3MAKA

Crystal structure of glutathione transferase dmgstd1 from drosophila melanogaster, in complex with glutathione
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
208
structure length
208
Chain Sequence
VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWEENWAGCLEFKKYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 1-1
publication title Structural evidence for conformational changes of Delta class glutathione transferases after ligand binding
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 78
structure length 208
sequence length 208
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2010-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3makA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3makA01
3C7MA 3QPMA 5ECIB 3IV4A 2YJ7A 5B8BA 1X9MB 3L0HA 1WP0A 1NW2A 2H1GA 3CYNA 5IMAA 1MTCA 1Z6MA 3HKRA 1Z3EA 5A4UA 3HCZA 1TI1A 5LCZA 4AF2A 4KSOA 1DE2A 2H75A 4LL4B 4KGIA 1X5CA 2VL2C 4POKA 1OKDA 2CX4A 1BJXA 5D73A 2JADA 2H6XA 5AN1A 2WFCA 2F8AA 1XWKA 2H0GA 1AXDA 3FR3A 3AY8A 1A8LA 2NDOA 2H6ZA 3GTUB 2AJQB 2VLUA 2QKEA 5IIZA 3UMAA 1GUMA 3P2AA 1ZOFA 1LJRA 2HRNA 2BTOT 4CHSA 2C8UA 3TJFA 1IYIA 4V2LA 1TOFA 4G2EA 1PKZA 2HSHA 2LS5A 4NV5A 1WMJA 4K9ZA 4G9HA 1PKWA 4Q5FA 2KLXA 4OD7A 1EV4A 4K1FA 4J57E 1FVKA 4HU9A 3TOTA 3O3TA 4WR4A 2I4AA 2VCVA 4YQUA 3KP9A 4O32A 2R3XA 3VI5A 2HZEA 2EIQA 1TK5B 3F63A 3E9JB 2DIZA 2FD3A 3ZLPA 3D5JA 3MAKA 2P0GA 1BG5A 4V2MA 2H66A 4MF6A 2RM6A 1TXXA 5FWGA 4BVXA 1R26A 2DJ1A 1PN9A 2N5AA 3KTLA 2NPBA 1JHBA 3ED3A 2LQOA 4L0WA 3NOFA 2CV4A 2YNXA 3APSA 3C1RA 4ECIA 2EIRA 2VCXA 3UJ1A 2OE0A 1HD2A 3A2WA 3US3A 5DCHA 3CTFA 4EL1A 3N9JA 2HQTA 1YKCA 3CBUA 4BA7A 2O87A 5J4UA 5INYA 3ZIJA 2B3SA 1K0AA 4QL9A 2H76A 6GSWA 1SKWB 3UL3A 1SYRA 1QFNA 3GYKA 4G0IA 5ECHB 1T00A 4NV2A 1B8XA 4KW6A 2C3NA 3Q6OA 3A2XA 3P7XA 4K0NA 2V41A 3MSZA 3HZ8A 1GSDA 3GL3A 19GSA 3IK7A 2R5GA 3GMFA 1VF4A 4OMVA 1EGOA 2PVOC 1PX6A 1GSUA 3F6DA 3BCIA 4IJIA 2DJ0A 5ABRA 5GAND 4K6XA 2VUPA 3ZITA 1UA5A 3ZREA 2X99A 1LBKA 5G5FA 4ISDA 2B1LA 3H79A 2BJXA 4GSSA 4LL1B 3IR4A 5HFIA 4MJAA 5IPGA 3D22A 5F05A 5HR1A 2K8VA 1PX7A 2VLTA 2XHFA 3PH9A 3EMPA 3HD5A 3APQA 4IS0A 3D6IA 3F6FA 4RI6A 2VO4A 4KDXA 4KA0A 1GWCA 4MZWA 3TOUA 2CA8A 5ECMB 2MYGA 1GP1A 2GQKA 3WT1A 2K9FA 2IFQA 4I2UA 4J2FA 3BD2A 4EKZA 2XBQA 1XW6A 4K7OA 5JWOB 4MPFA 5DQSA 2PU9C 2JZRA 5HQPA 1EGRA 2XC2A 3VI7A 4L5LA 1ERTA 4KCEA 3TB2A 3WT2A 1XWCA 3HVVA 4IP6A 4WR5A 2J23A 3I6AA 3KH7A 1K0DA 1XFLA 3DXBA 1ML6A 1F9MA 4P3YB 1U6TA 4BL7B 3H8QA 4N11A 2MZCA 1SJ6A 1X9WB 4AGSA 5IM9A 5GSSA 1JLWA 2ZNMA 2PBJA 4IQAA 1M2BA 1N2AA 5ENUA 2JL4A 2RUEA 3A2VA 4YAVA 3VFIA 2X8HA 5B7CA 3F4TA 1BEDA 3V1WA 2DMMA 3RAZA 1VF2A 3TCOA 2CAIA 2D2ZA 3HXSA 3QOUA 2I1UA 3DRNA 4XS1A 4XS4A 1K0NA 2LKUA 1SJZA 2V2GA 2H70A 5GSTA 2L5LA 2IMFA 2O8VB 3PGTA 1YZXA 2CX3A 1ZL9A 5CO3A 3ZRDA 1ILOA 4XTSA 1YQ1A 1B9XC 3VURA 2C0DA 3U5RE 4ZL9A 2AYTA 1T4YA 2FA8A 2HE3A 2LTKA 5J5NA 4F9ZA 3FKFA 3QDNA 1VRSD 5JCWA 1VF3A 5CRGA 4XRAA 1XCCA 1FVJA 3MWHA 4N30A 3TUEA 4NMUA 5IMFA 1JZOA 1M0UA 1MDJA 1TK8B 1GTIA 1U3IA 1EV9A 3UBKA 1ZYEA 5DDLA 1G6YA 1XBSA 2R4VA 2MBSA 4ZBAA 5IMCA 1XWBA 1LU4A 2N5BA 1H4OA 4MZBA 1A24A 1I5GA 2IL3A 5LNKe 4DSSA 3GKKA 1FHEA 3K8NA 5ID2A 1OYJA 4PURA 3RDWA 4WXTA 3LSZA 5KN0A 4X43A 4XRDA 3QAGA 3CTGA 4WF4A 3SWLA 4TOPA 3CMIA 1WIKA 1NSWA 1XWAA 1O73A 3BJ5A 5ECNB 4IELA 3F8UA 2ZCTA 1RK4A 1URMA 1QMVA 3ZIVA 5D9XA 2H01A 1S3CA 4GSTA 2B5YA 1C72A 1BAYA 1O8WA 4NWYA 3DGQA 1CQHA 1YF1A 2LUSA 3UARA 4O92A 1ZYQB 5G2ZA 1B9YC 3ZL5A 1SENA 20GSA 2QSIA 4XHMA 5G30A 1A8YA 1SK2A 3IOSA 1XPVA 2VLVA 2H19A 2HSYA 3HJMA 1K0CA 3APOA 4MJBA 1IYHA 4MZCA 1TU7A 5L71A 1MEKA 2Z9SA 2ALBA 5HFKA 3FRCA 3J7Yk 3KD0A 2IMEA 4OWYA 5DAKA 3TRXA 3HYPA 4G0KA 3KH9A 3ZTLA 4IKHA 3BOAA 3ISOA 2P5RA 4GF0A 1EEMA 3D4MA 3DIEA 4XIHA 10GSA 2C0FA 2H72A 1UVZA 2MMZA 1A2JA 4EF0A 1K0MA 2CAQA 2R37A 3QAWA 1MD3A 2H73A 1NM3A 4EO3A 3EMXA 5A5KA 3IAS2 5BMUA 2WS2A 4DEJA 2G2QA 5JWQB 1R5AA 4O5RA 3GURA 2B5XA 2YWMA 3I9V2 2DMLA 4WEYA 2RUFA 3I69A 4LMWA 2H30A 2HRFA 2L4CA 3DWVA 4I6XA 1X0RA 4BVYA 4EVMA 1JLVA 4OO5A 3TRPA 3GKNA 2HI7A 1HYUA 2WZ9A 1SK0A 3TKSE 3H93A 1K0OA 1M9AA 5FT3A 2VCQA 1T1VA 5D9WA 3PPUA 3TJGA 2L5OA 1TRUA 2C4JA 4MMMA 4KSMA 2VL2A 3TJJA 4L8EA 2WB9A 3L9UA 2VM2A 2OJLA 4ACSA 1WE0A 5HFGA 2PVQA 4ILFA 1GUKA 4PNFA 4HU7A 5B8AA 3W6GA 4X1UA 1G6WA 4L0UA 4AJ6A 4X0XA 2QC7A 2V1MA 4FIWA 2HT9A 2OBIA 2ZUPA 1SK1A 1E6BA 4I5QA 4LLRA 4FQUA 3KM6A 4MF5A 3OR5A 2E7PA 3GSTA 1M99A 4AJ7A 1SYXA 4TN8A 2HZFA 3UVHA 3D4TA 2B7KA 3E0UA 4F0BA 1K0BA 1SL0B 4MA9A 3TKRA 1WPIA 2KOKA 4LA1A 2FA4A 2WGRA 1THXA 4KNDA 6GSTA 2VD1A 4POMA 2YPMA 3FYGA 2YWIA 5G1KA 3ZFBA 3HVSA 3J7Yb 5JCGA 2H6YA 3WGXA 4XCSA 1R5PA 1FB6A 1XWGA 3VWXA 5EY6A 5IMZA 4XS6A 3UVTA 5COHA 1XW5A 3KEBA 2E2MA 3BBYA 3LQ7A 2VCTA 4RI7A 2YANA 2HRKA 5IQYA 3G7IA 2OE1A 3EU3A 3DYRA 3QAVA 3KXOA 4HZ2A 3VPQA 1Z5YE 3TKSC 3VLNA 1T4ZA 3FZ5A 4K7IA 3HA9A 4WF5A 3EC3A 1KNGA 4Z7XA 2AAWA 5ECPB 1MDKA 4NPBA 2NVLA 1TKDB 1O6JA 2HZEB 4TW5A 2OADA 1TJDA 2AV4A 1K3OA 4QL7A 2NTOA 1WOUA 2K6VA 2CT6A 4HZ4A 2GT5A 4ZB9A 2KP2A 3IK9A 3SBCA 1HNAA 5ECLB 2JACA 4HOJA 3FHKA 3FEUA 3TRQA 4MF7A 1ABAA 4ZL8A 3WGEA 3FR6A 4MP4A 1U87A 2E0QA 4WETA 5AIVA 3I43A 2M46A 4RQXA 1OKTA 2MMOA 4CDOA 3ZMKA 3MDKA 2CVBA 2L57A 3GKXA 2LRCA 5D96A 4G10A 2ES7A 2PERA 5KN2A 3S9FA 1PGTA 1EWXA 4HUAA 2FHEA 1NHOA 1PL1A 1GTUA 4JBBA 5F06A 5HR3A 3WD6A 3L78A 5LD0A 3DMLA 3Q19A 1J0FA 4EDZA 4IP1A 2GZYA 1UN2A 5HR0A 2FNOA 3KIJA 3GH9A 1J08A 2YN1A 1N8JA 3GX8A 4CW9A 2L6CA 2DLXA 11GSA 4HQZA 4JU5A 3GV1A 4EE0A 4K8MA 2K8SA 4PUAA 2HNLA 2H8LA 2VOCA 4ZIJA 4MH3A 2A4VA 1GNEA 1EP8A 1HNCA 4ECJA 3DKSA 2LJRA 1FW1A 2YCDA 5E59A 4MJEA 3CSHA 5IMVA 2LSTA 1SKRB 2R6KA 5CNWA 3WYWA 2GQMA 2X8CA 1TRWA 2DJJA 2UZ8A 4TR1A 2VL9A 4ECBA 2JZTA 4KDUA 3HY2A 5G31A 4ZILA 2IMKA 2O89A 3GFKA 1ACVA 2V6OA 4YAPA 1SD8A 3C73A 2F51A 4MLYA 1T8EB 5DALA 1YKAA 4IHUA 4K2DA 1SU9A 1W4VA 1YDKA 1ERWA 1AQVA 2HSMB 1WRYA 2VM1A 2YP6A 4IJ3A 1OE7A 1G7OA 2YV9A 5A4VA 3EWLA 4NAXA 1V98A 1PA3A 3LWAA 3Q74A 2V32A 2IFQB 1ZMAA 3L4NA 2GGTA 5CP1A 2IN3A 2HSNB 4D73A 5GZZB 2DSAA 1PRXA 4ZBBA 3KMOA 5JWRB 3DVWA 1AC1A 4F0CA 1DSBA 2G0FA 1Z7RA 5C00A 2ON5A 3A5WA 1SL2B 3O6TA 5G5EA 1FO5A 3L9SA 4PQIA 4GWRA 3QFAC 3IC4A 2DIYA 5DBQA 1ST9A 1GSFA 1OAZA 3CXGA 2MBTA 2I3YA 3UOMA 3VWWA 4FYCA 5ECSA 3H1NA 4KE3A 3G9BA 5E4WA 1FOVA 1O81A 4POBA 3ME8A 5F8BA 2GZZA 2OE3A 1PSQA 4KCAA 22GSA 3LJRA 2C0EA 5D93A 4TXOA 3MNGA 1E2YA 1QK8A 2I81A 2B6MA 2GLRA 2GZPA 1FG4A 4BWQA 2LQQA 2AB6A 2N5FA 2RLIA 5H5SA 2C80A 1Q98A 1B4QA 3FY7A 3D21A 4WBJA 3GX0A 2O85A 4IQ1A 3C71A 2H1DA 4OFNA 4AJ8A 3DEXA 4HJMA 2GSQA 4FYUA 3ERFA 4V1Ag 1S3AA 13GSA 5CREA 1I9DA 4RQRA 3IBHA 2IIYA 1K3LA 4GLTA 2IPAA 4PQ1A 2WJUA 4O7HA 4JZQA 1TTZA 1OVNA 2LV3A 3HZ4A 4PGTA 2DJ2A 3GL5A 2GS3A 4XS4B 1F37A 3KCMA 1AIUA 3R3EA 4MDCA 3F4SA 2PN8A 3GTUA 3TJKA 2L4QA 2FLSA 3FK8A 2AUVA 2TRCP 3IE3A 16GSA 3LFLA 3FZAA 1ON4A 2XPDA 1WJKA 1SKSB 4YH2A 1GH2A 1PQNA 5KN3A 2XBIA 4KH7A 2PGTA 2B1KA 4WBRD 3O76A 18GSA 4PXOA 3ZVJD 1PD21 1AUCA 1HQOA 3GUSA 4GRFA 4MCUA 2JU5A 4HQSA 2CVDA 1X9SB 5CRDA 3UBLA 2YJHA 3IRAA 2DJ3A 1YEPA 1V57A 2X64A 3TKQA 3A3TA 4Q5RA 1PMTA 5ECOB 3GN3A 1NHYA 2I9HA 4DSSB 3EURA 1QXHA 1ERUA 4ULXA 2GSTA 5ID2B 3RPPA 3M3MA 1QUWA 4BPYA 2GT6A 5D8IA 2GDRA 3EVIA 3LEFA 3ZVJA 5KEJA 4N0VA 3RHCA 3BCKA 1V9WA 3WGDA 1M9BA 2OACA 1MD4A 4RUVA 1EZKA 1B48A 2LJAA 4OCFA 2GSSA 2VCWA 4MABA 1OC9B 1V2AA 4ML6A 4IVFA 1YF0A 3IDVA 2WDUA 2YZUA 1JZWA 3G7YA 1GSSA 2FWEA 5DQYA 1Y25A 5J9CA 3C8EA 3HHVA 4TXVA 5F0GA 1R4WA 3QMXA 4TKYA 3H4KA 5D9VA 1TP9A 4J56E 12GSA 3GRXA 2KHPA 4HEA2 4JR4A 5HR2A 1M7TA 3UIWA 2RIIA 1GSYA 2H0IA 1M2DA 4FH8A 4KX4A 3DD3A 2K18A 5D9TA 2VCZA 3NZNA 1DUGA 1OE8A 5EPFA 17GSA 4NHWA 1HNBA 2GTUA 3R2QA 2FWGA 2FY6A 4JE1A 5ELAA 4BWSA 4ZB6A 3GA4A 2GVPA 1XIYA 5DAKB 2H1BA 5J9BA 3QFBC 2TRXA 5CRHA 4TR0A 5J41A 2CVKA 2LNSA 2HRAA 14GSA 5AIXA 4WKWA 2M72A 2ON7A 1X5DA 2GQLA 2IWTA 5ECQB 2TIRA 1O85A 5IMDA 1Y6EA 4Q5QA 1X5EA 4F2IA 3HJOA 1K3YA 3IHQA 2FWFA 4IGJA 3DVXA 2YOIA 1AQWA 3ZMLA 3QCPA 3G7JA 1GRXA 5DCGA 1Z6NA 4MK3A 6GSSA 2F3MA 4DVCA 1GLPA 3EE2A 4TR4A 1TW9A 3LXTA 1F3AA 4BVYB 1UC7A 4TR3A 2L6DA 4MH2A 2VL3A 2FUG2 2DJKA 1M2AA 2B5EA 1USBA 2F8FA 3IA1A 4KDYA 3F4RA 6GSVA 3KZQA 4NXIA 4V2NA 2PMTA 5J3RA 3IC8A 3GNJA 3UEMA 1SJIA 4ECCA 3RBTA 1BQ7A 1GUHA 2LJKA 1SD9A 4BL7A 1EOHA 2P31A 2C1YA 1W89A 1A2MA 4FYBA 3VWUA 3KP8A 3RPNA 2HLSA 2LEGA 3C1SA 1TRSA 2P5QA 5EVOA 3UAPA 1BYEA 3D0ZA 2H0HA 5F07A 1BX9A 2R2JA 2KP1A 1KEBA 5B6NA 3GSSA 1G0TA 4BVXB 5AISA 4ZBDA 4EC0A 1TRVA 1TDIA 1MDIA 4DSRA 1EOGA 2C3QA 3IAM2 1V40A 1DBYA 4GXZA 3TKSA 3NIVA 3Q18A 2WRTA 5KN1A 2HSMA 1KTEA 1KBNA 4YQMA 1PL2A 1GL8A 2RM5A 1YY7A 4E8HA 1DE1A 5IOXA 2KUCA 4PTSA 3TDGA 4JEDA 1XVWA 3FZ4A 3LG6A 1VGLA 2M80A 1VF1A 1TK0B 2PWJA 2F9SA 4OCEA 1U3AA 3FR9A 2LRTA 1YEXA 3CSJA 1FAAA 2FCHA 3VK9A 4KB3A 1AAZA 3P8WA 3LORA 2HRKB 1O8XA 2YWNA 2DC5A 4HI7A 2OBKA 2GSRA 2CQ9A 4QQ7A 2C0GA 1GULA 4I97A 3F3QA 3ERWA 1A23A 5ECKB 2HXKA 5DJMA 3GKMA 4F82A 1ZGNA 1O7UA 4FO5A 5ECRB 2J9HA 1G7EA 4KUNA 2A2SA 4PQHA 5AGYA 3ZZXA 2YV7A 5IOWA 1XVQA 5DVBA 4JR6A 4G0LA 4PNGA 3GIXA 2EIOA 5CRWA 5B6MA 4TRXA 6GSUA 3M9KA 2H74A 2V6KA 4N0ZA 5FHIA 3HDCA 3KMNA 3L9VA 2OKAA 1SL1B 2VAFA 2IJYA 4JRRA 3P90A 3ZFLA 4I8BA 1Z7PA 1A0FA 1AQXA 1ERVA 3FW2A 4MJCA 3W8JA 3QD9A 3M9JA 2AHEA 5ELGA 2WCIA 4GCIA 3HJPA 3QR6A 3CRTA 1S3DA 5CAXA 4ML1A 2OA7A 3E3EA 4KAEA 2REMA 8GSSA 2H1AA 1GSEA 2E2GA 2FWHA 3N5OA 4IBPA 2VIMA 4HS1A 3HVXA 4ZXGA 5H5QA 2CZ3A 1GNWA 2CZ2A 2PUKC 1F3BA 2QGVA 1QGVA 3TJBA 2MMNA 4G19A 5CYYA 1ZCPA 3PINA 3M0FA 1TI3A 1F2EA 5IPHA 2MMAA 1ZZYA 4K0GA 4PUFC 2B7JA 3LYPA 2X8GA 2EC4A 2A2RA 4I2TA 5G1LA 4DSQA 4OFTA 2YWOA 1J9BA 4TVEA 1GLQA 3W8SA 3M1GA 1Z9HA 4L5OA 3F0IA 3F9UA 4LMVA 1A2LA 1OC3A 4N10A 4TR1B 4ID0A 3KGKA 4HJ2A 3EINA 4POLA 3U6VA 1EP7A 3LGCA 3ERGA 1H75A 3FZ9A 2NBSA 2JZSA 2O7KA 5EL8A 3PR8A 4PX1A 3GHAA 2JSYA 5DALB 4K7NA 1T3BA 5GAPD 4ZB8A 3CSIA 3F3RA 2IMDA 4OO4A 1XZOA 3GH6A 3LXZA 7GSSA 1XW9A 3RHBA 4H86A 4YQVA 1GSQA 1RQMA 1B4PA 2PPTA 1GTBA 3JCML 2XPEA 5C04A 1OC9A 1V58A 5DJLA 5IO0A 5IO2A 1F6MC 1CQGA 1FB0A 5H5RA 1Q4JA 4USSA 2LNTA 4MPGA 4D73B 2C3TA 3IPZA 3TKPA 4KF9A 1A0RP 3CRUA 4GQCA 2HFDA 4IN0A 3ZYWA 1WWJA 3VPTA 1EEJA 1JFUA 4EDYA 4EXJA 1XOBA 1QQ2A 4NHZA 3ME7A 1TU8A 1AW9A 4OFMA 1GTAA 3VWVA 4E8EA 1XXUA 2IMIA 3EYTA 2WULA 3M8NA 4F03A 3TGZA 2YZHA 4HDEA 2HYXA 2FGXA 1R7HA 4V1Ap 2L59A 2H71A 4Q5NA 4ZL7A 1YJ6A 2DBCA 1OC8A 2VD0A 1U88A 4TXOB 1JZRA 1XOAA 3EU4A 1RW1A 2LRNA 6GSXA 4IW9A 3KTBA 9GSSA 4GTUA 6GSYA 3KJYA 4EUYA 5JCUA 1T7PB 4GQFA 3IXRA 4GSNA 5A4WA 1THOA 1JZDA 3LYKA 2BMXA 2JSZA
