5F07A

Crystal structure of glutathione transferase f8 from populus trichocarpa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
212
structure length
212
Chain Sequence
VVKVYGPAVAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLKQPFGQVPVVEDGDFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVILPRIGQQGDSELVRTYEEKLEKVLDVYEKRLSKSKYLAGDSFTLADLSHLPATRYLVNEAGLGHLVKDRKKLNAWWEDISSRPAWKKLMNLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative glutathione S-transferase family protein
publication title Structural plasticity among glutathione transferase Phi members: natural combination of catalytic residues confers dual biochemical activities.
pubmed doi rcsb
source organism Populus trichocarpa
total genus 81
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5f07A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5f07A01
1XOAA 1OKDA 6GSVA 2C0EA 2H8LA 2V32A 3EINA 2H0IA 1GTIA 5ID2A 2C1YA 3C7MA 3UVHA 2CZ2A 3U6VA 4DVCA 4ZILA 5B8AA 3HY2A 3EE2A 4GSNA 1XBSA 2C80A 3D22A 2V6KA 1DUGA 4GQCA 3D4MA 5HR0A 1GSSA 4MZWA 5D93A 4KSOA 1K0BA 4MK3A 2FWFA 3TRQA 4O7HA 5FT3A 4BVYB 4DSRA 2YOIA 3L9UA 1K3YA 5G5FA 1SKWB 2N5FA 4IQAA 2LJAA 2KHPA 2DLXA 3D5JA 4XHMA 3PR8A 2P5QA 2YP6A 2HRAA 2OA7A 3FR6A 4KE3A 3ERGA 4ZXGA 1UVZA 2RM5A 1T00A 1BX9A 3RHBA 2IPAA 3TKSE 4G0KA 2JU5A 1PX6A 5EVOA 1V40A 3WT2A 2QSIA 5C04A 4WEYA 4AGSA 3MSZA 5ECKB 3HA9A 4YAVA 2YZUA 3A2XA 3U5RE 3KJYA 1M2AA 5D9VA 4IP6A 3VWXA 5AISA 4DSQA 3UMAA 3HHVA 4HJ2A 1GTUA 1XVWA 1XPVA 3G7JA 2MMAA 2OBIA 5GAPD 4TR3A 2DJJA 4K0NA 1TRSA 2E2MA 3QPMA 1JFUA 4K7NA 2YJHA 2C3TA 3TGZA 2HQTA 1YEXA 1RK4A 2GTUA 4F2IA 16GSA 4KCAA 2VCQA 3DRNA 4YH2A 5DALB 1YQ1A 4XS1A 5KN0A 2H19A 17GSA 3GKNA 5IIZA 3DMLA 1SKRB 5ECRB 4EL1A 1MEKA 2L5LA 3HVXA 4MH3A 3HKRA 3VFIA 3AY8A 2YWIA 4JR6A 1WJKA 5A5KA 1T1VA 4ZBDA 1O73A 1DE1A 5INYA 2CVKA 2HSNB 3G7YA 2KP1A 2H6XA 1YKCA 3HJOA 1Z6MA 3FHKA 2VD0A 4L0UA 4MLYA 4Q5FA 3P90A 5F8BA 2O85A 4PXOA 4I2UA 2H1DA 2H6YA 3TOUA 3CSHA 3VI5A 4JE1A 3LJRA 2HRKB 3WT1A 3H1NA 1G7OA 3RPNA 5JCGA 1X9SB 5E59A 1OAZA 1ZGNA 3FW2A 3ZIVA 2YWOA 3GUSA 1T3BA 3O6TA 5AN1A 3VWUA 1QK8A 4USSA 3KZQA 2FA8A 4L0WA 3VWWA 1M2DA 1USBA 3N5OA 2FA4A 1PX7A 4OFNA 1NW2A 3F6FA 2VCZA 2HXKA 2ON7A 2HRFA 1A8LA 5B7CA 4G0LA 3ERFA 3DWVA 1ERVA 3DVWA 1GSUA 1ZMAA 3P8WA 1WWJA 1AAZA 1X9WB 4FQUA 1J0FA 5LNKe 3A5WA 1M0UA 5ECQB 2IMEA 4MJCA 1N2AA 1OYJA 2IMKA 3LFLA 2M80A 4JBBA 11GSA 1ZOFA 2EIOA 4POBA 5D8IA 2H6ZA 1Z3EA 4KNDA 2I4AA 2PU9C 1OE7A 4JU5A 2LNSA 1UA5A 4LMWA 4HEA2 3ZTLA 2RUEA 6GSTA 1E6BA 4GLTA 1ACVA 1QXHA 3E9JB 5CREA 1BEDA 3LSZA 2P5RA 5IMVA 1TXXA 1OC8A 2GT6A 3IC8A 5DJMA 2P31A 1RQMA 2B5YA 3APQA 2KLXA 3HJMA 3R2QA 5ECOB 2JL4A 2KP2A 4BVXB 2PVOC 3QD9A 3K8NA 1U87A 1HNBA 1YJ6A 1EGRA 4OFTA 2HNLA 5IPHA 4Q5RA 1PSQA 4J56E 5DQSA 3L9SA 2LEGA 4NAXA 2HI7A 2YWMA 2GQKA 4MZBA 1K0MA 4MA9A 3FZ4A 2B3SA 3UL3A 2XBIA 2X8GA 14GSA 5KN3A 2WDUA 4MJAA 3EU3A 2YZHA 5G2ZA 2PPTA 5DBQA 4K2DA 2ZNMA 1ZYQB 3F9UA 4BVYA 1K0OA 5D9XA 9GSSA 1EV4A 2K9FA 3ZMKA 1UC7A 1S3CA 3CBUA 1SD8A 3DD3A 5AGYA 1TW9A 2DIYA 1F9MA 1Q4JA 1FOVA 4MF7A 2R37A 1A0FA 3FK8A 4ZB8A 2H74A 3ZMLA 5A4UA 2IJYA 2H30A 1F37A 4NXIA 3WGEA 1WE0A 5CRDA 5EPFA 2IFQB 2IL3A 1QQ2A 1B9XC 1YF1A 2FWEA 3A3TA 3ZVJA 3KEBA 4EDZA 1BJXA 3FZAA 3IOSA 2MMOA 4JEDA 1GTAA 2C4JA 2AHEA 1I5GA 3IBHA 2VL2A 4I97A 2FWGA 2IMDA 2LV3A 5L71A 3FZ5A 4MZCA 3ZREA 4PQIA 3SBCA 3J7Yb 2C0GA 1K0DA 1BQ7A 2R5GA 1WMJA 2REMA 1GSDA 4AJ7A 4G10A 4MP4A 5IO2A 2HE3A 4IVFA 2FNOA 4IBPA 1V9WA 4AJ6A 4HOJA 4FYUA 2XHFA 5DALA 2C0FA 2WGRA 5A4VA 1YEPA 3M3MA 1TK0B 1AQWA 2GSQA 4NHZA 3QFAC 4EUYA 2DJKA 1GH2A 4WBJA 3UIWA 4YQUA 4PUAA 1I9DA 2VLUA 3LGCA 2GT5A 2H0HA 5DQYA 1K0NA 3WYWA 2IWTA 2F9SA 3EU4A 4PUFC 4HZ4A 3LYPA 4KF9A 2CT6A 1PN9A 1A2MA 2MMNA 2A2SA 3M9KA 3CRTA 1N8JA 5J9CA 1YY7A 4V1Ap 1FVKA 5IMCA 3CTFA 1PD21 2HRKA 2HYXA 2H75A 2XPEA 4MABA 3CSJA 2LNTA 4QL7A 5BMUA 1XW5A 4RQXA 4Q5QA 1X5EA 4ECIA 1SL0B 4KDYA 4LLRA 2H66A 4BL7B 1KTEA 2YPMA 3FR3A 2JZRA 4IQ1A 1FO5A 4HQSA 1TRWA 1LU4A 3SWLA 3VI7A 4ZBBA 2QC7A 4ECJA 1EZKA 2LS5A 5DCHA 4MCUA 3NIVA 2FY6A 4OMVA 3IAS2 4Z7XA 3A2WA 1LBKA 1XW6A 1WOUA 2DMLA 2GZZA 1PGTA 1Z5YE 2LQOA 2H73A 2VIMA 3F4TA 6GSWA 1TK5B 3GKXA 18GSA 1HYUA 4TR1B 4OCFA 1PKWA 1TKDB 5H5RA 6GSXA 5B6NA 5D96A 4OO4A 2AAWA 3ZLPA 1WRYA 1TRUA 3TKPA 4ZL9A 3V1WA 1HNAA 5IMDA 5HFGA 2RLIA 2C0DA 2OE1A 4EF0A 3G9BA 4X1UA 3HZ4A 1KBNA 2VM1A 2VCXA 1SK2A 4ML1A 2XPDA 1O8WA 1AXDA 4BVXA 3GV1A 1ON4A 3GL5A 5CP1A 3DGQA 3KXOA 4YQVA 1ML6A 3I9V2 4MPFA 5LCZA 4MPGA 4BA7A 2LRNA 2VUPA 10GSA 2YWNA 3IHQA 4HJMA 2O87A 2O89A 1GRXA 1XWGA 3DVXA 2FUG2 2DBCA 5G31A 5CAXA 3BBYA 4LL1B 3NZNA 3HCZA 2LJKA 5JWRB 3H8QA 3DIEA 5J5NA 3KD0A 2GSTA 3UBKA 3BOAA 4OFMA 4EO3A 3PH9A 4G19A 1M7TA 1A0RP 4I6XA 1X5CA 3HXSA 1GTBA 5G5EA 1VGLA 3F4SA 4OWYA 2CAQA 2ZCTA 1QGVA 4F0CA 2O8VB 2C8UA 1ILOA 2RM6A 2K8VA 3QDNA 3DEXA 2OADA 1PA3A 4TXVA 1H4OA 1IYIA 2YV9A 5AIXA 3LQ7A 3LG6A 1G6YA 2ES7A 1R7HA 5COHA 2VLTA 4IS0A 1XXUA 4IN0A 5J41A 4OO5A 1GUKA 4KX4A 2B7JA 1W89A 1XWCA 2GVPA 3IPZA 3QOUA 4KH7A 3TRXA 2IFQA 1K3OA 2GS3A 4ZBAA 4G2EA 2YNXA 5D73A 3EURA 4GXZA 1HD2A 4WR4A 2VLVA 3LORA 4TKYA 2H76A 3ED3A 2FGXA 2L4CA 4ZIJA 3J7Yk 1G0TA 2WFCA 3MNGA 4MJEA 2J9HA 4J57E 1SJ6A 2L57A 4TXOB 1X0RA 2NBSA 4E8HA 1T4YA 3TB2A 4EKZA 4NV5A 5B8BA 1EP8A 2YV7A 1Y6EA 1V58A 2HLSA 1H75A 2V6OA 2PUKC 1XOBA 2NDOA 2R6KA 4O32A 4K9ZA 1TK8B 4POLA 1T8EB 4AF2A 2RIIA 1AUCA 2UZ8A 4MF6A 4PNGA 3F3QA 1NM3A 3BD2A 2P0GA 4JRRA 5KEJA 4IJ3A 2DJ3A 3KMOA 4F82A 3TKSA 3MWHA 4EXJA 4DSSB 2H1BA 3TCOA 2VOCA 4EDYA 3TRPA 1TU7A 2CAIA 2XBQA 1ST9A 1GULA 2YCDA 1XCCA 3P2AA 1ERUA 3I43A 3GTUB 2B1LA 1MDJA 1WIKA 2DJ1A 3UJ1A 2GQMA 1VRSD 4GWRA 1DE2A 4KSMA 4BL7A 2AB6A 1B4QA 1XZOA 5IMFA 2GLRA 4F0BA 4HDEA 3GA4A 1MD4A 4RQRA 5LD0A 3CYNA 5F0GA 2M46A 1TI3A 3BCKA 4L8EA 2IMFA 3HYPA 2F3MA 4HUAA 3Q6OA 2I81A 5ENUA 3EWLA 3HJPA 3GNJA 4EE0A 1Y25A 4TVEA 20GSA 1TJDA 3FY7A 3FEUA 3GFKA 2PWJA 1JHBA 2H0GA 1Q98A 1JZRA 2K6VA 5G30A 5JCUA 1TI1A 7GSSA 4TW5A 2B1KA 4GRFA 4TR1A 2NPBA 1OC3A 3LEFA 3ZVJD 3KH9A 4IKHA 1GSEA 1XFLA 3N9JA 3UVTA 4RI6A 4ACSA 1A2LA 1GP1A 3HZ8A 2VM2A 5ELAA 2FHEA 1WPIA 2V41A 3UBLA 4GCIA 2JACA 3HD5A 4FYBA 2X8CA 1PL2A 1EV9A 2GSSA 3IAM2 3WGXA 2I3YA 3GKKA 5IO0A 2AYTA 3O76A 2K18A 3LYKA 1GLQA 4OD7A 4MJBA 2YANA 5CYYA 1TTZA 2NVLA 4P3YB 1GUMA 4L5LA 2VAFA 1ERTA 2OE0A 2OKAA 1GSYA 5J9BA 1J08A 1M9BA 1SK0A 1HQOA 2DJ2A 3H79A 5F07A 2RUFA 4NPBA 1SU9A 1HNCA 1JZDA 2GZYA 2PMTA 1J9BA 4QL9A 4PNFA 1B48A 1F3BA 3Q18A 4K8MA 1GNWA 1FVJA 2LUSA 4V2MA 3F3RA 3KGKA 1U3AA 1QFNA 1Z9HA 3M9JA 3LWAA 2XC2A 2H01A 3BCIA 2GDRA 3TUEA 3R3EA 3VPTA 12GSA 1Z7PA 5JCWA 4JR4A 2CQ9A 2CX3A 3RDWA 1VF3A 1BAYA 4YQMA 2HSMB 1FW1A 1G6WA 2CVDA 1IYHA 4FO5A 4O92A 2C3NA 3GKMA 4IJIA 4ILFA 1ZL9A 4N0VA 3VK9A 4N10A 5F05A 3M1GA 3M8NA 1ZYEA 3TJGA 4LMVA 1AW9A 2GZPA 4WBRD 1M99A 4IP1A 4ID0A 4K7IA 1TRVA 1TOFA 2OJLA 1SJZA 3DYRA 4POKA 1BG5A 3FYGA 1O6JA 3IR4A 1GNEA 5DDLA 3APSA 2LSTA 2R4VA 3L78A 4TXOA 5HR1A 3S9FA 3GURA 1SKSB 4KGIA 2E2GA 3FKFA 2JZSA 2VL2C 3C1SA 3KP9A 4WETA 2D2ZA 3KP8A 1GSQA 2TRXA 3F63A 3C1RA 1WP0A 1EP7A 3IK7A 3Q19A 3H93A 4N11A 1FAAA 4QQ7A 1S3AA 2PERA 3ME8A 4O5RA 5IOWA 5D9WA 3Q74A 2CX4A 4E8EA 4WR5A 3C8EA 1SJIA 1B4PA 3KM6A 3GSTA 3WGDA 4DSSA 2GGTA 1AC1A 4GQFA 3UOMA 3BJ5A 3EYTA 3GN3A 2HZEB 2B5EA 1EOHA 2A4VA 3GTUA 1R5PA 3F6DA 4BWSA 5F06A 4GSTA 1OKTA 2IIYA 2O7KA 22GSA 3GH6A 3VURA 4ZB6A 3GHAA 2ALBA 4NWYA 2VL3A 4K6XA 3KCMA 1A24A 2WS2A 4L5OA 2R2JA 2OE3A 2WCIA 1ABAA 4N30A 1Z7RA 1GWCA 1K0CA 2MBSA 4XRDA 5HFIA 5KN1A 2LRCA 4HU7A 3A2VA 3QCPA 5DAKB 3UEMA 2JSZA 3L4NA 2MYGA 4XCSA 1F3AA 4GTUA 3ZL5A 2HFDA 5IMZA 4F9ZA 2WRTA 3W8SA 5ECHB 2CVBA 2NTOA 2WULA 1XWAA 3DXBA 5JWQB 4I8BA 4I2TA 3GIXA 1FHEA 5IM9A 4XS4B 2BTOT 5DCGA 4WF4A 2LJRA 1KEBA 3ZFLA 2YN1A 3FZ9A 5HR2A 5G1KA 2M72A 2VCTA 2CV4A 2VCVA 3GL3A 4TR0A 2VO4A 4FH8A 1SYXA 13GSA 2ON5A 2HSYA 4ZL7A 2WB9A 1XVQA 4X43A 1O81A 1QUWA 1AIUA 3GMFA 3TJBA 1GSFA 3VLNA 3MAKA 5ECPB 3IXRA 2G2QA 2FCHA 2DSAA 5CRHA 2X8HA 2L4QA 1YZXA 4WKWA 3QAWA 5C00A 5GZZB 2V1MA 1SL2B 3FRCA 2CZ3A 3RBTA 2I9HA 2EC4A 4V1Ag 5AIVA 6GSUA 3QR6A 1SL1B 2MZCA 1THXA 1JZWA 4CDOA 1PL1A 1U3IA 2QGVA 3ZRDA 4JZQA 4PQHA 5FWGA 3KTBA 2EIQA 4HQZA 1AQXA 3EMXA 3D0ZA 3W6GA 3I6AA 1SENA 3ZYWA 5JWOB 2KOKA 1O8XA 4LL4B 2PVQA 3GRXA 3ZFBA 5IMAA 4J2FA 5E4WA 3IK9A 1MTCA 1E2YA 6GSYA 5H5QA 4ISDA 3ERWA 1VF2A 2HZFA 3I69A 2HSMA 3EC3A 2A2RA 3IV4A 4PURA 3F4RA 1NHYA 2OBKA 3TJJA 2B6MA 2LRTA 5KN2A 3UAPA 2DIZA 1GL8A 5DVBA 1CQGA 1Z6NA 3APOA 2VD1A 8GSSA 4CHSA 5IQYA 4ULXA 4WF5A 2PBJA 1O7UA 4XS6A 4MH2A 1F2EA 1G7EA 4BWQA 2E7PA 2I1UA 1OVNA 2GQLA 5CNWA 4K7OA 1YDKA 1M2BA 3TOTA 5GSTA 4D73B 2IMIA 2DJ0A 4MMMA 3VPQA 1R26A 2GSRA 4MF5A 4I5QA 2DC5A 1R4WA 3FR9A 3H4KA 2V2GA 4POMA 1TU8A 1AQVA 3E0UA 1XIYA 2FD3A 1PQNA 2H1GA 2L5OA 3US3A 4XRAA 2JZTA 3W8JA 4G9HA 4KB3A 2X64A 1K0AA 4BPYA 2FWHA 4XTSA 2LKUA 5G1LA 2B5XA 3TDGA 3ZITA 1VF1A 1PMTA 2QKEA 2H71A 3L0HA 4YAPA 2L59A 4AJ8A 2R3XA 3TJFA 4G0IA 1OC9B 4HI7A 4IW9A 1S3DA 3TKRA 1EGOA 1ZCPA 2AV4A 1SD9A 4K0GA 2BMXA 1EEJA 1DSBA 5ECIB 2HZEA 2LTKA 3ME7A 3QAVA 2F8AA 4TRXA 3GSSA 5HR3A 1YF0A 2H1AA 2PGTA 3TKSC 5IOXA 1JLWA 4LA1A 3ZZXA 6GSSA 2AUVA 2C3QA 4KW6A 1GUHA 5ID2B 3JCML 3C73A 2HRNA 3HVVA 2L6CA 2Z9SA 2TRCP 4FYCA 3QFBC 3EMPA 4F03A 2B7KA 1T4ZA 2E0QA 4MDCA 4PX1A 3PINA 1U6TA 3P7XA 4ML6A 2KUCA 4KCEA 5DAKA 1T7PB 3PPUA 4GSSA 1TDIA 4KDUA 2PN8A 5H5SA 2J23A 5J4UA 1B9YC 3GH9A 3KTLA 5ECNB 2F8FA 2LQQA 5FHIA 3UARA 1V57A 2H70A 4XS4A 1CQHA 4NV2A 1UN2A 4KUNA 3GX0A 1THOA 4CW9A 3F8UA 4IGJA 4EVMA 3LXZA 1O85A 2JSYA 1FG4A 3L9VA 4DEJA 1KNGA 1SYRA 3RAZA 3D4TA 4OCEA 4RUVA 4KA0A 5ECLB 5HQPA 1PKZA 3HDCA 2AJQB 5ECSA 4ZL8A 3M0FA 3C71A 1XWKA 3VWVA 1DBYA 4PGTA 4PTSA 4FIWA 1MDKA 2WJUA 1X5DA 3NOFA 4HZ2A 2VL9A 3GYKA 5GAND 2F51A 1A8YA 1RW1A 5ABRA 2TIRA 1A23A 2DMMA 3IA1A 4TN8A 2JADA 1PRXA 2CA8A 1MDIA 2N5AA 3E3EA 3TKQA 2N5BA 1NSWA 1YKAA 5J3RA 3KH7A 1X9MB 4ECBA 2WZ9A 2X99A 5HFKA 5CRGA 1V98A 1JLVA 1GLPA 3RHCA 5IPGA 1FB6A 3ZIJA 2HT9A 3RPPA 4KAEA 4HU9A 3IRAA 4IHUA 4V2LA 2MBTA 3CSIA 2IN3A 1LJRA 1JZOA 2H72A 4EC0A 1URMA 5CO3A 1EEMA 1ZZYA 4NMUA 2BJXA 4V2NA 2ZUPA 5CRWA 1EOGA 3CXGA 3GX8A 5B6MA 3HVSA 1SK1A 3F0IA 5D9TA 3DKSA 3MDKA 2FLSA 5ECMB 5DJLA 4WXTA 3IE3A 4GF0A 2YJ7A 4KDXA 4NHWA 4D73A 5A4WA 4HS1A 1QMVA 3IDVA 19GSA 3D21A 2OACA 4ZB9A 1BYEA 3IC4A 3CMIA 2VCWA 3QAGA 2K8SA 5GSSA 1A2JA 1C72A 3O3TA 4XIHA 3KMNA 3CTGA 1XWBA 1B8XA 4TOPA 4H86A 4X0XA 2HSHA 3LXTA 5ELGA 3G7IA 1EWXA 1F6MC 1MD3A 3EVIA 1FB0A 1XW9A 1K3LA 1TP9A 3CRUA 3TJKA 5EY6A 4TR4A 1M9AA 3KIJA 4ECCA 2L6DA 4RI7A 1U88A 1R5AA 4K1FA 3ISOA 4Q5NA 1W4VA 3OR5A 3D6IA 4PQ1A 1NHOA 1OC9A 2EIRA 4N0ZA 5EL8A 1OE8A 2G0FA 3QMXA 3PGTA 1VF4A 3WD6A 2MMZA 1ERWA 4IELA 1V2AA
