5F07A

Crystal structure of glutathione transferase f8 from populus trichocarpa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
212
structure length
212
Chain Sequence
VVKVYGPAVAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLKQPFGQVPVVEDGDFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVILPRIGQQGDSELVRTYEEKLEKVLDVYEKRLSKSKYLAGDSFTLADLSHLPATRYLVNEAGLGHLVKDRKKLNAWWEDISSRPAWKKLMNLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glutathione S-transferase family protein
publication title Structural plasticity among glutathione transferase Phi members: natural combination of catalytic residues confers dual biochemical activities.
pubmed doi rcsb
source organism Populus trichocarpa
molecule tags Transferase
total genus 81
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5f07A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5f07A01
1M99A 2HRKB 1X9MB 2GVPA 1S3DA 3WT1A 2IMKA 3MAKA 1OKDA 3KH7A 2CV4A 5JWOB 1K0BA 3C1SA 2AHEA 4ECBA 13GSA 2VUPA 5KN1A 1N8JA 2P5QA 4OCFA 1V40A 5D9VA 4K8MA 1X9WB 1G6YA 4NHWA 1USBA 1SJ6A 1ERUA 3E9JB 4OO4A 3KTLA 1NM3A 1YKCA 4XS4B 4TR1B 2DSAA 3J7Yk 3BBYA 3TKSE 1Q4JA 2DC5A 3LYPA 4ZL9A 1EOGA 2H0GA 2V2GA 1GSDA 3G7YA 2GSSA 2AJQB 3GL3A 4I5QA 4PUFC 1QQ2A 5EVOA 3TJBA 5D9TA 3PH9A 2P31A 4WR5A 5IOWA 1XW6A 3A2WA 3TKPA 1QFNA 2OBIA 4H86A 2X99A 4EXJA 4NHZA 5JCGA 2JADA 5HR2A 1M9BA 1PMTA 4EF0A 2OJLA 3IK7A 5JWRB 3RHCA 3MSZA 1FHEA 2CAQA 3RPPA 3FY7A 3TOTA 5KN3A 4K2DA 3TB2A 4K0GA 4J56E 3F3QA 1URMA 2P5RA 1U3AA 4E8EA 4YQVA 1TRSA 2O7KA 2YWNA 3BCKA 1TRUA 1ERWA 3Q6OA 3QFAC 4IELA 1YEXA 1LBKA 2CX4A 3GMFA 2F8AA 4GRFA 5DCHA 4K7NA 4N0ZA 4BVYB 3HCZA 5ECNB 2H74A 2YV7A 2VLTA 3K8NA 5E4WA 1XZOA 3ZVJA 4NAXA 4HUAA 1T8EB 3RBTA 1XVQA 1ZZYA 1GTIA 4YAPA 4OFMA 3VPQA 2JZTA 5DJMA 2YV9A 4HDEA 1RQMA 1U6TA 1J08A 1YZXA 2KP2A 3Q74A 1GSYA 4HU7A 4KH7A 5FHIA 3P7XA 5A4VA 4L0WA 4ZILA 3APOA 1XBSA 