chains in the Genus database with same CATH superfamily
3C7MA 4YKGA 3QPMA 5ECIB 3IV4A 2YJ7A 5B8BA 1X9MB 3L0HA 1WP0A 1NW2A 2H1GA 3CYNA 5IMAA 1MTCA 1Z6MA 3HKRA 1Z3EA 5A4UA 3HCZA 1TI1A 5LCZA 4AF2A 4KSOA 1DE2A 2H75A 4LL4B 4KGIA 1X5CA 2VL2C 4POKA 1OKDA 2CX4A 1BJXA 5D73A 2JADA 2H6XA 4K2XA 5AN1A 2WFCA 2F8AA 1XWKA 2H0GA 1AXDA 3FR3A 3AY8A 1A8LA 2NDOA 2H6ZA 3GTUB 2AJQB 2VLUA 2QKEA 5IIZA 3UMAA 1GUMA 3P2AA 1ZOFA 1LJRA 2HRNA 2BTOT 4CHSA 2C8UA 3TJFA 1IYIA 4V2LA 1TOFA 4G2EA 1PKZA 2HSHA 2LS5A 4NV5A 1WMJA 4K9ZA 4G9HA 1PKWA 4Q5FA 2KLXA 4OD7A 1EV4A 4K1FA 4J57E 1FVKA 4HU9A 3TOTA 3O3TA 4WR4A 4K5SA 2I4AA 2VCVA 4YQUA 3KP9A 4O32A 2R3XA 4EIPA 3VI5A 2HZEA 2EIQA 1TK5B 3F63A 3E9JB 2DIZA 2FD3A 3ZLPA 3D5JA 3MAKA 2P0GA 1BG5A 4V2MA 2H66A 4MF6A 2RM6A 1TXXA 5FWGA 4BVXA 5BMUB 2WVYA 1R26A 2DJ1A 1PN9A 5KOXA 3MIXA 2N5AA 3KTLA 2NPBA 1JHBA 3ED3A 2LQOA 4L0WA 3NOFA 2CV4A 2YNXA 3APSA 3C1RA 4ECIA 2EIRA 4N3ZA 2VCXA 3UJ1A 2OE0A 1HD2A 3A2WA 3US3A 2EFHA 5DCHA 3CTFA 4EL1A 3N9JA 2HQTA 4AKXB 1YKCA 3CBUA 4BA7A 2O87A 5J4UA 2UV8G 5INYA 3ZIJA 2B3SA 3HVNA 1K0AA 4QL9A 2H76A 6GSWA 1SKWB 3UL3A 1SYRA 1QFNA 3GYKA 1M3IA 4G0IA 5ECHB 1T00A 4NV2A 1B8XA 4KW6A 2C3NA 3Q6OA 3A2XA 3P7XA 1S4BP 4K0NA 2V41A 3MSZA 3HZ8A 1GSDA 3GL3A 19GSA 3IK7A 2R5GA 3GMFA 1VF4A 4OMVA 4PHZC 1EGOA 2PVOC 1PX6A 1GSUA 3F6DA 3BCIA 4IJIA 2DJ0A 5ABRA 5GAND 4K6XA 2VUPA 3ZITA 1UA5A 3ZREA 2X99A 1LBKA 5G5FA 4ISDA 2B1LA 3H79A 2BJXA 4GSSA 4LL1B 3IR4A 5HFIA 4MJAA 5IPGA 3D22A 5F05A 5HR1A 2K8VA 1M3JA 1PX7A 2VLTA 2XHFA 3PH9A 3EMPA 3HD5A 3APQA 1SVMA 4IS0A 3D6IA 3F6FA 4RI6A 2VO4A 4KDXA 4KA0A 1GWCA 4G01A 4MZWA 3TOUA 2CA8A 5ECMB 2MYGA 1GP1A 2GQKA 3WT1A 2K9FA 2IFQA 4I2UA 4J2FA 2HSNA 3BD2A 4EKZA 2XBQA 1XW6A 4K7OA 5JWOB 4MPFA 5DQSA 2PU9C 2JZRA 5HQPA 1EGRA 2XC2A 3VI7A 4L5LA 1ERTA 4KCEA 3TB2A 3WT2A 1XWCA 3CHXC 3HVVA 4IP6A 4WR5A 2J23A 4PI0C 3I6AA 3KH7A 1K0DA 1XFLA 3DXBA 1ML6A 1F9MA 4P3YB 1U6TA 4BL7B 3H8QA 4N11A 2MZCA 1SJ6A 1X9WB 4AGSA 5IM9A 5GSSA 1JLWA 4Z2TA 2ZNMA 2PBJA 4IQAA 1M2BA 1N2AA 5ENUA 2JL4A 2RUEA 3A2VA 4YAVA 3VFIA 2X8HA 5B7CA 3F4TA 1BEDA 3V1WA 2DMMA 3RAZA 1VF2A 3TCOA 2CAIA 2D2ZA 3HXSA 2DKHA 5J4VA 3QOUA 2I1UA 2EFDA 3DRNA 4XS1A 4XS4A 5A34B 1K0NA 2LKUA 1SJZA 2V2GA 2H70A 5GSTA 2L5LA 2IMFA 2O8VB 3PGTA 1YZXA 2CX3A 1ZL9A 5CO3A 3ZRDA 1ILOA 4XTSA 1YQ1A 1B9XC 3VURA 2C0DA 5A1NA 3U5RE 1XG8A 4ZL9A 2AYTA 1T4YA 2FA8A 2HE3A 2LTKA 5J5NA 4F9ZA 3FKFA 3QDNA 1VRSD 5JCWA 1VF3A 5CRGA 4XRAA 1XCCA 1FVJA 3MWHA 4N30A 3TUEA 4NMUA 5IMFA 1JZOA 1M0UA 1MDJA 1TK8B 1GTIA 1U3IA 1EV9A 3UBKA 1ZYEA 5DDLA 1G6YA 1XBSA 2R4VA 2MBSA 4ZBAA 5IMCA 1XWBA 1LU4A 2N5BA 1H4OA 4O5UA 4MZBA 1A24A 1I5GA 2IL3A 5LNKe 4DSSA 3GKKA 1FHEA 3K8NA 5ID2A 1OYJA 4PURA 3RDWA 4X4JA 2WVXA 4WXTA 3LSZA 5KN0A 4X43A 4XRDA 3QAGA 3CTGA 4WF4A 3SWLA 4TOPA 3CMIA 1WIKA 1NSWA 1XWAA 1O73A 3BJ5A 5ECNB 4IELA 3F8UA 2ZCTA 1RK4A 1URMA 1QMVA 3ZIVA 4CY8A 5D9XA 2H01A 1S3CA 4GSTA 2B5YA 1C72A 1BAYA 1O8WA 4NWYA 3DGQA 1CQHA 1YF1A 2LUSA 3UARA 4O92A 4K5RA 1ZYQB 5G2ZA 1B9YC 3ZL5A 1SENA 20GSA 2QSIA 1N25A 4XHMA 5G30A 1A8YA 1SK2A 3IOSA 1XPVA 2VLVA 2H19A 2HSYA 3HJMA 1K0CA 3APOA 4MJBA 1IYHA 4MZCA 1TU7A 5L71A 5BRTA 1MEKA 4BIKA 2Z9SA 2ALBA 5HFKA 3FRCA 3J7Yk 3KD0A 2IMEA 4OWYA 5DAKA 3TRXA 3HYPA 4G0KA 3KH9A 3ZTLA 4IKHA 3BOAA 3ISOA 2P5RA 4GF0A 1EEMA 3D4MA 3DIEA 4XIHA 10GSA 2C0FA 2H72A 1UVZA 2MMZA 1A2JA 4EF0A 1K0MA 2CAQA 2R37A 1MD3A 3QAWA 2H73A 1NM3A 4EO3A 1PFOA 3EMXA 5A5KA 3IAS2 5BMUA 4GDFA 2WS2A 4DEJA 2G2QA 5JWQB 1R5AA 4O5RA 3GURA 2B5XA 2YWMA 3I9V2 2DMLA 4WEYA 2RUFA 3I69A 4LMWA 2H30A 2HRFA 2L4CA 3DWVA 4I6XA 1X0RA 4BVYA 4EVMA 1JLVA 4OO5A 3TRPA 3GKNA 2HI7A 1HYUA 4AKGA 1SK0A 2WZ9A 3TKSE 3H93A 1K0OA 1M9AA 1S3RA 5FT3A 2VCQA 1T1VA 5D9WA 3PPUA 3TJGA 5J47A 2L5OA 1TRUA 2C4JA 4MMMA 4KSMA 4E68A 2VL2A 3TJJA 4L8EA 4AKIA 2WB9A 3L9UA 2VM2A 2OJLA 4ACSA 1WE0A 5HFGA 2PVQA 4ILFA 1GUKA 1BG1A 4PNFA 2X4AA 4HU7A 5B8AA 3W6GA 4X1UA 1G6WA 4L0UA 4AJ6A 4X0XA 2QC7A 2V1MA 4FIWA 2HT9A 2OBIA 2ZUPA 1SK1A 1E6BA 4I5QA 4LLRA 4FQUA 3KM6A 4MF5A 3OR5A 2E7PA 3GSTA 1M99A 4AJ7A 3CQFA 1SYXA 4TN8A 2HZFA 3UVHA 3D4TA 2B7KA 3E0UA 4F0BA 1K0BA 1SL0B 4MA9A 3TKRA 1WPIA 2KOKA 4LA1A 2FA4A 2WGRA 1THXA 4KNDA 6GSTA 1TXUA 2VD1A 4POMA 2YPMA 2H1LA 2X49A 3FYGA 2YWIA 5G1KA 3ZFBA 3HVSA 3J7Yb 5JCGA 2H6YA 3WGXA 4XCSA 1R5PA 1FB6A 1XWGA 3VWXA 5EY6A 5IMZA 1ZYNA 4XS6A 3UVTA 5COHA 1XW5A 3KEBA 4MNNA 1YVLA 2E2MA 3BBYA 3LQ7A 2VCTA 4RI7A 2YANA 2HRKA 5IQYA 3G7IA 2OE1A 3EU3A 3DYRA 3QAVA 2EFEA 3KXOA 4HZ2A 4O5QA 4W66A 3VPQA 1Z5YE 3TKSC 3VLNA 1T4ZA 2WW2A 3FZ5A 4K7IA 3HA9A 4WF5A 3EC3A 1KNGA 4Z7XA 2AAWA 5ECPB 1MDKA 4NPBA 2NVLA 1TKDB 1O6JA 2HZEB 4TW5A 2OADA 4ZB7A 1TJDA 2AV4A 1K3OA 4QL7A 2NTOA 5J40A 1WOUA 2K6VA 2CT6A 4HZ4A 3A5IA 2GT5A 4ZB9A 2KP2A 3IK9A 3SBCA 1HNAA 5ECLB 2JACA 4HOJA 3FHKA 3FEUA 3TRQA 4MF7A 1ABAA 4ZL8A 3WGEA 3FR6A 4MP4A 1U87A 2E0QA 4WETA 5AIVA 3I43A 2M46A 4RQXA 1OKTA 2MMOA 4CDOA 3ZMKA 3MDKA 2CVBA 2L57A 3GKXA 2LRCA 5D96A 4G10A 2VKZG 2WW1A 2ES7A 2PERA 5KN2A 3S9FA 1PGTA 1EWXA 4HUAA 2FHEA 1NHOA 1PL1A 1GTUA 4JBBA 5F06A 5A34A 5HR3A 3WD6A 3L78A 5LD0A 2WZSA 3DMLA 3Q19A 1J0FA 4EDZA 4IP1A 2GZYA 1UN2A 5HR0A 2FNOA 3KIJA 3GH9A 1J08A 2YN1A 1N8JA 3FMWA 3GX8A 2L6CA 4CW9A 2DLXA 11GSA 4HQZA 4JU5A 4AI6A 3GV1A 4EE0A 4K8MA 2K8SA 4PUAA 2HNLA 2H8LA 2VOCA 4ZIJA 4MH3A 2A4VA 1GNEA 1EP8A 4EIQA 1HNCA 4ECJA 3DKSA 2LJRA 1FW1A 2YCDA 5E59A 4MJEA 3CSHA 5IMVA 4A5PA 2LSTA 1SKRB 2R6KA 5CNWA 3WYWA 2GQMA 2X8CA 1TRWA 2DJJA 2UZ8A 4TR1A 2VL9A 4ECBA 2JZTA 4KDUA 3HY2A 5G31A 4ZILA 2IMKA 2O89A 3GFKA 2R0CA 1ACVA 2V6OA 4YAPA 1SD8A 3C73A 2F51A 4MLYA 1T8EB 5DALA 1YKAA 4IHUA 3RGBC 4K2DA 1SU9A 1W4VA 1YDKA 1ERWA 1AQVA 2HSMB 1WRYA 4CY6A 2VM1A 4YKFA 2YP6A 4IJ3A 1OE7A 1G7OA 2YV9A 5A4VA 3EWLA 4NAXA 1V98A 1PA3A 3LWAA 3CWGA 3Q74A 2V32A 2IFQB 1ZMAA 3L4NA 2GGTA 5CP1A 2IN3A 2HSNB 2QA2A 4D73A 5GZZB 2DSAA 1PRXA 4ZBBA 3KMOA 5JWRB 3DVWA 1AC1A 4F0CA 1DSBA 2G0FA 1Z7RA 5C00A 2ON5A 3A5WA 1SL2B 3O6TA 5G5EA 1FO5A 3L9SA 4PQIA 4GWRA 3LW9A 3QFAC 3IC4A 2DIYA 5DBQA 1ST9A 1GSFA 1OAZA 3CXGA 2MBTA 2I3YA 3UOMA 3VWWA 4FYCA 5ECSA 3H1NA 4KE3A 2R0PA 3G9BA 5E4WA 1FOVA 1O81A 4POBA 3ME8A 5F8BA 2GZZA 2OE3A 1PSQA 4KCAA 22GSA 3LJRA 2C0EA 5D93A 4TXOA 3MNGA 1E2YA 1QK8A 2I81A 2B6MA 2GLRA 2GZPA 1FG4A 4BWQA 2LQQA 2WVZA 2AB6A 2N5FA 2RLIA 5H5SA 2C80A 1Q98A 1B4QA 3FY7A 3D21A 4WBJA 2O5VA 3GX0A 2O85A 4IQ1A 2QA1A 3C71A 2H1DA 4OFNA 4AJ8A 3DEXA 4HJMA 2GSQA 4FYUA 3ERFA 4V1Ag 1S3AA 13GSA 5CREA 1I9DA 4RQRA 5A5HB 3IBHA 2IIYA 3HMJG 1K3LA 4GLTA 2IPAA 4PQ1A 2WJUA 4O7HA 4JZQA 1TTZA 2DKIA 1OVNA 3HZ4A 2LV3A 4PGTA 2DJ2A 3GL5A 2GS3A 4XS4B 1F37A 3KCMA 1AIUA 2R0GA 3R3EA 4MDCA 3F4SA 2PN8A 3GTUA 3TJKA 2L4QA 2FLSA 3FK8A 2AUVA 2TRCP 3IE3A 16GSA 3LFLA 3FZAA 1ON4A 3IHGA 2XPDA 1WJKA 1SKSB 4YH2A 1GH2A 1PQNA 5KN3A 2XBIA 4KH7A 2PGTA 2B1KA 4WBRD 3O76A 18GSA 4PXOA 3ZVJD 1PD21 1AUCA 1HQOA 3GUSA 4GRFA 4MCUA 2JU5A 4HQSA 2CVDA 1X9SB 5CRDA 3UBLA 2YJHA 3IRAA 2DJ3A 1YEPA 1V57A 2X64A 3TKQA 3A3TA 4Q5RA 2OT3A 1PMTA 5ECOB 3GN3A 1NHYA 2I9HA 1ZYPA 4DSSB 3EURA 1QXHA 1ERUA 4ULXA 2GSTA 5ID2B 3RPPA 3M3MA 1QUWA 4BPYA 2WVXB 2GT6A 5D8IA 2GDRA 3EVIA 3LEFA 3ZVJA 5KEJA 4N0VA 3RHCA 3BCKA 1V9WA 3WGDA 1M9BA 2OACA 1MD4A 4RUVA 1EZKA 1B48A 2LJAA 4OCFA 2GSSA 4QMKA 2VCWA 4MABA 1OC9B 1V2AA 4ML6A 4IVFA 1YF0A 3IDVA 2WDUA 2YZUA 1JZWA 1I1IP 1SVLA 3G7YA 1GSSA 2FWEA 5DQYA 1Y25A 5J9CA 3C8EA 3HHVA 4TXVA 5F0GA 1R4WA 3QMXA 4TKYA 3H4KA 5D9VA 1TP9A 3TU3B 4J56E 12GSA 3GRXA 2KHPA 4HEA2 4JR4A 5HR2A 1M7TA 3UIWA 2RIIA 1GSYA 2H0IA 1M2DA 4FH8A 4PI2C 4KX4A 3DD3A 2K18A 5D9TA 2VCZA 3NZNA 1DUGA 1OE8A 5EPFA 17GSA 4NHWA 1HNBA 2EFCA 2GTUA 3RFRC 3R2QA 2FWGA 2FY6A 4JE1A 2A2PA 5ELAA 4BWSA 4ZB6A 3GA4A 2GVPA 1XIYA 5DAKB 2H1BA 5J9BA 5J4YA 3QFBC 2TRXA 5CRHA 4TR0A 2O36A 5J41A 2CVKA 2LNSA 2HRAA 14GSA 5AIXA 4WKWA 2M72A 2ON7A 1X5DA 2GQLA 2IWTA 5ECQB 2TIRA 1O85A 5IMDA 1Y6EA 4Q5QA 1X5EA 4F2IA 3HJOA 1K3YA 3IHQA 2FWFA 4IGJA 3DVXA 2YOIA 1AQWA 3ZMLA 3QCPA 3G7JA 1GRXA 5DCGA 1Z6NA 4MK3A 6GSSA 2F3MA 4DVCA 1GLPA 3EE2A 4TR4A 1TW9A 3LXTA 1F3AA 1FOHA 4BVYB 1UC7A 4TR3A 2L6DA 4MH2A 2VL3A 2FUG2 2DJKA 1M2AA 2B5EA 1USBA 2F8FA 3IA1A 4KDYA 3F4RA 6GSVA 3KZQA 4NXIA 4V2NA 2PMTA 5J3RA 3IC8A 3GNJA 3UEMA 1SJIA 4ECCA 3RBTA 1BQ7A 1GUHA 2LJKA 1SD9A 4BL7A 1EOHA 2P31A 2C1YA 1W89A 1A2MA 4FYBA 3VWUA 3KP8A 3RPNA 2HLSA 2LEGA 3C1SA 1TRSA 2P5QA 5EVOA 3UAPA 1BYEA 3D0ZA 2H0HA 5F07A 1BX9A 2R2JA 2KP1A 1KEBA 5B6NA 3GSSA 1G0TA 4BVXB 5AISA 4ZBDA 4EC0A 4AKHA 3MYDA 1TRVA 4Z2RA 1TDIA 1MDIA 4DSRA 1EOGA 2C3QA 3IAM2 1V40A 1DBYA 4GXZA 3TKSA 3NIVA 3Q18A 2WRTA 5KN1A 2HSMA 1KTEA 1KBNA 4YQMA 1PL2A 1GL8A 2RM5A 1YY7A 4E8HA 1DE1A 5IOXA 2KUCA 4PTSA 3TDGA 4JEDA 1XVWA 3FZ4A 3LG6A 1VGLA 2M80A 1VF1A 1TK0B 2PWJA 2F9SA 4OCEA 1U3AA 3FR9A 2LRTA 1YEXA 3CSJA 1FAAA 2FCHA 3VK9A 4KB3A 1AAZA 3P8WA 4FXYP 3LORA 2HRKB 1O8XA 2YWNA 2DC5A 4HI7A 2OBKA 2GSRA 2CQ9A 4QQ7A 2C0GA 1GULA 4I97A 3F3QA 3ERWA 1A23A 5ECKB 4ICYA 2HXKA 