chains in the Genus database with same CATH superfamily
4PI0C 1XOAA 1OKDA 6GSVA 2C0EA 2H8LA 2V32A 3EINA 2H0IA 1GTIA 5ID2A 2C1YA 3C7MA 3UVHA 2CZ2A 3U6VA 4DVCA 4N3ZA 4ZILA 5B8AA 3HY2A 3EE2A 4GSNA 4AKHA 2C80A 1XBSA 2V6KA 3D22A 1DUGA 4GQCA 3D4MA 5HR0A 1GSSA 4MZWA 5D93A 4KSOA 1K0BA 4MK3A 2FWFA 3TRQA 4O7HA 5FT3A 4BVYB 4DSRA 2YOIA 3L9UA 1K3YA 5G5FA 1SKWB 1Y1UA 2N5FA 4IQAA 2LJAA 2KHPA 2DLXA 3D5JA 4XHMA 3PR8A 2P5QA 2YP6A 2HRAA 2OA7A 3FR6A 4KE3A 3ERGA 4ZXGA 1UVZA 2RM5A 1T00A 1BX9A 3RHBA 2IPAA 3TKSE 4G0KA 2JU5A 1PX6A 5EVOA 1V40A 3WT2A 2QSIA 5J4VA 5C04A 4WEYA 4AGSA 3MSZA 5ECKB 3HA9A 4YAVA 2YZUA 3A2XA 3U5RE 3KJYA 1M2AA 5D9VA 4IP6A 3VWXA 5AISA 4DSQA 3UMAA 3HHVA 4HJ2A 3RFRC 1GTUA 1XVWA 1XPVA 5A5HA 4CY8A 3G7JA 4BIKA 2MMAA 2OBIA 5GAPD 4TR3A 2DJJA 3RGBC 4K0NA 1TRSA 2E2MA 3QPMA 1JFUA 4K7NA 2YJHA 2C3TA 3TGZA 2HQTA 1YEXA 1RK4A 2GTUA 4F2IA 2WW2A 5A1NB 16GSA 4KCAA 2VCQA 3DRNA 4YH2A 4O5QA 5DALB 1YQ1A 4XS1A 5KN0A 2DKHA 2H19A 17GSA 3GKNA 5IIZA 3DMLA 1SKRB 5ECRB 4EL1A 1MEKA 2L5LA 3HVXA 4MH3A 5A34B 3HKRA 3VFIA 3AY8A 2YWIA 1FOHA 4JR6A 1WJKA 5A5KA 1T1VA 4ZBDA 1O73A 1DE1A 5INYA 2CVKA 2HSNB 3G7YA 2KP1A 2H6XA 1YKCA 3HJOA 1Z6MA 4A5PA 3FHKA 2VD0A 4L0UA 4MLYA 4Q5FA 3P90A 5F8BA 2O85A 4PXOA 4I2UA 2H1DA 2H6YA 3TOUA 3CSHA 3VI5A 4JE1A 3LJRA 2HRKB 3WT1A 3H1NA 1G7OA 3RPNA 5JCGA 4W66A 1X9SB 5E59A 1OAZA 1ZGNA 3FW2A 3ZIVA 2YWOA 3GUSA 1T3BA 3O6TA 5BMUB 2R0PA 5AN1A 3VWUA 1QK8A 4USSA 3KZQA 2FA8A 4L0WA 3VWWA 1M2DA 1USBA 3N5OA 2FA4A 1PX7A 4OFNA 1NW2A 3F6FA 2VCZA 2HXKA 2ON7A 2HRFA 1A8LA 5B7CA 4G0LA 3ERFA 3DWVA 1ERVA 3DVWA 1GSUA 1ZMAA 3P8WA 1WWJA 1AAZA 1X9WB 4FQUA 1J0FA 5LNKe 2A2PA 3A5WA 1M0UA 5ECQB 2IMEA 4MJCA 1N2AA 1OYJA 2IMKA 3LFLA 2M80A 4JBBA 11GSA 1ZOFA 2EIOA 4POBA 5D8IA 2H6ZA 1Z3EA 4KNDA 2I4AA 2PU9C 1OE7A 3TU3B 4JU5A 2LNSA 1UA5A 4LMWA 4HEA2 3ZTLA 2RUEA 6GSTA 1S3RA 1E6BA 4GLTA 1ACVA 1QXHA 3E9JB 5CREA 1BEDA 3LSZA 2P5RA 5IMVA 1TXXA 4EIPA 1OC8A 2GT6A 3IC8A 5DJMA 2P31A 1RQMA 2B5YA 3APQA 2KLXA 3HJMA 3R2QA 5ECOB 2WW3A 2JL4A 2KP2A 4BVXB 2PVOC 3QD9A 2WW1A 3K8NA 1U87A 1HNBA 1YJ6A 1EGRA 4OFTA 2HNLA 5IPHA 4Q5RA 1PSQA 4J56E 5DQSA 3L9SA 2LEGA 4NAXA 2HI7A 2YWMA 2GQKA 4MZBA 1K0MA 4MA9A 3FZ4A 2B3SA 3UL3A 2XBIA 2X8GA 14GSA 5KN3A 2WDUA 4MJAA 3EU3A 2YZHA 5G2ZA 2PPTA 5DBQA 4K2DA 1SVOA 2ZNMA 1ZYQB 3F9UA 4BVYA 1K0OA 4G01A 5D9XA 9GSSA 1EV4A 2K9FA 3ZMKA 1UC7A 1S3CA 3CBUA 1SD8A 3DD3A 5AGYA 1TW9A 2DIYA 1F9MA 1Q4JA 1FOVA 1YVLA 4MF7A 2R37A 1A0FA 3FK8A 3MYDA 4ZB8A 2H74A 3ZMLA 5A4UA 2IJYA 2H30A 1F37A 4NXIA 3WGEA 1WE0A 5CRDA 5EPFA 2IFQB 2IL3A 1QQ2A 1B9XC 1YF1A 2FWEA 2O36A 3A3TA 3ZVJA 3KEBA 4EDZA 1BJXA 3FZAA 3IOSA 2MMOA 4JEDA 1GTAA 2C4JA 2AHEA 1I5GA 3IBHA 2VL2A 4I97A 2FWGA 2IMDA 2LV3A 5L71A 3FZ5A 4MZCA 3ZREA 4PQIA 3SBCA 4K2XA 3J7Yb 2C0GA 1K0DA 2O3EA 1BQ7A 2R5GA 1WMJA 2REMA 1GSDA 4AJ7A 4G10A 5A1NA 4MP4A 5IO2A 2HE3A 4IVFA 2FNOA 4IBPA 1V9WA 4AJ6A 4HOJA 4FYUA 2XHFA 5DALA 2C0FA 2WGRA 5A4VA 1YEPA 3M3MA 4AKGA 1TK0B 1AQWA 2GSQA 4NHZA 3QFAC 4EUYA 2DJKA 1GH2A 4WBJA 3UIWA 5A34A 4YQUA 4PUAA 1I9DA 2VLUA 3LGCA 2GT5A 2H0HA 5DQYA 1K0NA 3WYWA 2IWTA 2F9SA 3EU4A 4PUFC 4HZ4A 3LYPA 4KF9A 2CT6A 4PI2C 2HSNA 1PN9A 1A2MA 2MMNA 2A2SA 3M9KA 3CRTA 4AI6A 1N8JA 1PN0A 5J9CA 1YY7A 4V1Ap 1FVKA 5IMCA 3CTFA 1PD21 2HRKA 2HYXA 2H75A 2XPEA 4MABA 3CSJA 2LNTA 3A5IA 4QL7A 5BMUA 1XW5A 4RQXA 4Q5QA 1X5EA 2O5VA 2WVYA 4ECIA 1SL0B 4KDYA 4LLRA 2H66A 4BL7B 1KTEA 2YPMA 4E68A 3FR3A 2JZRA 4IQ1A 4X4JA 1FO5A 4HQSA 1TRWA 1LU4A 3SWLA 3VI7A 4ZBBA 2QC7A 4ECJA 1XG8A 1EZKA 2LS5A 5DCHA 4MCUA 3NIVA 2FY6A 4OMVA 3IAS2 4FXYP 4Z7XA 3A2WA 3HMJG 1LBKA 1XW6A 1WOUA 2DMLA 2GZZA 1PGTA 1Z5YE 2WW0A 2LQOA 2H73A 2VIMA 3F4TA 4AKXB 6GSWA 2X4AA 1TK5B 3GKXA 18GSA 1HYUA 2EFEA 4TR1B 4OCFA 1PKWA 1TKDB 5H5RA 6GSXA 5B6NA 5D96A 4OO4A 2AAWA 3ZLPA 1WRYA 1TRUA 3TKPA 4ZL9A 3V1WA 1HNAA 5IMDA 5HFGA 2RLIA 2C0DA 2OE1A 4EF0A 3G9BA 4X1UA 3HZ4A 1KBNA 2VM1A 2VCXA 1SK2A 4ML1A 2XPDA 1O8WA 1AXDA 4BVXA 3GV1A 1ON4A 3GL5A 5CP1A 3DGQA 3KXOA 4YQVA 1ML6A 3I9V2 4MPFA 5LCZA 4MPGA 4BA7A 2LRNA 2VUPA 10GSA 2YWNA 3IHQA 4HJMA 2O87A 2O89A 1GRXA 1XWGA 3DVXA 2FUG2 2DBCA 5G31A 5CAXA 3BBYA 4ZB7A 4LL1B 3NZNA 3HCZA 2LJKA 5JWRB 3H8QA 3DIEA 5J5NA 3KD0A 2GSTA 3UBKA 3BOAA 4OFMA 4EO3A 3PH9A 4G19A 1M7TA 1A0RP 4I6XA 1X5CA 3HXSA 1GTBA 5G5EA 1VGLA 3F4SA 4OWYA 2CAQA 2ZCTA 1QGVA 4F0CA 2O8VB 4Z2RA 2C8UA 1ILOA 2RM6A 2K8VA 3QDNA 3DEXA 2OADA 1PA3A 4TXVA 1H4OA 1IYIA 2YV9A 5AIXA 3LQ7A 3LG6A 1G6YA 2ES7A 1R7HA 5COHA 2VLTA 4IS0A 1XXUA 4IN0A 5J41A 4OO5A 1GUKA 4KX4A 2B7JA 1W89A 1XWCA 2GVPA 3IPZA 3QOUA 4KH7A 3MIXA 3TRXA 4MNNA 2IFQA 1K3OA 2GS3A 4ZBAA 4G2EA 2YNXA 5D73A 3EURA 4GXZA 1HD2A 4WR4A 2VLVA 1N25A 3LORA 4TKYA 2H76A 3ED3A 1S4BP 2FGXA 2L4CA 4ZIJA 3J7Yk 1G0TA 2WFCA 3MNGA 4MJEA 2J9HA 4J57E 1SJ6A 2L57A 4TXOB 1X0RA 2NBSA 4E8HA 1T4YA 3TB2A 4EKZA 4NV5A 5B8BA 1EP8A 2YV7A 1Y6EA 1V58A 2HLSA 1H75A 2V6OA 2PUKC 1XOBA 2NDOA 2R6KA 4O32A 4K9ZA 4Z2UA 1TK8B 4POLA 1T8EB 4AF2A 2RIIA 5J47A 1AUCA 2UZ8A 4MF6A 4PNGA 3F3QA 2WVZA 1NM3A 3BD2A 2P0GA 4JRRA 5KEJA 4IJ3A 3CQFA 2DJ3A 3EPTA 2H1LA 3KMOA 4F82A 3TKSA 3MWHA 4EXJA 4DSSB 2H1BA 3TCOA 2VOCA 4EDYA 3TRPA 1TU7A 4GDFA 2CAIA 2XBQA 1ST9A 1GULA 2YCDA 1XCCA 3P2AA 1ERUA 3I43A 3GTUB 2B1LA 1MDJA 2QA1A 1WIKA 2DJ1A 3UJ1A 2GQMA 1VRSD 4GWRA 1DE2A 4KSMA 4BL7A 2AB6A 1B4QA 1XZOA 1TXUA 5IMFA 2GLRA 4F0BA 4HDEA 3GA4A 1MD4A 4RQRA 5LD0A 3CYNA 5F0GA 2M46A 1TI3A 3BCKA 4L8EA 2IMFA 3HYPA 2F3MA 4HUAA 3Q6OA 2I81A 5ENUA 3EWLA 3HJPA 3GNJA 4EE0A 1Y25A 4TVEA 20GSA 1TJDA 3FY7A 3FEUA 3GFKA 2PWJA 1JHBA 2H0GA 1SVMA 1Q98A 1JZRA 2K6VA 5G30A 5JCUA 1TI1A 7GSSA 4TW5A 2B1KA 4GRFA 4TR1A 2NPBA 1OC3A 3LEFA 3ZVJD 3KH9A 4IKHA 1GSEA 1XFLA 3N9JA 3UVTA 4RI6A 4ACSA 1A2LA 1GP1A 4O5UA 3HZ8A 2VM2A 5ELAA 2FHEA 1WPIA 2V41A 3IHGA 3UBLA 4GCIA 2JACA 3HD5A 4FYBA 2X8CA 1PL2A 1EV9A 2GSSA 3IAM2 3WGXA 2I3YA 2A4HA 3GKKA 5IO0A 2AYTA 3O76A 2K18A 3LYKA 1GLQA 4OD7A 4MJBA 2YANA 5CYYA 4QMKA 1TTZA 2NVLA 4P3YB 1GUMA 4L5LA 2VAFA 1ERTA 2OE0A 2OKAA 1GSYA 5J9BA 1J08A 1M9BA 1SK0A 1HQOA 2DJ2A 3H79A 5F07A 2RUFA 4NPBA 1SU9A 1HNCA 1JZDA 2GZYA 2PMTA 1J9BA 1YEWC 5J4YA 4QL9A 4PNFA 1B48A 1F3BA 3Q18A 4K8MA 1GNWA 1FVJA 2LUSA 4V2MA 3F3RA 3KGKA 1U3AA 1QFNA 1Z9HA 3M9JA 3LWAA 2XC2A 2H01A 3BCIA 2GDRA 3TUEA 3R3EA 3VPTA 12GSA 1Z7PA 5JCWA 3HVNA 4JR4A 2CQ9A 2CX3A 3RDWA 1VF3A 1BAYA 4YQMA 2HSMB 1FW1A 1G6WA 2CVDA 1IYHA 4FO5A 4O92A 2C3NA 3GKMA 4IJIA 4ILFA 1ZL9A 4N0VA 3VK9A 4N10A 5F05A 3M1GA 3M8NA 1ZYEA 3TJGA 4LMVA 1AW9A 2GZPA 4WBRD 1M99A 4IP1A 4ID0A 1SVLA 4K7IA 1TRVA 1TOFA 2OJLA 1SJZA 3DYRA 4POKA 1BG5A 3FYGA 1O6JA 3IR4A 1GNEA 5DDLA 3APSA 2LSTA 2R4VA 3L78A 4TXOA 5HR1A 3S9FA 3GURA 1SKSB 4KGIA 2E2GA 3FKFA 2JZSA 2VL2C 3C1SA 3KP9A 4WETA 4YKGA 2D2ZA 3KP8A 1GSQA 2TRXA 3F63A 3C1RA 1WP0A 1EP7A 3IK7A 3Q19A 3H93A 4N11A 1FAAA 4QQ7A 1S3AA 2PERA 3ME8A 4O5RA 5IOWA 5D9WA 3Q74A 2CX4A 4E8EA 4WR5A 3C8EA 4Z2TA 1SJIA 1B4PA 3KM6A 3GSTA 3WGDA 4DSSA 2GGTA 1AC1A 4GQFA 4ICYA 3UOMA 3BJ5A 3EYTA 3GN3A 2HZEB 2B5EA 1EOHA 2UV8G 2A4VA 3GTUA 1R5PA 3F6DA 4BWSA 5F06A 4GSTA 1OKTA 5KOWA 2IIYA 2O7KA 22GSA 3GH6A 3VURA 1M3IA 4ZB6A 3GHAA 2ALBA 4NWYA 2VL3A 4K6XA 3KCMA 1A24A 2WS2A 4L5OA 2R2JA 2OE3A 2WCIA 1ABAA 4N30A 1Z7RA 1GWCA 1K0CA 2MBSA 4XRDA 5HFIA 5KN1A 2LRCA 4HU7A 3A2VA 3QCPA 5DAKB 3UEMA 2JSZA 2MYGA 3L4NA 4XCSA 1F3AA 4K5SA 4GTUA 3ZL5A 2HFDA 5IMZA 4F9ZA 2WRTA 3W8SA 5ECHB 2CVBA 2NTOA 2WULA 1XWAA 3DXBA 5JWQB 4I8BA 4I2TA 3GIXA 1FHEA 5IM9A 4XS4B 2BTOT 5DCGA 4WF4A 2LJRA 1KEBA 3ZFLA 2YN1A 2DKIA 3FZ9A 5HR2A 5G1KA 2M72A 2VCTA 2CV4A 3LW9A 2VCVA 2WVXB 3GL3A 4TR0A 2VO4A 4FH8A 1SYXA 13GSA 2ON5A 2HSYA 4ZL7A 2WB9A 1XVQA 4X43A 1O81A 1QUWA 1AIUA 3GMFA 3TJBA 1GSFA 3VLNA 3MAKA 5ECPB 3IXRA 2G2QA 2FCHA 2DSAA 5CRHA 2X8HA 2L4QA 1YZXA 4WKWA 3QAWA 5C00A 5GZZB 2V1MA 1SL2B 3FRCA 2CZ3A 3RBTA 2I9HA 2EC4A 4V1Ag 5AIVA 6GSUA 3QR6A 1SL1B 2MZCA 1THXA 1JZWA 4CDOA 1PL1A 1U3IA 2QGVA 3ZRDA 4JZQA 4PQHA 1I1IP 5FWGA 3KTBA 2EIQA 4HQZA 1AQXA 3EMXA 2R0GA 3D0ZA 3W6GA 3I6AA 1SENA 3ZYWA 5JWOB 2KOKA 1O8XA 4LL4B 2PVQA 3GRXA 3ZFBA 2VKZG 5IMAA 4J2FA 2X49A 5E4WA 2R0CA 3IK9A 1MTCA 1E2YA 6GSYA 5H5QA 4ISDA 3ERWA 1VF2A 2HZFA 3I69A 2HSMA 3EC3A 2A2RA 3IV4A 4PURA 3F4RA 1NHYA 2OBKA 3TJJA 2B6MA 2LRTA 5KN2A 3UAPA 2DIZA 1GL8A 5DVBA 1CQGA 1Z6NA 3APOA 2VD1A 8GSSA 4CHSA 5IQYA 4ULXA 4WF5A 2PBJA 1O7UA 4XS6A 4MH2A 1F2EA 1G7EA 4BWQA 2E7PA 2I1UA 1OVNA 2GQLA 5CNWA 4K7OA 1YDKA 1M2BA 3TOTA 5GSTA 4D73B 2IMIA 2DJ0A 4MMMA 3VPQA 1R26A 2EFCA 2GSRA 4MF5A 4I5QA 2DC5A 1R4WA 3FR9A 3H4KA 2V2GA 4POMA 4EIQA 1TU8A 1AQVA 3E0UA 1XIYA 2FD3A 1PQNA 2H1GA 2L5OA 3US3A 4XRAA 2JZTA 3W8JA 4G9HA 4KB3A 2X64A 1K0AA 4BPYA 2FWHA 4XTSA 2LKUA 2OT3A 5G1LA 2B5XA 3TDGA 3ZITA 1VF1A 1PMTA 2QKEA 2H71A 3L0HA 4YAPA 2L59A 4AJ8A 2R3XA 3TJFA 4G0IA 1OC9B 4HI7A 4IW9A 1S3DA 3TKRA 1EGOA 1ZCPA 1PFOA 2AV4A 1SD9A 4K0GA 2BMXA 1EEJA 1DSBA 5ECIB 