1CQHA 3FR6A 2IMEA 4RQXA 3DVWA 2I3YA 5CYYA 5ECRB 1GP1A 2HFDA 5F0GA 4BVXB 1XXUA 4MZWA 1U3IA 3WGXA 5CREA 4MJAA 4I97A 2XHFA 3HJMA 3F4RA 2R4VA 1ZOFA 1AC1A 2OKAA 3DD3A 4AF2A 2IJYA 3UARA 1FW1A 4I8BA 4G19A 4LMVA 3UVHA 2HYXA 3HA9A 2H6XA 1UN2A 3KMOA 2UZ8A 3UOMA 2MMAA 3CMIA 3GH9A 4MMMA 2O85A 3ZFLA 4G9HA 4ECIA 3RPNA 3CRUA 3C8EA 2H75A 3KEBA 3GSSA 2I4AA 4GWRA 3ZZXA 4MH3A 4F9ZA 1PSQA 3F4SA 4HQSA 5ECMB 3EVIA 4K6XA 1T00A 2PWJA 1AQWA 1XWKA 3TUEA 4AGSA 1K3YA 1YDKA 4MPFA 3H79A 4TN8A 3CSHA 3G9BA 5B8AA 8GSSA 2FA4A 2QSIA 4J2FA 3D22A 3GUSA 1E6BA 2HSHA 4KDUA 2XBQA 2K6VA 4PXOA 3GSTA 1LJRA 1FB0A 2DJ0A 4K9ZA 1A24A 2OBKA 3GKKA 4EDZA 2XC2A 2EC4A 3ME8A 4X0XA 3WGDA 2WJUA 4TRXA 3WGEA 2PERA 1SKSB 3VWXA 4BPYA 2LSTA 3D5JA 2X8GA 1K3OA 3BD2A 1TP9A 3TJKA 3QDNA 4X43A 4PNGA 1K0DA 3ZMKA 1ST9A 1VF1A 2BMXA 3ERWA 2JZRA 5B6NA 1CQGA 2VM1A 5AIXA 5DALA 5AN1A 4ZB8A 2HSMA 3ZIVA 12GSA 5GAPD 1UA5A 5IO0A 5B8BA 4ZBDA 4KW6A 5ID2A 1S3CA 4J57E 4BL7B 3APSA 2PPTA 4HQZA 2AUVA 2YZUA 3LFLA 3GX8A 3HHVA 2C0DA 2F51A 2H76A 4HZ4A 1T1VA 3NIVA 4KF9A 1GNWA 4GSTA 2IMDA 3F0IA 3HDCA 1SYXA 2LKUA 5J9BA 3IDVA 1B48A 5DJLA 3P90A 3A3TA 4PUAA 1X5DA 1GULA 4GSNA 3N9JA 1GUMA 4GSSA 4Q5QA 2IL3A 2VL9A 3C7MA 3MWHA 3P8WA 4TR4A 1OC8A 2X8HA 3F4TA 2X64A 3FW2A 4MF7A 2NBSA 1Z3EA 1R5PA 1BQ7A 2IMFA 5HR0A 3KD0A 1IYHA 3CRTA 3DEXA 5ENUA 4F2IA 4IP1A 4KB3A 1M2BA 2B1LA 5IO2A 4K7IA 4POMA 3GNJA 1A2JA 6GSSA 3D0ZA 3QR6A 4ZB9A 1THOA 2AV4A 2IFQA 4HS1A 3I9V2 4KUNA 3IPZA 4V1Ap 2KUCA 2V32A 5C00A 2DMMA 3I6AA 5FWGA 1A23A 1ERTA 3VLNA 1YKAA 1ON4A 1A8YA 4WF5A 3KH9A 1TK5B 1AW9A 3DIEA 1JZOA 2VOCA 2WB9A 1KTEA 1EWXA 1DUGA 2H1AA 1XOBA 5J3RA 1ZYQB 1X5EA 5DALB 3UIWA 2HSMB 1JZRA 3UBKA 1QGVA 1A0RP 2J9HA 2VD1A 3DVXA 5ID2B 3LEFA 1O85A 2HI7A 4TR1A 1O7UA 4MP4A 3EURA 4N10A 3RDWA 1AIUA 3FRCA 3LJRA 2VL2A 2HZEA 1FVJA 1FVKA 2HT9A 3O76A 5F05A 1M2AA 3GA4A 1EOHA 1WMJA 2GSRA 2IWTA 2NPBA 4N0VA 3W6GA 1GSUA 3FZ4A 2F3MA 1Z5YE 