5DJMA 3GKMA 4F82A 1ZGNA 1O7UA 4FO5A 5ECRB 2WW3A 2J9HA 1G7EA 4KUNA 2A2SA 4PQHA 5AGYA 3ZZXA 2YV7A 5IOWA 1XVQA 5DVBA 4JR6A 4G0LA 4PNGA 3GIXA 2EIOA 5CRWA 5B6MA 4TRXA 6GSUA 3M9KA 2H74A 5KOWA 2V6KA 4N0ZA 5FHIA 3HDCA 3KMNA 3L9VA 2OKAA 1SL1B 2VAFA 2IJYA 4JRRA 3P90A 3ZFLA 4I8BA 1Z7PA 1A0FA 1AQXA 1ERVA 3FW2A 4MJCA 3W8JA 3QD9A 3M9JA 2AHEA 5ELGA 2WCIA 4GCIA 3HJPA 3QR6A 1SVOA 3CRTA 1S3DA 5CAXA 5A5HA 4ML1A 2OA7A 3E3EA 4KAEA 2REMA 8GSSA 2H1AA 3EPTA 1GSEA 2E2GA 2FWHA 3N5OA 4IBPA 2VIMA 4HS1A 3HVXA 4ZXGA 5H5QA 2CZ3A 1GNWA 2CZ2A 2PUKC 1F3BA 2QGVA 1QGVA 3TJBA 2MMNA 4G19A 5CYYA 1ZCPA 3PINA 3M0FA 1TI3A 1F2EA 5IPHA 1YEWC 2MMAA 1ZZYA 4K0GA 4PUFC 2B7JA 3LYPA 2X8GA 2EC4A 2A2RA 4I2TA 5G1LA 4DSQA 4OFTA 2YWOA 1J9BA 4TVEA 1GLQA 3W8SA 3M1GA 1Z9HA 4L5OA 3F0IA 3F9UA 4LMVA 1A2LA 1OC3A 4N10A 4TR1B 4ID0A 4HJ2A 3KGKA 3EINA 4POLA 1BF5A 3U6VA 1EP7A 2O3EA 3LGCA 3ERGA 1H75A 3FZ9A 2NBSA 2JZSA 2O7KA 5EL8A 3PR8A 4PX1A 3GHAA 2JSYA 5DALB 4K7NA 1T3BA 2A4HA 5GAPD 4ZB8A 3CSIA 3F3RA 2IMDA 4OO4A 1XZOA 3GH6A 3LXZA 7GSSA 1XW9A 3RHBA 4H86A 4YQVA 1GSQA 1RQMA 1B4PA 2WW0A 2PPTA 1GTBA 3JCML 2XPEA 5C04A 4Z2UA 1OC9A 1V58A 5DJLA 5IO0A 5IO2A 1F6MC 1CQGA 1FB0A 1PN0A 5H5RA 1Q4JA 4USSA 2LNTA 4MPGA 4D73B 2C3TA 3IPZA 3TKPA 5A1NB 4KF9A 1A0RP 3CRUA 4GQCA 2HFDA 4IN0A 3ZYWA 1WWJA 3VPTA 1EEJA 1JFUA 4EDYA 4EXJA 1XOBA 1QQ2A 4NHZA 3ME7A 1TU8A 1AW9A 4OFMA 1GTAA 3VWVA 4E8EA 1XXUA 2IMIA 3EYTA 2WULA 3M8NA 4F03A 3TGZA 2YZHA 4HDEA 2HYXA 2FGXA 1R7HA 4V1Ap 2L59A 2H71A 4Q5NA 4ZL7A 1YJ6A 2DBCA 1OC8A 2VD0A 4HSCX 1U88A 4TXOB 1JZRA 1XOAA 3EU4A 1RW1A 2LRNA 6GSXA 4IW9A 3KTBA 9GSSA 4GTUA 6GSYA 1Y1UA 3KJYA 4EUYA 5JCUA 1T7PB 4GQFA 3IXRA 4GSNA 5A4WA 1THOA 1JZDA 3LYKA 2BMXA 2JSZA
chains in the Genus database with same CATH topology
3C7MA 4YKGA 3QPMA 5ECIB 3IV4A 2YJ7A 5B8BA 1X9MB 3L0HA 1WP0A 1NW2A 2H1GA 3CYNA 5IMAA 1MTCA 1Z6MA 3HKRA 1Z3EA 5A4UA 3HCZA 1TI1A 5LCZA 4AF2A 4KSOA 1DE2A 2H75A 4LL4B 4KGIA 1X5CA 2VL2C 4POKA 1OKDA 2CX4A 1BJXA 5D73A 2JADA 2H6XA 4K2XA 5AN1A 2WFCA 2F8AA 1XWKA 2H0GA 1AXDA 3FR3A 3AY8A 1A8LA 2NDOA 2H6ZA 3GTUB 2AJQB 2VLUA 2QKEA 5IIZA 3UMAA 1GUMA 3P2AA 1ZOFA 1LJRA 2HRNA 2BTOT 4CHSA 2C8UA 3TJFA 1IYIA 4V2LA 1TOFA 4G2EA 1PKZA 2HSHA 2LS5A 4NV5A 1WMJA 4K9ZA 4G9HA 1PKWA 4Q5FA 2KLXA 4OD7A 1EV4A 4K1FA 4J57E 1FVKA 4HU9A 3TOTA 3O3TA 4WR4A 4K5SA 2I4AA 2VCVA 4YQUA 3KP9A 4O32A 2R3XA 4EIPA 3VI5A 2HZEA 2EIQA 1TK5B 3F63A 3E9JB 2DIZA 2FD3A 3ZLPA 3D5JA 3MAKA 2P0GA 1BG5A 4V2MA 2H66A 4MF6A 2RM6A 1TXXA 5FWGA 4BVXA 5BMUB 1R26A 2DJ1A 1PN9A 5KOXA 3MIXA 2N5AA 3KTLA 2NPBA 1JHBA 3ED3A 2LQOA 4L0WA 3NOFA 2CV4A 2YNXA 3APSA 3C1RA 4ECIA 2EIRA 4N3ZA 2VCXA 3UJ1A 2OE0A 1HD2A 3A2WA 3US3A 2EFHA 5DCHA 3CTFA 4EL1A 3N9JA 2HQTA 4AKXB 1YKCA 3CBUA 4BA7A 2O87A 5J4UA 2UV8G 5INYA 3ZIJA 2B3SA 1K0AA 4QL9A 2H76A 6GSWA 1SKWB 3UL3A 1SYRA 1QFNA 3GYKA 4G0IA 5ECHB 1T00A 4NV2A 1B8XA 4KW6A 2C3NA 3Q6OA 3A2XA 3P7XA 4K0NA 2V41A 3MSZA 3HZ8A 1GSDA 3GL3A 19GSA 3IK7A 2R5GA 3GMFA 1VF4A 4OMVA 1EGOA 2PVOC 1PX6A 1GSUA 3F6DA 3BCIA 4IJIA 2DJ0A 5ABRA 5GAND 4K6XA 2VUPA 3ZITA 1UA5A 3ZREA 2X99A 1LBKA 5G5FA 4ISDA 2B1LA 3H79A 2BJXA 4GSSA 4LL1B 3IR4A 5HFIA 4MJAA 5IPGA 3D22A 5F05A 5HR1A 2K8VA 1PX7A 2VLTA 2XHFA 3PH9A 3EMPA 3HD5A 3APQA 1SVMA 4IS0A 3D6IA 3F6FA 4RI6A 2VO4A 4KDXA 4KA0A 1GWCA 4G01A 4MZWA 3TOUA 2CA8A 5ECMB 2MYGA 1GP1A 2GQKA 3WT1A 2K9FA 2IFQA 4I2UA 4J2FA 2HSNA 3BD2A 4EKZA 2XBQA 1XW6A 4K7OA 5JWOB 4MPFA 5DQSA 2PU9C 2JZRA 5HQPA 1EGRA 2XC2A 3VI7A 4L5LA 1ERTA 4KCEA 3TB2A 3WT2A 1XWCA 3HVVA 4IP6A 4WR5A 2J23A 3I6AA 3KH7A 1K0DA 1XFLA 3DXBA 1ML6A 1F9MA 4P3YB 1U6TA 4BL7B 3H8QA 4N11A 2MZCA 1SJ6A 1X9WB 4AGSA 5IM9A 5GSSA 1JLWA 4Z2TA 2ZNMA 2PBJA 4IQAA 1M2BA 1N2AA 5ENUA 2JL4A 2RUEA 3A2VA 4YAVA 3VFIA 2X8HA 5B7CA 3F4TA 1BEDA 3V1WA 2DMMA 3RAZA 1VF2A 3TCOA 2CAIA 2D2ZA 3HXSA 2DKHA 5J4VA 3QOUA 2I1UA 2EFDA 3DRNA 4XS1A 4XS4A 5A34B 1K0NA 2LKUA 1SJZA 2V2GA 2H70A 5GSTA 2L5LA 2IMFA 2O8VB 3PGTA 1YZXA 2CX3A 1ZL9A 5CO3A 3ZRDA 1ILOA 4XTSA 1YQ1A 1B9XC 3VURA 2C0DA 5A1NA 3U5RE 4ZL9A 2AYTA 1T4YA 2FA8A 2HE3A 2LTKA 5J5NA 4F9ZA 3FKFA 3QDNA 1VRSD 5JCWA 1VF3A 5CRGA 4XRAA 1XCCA 1FVJA 3MWHA 4N30A 3TUEA 4NMUA 5IMFA 1JZOA 1M0UA 1MDJA 1TK8B 1GTIA 1U3IA 1EV9A 3UBKA 1ZYEA 5DDLA 1G6YA 1XBSA 2R4VA 2MBSA 4ZBAA 5IMCA 1XWBA 1LU4A 2N5BA 1H4OA 4O5UA 4MZBA 1A24A 1I5GA 2IL3A 5LNKe 4DSSA 3GKKA 1FHEA 3K8NA 5ID2A 1OYJA 4PURA 3RDWA 4X4JA 4WXTA 3LSZA 5KN0A 4X43A 4XRDA 3QAGA 3CTGA 4WF4A 3SWLA 4TOPA 3CMIA 1WIKA 1NSWA 1XWAA 1O73A 3BJ5A 5ECNB 4IELA 3F8UA 2ZCTA 1RK4A 1URMA 1QMVA 3ZIVA 4CY8A 5D9XA 2H01A 1S3CA 4GSTA 2B5YA 1C72A 1BAYA 1O8WA 4NWYA 3DGQA 1CQHA 1YF1A 2LUSA 3UARA 4O92A 4K5RA 1ZYQB 5G2ZA 1B9YC 3ZL5A 1SENA 20GSA 2QSIA 1N25A 4XHMA 5G30A 1A8YA 1SK2A 3IOSA 1XPVA 2VLVA 2H19A 2HSYA 3HJMA 1K0CA 3APOA 4MJBA 1IYHA 4MZCA 1TU7A 5L71A 5BRTA 1MEKA 2Z9SA 2ALBA 5HFKA 3FRCA 3J7Yk 3KD0A 2IMEA 4OWYA 5DAKA 3TRXA 3HYPA 4G0KA 3KH9A 3ZTLA 4IKHA 3BOAA 3ISOA 2P5RA 4GF0A 1EEMA 3D4MA 3DIEA 4XIHA 10GSA 2C0FA 2H72A 1UVZA 2MMZA 1A2JA 4EF0A 1K0MA 2CAQA 2R37A 1MD3A 3QAWA 2H73A 1NM3A 4EO3A 3EMXA 5A5KA 3IAS2 5BMUA 4GDFA 2WS2A 4DEJA 2G2QA 5JWQB 1R5AA 4O5RA 3GURA 2B5XA 2YWMA 3I9V2 2DMLA 4WEYA 2RUFA 3I69A 4LMWA 2H30A 2HRFA 2L4CA 3DWVA 4I6XA 1X0RA 4BVYA 4EVMA 1JLVA 4OO5A 3TRPA 3GKNA 2HI7A 1HYUA 4AKGA 1SK0A 2WZ9A 3TKSE 3H93A 1K0OA 1M9AA 5FT3A 2VCQA 1T1VA 5D9WA 3PPUA 3TJGA 5J47A 2L5OA 1TRUA 2C4JA 4MMMA 4KSMA 4E68A 2VL2A 3TJJA 4L8EA 4AKIA 2WB9A 3L9UA 2VM2A 2OJLA 4ACSA 1WE0A 5HFGA 2PVQA 4ILFA 1GUKA 1BG1A 4PNFA 2X4AA 4HU7A 5B8AA 3W6GA 4X1UA 1G6WA 4L0UA 4AJ6A 4X0XA 2QC7A 2V1MA 4FIWA 2HT9A 2OBIA 2ZUPA 1SK1A 1E6BA 4I5QA 4LLRA 4FQUA 3KM6A 4MF5A 3OR5A 2E7PA 3GSTA 1M99A 4AJ7A 1SYXA 4TN8A 2HZFA 3UVHA 3D4TA 2B7KA 3E0UA 4F0BA 1K0BA 1SL0B 4MA9A 3TKRA 1WPIA 2KOKA 4LA1A 2FA4A 2WGRA 1THXA 4KNDA 6GSTA 1TXUA 2VD1A 4POMA 2YPMA 2H1LA 2X49A 3FYGA 2YWIA 5G1KA 3ZFBA 3HVSA 3J7Yb 5JCGA 2H6YA 3WGXA 4XCSA 1R5PA 1FB6A 1XWGA 3VWXA 5EY6A 5IMZA 1ZYNA 4XS6A 3UVTA 5COHA 1XW5A 3KEBA 4MNNA 1YVLA 2E2MA 3BBYA 3LQ7A 2VCTA 4RI7A 2YANA 2HRKA 5IQYA 3G7IA 2OE1A 3EU3A 3DYRA 3QAVA 2EFEA 3KXOA 4HZ2A 4O5QA 4W66A 3VPQA 1Z5YE 3TKSC 3VLNA 1T4ZA 3FZ5A 4K7IA 3HA9A 4WF5A 3EC3A 1KNGA 4Z7XA 2AAWA 5ECPB 1MDKA 4NPBA 2NVLA 1TKDB 1O6JA 2HZEB 4TW5A 2OADA 4ZB7A 1TJDA 2AV4A 1K3OA 4QL7A 2NTOA 5J40A 1WOUA 2K6VA 2CT6A 4HZ4A 3A5IA 2GT5A 4ZB9A 2KP2A 3IK9A 3SBCA 1HNAA 5ECLB 2JACA 4HOJA 3FHKA 3FEUA 3TRQA 4MF7A 1ABAA 4ZL8A 3WGEA 3FR6A 4MP4A 1U87A 2E0QA 4WETA 5AIVA 3I43A 2M46A 4RQXA 1OKTA 2MMOA 4CDOA 3ZMKA 3MDKA 2CVBA 2L57A 3GKXA 2LRCA 5D96A 4G10A 2VKZG 2ES7A 2PERA 5KN2A 3S9FA 1PGTA 1EWXA 4HUAA 2FHEA 1NHOA 1PL1A 1GTUA 4JBBA 5F06A 5A34A 5HR3A 3WD6A 3L78A 5LD0A 3DMLA 3Q19A 1J0FA 4EDZA 4IP1A 2GZYA 1UN2A 5HR0A 2FNOA 3KIJA 3GH9A 1J08A 2YN1A 1N8JA 3FMWA 3GX8A 2L6CA 4CW9A 2DLXA 11GSA 4HQZA 4JU5A 4AI6A 3GV1A 4EE0A 4K8MA 2K8SA 4PUAA 2HNLA 2H8LA 2VOCA 4ZIJA 4MH3A 2A4VA 1GNEA 1EP8A 4EIQA 1HNCA 4ECJA 3DKSA 2LJRA 1FW1A 2YCDA 5E59A 4MJEA 3CSHA 5IMVA 4A5PA 2LSTA 1SKRB 2R6KA 5CNWA 3WYWA 2GQMA 2X8CA 1TRWA 2DJJA 2UZ8A 4TR1A 2VL9A 4ECBA 2JZTA 4KDUA 3HY2A 5G31A 4ZILA 2IMKA 2O89A 3GFKA 2R0CA 1ACVA 2V6OA 4YAPA 1SD8A 3C73A 2F51A 4MLYA 1T8EB 5DALA 1YKAA 4IHUA 4K2DA 1SU9A 1W4VA 1YDKA 1ERWA 1AQVA 2HSMB 1WRYA 4CY6A 2VM1A 4YKFA 2YP6A 4IJ3A 1OE7A 1G7OA 2YV9A 5A4VA 3EWLA 4NAXA 1V98A 1PA3A 3LWAA 3CWGA 3Q74A 2V32A 2IFQB 1ZMAA 3L4NA 2GGTA 5CP1A 2IN3A 2HSNB 2QA2A 4D73A 5GZZB 2DSAA 1PRXA 4ZBBA 3KMOA 5JWRB 3DVWA 1AC1A 4F0CA 1DSBA 2G0FA 1Z7RA 5C00A 2ON5A 3A5WA 1SL2B 3O6TA 5G5EA 1FO5A 3L9SA 4PQIA 4GWRA 3LW9A 3QFAC 3IC4A 2DIYA 5DBQA 1ST9A 1GSFA 1OAZA 3CXGA 2MBTA 2I3YA 3UOMA 3VWWA 4FYCA 5ECSA 3H1NA 4KE3A 2R0PA 3G9BA 5E4WA 1FOVA 1O81A 4POBA 3ME8A 5F8BA 2GZZA 2OE3A 1PSQA 4KCAA 22GSA 3LJRA 2C0EA 5D93A 4TXOA 3MNGA 1E2YA 1QK8A 2I81A 2B6MA 2GLRA 2GZPA 1FG4A 4BWQA 2LQQA 2AB6A 2N5FA 2RLIA 5H5SA 2C80A 1Q98A 1B4QA 3FY7A 3D21A 4WBJA 2O5VA 3GX0A 2O85A 4IQ1A 2QA1A 3C71A 2H1DA 4OFNA 4AJ8A 3DEXA 4HJMA 2GSQA 4FYUA 3ERFA 4V1Ag 1S3AA 13GSA 5CREA 1I9DA 4RQRA 5A5HB 3IBHA 2IIYA 3HMJG 1K3LA 4GLTA 2IPAA 4PQ1A 2WJUA 4O7HA 4JZQA 1TTZA 2DKIA 1OVNA 2LV3A 3HZ4A 4PGTA 2DJ2A 3GL5A 2GS3A 4XS4B 1F37A 3KCMA 1AIUA 2R0GA 3R3EA 4MDCA 3F4SA 2PN8A 3GTUA 3TJKA 2L4QA 2FLSA 3FK8A 2AUVA 2TRCP 3IE3A 16GSA 3LFLA 3FZAA 1ON4A 3IHGA 2XPDA 1WJKA 1SKSB 4YH2A 1GH2A 1PQNA 5KN3A 2XBIA 4KH7A 2PGTA 2B1KA 4WBRD 3O76A 18GSA 4PXOA 3ZVJD 1PD21 1AUCA 1HQOA 3GUSA 4GRFA 4MCUA 2JU5A 4HQSA 2CVDA 1X9SB 5CRDA 3UBLA 2YJHA 3IRAA 2DJ3A 1YEPA 1V57A 2X64A 3TKQA 3A3TA 4Q5RA 2OT3A 1PMTA 5ECOB 3GN3A 1NHYA 2I9HA 1ZYPA 4DSSB 3EURA 1QXHA 1ERUA 4ULXA 2GSTA 5ID2B 3RPPA 3M3MA 1QUWA 4BPYA 2GT6A 5D8IA 2GDRA 3EVIA 3LEFA 3ZVJA 5KEJA 4N0VA 3RHCA 3BCKA 1V9WA 3WGDA 1M9BA 2OACA 1MD4A 4RUVA 1EZKA 1B48A 2LJAA 4OCFA 2GSSA 4QMKA 2VCWA 4MABA 1OC9B 1V2AA 4ML6A 4IVFA 1YF0A 3IDVA 2WDUA 2YZUA 1JZWA 1SVLA 3G7YA 1GSSA 2FWEA 5DQYA 1Y25A 5J9CA 3C8EA 3HHVA 4TXVA 5F0GA 1R4WA 3QMXA 4TKYA 3H4KA 5D9VA 1TP9A 3TU3B 4J56E 12GSA 3GRXA 2KHPA 4HEA2 4JR4A 5HR2A 1M7TA 3UIWA 2RIIA 1GSYA 2H0IA 1M2DA 4FH8A 4KX4A 3DD3A 2K18A 5D9TA 2VCZA 3NZNA 1DUGA 1OE8A 5EPFA 17GSA 4NHWA 1HNBA 2EFCA 2GTUA 3R2QA 2FWGA 2FY6A 4JE1A 2A2PA 5ELAA 4BWSA 4ZB6A 3GA4A 2GVPA 1XIYA 5DAKB 2H1BA 5J9BA 5J4YA 3QFBC 2TRXA 5CRHA 4TR0A 5J41A 2CVKA 2LNSA 2HRAA 14GSA 5AIXA 4WKWA 2M72A 2ON7A 1X5DA 2GQLA 2IWTA 5ECQB 2TIRA 1O85A 5IMDA 1Y6EA 4Q5QA 1X5EA 4F2IA 3HJOA 1K3YA 3IHQA 2FWFA 4IGJA 3DVXA 2YOIA 1AQWA 3ZMLA 3QCPA 3G7JA 1GRXA 5DCGA 1Z6NA 4MK3A 6GSSA 2F3MA 4DVCA 1GLPA 3EE2A 4TR4A 1TW9A 3LXTA 1F3AA 1FOHA 4BVYB 1UC7A 4TR3A 2L6DA 4MH2A 2VL3A 2FUG2 2DJKA 1M2AA 2B5EA 1USBA 2F8FA 3IA1A 4KDYA 3F4RA 6GSVA 3KZQA 4NXIA 4V2NA 2PMTA 5J3RA 3IC8A 3GNJA 3UEMA 1SJIA 