2HZEA 2LTKA 3ME7A 3QAVA 2F8AA 4TRXA 3GSSA 5HR3A 1YF0A 2H1AA 2PGTA 3TKSC 5IOXA 1JLWA 4LA1A 3ZZXA 6GSSA 2AUVA 2C3QA 2EFDA 4KW6A 1GUHA 5ID2B 3JCML 3C73A 2HRNA 3HVVA 2L6CA 2Z9SA 2TRCP 4FYCA 3QFBC 3EMPA 4F03A 2WZSA 2B7KA 3CHXC 1T4ZA 2E0QA 4MDCA 4PX1A 3PINA 1U6TA 3P7XA 4ML6A 2KUCA 4KCEA 5DAKA 1T7PB 3PPUA 4GSSA 1TDIA 1BF5A 4KDUA 2PN8A 5H5SA 1M3JA 2J23A 5J4UA 1B9YC 3GH9A 3KTLA 5ECNB 2F8FA 2LQQA 5FHIA 3UARA 1V57A 2H70A 4XS4A 1CQHA 4NV2A 1ZYNA 1UN2A 4KUNA 3GX0A 1THOA 4CW9A 2WVXA 3F8UA 4IGJA 4EVMA 3LXZA 1O85A 2JSYA 1FG4A 3L9VA 4PHZC 4DEJA 1KNGA 1SYRA 3RAZA 3D4TA 4OCEA 4RUVA 4KA0A 5ECLB 5HQPA 1PKZA 3HDCA 2AJQB 5A5HB 5ECSA 4ZL8A 3M0FA 3C71A 1XWKA 3VWVA 1DBYA 4PGTA 4PTSA 4FIWA 1MDKA 2WJUA 1X5DA 3NOFA 4HZ2A 4YKFA 2VL9A 3GYKA 5GAND 2F51A 1A8YA 1RW1A 5ABRA 2TIRA 1A23A 2DMMA 3IA1A 4TN8A 2JADA 1PRXA 2CA8A 1MDIA 2N5AA 3E3EA 3TKQA 2N5BA 1NSWA 1YKAA 5J3RA 3KH7A 1X9MB 4ECBA 2WZ9A 2X99A 5HFKA 5CRGA 1V98A 1JLVA 1GLPA 3RHCA 5IPGA 1FB6A 3ZIJA 2HT9A 3RPPA 4KAEA 4HU9A 3IRAA 4IHUA 4V2LA 2MBTA 4AKIA 3CSIA 2IN3A 1LJRA 1JZOA 2H72A 4EC0A 1URMA 5CO3A 1EEMA 1ZZYA 4NMUA 2BJXA 4K5RA 4V2NA 2ZUPA 5CRWA 1EOGA 3CXGA 3GX8A 5B6MA 3HVSA 1SK1A 3F0IA 5D9TA 2EFHA 3DKSA 3MDKA 2FLSA 5ECMB 5DJLA 4WXTA 3IE3A 3CWGA 4GF0A 2YJ7A 4KDXA 4NHWA 4D73A 5A4WA 4HS1A 1QMVA 3IDVA 19GSA 3D21A 2OACA 4ZB9A 1BYEA 3IC4A 3CMIA 3FMWA 2VCWA 4CY6A 3QAGA 2K8SA 5GSSA 1A2JA 1C72A 3O3TA 4XIHA 3KMNA 3CTGA 4HSCX 1XWBA 1B8XA 4TOPA 4H86A 5BRTA 4X0XA 2HSHA 3LXTA 5ELGA 3G7IA 1EWXA 1F6MC 1MD3A 3EVIA 1FB0A 1XW9A 1K3LA 1TP9A 3CRUA 3TJKA 5EY6A 4TR4A 1M9AA 3KIJA 4ECCA 2L6DA 4RI7A 1U88A 1R5AA 4K1FA 3ISOA 4Q5NA 1W4VA 3OR5A 3D6IA 4PQ1A 1NHOA 5J40A 1OC9A 2EIRA 4N0ZA 2QA2A 5EL8A 1OE8A 2G0FA 3QMXA 3PGTA 1VF4A 3WD6A 5KOXA 1BG1A 1ZYPA 2MMZA 1ERWA 4IELA 1V2AA
chains in the Genus database with same CATH topology
1XOAA 1OKDA 6GSVA 2C0EA 2H8LA 2V32A 3EINA 2H0IA 1GTIA 5ID2A 2C1YA 3C7MA 3UVHA 2CZ2A 3U6VA 4DVCA 4N3ZA 4ZILA 5B8AA 3HY2A 3EE2A 4GSNA 4AKHA 2C80A 1XBSA 2V6KA 3D22A 1DUGA 4GQCA 3D4MA 5HR0A 1GSSA 4MZWA 5D93A 4KSOA 1K0BA 4MK3A 2FWFA 3TRQA 4O7HA 5FT3A 4BVYB 4DSRA 2YOIA 3L9UA 1K3YA 5G5FA 1SKWB 1Y1UA 2N5FA 4IQAA 2LJAA 2KHPA 2DLXA 3D5JA 4XHMA 3PR8A 2P5QA 2YP6A 2HRAA 2OA7A 3FR6A 4KE3A 3ERGA 4ZXGA 1UVZA 2RM5A 1T00A 1BX9A 3RHBA 2IPAA 3TKSE 4G0KA 2JU5A 1PX6A 5EVOA 1V40A 3WT2A 2QSIA 5J4VA 5C04A 4WEYA 4AGSA 3MSZA 5ECKB 3HA9A 4YAVA 2YZUA 3A2XA 3U5RE 3KJYA 1M2AA 5D9VA 4IP6A 3VWXA 5AISA 4DSQA 3UMAA 3HHVA 4HJ2A 1GTUA 1XVWA 1XPVA 5A5HA 4CY8A 3G7JA 2MMAA 2OBIA 5GAPD 4TR3A 2DJJA 4K0NA 1TRSA 2E2MA 3QPMA 1JFUA 4K7NA 2YJHA 2C3TA 3TGZA 2HQTA 1YEXA 1RK4A 2GTUA 4F2IA 5A1NB 16GSA 4KCAA 2VCQA 3DRNA 4YH2A 4O5QA 5DALB 1YQ1A 4XS1A 5KN0A 2DKHA 2H19A 17GSA 3GKNA 5IIZA 3DMLA 1SKRB 5ECRB 4EL1A 1MEKA 2L5LA 3HVXA 4MH3A 5A34B 3HKRA 3VFIA 3AY8A 2YWIA 1FOHA 4JR6A 1WJKA 5A5KA 1T1VA 4ZBDA 1O73A 1DE1A 5INYA 2CVKA 2HSNB 3G7YA 2KP1A 2H6XA 1YKCA 3HJOA 1Z6MA 4A5PA 3FHKA 2VD0A 4L0UA 4MLYA 4Q5FA 3P90A 5F8BA 2O85A 4PXOA 4I2UA 2H1DA 2H6YA 3TOUA 3CSHA 3VI5A 4JE1A 3LJRA 2HRKB 3WT1A 3H1NA 1G7OA 3RPNA 5JCGA 4W66A 1X9SB 5E59A 1OAZA 1ZGNA 3FW2A 3ZIVA 2YWOA 3GUSA 1T3BA 3O6TA 5BMUB 2R0PA 5AN1A 3VWUA 1QK8A 4USSA 3KZQA 2FA8A 4L0WA 3VWWA 1M2DA 1USBA 3N5OA 2FA4A 1PX7A 4OFNA 1NW2A 3F6FA 2VCZA 2HXKA 2ON7A 2HRFA 1A8LA 5B7CA 4G0LA 3ERFA 3DWVA 1ERVA 3DVWA 1GSUA 1ZMAA 3P8WA 1WWJA 1AAZA 1X9WB 4FQUA 1J0FA 5LNKe 2A2PA 3A5WA 1M0UA 5ECQB 2IMEA 4MJCA 1N2AA 1OYJA 2IMKA 3LFLA 2M80A 4JBBA 11GSA 1ZOFA 2EIOA 4POBA 5D8IA 2H6ZA 1Z3EA 4KNDA 2I4AA 2PU9C 1OE7A 3TU3B 4JU5A 2LNSA 1UA5A 4LMWA 4HEA2 3ZTLA 2RUEA 6GSTA 1E6BA 4GLTA 1ACVA 1QXHA 3E9JB 5CREA 1BEDA 3LSZA 2P5RA 5IMVA 1TXXA 4EIPA 1OC8A 2GT6A 3IC8A 5DJMA 2P31A 1RQMA 2B5YA 3APQA 2KLXA 3HJMA 3R2QA 5ECOB 2JL4A 2KP2A 4BVXB 2PVOC 3QD9A 3K8NA 1U87A 1HNBA 1YJ6A 1EGRA 4OFTA 2HNLA 5IPHA 4Q5RA 1PSQA 4J56E 5DQSA 3L9SA 2LEGA 4NAXA 2HI7A 2YWMA 2GQKA 4MZBA 1K0MA 4MA9A 3FZ4A 2B3SA 3UL3A 2XBIA 2X8GA 14GSA 5KN3A 2WDUA 4MJAA 3EU3A 2YZHA 5G2ZA 2PPTA 5DBQA 4K2DA 1SVOA 2ZNMA 1ZYQB 3F9UA 4BVYA 1K0OA 4G01A 5D9XA 9GSSA 1EV4A 2K9FA 3ZMKA 1UC7A 1S3CA 3CBUA 1SD8A 3DD3A 5AGYA 1TW9A 2DIYA 1F9MA 1Q4JA 1FOVA 1YVLA 4MF7A 2R37A 1A0FA 3FK8A 3MYDA 4ZB8A 2H74A 3ZMLA 5A4UA 2IJYA 2H30A 1F37A 4NXIA 3WGEA 1WE0A 5CRDA 5EPFA 2IFQB 2IL3A 1QQ2A 1B9XC 1YF1A 2FWEA 3A3TA 3ZVJA 3KEBA 4EDZA 1BJXA 3FZAA 3IOSA 2MMOA 4JEDA 1GTAA 2C4JA 2AHEA 1I5GA 3IBHA 2VL2A 4I97A 2FWGA 2IMDA 2LV3A 5L71A 3FZ5A 4MZCA 3ZREA 4PQIA 3SBCA 4K2XA 3J7Yb 2C0GA 1K0DA 1BQ7A 2R5GA 1WMJA 2REMA 1GSDA 4AJ7A 4G10A 5A1NA 4MP4A 5IO2A 2HE3A 4IVFA 2FNOA 4IBPA 1V9WA 4AJ6A 4HOJA 4FYUA 2XHFA 5DALA 2C0FA 2WGRA 5A4VA 1YEPA 3M3MA 4AKGA 1TK0B 1AQWA 2GSQA 4NHZA 3QFAC 4EUYA 2DJKA 1GH2A 4WBJA 3UIWA 5A34A 4YQUA 4PUAA 1I9DA 2VLUA 3LGCA 2GT5A 2H0HA 5DQYA 1K0NA 3WYWA 2IWTA 2F9SA 3EU4A 4PUFC 4HZ4A 3LYPA 4KF9A 2CT6A 2HSNA 1PN9A 1A2MA 2MMNA 2A2SA 3M9KA 3CRTA 4AI6A 1N8JA 1PN0A 5J9CA 1YY7A 4V1Ap 1FVKA 5IMCA 3CTFA 1PD21 2HRKA 2HYXA 2H75A 2XPEA 4MABA 3CSJA 2LNTA 3A5IA 4QL7A 5BMUA 1XW5A 4RQXA 4Q5QA 1X5EA 2O5VA 4ECIA 1SL0B 4KDYA 4LLRA 2H66A 4BL7B 1KTEA 2YPMA 4E68A 3FR3A 2JZRA 4IQ1A 4X4JA 1FO5A 4HQSA 1TRWA 1LU4A 3SWLA 3VI7A 4ZBBA 2QC7A 4ECJA 1EZKA 2LS5A 5DCHA 4MCUA 3NIVA 2FY6A 4OMVA 3IAS2 4Z7XA 3A2WA 3HMJG 1LBKA 1XW6A 1WOUA 2DMLA 2GZZA 1PGTA 1Z5YE 2LQOA 2H73A 2VIMA 3F4TA 4AKXB 6GSWA 2X4AA 1TK5B 3GKXA 18GSA 1HYUA 2EFEA 4TR1B 4OCFA 1PKWA 1TKDB 5H5RA 6GSXA 5B6NA 5D96A 4OO4A 2AAWA 3ZLPA 1WRYA 1TRUA 3TKPA 4ZL9A 3V1WA 1HNAA 5IMDA 5HFGA 2RLIA 2C0DA 2OE1A 4EF0A 3G9BA 4X1UA 3HZ4A 1KBNA 2VM1A 2VCXA 1SK2A 4ML1A 2XPDA 1O8WA 1AXDA 4BVXA 3GV1A 1ON4A 3GL5A 5CP1A 3DGQA 3KXOA 4YQVA 1ML6A 3I9V2 4MPFA 5LCZA 4MPGA 4BA7A 2LRNA 2VUPA 10GSA 2YWNA 3IHQA 4HJMA 2O87A 2O89A 1GRXA 1XWGA 3DVXA 2FUG2 2DBCA 5G31A 5CAXA 3BBYA 4ZB7A 4LL1B 3NZNA 3HCZA 2LJKA 5JWRB 3H8QA 3DIEA 5J5NA 3KD0A 2GSTA 3UBKA 3BOAA 4OFMA 4EO3A 3PH9A 4G19A 1M7TA 1A0RP 4I6XA 1X5CA 3HXSA 1GTBA 5G5EA 1VGLA 3F4SA 4OWYA 2CAQA 2ZCTA 1QGVA 4F0CA 2O8VB 4Z2RA 2C8UA 1ILOA 2RM6A 2K8VA 3QDNA 3DEXA 2OADA 1PA3A 4TXVA 1H4OA 1IYIA 2YV9A 5AIXA 3LQ7A 3LG6A 1G6YA 2ES7A 1R7HA 5COHA 2VLTA 4IS0A 1XXUA 4IN0A 5J41A 4OO5A 1GUKA 4KX4A 2B7JA 1W89A 1XWCA 2GVPA 3IPZA 3QOUA 4KH7A 3MIXA 3TRXA 4MNNA 2IFQA 1K3OA 2GS3A 4ZBAA 4G2EA 2YNXA 5D73A 3EURA 4GXZA 1HD2A 4WR4A 2VLVA 1N25A 3LORA 4TKYA 2H76A 3ED3A 2FGXA 2L4CA 4ZIJA 3J7Yk 1G0TA 2WFCA 3MNGA 4MJEA 2J9HA 4J57E 1SJ6A 2L57A 4TXOB 1X0RA 2NBSA 4E8HA 1T4YA 3TB2A 4EKZA 4NV5A 5B8BA 1EP8A 2YV7A 1Y6EA 1V58A 2HLSA 1H75A 2V6OA 2PUKC 1XOBA 2NDOA 2R6KA 4O32A 4K9ZA 4Z2UA 1TK8B 4POLA 1T8EB 4AF2A 2RIIA 5J47A 1AUCA 2UZ8A 4MF6A 4PNGA 3F3QA 1NM3A 3BD2A 2P0GA 4JRRA 5KEJA 4IJ3A 2DJ3A 3EPTA 2H1LA 3KMOA 4F82A 3TKSA 3MWHA 4EXJA 4DSSB 2H1BA 3TCOA 2VOCA 4EDYA 3TRPA 1TU7A 4GDFA 2CAIA 2XBQA 1ST9A 1GULA 2YCDA 1XCCA 3P2AA 1ERUA 3I43A 3GTUB 2B1LA 1MDJA 2QA1A 1WIKA 2DJ1A 3UJ1A 2GQMA 1VRSD 4GWRA 1DE2A 4KSMA 4BL7A 2AB6A 1B4QA 1XZOA 1TXUA 5IMFA 2GLRA 4F0BA 4HDEA 3GA4A 1MD4A 4RQRA 5LD0A 3CYNA 5F0GA 2M46A 1TI3A 3BCKA 4L8EA 2IMFA 3HYPA 2F3MA 4HUAA 3Q6OA 2I81A 5ENUA 3EWLA 3HJPA 3GNJA 4EE0A 1Y25A 4TVEA 20GSA 1TJDA 3FY7A 3FEUA 3GFKA 2PWJA 1JHBA 2H0GA 1SVMA 1Q98A 1JZRA 2K6VA 5G30A 5JCUA 1TI1A 7GSSA 4TW5A 2B1KA 4GRFA 4TR1A 2NPBA 1OC3A 3LEFA 3ZVJD 3KH9A 4IKHA 1GSEA 1XFLA 3N9JA 3UVTA 4RI6A 4ACSA 1A2LA 1GP1A 4O5UA 3HZ8A 2VM2A 5ELAA 2FHEA 1WPIA 2V41A 3IHGA 3UBLA 4GCIA 2JACA 3HD5A 4FYBA 2X8CA 1PL2A 1EV9A 2GSSA 3IAM2 3WGXA 2I3YA 2A4HA 3GKKA 5IO0A 2AYTA 3O76A 2K18A 3LYKA 1GLQA 4OD7A 4MJBA 2YANA 5CYYA 4QMKA 1TTZA 2NVLA 4P3YB 1GUMA 4L5LA 2VAFA 1ERTA 2OE0A 2OKAA 1GSYA 5J9BA 1J08A 1M9BA 1SK0A 1HQOA 2DJ2A 3H79A 5F07A 2RUFA 4NPBA 1SU9A 1HNCA 1JZDA 2GZYA 2PMTA 1J9BA 5J4YA 4QL9A 4PNFA 1B48A 1F3BA 3Q18A 4K8MA 1GNWA 1FVJA 2LUSA 4V2MA 3F3RA 3KGKA 1U3AA 1QFNA 1Z9HA 3M9JA 3LWAA 2XC2A 2H01A 3BCIA 2GDRA 3TUEA 3R3EA 3VPTA 12GSA 1Z7PA 5JCWA 4JR4A 2CQ9A 2CX3A 3RDWA 1VF3A 1BAYA 4YQMA 2HSMB 1FW1A 1G6WA 2CVDA 1IYHA 4FO5A 4O92A 2C3NA 3GKMA 4IJIA 4ILFA 1ZL9A 4N0VA 3VK9A 4N10A 5F05A 3M1GA 3M8NA 1ZYEA 3TJGA 4LMVA 1AW9A 2GZPA 4WBRD 1M99A 4IP1A 4ID0A 1SVLA 4K7IA 1TRVA 1TOFA 2OJLA 1SJZA 3DYRA 4POKA 1BG5A 3FYGA 1O6JA 3IR4A 1GNEA 5DDLA 3APSA 2LSTA 2R4VA 3L78A 4TXOA 5HR1A 3S9FA 3GURA 1SKSB 4KGIA 2E2GA 3FKFA 2JZSA 2VL2C 3C1SA 3KP9A 4WETA 4YKGA 2D2ZA 3KP8A 1GSQA 2TRXA 3F63A 3C1RA 1WP0A 1EP7A 3IK7A 3Q19A 3H93A 4N11A 1FAAA 4QQ7A 1S3AA 2PERA 3ME8A 4O5RA 5IOWA 5D9WA 3Q74A 2CX4A 4E8EA 4WR5A 3C8EA 4Z2TA 1SJIA 1B4PA 3KM6A 3GSTA 3WGDA 4DSSA 2GGTA 1AC1A 4GQFA 4ICYA 3UOMA 3BJ5A 3EYTA 3GN3A 2HZEB 2B5EA 1EOHA 2UV8G 2A4VA 3GTUA 1R5PA 3F6DA 4BWSA 5F06A 4GSTA 1OKTA 5KOWA 2IIYA 2O7KA 22GSA 3GH6A 3VURA 4ZB6A 3GHAA 2ALBA 4NWYA 2VL3A 4K6XA 3KCMA 1A24A 2WS2A 4L5OA 2R2JA 2OE3A 2WCIA 1ABAA 4N30A 1Z7RA 1GWCA 1K0CA 2MBSA 4XRDA 5HFIA 5KN1A 2LRCA 4HU7A 3A2VA 3QCPA 5DAKB 3UEMA 2JSZA 3L4NA 2MYGA 4XCSA 1F3AA 4K5SA 4GTUA 3ZL5A 2HFDA 5IMZA 4F9ZA 2WRTA 3W8SA 5ECHB 2CVBA 2NTOA 2WULA 1XWAA 3DXBA 5JWQB 4I8BA 4I2TA 3GIXA 1FHEA 5IM9A 4XS4B 2BTOT 5DCGA 4WF4A 2LJRA 1KEBA 3ZFLA 2YN1A 2DKIA 3FZ9A 5HR2A 5G1KA 2M72A 2VCTA 2CV4A 3LW9A 2VCVA 3GL3A 4TR0A 2VO4A 4FH8A 1SYXA 13GSA 2ON5A 2HSYA 4ZL7A 2WB9A 1XVQA 4X43A 1O81A 1QUWA 1AIUA 3GMFA 3TJBA 1GSFA 3VLNA 3MAKA 5ECPB 3IXRA 2G2QA 2FCHA 2DSAA 5CRHA 2X8HA 2L4QA 1YZXA 4WKWA 3QAWA 5C00A 5GZZB 2V1MA 1SL2B 3FRCA 2CZ3A 3RBTA 2I9HA 2EC4A 4V1Ag 5AIVA 6GSUA 3QR6A 1SL1B 2MZCA 1THXA 1JZWA 4CDOA 1PL1A 1U3IA 2QGVA 3ZRDA 4JZQA 4PQHA 5FWGA 3KTBA 2EIQA 4HQZA 1AQXA 3EMXA 2R0GA 3D0ZA 3W6GA 3I6AA 1SENA 3ZYWA 5JWOB 2KOKA 1O8XA 4LL4B 2PVQA 3GRXA 3ZFBA 2VKZG 5IMAA 4J2FA 2X49A 5E4WA 2R0CA 3IK9A 1MTCA 1E2YA 6GSYA 5H5QA 4ISDA 3ERWA 1VF2A 2HZFA 