A;  1WOU A;  5BMU A;  3WGX A;  2EFC A;  3H79 A;  2WB9 A;  4DSS A;  4ML1 A;  2H01 A;  1MDK A;  2I9H A;  1XW6 A;  3KTL A;  5B6N A;  1JHB A;  4MF5 A;  4WF5 A;  3RFR C;  5COH A;  2XPE A;  4TR4 A;  3IXR A;  1FHE A;  1EEJ A;  1O8W A;  1A2L A;  1WJK A;  2H6X A;  3H1N A;  1YF1 A;  1ERW A;  5F8B A;  2E7P A;  4FYU A;  3IC8 A;  3D4M A;  3IAS 2;  3C8E A;  4HJ2 A;  4MPG A;  1GWC A;  5JCU A;  1R26 A;  2WW0 A;  4ZB6 A;  1SD8 A;  4ECB A;  1GH2 A;  3M9K A;  3TKQ A;  1BYE A;  1Q98 A;  2MMN A;  1MEK A;  3F4T A;  1KTE A;  1O85 A;  2CX4 A;  2A2P A;  2VL2 C;  2WS2 A;  1G0T A;  3US3 A;  1M9B A;  4POK A;  3G7I A;  2PN8 A;  1XWA A;  3TJB A;  1PRX A;  2ES7 A;  4PUR A;  3ZLP A;  4GCI A;  4HZ4 A;  2HRN A;  2DJ2 A; 
#chains in the Genus database with same CATH homology
 1SK0 A;  4Q5N A;  4TXO B;  2AV4 A;  2H70 A;  3UBL A;  2NPB A;  2LJR A;  1M2D A;  2XHF A;  3DML A;  4IHU A;  4O92 A;  3LEF A;  3P8W A;  1GUM A;  1YVL A;  3TKS E;  3UAR A;  3MDK A;  4MPF A;  3ERW A;  4G0K A;  4HU9 A;  4EXJ A;  4ZIL A;  3E0U A;  1HYU A;  1T7P B;  2V41 A;  3VWV A;  4MH2 A;  2C1Y A;  2HLS A;  3MWH A;  5HR1 A;  4HOJ A;  2JSY A;  1PKW A;  3K8N A;  5BRT A;  3A3T A;  5J41 A;  2KP1 A;  2KUC A;  3FZ5 A;  2VCV A;  4PQH A;  4NXI A;  1XWG A;  1DSB A;  3I43 A;  1F9M A;  4K7N A;  3FZA A;  3EU4 A;  4EL1 A;  4QQ7 A;  2LNS A;  2L4C A;  4IQA A;  2BTO T;  5ECR B;  1Q4J A;  2K8V A;  2C0G A;  2V1M A;  4XTS A;  1ZYN A;  2B5X A;  5D73 A;  1Z6M A;  4KUN A;  4NMU A;  5C00 A;  2MMZ A;  1SYX A;  5L71 A;  2DKH A;  3O3T A;  1XWK A;  2AB6 A;  1T1V A;  2REM A;  3F6F A;  3DEX A;  4A5P A;  2I1U A;  5KN2 A;  3AY8 A;  1N25 A;  3KGK A;  6GSU A;  3LJR A;  2A4H A;  3W8S A;  2VLU A;  3HMJ G;  1EGO A;  2OKA A;  2WUL A;  4JBB A;  1T8E B;  2B6M A;  4ICY A;  4N30 A;  2FWH A;  2O89 A;  4FO5 A;  3FR3 A;  1MTC A;  3J7Y k;  4EC0 A;  3KCM A;  3FK8 A;  3TOT A;  1ZYQ B;  4ZBA A;  4XIH A;  2VOC A;  2LRC A;  5EL8 A;  4MZW A;  3KEB A;  4EIQ A;  3GUS A;  5ECK B;  3ED3 A;  3I69 A;  1UC7 A;  