4ECCA 3RBTA 1BQ7A 1GUHA 2LJKA 1SD9A 4BL7A 1EOHA 2P31A 2C1YA 1W89A 1A2MA 4FYBA 3VWUA 3KP8A 3RPNA 2HLSA 2LEGA 3C1SA 1TRSA 2P5QA 5EVOA 3UAPA 1BYEA 3D0ZA 2H0HA 5F07A 1BX9A 2R2JA 2KP1A 1KEBA 5B6NA 3GSSA 1G0TA 4BVXB 5AISA 4ZBDA 4EC0A 4AKHA 3MYDA 1TRVA 4Z2RA 1TDIA 1MDIA 4DSRA 1EOGA 2C3QA 3IAM2 1V40A 1DBYA 4GXZA 3TKSA 3NIVA 3Q18A 2WRTA 5KN1A 2HSMA 1KTEA 1KBNA 4YQMA 1PL2A 1GL8A 2RM5A 1YY7A 4E8HA 1DE1A 5IOXA 2KUCA 4PTSA 3TDGA 4JEDA 1XVWA 3FZ4A 3LG6A 1VGLA 2M80A 1VF1A 1TK0B 2PWJA 2F9SA 4OCEA 1U3AA 3FR9A 2LRTA 1YEXA 3CSJA 1FAAA 2FCHA 3VK9A 4KB3A 1AAZA 3P8WA 3LORA 2HRKB 1O8XA 2YWNA 2DC5A 4HI7A 2OBKA 2GSRA 2CQ9A 4QQ7A 2C0GA 1GULA 4I97A 3F3QA 3ERWA 1A23A 5ECKB 4ICYA 2HXKA 5DJMA 3GKMA 4F82A 1ZGNA 1O7UA 4FO5A 5ECRB 2J9HA 1G7EA 4KUNA 2A2SA 4PQHA 5AGYA 3ZZXA 2YV7A 5IOWA 1XVQA 5DVBA 4JR6A 4G0LA 4PNGA 3GIXA 2EIOA 5CRWA 5B6MA 4TRXA 6GSUA 3M9KA 2H74A 5KOWA 2V6KA 4N0ZA 5FHIA 3HDCA 3KMNA 3L9VA 2OKAA 1SL1B 2VAFA 2IJYA 4JRRA 3P90A 3ZFLA 4I8BA 1Z7PA 1A0FA 1AQXA 1ERVA 3FW2A 4MJCA 3W8JA 3QD9A 3M9JA 2AHEA 5ELGA 2WCIA 4GCIA 3HJPA 3QR6A 1SVOA 3CRTA 1S3DA 5CAXA 5A5HA 4ML1A 2OA7A 3E3EA 4KAEA 2REMA 8GSSA 2H1AA 3EPTA 1GSEA 2E2GA 2FWHA 3N5OA 4IBPA 2VIMA 4HS1A 3HVXA 4ZXGA 5H5QA 2CZ3A 1GNWA 2CZ2A 2PUKC 1F3BA 2QGVA 1QGVA 3TJBA 2MMNA 4G19A 5CYYA 1ZCPA 3PINA 3M0FA 1TI3A 1F2EA 5IPHA 2MMAA 1ZZYA 4K0GA 4PUFC 2B7JA 3LYPA 2X8GA 2EC4A 2A2RA 4I2TA 5G1LA 4DSQA 4OFTA 2YWOA 1J9BA 4TVEA 1GLQA 3W8SA 3M1GA 1Z9HA 4L5OA 3F0IA 3F9UA 4LMVA 1A2LA 1OC3A 4N10A 4TR1B 4ID0A 3KGKA 4HJ2A 3EINA 4POLA 1BF5A 3U6VA 1EP7A 3LGCA 3ERGA 1H75A 3FZ9A 2NBSA 2JZSA 2O7KA 5EL8A 3PR8A 4PX1A 3GHAA 2JSYA 5DALB 4K7NA 1T3BA 2A4HA 5GAPD 4ZB8A 3CSIA 3F3RA 2IMDA 4OO4A 1XZOA 3GH6A 3LXZA 7GSSA 1XW9A 3RHBA 4H86A 4YQVA 1GSQA 1RQMA 1B4PA 2PPTA 1GTBA 3JCML 2XPEA 5C04A 4Z2UA 1OC9A 1V58A 5DJLA 5IO0A 5IO2A 1F6MC 1CQGA 1FB0A 1PN0A 5H5RA 1Q4JA 4USSA 2LNTA 4MPGA 4D73B 2C3TA 3IPZA 3TKPA 5A1NB 4KF9A 1A0RP 3CRUA 4GQCA 2HFDA 4IN0A 3ZYWA 1WWJA 3VPTA 1EEJA 1JFUA 4EDYA 4EXJA 1XOBA 1QQ2A 4NHZA 3ME7A 1TU8A 1AW9A 4OFMA 1GTAA 3VWVA 4E8EA 1XXUA 2IMIA 3EYTA 2WULA 3M8NA 4F03A 3TGZA 2YZHA 4HDEA 2HYXA 2FGXA 1R7HA 4V1Ap 2L59A 2H71A 4Q5NA 4ZL7A 1YJ6A 2DBCA 1OC8A 2VD0A 1U88A 4TXOB 1JZRA 1XOAA 3EU4A 1RW1A 2LRNA 6GSXA 4IW9A 3KTBA 9GSSA 4GTUA 6GSYA 1Y1UA 3KJYA 4EUYA 5JCUA 1T7PB 4GQFA 3IXRA 4GSNA 5A4WA 1THOA 1JZDA 3LYKA 2BMXA 2JSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7M A;  3QPM A;  5ECI B;  3IV4 A;  2YJ7 A;  5B8B A;  1X9M B;  3L0H A;  1WP0 A;  1NW2 A;  2H1G A;  3CYN A;  5IMA A;  1MTC A;  1Z6M A;  3HKR A;  1Z3E A;  5A4U A;  3HCZ A;  1TI1 A;  5LCZ A;  4AF2 A;  4KSO A;  1DE2 A;  2H75 A;  4LL4 B;  4KGI A;  1X5C A;  2VL2 C;  4POK A;  1OKD A;  2CX4 A;  1BJX A;  5D73 A;  2JAD A;  2H6X A;  5AN1 A;  2WFC A;  2F8A A;  1XWK A;  2H0G A;  1AXD A;  3FR3 A;  3AY8 A;  1A8L A;  2NDO A;  2H6Z A;  3GTU B;  2AJQ B;  2VLU A;  2QKE A;  5IIZ A;  3UMA A;  1GUM A;  3P2A A;  1ZOF A;  1LJR A;  2HRN A;  2BTO T;  4CHS A;  2C8U A;  3TJF A;  1IYI A;  4V2L A;  1TOF A;  4G2E A;  1PKZ A;  2HSH A;  2LS5 A;  4NV5 A;  1WMJ A;  4K9Z A;  4G9H A;  1PKW A;  4Q5F A;  2KLX A;  4OD7 A;  1EV4 A;  4K1F A;  4J57 E;  1FVK A;  4HU9 A;  3TOT A;  3O3T A;  4WR4 A;  2I4A A;  2VCV A;  4YQU A;  3KP9 A;  4O32 A;  2R3X A;  3VI5 A;  2HZE A;  2EIQ A;  1TK5 B;  3F63 A;  3E9J B;  2DIZ A;  2FD3 A;  3ZLP A;  3D5J A;  3MAK A;  2P0G A;  1BG5 A;  4V2M A;  2H66 A;  4MF6 A;  2RM6 A;  1TXX A;  5FWG A;  4BVX A;  1R26 A;  2DJ1 A;  1PN9 A;  2N5A A;  3KTL A;  2NPB A;  1JHB A;  3ED3 A;  2LQO A;  4L0W A;  3NOF A;  2CV4 A;  2YNX A;  3APS A;  3C1R A;  4ECI A;  2EIR A;  2VCX A;  3UJ1 A;  2OE0 A;  1HD2 A;  3A2W A;  3US3 A;  5DCH A;  3CTF A;  4EL1 A;  3N9J A;  2HQT A;  1YKC A;  3CBU A;  4BA7 A;  2O87 A;  5J4U A;  5INY A;  3ZIJ A;  2B3S A;  1K0A A;  4QL9 A;  2H76 A;  6GSW A;  1SKW B;  3UL3 A;  1SYR A;  1QFN A;  3GYK A;  4G0I A;  5ECH B;  1T00 A;  4NV2 A;  1B8X A;  4KW6 A;  2C3N A;  3Q6O A;  3A2X A;  3P7X A;  4K0N A;  2V41 A;  3MSZ A;  3HZ8 A;  1GSD A;  3GL3 A;  19GS A;  3IK7 A;  2R5G A;  3GMF A;  1VF4 A;  4OMV A;  1EGO A;  2PVO C;  1PX6 A;  1GSU A;  3F6D A;  3BCI A;  4IJI A;  2DJ0 A;  5ABR A;  5GAN D;  4K6X A;  2VUP A;  3ZIT A;  1UA5 A;  3ZRE A;  2X99 A;  1LBK A;  5G5F A;  4ISD A;  2B1L A;  3H79 A;  2BJX A;  4GSS A;  4LL1 B;  3IR4 A;  5HFI A;  4MJA A;  5IPG A;  3D22 A;  5F05 A;  5HR1 A;  2K8V A;  1PX7 A;  2VLT A;  2XHF A;  3PH9 A;  3EMP A;  3HD5 A;  3APQ A;  4IS0 A;  3D6I A;  3F6F A;  4RI6 A;  2VO4 A;  4KDX A;  4KA0 A;  1GWC A;  4MZW A;  3TOU A;  2CA8 A;  5ECM B;  2MYG A;  1GP1 A;  2GQK A;  3WT1 A;  2K9F A;  2IFQ A;  4I2U A;  4J2F A;  3BD2 A;  4EKZ A;  2XBQ A;  1XW6 A;  4K7O A;  5JWO B;  4MPF A;  5DQS A;  2PU9 C;  2JZR A;  5HQP A;  1EGR A;  2XC2 A;  3VI7 A;  4L5L A;  1ERT A;  4KCE A;  3TB2 A;  3WT2 A;  1XWC A;  3HVV A;  4IP6 A;  4WR5 A;  2J23 A;  3I6A A;  3KH7 A;  1K0D A;  1XFL A;  3DXB A;  1ML6 A;  1F9M A;  4P3Y B;  1U6T A;  4BL7 B;  3H8Q A;  4N11 A;  2MZC A;  1SJ6 A;  1X9W B;  4AGS A;  5IM9 A;  5GSS A;  1JLW A;  2ZNM A;  2PBJ A;  4IQA A;  1M2B A;  1N2A A;  5ENU A;  2JL4 A;  2RUE A;  3A2V A;  4YAV A;  3VFI A;  2X8H A;  5B7C A;  3F4T A;  1BED A;  3V1W A;  2DMM A;  3RAZ A;  1VF2 A;  3TCO A;  2CAI A;  2D2Z A;  3HXS A;  3QOU A;  2I1U A;  3DRN A;  4XS1 A;  4XS4 A;  1K0N A;  2LKU A;  1SJZ A;  2V2G A;  2H70 A;  5GST A;  2L5L A;  2IMF A;  2O8V B;  3PGT A;  1YZX A;  2CX3 A;  1ZL9 A;  5CO3 A;  3ZRD A;  1ILO A;  4XTS A;  1YQ1 A;  1B9X C;  3VUR A;  2C0D A;  3U5R E;  4ZL9 A;  2AYT A;  1T4Y A;  2FA8 A;  2HE3 A;  2LTK A;  5J5N A;  4F9Z A;  3FKF A;  3QDN A;  1VRS D;  5JCW A;  1VF3 A;  5CRG A;  4XRA A;  1XCC A;  1FVJ A;  3MWH A;  4N30 A;  3TUE A;  4NMU A;  5IMF A;  1JZO A;  1M0U A;  1MDJ A;  1TK8 B;  1GTI A;  1U3I A;  1EV9 A;  3UBK A;  1ZYE A;  5DDL A;  1G6Y A;  1XBS A;  2R4V A;  2MBS A;  4ZBA A;  5IMC A;  1XWB A;  1LU4 A;  2N5B A;  1H4O A;  4MZB A;  1A24 A;  1I5G A;  2IL3 A;  5LNK e;  4DSS A;  3GKK A;  1FHE A;  3K8N A;  5ID2 A;  1OYJ A;  4PUR A;  3RDW A;  4WXT A;  3LSZ A;  5KN0 A;  4X43 A;  4XRD A;  3QAG A;  3CTG A;  4WF4 A;  3SWL A;  4TOP A;  3CMI A;  1WIK A;  1NSW A;  1XWA A;  1O73 A;  3BJ5 A;  5ECN B;  4IEL A;  3F8U A;  2ZCT A;  1RK4 A;  1URM A;  1QMV A;  3ZIV A;  5D9X A;  2H01 A;  1S3C A;  4GST A;  2B5Y A;  1C72 A;  1BAY A;  1O8W A;  4NWY A;  3DGQ A;  1CQH A;  1YF1 A;  2LUS A;  3UAR A;  4O92 A;  1ZYQ B;  5G2Z A;  1B9Y C;  3ZL5 A;  1SEN A;  20GS A;  2QSI A;  4XHM A;  5G30 A;  1A8Y A;  1SK2 A;  3IOS A;  1XPV A;  2VLV A;  2H19 A;  2HSY A;  3HJM A;  1K0C A;  3APO A;  4MJB A;  1IYH A;  4MZC A;  1TU7 A;  5L71 A;  1MEK A;  2Z9S A;  2ALB A;  5HFK A;  3FRC A;  3J7Y k;  3KD0 A;  2IME A;  4OWY A;  5DAK A;  3TRX A;  3HYP A;  4G0K A;  3KH9 A;  3ZTL A;  4IKH A;  3BOA A;  3ISO A;  2P5R A;  4GF0 A;  1EEM A;  3D4M A;  3DIE A;  4XIH A;  10GS A;  2C0F A;  2H72 A;  1UVZ A;  2MMZ A;  1A2J A;  4EF0 A;  1K0M A;  2CAQ A;  2R37 A;  3QAW A;  1MD3 A;  2H73 A;  1NM3 A;  4EO3 A;  3EMX A;  5A5K A;  3IAS 2;  5BMU A;  2WS2 A;  4DEJ A;  2G2Q A;  5JWQ B;  1R5A A;  4O5R A;  3GUR A;  2B5X A;  2YWM A;  3I9V 2;  2DML A;  4WEY A;  2RUF A;  3I69 A;  4LMW A;  2H30 A;  2HRF A;  2L4C A;  3DWV A;  4I6X A;  1X0R A;  4BVY A;  4EVM A;  1JLV A;  4OO5 A;  3TRP A;  3GKN A;  2HI7 A;  1HYU A;  2WZ9 A;  1SK0 A;  3TKS E;  3H93 A;  1K0O A;  1M9A A;  5FT3 A;  2VCQ A;  1T1V A;  5D9W A;  3PPU A;  3TJG A;  2L5O A;  1TRU A;  2C4J A;  4MMM A;  4KSM A;  2VL2 A;  3TJJ A;  4L8E A;  2WB9 A;  3L9U A;  2VM2 A;  2OJL A;  4ACS A;  1WE0 A;  5HFG A;  2PVQ A;  4ILF A;  1GUK A;  4PNF A;  4HU7 A;  5B8A A;  3W6G A;  4X1U A;  1G6W A;  4L0U A;  4AJ6 A;  4X0X A;  2QC7 A;  2V1M A;  4FIW A;  2HT9 A;  2OBI A;  2ZUP A;  1SK1 A;  1E6B A;  4I5Q A;  4LLR A;  4FQU A;  3KM6 A;  4MF5 A;  3OR5 A;  2E7P A;  3GST A;  1M99 A;  4AJ7 A;  1SYX A;  4TN8 A;  2HZF A;  3UVH A;  3D4T A;  2B7K A;  3E0U A;  4F0B A;  1K0B A;  1SL0 B;  4MA9 A;  3TKR A;  1WPI A;  2KOK A;  4LA1 A;  2FA4 A;  2WGR A;  1THX A;  4KND A;  6GST A;  2VD1 A;  4POM A;  2YPM A;  3FYG A;  2YWI A;  5G1K A;  3ZFB A;  3HVS A;  3J7Y b;  5JCG A;  2H6Y A;  3WGX A;  4XCS A;  1R5P A;  1FB6 A;  1XWG A;  3VWX A;  5EY6 A;  5IMZ A;  4XS6 A;  3UVT A;  5COH A;  1XW5 A;  3KEB A;  2E2M A;  3BBY A;  3LQ7 A;  2VCT A;  4RI7 A;  2YAN A;  2HRK A;  5IQY A;  3G7I A;  2OE1 A;  3EU3 A;  3DYR A;  3QAV A;  3KXO A;  4HZ2 A;  3VPQ A;  1Z5Y E;  3TKS C;  3VLN A;  1T4Z A;  3FZ5 A;  4K7I A;  3HA9 A;  4WF5 A;  3EC3 A;  1KNG A;  4Z7X A;  2AAW A;  5ECP B;  1MDK A;  4NPB A;  2NVL A;  1TKD B;  1O6J A;  2HZE B;  4TW5 A;  2OAD A;  1TJD A;  2AV4 A;  1K3O A;  4QL7 A;  2NTO A;  1WOU A;  2K6V A;  2CT6 A;  4HZ4 A;  2GT5 A;  4ZB9 A;  2KP2 A;  3IK9 A;  3SBC A;  1HNA A;  5ECL B;  2JAC A;  4HOJ A;  3FHK A;  3FEU A;  3TRQ A;  4MF7 A;  1ABA A;  4ZL8 A;  3WGE A;  3FR6 A;  4MP4 A;  1U87 A;  2E0Q A;  4WET A;  5AIV A;  3I43 A;  2M46 A;  4RQX A;  1OKT A;  2MMO A;  4CDO A;  3ZMK A;  3MDK A;  2CVB A;  2L57 A;  3GKX A;  2LRC A;  5D96 A;  4G10 A;  2ES7 A;  2PER A;  5KN2 A;  3S9F A;  1PGT A;  1EWX A;  4HUA A;  2FHE A;  1NHO A;  1PL1 A;  1GTU A;  4JBB A;  5F06 A;  5HR3 A;  3WD6 A;  3L78 A;  5LD0 A;  3DML A;  3Q19 A;  1J0F A;  4EDZ A;  4IP1 A;  2GZY A;  1UN2 A;  5HR0 A;  2FNO A;  3KIJ A;  3GH9 A;  1J08 A;  2YN1 A;  1N8J A;  3GX8 A;  4CW9 A;  2L6C A;  2DLX A;  11GS A;  4HQZ A;  4JU5 A;  3GV1 A;  4EE0 A;  4K8M A;  2K8S A;  4PUA A;  2HNL A;  2H8L A;  2VOC A;  4ZIJ A;  4MH3 A;  2A4V A;  1GNE A;  1EP8 A;  1HNC A;  4ECJ A;  3DKS A;  2LJR A;  1FW1 