3I69A 2HSMA 3EC3A 2A2RA 3IV4A 4PURA 3F4RA 1NHYA 2OBKA 3TJJA 2B6MA 2LRTA 5KN2A 3UAPA 2DIZA 1GL8A 5DVBA 1CQGA 1Z6NA 3APOA 2VD1A 8GSSA 4CHSA 5IQYA 4ULXA 4WF5A 2PBJA 1O7UA 4XS6A 4MH2A 1F2EA 1G7EA 4BWQA 2E7PA 2I1UA 1OVNA 2GQLA 5CNWA 4K7OA 1YDKA 1M2BA 3TOTA 5GSTA 4D73B 2IMIA 2DJ0A 4MMMA 3VPQA 1R26A 2EFCA 2GSRA 4MF5A 4I5QA 2DC5A 1R4WA 3FR9A 3H4KA 2V2GA 4POMA 4EIQA 1TU8A 1AQVA 3E0UA 1XIYA 2FD3A 1PQNA 2H1GA 2L5OA 3US3A 4XRAA 2JZTA 3W8JA 4G9HA 4KB3A 2X64A 1K0AA 4BPYA 2FWHA 4XTSA 2LKUA 2OT3A 5G1LA 2B5XA 3TDGA 3ZITA 1VF1A 1PMTA 2QKEA 2H71A 3L0HA 4YAPA 2L59A 4AJ8A 2R3XA 3TJFA 4G0IA 1OC9B 4HI7A 4IW9A 1S3DA 3TKRA 1EGOA 1ZCPA 2AV4A 1SD9A 4K0GA 2BMXA 1EEJA 1DSBA 5ECIB 2HZEA 2LTKA 3ME7A 3QAVA 2F8AA 4TRXA 3GSSA 5HR3A 1YF0A 2H1AA 2PGTA 3TKSC 5IOXA 1JLWA 4LA1A 3ZZXA 6GSSA 2AUVA 2C3QA 2EFDA 4KW6A 1GUHA 5ID2B 3JCML 3C73A 2HRNA 3HVVA 2L6CA 2Z9SA 2TRCP 4FYCA 3QFBC 3EMPA 4F03A 2B7KA 1T4ZA 2E0QA 4MDCA 4PX1A 3PINA 1U6TA 3P7XA 4ML6A 2KUCA 4KCEA 5DAKA 1T7PB 3PPUA 4GSSA 1TDIA 1BF5A 4KDUA 2PN8A 5H5SA 2J23A 5J4UA 1B9YC 3GH9A 3KTLA 5ECNB 2F8FA 2LQQA 5FHIA 3UARA 1V57A 2H70A 4XS4A 1CQHA 4NV2A 1ZYNA 1UN2A 4KUNA 3GX0A 1THOA 4CW9A 3F8UA 4IGJA 4EVMA 3LXZA 1O85A 2JSYA 1FG4A 3L9VA 4DEJA 1KNGA 1SYRA 3RAZA 3D4TA 4OCEA 4RUVA 4KA0A 5ECLB 5HQPA 1PKZA 3HDCA 2AJQB 5A5HB 5ECSA 4ZL8A 3M0FA 3C71A 1XWKA 3VWVA 1DBYA 4PGTA 4PTSA 4FIWA 1MDKA 2WJUA 1X5DA 3NOFA 4HZ2A 4YKFA 2VL9A 3GYKA 5GAND 2F51A 1A8YA 1RW1A 5ABRA 2TIRA 1A23A 2DMMA 3IA1A 4TN8A 2JADA 1PRXA 2CA8A 1MDIA 2N5AA 3E3EA 3TKQA 2N5BA 1NSWA 1YKAA 5J3RA 3KH7A 1X9MB 4ECBA 2WZ9A 2X99A 5HFKA 5CRGA 1V98A 1JLVA 1GLPA 3RHCA 5IPGA 1FB6A 3ZIJA 2HT9A 3RPPA 4KAEA 4HU9A 3IRAA 4IHUA 4V2LA 2MBTA 4AKIA 3CSIA 2IN3A 1LJRA 1JZOA 2H72A 4EC0A 1URMA 5CO3A 1EEMA 1ZZYA 4NMUA 2BJXA 4K5RA 4V2NA 2ZUPA 5CRWA 1EOGA 3CXGA 3GX8A 5B6MA 3HVSA 1SK1A 3F0IA 5D9TA 2EFHA 3DKSA 3MDKA 2FLSA 5ECMB 5DJLA 4WXTA 3IE3A 3CWGA 4GF0A 2YJ7A 4KDXA 4NHWA 4D73A 5A4WA 4HS1A 1QMVA 3IDVA 19GSA 3D21A 2OACA 4ZB9A 1BYEA 3IC4A 3CMIA 3FMWA 2VCWA 4CY6A 3QAGA 2K8SA 5GSSA 1A2JA 1C72A 3O3TA 4XIHA 3KMNA 3CTGA 1XWBA 1B8XA 4TOPA 4H86A 5BRTA 4X0XA 2HSHA 3LXTA 5ELGA 3G7IA 1EWXA 1F6MC 1MD3A 3EVIA 1FB0A 1XW9A 1K3LA 1TP9A 3CRUA 3TJKA 5EY6A 4TR4A 1M9AA 3KIJA 4ECCA 2L6DA 4RI7A 1U88A 1R5AA 4K1FA 3ISOA 4Q5NA 1W4VA 3OR5A 3D6IA 4PQ1A 1NHOA 5J40A 1OC9A 2EIRA 4N0ZA 2QA2A 5EL8A 1OE8A 2G0FA 3QMXA 3PGTA 1VF4A 3WD6A 5KOXA 1BG1A 1ZYPA 2MMZA 1ERWA 4IELA 1V2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XOA A;  1OKD A;  6GSV A;  2C0E A;  2H8L A;  2V32 A;  3EIN A;  2H0I A;  1GTI A;  5ID2 A;  2C1Y A;  3C7M A;  3UVH A;  2CZ2 A;  3U6V A;  4DVC A;  4ZIL A;  5B8A A;  3HY2 A;  3EE2 A;  4GSN A;  1XBS A;  2C80 A;  3D22 A;  2V6K A;  1DUG A;  4GQC A;  3D4M A;  5HR0 A;  1GSS A;  4MZW A;  5D93 A;  4KSO A;  1K0B A;  4MK3 A;  2FWF A;  3TRQ A;  4O7H A;  5FT3 A;  4BVY B;  4DSR A;  2YOI A;  3L9U A;  1K3Y A;  5G5F A;  1SKW B;  2N5F A;  4IQA A;  2LJA A;  2KHP A;  2DLX A;  3D5J A;  4XHM A;  3PR8 A;  2P5Q A;  2YP6 A;  2HRA A;  2OA7 A;  3FR6 A;  4KE3 A;  3ERG A;  4ZXG A;  1UVZ A;  2RM5 A;  1T00 A;  1BX9 A;  3RHB A;  2IPA A;  3TKS E;  4G0K A;  2JU5 A;  1PX6 A;  5EVO A;  1V40 A;  3WT2 A;  2QSI A;  5C04 A;  4WEY A;  4AGS A;  3MSZ A;  5ECK B;  3HA9 A;  4YAV A;  2YZU A;  3A2X A;  3U5R E;  3KJY A;  1M2A A;  5D9V A;  4IP6 A;  3VWX A;  5AIS A;  4DSQ A;  3UMA A;  3HHV A;  4HJ2 A;  1GTU A;  1XVW A;  1XPV A;  3G7J A;  2MMA A;  2OBI A;  5GAP D;  4TR3 A;  2DJJ A;  4K0N A;  1TRS A;  2E2M A;  3QPM A;  1JFU A;  4K7N A;  2YJH A;  2C3T A;  3TGZ A;  2HQT A;  1YEX A;  1RK4 A;  2GTU A;  4F2I A;  16GS A;  4KCA A;  2VCQ A;  3DRN A;  4YH2 A;  5DAL B;  1YQ1 A;  4XS1 A;  5KN0 A;  2H19 A;  17GS A;  3GKN A;  5IIZ A;  3DML A;  1SKR B;  5ECR B;  4EL1 A;  1MEK A;  2L5L A;  3HVX A;  4MH3 A;  3HKR A;  3VFI A;  3AY8 A;  2YWI A;  4JR6 A;  1WJK A;  5A5K A;  1T1V A;  4ZBD A;  1O73 A;  1DE1 A;  5INY A;  2CVK A;  2HSN B;  3G7Y A;  2KP1 A;  2H6X A;  1YKC A;  3HJO A;  1Z6M A;  3FHK A;  2VD0 A;  4L0U A;  4MLY A;  4Q5F A;  3P90 A;  5F8B A;  2O85 A;  4PXO A;  4I2U A;  2H1D A;  2H6Y A;  3TOU A;  3CSH A;  3VI5 A;  4JE1 A;  3LJR A;  2HRK B;  3WT1 A;  3H1N A;  1G7O A;  3RPN A;  5JCG A;  1X9S B;  5E59 A;  1OAZ A;  1ZGN A;  3FW2 A;  3ZIV A;  2YWO A;  3GUS A;  1T3B A;  3O6T A;  5AN1 A;  3VWU A;  1QK8 A;  4USS A;  3KZQ A;  2FA8 A;  4L0W A;  3VWW A;  1M2D A;  1USB A;  3N5O A;  2FA4 A;  1PX7 A;  4OFN A;  1NW2 A;  3F6F A;  2VCZ A;  2HXK A;  2ON7 A;  2HRF A;  1A8L A;  5B7C A;  4G0L A;  3ERF A;  3DWV A;  1ERV A;  3DVW A;  1GSU A;  1ZMA A;  3P8W A;  1WWJ A;  1AAZ A;  1X9W B;  4FQU A;  1J0F A;  5LNK e;  3A5W A;  1M0U A;  5ECQ B;  2IME A;  4MJC A;  1N2A A;  1OYJ A;  2IMK A;  3LFL A;  2M80 A;  4JBB A;  11GS A;  1ZOF A;  2EIO A;  4POB A;  5D8I A;  2H6Z A;  1Z3E A;  4KND A;  2I4A A;  2PU9 C;  1OE7 A;  4JU5 A;  2LNS A;  1UA5 A;  4LMW A;  4HEA 2;  3ZTL A;  2RUE A;  6GST A;  1E6B A;  4GLT A;  1ACV A;  1QXH A;  3E9J B;  5CRE A;  1BED A;  3LSZ A;  2P5R A;  5IMV A;  1TXX A;  1OC8 A;  2GT6 A;  3IC8 A;  5DJM A;  2P31 A;  1RQM A;  2B5Y A;  3APQ A;  2KLX A;  3HJM A;  3R2Q A;  5ECO B;  2JL4 A;  2KP2 A;  4BVX B;  2PVO C;  3QD9 A;  3K8N A;  1U87 A;  1HNB A;  1YJ6 A;  1EGR A;  4OFT A;  2HNL A;  5IPH A;  4Q5R A;  1PSQ A;  4J56 E;  5DQS A;  3L9S A;  2LEG A;  4NAX A;  2HI7 A;  2YWM A;  2GQK A;  4MZB A;  1K0M A;  4MA9 A;  3FZ4 A;  2B3S A;  3UL3 A;  2XBI A;  2X8G A;  14GS A;  5KN3 A;  2WDU A;  4MJA A;  3EU3 A;  2YZH A;  5G2Z A;  2PPT A;  5DBQ A;  4K2D A;  2ZNM A;  1ZYQ B;  3F9U A;  4BVY A;  1K0O A;  5D9X A;  9GSS A;  1EV4 A;  2K9F A;  3ZMK A;  1UC7 A;  1S3C A;  3CBU A;  1SD8 A;  3DD3 A;  5AGY A;  1TW9 A;  2DIY A;  1F9M A;  1Q4J A;  1FOV A;  4MF7 A;  2R37 A;  1A0F A;  3FK8 A;  4ZB8 A;  2H74 A;  3ZML A;  5A4U A;  2IJY A;  2H30 A;  1F37 A;  4NXI A;  3WGE A;  1WE0 A;  5CRD A;  5EPF A;  2IFQ B;  2IL3 A;  1QQ2 A;  1B9X C;  1YF1 A;  2FWE A;  3A3T A;  3ZVJ A;  3KEB A;  4EDZ A;  1BJX A;  3FZA A;  3IOS A;  2MMO A;  4JED A;  1GTA A;  2C4J A;  2AHE A;  1I5G A;  3IBH A;  2VL2 A;  4I97 A;  2FWG A;  2IMD A;  2LV3 A;  5L71 A;  3FZ5 A;  4MZC A;  3ZRE A;  4PQI A;  3SBC A;  3J7Y b;  2C0G A;  1K0D A;  1BQ7 A;  2R5G A;  1WMJ A;  2REM A;  1GSD A;  4AJ7 A;  4G10 A;  4MP4 A;  5IO2 A;  2HE3 A;  4IVF A;  2FNO A;  4IBP A;  1V9W A;  4AJ6 A;  4HOJ A;  4FYU A;  2XHF A;  5DAL A;  2C0F A;  2WGR A;  5A4V A;  1YEP A;  3M3M A;  1TK0 B;  1AQW A;  2GSQ A;  4NHZ A;  3QFA C;  4EUY A;  2DJK A;  1GH2 A;  4WBJ A;  3UIW A;  4YQU A;  4PUA A;  1I9D A;  2VLU A;  3LGC A;  2GT5 A;  2H0H A;  5DQY A;  1K0N A;  3WYW A;  2IWT A;  2F9S A;  3EU4 A;  4PUF C;  4HZ4 A;  3LYP A;  4KF9 A;  2CT6 A;  1PN9 A;  1A2M A;  2MMN A;  2A2S A;  3M9K A;  3CRT A;  1N8J A;  5J9C A;  1YY7 A;  4V1A p;  1FVK A;  5IMC A;  3CTF A;  1PD2 1;  2HRK A;  2HYX A;  2H75 A;  2XPE A;  4MAB A;  3CSJ A;  2LNT A;  4QL7 A;  5BMU A;  1XW5 A;  4RQX A;  4Q5Q A;  1X5E A;  4ECI A;  1SL0 B;  4KDY A;  4LLR A;  2H66 A;  4BL7 B;  1KTE A;  2YPM A;  3FR3 A;  2JZR A;  4IQ1 A;  1FO5 A;  4HQS A;  1TRW A;  1LU4 A;  3SWL A;  3VI7 A;  4ZBB A;  2QC7 A;  4ECJ A;  1EZK A;  2LS5 A;  5DCH A;  4MCU A;  3NIV A;  2FY6 A;  4OMV A;  3IAS 2;  4Z7X A;  3A2W A;  1LBK A;  1XW6 A;  1WOU A;  2DML A;  2GZZ A;  1PGT A;  1Z5Y E;  2LQO A;  2H73 A;  2VIM A;  3F4T A;  6GSW A;  1TK5 B;  3GKX A;  18GS A;  1HYU A;  4TR1 B;  4OCF A;  1PKW A;  1TKD B;  5H5R A;  6GSX A;  5B6N A;  5D96 A;  4OO4 A;  2AAW A;  3ZLP A;  1WRY A;  1TRU A;  3TKP A;  4ZL9 A;  3V1W A;  1HNA A;  5IMD A;  5HFG A;  2RLI A;  2C0D A;  2OE1 A;  4EF0 A;  3G9B A;  4X1U A;  3HZ4 A;  1KBN A;  2VM1 A;  2VCX A;  1SK2 A;  4ML1 A;  2XPD A;  1O8W A;  1AXD A;  4BVX A;  3GV1 A;  1ON4 A;  3GL5 A;  5CP1 A;  3DGQ A;  3KXO A;  4YQV A;  1ML6 A;  3I9V 2;  4MPF A;  5LCZ A;  4MPG A;  4BA7 A;  2LRN A;  2VUP A;  10GS A;  2YWN A;  3IHQ A;  4HJM A;  2O87 A;  2O89 A;  1GRX A;  1XWG A;  3DVX A;  2FUG 2;  2DBC A;  5G31 A;  5CAX A;  3BBY A;  4LL1 B;  3NZN A;  3HCZ A;  2LJK A;  5JWR B;  3H8Q A;  3DIE A;  5J5N A;  3KD0 A;  2GST A;  3UBK A;  3BOA A;  4OFM A;  4EO3 A;  3PH9 A;  4G19 A;  1M7T A;  1A0R P;  4I6X A;  1X5C A;  3HXS A;  1GTB A;  5G5E A;  1VGL A;  3F4S A;  4OWY A;  2CAQ A;  2ZCT A;  1QGV A;  4F0C A;  2O8V B;  2C8U A;  1ILO A;  2RM6 A;  2K8V A;  3QDN A;  3DEX A;  2OAD A;  1PA3 A;  4TXV A;  1H4O A;  1IYI A;  2YV9 A;  5AIX A;  3LQ7 A;  3LG6 A;  1G6Y A;  2ES7 A;  1R7H A;  5COH A;  2VLT A;  4IS0 A;  1XXU A;  4IN0 A;  5J41 A;  4OO5 A;  1GUK A;  4KX4 A;  2B7J A;  1W89 A;  1XWC A;  2GVP A;  3IPZ A;  3QOU A;  4KH7 A;  3TRX A;  2IFQ A;  1K3O A;  2GS3 A;  4ZBA A;  4G2E A;  2YNX A;  5D73 A;  3EUR A;  4GXZ A;  1HD2 A;  4WR4 A;  2VLV A;  3LOR A;  4TKY A;  2H76 A;  3ED3 A;  2FGX A;  2L4C A;  4ZIJ A;  3J7Y k;  1G0T A;  2WFC A;  3MNG A;  4MJE A;  2J9H A;  4J57 E;  1SJ6 A;  2L57 A;  4TXO B;  1X0R A;  2NBS A;  4E8H A;  1T4Y A;  3TB2 A;  4EKZ A;  4NV5 A;  5B8B A;  1EP8 A;  2YV7 A;  1Y6E A;  1V58 A;  2HLS A;  1H75 A;  2V6O A;  2PUK C;  1XOB A;  2NDO A;  2R6K A;  4O32 A;  4K9Z A;  1TK8 B;  4POL A;  1T8E B;  4AF2 A;  2RII A;  1AUC A;  2UZ8 A;  4MF6 A;  4PNG A;  3F3Q A;  1NM3 A;  3BD2 A;  2P0G A;  4JRR A;  5KEJ A;  4IJ3 A;  2DJ3 A;  3KMO A;  4F82 A;  3TKS A;  3MWH A;  4EXJ A;  4DSS B;  2H1B A;  3TCO A;  2VOC A;  4EDY A;  3TRP A;  1TU7 A;  2CAI A;  2XBQ A;  1ST9 A;  1GUL A;  2YCD A;  1XCC A;  3P2A A;  1ERU A;  3I43 A;  3GTU B;  2B1L A;  1MDJ A;  1WIK A;  2DJ1 A;  3UJ1 A;  2GQM A;  1VRS D;  4GWR A;  1DE2 A;  4KSM A;  4BL7 A;  2AB6 A;  1B4Q A;  1XZO A;  5IMF