4YKG A;  3LFL A;  3ZVJ D;  3GRX A;  4KCE A;  3LYK A;  1UA5 A;  4TRX A;  1GNE A;  2EC4 A;  1IYH A;  3WYW A;  1J9B A;  2IMD A;  5HFI A;  8GSS A;  2ALB A;  4PXO A;  5C04 A;  1SKW B;  4MLY A;  1EOG A;  3BD2 A;  2OT3 A;  4NAX A;  3BBY A;  1BQ7 A;  3HJM A;  2RM6 A;  4I2U A;  1QQ2 A;  3HY2 A;  4MA9 A;  5IIZ A;  1QUW A;  5A1N A;  3FMW A;  5J9B A;  4EUY A;  2H75 A;  3A5W A;  4HJM A;  1F6M C;  1JZD A;  1JZO A;  1QFN A;  1EP8 A;  2MYG A;  1LU4 A;  2BMX A;  3P7X A;  5HFG A;  1OAZ A;  4MF7 A;  3TGZ A;  1WPI A;  3H4K A;  2NDO A;  1GSQ A;  2B5Y A;  1X9W B;  3CSH A;  1IYI A;  2H1L A;  4AF2 A;  1NHY A;  2H76 A;  1EEM A;  2NTO A;  1THO A;  3FZ4 A;  3WGE A;  1ERT A;  1V9W A;  2J9H A;  4BWQ A;  2R0P A;  4ZBB A;  2FY6 A;  3HHV A;  3EC3 A;  3FYG A;  4EF0 A;  2O7K A;  4G10 A;  4AJ7 A;  3UVT A;  1EOH A;  3QCP A;  1J0F A;  3G7J A;  1F3A A;  2GVP A;  2K18 A;  4OCE A;  4HZ2 A;  3GUR A;  2HSH A;  1X5E A;  5FHI A;  5ECN B;  1WE0 A;  2KHP A;  5IMZ A;  1GTA A;  2WCI A;  3ZL5 A;  3LQ7 A;  3U6V A;  2H1B A;  4JR4 A;  4TXV A;  1N2A A;  4G2E A;  1A0R P;  4KDU A;  1GLQ A;  3GST A;  3FR9 A;  5HR2 A;  4TN8 A;  4RUV A;  4N11 A;  1F37 A;  3TUE A;  2H66 A;  3FR6 A;  2V6O A;  2CV4 A;  4MDC A;  2XC2 A;  4F2I A;  3UBK A;  3MYD A;  2JSZ A;  1X0R A;  4ZIJ A;  5D9T A;  4XCS A;  3F6D A;  3TRP A;  3IAM 2;  2LRN A;  2A2S A;  2VLT A;  5CRE A;  3W6G A;  5F06 A;  1TOF A;  3D22 A;  3TKS A;  2H1A A;  2WZ9 A;  1SJZ A;  3HJO A;  4K2X A;  1EP7 A;  1XFL A;  1CQG A;  3HVX A;  3DVW A;  5DAL A;  1A8L A;  4AKH A;  1FAA A;  2VCZ A;  3NOF A;  2YOI A;  4PTS A;  1GSF A;  3RAZ A;  4I8B A;  5ELA A;  3VPT A;  4BL7 B;  1K0O A;  1HQO A;  2FUG 2;  5ECI B;  3A2X A;  2H6Y A;  4IBP A;  4LL1 B;  5ECQ B;  2IIY A;  2H30 A;  3EWL A;  2GSR A;  2E2M A;  3C73 A;  4GST A;  2PWJ A;  2V2G A;  5JWQ B;  2L6C A;  2JAD A;  2IFQ B;  2O87 A;  5IO0 A;  1GSU A;  4EVM A;  1NM3 A;  4O5Q A;  3TKR A;  4RQR A;  2YAN A;  4MAB A;  1XBS A;  5JWO B;  1YJ6 A;  3W8J A;  2JU5 A;  3PR8 A;  