4IW9A 2CAIA 2LRNA 1YY7A 2YZHA 2GQMA 3VPTA 1Z6NA 3VWUA 3CSJA 2GSTA 3ZMLA 2NDOA 4OFTA 2WCIA 3QD9A 2N5AA 1GSFA 4YAVA 16GSA 4ZBAA 4LA1A 2HRAA 2WZ9A 3UL3A 1Z7PA 2KP1A 2GZPA 1XWCA 4EUYA 2IFQB 1BYEA 5CRWA 2DJKA 4MK3A 4O92A 4DSQA 4G0IA 5IMVA 1GSQA 5J5NA 2C80A 1K0OA 5IPGA 5G5FA 2VD0A 1WP0A 2VO4A 2YCDA 3ERFA 1NHYA 2YWMA 2HSNB 4XCSA 2R5GA 4AJ7A 2FWFA 3KMNA 1T4YA 4XIHA 4TR3A 2M46A 3LGCA 1V58A 4MJCA 3FHKA 2FWGA 3A2VA 5KEJA 2RUFA 4YQUA 2C8UA 1PKZA 3FYGA 1GUHA 2H1BA 2DJJA 5CNWA 4RI7A 4POKA 2L59A 1TU7A 1H4OA 2JZSA 4FQUA 4ISDA 4RI6A 4BVXA 5F07A 3QCPA 3GN3A 1Z6MA 2GQLA 4IKHA 1KEBA 4L5OA 3IBHA 2HXKA 2VCTA 2JSZA 1B9YC 3VWVA 3FZ9A 1GNEA 2K18A 2VIMA 2EIOA 3VK9A 4OCEA 2HZEB 4POLA 2WS2A 3EINA 3H4KA 1WRYA 1V57A 4GXZA 5ECQB 1EP8A 2LJKA 1WJKA 2NVLA 3GFKA 3WT2A 2KHPA 3TJFA 4CW9A 5KN2A 3HJPA 3ZYWA 2R6KA 3OR5A 1JHBA 1M7TA 4PQHA 3M1GA 5J9CA 1JFUA 4ZL7A 4AJ8A 1MTCA 2C3NA 1N2AA 1ACVA 2HNLA 1QK8A 2HRNA 3TRQA 2MZCA 3IHQA 1JZWA 2G0FA 3TKQA 1NHOA 2CQ9A 5COHA 4MA9A 2ZNMA 3U5RE 1F2EA 2YOIA 3QOUA 3QMXA 4LL4B 5IMZA 3APQA 4FYBA 4JE1A 2B6MA 5DVBA 1GTBA 4HZ2A 3F6DA 3ZL5A 2L5LA 1SJIA 4JEDA 3KZQA 2FHEA 2C0EA 5B7CA 2PVQA 2REMA 2MMOA 3UJ1A 1A2MA 3KIJA 1Z7RA 1O8WA 2C3QA 5ECHB 1HNCA 2C4JA 1V9WA 1WIKA 2FA8A 5F8BA 2GS3A 4USSA 2I1UA 2H71A 4YQMA 2WRTA 3DRNA 6GSTA 3PINA 4WETA 5G1LA 3W8JA 3VFIA 2H1GA 3HKRA 2HZFA 5D8IA 4TKYA 1M2DA 1SKWB 6GSXA 3LYKA 5A4UA 3KCMA 1FG4A 4D73B 1AAZA 4MZBA 2VCZA 3EMPA 2R37A 5ECSA 1PL1A 3LXTA 3F8UA 1PKWA 2QC7A 2YN1A 1SYRA 1JLWA 1PRXA 4BL7A 3CXGA 1TRVA 2YJ7A 3NZNA 2YWOA 3GHAA 3ERGA 5GSTA 2PUKC 4MCUA 4IVFA 4EDYA 4K0NA 3RAZA 4KDYA 3DWVA 4DSRA 1AQVA 3LORA 1PGTA 4N30A 1PA3A 3CSIA 4DSSA 1TK0B 2C1YA 2FWHA 2CVBA 4NXIA 1MDJA 1X0RA 2YNXA 1ZGNA 1QUWA 5IM9A 1QMVA 3UEMA 17GSA 3TJGA 4ML1A 4OD7A 4Q5RA 2H73A 4O5RA 5G5EA 4RQRA 4I2TA 4KX4A 5AGYA 1GL8A 4PX1A 3NOFA 1VRSD 4G0KA 2YWIA 4L0UA 7GSSA 3KP9A 1XWGA 3R3EA 1K0MA 4PNFA 2FNOA 