A;  2GLR A;  4F0B A;  4HDE A;  3GA4 A;  1MD4 A;  4RQR A;  5LD0 A;  3CYN A;  5F0G A;  2M46 A;  1TI3 A;  3BCK A;  4L8E A;  2IMF A;  3HYP A;  2F3M A;  4HUA A;  3Q6O A;  2I81 A;  5ENU A;  3EWL A;  3HJP A;  3GNJ A;  4EE0 A;  1Y25 A;  4TVE A;  20GS A;  1TJD A;  3FY7 A;  3FEU A;  3GFK A;  2PWJ A;  1JHB A;  2H0G A;  1Q98 A;  1JZR A;  2K6V A;  5G30 A;  5JCU A;  1TI1 A;  7GSS A;  4TW5 A;  2B1K A;  4GRF A;  4TR1 A;  2NPB A;  1OC3 A;  3LEF A;  3ZVJ D;  3KH9 A;  4IKH A;  1GSE A;  1XFL A;  3N9J A;  3UVT A;  4RI6 A;  4ACS A;  1A2L A;  1GP1 A;  3HZ8 A;  2VM2 A;  5ELA A;  2FHE A;  1WPI A;  2V41 A;  3UBL A;  4GCI A;  2JAC A;  3HD5 A;  4FYB A;  2X8C A;  1PL2 A;  1EV9 A;  2GSS A;  3IAM 2;  3WGX A;  2I3Y A;  3GKK A;  5IO0 A;  2AYT A;  3O76 A;  2K18 A;  3LYK A;  1GLQ A;  4OD7 A;  4MJB A;  2YAN A;  5CYY A;  1TTZ A;  2NVL A;  4P3Y B;  1GUM A;  4L5L A;  2VAF A;  1ERT A;  2OE0 A;  2OKA A;  1GSY A;  5J9B A;  1J08 A;  1M9B A;  1SK0 A;  1HQO A;  2DJ2 A;  3H79 A;  5F07 A;  2RUF A;  4NPB A;  1SU9 A;  1HNC A;  1JZD A;  2GZY A;  2PMT A;  1J9B A;  4QL9 A;  4PNF A;  1B48 A;  1F3B A;  3Q18 A;  4K8M A;  1GNW A;  1FVJ A;  2LUS A;  4V2M A;  3F3R A;  3KGK A;  1U3A A;  1QFN A;  1Z9H A;  3M9J A;  3LWA A;  2XC2 A;  2H01 A;  3BCI A;  2GDR A;  3TUE A;  3R3E A;  3VPT A;  12GS A;  1Z7P A;  5JCW A;  4JR4 A;  2CQ9 A;  2CX3 A;  3RDW A;  1VF3 A;  1BAY A;  4YQM A;  2HSM B;  1FW1 A;  1G6W A;  2CVD A;  1IYH A;  4FO5 A;  4O92 A;  2C3N A;  3GKM A;  4IJI A;  4ILF A;  1ZL9 A;  4N0V A;  3VK9 A;  4N10 A;  5F05 A;  3M1G A;  3M8N A;  1ZYE A;  3TJG A;  4LMV A;  1AW9 A;  2GZP A;  4WBR D;  1M99 A;  4IP1 A;  4ID0 A;  4K7I A;  1TRV A;  1TOF A;  2OJL A;  1SJZ A;  3DYR A;  4POK A;  1BG5 A;  3FYG A;  1O6J A;  3IR4 A;  1GNE A;  5DDL A;  3APS A;  2LST A;  2R4V A;  3L78 A;  4TXO A;  5HR1 A;  3S9F A;  3GUR A;  1SKS B;  4KGI A;  2E2G A;  3FKF A;  2JZS A;  2VL2 C;  3C1S A;  3KP9 A;  4WET A;  2D2Z A;  3KP8 A;  1GSQ A;  2TRX A;  3F63 A;  3C1R A;  1WP0 A;  1EP7 A;  3IK7 A;  3Q19 A;  3H93 A;  4N11 A;  1FAA A;  4QQ7 A;  1S3A A;  2PER A;  3ME8 A;  4O5R A;  5IOW A;  5D9W A;  3Q74 A;  2CX4 A;  4E8E A;  4WR5 A;  3C8E A;  1SJI A;  1B4P A;  3KM6 A;  3GST A;  3WGD A;  4DSS A;  2GGT A;  1AC1 A;  4GQF A;  3UOM A;  3BJ5 A;  3EYT A;  3GN3 A;  2HZE B;  2B5E A;  1EOH A;  2A4V A;  3GTU A;  1R5P A;  3F6D A;  4BWS A;  5F06 A;  4GST A;  1OKT A;  2IIY A;  2O7K A;  22GS A;  3GH6 A;  3VUR A;  4ZB6 A;  3GHA A;  2ALB A;  4NWY A;  2VL3 A;  4K6X A;  3KCM A;  1A24 A;  2WS2 A;  4L5O A;  2R2J A;  2OE3 A;  2WCI A;  1ABA A;  4N30 A;  1Z7R A;  1GWC A;  1K0C A;  2MBS A;  4XRD A;  5HFI A;  5KN1 A;  2LRC A;  4HU7 A;  3A2V A;  3QCP A;  5DAK B;  3UEM A;  2JSZ A;  3L4N A;  2MYG A;  4XCS A;  1F3A A;  4GTU A;  3ZL5 A;  2HFD A;  5IMZ A;  4F9Z A;  2WRT A;  3W8S A;  5ECH B;  2CVB A;  2NTO A;  2WUL A;  1XWA A;  3DXB A;  5JWQ B;  4I8B A;  4I2T A;  3GIX A;  1FHE A;  5IM9 A;  4XS4 B;  2BTO T;  5DCG A;  4WF4 A;  2LJR A;  1KEB A;  3ZFL A;  2YN1 A;  3FZ9 A;  5HR2 A;  5G1K A;  2M72 A;  2VCT A;  2CV4 A;  2VCV A;  3GL3 A;  4TR0 A;  2VO4 A;  4FH8 A;  1SYX A;  13GS A;  2ON5 A;  2HSY A;  4ZL7 A;  2WB9 A;  1XVQ A;  4X43 A;  1O81 A;  1QUW A;  1AIU A;  3GMF A;  3TJB A;  1GSF A;  3VLN A;  3MAK A;  5ECP B;  3IXR A;  2G2Q A;  2FCH A;  2DSA A;  5CRH A;  2X8H A;  2L4Q A;  1YZX A;  4WKW A;  3QAW A;  5C00 A;  5GZZ B;  2V1M A;  1SL2 B;  3FRC A;  2CZ3 A;  3RBT A;  2I9H A;  2EC4 A;  4V1A g;  5AIV A;  6GSU A;  3QR6 A;  1SL1 B;  2MZC A;  1THX A;  1JZW A;  4CDO A;  1PL1 A;  1U3I A;  2QGV A;  3ZRD A;  4JZQ A;  4PQH A;  5FWG A;  3KTB A;  2EIQ A;  4HQZ A;  1AQX A;  3EMX A;  3D0Z A;  3W6G A;  3I6A A;  1SEN A;  3ZYW A;  5JWO B;  2KOK A;  1O8X A;  4LL4 B;  2PVQ A;  3GRX A;  3ZFB A;  5IMA A;  4J2F A;  5E4W A;  3IK9 A;  1MTC A;  1E2Y A;  6GSY A;  5H5Q A;  4ISD A;  3ERW A;  1VF2 A;  2HZF A;  3I69 A;  2HSM A;  3EC3 A;  2A2R A;  3IV4 A;  4PUR A;  3F4R A;  1NHY A;  2OBK A;  3TJJ A;  2B6M A;  2LRT A;  5KN2 A;  3UAP A;  2DIZ A;  1GL8 A;  5DVB A;  1CQG A;  1Z6N A;  3APO A;  2VD1 A;  8GSS A;  4CHS A;  5IQY A;  4ULX A;  4WF5 A;  2PBJ A;  1O7U A;  4XS6 A;  4MH2 A;  1F2E A;  1G7E A;  4BWQ A;  2E7P A;  2I1U A;  1OVN A;  2GQL A;  5CNW A;  4K7O A;  1YDK A;  1M2B A;  3TOT A;  5GST A;  4D73 B;  2IMI A;  2DJ0 A;  4MMM A;  3VPQ A;  1R26 A;  2GSR A;  4MF5 A;  4I5Q A;  2DC5 A;  1R4W A;  3FR9 A;  3H4K A;  2V2G A;  4POM A;  1TU8 A;  1AQV A;  3E0U A;  1XIY A;  2FD3 A;  1PQN A;  2H1G A;  2L5O A;  3US3 A;  4XRA A;  2JZT A;  3W8J A;  4G9H A;  4KB3 A;  2X64 A;  1K0A A;  4BPY A;  2FWH A;  4XTS A;  2LKU A;  5G1L A;  2B5X A;  3TDG A;  3ZIT A;  1VF1 A;  1PMT A;  2QKE A;  2H71 A;  3L0H A;  4YAP A;  2L59 A;  4AJ8 A;  2R3X A;  3TJF A;  4G0I A;  1OC9 B;  4HI7 A;  4IW9 A;  1S3D A;  3TKR A;  1EGO A;  1ZCP A;  2AV4 A;  1SD9 A;  4K0G A;  2BMX A;  1EEJ A;  1DSB A;  5ECI B;  2HZE A;  2LTK A;  3ME7 A;  3QAV A;  2F8A A;  4TRX A;  3GSS A;  5HR3 A;  1YF0 A;  2H1A A;  2PGT A;  3TKS C;  5IOX A;  1JLW A;  4LA1 A;  3ZZX A;  6GSS A;  2AUV A;  2C3Q A;  4KW6 A;  1GUH A;  5ID2 B;  3JCM L;  3C73 A;  2HRN A;  3HVV A;  2L6C A;  2Z9S A;  2TRC P;  4FYC A;  3QFB C;  3EMP A;  4F03 A;  2B7K A;  1T4Z A;  2E0Q A;  4MDC A;  4PX1 A;  3PIN A;  1U6T A;  3P7X A;  4ML6 A;  2KUC A;  4KCE A;  5DAK A;  1T7P B;  3PPU A;  4GSS A;  1TDI A;  4KDU A;  2PN8 A;  5H5S A;  2J23 A;  5J4U A;  1B9Y C;  3GH9 A;  3KTL A;  5ECN B;  2F8F A;  2LQQ A;  5FHI A;  3UAR A;  1V57 A;  2H70 A;  4XS4 A;  1CQH A;  4NV2 A;  1UN2 A;  4KUN A;  3GX0 A;  1THO A;  4CW9 A;  3F8U A;  4IGJ A;  4EVM A;  3LXZ A;  1O85 A;  2JSY A;  1FG4 A;  3L9V A;  4DEJ A;  1KNG A;  1SYR A;  3RAZ A;  3D4T A;  4OCE A;  4RUV A;  4KA0 A;  5ECL B;  5HQP A;  1PKZ A;  3HDC A;  2AJQ B;  5ECS A;  4ZL8 A;  3M0F A;  3C71 A;  1XWK A;  3VWV A;  1DBY A;  4PGT A;  4PTS A;  4FIW A;  1MDK A;  2WJU A;  1X5D A;  3NOF A;  4HZ2 A;  2VL9 A;  3GYK A;  5GAN D;  2F51 A;  1A8Y A;  1RW1 A;  5ABR A;  2TIR A;  1A23 A;  2DMM A;  3IA1 A;  4TN8 A;  2JAD A;  1PRX A;  2CA8 A;  1MDI A;  2N5A A;  3E3E A;  3TKQ A;  2N5B A;  1NSW A;  1YKA A;  5J3R A;  3KH7 A;  1X9M B;  4ECB A;  2WZ9 A;  2X99 A;  5HFK A;  5CRG A;  1V98 A;  1JLV A;  1GLP A;  3RHC A;  5IPG A;  1FB6 A;  3ZIJ A;  2HT9 A;  3RPP A;  4KAE A;  4HU9 A;  3IRA A;  4IHU A;  4V2L A;  2MBT A;  3CSI A;  2IN3 A;  1LJR A;  1JZO A;  2H72 A;  4EC0 A;  1URM A;  5CO3 A;  1EEM A;  1ZZY A;  4NMU A;  2BJX A;  4V2N A;  2ZUP A;  5CRW A;  1EOG A;  3CXG A;  3GX8 A;  5B6M A;  3HVS A;  1SK1 A;  3F0I A;  5D9T A;  3DKS A;  3MDK A;  2FLS A;  5ECM B;  5DJL A;  4WXT A;  3IE3 A;  4GF0 A;  2YJ7 A;  4KDX A;  4NHW A;  4D73 A;  5A4W A;  4HS1 A;  1QMV A;  3IDV A;  19GS A;  3D21 A;  2OAC A;  4ZB9 A;  1BYE A;  3IC4 A;  3CMI A;  2VCW A;  3QAG A;  2K8S A;  5GSS A;  1A2J A;  1C72 A;  3O3T A;  4XIH A;  3KMN A;  3CTG A;  1XWB A;  1B8X A;  4TOP A;  4H86 A;  4X0X A;  2HSH A;  3LXT A;  5ELG A;  3G7I A;  1EWX A;  1F6M C;  1MD3 A;  3EVI A;  1FB0 A;  1XW9 A;  1K3L A;  1TP9 A;  3CRU A;  3TJK A;  5EY6 A;  4TR4 A;  1M9A A;  3KIJ A;  4ECC A;  2L6D A;  4RI7 A;  1U88 A;  1R5A A;  4K1F A;  3ISO A;  4Q5N A;  1W4V A;  3OR5 A;  3D6I A;  4PQ1 A;  1NHO A;  1OC9 A;  2EIR A;  4N0Z A;  5EL8 A;  1OE8 A;  2G0F A;  3QMX A;  3PGT A;  1VF4 A;  3WD6 A;  2MMZ A;  1ERW A;  4IEL A;  1V2A A; 
#chains in the Genus database with same CATH topology
 4PI0 C;  1XOA A;  1OKD A;  6GSV A;  2C0E A;  2H8L A;  2V32 A;  3EIN A;  2H0I A;  1GTI A;  5ID2 A;  2C1Y A;  3C7M A;  3UVH A;  2CZ2 A;  3U6V A;  4DVC A;  4N3Z A;  4ZIL A;  5B8A A;  3HY2 A;  3EE2 A;  4GSN A;  4AKH A;  2C80 A;  1XBS A;  2V6K A;  3D22 A;  1DUG A;  4GQC A;  3D4M A;  5HR0 A;  1GSS A;  4MZW A;  5D93 A;  4KSO A;  1K0B A;  4MK3 A;  2FWF A;  3TRQ A;  4O7H A;  5FT3 A;  4BVY B;  4DSR A;  2YOI A;  3L9U A;  1K3Y A;  5G5F A;  1SKW B;  1Y1U A;  2N5F A;  4IQA A;  2LJA A;  2KHP A;  2DLX A;  3D5J A;  4XHM A;  3PR8 A;  2P5Q A;  2YP6 A;  2HRA A;  2OA7 A;  3FR6 A;  4KE3 A;  3ERG A;  4ZXG A;  1UVZ A;  2RM5 A;  1T00 A;  1BX9 A;  3RHB A;  2IPA A;  3TKS E;  4G0K A;  2JU5 A;  1PX6 A;  5EVO A;  1V40 A;  3WT2 A;  2QSI A;  5J4V A;  5C04 A;  4WEY A;  4AGS A;  3MSZ A;  5ECK B;  3HA9 A;  4YAV A;  2YZU A;  3A2X A;  3U5R E;  3KJY A;  1M2A A;  5D9V A;  4IP6 A;  3VWX A;  5AIS A;  4DSQ A;  3UMA A;  3HHV A;  4HJ2 A;  3RFR C;  1GTU A;  1XVW A;  1XPV A;  5A5H A;  4CY8 A;  3G7J A;  4BIK A;  2MMA A;  2OBI A;  5GAP D;  4TR3 A;  2DJJ A;  3RGB C;  4K0N A;  1TRS A;  2E2M A;  3QPM A;  1JFU A;  4K7N A;  2YJH A;  2C3T A;  3TGZ A;  2HQT A;  1YEX A;  1RK4 A;  2GTU A;  4F2I A;  2WW2 A;  5A1N B;  16GS A;  4KCA A;  2VCQ A;  3DRN A;  4YH2 A;  4O5Q A;  5DAL B;  1YQ1 A;  4XS1 A;  5KN0 A;  2DKH A;  2H19 A;  17GS A;  3GKN A;  5IIZ A;  3DML A;  1SKR B;  5ECR B;  4EL1 A;  1MEK A;  2L5L A;  3HVX A;  4MH3 A;  5A34 B;  3HKR A;  3VFI A;  3AY8 A;  2YWI A;  1FOH A;  4JR6 A;  1WJK A;  5A5K A;  1T1V A;  4ZBD A;  1O73 A;  1DE1 A;  5INY A;  2CVK A;  2HSN B;  3G7Y A;  2KP1 A;  2H6X A;  1YKC A;  3HJO A;  1Z6M A;  4A5P A;  3FHK A;  2VD0 A;  4L0U A;  4MLY A;  4Q5F A;  3P90 A;  5F8B A;  2O85 A;  4PXO A;  4I2U A;  2H1D A;  2H6Y A;  3TOU A;  3CSH A;  3VI5 A;  4JE1 A;  3LJR A;  2HRK B;  3WT1 A;  3H1N A;  1G7O A;  3RPN A;  5JCG A;  4W66 A;  1X9S B;  5E59 A;  1OAZ A;  1ZGN A;  3FW2 A;  3ZIV A;  2YWO A;  3GUS A;  1T3B A;  3O6T A;  5BMU B;  2R0P A;  5AN1 A;  3VWU A;  1QK8 A;  4USS A;  3KZQ A;  2FA8 A;  4L0W A;  3VWW A;  1M2D A;  1USB A;  3N5O A;  2FA4 A;  1PX7 A;  4OFN A;  1NW2 A;  3F6F A;  2VCZ A;  2HXK A;  2ON7 