A;  2YCD A;  5E59 A;  4MJE A;  3CSH A;  5IMV A;  2LST A;  1SKR B;  2R6K A;  5CNW A;  3WYW A;  2GQM A;  2X8C A;  1TRW A;  2DJJ A;  2UZ8 A;  4TR1 A;  2VL9 A;  4ECB A;  2JZT A;  4KDU A;  3HY2 A;  5G31 A;  4ZIL A;  2IMK A;  2O89 A;  3GFK A;  1ACV A;  2V6O A;  4YAP A;  1SD8 A;  3C73 A;  2F51 A;  4MLY A;  1T8E B;  5DAL A;  1YKA A;  4IHU A;  4K2D A;  1SU9 A;  1W4V A;  1YDK A;  1ERW A;  1AQV A;  2HSM B;  1WRY A;  2VM1 A;  2YP6 A;  4IJ3 A;  1OE7 A;  1G7O A;  2YV9 A;  5A4V A;  3EWL A;  4NAX A;  1V98 A;  1PA3 A;  3LWA A;  3Q74 A;  2V32 A;  2IFQ B;  1ZMA A;  3L4N A;  2GGT A;  5CP1 A;  2IN3 A;  2HSN B;  4D73 A;  5GZZ B;  2DSA A;  1PRX A;  4ZBB A;  3KMO A;  5JWR B;  3DVW A;  1AC1 A;  4F0C A;  1DSB A;  2G0F A;  1Z7R A;  5C00 A;  2ON5 A;  3A5W A;  1SL2 B;  3O6T A;  5G5E A;  1FO5 A;  3L9S A;  4PQI A;  4GWR A;  3QFA C;  3IC4 A;  2DIY A;  5DBQ A;  1ST9 A;  1GSF A;  1OAZ A;  3CXG A;  2MBT A;  2I3Y A;  3UOM A;  3VWW A;  4FYC A;  5ECS A;  3H1N A;  4KE3 A;  3G9B A;  5E4W A;  1FOV A;  1O81 A;  4POB A;  3ME8 A;  5F8B A;  2GZZ A;  2OE3 A;  1PSQ A;  4KCA A;  22GS A;  3LJR A;  2C0E A;  5D93 A;  4TXO A;  3MNG A;  1E2Y A;  1QK8 A;  2I81 A;  2B6M A;  2GLR A;  2GZP A;  1FG4 A;  4BWQ A;  2LQQ A;  2AB6 A;  2N5F A;  2RLI A;  5H5S A;  2C80 A;  1Q98 A;  1B4Q A;  3FY7 A;  3D21 A;  4WBJ A;  3GX0 A;  2O85 A;  4IQ1 A;  3C71 A;  2H1D A;  4OFN A;  4AJ8 A;  3DEX A;  4HJM A;  2GSQ A;  4FYU A;  3ERF A;  4V1A g;  1S3A A;  13GS A;  5CRE A;  1I9D A;  4RQR A;  3IBH A;  2IIY A;  1K3L A;  4GLT A;  2IPA A;  4PQ1 A;  2WJU A;  4O7H A;  4JZQ A;  1TTZ A;  1OVN A;  2LV3 A;  3HZ4 A;  4PGT A;  2DJ2 A;  3GL5 A;  2GS3 A;  4XS4 B;  1F37 A;  3KCM A;  1AIU A;  3R3E A;  4MDC A;  3F4S A;  2PN8 A;  3GTU A;  3TJK A;  2L4Q A;  2FLS A;  3FK8 A;  2AUV A;  2TRC P;  3IE3 A;  16GS A;  3LFL A;  3FZA A;  1ON4 A;  2XPD A;  1WJK A;  1SKS B;  4YH2 A;  1GH2 A;  1PQN A;  5KN3 A;  2XBI A;  4KH7 A;  2PGT A;  2B1K A;  4WBR D;  3O76 A;  18GS A;  4PXO A;  3ZVJ D;  1PD2 1;  1AUC A;  1HQO A;  3GUS A;  4GRF A;  4MCU A;  2JU5 A;  4HQS A;  2CVD A;  1X9S B;  5CRD A;  3UBL A;  2YJH A;  3IRA A;  2DJ3 A;  1YEP A;  1V57 A;  2X64 A;  3TKQ A;  3A3T A;  4Q5R A;  1PMT A;  5ECO B;  3GN3 A;  1NHY A;  2I9H A;  4DSS B;  3EUR A;  1QXH A;  1ERU A;  4ULX A;  2GST A;  5ID2 B;  3RPP A;  3M3M A;  1QUW A;  4BPY A;  2GT6 A;  5D8I A;  2GDR A;  3EVI A;  3LEF A;  3ZVJ A;  5KEJ A;  4N0V A;  3RHC A;  3BCK A;  1V9W A;  3WGD A;  1M9B A;  2OAC A;  1MD4 A;  4RUV A;  1EZK A;  1B48 A;  2LJA A;  4OCF A;  2GSS A;  2VCW A;  4MAB A;  1OC9 B;  1V2A A;  4ML6 A;  4IVF A;  1YF0 A;  3IDV A;  2WDU A;  2YZU A;  1JZW A;  3G7Y A;  1GSS A;  2FWE A;  5DQY A;  1Y25 A;  5J9C A;  3C8E A;  3HHV A;  4TXV A;  5F0G A;  1R4W A;  3QMX A;  4TKY A;  3H4K A;  5D9V A;  1TP9 A;  4J56 E;  12GS A;  3GRX A;  2KHP A;  4HEA 2;  4JR4 A;  5HR2 A;  1M7T A;  3UIW A;  2RII A;  1GSY A;  2H0I A;  1M2D A;  4FH8 A;  4KX4 A;  3DD3 A;  2K18 A;  5D9T A;  2VCZ A;  3NZN A;  1DUG A;  1OE8 A;  5EPF A;  17GS A;  4NHW A;  1HNB A;  2GTU A;  3R2Q A;  2FWG A;  2FY6 A;  4JE1 A;  5ELA A;  4BWS A;  4ZB6 A;  3GA4 A;  2GVP A;  1XIY A;  5DAK B;  2H1B A;  5J9B A;  3QFB C;  2TRX A;  5CRH A;  4TR0 A;  5J41 A;  2CVK A;  2LNS A;  2HRA A;  14GS A;  5AIX A;  4WKW A;  2M72 A;  2ON7 A;  1X5D A;  2GQL A;  2IWT A;  5ECQ B;  2TIR A;  1O85 A;  5IMD A;  1Y6E A;  4Q5Q A;  1X5E A;  4F2I A;  3HJO A;  1K3Y A;  3IHQ A;  2FWF A;  4IGJ A;  3DVX A;  2YOI A;  1AQW A;  3ZML A;  3QCP A;  3G7J A;  1GRX A;  5DCG A;  1Z6N A;  4MK3 A;  6GSS A;  2F3M A;  4DVC A;  1GLP A;  3EE2 A;  4TR4 A;  1TW9 A;  3LXT A;  1F3A A;  4BVY B;  1UC7 A;  4TR3 A;  2L6D A;  4MH2 A;  2VL3 A;  2FUG 2;  2DJK A;  1M2A A;  2B5E A;  1USB A;  2F8F A;  3IA1 A;  4KDY A;  3F4R A;  6GSV A;  3KZQ A;  4NXI A;  4V2N A;  2PMT A;  5J3R A;  3IC8 A;  3GNJ A;  3UEM A;  1SJI A;  4ECC A;  3RBT A;  1BQ7 A;  1GUH A;  2LJK A;  1SD9 A;  4BL7 A;  1EOH A;  2P31 A;  2C1Y A;  1W89 A;  1A2M A;  4FYB A;  3VWU A;  3KP8 A;  3RPN A;  2HLS A;  2LEG A;  3C1S A;  1TRS A;  2P5Q A;  5EVO A;  3UAP A;  1BYE A;  3D0Z A;  2H0H A;  5F07 A;  1BX9 A;  2R2J A;  2KP1 A;  1KEB A;  5B6N A;  3GSS A;  1G0T A;  4BVX B;  5AIS A;  4ZBD A;  4EC0 A;  1TRV A;  1TDI A;  1MDI A;  4DSR A;  1EOG A;  2C3Q A;  3IAM 2;  1V40 A;  1DBY A;  4GXZ A;  3TKS A;  3NIV A;  3Q18 A;  2WRT A;  5KN1 A;  2HSM A;  1KTE A;  1KBN A;  4YQM A;  1PL2 A;  1GL8 A;  2RM5 A;  1YY7 A;  4E8H A;  1DE1 A;  5IOX A;  2KUC A;  4PTS A;  3TDG A;  4JED A;  1XVW A;  3FZ4 A;  3LG6 A;  1VGL A;  2M80 A;  1VF1 A;  1TK0 B;  2PWJ A;  2F9S A;  4OCE A;  1U3A A;  3FR9 A;  2LRT A;  1YEX A;  3CSJ A;  1FAA A;  2FCH A;  3VK9 A;  4KB3 A;  1AAZ A;  3P8W A;  3LOR A;  2HRK B;  1O8X A;  2YWN A;  2DC5 A;  4HI7 A;  2OBK A;  2GSR A;  2CQ9 A;  4QQ7 A;  2C0G A;  1GUL A;  4I97 A;  3F3Q A;  3ERW A;  1A23 A;  5ECK B;  2HXK A;  5DJM A;  3GKM A;  4F82 A;  1ZGN A;  1O7U A;  4FO5 A;  5ECR B;  2J9H A;  1G7E A;  4KUN A;  2A2S A;  4PQH A;  5AGY A;  3ZZX A;  2YV7 A;  5IOW A;  1XVQ A;  5DVB A;  4JR6 A;  4G0L A;  4PNG A;  3GIX A;  2EIO A;  5CRW A;  5B6M A;  4TRX A;  6GSU A;  3M9K A;  2H74 A;  2V6K A;  4N0Z A;  5FHI A;  3HDC A;  3KMN A;  3L9V A;  2OKA A;  1SL1 B;  2VAF A;  2IJY A;  4JRR A;  3P90 A;  3ZFL A;  4I8B A;  1Z7P A;  1A0F A;  1AQX A;  1ERV A;  3FW2 A;  4MJC A;  3W8J A;  3QD9 A;  3M9J A;  2AHE A;  5ELG A;  2WCI A;  4GCI A;  3HJP A;  3QR6 A;  3CRT A;  1S3D A;  5CAX A;  4ML1 A;  2OA7 A;  3E3E A;  4KAE A;  2REM A;  8GSS A;  2H1A A;  1GSE A;  2E2G A;  2FWH A;  3N5O A;  4IBP A;  2VIM A;  4HS1 A;  3HVX A;  4ZXG A;  5H5Q A;  2CZ3 A;  1GNW A;  2CZ2 A;  2PUK C;  1F3B A;  2QGV A;  1QGV A;  3TJB A;  2MMN A;  4G19 A;  5CYY A;  1ZCP A;  3PIN A;  3M0F A;  1TI3 A;  1F2E A;  5IPH A;  2MMA A;  1ZZY A;  4K0G A;  4PUF C;  2B7J A;  3LYP A;  2X8G A;  2EC4 A;  2A2R A;  4I2T A;  5G1L A;  4DSQ A;  4OFT A;  2YWO A;  1J9B A;  4TVE A;  1GLQ A;  3W8S A;  3M1G A;  1Z9H A;  4L5O A;  3F0I A;  3F9U A;  4LMV A;  1A2L A;  1OC3 A;  4N10 A;  4TR1 B;  4ID0 A;  3KGK A;  4HJ2 A;  3EIN A;  4POL A;  3U6V A;  1EP7 A;  3LGC A;  3ERG A;  1H75 A;  3FZ9 A;  2NBS A;  2JZS A;  2O7K A;  5EL8 A;  3PR8 A;  4PX1 A;  3GHA A;  2JSY A;  5DAL B;  4K7N A;  1T3B A;  5GAP D;  4ZB8 A;  3CSI A;  3F3R A;  2IMD A;  4OO4 A;  1XZO A;  3GH6 A;  3LXZ A;  7GSS A;  1XW9 A;  3RHB A;  4H86 A;  4YQV A;  1GSQ A;  1RQM A;  1B4P A;  2PPT A;  1GTB A;  3JCM L;  2XPE A;  5C04 A;  1OC9 A;  1V58 A;  5DJL A;  5IO0 A;  5IO2 A;  1F6M C;  1CQG A;  1FB0 A;  5H5R A;  1Q4J A;  4USS A;  2LNT A;  4MPG A;  4D73 B;  2C3T A;  3IPZ A;  3TKP A;  4KF9 A;  1A0R P;  3CRU A;  4GQC A;  2HFD A;  4IN0 A;  3ZYW A;  1WWJ A;  3VPT A;  1EEJ A;  1JFU A;  4EDY A;  4EXJ A;  1XOB A;  1QQ2 A;  4NHZ A;  3ME7 A;  1TU8 A;  1AW9 A;  4OFM A;  1GTA A;  3VWV A;  4E8E A;  1XXU A;  2IMI A;  3EYT A;  2WUL A;  3M8N A;  4F03 A;  3TGZ A;  2YZH A;  4HDE A;  2HYX A;  2FGX A;  1R7H A;  4V1A p;  2L59 A;  2H71 A;  4Q5N A;  4ZL7 A;  1YJ6 A;  2DBC A;  1OC8 A;  2VD0 A;  1U88 A;  4TXO B;  1JZR A;  1XOA A;  3EU4 A;  1RW1 A;  2LRN A;  6GSX A;  4IW9 A;  3KTB A;  9GSS A;  4GTU A;  6GSY A;  3KJY A;  4EUY A;  5JCU A;  1T7P B;  4GQF A;  3IXR A;  4GSN A;  5A4W A;  1THO A;  1JZD A;  3LYK A;  2BMX A;  2JSZ A; 
#chains in the Genus database with same CATH topology
 3C7M A;  4YKG A;  3QPM A;  5ECI B;  3IV4 A;  2YJ7 A;  5B8B A;  1X9M B;  3L0H A;  1WP0 A;  1NW2 A;  2H1G A;  3CYN A;  5IMA A;  1MTC A;  1Z6M A;  3HKR A;  1Z3E A;  5A4U A;  3HCZ A;  1TI1 A;  5LCZ A;  4AF2 A;  4KSO A;  1DE2 A;  2H75 A;  4LL4 B;  4KGI A;  1X5C A;  2VL2 C;  4POK A;  1OKD A;  2CX4 A;  1BJX A;  5D73 A;  2JAD A;  2H6X A;  4K2X A;  5AN1 A;  2WFC A;  2F8A A;  1XWK A;  2H0G A;  1AXD A;  3FR3 A;  3AY8 A;  1A8L A;  2NDO A;  2H6Z A;  3GTU B;  2AJQ B;  2VLU A;  2QKE A;  5IIZ A;  3UMA A;  1GUM A;  3P2A A;  1ZOF A;  1LJR A;  2HRN A;  2BTO T;  4CHS A;  2C8U A;  3TJF A;  1IYI A;  4V2L A;  1TOF A;  4G2E A;  1PKZ A;  2HSH A;  2LS5 A;  4NV5 A;  1WMJ A;  4K9Z A;  4G9H A;  1PKW A;  4Q5F A;  2KLX A;  4OD7 A;  1EV4 A;  4K1F A;  4J57 E;  1FVK A;  4HU9 A;  3TOT A;  3O3T A;  4WR4 A;  4K5S A;  2I4A A;  2VCV A;  4YQU A;  3KP9 A;  4O32 A;  2R3X A;  4EIP A;  3VI5 A;  2HZE A;  2EIQ A;  1TK5 B;  3F63 A;  3E9J B;  2DIZ A;  2FD3 A;  3ZLP A;  3D5J A;  3MAK A;  2P0G A;  1BG5 A;  4V2M A;  2H66 A;  4MF6 A;  2RM6 A;  1TXX A;  5FWG A;  4BVX A;  5BMU B;  2WVY A;  1R26 A;  2DJ1 A;  1PN9 A;  5KOX A;  3MIX A;  2N5A A;  3KTL A;  2NPB A;  1JHB A;  3ED3 A;  2LQO A;  4L0W A;  3NOF A;  2CV4 A;  2YNX A;  3APS A;  3C1R A;  4ECI A;  2EIR A;  4N3Z A;  2VCX A;  3UJ1 A;  2OE0 A;  1HD2 A;  3A2W A;  3US3 A;  2EFH A;  5DCH A;  3CTF A;  4EL1 A;  3N9J A;  2HQT A;  4AKX B;  1YKC A;  3CBU A;  4BA7 A;  2O87 A;  5J4U A;  2UV8 G;  5INY A;  3ZIJ A;  2B3S A;  3HVN A;  1K0A A;  4QL9 A;  2H76 A;  6GSW A;  1SKW B;  3UL3 A;  1SYR A;  1QFN A;  3GYK A;  1M3I A;  4G0I A;  5ECH B;  1T00 A;  4NV2 A;  1B8X A;  4KW6 A;  2C3N A;  3Q6O A;  3A2X A;  3P7X A;  1S4B P;  4K0N A;  2V41 A;  3MSZ A;  3HZ8 A;  1GSD A;  3GL3 A;  19GS A;  3IK7 A;  2R5G A;  3GMF A;  1VF4 A;  4OMV A;  4PHZ C;  1EGO A;  2PVO C;  1PX6 A;  1GSU A;  3F6D A;  3BCI A;  4IJI A;  2DJ0 A;  5ABR A;  5GAN D;  4K6X A;  2VUP A;  3ZIT A;  1UA5 A;  3ZRE A;  2X99 A;  1LBK A;  5G5F A;  4ISD A;  2B1L A;  3H79 A;  2BJX A;  4GSS A;  4LL1 B;  3IR4 A;  5HFI A;  4MJA A;  5IPG A;  3D22 A;  5F05 A;  5HR1 A;  2K8V A;  1M3J A;  1PX7 A;  2VLT A;  2XHF A;  3PH9 A;  3EMP A;  3HD5 A;  3APQ A;  1SVM A;  4IS0 A;  