4F0CA 3GKMA 4GF0A 3EYTA 3PGTA 1EGRA 2V41A 5DBQA 1MDKA 1SU9A 2OE1A 2FWEA 3TCOA 2YPMA 1T3BA 1HNBA 3DMLA 2RLIA 4N11A 1X9SB 1T7PB 4XRDA 4Z7XA 2LRTA 2H19A 2XBIA 2IN3A 5A4WA 3HJOA 1KNGA 3R2QA 4L8EA 5AIVA 3QAVA 2PMTA 4XRAA 1FO5A 3QAGA 1R26A 1ERVA 2O8VB 4E8HA 4PQIA 2AYTA 3TDGA 3FKFA 3KM6A 2DLXA 5HFKA 3D21A 2LTKA 2DJ1A 2E7PA 4V2MA 1TKDB 1GRXA 6GSUA 3TKRA 2FCHA 3DXBA 2B5EA 2C3TA 4TXVA 2HLSA 2IMIA 1XCCA 3F3RA 3CTFA 3UMAA 2ES7A 4HJ2A 2B7JA 1XOAA 5J41A 3C71A 5IQYA 1SD9A 4ULXA 2LJAA 3E3EA 2VL2C 4O32A 2FD3A 1YQ1A 1PX7A 4GQFA 3KJYA 4DSSB 5HQPA 3ZIJA 4F0BA 2GT5A 5CP1A 3KP8A 1XW5A 3LG6A 1OKTA 2N5FA 3HY2A 2HQTA 1XW9A 3E0UA 2H70A 4IP6A 2JL4A 1J9BA 1R7HA 4JU5A 3Q19A 1YF0A 1GUKA 5EPFA 4EL1A 1OVNA 5ECIB 5IMFA 5BMUA 2MMNA 3PR8A 3QPMA 1FAAA 3GKXA 4NV5A 4FYUA 3KGKA 2H0HA 4WKWA 2DBCA 4HEA2 4HI7A 4ZIJA 1OAZA 4POBA 1F3AA 3L9VA 4QL7A 3GH6A 3FZ5A 3D6IA 4IQAA 4KA0A 2RIIA 3TRXA 2I9HA 2IIYA 2RM6A 3IC8A 4TR0A 5DDLA 3ZREA 4F03A 2B5XA 1NSWA 1ZCPA 4ID0A 3TOUA 2VCWA 4BWSA 3F63A 1BEDA 2V6OA 3CTGA 3ISOA 1A2LA 3H1NA 2ALBA 1OC9B 4EE0A 2JACA 1FOVA 1SK2A 2WULA 3IRAA 4WF4A 2A4VA 3EE2A 1OC3A 1WWJA 2I81A 2B3SA 1C72A 1YF1A 4JBBA 2PBJA 4LL1B 4WEYA 1MD3A 1GLPA 2H66A 4K7OA 4ZL8A 3UBLA 3UVTA 5H5SA 2D2ZA 10GSA 1SK0A 3KXOA 1U87A 4ZXGA 2FGXA 1ILOA 4ML6A 1EV9A 3HVXA 2ZCTA 2L6DA 4WR4A 4KCEA 4GQCA 4NMUA 2E2GA 2XPEA 3GV1A 2GLRA 2M72A 2YP6A 1O6JA 4NV2A 1BG5A 5CO3A 5ABRA 1BX9A 4O7HA 1KBNA 3L9SA 3AY8A 1TRWA 2QGVA 2PGTA 3JCML 2TRCP 1VF4A 3U6VA 1XIYA 1TI3A 3TJJA 2HSYA 3ZTLA 1XFLA 5CRGA 4MF6A 2H1DA 4EKZA 3QFBC 3ED3A 1GTUA 4IJIA 2C0GA 3GRXA 2H6YA 2PU9C 6GSVA 4I2UA 5HR1A 3BCIA 4MJEA 4FO5A 1PL2A 2BTOT 2LNTA 1XPVA 1W89A 22GSA 3EMXA 4QL9A 1GH2A 1UC7A 3Q18A 1HD2A 4PQ1A 1DE1A 3UAPA 3DYRA 1Q98A 3IR4A 1EEJA 1XWBA 1V2AA 4IJ3A 2BJXA 3GIXA 3M8NA 4HU9A 4TXOA 4IGJA 2WGRA 1VF2A 1G6WA 2MBTA 3BJ5A 4D73A 4FH8A 3FEUA 1TU8A 4QQ7A 2L5OA 2AAWA 4ECJA 4KE3A 2CZ3A 3FR9A 3H8QA 