A;  2HRF A;  1A8L A;  5B7C A;  4G0L A;  3ERF A;  3DWV A;  1ERV A;  3DVW A;  1GSU A;  1ZMA A;  3P8W A;  1WWJ A;  1AAZ A;  1X9W B;  4FQU A;  1J0F A;  5LNK e;  2A2P A;  3A5W A;  1M0U A;  5ECQ B;  2IME A;  4MJC A;  1N2A A;  1OYJ A;  2IMK A;  3LFL A;  2M80 A;  4JBB A;  11GS A;  1ZOF A;  2EIO A;  4POB A;  5D8I A;  2H6Z A;  1Z3E A;  4KND A;  2I4A A;  2PU9 C;  1OE7 A;  3TU3 B;  4JU5 A;  2LNS A;  1UA5 A;  4LMW A;  4HEA 2;  3ZTL A;  2RUE A;  6GST A;  1S3R A;  1E6B A;  4GLT A;  1ACV A;  1QXH A;  3E9J B;  5CRE A;  1BED A;  3LSZ A;  2P5R A;  5IMV A;  1TXX A;  4EIP A;  1OC8 A;  2GT6 A;  3IC8 A;  5DJM A;  2P31 A;  1RQM A;  2B5Y A;  3APQ A;  2KLX A;  3HJM A;  3R2Q A;  5ECO B;  2WW3 A;  2JL4 A;  2KP2 A;  4BVX B;  2PVO C;  3QD9 A;  2WW1 A;  3K8N A;  1U87 A;  1HNB A;  1YJ6 A;  1EGR A;  4OFT A;  2HNL A;  5IPH A;  4Q5R A;  1PSQ A;  4J56 E;  5DQS A;  3L9S A;  2LEG A;  4NAX A;  2HI7 A;  2YWM A;  2GQK A;  4MZB A;  1K0M A;  4MA9 A;  3FZ4 A;  2B3S A;  3UL3 A;  2XBI A;  2X8G A;  14GS A;  5KN3 A;  2WDU A;  4MJA A;  3EU3 A;  2YZH A;  5G2Z A;  2PPT A;  5DBQ A;  4K2D A;  1SVO A;  2ZNM A;  1ZYQ B;  3F9U A;  4BVY A;  1K0O A;  4G01 A;  5D9X A;  9GSS A;  1EV4 A;  2K9F A;  3ZMK A;  1UC7 A;  1S3C A;  3CBU A;  1SD8 A;  3DD3 A;  5AGY A;  1TW9 A;  2DIY A;  1F9M A;  1Q4J A;  1FOV A;  1YVL A;  4MF7 A;  2R37 A;  1A0F A;  3FK8 A;  3MYD A;  4ZB8 A;  2H74 A;  3ZML A;  5A4U A;  2IJY A;  2H30 A;  1F37 A;  4NXI A;  3WGE A;  1WE0 A;  5CRD A;  5EPF A;  2IFQ B;  2IL3 A;  1QQ2 A;  1B9X C;  1YF1 A;  2FWE A;  2O36 A;  3A3T A;  3ZVJ A;  3KEB A;  4EDZ A;  1BJX A;  3FZA A;  3IOS A;  2MMO A;  4JED A;  1GTA A;  2C4J A;  2AHE A;  1I5G A;  3IBH A;  2VL2 A;  4I97 A;  2FWG A;  2IMD A;  2LV3 A;  5L71 A;  3FZ5 A;  4MZC A;  3ZRE A;  4PQI A;  3SBC A;  4K2X A;  3J7Y b;  2C0G A;  1K0D A;  2O3E A;  1BQ7 A;  2R5G A;  1WMJ A;  2REM A;  1GSD A;  4AJ7 A;  4G10 A;  5A1N A;  4MP4 A;  5IO2 A;  2HE3 A;  4IVF A;  2FNO A;  4IBP A;  1V9W A;  4AJ6 A;  4HOJ A;  4FYU A;  2XHF A;  5DAL A;  2C0F A;  2WGR A;  5A4V A;  1YEP A;  3M3M A;  4AKG A;  1TK0 B;  1AQW A;  2GSQ A;  4NHZ A;  3QFA C;  4EUY A;  2DJK A;  1GH2 A;  4WBJ A;  3UIW A;  5A34 A;  4YQU A;  4PUA A;  1I9D A;  2VLU A;  3LGC A;  2GT5 A;  2H0H A;  5DQY A;  1K0N A;  3WYW A;  2IWT A;  2F9S A;  3EU4 A;  4PUF C;  4HZ4 A;  3LYP A;  4KF9 A;  2CT6 A;  4PI2 C;  2HSN A;  1PN9 A;  1A2M A;  2MMN A;  2A2S A;  3M9K A;  3CRT A;  4AI6 A;  1N8J A;  1PN0 A;  5J9C A;  1YY7 A;  4V1A p;  1FVK A;  5IMC A;  3CTF A;  1PD2 1;  2HRK A;  2HYX A;  2H75 A;  2XPE A;  4MAB A;  3CSJ A;  2LNT A;  3A5I A;  4QL7 A;  5BMU A;  1XW5 A;  4RQX A;  4Q5Q A;  1X5E A;  2O5V A;  2WVY A;  4ECI A;  1SL0 B;  4KDY A;  4LLR A;  2H66 A;  4BL7 B;  1KTE A;  2YPM A;  4E68 A;  3FR3 A;  2JZR A;  4IQ1 A;  4X4J A;  1FO5 A;  4HQS A;  1TRW A;  1LU4 A;  3SWL A;  3VI7 A;  4ZBB A;  2QC7 A;  4ECJ A;  1XG8 A;  1EZK A;  2LS5 A;  5DCH A;  4MCU A;  3NIV A;  2FY6 A;  4OMV A;  3IAS 2;  4FXY P;  4Z7X A;  3A2W A;  3HMJ G;  1LBK A;  1XW6 A;  1WOU A;  2DML A;  2GZZ A;  1PGT A;  1Z5Y E;  2WW0 A;  2LQO A;  2H73 A;  2VIM A;  3F4T A;  4AKX B;  6GSW A;  2X4A A;  1TK5 B;  3GKX A;  18GS A;  1HYU A;  2EFE A;  4TR1 B;  4OCF A;  1PKW A;  1TKD B;  5H5R A;  6GSX A;  5B6N A;  5D96 A;  4OO4 A;  2AAW A;  3ZLP A;  1WRY A;  1TRU A;  3TKP A;  4ZL9 A;  3V1W A;  1HNA A;  5IMD A;  5HFG A;  2RLI A;  2C0D A;  2OE1 A;  4EF0 A;  3G9B A;  4X1U A;  3HZ4 A;  1KBN A;  2VM1 A;  2VCX A;  1SK2 A;  4ML1 A;  2XPD A;  1O8W A;  1AXD A;  4BVX A;  3GV1 A;  1ON4 A;  3GL5 A;  5CP1 A;  3DGQ A;  3KXO A;  4YQV A;  1ML6 A;  3I9V 2;  4MPF A;  5LCZ A;  4MPG A;  4BA7 A;  2LRN A;  2VUP A;  10GS A;  2YWN A;  3IHQ A;  4HJM A;  2O87 A;  2O89 A;  1GRX A;  1XWG A;  3DVX A;  2FUG 2;  2DBC A;  5G31 A;  5CAX A;  3BBY A;  4ZB7 A;  4LL1 B;  3NZN A;  3HCZ A;  2LJK A;  5JWR B;  3H8Q A;  3DIE A;  5J5N A;  3KD0 A;  2GST A;  3UBK A;  3BOA A;  4OFM A;  4EO3 A;  3PH9 A;  4G19 A;  1M7T A;  1A0R P;  4I6X A;  1X5C A;  3HXS A;  1GTB A;  5G5E A;  1VGL A;  3F4S A;  4OWY A;  2CAQ A;  2ZCT A;  1QGV A;  4F0C A;  2O8V B;  4Z2R A;  2C8U A;  1ILO A;  2RM6 A;  2K8V A;  3QDN A;  3DEX A;  2OAD A;  1PA3 A;  4TXV A;  1H4O A;  1IYI A;  2YV9 A;  5AIX A;  3LQ7 A;  3LG6 A;  1G6Y A;  2ES7 A;  1R7H A;  5COH A;  2VLT A;  4IS0 A;  1XXU A;  4IN0 A;  5J41 A;  4OO5 A;  1GUK A;  4KX4 A;  2B7J A;  1W89 A;  1XWC A;  2GVP A;  3IPZ A;  3QOU A;  4KH7 A;  3MIX A;  3TRX A;  4MNN A;  2IFQ A;  1K3O A;  2GS3 A;  4ZBA A;  4G2E A;  2YNX A;  5D73 A;  3EUR A;  4GXZ A;  1HD2 A;  4WR4 A;  2VLV A;  1N25 A;  3LOR A;  4TKY A;  2H76 A;  3ED3 A;  1S4B P;  2FGX A;  2L4C A;  4ZIJ A;  3J7Y k;  1G0T A;  2WFC A;  3MNG A;  4MJE A;  2J9H A;  4J57 E;  1SJ6 A;  2L57 A;  4TXO B;  1X0R A;  2NBS A;  4E8H A;  1T4Y A;  3TB2 A;  4EKZ A;  4NV5 A;  5B8B A;  1EP8 A;  2YV7 A;  1Y6E A;  1V58 A;  2HLS A;  1H75 A;  2V6O A;  2PUK C;  1XOB A;  2NDO A;  2R6K A;  4O32 A;  4K9Z A;  4Z2U A;  1TK8 B;  4POL A;  1T8E B;  4AF2 A;  2RII A;  5J47 A;  1AUC A;  2UZ8 A;  4MF6 A;  4PNG A;  3F3Q A;  2WVZ A;  1NM3 A;  3BD2 A;  2P0G A;  4JRR A;  5KEJ A;  4IJ3 A;  3CQF A;  2DJ3 A;  3EPT A;  2H1L A;  3KMO A;  4F82 A;  3TKS A;  3MWH A;  4EXJ A;  4DSS B;  2H1B A;  3TCO A;  2VOC A;  4EDY A;  3TRP A;  1TU7 A;  4GDF A;  2CAI A;  2XBQ A;  1ST9 A;  1GUL A;  2YCD A;  1XCC A;  3P2A A;  1ERU A;  3I43 A;  3GTU B;  2B1L A;  1MDJ A;  2QA1 A;  1WIK A;  2DJ1 A;  3UJ1 A;  2GQM A;  1VRS D;  4GWR A;  1DE2 A;  4KSM A;  4BL7 A;  2AB6 A;  1B4Q A;  1XZO A;  1TXU A;  5IMF A;  2GLR A;  4F0B A;  4HDE A;  3GA4 A;  1MD4 A;  4RQR A;  5LD0 A;  3CYN A;  5F0G A;  2M46 A;  1TI3 A;  3BCK A;  4L8E A;  2IMF A;  3HYP A;  2F3M A;  4HUA A;  3Q6O A;  2I81 A;  5ENU A;  3EWL A;  3HJP A;  3GNJ A;  4EE0 A;  1Y25 A;  4TVE A;  20GS A;  1TJD A;  3FY7 A;  3FEU A;  3GFK A;  2PWJ A;  1JHB A;  2H0G A;  1SVM A;  1Q98 A;  1JZR A;  2K6V A;  5G30 A;  5JCU A;  1TI1 A;  7GSS A;  4TW5 A;  2B1K A;  4GRF A;  4TR1 A;  2NPB A;  1OC3 A;  3LEF A;  3ZVJ D;  3KH9 A;  4IKH A;  1GSE A;  1XFL A;  3N9J A;  3UVT A;  4RI6 A;  4ACS A;  1A2L A;  1GP1 A;  4O5U A;  3HZ8 A;  2VM2 A;  5ELA A;  2FHE A;  1WPI A;  2V41 A;  3IHG A;  3UBL A;  4GCI A;  2JAC A;  3HD5 A;  4FYB A;  2X8C A;  1PL2 A;  1EV9 A;  2GSS A;  3IAM 2;  3WGX A;  2I3Y A;  2A4H A;  3GKK A;  5IO0 A;  2AYT A;  3O76 A;  2K18 A;  3LYK A;  1GLQ A;  4OD7 A;  4MJB A;  2YAN A;  5CYY A;  4QMK A;  1TTZ A;  2NVL A;  4P3Y B;  1GUM A;  4L5L A;  2VAF A;  1ERT A;  2OE0 A;  2OKA A;  1GSY A;  5J9B A;  1J08 A;  1M9B A;  1SK0 A;  1HQO A;  2DJ2 A;  3H79 A;  5F07 A;  2RUF A;  4NPB A;  1SU9 A;  1HNC A;  1JZD A;  2GZY A;  2PMT A;  1J9B A;  1YEW C;  5J4Y A;  4QL9 A;  4PNF A;  1B48 A;  1F3B A;  3Q18 A;  4K8M A;  1GNW A;  1FVJ A;  2LUS A;  4V2M A;  3F3R A;  3KGK A;  1U3A A;  1QFN A;  1Z9H A;  3M9J A;  3LWA A;  2XC2 A;  2H01 A;  3BCI A;  2GDR A;  3TUE A;  3R3E A;  3VPT A;  12GS A;  1Z7P A;  5JCW A;  3HVN A;  4JR4 A;  2CQ9 A;  2CX3 A;  3RDW A;  1VF3 A;  1BAY A;  4YQM A;  2HSM B;  1FW1 A;  1G6W A;  2CVD A;  1IYH A;  4FO5 A;  4O92 A;  2C3N A;  3GKM A;  4IJI A;  4ILF A;  1ZL9 A;  4N0V A;  3VK9 A;  4N10 A;  5F05 A;  3M1G A;  3M8N A;  1ZYE A;  3TJG A;  4LMV A;  1AW9 A;  2GZP A;  4WBR D;  1M99 A;  4IP1 A;  4ID0 A;  1SVL A;  4K7I A;  1TRV A;  1TOF A;  2OJL A;  1SJZ A;  3DYR A;  4POK A;  1BG5 A;  3FYG A;  1O6J A;  3IR4 A;  1GNE A;  5DDL A;  3APS A;  2LST A;  2R4V A;  3L78 A;  4TXO A;  5HR1 A;  3S9F A;  3GUR A;  1SKS B;  4KGI A;  2E2G A;  3FKF A;  2JZS A;  2VL2 C;  3C1S A;  3KP9 A;  4WET A;  4YKG A;  2D2Z A;  3KP8 A;  1GSQ A;  2TRX A;  3F63 A;  3C1R A;  1WP0 A;  1EP7 A;  3IK7 A;  3Q19 A;  3H93 A;  4N11 A;  1FAA A;  4QQ7 A;  1S3A A;  2PER A;  3ME8 A;  4O5R A;  5IOW A;  5D9W A;  3Q74 A;  2CX4 A;  4E8E A;  4WR5 A;  3C8E A;  4Z2T A;  1SJI A;  1B4P A;  3KM6 A;  3GST A;  3WGD A;  4DSS A;  2GGT A;  1AC1 A;  4GQF A;  4ICY A;  3UOM A;  3BJ5 A;  3EYT A;  3GN3 A;  2HZE B;  2B5E A;  1EOH A;  2UV8 G;  2A4V A;  3GTU A;  1R5P A;  3F6D A;  4BWS A;  5F06 A;  4GST A;  1OKT A;  5KOW A;  2IIY A;  2O7K A;  22GS A;  3GH6 A;  3VUR A;  1M3I A;  4ZB6 A;  3GHA A;  2ALB A;  4NWY A;  2VL3 A;  4K6X A;  3KCM A;  1A24 A;  2WS2 A;  4L5O A;  2R2J A;  2OE3 A;  2WCI A;  1ABA A;  4N30 A;  1Z7R A;  1GWC A;  1K0C A;  2MBS A;  4XRD A;  5HFI A;  5KN1 A;  2LRC A;  4HU7 A;  3A2V A;  3QCP A;  5DAK B;  3UEM A;  2JSZ A;  2MYG A;  3L4N A;  4XCS A;  1F3A A;  4K5S A;  4GTU A;  3ZL5 A;  2HFD A;  5IMZ A;  4F9Z A;  2WRT A;  3W8S A;  5ECH B;  2CVB A;  2NTO A;  2WUL A;  1XWA A;  3DXB A;  5JWQ B;  4I8B A;  4I2T A;  3GIX A;  1FHE A;  5IM9 A;  4XS4 B;  2BTO T;  5DCG A;  4WF4 A;  2LJR A;  1KEB A;  3ZFL A;  2YN1 A;  2DKI A;  3FZ9 A;  5HR2 A;  5G1K A;  2M72 A;  2VCT A;  2CV4 A;  3LW9 A;  2VCV A;  2WVX B;  3GL3 A;  4TR0 A;  2VO4 A;  4FH8 A;  1SYX A;  13GS A;  2ON5 A;  2HSY A;  4ZL7 A;  2WB9 A;  1XVQ A;  4X43 A;  1O81 A;  1QUW A;  1AIU A;  3GMF A;  3TJB A;  1GSF A;  3VLN A;  3MAK A;  5ECP B;  3IXR A;  2G2Q A;  2FCH A;  2DSA A;  5CRH A;  2X8H A;  2L4Q A;  1YZX A;  4WKW A;  3QAW A;  5C00 A;  5GZZ B;  2V1M A;  1SL2 B;  3FRC A;  2CZ3 A;  3RBT A;  2I9H A;  2EC4 A;  4V1A g;  5AIV A;  6GSU A;  3QR6 A;  1SL1 B;  2MZC A;  1THX A;  1JZW A;  4CDO A;  1PL1 A;  1U3I A;  2QGV A;  3ZRD A;  4JZQ A;  4PQH A;  1I1I P;  5FWG A;  3KTB A;  2EIQ A;  4HQZ A;  1AQX A;  3EMX A;  2R0G A;  3D0Z A;  3W6G A;  3I6A A;  1SEN A;  3ZYW A;  5JWO B;  2KOK A;  1O8X A;  4LL4 B;  2PVQ A;  3GRX A;  3ZFB A;  2VKZ G;  5IMA A;  4J2F A;  2X49 A;  5E4W A;  2R0C A;  3IK9 A;  1MTC A;  1E2Y A;  6GSY A;  5H5Q A;  4ISD A;  3ERW A;  1VF2 A;  2HZF A;  3I69 A;  2HSM A;  3EC3 A;  2A2R A;  3IV4 A;  4PUR A;  3F4R A;  1NHY A;  2OBK A;  3TJJ A;  2B6M A;  2LRT A;  5KN2 A;  3UAP A;  2DIZ A;  1GL8 A;  5DVB A;  1CQG A;  1Z6N A;  3APO A;  2VD1 A;  8GSS A;  4CHS A;  5IQY A;  4ULX A;  4WF5 A;  2PBJ A;  1O7U A;  4XS6 A;  4MH2 A;  1F2E A;  1G7E A;  4BWQ A;  2E7P A;  2I1U A;  1OVN A;  2GQL A;  5CNW A;  4K7O A;  1YDK A;  1M2B A;  3TOT A;  5GST A;  4D73 B;  2IMI A;  2DJ0 A;  4MMM A;  3VPQ A;  1R26 A;  2EFC A;  2GSR A;  4MF5 A;  4I5Q A;  2DC5 A;  1R4W A;  3FR9 A;  3H4K A;  2V2G A;  4POM A;  4EIQ A;  1TU8 A;  1AQV A;  3E0U A;  1XIY A;  2FD3 A;  1PQN A;  2H1G A;  2L5O A;  3US3 A;  4XRA A;  2JZT A;  3W8J A;  4G9H A;  4KB3 A;  2X64 A;  1K0A A;  4BPY A;  2FWH A;  4XTS A;  2LKU A;  2OT3 A;  5G1L A;  2B5X A;  3TDG A;  3ZIT A;  1VF1 A;  1PMT A;  2QKE A;  2H71 A;  3L0H A;  4YAP A;  2L59 A;  4AJ8 A;  2R3X A;  3TJF A;  4G0I A;  1OC9 B;  4HI7 A;  4IW9 A;  1S3D A;  3TKR A;  1EGO A;  1ZCP A;  1PFO A;  2AV4 A;  1SD9 A;  4K0G A;  2BMX A;  1EEJ A;  1DSB A;  5ECI B;  2HZE A;  2LTK A;  3ME7 A;  3QAV A;  2F8A A;  4TRX A;  3GSS A;  5HR3 A;  1YF0 A;  2H1A A;  2PGT A;  3TKS C;  5IOX A;  1JLW A;  4LA1 A;  3ZZX A;  6GSS A;  2AUV A;  2C3Q A;  2EFD A;  4KW6 A;  1GUH A;  5ID2 B;  3JCM L;  3C73 A;  2HRN A;  3HVV A;  2L6C A;  2Z9S A;  2TRC P;  4FYC A;  3QFB C;  3EMP A;  4F03 A;  2WZS A;  2B7K A;  3CHX C;  1T4Z A;  2E0Q A;  4MDC A;  4PX1 A;  3PIN A;  1U6T A;  3P7X A;  4ML6 A;  2KUC A;  4KCE A;  5DAK A;  1T7P B;  3PPU A;  4GSS A;  1TDI A;  1BF5 A;  4KDU A;  2PN8 A;  5H5S A;  1M3J A;  2J23 A;  5J4U A;  1B9Y C;  3GH9 A;  3KTL A;  5ECN B;  2F8F A;  2LQQ A;  5FHI A;  3UAR A;  1V57 A;  2H70 A;  4XS4 A;  1CQH A;  4NV2 A;  1ZYN A;  1UN2 A;  4KUN A;  3GX0 A;  1THO A;  4CW9 A;  2WVX A;  3F8U A;  4IGJ A;  4EVM A;  3LXZ A;  1O85 A;  2JSY A;  1FG4 A;  3L9V A;  4PHZ C;  4DEJ A;  1KNG A;  1SYR A;  3RAZ A;  3D4T A;  4OCE A;  4RUV A;  4KA0 A;  5ECL B;  5HQP A;  1PKZ A;  3HDC A;  2AJQ B;  5A5H B;  5ECS A;  4ZL8 A;  3M0F A;  3C71 A;  1XWK A;  3VWV A;  1DBY A;  4PGT A;  4PTS A;  4FIW A;  1MDK A;  2WJU A;  1X5D A;  3NOF A;  4HZ2 A;  4YKF A;  2VL9 A;  3GYK A;  5GAN D;  2F51 A;  1A8Y A;  1RW1 A;  5ABR A;  2TIR A;  1A23 A;  2DMM A;  3IA1 A;  4TN8 A;  2JAD A;  1PRX A;  2CA8 A;  1MDI A;  2N5A A;  3E3E A;  3TKQ A;  2N5B A;  1NSW A;  1YKA A;  5J3R A;  3KH7 A;  1X9M B;  4ECB A;  2WZ9 A;  2X99 A;  5HFK A;  5CRG A;  1V98 A;  1JLV A;  1GLP A;  3RHC A;  5IPG A;  1FB6 A;  3ZIJ A;  2HT9 A;  3RPP A;  4KAE A;  4HU9 A;  3IRA A;  4IHU A;  4V2L A;  2MBT A;  4AKI A;  3CSI A;  2IN3 A;  1LJR A;  1JZO A;  2H72 A;  4EC0 A;  1URM A;  5CO3 A;  1EEM A;  1ZZY A;  4NMU A;  2BJX A;  4K5R A;  4V2N A;  2ZUP A;  5CRW A;  1EOG A;  3CXG A;  3GX8 A;  5B6M A;  3HVS A;  1SK1 A;  3F0I A;  5D9T A;  2EFH A;  3DKS A;  3MDK A;  2FLS A;  5ECM B;  5DJL A;  4WXT A;  3IE3 A;  3CWG A;  4GF0 A;  2YJ7 A;  4KDX A;  4NHW A;  4D73 A;  5A4W A;  4HS1 A;  1QMV A;  3IDV A;  19GS A;  3D21 A;  2OAC A;  4ZB9 A;  1BYE A;  3IC4 A;  3CMI A;  3FMW A;  2VCW A;  4CY6 A;  3QAG A;  2K8S A;  5GSS A;  1A2J A;  1C72 A;  3O3T A;  4XIH A;  3KMN A;  3CTG A;  4HSC X;  1XWB A;  1B8X A;  4TOP A;  4H86 A;  5BRT A;  4X0X A;  2HSH A;  3LXT A;  5ELG A;  3G7I A;  1EWX A;  1F6M C;  1MD3 A;  3EVI A;  1FB0 A;  1XW9 A;  1K3L A;  1TP9 A;  3CRU A;  3TJK A;  5EY6 A;  4TR4 A;  1M9A A;  3KIJ A;  4ECC A;  2L6D A;  4RI7 A;  1U88 A;  1R5A A;  4K1F A;  3ISO A;  4Q5N A;  1W4V A;  3OR5 A;  3D6I A;  4PQ1 A;  1NHO A;  5J40 A;  1OC9 A;  2EIR A;  4N0Z A;  2QA2 A;  5EL8 A;  1OE8 A;  2G0F A;  3QMX A;  3PGT A;  1VF4 A;  3WD6 A;  5KOX A;  1BG1 A;  1ZYP A;  2MMZ A;  1ERW A;  4IEL A;  1V2A A; 
#chains in the Genus database with same CATH homology
 1XOA A;  1OKD A;  6GSV A;  2C0E A;  2H8L A;  2V32 A;  3EIN A;  2H0I A;  1GTI A;  5ID2 A;  2C1Y A;  3C7M A;  3UVH A;  2CZ2 A;  3U6V A;  4DVC A;  4N3Z A;  4ZIL A;  5B8A A;  3HY2 A;  3EE2 A;  4GSN A;  4AKH A;  2C80 A;  1XBS A;  2V6K A;  3D22 A;  1DUG A;  4GQC A;  3D4M A;  5HR0 A;  1GSS A;  4MZW A;  5D93 A;  4KSO A;  1K0B A;  4MK3 A;  2FWF A;  3TRQ A;  4O7H A;  5FT3 A;  4BVY B;  4DSR A;  2YOI A;  3L9U A;  1K3Y A;  5G5F A;  1SKW B;  1Y1U A;  2N5F A;  4IQA A;  2LJA A;  2KHP A;  2DLX A;  3D5J A;  4XHM A;  3PR8 A;  2P5Q A;  2YP6 A;  2HRA A;  2OA7 A;  3FR6 A;  4KE3 A;  3ERG A;  4ZXG A;  1UVZ A;  2RM5 A;  1T00 A;  1BX9 A;  3RHB A;  2IPA A;  3TKS E;  4G0K A;  2JU5 A;  1PX6 A;  5EVO A;  1V40 A;  3WT2 A;  2QSI A;  5J4V A;  5C04 A;  4WEY A;  4AGS A;  3MSZ A;  5ECK B;  3HA9 A;  4YAV A;  2YZU A;  3A2X A;  3U5R E;  3KJY A;  1M2A A;  5D9V A;  4IP6 A;  3VWX A;  5AIS A;  4DSQ A;  3UMA A;  3HHV A;  4HJ2 A;  1GTU A;  1XVW A;  1XPV A;  5A5H A;  4CY8 A;  3G7J A;  2MMA A;  2OBI A;  5GAP D;  4TR3 A;  2DJJ A;  4K0N A;  1TRS A;  2E2M A;  3QPM A;  1JFU A;  4K7N A;  2YJH A;  2C3T A;  3TGZ A;  2HQT A;  1YEX A;  1RK4 A;  2GTU A;  4F2I A;  5A1N B;  16GS A;  4KCA A;  2VCQ A;  3DRN A;  4YH2 A;  4O5Q A;  5DAL B;  1YQ1 A;  4XS1 A;  5KN0 A;  2DKH A;  2H19 A;  17GS A;  3GKN A;  5IIZ A;  3DML A;  1SKR B;  5ECR B;  4EL1 A;  1MEK A;  2L5L A;  3HVX A;  4MH3 A;  5A34 B;  3HKR A;  3VFI A;  3AY8 A;  2YWI A;  1FOH A;  4JR6 A;  1WJK A;  5A5K A;  1T1V A;  4ZBD A;  1O73 A;  1DE1 A;  5INY A;  2CVK A;  2HSN B;  3G7Y A;  2KP1 A;  2H6X A;  1YKC A;  3HJO A;  1Z6M A;  4A5P A;  3FHK A;  2VD0 A;  4L0U A;  4MLY A;  4Q5F A;  3P90 A;  5F8B A;  2O85 A;  4PXO A;  4I2U A;  2H1D A;  2H6Y A;  3TOU A;  3CSH A;  3VI5 A;  4JE1 A;  3LJR A;  2HRK B;  3WT1 A;  3H1N A;  1G7O A;  3RPN A;  5JCG A;  4W66 A;  1X9S B;  5E59 A;  1OAZ A;  1ZGN A;  3FW2 A;  3ZIV A;  2YWO A;  3GUS A;  1T3B A;  3O6T A;  5BMU B;  2R0P A;  5AN1 A;  3VWU A;  1QK8 A;  4USS A;  3KZQ A;  2FA8 A;  4L0W A;  3VWW A;  1M2D A;  1USB A;  3N5O A;  2FA4 A;  1PX7 A;  4OFN A;  1NW2 A;  3F6F A;  2VCZ A;  2HXK A;  2ON7 A;  2HRF A;  1A8L A;  5B7C A;  4G0L A;  3ERF A;  3DWV A;  1ERV A;  3DVW A;  1GSU A;  1ZMA A;  3P8W A;  1WWJ A;  1AAZ A;  1X9W B;  4FQU A;  1J0F A;  5LNK e;  2A2P A;  3A5W A;  1M0U A;  5ECQ B;  2IME A;  4MJC A;  1N2A A;  1OYJ A;  2IMK A;  3LFL A;  2M80 A;  4JBB A;  11GS A;  1ZOF A;  2EIO A;  4POB A;  5D8I A;  2H6Z A;  1Z3E A;  4KND A;  2I4A A;  2PU9 C;  1OE7 A;  3TU3 B;  4JU5 A;  2LNS A;  1UA5 A;  4LMW A;  4HEA 2;  3ZTL A;  2RUE A;  6GST A;  1E6B A;  4GLT A;  1ACV A;  1QXH A;  3E9J B;  5CRE A;  1BED A;  3LSZ A;  2P5R A;  5IMV A;  1TXX A;  4EIP A;  1OC8 A;  2GT6 A;  3IC8 A;  5DJM A;  2P31 A;  1RQM A;  2B5Y A;  3APQ A;  2KLX A;  3HJM A;  3R2Q A;  5ECO B;  2JL4 A;  2KP2 A;  4BVX B;  2PVO C;  3QD9 A;  3K8N A;  1U87 A;  1HNB A;  1YJ6 A;  1EGR A;  4OFT A;  2HNL A;  5IPH A;  4Q5R A;  1PSQ A;  4J56 E;  5DQS A;  3L9S A;  2LEG A;  4NAX A;  2HI7 A;  2YWM A;  2GQK A;  4MZB A;  1K0M A;  4MA9 A;  3FZ4 A;  2B3S A;  3UL3 A;  2XBI A;  2X8G A;  14GS A;  5KN3 A;  2WDU A;  4MJA A;  3EU3 A;  2YZH A;  5G2Z A;  2PPT A;  5DBQ A;  4K2D A;  1SVO A;  2ZNM A;  1ZYQ B;  3F9U A;  4BVY A;  1K0O A;  4G01 A;  5D9X A;  9GSS A;  1EV4 A;  2K9F A;  3ZMK A;  1UC7 A;  1S3C A;  3CBU A;  1SD8 A;  3DD3 A;  5AGY A;  1TW9 A;  2DIY A;  1F9M A;  1Q4J A;  1FOV A;  1YVL A;  4MF7 A;  2R37 A;  1A0F A;  3FK8 A;  3MYD A;  4ZB8 A;  2H74 A;  3ZML A;  5A4U A;  2IJY A;  2H30 A;  1F37 A;  4NXI A;  3WGE A;  1WE0 A;  5CRD A;  5EPF A;  2IFQ B;  2IL3 A;  1QQ2 A;  1B9X C;  1YF1 A;  2FWE A;  3A3T A;  3ZVJ A;  3KEB A;  4EDZ A;  1BJX A;  3FZA A;  3IOS A;  2MMO A;  4JED A;  1GTA A;  2C4J A;  2AHE A;  1I5G A;  3IBH A;  2VL2 A;  4I97 A;  2FWG A;  2IMD A;  2LV3 A;  5L71 A;  3FZ5 A;  4MZC A;  3ZRE A;  4PQI A;  3SBC A;  4K2X A;  3J7Y b;  2C0G A;  1K0D A;  1BQ7 A;  2R5G A;  1WMJ A;  2REM A;  1GSD A;  4AJ7 A;  4G10 A;  5A1N A;  4MP4 A;  5IO2 A;  2HE3 A;  4IVF A;  2FNO A;  4IBP A;  1V9W A;  4AJ6 A;  4HOJ A;  4FYU A;  2XHF A;  5DAL A;  2C0F A;  2WGR A;  5A4V A;  1YEP A;  3M3M A;  4AKG A;  1TK0 B;  1AQW A;  2GSQ A;  4NHZ A;  3QFA C;  4EUY A;  2DJK A;  1GH2 A;  4WBJ A;  3UIW A;  5A34 A;  4YQU A;  4PUA A;  1I9D A;  2VLU A;  3LGC A;  2GT5 A;  2H0H A;  5DQY A;  1K0N A;  3WYW A;  2IWT A;  2F9S A;  3EU4 A;  4PUF C;  4HZ4 A;  3LYP A;  4KF9 A;  2CT6 A;  2HSN A;  1PN9 A;  1A2M A;  2MMN A;  2A2S A;  3M9K A;  3CRT A;  4AI6 A;  1N8J A;  1PN0 A;  5J9C A;  1YY7 A;  4V1A p;  1FVK A;  5IMC A;  3CTF A;  1PD2 1;  2HRK A;  2HYX A;  2H75 A;  2XPE A;  4MAB A;  3CSJ A;  2LNT A;  3A5I A;  4QL7 A;  5BMU A;  1XW5 A;  4RQX A;  4Q5Q A;  1X5E A;  2O5V A;  4ECI A;  1SL0 B;  4KDY A;  4LLR A;  2H66 A;  4BL7 B;  1KTE A;  2YPM A;  4E68 A;  3FR3 A;  2JZR A;  4IQ1 A;  4X4J A;  1FO5 A;  4HQS A;  1TRW A;  1LU4 A;  3SWL A;  3VI7 A;  4ZBB A;  2QC7 A;  4ECJ A;  1EZK A;  2LS5 A;  5DCH A;  4MCU A;  3NIV A;  2FY6 A;  4OMV A;  3IAS 2;  4Z7X A;  3A2W A;  3HMJ G;  1LBK A;  1XW6 A;  1WOU A;  2DML A;  2GZZ A;  1PGT A;  1Z5Y E;  2LQO A;  2H73 A;  2VIM A;  3F4T A;  4AKX B;  6GSW A;  2X4A A;  1TK5 B;  3GKX A;  18GS A;  1HYU A;  2EFE A;  4TR1 B;  4OCF A;  1PKW A;  1TKD B;  5H5R A;  6GSX A;  5B6N A;  5D96 A;  4OO4 A;  2AAW A;  3ZLP A;  1WRY A;  1TRU A;  3TKP A;  4ZL9 A;  3V1W A;  1HNA A;  5IMD A;  5HFG A;  2RLI A;  2C0D A;  2OE1 A;  4EF0 A;  3G9B A;  4X1U A;  3HZ4 A;  1KBN A;  2VM1 A;  2VCX A;  1SK2 A;  4ML1 A;  2XPD A;  1O8W A;  1AXD A;  4BVX A;  3GV1 A;  1ON4 A;  3GL5 A;  5CP1 A;  3DGQ A;  3KXO A;  4YQV A;  1ML6 A;  3I9V 2;  4MPF A;  5LCZ A;  4MPG A;  4BA7 A;  2LRN A;  2VUP A;  10GS A;  2YWN A;  