1MD3 A;  1G7O A;  4KSO A;  1BJX A;  2N5A A;  1F3B A;  1T4Y A;  4I97 A;  2GTU A;  4JED A;  4BVX B;  3FEU A;  3Q74 A;  5J40 A;  4F0C A;  2QSI A;  3ZRE A;  4K1F A;  4MH3 A;  3JCM L;  1V57 A;  3OR5 A;  1AQV A;  5D9W A;  3CSI A;  4EIP A;  1YZX A;  4PNG A;  2D2Z A;  2G0F A;  4ZL7 A;  4LMV A;  1Z3E A;  2HZE A;  3PGT A;  2PGT A;  1SYR A;  4MMM A;  1PQN A;  3GN3 A;  3H8Q A;  4K2D A;  4HEA 2;  4V2M A;  2H73 A;  4K9Z A;  2R5G A;  3APS A;  2CAI A;  4L5L A;  4IN0 A;  1QMV A;  3L9V A;  3MNG A;  1R7H A;  1SEN A;  1JFU A;  4O32 A;  1Y25 A;  3ZRD A;  4BPY A;  5G30 A;  4JR6 A;  1HNC A;  4OD7 A;  4GRF A;  2R0C A;  5G5E A;  1PN0 A;  1AQX A;  4XRD A;  2H8L A;  4Q5R A;  2VD0 A;  5D93 A;  3KP8 A;  3R2Q A;  1X9S B;  4K0G A;  2OJL A;  3HD5 A;  1B48 A;  2B5E A;  1MD4 A;  2NBS A;  1TXU A;  5KOW A;  1BED A;  1GTU A;  3GTU A;  3D4T A;  3L9U A;  1T3B A;  5CO3 A;  1SJ6 A;  9GSS A;  4W66 A;  4OFM A;  2VD1 A;  3ME8 A;  4ZL8 A;  1TK8 B;  3M3M A;  4FH8 A;  4O7H A;  1T4Z A;  2C8U A;  2HRA A;  2A4V A;  2YZU A;  2AUV A;  5ID2 B;  3WT2 A;  1FOV A;  5H5R A;  1PKZ A;  1GL8 A;  2YJ7 A;  2N5B A;  1AXD A;  2FCH A;  2IPA A;  3DKS A;  1O81 A;  5CP1 A;  4WBR D;  5DAK A;  4AKG A;  4JE1 A;  1TU7 A;  4QL7 A;  1OE7 A;  5D9V A;  4GXZ A;  2LJA A;  4HQS A;  4GQF A;  2L57 A;  4V1A g;  2F3M A;  3S9F A;  2WDU A;  4XS4 B;  3QAG A;  3G9B A;  2DSA A;  1I5G A;  4CHS A;  1Z5Y E;  4MJE A;  1UN2 A;  5BMU B;  2MZC A;  1K0A A;  3F9U A;  3TKP A;  4E8E A;  4DSS B;  3VFI A;  2H1D A;  2HZF A;  3GV1 A;  4KSM A;  1DBY A;  3M1G A;  2GZP A;  5DBQ A;  2YWO A;  4K5R A;  4MZC A;  1AIU A;  4IJ3 A;  1TI3 A;  4NHZ A;  1YEX A;  2X99 A;  3SWL A;  3IV4 A;  1U88 A;  2H0I A;  1MDJ A;  19GS A;  2K6V A;  1YY7 A;  3DGQ A;  3IOS A;  1Z6N A;  2KOK A;  2V6K A;  4J57 E;  1I9D A;  3QD9 A;  4G0I A;  4TKY A;  2EFD A;  1M7T A;  1GP1 A;  1FO5 A;  3KJY A;  2B7J A;  2MBS A;  2RLI A;  18GS A;  4TR1 A;  3L4N A;  3VPQ A;  2V32 A;  1GTB A;  4RI6 A;  2LST A;  3EU3 A;  5ELG A;  5LNK e;  1K0M