5CAXA 4XS6A 3ZITA 4YH2A 4TVEA 4V1Ag 5AISA 4MF5A 3EU4A 2F8FA 5ECLB 4V2LA 3QAWA 5DCGA 5D93A 1S3AA 2A2RA 1YEPA 1G7OA 3C1RA 4KDXA 3TKSA 3GX0A 4OO5A 4MZCA 1ZL9A 3FK8A 2CZ2A 1GTAA 3IV4A 2PN8A 1AQXA 1TDIA 5EY6A 1THXA 4NWYA 1MDIA 3V1WA 2TRXA 1Y6EA 3N5OA 5DAKA 2CVKA 2V1MA 4AJ6A 2MYGA 4GLTA 2K8SA 4K1FA 2XPDA 3HZ8A 1F37A 1VF3A 2PVOC 1MD4A 1GSSA 1TW9A 1EEMA 2LUSA 2LEGA 5IMCA 5ECKB 2LQQA 2ZUPA 3ZFBA 1O8XA 2JU5A 3EU3A 5J4UA 1SL0B 2OE3A 1I9DA 1SJZA 3VI7A 5JWQB 2Z9SA 3W8SA 1LU4A 3GKNA 5D9XA 3DGQA 3VURA 1TOFA 2VCVA 2B5YA 5LNKe 2L4CA 1GLQA 2DJ3A 2R3XA 4KSMA 3HXSA 4IBPA 1DSBA 5C04A 2GDRA 1SL1B 3M0FA 3HVVA 1TK8B 2O89A 4MDCA 5CRDA 4FIWA 2DIYA 4TXOB 1T4ZA 4HOJA 4TOPA 2QKEA 1K0AA 3C73A 1YJ6A 2IPAA 2R2JA 3M9KA 2G2QA 3I69A 1M9AA 4OFNA 4FYCA 2YANA 5HFIA 3A5WA 3P2AA 4IHUA 1JLVA 4TW5A 1A8LA 2MBSA 2P0GA 3LXZA 4V2NA 2L57A 3ME7A 4IN0A 3M3MA 1K0CA 2HRFA 1BAYA 5G2ZA 5KN0A 4JR4A 3HVSA 2RM5A 1BJXA 3IXRA 4XHMA 3L4NA 5ELAA 2DMLA 2LJRA 2FLSA 2DJ2A 4KSOA 1B8XA 2K8VA 2A2SA 4MPGA 2C0FA 4WBJA 1F3BA 1J0FA 1G0TA 3L9UA 1AXDA 1SD8A 2M80A 3IC4A 3ZVJD 3D4TA 3L0HA 2VLUA 5DAKB 2LRCA 4MH2A 3SWLA 2TIRA 3IAS2 5L71A 1O73A 3RHBA 2LNSA 3IA1A 1GSEA 1PD21 1FB6A 5HFGA 19GSA 2KLXA 3F9UA 20GSA 3GL5A 3IK9A 4BA7A 1TJDA 1GWCA 1ML6A 2H0IA 3ZLPA 3ZRDA 4EC0A 3J7Yb 2GQKA 1PX6A 1DBYA 14GSA 2NTOA 5E59A 5A5KA 1B4QA 2H30A 1B9XC 1U88A 4IS0A 4WXTA 1HNAA 3PPUA 1SKRB 2EIRA 3G7IA 5HR3A 4CHSA 2OA7A 1OYJA 4PGTA 4KAEA 4I6XA 5ECOB 1R4WA 2VCXA 1PQNA 4G2EA 2RUEA 3LQ7A 4G10A 4OMVA 3GTUA 1HQOA 3IE3A 4PTSA 4OWYA 1ZMAA 3HD5A 2H8LA 2FUG2 3FZAA 1RK4A 3HZ4A 1OC9A 2WDUA 4F82A 4PURA 2YJHA 2E0QA 5GZZB 1M0UA 18GSA 2GSQA 4XS1A 3TGZA 4WBRD 3A2XA 5ELGA 4EVMA 3HYPA 2JSYA 1F9MA 4ILFA 2O87A 5LD0A 4XTSA 5F06A 3L78A 1HYUA 4RUVA 4NPBA 5IMDA 5G30A 1JZDA 2DIZA 1A0FA 4ECCA 2WFCA 3CYNA 2LV3A 4KCAA 5ECPB 4X1UA 3CBUA 3M9JA 5DQSA 3H93A 4DVCA 1ZYEA 2H6ZA 3LSZA 5IIZA 3MDKA 1IYIA 2E2MA 2OACA 2VM2A 