3D6I A;  3F6F A;  4RI6 A;  2VO4 A;  4KDX A;  4KA0 A;  1GWC A;  4G01 A;  4MZW A;  3TOU A;  2CA8 A;  5ECM B;  2MYG A;  1GP1 A;  2GQK A;  3WT1 A;  2K9F A;  2IFQ A;  4I2U A;  4J2F A;  2HSN A;  3BD2 A;  4EKZ A;  2XBQ A;  1XW6 A;  4K7O A;  5JWO B;  4MPF A;  5DQS A;  2PU9 C;  2JZR A;  5HQP A;  1EGR A;  2XC2 A;  3VI7 A;  4L5L A;  1ERT A;  4KCE A;  3TB2 A;  3WT2 A;  1XWC A;  3CHX C;  3HVV A;  4IP6 A;  4WR5 A;  2J23 A;  4PI0 C;  3I6A A;  3KH7 A;  1K0D A;  1XFL A;  3DXB A;  1ML6 A;  1F9M A;  4P3Y B;  1U6T A;  4BL7 B;  3H8Q A;  4N11 A;  2MZC A;  1SJ6 A;  1X9W B;  4AGS A;  5IM9 A;  5GSS A;  1JLW A;  4Z2T A;  2ZNM A;  2PBJ A;  4IQA A;  1M2B A;  1N2A A;  5ENU A;  2JL4 A;  2RUE A;  3A2V A;  4YAV A;  3VFI A;  2X8H A;  5B7C A;  3F4T A;  1BED A;  3V1W A;  2DMM A;  3RAZ A;  1VF2 A;  3TCO A;  2CAI A;  2D2Z A;  3HXS A;  2DKH A;  5J4V A;  3QOU A;  2I1U A;  2EFD A;  3DRN A;  4XS1 A;  4XS4 A;  5A34 B;  1K0N A;  2LKU A;  1SJZ A;  2V2G A;  2H70 A;  5GST A;  2L5L A;  2IMF A;  2O8V B;  3PGT A;  1YZX A;  2CX3 A;  1ZL9 A;  5CO3 A;  3ZRD A;  1ILO A;  4XTS A;  1YQ1 A;  1B9X C;  3VUR A;  2C0D A;  5A1N A;  3U5R E;  1XG8 A;  4ZL9 A;  2AYT A;  1T4Y A;  2FA8 A;  2HE3 A;  2LTK A;  5J5N A;  4F9Z A;  3FKF A;  3QDN A;  1VRS D;  5JCW A;  1VF3 A;  5CRG A;  4XRA A;  1XCC A;  1FVJ A;  3MWH A;  4N30 A;  3TUE A;  4NMU A;  5IMF A;  1JZO A;  1M0U A;  1MDJ A;  1TK8 B;  1GTI A;  1U3I A;  1EV9 A;  3UBK A;  1ZYE A;  5DDL A;  1G6Y A;  1XBS A;  2R4V A;  2MBS A;  4ZBA A;  5IMC A;  1XWB A;  1LU4 A;  2N5B A;  1H4O A;  4O5U A;  4MZB A;  1A24 A;  1I5G A;  2IL3 A;  5LNK e;  4DSS A;  3GKK A;  1FHE A;  3K8N A;  5ID2 A;  1OYJ A;  4PUR A;  3RDW A;  4X4J A;  2WVX A;  4WXT A;  3LSZ A;  5KN0 A;  4X43 A;  4XRD A;  3QAG A;  3CTG A;  4WF4 A;  3SWL A;  4TOP A;  3CMI A;  1WIK A;  1NSW A;  1XWA A;  1O73 A;  3BJ5 A;  5ECN B;  4IEL A;  3F8U A;  2ZCT A;  1RK4 A;  1URM A;  1QMV A;  3ZIV A;  4CY8 A;  5D9X A;  2H01 A;  1S3C A;  4GST A;  2B5Y A;  1C72 A;  1BAY A;  1O8W A;  4NWY A;  3DGQ A;  1CQH A;  1YF1 A;  2LUS A;  3UAR A;  4O92 A;  4K5R A;  1ZYQ B;  5G2Z A;  1B9Y C;  3ZL5 A;  1SEN A;  20GS A;  2QSI A;  1N25 A;  4XHM A;  5G30 A;  1A8Y A;  1SK2 A;  3IOS A;  1XPV A;  2VLV A;  2H19 A;  2HSY A;  3HJM A;  1K0C A;  3APO A;  4MJB A;  1IYH A;  4MZC A;  1TU7 A;  5L71 A;  5BRT A;  1MEK A;  4BIK A;  2Z9S A;  2ALB A;  5HFK A;  3FRC A;  3J7Y k;  3KD0 A;  2IME A;  4OWY A;  5DAK A;  3TRX A;  3HYP A;  4G0K A;  3KH9 A;  3ZTL A;  4IKH A;  3BOA A;  3ISO A;  2P5R A;  4GF0 A;  1EEM A;  3D4M A;  3DIE A;  4XIH A;  10GS A;  2C0F A;  2H72 A;  1UVZ A;  2MMZ A;  1A2J A;  4EF0 A;  1K0M A;  2CAQ A;  2R37 A;  1MD3 A;  3QAW A;  2H73 A;  1NM3 A;  4EO3 A;  1PFO A;  3EMX A;  5A5K A;  3IAS 2;  5BMU A;  4GDF A;  2WS2 A;  4DEJ A;  2G2Q A;  5JWQ B;  1R5A A;  4O5R A;  3GUR A;  2B5X A;  2YWM A;  3I9V 2;  2DML A;  4WEY A;  2RUF A;  3I69 A;  4LMW A;  2H30 A;  2HRF A;  2L4C A;  3DWV A;  4I6X A;  1X0R A;  4BVY A;  4EVM A;  1JLV A;  4OO5 A;  3TRP A;  3GKN A;  2HI7 A;  1HYU A;  4AKG A;  1SK0 A;  2WZ9 A;  3TKS E;  3H93 A;  1K0O A;  1M9A A;  1S3R A;  5FT3 A;  2VCQ A;  1T1V A;  5D9W A;  3PPU A;  3TJG A;  5J47 A;  2L5O A;  1TRU A;  2C4J A;  4MMM A;  4KSM A;  4E68 A;  2VL2 A;  3TJJ A;  4L8E A;  4AKI A;  2WB9 A;  3L9U A;  2VM2 A;  2OJL A;  4ACS A;  1WE0 A;  5HFG A;  2PVQ A;  4ILF A;  1GUK A;  1BG1 A;  4PNF A;  2X4A A;  4HU7 A;  5B8A A;  3W6G A;  4X1U A;  1G6W A;  4L0U A;  4AJ6 A;  4X0X A;  2QC7 A;  2V1M A;  4FIW A;  2HT9 A;  2OBI A;  2ZUP A;  1SK1 A;  1E6B A;  4I5Q A;  4LLR A;  4FQU A;  3KM6 A;  4MF5 A;  3OR5 A;  2E7P A;  3GST A;  1M99 A;  4AJ7 A;  3CQF A;  1SYX A;  4TN8 A;  2HZF A;  3UVH A;  3D4T A;  2B7K A;  3E0U A;  4F0B A;  1K0B A;  1SL0 B;  4MA9 A;  3TKR A;  1WPI A;  2KOK A;  4LA1 A;  2FA4 A;  2WGR A;  1THX A;  4KND A;  6GST A;  1TXU A;  2VD1 A;  4POM A;  2YPM A;  2H1L A;  2X49 A;  3FYG A;  2YWI A;  5G1K A;  3ZFB A;  3HVS A;  3J7Y b;  5JCG A;  2H6Y A;  3WGX A;  4XCS A;  1R5P A;  1FB6 A;  1XWG A;  3VWX A;  5EY6 A;  5IMZ A;  1ZYN A;  4XS6 A;  3UVT A;  5COH A;  1XW5 A;  3KEB A;  4MNN A;  1YVL A;  2E2M A;  3BBY A;  3LQ7 A;  2VCT A;  4RI7 A;  2YAN A;  2HRK A;  5IQY A;  3G7I A;  2OE1 A;  3EU3 A;  3DYR A;  3QAV A;  2EFE A;  3KXO A;  4HZ2 A;  4O5Q A;  4W66 A;  3VPQ A;  1Z5Y E;  3TKS C;  3VLN A;  1T4Z A;  2WW2 A;  3FZ5 A;  4K7I A;  3HA9 A;  4WF5 A;  3EC3 A;  1KNG A;  4Z7X A;  2AAW A;  5ECP B;  1MDK A;  4NPB A;  2NVL A;  1TKD B;  1O6J A;  2HZE B;  4TW5 A;  2OAD A;  4ZB7 A;  1TJD A;  2AV4 A;  1K3O A;  4QL7 A;  2NTO A;  5J40 A;  1WOU A;  2K6V A;  2CT6 A;  4HZ4 A;  3A5I A;  2GT5 A;  4ZB9 A;  2KP2 A;  3IK9 A;  3SBC A;  1HNA A;  5ECL B;  2JAC A;  4HOJ A;  3FHK A;  3FEU A;  3TRQ A;  4MF7 A;  1ABA A;  4ZL8 A;  3WGE A;  3FR6 A;  4MP4 A;  1U87 A;  2E0Q A;  4WET A;  5AIV A;  3I43 A;  2M46 A;  4RQX A;  1OKT A;  2MMO A;  4CDO A;  3ZMK A;  3MDK A;  2CVB A;  2L57 A;  3GKX A;  2LRC A;  5D96 A;  4G10 A;  2VKZ G;  2WW1 A;  2ES7 A;  2PER A;  5KN2 A;  3S9F A;  1PGT A;  1EWX A;  4HUA A;  2FHE A;  1NHO A;  1PL1 A;  1GTU A;  4JBB A;  5F06 A;  5A34 A;  5HR3 A;  3WD6 A;  3L78 A;  5LD0 A;  2WZS A;  3DML A;  3Q19 A;  1J0F A;  4EDZ A;  4IP1 A;  2GZY A;  1UN2 A;  5HR0 A;  2FNO A;  3KIJ A;  3GH9 A;  1J08 A;  2YN1 A;  1N8J A;  3FMW A;  3GX8 A;  2L6C A;  4CW9 A;  2DLX A;  11GS A;  4HQZ A;  4JU5 A;  4AI6 A;  3GV1 A;  4EE0 A;  4K8M A;  2K8S A;  4PUA A;  2HNL A;  2H8L A;  2VOC A;  4ZIJ A;  4MH3 A;  2A4V A;  1GNE A;  1EP8 A;  4EIQ A;  1HNC A;  4ECJ A;  3DKS A;  2LJR A;  1FW1 A;  2YCD A;  5E59 A;  4MJE A;  3CSH A;  5IMV A;  4A5P A;  2LST A;  1SKR B;  2R6K A;  5CNW A;  3WYW A;  2GQM A;  2X8C A;  1TRW A;  2DJJ A;  2UZ8 A;  4TR1 A;  2VL9 A;  4ECB A;  2JZT A;  4KDU A;  3HY2 A;  5G31 A;  4ZIL A;  2IMK A;  2O89 A;  3GFK A;  2R0C A;  1ACV A;  2V6O A;  4YAP A;  1SD8 A;  3C73 A;  2F51 A;  4MLY A;  1T8E B;  5DAL A;  1YKA A;  4IHU A;  3RGB C;  4K2D A;  1SU9 A;  1W4V A;  1YDK A;  1ERW A;  1AQV A;  2HSM B;  1WRY A;  4CY6 A;  2VM1 A;  4YKF A;  2YP6 A;  4IJ3 A;  1OE7 A;  1G7O A;  2YV9 A;  5A4V A;  3EWL A;  4NAX A;  1V98 A;  1PA3 A;  3LWA A;  3CWG A;  3Q74 A;  2V32 A;  2IFQ B;  1ZMA A;  3L4N A;  2GGT A;  5CP1 A;  2IN3 A;  2HSN B;  2QA2 A;  4D73 A;  5GZZ B;  2DSA A;  1PRX A;  4ZBB A;  3KMO A;  5JWR B;  3DVW A;  1AC1 A;  4F0C A;  1DSB A;  2G0F A;  1Z7R A;  5C00 A;  2ON5 A;  3A5W A;  1SL2 B;  3O6T A;  5G5E A;  1FO5 A;  3L9S A;  4PQI A;  4GWR A;  3LW9 A;  3QFA C;  3IC4 A;  2DIY A;  5DBQ A;  1ST9 A;  1GSF A;  1OAZ A;  3CXG A;  2MBT A;  2I3Y A;  3UOM A;  3VWW A;  4FYC A;  5ECS A;  3H1N A;  4KE3 A;  2R0P A;  3G9B A;  5E4W A;  1FOV A;  1O81 A;  4POB A;  3ME8 A;  5F8B A;  2GZZ A;  2OE3 A;  1PSQ A;  4KCA A;  22GS A;  3LJR A;  2C0E A;  5D93 A;  4TXO A;  3MNG A;  1E2Y A;  1QK8 A;  2I81 A;  2B6M A;  2GLR A;  2GZP A;  1FG4 A;  4BWQ A;  2LQQ A;  2WVZ A;  2AB6 A;  2N5F A;  2RLI A;  5H5S A;  2C80 A;  1Q98 A;  1B4Q A;  3FY7 A;  3D21 A;  4WBJ A;  2O5V A;  3GX0 A;  2O85 A;  4IQ1 A;  2QA1 A;  3C71 A;  2H1D A;  4OFN A;  4AJ8 A;  3DEX A;  4HJM A;  2GSQ A;  4FYU A;  3ERF A;  4V1A g;  1S3A A;  13GS A;  5CRE A;  1I9D A;  4RQR A;  5A5H B;  3IBH A;  2IIY A;  3HMJ G;  1K3L A;  4GLT A;  2IPA A;  4PQ1 A;  2WJU A;  4O7H A;  4JZQ A;  1TTZ A;  2DKI A;  1OVN A;  3HZ4 A;  2LV3 A;  4PGT A;  2DJ2 A;  3GL5 A;  2GS3 A;  4XS4 B;  1F37 A;  3KCM A;  1AIU A;  2R0G A;  3R3E A;  4MDC A;  3F4S A;  2PN8 A;  3GTU A;  3TJK A;  2L4Q A;  2FLS A;  3FK8 A;  2AUV A;  2TRC P;  3IE3 A;  16GS A;  3LFL A;  3FZA A;  1ON4 A;  3IHG A;  2XPD A;  1WJK A;  1SKS B;  4YH2 A;  1GH2 A;  1PQN A;  5KN3 A;  2XBI A;  4KH7 A;  2PGT A;  2B1K A;  4WBR D;  3O76 A;  18GS A;  4PXO A;  3ZVJ D;  1PD2 1;  1AUC A;  1HQO A;  3GUS A;  4GRF A;  4MCU A;  2JU5 A;  4HQS A;  2CVD A;  1X9S B;  5CRD A;  3UBL A;  2YJH A;  3IRA A;  2DJ3 A;  1YEP A;  1V57 A;  2X64 A;  3TKQ A;  3A3T A;  4Q5R A;  2OT3 A;  1PMT A;  5ECO B;  3GN3 A;  1NHY A;  2I9H A;  1ZYP A;  4DSS B;  3EUR A;  1QXH A;  1ERU A;  4ULX A;  2GST A;  5ID2 B;  3RPP A;  3M3M A;  1QUW A;  4BPY A;  2WVX B;  2GT6 A;  5D8I A;  2GDR A;  3EVI A;  3LEF A;  3ZVJ A;  5KEJ A;  4N0V A;  3RHC A;  3BCK A;  1V9W A;  3WGD A;  1M9B A;  2OAC A;  1MD4 A;  4RUV A;  1EZK A;  1B48 A;  2LJA A;  4OCF A;  2GSS A;  4QMK A;  2VCW A;  4MAB A;  1OC9 B;  1V2A A;  4ML6 A;  4IVF A;  1YF0 A;  3IDV A;  2WDU A;  2YZU A;  1JZW A;  1I1I P;  1SVL A;  3G7Y A;  1GSS A;  2FWE A;  5DQY A;  1Y25 A;  5J9C A;  3C8E A;  3HHV A;  4TXV A;  5F0G A;  1R4W A;  3QMX A;  4TKY A;  3H4K A;  5D9V A;  1TP9 A;  3TU3 B;  4J56 E;  12GS A;  3GRX A;  2KHP A;  4HEA 2;  4JR4 A;  5HR2 A;  1M7T A;  3UIW A;  2RII A;  1GSY A;  2H0I A;  1M2D A;  4FH8 A;  4PI2 C;  4KX4 A;  3DD3 A;  2K18 A;  5D9T A;  2VCZ A;  3NZN A;  1DUG A;  1OE8 A;  5EPF A;  17GS A;  4NHW A;  1HNB A;  2EFC A;  2GTU A;  3RFR C;  3R2Q A;  2FWG A;  2FY6 A;  4JE1 A;  2A2P A;  5ELA A;  4BWS A;  4ZB6 A;  3GA4 A;  2GVP A;  1XIY A;  5DAK B;  2H1B A;  5J9B A;  5J4Y A;  3QFB C;  2TRX A;  5CRH A;  4TR0 A;  2O36 A;  5J41 A;  2CVK A;  2LNS A;  2HRA A;  14GS A;  5AIX A;  4WKW A;  2M72 A;  2ON7 A;  1X5D A;  2GQL A;  2IWT A;  5ECQ B;  2TIR A;  1O85 A;  5IMD A;  1Y6E A;  4Q5Q A;  1X5E A;  4F2I A;  3HJO A;  1K3Y A;  3IHQ A;  2FWF A;  4IGJ A;  3DVX A;  2YOI A;  1AQW A;  3ZML A;  3QCP A;  3G7J A;  1GRX A;  5DCG A;  1Z6N A;  4MK3 A;  6GSS A;  2F3M A;  4DVC A;  1GLP A;  3EE2 A;  4TR4 A;  1TW9 A;  3LXT A;  1F3A A;  1FOH A;  4BVY B;  1UC7 A;  4TR3 A;  2L6D A;  4MH2 A;  2VL3 A;  2FUG 2;  2DJK A;  