A;  1ZYE A;  3GH6 A;  2MMA A;  5D8I A;  4EO3 A;  1XVQ A;  2DJ1 A;  1FVK A;  5AIS A;  5A34 A;  5GZZ B;  2IL3 A;  2DIZ A;  5IOW A;  4WXT A;  5J4Y A;  2FNO A;  4Q5F A;  1ZMA A;  2HT9 A;  1NW2 A;  4J2F A;  4BVY A;  1AQW A;  1R4W A;  5GAP D;  2WRT A;  4ZXG A;  5HQP A;  2OAC A;  1UVZ A;  3Q19 A;  2DJK A;  3UAP A;  2PVQ A;  5J4V A;  3C1R A;  1ZYP A;  1VGL A;  2J23 A;  1HD2 A;  1RQM A;  4XRA A;  1ABA A;  2MMO A;  1SD9 A;  1GUK A;  2PPT A;  5A34 B;  4IQ1 A;  2B3S A;  3GKM A;  3SBC A;  3HXS A;  4LA1 A;  3WT1 A;  2RUE A;  3G7Y A;  4F0B A;  1TJD A;  4KDX A;  3EPT A;  1SVO A;  1ERU A;  4POL A;  4ACS A;  3HA9 A;  2M80 A;  2IN3 A;  2I3Y A;  4KB3 A;  1A0F A;  3EE2 A;  4CW9 A;  1G6Y A;  2R37 A;  2EIQ A;  4KCA A;  1G6W A;  1B4P A;  2HRF A;  1BAY A;  3D6I A;  1M0U A;  1LJR A;  5A4V A;  2H71 A;  3HVS A;  4OFT A;  3P2A A;  2FWG A;  1PSQ A;  4IW9 A;  1ZL9 A;  4PNF A;  5DDL A;  2C80 A;  1HNB A;  1R5P A;  2YV7 A;  2HYX A;  3HZ8 A;  4G01 A;  2DC5 A;  1PL2 A;  1SJI A;  2H6Z A;  1XXU A;  4F82 A;  2C0D A;  4NV2 A;  2GQK A;  4AKI A;  3TDG A;  1CQH A;  2HSN A;  2IMF A;  4MJC A;  4ECJ A;  3GKN A;  3TU3 B;  2M46 A;  4GTU A;  4HUA A;  3LGC A;  1DE2 A;  5IMD A;  1XCC A;  3KD0 A;  2QC7 A;  2YN1 A;  3O6T A;  1EV9 A;  5IOX A;  2IWT A;  5ECH B;  1PD2 1;  2JZR A;  2R4V A;  4TOP A;  1SL0 B;  3KXO A;  2VCW A;  3BCK A;  2I4A A;  4E8H A;  2GT5 A;  2QKE A;  3KMO A;  1ZZY A;  2NVL A;  5IMA A;  3L9S A;  1O8X A;  3L78 A;  3BCI A;  4WBJ A;  1URM A;  4F03 A;  1ILO A;  2ZCT A;  3C71 A;  2VLV A;  1Z9H A;  2KLX A;  1G7E A;  3U5R E;  3FHK A;  2PMT A;  1QK8 A;  1K3L A;  22GS A;  3ZFB A;  1GUH A;  3FW2 A;  3IBH A;  2LS5 A;  1B8X A;  3GX8 A;  3QFA C;  5AGY A;  2VCX A;  4O5U A;  2FWE A;  3KIJ A;  4YH2 A;  5HR3 A;  1PMT A;  5ECP B;  4LLR A;  3E9J B;  2JZT A;  2LQQ A;  1C72 A;  1YKA A;  1XVW A;  2DML A;  2X49 A;  4KGI A;  4NHW A;  6GSX A;  5A1N B;  2DJ0 A;  4EDY A;  1N8J A;  2RII A;  3TRX A;  4WR5 A;  1XOB A;  5AIV A;  2LTK A;  4RQX A;  3GHA A;  