3IHQ A;  4HJM A;  2O87 A;  2O89 A;  1GRX A;  1XWG A;  3DVX A;  2FUG 2;  2DBC A;  5G31 A;  5CAX A;  3BBY A;  4ZB7 A;  4LL1 B;  3NZN A;  3HCZ A;  2LJK A;  5JWR B;  3H8Q A;  3DIE A;  5J5N A;  3KD0 A;  2GST A;  3UBK A;  3BOA A;  4OFM A;  4EO3 A;  3PH9 A;  4G19 A;  1M7T A;  1A0R P;  4I6X A;  1X5C A;  3HXS A;  1GTB A;  5G5E A;  1VGL A;  3F4S A;  4OWY A;  2CAQ A;  2ZCT A;  1QGV A;  4F0C A;  2O8V B;  4Z2R A;  2C8U A;  1ILO A;  2RM6 A;  2K8V A;  3QDN A;  3DEX A;  2OAD A;  1PA3 A;  4TXV A;  1H4O A;  1IYI A;  2YV9 A;  5AIX A;  3LQ7 A;  3LG6 A;  1G6Y A;  2ES7 A;  1R7H A;  5COH A;  2VLT A;  4IS0 A;  1XXU A;  4IN0 A;  5J41 A;  4OO5 A;  1GUK A;  4KX4 A;  2B7J A;  1W89 A;  1XWC A;  2GVP A;  3IPZ A;  3QOU A;  4KH7 A;  3MIX A;  3TRX A;  4MNN A;  2IFQ A;  1K3O A;  2GS3 A;  4ZBA A;  4G2E A;  2YNX A;  5D73 A;  3EUR A;  4GXZ A;  1HD2 A;  4WR4 A;  2VLV A;  1N25 A;  3LOR A;  4TKY A;  2H76 A;  3ED3 A;  2FGX A;  2L4C A;  4ZIJ A;  3J7Y k;  1G0T A;  2WFC A;  3MNG A;  4MJE A;  2J9H A;  4J57 E;  1SJ6 A;  2L57 A;  4TXO B;  1X0R A;  2NBS A;  4E8H A;  1T4Y A;  3TB2 A;  4EKZ A;  4NV5 A;  5B8B A;  1EP8 A;  2YV7 A;  1Y6E A;  1V58 A;  2HLS A;  1H75 A;  2V6O A;  2PUK C;  1XOB A;  2NDO A;  2R6K A;  4O32 A;  4K9Z A;  4Z2U A;  1TK8 B;  4POL A;  1T8E B;  4AF2 A;  2RII A;  5J47 A;  1AUC A;  2UZ8 A;  4MF6 A;  4PNG A;  3F3Q A;  1NM3 A;  3BD2 A;  2P0G A;  4JRR A;  5KEJ A;  4IJ3 A;  2DJ3 A;  3EPT A;  2H1L A;  3KMO A;  4F82 A;  3TKS A;  3MWH A;  4EXJ A;  4DSS B;  2H1B A;  3TCO A;  2VOC A;  4EDY A;  3TRP A;  1TU7 A;  4GDF A;  2CAI A;  2XBQ A;  1ST9 A;  1GUL A;  2YCD A;  1XCC A;  3P2A A;  1ERU A;  3I43 A;  3GTU B;  2B1L A;  1MDJ A;  2QA1 A;  1WIK A;  2DJ1 A;  3UJ1 A;  2GQM A;  1VRS D;  4GWR A;  1DE2 A;  4KSM A;  4BL7 A;  2AB6 A;  1B4Q A;  1XZO A;  1TXU A;  5IMF A;  2GLR A;  4F0B A;  4HDE A;  3GA4 A;  1MD4 A;  4RQR A;  5LD0 A;  3CYN A;  5F0G A;  2M46 A;  1TI3 A;  3BCK A;  4L8E A;  2IMF A;  3HYP A;  2F3M A;  4HUA A;  3Q6O A;  2I81 A;  5ENU A;  3EWL A;  3HJP A;  3GNJ A;  4EE0 A;  1Y25 A;  4TVE A;  20GS A;  1TJD A;  3FY7 A;  3FEU A;  3GFK A;  2PWJ A;  1JHB A;  2H0G A;  1SVM A;  1Q98 A;  1JZR A;  2K6V A;  5G30 A;  5JCU A;  1TI1 A;  7GSS A;  4TW5 A;  2B1K A;  4GRF A;  4TR1 A;  2NPB A;  1OC3 A;  3LEF A;  3ZVJ D;  3KH9 A;  4IKH A;  1GSE A;  1XFL A;  3N9J A;  3UVT A;  4RI6 A;  4ACS A;  1A2L A;  1GP1 A;  4O5U A;  3HZ8 A;  2VM2 A;  5ELA A;  2FHE A;  1WPI A;  2V41 A;  3IHG A;  3UBL A;  4GCI A;  2JAC A;  3HD5 A;  4FYB A;  2X8C A;  1PL2 A;  1EV9 A;  2GSS A;  3IAM 2;  3WGX A;  2I3Y A;  2A4H A;  3GKK A;  5IO0 A;  2AYT A;  3O76 A;  2K18 A;  3LYK A;  1GLQ A;  4OD7 A;  4MJB A;  2YAN A;  5CYY A;  4QMK A;  1TTZ A;  2NVL A;  4P3Y B;  1GUM A;  4L5L A;  2VAF A;  1ERT A;  2OE0 A;  2OKA A;  1GSY A;  5J9B A;  1J08 A;  1M9B A;  1SK0 A;  1HQO A;  2DJ2 A;  3H79 A;  5F07 A;  2RUF A;  4NPB A;  1SU9 A;  1HNC A;  1JZD A;  2GZY A;  2PMT A;  1J9B A;  5J4Y A;  4QL9 A;  4PNF A;  1B48 A;  1F3B A;  3Q18 A;  4K8M A;  1GNW A;  1FVJ A;  2LUS A;  4V2M A;  3F3R A;  3KGK A;  1U3A A;  1QFN A;  1Z9H A;  3M9J A;  3LWA A;  2XC2 A;  2H01 A;  3BCI A;  2GDR A;  3TUE A;  3R3E A;  3VPT A;  12GS A;  1Z7P A;  5JCW A;  4JR4 A;  2CQ9 A;  2CX3 A;  3RDW A;  1VF3 A;  1BAY A;  4YQM A;  2HSM B;  1FW1 A;  1G6W A;  2CVD A;  1IYH A;  4FO5 A;  4O92 A;  2C3N A;  3GKM A;  4IJI A;  4ILF A;  1ZL9 A;  4N0V A;  3VK9 A;  4N10 A;  5F05 A;  3M1G A;  3M8N A;  1ZYE A;  3TJG A;  4LMV A;  1AW9 A;  2GZP A;  4WBR D;  1M99 A;  4IP1 A;  4ID0 A;  1SVL A;  4K7I A;  1TRV A;  1TOF A;  2OJL A;  1SJZ A;  3DYR A;  4POK A;  1BG5 A;  3FYG A;  1O6J A;  3IR4 A;  1GNE A;  5DDL A;  3APS A;  2LST A;  2R4V A;  3L78 A;  4TXO A;  5HR1 A;  3S9F A;  3GUR A;  1SKS B;  4KGI A;  2E2G A;  3FKF A;  2JZS A;  2VL2 C;  3C1S A;  3KP9 A;  4WET A;  4YKG A;  2D2Z A;  3KP8 A;  1GSQ A;  2TRX A;  3F63 A;  3C1R A;  1WP0 A;  1EP7 A;  3IK7 A;  3Q19 A;  3H93 A;  4N11 A;  1FAA A;  4QQ7 A;  1S3A A;  2PER A;  3ME8 A;  4O5R A;  5IOW A;  5D9W A;  3Q74 A;  2CX4 A;  4E8E A;  4WR5 A;  3C8E A;  4Z2T A;  1SJI A;  1B4P A;  3KM6 A;  3GST A;  3WGD A;  4DSS A;  2GGT A;  1AC1 A;  4GQF A;  4ICY A;  3UOM A;  3BJ5 A;  3EYT A;  3GN3 A;  2HZE B;  2B5E A;  1EOH A;  2UV8 G;  2A4V A;  3GTU A;  1R5P A;  3F6D A;  4BWS A;  5F06 A;  4GST A;  1OKT A;  5KOW A;  2IIY A;  2O7K A;  22GS A;  3GH6 A;  3VUR A;  4ZB6 A;  3GHA A;  2ALB A;  4NWY A;  2VL3 A;  4K6X A;  3KCM A;  1A24 A;  2WS2 A;  4L5O A;  2R2J A;  2OE3 A;  2WCI A;  1ABA A;  4N30 A;  1Z7R A;  1GWC A;  1K0C A;  2MBS A;  4XRD A;  5HFI A;  5KN1 A;  2LRC A;  4HU7 A;  3A2V A;  3QCP A;  5DAK B;  3UEM A;  2JSZ A;  3L4N A;  2MYG A;  4XCS A;  1F3A A;  4K5S A;  4GTU A;  3ZL5 A;  2HFD A;  5IMZ A;  4F9Z A;  2WRT A;  3W8S A;  5ECH B;  2CVB A;  2NTO A;  2WUL A;  1XWA A;  3DXB A;  5JWQ B;  4I8B A;  4I2T A;  3GIX A;  1FHE A;  5IM9 A;  4XS4 B;  2BTO T;  5DCG A;  4WF4 A;  2LJR A;  1KEB A;  3ZFL A;  2YN1 A;  2DKI A;  3FZ9 A;  5HR2 A;  5G1K A;  2M72 A;  2VCT A;  2CV4 A;  3LW9 A;  2VCV A;  3GL3 A;  4TR0 A;  2VO4 A;  4FH8 A;  1SYX A;  13GS A;  2ON5 A;  2HSY A;  4ZL7 A;  2WB9 A;  1XVQ A;  4X43 A;  1O81 A;  1QUW A;  1AIU A;  3GMF A;  3TJB A;  1GSF A;  3VLN A;  3MAK A;  5ECP B;  3IXR A;  2G2Q A;  2FCH A;  2DSA A;  5CRH A;  2X8H A;  2L4Q A;  1YZX A;  4WKW A;  3QAW A;  5C00 A;  5GZZ B;  2V1M A;  1SL2 B;  3FRC A;  2CZ3 A;  3RBT A;  2I9H A;  2EC4 A;  4V1A g;  5AIV A;  6GSU A;  3QR6 A;  1SL1 B;  2MZC A;  1THX A;  1JZW A;  4CDO A;  1PL1 A;  1U3I A;  2QGV A;  3ZRD A;  4JZQ A;  4PQH A;  5FWG A;  3KTB A;  2EIQ A;  4HQZ A;  1AQX A;  3EMX A;  2R0G A;  3D0Z A;  3W6G A;  3I6A A;  1SEN A;  3ZYW A;  5JWO B;  2KOK A;  1O8X A;  4LL4 B;  2PVQ A;  3GRX A;  3ZFB A;  2VKZ G;  5IMA A;  4J2F A;  2X49 A;  5E4W A;  2R0C A;  3IK9 A;  1MTC A;  1E2Y A;  6GSY A;  5H5Q A;  4ISD A;  3ERW A;  1VF2 A;  2HZF A;  3I69 A;  2HSM A;  3EC3 A;  2A2R A;  3IV4 A;  4PUR A;  3F4R A;  1NHY A;  2OBK A;  3TJJ A;  2B6M A;  2LRT A;  5KN2 A;  3UAP A;  2DIZ A;  1GL8 A;  5DVB A;  1CQG A;  1Z6N A;  3APO A;  2VD1 A;  8GSS A;  4CHS A;  5IQY A;  4ULX A;  4WF5 A;  2PBJ A;  1O7U A;  4XS6 A;  4MH2 A;  1F2E A;  1G7E A;  4BWQ A;  2E7P A;  2I1U A;  1OVN A;  2GQL A;  5CNW A;  4K7O A;  1YDK A;  1M2B A;  3TOT A;  5GST A;  4D73 B;  2IMI A;  2DJ0 A;  4MMM A;  3VPQ A;  1R26 A;  2EFC A;  2GSR A;  4MF5 A;  4I5Q A;  2DC5 A;  1R4W A;  3FR9 A;  3H4K A;  2V2G A;  4POM A;  4EIQ A;  1TU8 A;  1AQV A;  3E0U A;  1XIY A;  2FD3 A;  1PQN A;  2H1G A;  2L5O A;  3US3 A;  4XRA A;  2JZT A;  3W8J A;  4G9H A;  4KB3 A;  2X64 A;  1K0A A;  4BPY A;  2FWH A;  4XTS A;  2LKU A;  2OT3 A;  5G1L A;  2B5X A;  3TDG A;  3ZIT A;  1VF1 A;  1PMT A;  2QKE A;  2H71 A;  3L0H A;  4YAP A;  2L59 A;  4AJ8 A;  2R3X A;  3TJF A;  4G0I A;  1OC9 B;  4HI7 A;  4IW9 A;  1S3D A;  3TKR A;  1EGO A;  1ZCP A;  2AV4 A;  1SD9 A;  4K0G A;  2BMX A;  1EEJ A;  1DSB A;  5ECI B;  2HZE A;  2LTK A;  3ME7 A;  3QAV A;  2F8A A;  4TRX A;  3GSS A;  5HR3 A;  1YF0 A;  2H1A A;  2PGT A;  3TKS C;  5IOX A;  1JLW A;  4LA1 A;  3ZZX A;  6GSS A;  2AUV A;  2C3Q A;  2EFD A;  4KW6 A;  1GUH A;  5ID2 B;  3JCM L;  3C73 A;  2HRN A;  3HVV A;  2L6C A;  2Z9S A;  2TRC P;  4FYC A;  3QFB C;  3EMP A;  4F03 A;  2B7K A;  1T4Z A;  2E0Q A;  4MDC A;  4PX1 A;  3PIN A;  1U6T A;  3P7X A;  4ML6 A;  2KUC A;  4KCE A;  5DAK A;  1T7P B;  3PPU A;  4GSS A;  1TDI A;  1BF5 A;  4KDU A;  2PN8 A;  5H5S A;  2J23 A;  5J4U A;  1B9Y C;  3GH9 A;  3KTL A;  5ECN B;  2F8F A;  2LQQ A;  5FHI A;  3UAR A;  1V57 A;  2H70 A;  4XS4 A;  1CQH A;  4NV2 A;  1ZYN A;  1UN2 A;  4KUN A;  3GX0 A;  1THO A;  4CW9 A;  3F8U A;  4IGJ A;  4EVM A;  3LXZ A;  1O85 A;  2JSY A;  1FG4 A;  3L9V A;  4DEJ A;  1KNG A;  1SYR A;  3RAZ A;  3D4T A;  4OCE A;  4RUV A;  4KA0 A;  5ECL B;  5HQP A;  1PKZ A;  3HDC A;  2AJQ B;  5A5H B;  5ECS A;  4ZL8 A;  3M0F A;  3C71 A;  1XWK A;  3VWV A;  1DBY A;  4PGT A;  4PTS A;  4FIW A;  1MDK A;  2WJU A;  1X5D A;  3NOF A;  4HZ2 A;  4YKF A;  2VL9 A;  3GYK A;  5GAN D;  2F51 A;  1A8Y A;  1RW1 A;  5ABR A;  2TIR A;  1A23 A;  2DMM A;  3IA1 A;  4TN8 A;  2JAD A;  1PRX A;  2CA8 A;  1MDI A;  2N5A A;  3E3E A;  3TKQ A;  2N5B A;  1NSW A;  1YKA A;  5J3R A;  3KH7 A;  1X9M B;  4ECB A;  2WZ9 A;  2X99 A;  5HFK A;  5CRG A;  1V98 A;  1JLV A;  1GLP A;  3RHC A;  5IPG A;  1FB6 A;  3ZIJ A;  2HT9 A;  3RPP A;  4KAE A;  4HU9 A;  3IRA A;  4IHU A;  4V2L A;  2MBT A;  4AKI A;  3CSI A;  2IN3 A;  1LJR A;  1JZO A;  2H72 A;  4EC0 A;  1URM A;  5CO3 A;  1EEM A;  1ZZY A;  4NMU A;  2BJX A;  4K5R A;  4V2N A;  2ZUP A;  5CRW A;  1EOG A;  3CXG A;  3GX8 A;  5B6M A;  3HVS A;  1SK1 A;  3F0I A;  5D9T A;  2EFH A;  3DKS A;  3MDK A;  2FLS A;  5ECM B;  5DJL A;  4WXT A;  3IE3 A;  3CWG A;  4GF0 A;  2YJ7 A;  4KDX A;  4NHW A;  4D73 A;  5A4W A;  4HS1 A;  1QMV A;  3IDV A;  19GS A;  3D21 A;  2OAC A;  4ZB9 A;  1BYE A;  3IC4 A;  3CMI A;  3FMW A;  2VCW A;  4CY6 A;  3QAG A;  2K8S A;  5GSS A;  1A2J A;  1C72 A;  3O3T A;  4XIH A;  3KMN A;  3CTG A;  1XWB A;  1B8X A;  4TOP A;  4H86 A;  5BRT A;  4X0X A;  2HSH A;  3LXT A;  5ELG A;  3G7I A;  1EWX A;  1F6M C;  1MD3 A;  3EVI A;  1FB0 A;  1XW9 A;  1K3L A;  1TP9 A;  3CRU A;  3TJK A;  5EY6 A;  4TR4 A;  1M9A A;  3KIJ A;  4ECC A;  2L6D A;  4RI7 A;  1U88 A;  1R5A A;  4K1F A;  3ISO A;  4Q5N A;  1W4V A;  3OR5 A;  3D6I A;  4PQ1 A;  1NHO A;  5J40 A;  1OC9 A;  2EIR A;  4N0Z A;  2QA2 A;  5EL8 A;  1OE8 A;  2G0F A;  3QMX A;  3PGT A;  1VF4 A;  3WD6 A;  5KOX A;  1BG1 A;  1ZYP A;  2MMZ A;  1ERW A;  4IEL A;  1V2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...