1M2A A;  2B5E A;  1USB A;  2F8F A;  3IA1 A;  4KDY A;  3F4R A;  6GSV A;  3KZQ A;  4NXI A;  4V2N A;  2PMT A;  5J3R A;  3IC8 A;  3GNJ A;  3UEM A;  1SJI A;  4ECC A;  3RBT A;  1BQ7 A;  1GUH A;  2LJK A;  1SD9 A;  4BL7 A;  1EOH A;  2P31 A;  2C1Y A;  1W89 A;  1A2M A;  4FYB A;  3VWU A;  3KP8 A;  3RPN A;  2HLS A;  2LEG A;  3C1S A;  1TRS A;  2P5Q A;  5EVO A;  3UAP A;  1BYE A;  3D0Z A;  2H0H A;  5F07 A;  1BX9 A;  2R2J A;  2KP1 A;  1KEB A;  5B6N A;  3GSS A;  1G0T A;  4BVX B;  5AIS A;  4ZBD A;  4EC0 A;  4AKH A;  3MYD A;  1TRV A;  4Z2R A;  1TDI A;  1MDI A;  4DSR A;  1EOG A;  2C3Q A;  3IAM 2;  1V40 A;  1DBY A;  4GXZ A;  3TKS A;  3NIV A;  3Q18 A;  2WRT A;  5KN1 A;  2HSM A;  1KTE A;  1KBN A;  4YQM A;  1PL2 A;  1GL8 A;  2RM5 A;  1YY7 A;  4E8H A;  1DE1 A;  5IOX A;  2KUC A;  4PTS A;  3TDG A;  4JED A;  1XVW A;  3FZ4 A;  3LG6 A;  1VGL A;  2M80 A;  1VF1 A;  1TK0 B;  2PWJ A;  2F9S A;  4OCE A;  1U3A A;  3FR9 A;  2LRT A;  1YEX A;  3CSJ A;  1FAA A;  2FCH A;  3VK9 A;  4KB3 A;  1AAZ A;  3P8W A;  4FXY P;  3LOR A;  2HRK B;  1O8X A;  2YWN A;  2DC5 A;  4HI7 A;  2OBK A;  2GSR A;  2CQ9 A;  4QQ7 A;  2C0G A;  1GUL A;  4I97 A;  3F3Q A;  3ERW A;  1A23 A;  5ECK B;  4ICY A;  2HXK A;  5DJM A;  3GKM A;  4F82 A;  1ZGN A;  1O7U A;  4FO5 A;  5ECR B;  2WW3 A;  2J9H A;  1G7E A;  4KUN A;  2A2S A;  4PQH A;  5AGY A;  3ZZX A;  2YV7 A;  5IOW A;  1XVQ A;  5DVB A;  4JR6 A;  4G0L A;  4PNG A;  3GIX A;  2EIO A;  5CRW A;  5B6M A;  4TRX A;  6GSU A;  3M9K A;  2H74 A;  5KOW A;  2V6K A;  4N0Z A;  5FHI A;  3HDC A;  3KMN A;  3L9V A;  2OKA A;  1SL1 B;  2VAF A;  2IJY A;  4JRR A;  3P90 A;  3ZFL A;  4I8B A;  1Z7P A;  1A0F A;  1AQX A;  1ERV A;  3FW2 A;  4MJC A;  3W8J A;  3QD9 A;  3M9J A;  2AHE A;  5ELG A;  2WCI A;  4GCI A;  3HJP A;  3QR6 A;  1SVO A;  3CRT A;  1S3D A;  5CAX A;  5A5H A;  4ML1 A;  2OA7 A;  3E3E A;  4KAE A;  2REM A;  8GSS A;  2H1A A;  3EPT A;  1GSE A;  2E2G A;  2FWH A;  3N5O A;  4IBP A;  2VIM A;  4HS1 A;  3HVX A;  4ZXG A;  5H5Q A;  2CZ3 A;  1GNW A;  2CZ2 A;  2PUK C;  1F3B A;  2QGV A;  1QGV A;  3TJB A;  2MMN A;  4G19 A;  5CYY A;  1ZCP A;  3PIN A;  3M0F A;  1TI3 A;  1F2E A;  5IPH A;  1YEW C;  2MMA A;  1ZZY A;  4K0G A;  4PUF C;  2B7J A;  3LYP A;  2X8G A;  2EC4 A;  2A2R A;  4I2T A;  5G1L A;  4DSQ A;  4OFT A;  2YWO A;  1J9B A;  4TVE A;  1GLQ A;  3W8S A;  3M1G A;  1Z9H A;  4L5O A;  3F0I A;  3F9U A;  4LMV A;  1A2L A;  1OC3 A;  4N10 A;  4TR1 B;  4ID0 A;  4HJ2 A;  3KGK A;  3EIN A;  4POL A;  1BF5 A;  3U6V A;  1EP7 A;  2O3E A;  3LGC A;  3ERG A;  1H75 A;  3FZ9 A;  2NBS A;  2JZS A;  2O7K A;  5EL8 A;  3PR8 A;  4PX1 A;  3GHA A;  2JSY A;  5DAL B;  4K7N A;  1T3B A;  2A4H A;  5GAP D;  4ZB8 A;  3CSI A;  3F3R A;  2IMD A;  4OO4 A;  1XZO A;  3GH6 A;  3LXZ A;  7GSS A;  1XW9 A;  3RHB A;  4H86 A;  4YQV A;  1GSQ A;  1RQM A;  1B4P A;  2WW0 A;  2PPT A;  1GTB A;  3JCM L;  2XPE A;  5C04 A;  4Z2U A;  1OC9 A;  1V58 A;  5DJL A;  5IO0 A;  5IO2 A;  1F6M C;  1CQG A;  1FB0 A;  1PN0 A;  5H5R A;  1Q4J A;  4USS A;  2LNT A;  4MPG A;  4D73 B;  2C3T A;  3IPZ A;  3TKP A;  5A1N B;  4KF9 A;  1A0R P;  3CRU A;  4GQC A;  2HFD A;  4IN0 A;  3ZYW A;  1WWJ A;  3VPT A;  1EEJ A;  1JFU A;  4EDY A;  4EXJ A;  1XOB A;  1QQ2 A;  4NHZ A;  3ME7 A;  1TU8 A;  1AW9 A;  4OFM A;  1GTA A;  3VWV A;  4E8E A;  1XXU A;  2IMI A;  3EYT A;  2WUL A;  3M8N A;  4F03 A;  3TGZ A;  2YZH A;  4HDE A;  2HYX A;  2FGX A;  1R7H A;  4V1A p;  2L59 A;  2H71 A;  4Q5N A;  4ZL7 A;  1YJ6 A;  2DBC A;  1OC8 A;  2VD0 A;  4HSC X;  1U88 A;  4TXO B;  1JZR A;  1XOA A;  3EU4 A;  1RW1 A;  2LRN A;  6GSX A;  4IW9 A;  3KTB A;  9GSS A;  4GTU A;  6GSY A;  1Y1U A;  3KJY A;  4EUY A;  5JCU A;  1T7P B;  4GQF A;  3IXR A;  4GSN A;  5A4W A;  1THO A;  1JZD A;  3LYK A;  2BMX A;  2JSZ A; 
#chains in the Genus database with same CATH homology
 3C7M A;  4YKG A;  3QPM A;  5ECI B;  3IV4 A;  2YJ7 A;  5B8B A;  1X9M B;  3L0H A;  1WP0 A;  1NW2 A;  2H1G A;  3CYN A;  5IMA A;  1MTC A;  1Z6M A;  3HKR A;  1Z3E A;  5A4U A;  3HCZ A;  1TI1 A;  5LCZ A;  4AF2 A;  4KSO A;  1DE2 A;  2H75 A;  4LL4 B;  4KGI A;  1X5C A;  2VL2 C;  4POK A;  1OKD A;  2CX4 A;  1BJX A;  5D73 A;  2JAD A;  2H6X A;  4K2X A;  5AN1 A;  2WFC A;  2F8A A;  1XWK A;  2H0G A;  1AXD A;  3FR3 A;  3AY8 A;  1A8L A;  2NDO A;  2H6Z A;  3GTU B;  2AJQ B;  2VLU A;  2QKE A;  5IIZ A;  3UMA A;  1GUM A;  3P2A A;  1ZOF A;  1LJR A;  2HRN A;  2BTO T;  4CHS A;  2C8U A;  3TJF A;  1IYI A;  4V2L A;  1TOF A;  4G2E A;  1PKZ A;  2HSH A;  2LS5 A;  4NV5 A;  1WMJ A;  4K9Z A;  4G9H A;  1PKW A;  4Q5F A;  2KLX A;  4OD7 A;  1EV4 A;  4K1F A;  4J57 E;  1FVK A;  4HU9 A;  3TOT A;  3O3T A;  4WR4 A;  4K5S A;  2I4A A;  2VCV A;  4YQU A;  3KP9 A;  4O32 A;  2R3X A;  4EIP A;  3VI5 A;  2HZE A;  2EIQ A;  1TK5 B;  3F63 A;  3E9J B;  2DIZ A;  2FD3 A;  3ZLP A;  3D5J A;  3MAK A;  2P0G A;  1BG5 A;  4V2M A;  2H66 A;  4MF6 A;  2RM6 A;  1TXX A;  5FWG A;  4BVX A;  5BMU B;  1R26 A;  2DJ1 A;  1PN9 A;  5KOX A;  3MIX A;  2N5A A;  3KTL A;  2NPB A;  1JHB A;  3ED3 A;  2LQO A;  4L0W A;  3NOF A;  2CV4 A;  2YNX A;  3APS A;  3C1R A;  4ECI A;  2EIR A;  4N3Z A;  2VCX A;  3UJ1 A;  2OE0 A;  1HD2 A;  3A2W A;  3US3 A;  2EFH A;  5DCH A;  3CTF A;  4EL1 A;  3N9J A;  2HQT A;  4AKX B;  1YKC A;  3CBU A;  4BA7 A;  2O87 A;  5J4U A;  2UV8 G;  5INY A;  3ZIJ A;  2B3S A;  1K0A A;  4QL9 A;  2H76 A;  6GSW A;  1SKW B;  3UL3 A;  1SYR A;  1QFN A;  3GYK A;  4G0I A;  5ECH B;  1T00 A;  4NV2 A;  1B8X A;  4KW6 A;  2C3N A;  3Q6O A;  3A2X A;  3P7X A;  4K0N A;  2V41 A;  3MSZ A;  3HZ8 A;  1GSD A;  3GL3 A;  19GS A;  3IK7 A;  2R5G A;  3GMF A;  1VF4 A;  4OMV A;  1EGO A;  2PVO C;  1PX6 A;  1GSU A;  3F6D A;  3BCI A;  4IJI A;  2DJ0 A;  5ABR A;  5GAN D;  4K6X A;  2VUP A;  3ZIT A;  1UA5 A;  3ZRE A;  2X99 A;  1LBK A;  5G5F A;  4ISD A;  2B1L A;  3H79 A;  2BJX A;  4GSS A;  4LL1 B;  3IR4 A;  5HFI A;  4MJA A;  5IPG A;  3D22 A;  5F05 A;  5HR1 A;  2K8V A;  1PX7 A;  2VLT A;  2XHF A;  3PH9 A;  3EMP A;  3HD5 A;  3APQ A;  1SVM A;  4IS0 A;  3D6I A;  3F6F A;  4RI6 A;  2VO4 A;  4KDX A;  4KA0 A;  1GWC A;  4G01 A;  4MZW A;  3TOU A;  2CA8 A;  5ECM B;  2MYG A;  1GP1 A;  2GQK A;  3WT1 A;  2K9F A;  2IFQ A;  4I2U A;  4J2F A;  2HSN A;  3BD2 A;  4EKZ A;  2XBQ A;  1XW6 A;  4K7O A;  5JWO B;  4MPF A;  5DQS A;  2PU9 C;  2JZR A;  5HQP A;  1EGR A;  2XC2 A;  3VI7 A;  4L5L A;  1ERT A;  4KCE A;  3TB2 A;  3WT2 A;  1XWC A;  3HVV A;  4IP6 A;  4WR5 A;  2J23 A;  3I6A A;  3KH7 A;  1K0D A;  1XFL A;  3DXB A;  1ML6 A;  1F9M A;  4P3Y B;  1U6T A;  4BL7 B;  3H8Q A;  4N11 A;  2MZC A;  1SJ6 A;  1X9W B;  4AGS A;  5IM9 A;  5GSS A;  1JLW A;  4Z2T A;  2ZNM A;  2PBJ A;  4IQA A;  1M2B A;  1N2A A;  5ENU A;  2JL4 A;  2RUE A;  3A2V A;  4YAV A;  3VFI A;  2X8H A;  5B7C A;  3F4T A;  1BED A;  3V1W A;  2DMM A;  3RAZ A;  1VF2 A;  3TCO A;  2CAI A;  2D2Z A;  3HXS A;  2DKH A;  5J4V A;  3QOU A;  2I1U A;  2EFD A;  3DRN A;  4XS1 A;  4XS4 A;  5A34 B;  1K0N A;  2LKU A;  1SJZ A;  2V2G A;  2H70 A;  5GST A;  2L5L A;  2IMF A;  2O8V B;  3PGT A;  1YZX A;  2CX3 A;  1ZL9 A;  5CO3 A;  3ZRD A;  1ILO A;  4XTS A;  1YQ1 A;  1B9X C;  3VUR A;  2C0D A;  5A1N A;  3U5R E;  4ZL9 A;  2AYT A;  1T4Y A;  2FA8 A;  2HE3 A;  2LTK A;  5J5N A;  4F9Z A;  3FKF A;  3QDN A;  1VRS D;  5JCW A;  1VF3 A;  5CRG A;  4XRA A;  1XCC A;  1FVJ A;  3MWH A;  4N30 A;  3TUE A;  4NMU A;  5IMF A;  1JZO A;  1M0U A;  1MDJ A;  1TK8 B;  1GTI A;  1U3I A;  1EV9 A;  3UBK A;  1ZYE A;  5DDL A;  1G6Y A;  1XBS A;  2R4V A;  2MBS A;  4ZBA A;  5IMC A;  1XWB A;  1LU4 A;  2N5B A;  1H4O A;  4O5U A;  4MZB A;  1A24 A;  1I5G A;  2IL3 A;  5LNK e;  4DSS A;  3GKK A;  1FHE A;  3K8N A;  5ID2 A;  1OYJ A;  4PUR A;  3RDW A;  4X4J A;  4WXT A;  3LSZ A;  5KN0 A;  4X43 A;  4XRD A;  3QAG A;  3CTG A;  4WF4 A;  3SWL A;  4TOP A;  3CMI A;  1WIK A;  1NSW A;  1XWA A;  1O73 A;  3BJ5 A;  5ECN B;  4IEL A;  3F8U A;  2ZCT A;  1RK4 A;  1URM A;  1QMV A;  3ZIV A;  4CY8 A;  5D9X A;  2H01 A;  1S3C A;  4GST A;  2B5Y A;  1C72 A;  1BAY A;  1O8W A;  4NWY A;  3DGQ A;  1CQH A;  1YF1 A;  2LUS A;  3UAR A;  4O92 A;  4K5R A;  1ZYQ B;  5G2Z A;  1B9Y C;  3ZL5 A;  1SEN A;  20GS A;  2QSI A;  1N25 A;  4XHM A;  5G30 A;  1A8Y A;  1SK2 A;  3IOS A;  1XPV A;  2VLV A;  2H19 A;  2HSY A;  3HJM A;  1K0C A;  3APO A;  4MJB A;  1IYH A;  4MZC A;  1TU7 A;  5L71 A;  5BRT A;  1MEK A;  2Z9S A;  2ALB A;  5HFK A;  3FRC A;  3J7Y k;  3KD0 A;  2IME A;  4OWY A;  5DAK A;  3TRX A;  3HYP A;  4G0K A;  3KH9 A;  3ZTL A;  4IKH A;  3BOA A;  3ISO A;  2P5R A;  4GF0 A;  1EEM A;  3D4M A;  3DIE A;  4XIH A;  10GS A;  2C0F A;  2H72 A;  1UVZ A;  2MMZ A;  1A2J A;  4EF0 A;  1K0M A;  2CAQ A;  2R37 A;  1MD3 A;  3QAW A;  2H73 A;  1NM3 A;  4EO3 A;  3EMX A;  5A5K A;  3IAS 2;  5BMU A;  4GDF A;  2WS2 A;  4DEJ A;  2G2Q A;  5JWQ B;  1R5A A;  4O5R A;  3GUR A;  2B5X A;  2YWM A;  3I9V 2;  2DML A;  4WEY A;  2RUF A;  3I69 A;  4LMW A;  2H30 A;  2HRF A;  2L4C A;  3DWV A;  4I6X A;  1X0R A;  4BVY A;  4EVM A;  1JLV A;  4OO5 A;  3TRP A;  3GKN A;  2HI7 A;  1HYU A;  4AKG A;  1SK0 A;  2WZ9 A;  3TKS E;  3H93 A;  1K0O A;  1M9A A;  5FT3 A;  2VCQ A;  1T1V A;  5D9W A;  3PPU A;  3TJG A;  5J47 A;  2L5O A;  1TRU A;  2C4J A;  4MMM A;  4KSM A;  4E68 A;  2VL2 A;  3TJJ A;  4L8E A;  4AKI A;  2WB9 A;  3L9U A;  2VM2 A;  2OJL A;  4ACS A;  1WE0 A;  5HFG A;  2PVQ A;  4ILF A;  1GUK A;  1BG1 A;  4PNF A;  2X4A A;  4HU7 A;  5B8A A;  3W6G A;  4X1U A;  1G6W A;  4L0U A;  4AJ6 A;  4X0X A;  2QC7 A;  2V1M A;  4FIW A;  2HT9 A;  2OBI A;  2ZUP A;  1SK1 A;  1E6B A;  4I5Q A;  4LLR A;  4FQU A;  3KM6 A;  4MF5 A;  3OR5 A;  2E7P A;  3GST A;  1M99 A;  4AJ7 