1NHO A;  2O5V A;  4QMK A;  4RI7 A;  3DVX A;  3KH9 A;  1OC9 A;  4MNN A;  6GSV A;  1HNA A;  3UIW A;  4CY6 A;  2OBI A;  3HJP A;  4FQU A;  5F05 A;  1O73 A;  10GS A;  1B9Y C;  4YQV A;  3C1S A;  3E3E A;  3UEM A;  2PER A;  2GQL A;  3GYK A;  2PUK C;  4MJA A;  1SKR B;  3LWA A;  4FYB A;  4ECI A;  1M2A A;  3UOM A;  2HFD A;  2FA4 A;  4X1U A;  4K7O A;  3GA4 A;  4AI6 A;  2GDR A;  3NZN A;  2LRT A;  1GSY A;  4KA0 A;  2QA1 A;  2IME A;  3LSZ A;  3FY7 A;  1KEB A;  4KW6 A;  4CY8 A;  4BA7 A;  2GQM A;  2R3X A;  1M9A A;  2DMM A;  2XPD A;  3LW9 A;  5J5N A;  4L8E A;  1BG5 A;  4JZQ A;  4Z2T A;  4WKW A;  3ZIV A;  1O6J A;  1XPV A;  1H75 A;  3CBU A;  5LD0 A;  2M72 A;  4ZBD A;  2H1G A;  2K9F A;  3GKK A;  3RHC A;  2JAC A;  3VLN A;  4IKH A;  2HNL A;  3DYR A;  2X8C A;  3IDV A;  5B7C A;  3TRQ A;  1SVM A;  5DAL B;  4EDZ A;  1SU9 A;  2LEG A;  4OO4 A;  4ULX A;  4N0V A;  2HRK A;  3GKX A;  12GS A;  5DJL A;  2HSM A;  5J47 A;  1V58 A;  2B7K A;  4GQC A;  2K8S A;  3GH9 A;  2UZ8 A;  4DEJ A;  3WGD A;  5B8B A;  4ISD A;  1DUG A;  5B8A A;  5CRW A;  2YV9 A;  2EIO A;  2GST A;  5FWG A;  3ZIT A;  1TI1 A;  2X8H A;  3A5I A;  3KM6 A;  2ZUP A;  4PUF C;  4K6X A;  5F07 A;  5DCH A;  2CVB A;  5ECM B;  1A2M A;  1MDI A;  4J56 E;  4G19 A;  4GF0 A;  2DLX A;  1WP0 A;  4V1A p;  3ZZX A;  14GS A;  4MJB A;  5JCW A;  4YQM A;  1U3A A;  1USB A;  1WIK A;  1YEP A;  1U3I A;  4WEY A;  6GST A;  4OCF A;  1A8Y A;  3EMP A;  2FGX A;  2GZZ A;  1FB6 A;  3TKS C;  4TR3 A;  2F51 A;  3UVH A;  2FA8 A;  1Z7R A;  2VM2 A;  2P5Q A;  1W4V A;  1Y6E A;  2OA7 A;  3C7M A;  1V2A A;  2DKI A;  5DJM A;  3APO A;  5CAX A;  3IA1 A;  2P5R A;  5DCG A;  1XZO A;  2G2Q A;  5IMF A;  5G2Z A;  2WJU A;  3ZFL A;  2HZE B;  3LXT A;  2EFH A;  5CRG A;  3VWX A;  3V1W A;  1XW9 A;  2OE3 A;  2FD3 A;  1QXH A;  2O8V B;  1SKS B;  4USS A;  1TDI A;  1OKD A;  1YDK A;  2VL2 A;  5A5H A;  1B9X C;  3M8N A;  1TXX A;  1K3Y A;  5INY A;  4JRR A;  3ZVJ A;  1GSD A;  3ZML A;  1WWJ A;  5GSS A;  2A2R A;  1K0C A;  1JZR A;  1WMJ A;  4POB A;  3QAV A;  3KMN A;  2TIR A;  2YZH A;  3IR4 A;  1SL1 B;  16GS A;  3HZ4 A;  1K3O A;  4GDF A;  4K5S A;  4P3Y B;  3HCZ A;  3FKF A;  4G0L A;  3GTU B;  1A24 A;  7GSS A;  2AAW A;  2JL4 A;  3P90 A;  3TJF A;  5A5H B;  5ECO B;  2VCQ A;  3IRA A;  3RDW A;  2X4A A;  4HQZ A;  1K0B A;  2L5L A;  5KOX A;  5HFK A;  1SK1 A;  1EGR A;  1OC8 A;  2DBC A;  3F63 A;  4MK3 A;  3ZYW A;  1JZW A;  1T00 A;  4NPB A;  4Z2U A;  1VF4 A;  4YQU A;  5J3R A;  2AHE A;  4XHM A;  2VUP A;  3IK7 A;  5AN1 A;  1SK2 A;  2IMK A;  2CT6 A;  1X5C A;  5DAK B;  1TRW A;  3EYT A;  3KP9 A;  1OYJ A;  4PQI A;  2R6K A;  1TP9 A;  4Z7X A;  1TK5 B;  2C0E A;  1OVN A;  1PGT A;  2YJH A;  3D0Z A;  3D21 A;  5JCG A;  1GSS A;  3QPM A;  5CRH A;  2Z9S A;  4IVF A;  5AIX A;  1VRS D;  3L0H A;  2EFE A;  1V98 A;  2TRX A;  4GLT A;  2YP6 A;  4TXO A;  1Z7P A;  1PA3 A;  3GSS A;  5GST A;  1F2E A;  3F8U A;  2AYT A;  5IMV A;  3IE3 A;  3EUR A;  1W89 A;  3UJ1 A;  5G31 A;  1GTI A;  4IGJ A;  2WFC A;  2H0G A;  2C3N A;  3PIN A;  2H19 A;  1VF3 A;  3CTF A;  2VAF A;  4GSN A;  2H72 A;  5IPG A;  1AC1 A;  3HYP A;  4ILF A;  2DJJ A;  5J4U A;  3DWV A;  4TR1 B;  2KP2 A;  1AAZ A;  4I6X A;  1ON4 A;  2QGV A;  3HKR A;  4Z2R A;  3VWW A;  2LQO A;  6GSS A;  1TRS A;  4AKX B;  3IK9 A;  3KTB A;  3QOU A;  3RPN A;  2VM1 A;  13GS A;  2HQT A;  4HDE A;  3ZMK A;  5G5F A;  2B1K A;  1M2B A;  4I5Q A;  4BVY B;  1ERV A;  4AJ8 A;  1TW9 A;  2O85 A;  3QMX A;  4HI7 A;  3UL3 A;  3CSJ A;  2L5O A;  3F4R A;  1ZGN A;  2GT6 A;  5F0G A;  2GSQ A;  1AUC A;  2FWF A;  4KAE A;  4NWY A;  1PN9 A;  3ERF A;  3HDC A;  3PPU A;  4YKF A;  3M0F A;  2PU9 C;  2XBQ A;  1XW5 A;  2OE1 A;  1EWX A;  1GLP A;  1OE8 A;  1TRU A;  2C0F A;  2QA2 A;  5D96 A;  2L4Q A;  3F4S A;  3TJJ A;  1ML6 A;  5E59 A;  2AJQ B;  2X64 A;  2PBJ A;  1S3C A;  3M9J A;  4V2N A;  3Q6O A;  4MF6 A;  4WET A;  1FOH A;  4F9Z A;  3VI7 A;  2RUF A;  3IHG A;  2H74 A;  6GSY A;  11GS A;  4OO5 A;  3CXG A;  5H5S A;  5CRD A;  1S3D A;  4AJ6 A;  3Q18 A;  2YNX A;  2C3T A;  3VK9 A;  2HE3 A;  2OBK A;  2F9S A;  3LYP A;  3N9J A;  3MIX A;  4TW5 A;  2FHE A;  1B4Q A;  3QDN A;  4L0U A;  4CDO A;  5A4U A;  1YQ1 A;  4WR4 A;  4LL4 B;  1ST9 A;  1XWC A;  3APQ A;  5D9X A;  3LOR A;  2I81 A;  2EIR A;  5DVB A;  4IP6 A;  3FRC A;  2P0G A;  2HSN B;  1X9M B;  1FVJ A;  4I2T A;  4X4J A;  2OAD A;  4EE0 A;  4XS1 A;  5KN1 A;  1R5A A;  1EZK A;  4N3Z A;  4N0Z A;  4QL9 A;  1TRV A;  4OWY A;  4PUA A;  3TOU A;  3PH9 A;  4JU5 A;  4XS6 A;  3TJK A;  3GL5 A;  3GIX A;  3RBT A;  5KN0 A;  4LMW A;  3A2W A;  2JZS A;  1BX9 A;  4ZB7 A;  5LCZ A;  2YPM A;  1V40 A;  4OFN A;  2VIM A;  4POM A;  2F8A A;  3CYN A;  4NV5 A;  1GUL A;  3EVI A;  3LG6 A;  2OE0 A;  3IHQ A;  3CMI A;  4V2L A;  5CNW A;  2CA8 A;  4K8M A;  3BOA A;  2ON5 A;  1GNW A;  4AGS A;  2H0H A;  5GAN D;  4E68 A;  1RK4 A;  4BWS A;  2IMI A;  2HXK A;  3ERG A;  2DIY A;  1FW1 A;  3QAW A;  1QGV A;  2X8G A;  3NIV A;  1PX7 A;  5HR0 A;  1GRX A;  4L0W A;  4WF4 A;  4K7I A;  4TVE A;  2UV8 G;  1O7U A;  1SVL A;  3UMA A;  3VUR A;  5B6M A;  2GS3 A;  5CYY A;  3H93 A;  2R0G A;  2CQ9 A;  2P31 A;  3I9V 2;  4YAP A;  5KEJ A;  4Q5Q A;  5EPF A;  1Y1U A;  2F8F A;  2L59 A;  5G1L A;  1KBN A;  3VWU A;  3DIE A;  3GMF A;  3DD3 A;  1KNG A;  4D73 A;  2VCT A;  1THX A;  5KN3 A;  1U87 A;  5ENU A;  4PQ1 A;  3O76 A;  3N5O A;  4ML6 A;  5EY6 A;  3HVV A;  1X5D A;  4ZB9 A;  4KF9 A;  2R2J A;  2N5F A;  1OC9 B;  2GGT A;  2LKU A;  3KZQ A;  2YWM A;  2GLR A;  3GNJ A;  6GSW A;  4HS1 A;  3ZIJ A;  4EKZ A;  5EVO A;  2WGR A;  4BL7 A;  4H86 A;  4MCU A;  3DXB A;  4ID0 A;  1VF2 A;  4DSR A;  5IQY A;  2RM5 A;  2B1L A;  5DQY A;  5IM9 A;  4IJI A;  4D73 B;  4X0X A;  5ECL B;  1OKT A;  3QR6 A;  3VI5 A;  1J08 A;  4ZL9 A;  1OC3 A;  2MBT A;  2IFQ A;  4ECC A;  5FT3 A;  2IJY A;  1SL2 B;  5ECS A;  3TJG A;  5IO2 A;  4N10 A;  1XWB A;  2HSY A;  1EV4 A;  1JLV A;  2YWN A;  5E4W A;  20GS A;  4HU7 A;  3CTG A;  4KX4 A;  3DRN A;  3F3Q A;  4ZB8 A;  5G1K A;  2VO4 A;  3EMX A;  3D5J A;  4IEL A;  3RHB A;  1ACV A;  2CVK A;  