A;  1SYX A;  4TN8 A;  2HZF A;  3UVH A;  3D4T A;  2B7K A;  3E0U A;  4F0B A;  1K0B A;  1SL0 B;  4MA9 A;  3TKR A;  1WPI A;  2KOK A;  4LA1 A;  2FA4 A;  2WGR A;  1THX A;  4KND A;  6GST A;  1TXU A;  2VD1 A;  4POM A;  2YPM A;  2H1L A;  2X49 A;  3FYG A;  2YWI A;  5G1K A;  3ZFB A;  3HVS A;  3J7Y b;  5JCG A;  2H6Y A;  3WGX A;  4XCS A;  1R5P A;  1FB6 A;  1XWG A;  3VWX A;  5EY6 A;  5IMZ A;  1ZYN A;  4XS6 A;  3UVT A;  5COH A;  1XW5 A;  3KEB A;  4MNN A;  1YVL A;  2E2M A;  3BBY A;  3LQ7 A;  2VCT A;  4RI7 A;  2YAN A;  2HRK A;  5IQY A;  3G7I A;  2OE1 A;  3EU3 A;  3DYR A;  3QAV A;  2EFE A;  3KXO A;  4HZ2 A;  4O5Q A;  4W66 A;  3VPQ A;  1Z5Y E;  3TKS C;  3VLN A;  1T4Z A;  3FZ5 A;  4K7I A;  3HA9 A;  4WF5 A;  3EC3 A;  1KNG A;  4Z7X A;  2AAW A;  5ECP B;  1MDK A;  4NPB A;  2NVL A;  1TKD B;  1O6J A;  2HZE B;  4TW5 A;  2OAD A;  4ZB7 A;  1TJD A;  2AV4 A;  1K3O A;  4QL7 A;  2NTO A;  5J40 A;  1WOU A;  2K6V A;  2CT6 A;  4HZ4 A;  3A5I A;  2GT5 A;  4ZB9 A;  2KP2 A;  3IK9 A;  3SBC A;  1HNA A;  5ECL B;  2JAC A;  4HOJ A;  3FHK A;  3FEU A;  3TRQ A;  4MF7 A;  1ABA A;  4ZL8 A;  3WGE A;  3FR6 A;  4MP4 A;  1U87 A;  2E0Q A;  4WET A;  5AIV A;  3I43 A;  2M46 A;  4RQX A;  1OKT A;  2MMO A;  4CDO A;  3ZMK A;  3MDK A;  2CVB A;  2L57 A;  3GKX A;  2LRC A;  5D96 A;  4G10 A;  2VKZ G;  2ES7 A;  2PER A;  5KN2 A;  3S9F A;  1PGT A;  1EWX A;  4HUA A;  2FHE A;  1NHO A;  1PL1 A;  1GTU A;  4JBB A;  5F06 A;  5A34 A;  5HR3 A;  3WD6 A;  3L78 A;  5LD0 A;  3DML A;  3Q19 A;  1J0F A;  4EDZ A;  4IP1 A;  2GZY A;  1UN2 A;  5HR0 A;  2FNO A;  3KIJ A;  3GH9 A;  1J08 A;  2YN1 A;  1N8J A;  3FMW A;  3GX8 A;  2L6C A;  4CW9 A;  2DLX A;  11GS A;  4HQZ A;  4JU5 A;  4AI6 A;  3GV1 A;  4EE0 A;  4K8M A;  2K8S A;  4PUA A;  2HNL A;  2H8L A;  2VOC A;  4ZIJ A;  4MH3 A;  2A4V A;  1GNE A;  1EP8 A;  4EIQ A;  1HNC A;  4ECJ A;  3DKS A;  2LJR A;  1FW1 A;  2YCD A;  5E59 A;  4MJE A;  3CSH A;  5IMV A;  4A5P A;  2LST A;  1SKR B;  2R6K A;  5CNW A;  3WYW A;  2GQM A;  2X8C A;  1TRW A;  2DJJ A;  2UZ8 A;  4TR1 A;  2VL9 A;  4ECB A;  2JZT A;  4KDU A;  3HY2 A;  5G31 A;  4ZIL A;  2IMK A;  2O89 A;  3GFK A;  2R0C A;  1ACV A;  2V6O A;  4YAP A;  1SD8 A;  3C73 A;  2F51 A;  4MLY A;  1T8E B;  5DAL A;  1YKA A;  4IHU A;  4K2D A;  1SU9 A;  1W4V A;  1YDK A;  1ERW A;  1AQV A;  2HSM B;  1WRY A;  4CY6 A;  2VM1 A;  4YKF A;  2YP6 A;  4IJ3 A;  1OE7 A;  1G7O A;  2YV9 A;  5A4V A;  3EWL A;  4NAX A;  1V98 A;  1PA3 A;  3LWA A;  3CWG A;  3Q74 A;  2V32 A;  2IFQ B;  1ZMA A;  3L4N A;  2GGT A;  5CP1 A;  2IN3 A;  2HSN B;  2QA2 A;  4D73 A;  5GZZ B;  2DSA A;  1PRX A;  4ZBB A;  3KMO A;  5JWR B;  3DVW A;  1AC1 A;  4F0C A;  1DSB A;  2G0F A;  1Z7R A;  5C00 A;  2ON5 A;  3A5W A;  1SL2 B;  3O6T A;  5G5E A;  1FO5 A;  3L9S A;  4PQI A;  4GWR A;  3LW9 A;  3QFA C;  3IC4 A;  2DIY A;  5DBQ A;  1ST9 A;  1GSF A;  1OAZ A;  3CXG A;  2MBT A;  2I3Y A;  3UOM A;  3VWW A;  4FYC A;  5ECS A;  3H1N A;  4KE3 A;  2R0P A;  3G9B A;  5E4W A;  1FOV A;  1O81 A;  4POB A;  3ME8 A;  5F8B A;  2GZZ A;  2OE3 A;  1PSQ A;  4KCA A;  22GS A;  3LJR A;  2C0E A;  5D93 A;  4TXO A;  3MNG A;  1E2Y A;  1QK8 A;  2I81 A;  2B6M A;  2GLR A;  2GZP A;  1FG4 A;  4BWQ A;  2LQQ A;  2AB6 A;  2N5F A;  2RLI A;  5H5S A;  2C80 A;  1Q98 A;  1B4Q A;  3FY7 A;  3D21 A;  4WBJ A;  2O5V A;  3GX0 A;  2O85 A;  4IQ1 A;  2QA1 A;  3C71 A;  2H1D A;  4OFN A;  4AJ8 A;  3DEX A;  4HJM A;  2GSQ A;  4FYU A;  3ERF A;  4V1A g;  1S3A A;  13GS A;  5CRE A;  1I9D A;  4RQR A;  5A5H B;  3IBH A;  2IIY A;  3HMJ G;  1K3L A;  4GLT A;  2IPA A;  4PQ1 A;  2WJU A;  4O7H A;  4JZQ A;  1TTZ A;  2DKI A;  1OVN A;  2LV3 A;  3HZ4 A;  4PGT A;  2DJ2 A;  3GL5 A;  2GS3 A;  4XS4 B;  1F37 A;  3KCM A;  1AIU A;  2R0G A;  3R3E A;  4MDC A;  3F4S A;  2PN8 A;  3GTU A;  3TJK A;  2L4Q A;  2FLS A;  3FK8 A;  2AUV A;  2TRC P;  3IE3 A;  16GS A;  3LFL A;  3FZA A;  1ON4 A;  3IHG A;  2XPD A;  1WJK A;  1SKS B;  4YH2 A;  1GH2 A;  1PQN A;  5KN3 A;  2XBI A;  4KH7 A;  2PGT A;  2B1K A;  4WBR D;  3O76 A;  18GS A;  4PXO A;  3ZVJ D;  1PD2 1;  1AUC A;  1HQO A;  3GUS A;  4GRF A;  4MCU A;  2JU5 A;  4HQS A;  2CVD A;  1X9S B;  5CRD A;  3UBL A;  2YJH A;  3IRA A;  2DJ3 A;  1YEP A;  1V57 A;  2X64 A;  3TKQ A;  3A3T A;  4Q5R A;  2OT3 A;  1PMT A;  5ECO B;  3GN3 A;  1NHY A;  2I9H A;  1ZYP A;  4DSS B;  3EUR A;  1QXH A;  1ERU A;  4ULX A;  2GST A;  5ID2 B;  3RPP A;  3M3M A;  1QUW A;  4BPY A;  2GT6 A;  5D8I A;  2GDR A;  3EVI A;  3LEF A;  3ZVJ A;  5KEJ A;  4N0V A;  3RHC A;  3BCK A;  1V9W A;  3WGD A;  1M9B A;  2OAC A;  1MD4 A;  4RUV A;  1EZK A;  1B48 A;  2LJA A;  4OCF A;  2GSS A;  4QMK A;  2VCW A;  4MAB A;  1OC9 B;  1V2A A;  4ML6 A;  4IVF A;  1YF0 A;  3IDV A;  2WDU A;  2YZU A;  1JZW A;  1SVL A;  3G7Y A;  1GSS A;  2FWE A;  5DQY A;  1Y25 A;  5J9C A;  3C8E A;  3HHV A;  4TXV A;  5F0G A;  1R4W A;  3QMX A;  4TKY A;  3H4K A;  5D9V A;  1TP9 A;  3TU3 B;  4J56 E;  12GS A;  3GRX A;  2KHP A;  4HEA 2;  4JR4 A;  5HR2 A;  1M7T A;  3UIW A;  2RII A;  1GSY A;  2H0I A;  1M2D A;  4FH8 A;  4KX4 A;  3DD3 A;  2K18 A;  5D9T A;  2VCZ A;  3NZN A;  1DUG A;  1OE8 A;  5EPF A;  17GS A;  4NHW A;  1HNB A;  2EFC A;  2GTU A;  3R2Q A;  2FWG A;  2FY6 A;  4JE1 A;  2A2P A;  5ELA A;  4BWS A;  4ZB6 A;  3GA4 A;  2GVP A;  1XIY A;  5DAK B;  2H1B A;  5J9B A;  5J4Y A;  3QFB C;  2TRX A;  5CRH A;  4TR0 A;  5J41 A;  2CVK A;  2LNS A;  2HRA A;  14GS A;  5AIX A;  4WKW A;  2M72 A;  2ON7 A;  1X5D A;  2GQL A;  2IWT A;  5ECQ B;  2TIR A;  1O85 A;  5IMD A;  1Y6E A;  4Q5Q A;  1X5E A;  4F2I A;  3HJO A;  1K3Y A;  3IHQ A;  2FWF A;  4IGJ A;  3DVX A;  2YOI A;  1AQW A;  3ZML A;  3QCP A;  3G7J A;  1GRX A;  5DCG A;  1Z6N A;  4MK3 A;  6GSS A;  2F3M A;  4DVC A;  1GLP A;  3EE2 A;  4TR4 A;  1TW9 A;  3LXT A;  1F3A A;  1FOH A;  4BVY B;  1UC7 A;  4TR3 A;  2L6D A;  4MH2 A;  2VL3 A;  2FUG 2;  2DJK A;  1M2A A;  2B5E A;  1USB A;  2F8F A;  3IA1 A;  4KDY A;  3F4R A;  6GSV A;  3KZQ A;  4NXI A;  4V2N A;  2PMT A;  5J3R A;  3IC8 A;  3GNJ A;  3UEM A;  1SJI A;  4ECC A;  3RBT A;  1BQ7 A;  1GUH A;  2LJK A;  1SD9 A;  4BL7 A;  1EOH A;  2P31 A;  2C1Y A;  1W89 A;  1A2M A;  4FYB A;  3VWU A;  3KP8 A;  3RPN A;  2HLS A;  2LEG A;  3C1S A;  1TRS A;  2P5Q A;  5EVO A;  3UAP A;  1BYE A;  3D0Z A;  2H0H A;  5F07 A;  1BX9 A;  2R2J A;  2KP1 A;  1KEB A;  5B6N A;  3GSS A;  1G0T A;  4BVX B;  5AIS A;  4ZBD A;  4EC0 A;  4AKH A;  3MYD A;  1TRV A;  4Z2R A;  1TDI A;  1MDI A;  4DSR A;  1EOG A;  2C3Q A;  3IAM 2;  1V40 A;  1DBY A;  4GXZ A;  3TKS A;  3NIV A;  3Q18 A;  2WRT A;  5KN1 A;  2HSM A;  1KTE A;  1KBN A;  4YQM A;  1PL2 A;  1GL8 A;  2RM5 A;  1YY7 A;  4E8H A;  1DE1 A;  5IOX A;  2KUC A;  4PTS A;  3TDG A;  4JED A;  1XVW A;  3FZ4 A;  3LG6 A;  1VGL A;  2M80 A;  1VF1 A;  1TK0 B;  2PWJ A;  2F9S A;  4OCE A;  1U3A A;  3FR9 A;  2LRT A;  1YEX A;  3CSJ A;  1FAA A;  2FCH A;  3VK9 A;  4KB3 A;  1AAZ A;  3P8W A;  3LOR A;  2HRK B;  1O8X A;  2YWN A;  2DC5 A;  4HI7 A;  2OBK A;  2GSR A;  2CQ9 A;  4QQ7 A;  2C0G A;  1GUL A;  4I97 A;  3F3Q A;  3ERW A;  1A23 A;  5ECK B;  4ICY A;  2HXK A;  5DJM A;  3GKM A;  4F82 A;  1ZGN A;  1O7U A;  4FO5 A;  5ECR B;  2J9H A;  1G7E A;  4KUN A;  2A2S A;  4PQH A;  5AGY A;  3ZZX A;  2YV7 A;  5IOW A;  1XVQ A;  5DVB A;  4JR6 A;  4G0L A;  4PNG A;  3GIX A;  2EIO A;  5CRW A;  5B6M A;  4TRX A;  6GSU A;  3M9K A;  2H74 A;  5KOW A;  2V6K A;  4N0Z A;  5FHI A;  3HDC A;  3KMN A;  3L9V A;  2OKA A;  1SL1 B;  2VAF A;  2IJY A;  4JRR A;  3P90 A;  3ZFL A;  4I8B A;  1Z7P A;  1A0F A;  1AQX A;  1ERV A;  3FW2 A;  4MJC A;  3W8J A;  3QD9 A;  3M9J A;  2AHE A;  5ELG A;  2WCI A;  4GCI A;  3HJP A;  3QR6 A;  1SVO A;  3CRT A;  1S3D A;  5CAX A;  5A5H A;  4ML1 A;  2OA7 A;  3E3E A;  4KAE A;  2REM A;  8GSS A;  2H1A A;  3EPT A;  1GSE A;  2E2G A;  2FWH A;  3N5O A;  4IBP A;  2VIM A;  4HS1 A;  3HVX A;  4ZXG A;  5H5Q A;  2CZ3 A;  1GNW A;  2CZ2 A;  2PUK C;  1F3B A;  2QGV A;  1QGV A;  3TJB A;  2MMN A;  4G19 A;  5CYY A;  1ZCP A;  3PIN A;  3M0F A;  1TI3 A;  1F2E A;  5IPH A;  2MMA A;  1ZZY A;  4K0G A;  4PUF C;  2B7J A;  3LYP A;  2X8G A;  2EC4 A;  2A2R A;  4I2T A;  5G1L A;  4DSQ A;  4OFT A;  2YWO A;  1J9B A;  4TVE A;  1GLQ A;  3W8S A;  3M1G A;  1Z9H A;  4L5O A;  3F0I A;  3F9U A;  4LMV A;  1A2L A;  1OC3 A;  4N10 A;  4TR1 B;  4ID0 A;  3KGK A;  4HJ2 A;  3EIN A;  4POL A;  1BF5 A;  3U6V A;  1EP7 A;  3LGC A;  3ERG A;  1H75 A;  3FZ9 A;  2NBS A;  2JZS A;  2O7K A;  5EL8 A;  3PR8 A;  4PX1 A;  3GHA A;  2JSY A;  5DAL B;  4K7N A;  1T3B A;  2A4H A;  5GAP D;  4ZB8 A;  3CSI A;  3F3R A;  2IMD A;  4OO4 A;  1XZO A;  3GH6 A;  3LXZ A;  7GSS A;  1XW9 A;  3RHB A;  4H86 A;  4YQV A;  1GSQ A;  1RQM A;  1B4P A;  2PPT A;  1GTB A;  3JCM L;  2XPE A;  5C04 A;  4Z2U A;  1OC9 A;  1V58 A;  5DJL A;  5IO0 A;  5IO2 A;  1F6M C;  1CQG A;  1FB0 A;  1PN0 A;  5H5R A;  1Q4J A;  4USS A;  2LNT A;  4MPG A;  4D73 B;  2C3T A;  3IPZ A;  3TKP A;  5A1N B;  4KF9 A;  1A0R P;  3CRU A;  4GQC A;  2HFD A;  4IN0 A;  3ZYW A;  1WWJ A;  3VPT A;  1EEJ A;  1JFU A;  4EDY A;  4EXJ A;  1XOB A;  1QQ2 A;  4NHZ A;  3ME7 A;  1TU8 A;  1AW9 A;  4OFM A;  1GTA A;  3VWV A;  4E8E A;  1XXU A;  2IMI A;  3EYT A;  2WUL A;  3M8N A;  4F03 A;  3TGZ A;  2YZH A;  4HDE A;  2HYX A;  2FGX A;  1R7H A;  4V1A p;  2L59 A;  2H71 A;  4Q5N A;  4ZL7 A;  1YJ6 A;  2DBC A;  1OC8 A;  2VD0 A;  1U88 A;  4TXO B;  1JZR A;  1XOA A;  3EU4 A;  1RW1 A;  2LRN A;  6GSX A;  4IW9 A;  3KTB A;  9GSS A;  4GTU A;  6GSY A;  1Y1U A;  3KJY A;  4EUY A;  5JCU A;  1T7P B;  4GQF A;  3IXR A;  4GSN A;  5A4W A;  1THO A;  1JZD A;  3LYK A;  2BMX A;  2JSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...