4BVX A;  3LXZ A;  2E0Q A;  5A4W A;  2GZY A;  2PVO C;  4K0N A;  3IC4 A;  1YKC A;  4DSQ A;  1U6T A;  2YCD A;  4KND A;  2VL3 A;  4L5O A;  2TRC P;  3EIN A;  2L6D A;  3ME7 A;  3WD6 A;  4DVC A;  2XBI A;  3BJ5 A;  2BJX A;  3MSZ A;  1TU8 A;  5DQS A;  3GFK A;  1XOA A;  3MAK A;  2DJ3 A;  3GX0 A;  2HRK B;  1BG1 A;  4MP4 A;  1LBK A;  3FZ9 A;  1TKD B;  1FB0 A;  5IMC A;  2HSM B;  3I6A A;  3F0I A;  2LNT A;  1NSW A;  4FIW A;  1AW9 A;  2E2G A;  1RW1 A;  5JWR B;  3F3R A;  1FG4 A;  4GWR A;  1E2Y A;  4MZB A;  3QFB C;  4KDY A;  1TK0 B;  3ZTL A;  1VF1 A;  1DE1 A;  2C3Q A;  2ZNM A;  1GSE A;  4IP1 A;  2LUS A;  5ABR A;  3CRU A;  4X43 A;  17GS A;  1H4O A;  4OMV A;  5A5K A;  2ON7 A;  3GL3 A;  1A2J A;  3TCO A;  3KH7 A;  3A2V A;  1PL1 A;  2YWI A;  1PX6 A;  1K0N A;  2GSS A;  1YF0 A;  5H5Q A;  4KE3 A;  3CWG A;  4PGT A;  1ZCP A;  1BF5 A;  3RPP A;  4IS0 A;  2LJK A;  2CX3 A;  5ID2 A;  4TR0 A;  1XIY A;  1TTZ A;  1JLW A;  2VKZ G;  1K0D A;  3ISO A;  2C4J A;  1A23 A;  2CVD A;  3IPZ A;  1M99 A;  5J9C A;  2CZ3 A;  4FYC A;  4PX1 A;  2LV3 A;  1ZOF A;  3TB2 A;  4G9H A;  1S3A A;  2CAQ A;  2FLS A;  4KH7 A;  1WRY A;  1E6B A;  4YAV A;  4XS4 A;  4GSS A;  2CZ2 A;  3CRT A;  3R3E A;  4O5R A;  5IPH A;  2HI7 A;  3J7Y b;  2VL9 A;  1WOU A;  5BMU A;  3WGX A;  2EFC A;  3H79 A;  2WB9 A;  4DSS A;  4ML1 A;  2H01 A;  1MDK A;  2I9H A;  1XW6 A;  3KTL A;  5B6N A;  1JHB A;  4MF5 A;  4WF5 A;  5COH A;  2XPE A;  4TR4 A;  3IXR A;  1FHE A;  1EEJ A;  1O8W A;  1A2L A;  1WJK A;  2H6X A;  3H1N A;  1YF1 A;  1ERW A;  5F8B A;  2E7P A;  4FYU A;  3IC8 A;  3D4M A;  3IAS 2;  3C8E A;  4HJ2 A;  4MPG A;  1GWC A;  5JCU A;  1R26 A;  4ZB6 A;  1SD8 A;  4ECB A;  1GH2 A;  3M9K A;  3TKQ A;  1BYE A;  1Q98 A;  2MMN A;  1MEK A;  3F4T A;  1KTE A;  1O85 A;  2CX4 A;  2A2P A;  2VL2 C;  2WS2 A;  1G0T A;  3US3 A;  1M9B A;  4POK A;  3G7I A;  2PN8 A;  1XWA A;  3TJB A;  1PRX A;  2ES7 A;  4PUR A;  3ZLP A;  4GCI A;  4HZ4 A;  2HRN A;  2DJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...