3MNGA 4JR6A 4Q5FA 1SK1A 4LMWA 4JRRA 9GSSA 3F6FA 2L4QA 1B4PA 3WYWA 2B7KA 2HE3A 2LQOA 1RW1A 3S9FA 2KOKA 1EP7A 2ON7A 3EC3A 1F6MC 2GGTA 3O3TA 4P3YB 1EV4A 3LWAA 1H75A 2CX3A 3BOAA 2VL3A 1R5AA 1AUCA 2VLVA 3IOSA 2HRKA 3GTUB 2L6CA 2CT6A 2MMZA 4IQ1A 1Y25A 1V98A 4ZBBA 1O81A 5D9WA 4EO3A 2V6KA 1TXXA 2H72A 2EIQA 3TRPA 2F9SA 4G0LA 4JZQA 5LCZA 6GSYA 1DE2A 2OE0A 1E2YA 5JCUA 1WE0A 5IMAA 1XVWA 4KNDA 1EZKA 2LS5A 1WPIA 4MABA 3KTBA 2FY6A 2GTUA 1K0NA 3I43A 1SL2B 2N5BA 5B6MA 4KGIA 4XS4A 2H01A 5H5RA 2CVDA 5IOXA 5GSSA 5GAND 2X8CA 3O6TA 5IPHA 6GSWA 1TI1A 4GTUA 2AB6A 2VAFA 2ON5A 3EWLA 1OE7A 5G31A 3GURA 2VCQA 1MEKA 1XWAA 4Q5NA 3DKSA 3VWWA 5FT3A 4ZB6A 3D4MA 5CRHA 4CDOA 4MJBA 5D96A 2K9FA 3TKSC 4LLRA 2GT6A 4DEJA 2OADA 4L5LA 3G7JA 5H5QA 1EGOA 1NW2A 4BWQA 1K3LA 4ACSA 1WOUA 1G7EA 1ABAA 2B1KA 11GSA 5JCWA 2J23A 5G1KA 4HJMA 1Z9HA 5D73A 1PN9A 3FR3A 2GZYA 5INYA 3WD6A 1I5GA 1SENA 4MLYA 5DQYA 5EL8A 4GCIA 1W4VA 3GYKA 4BVYA 2CA8A 1QXHA 2GZZA 3SBCA 1TTZA 3IAM2 3US3A 1OE8A 3VI5A 1X5CA 1UVZA 1VGLA
chains in the Genus database with same CATH superfamily
1M99A 2HRKB 1X9MB 2GVPA 1S3DA 3WT1A 2IMKA 3MAKA 1OKDA 3KH7A 2CV4A 5JWOB 1K0BA 3C1SA 2AHEA 4ECBA 13GSA 2VUPA 5KN1A 1N8JA 2P5QA 4OCFA 1V40A 5D9VA 4K8MA 1X9WB 1G6YA 4NHWA 1USBA 1SJ6A 1ERUA 3E9JB 4OO4A 5KOWA 3KTLA 1NM3A 1YKCA 4XS4B 4BIKA 4TR1B 2DSAA 3J7Yk 3BBYA 3TKSE 1Q4JA 2DC5A 3LYPA 4ZL9A 1EOGA 2H0GA 4EIQA 5J40A 2V2GA 1GSDA 3G7YA 2GSSA 2WW1A 2AJQB 3GL3A 4I5QA 4PUFC 1QQ2A 5EVOA 3TJBA 5D9TA 3PH9A 2P31A 2VKZG 4WR5A 5IOWA 1XW6A 3A2WA 3TKPA 1QFNA 2OBIA 4H86A 2X99A 4EXJA 4NHZA 5JCGA 2JADA 5HR2A 1M9BA 1PMTA 4EF0A 2OJLA 3IK7A 5JWRB 3RHCA 3MSZA 1FHEA 2CAQA 2WVYA 3RPPA 3FY7A 4Z2TA 3TOTA 5KN3A 4K2DA 2A2PA 3TB2A 4K0GA 4J56E 3F3QA 1URMA 2P5RA 1U3AA 4E8EA 4YQVA 1TRSA 2O7KA 2YWNA 3BCKA 1TRUA 2EFEA 1ERWA 3Q6OA 3QFAC 4IELA 1YEXA 1LBKA 2CX4A 3GMFA 2F8AA 4GRFA 5DCHA 4K7NA 4N0ZA 4BVYB 3HCZA 5ECNB 2H74A 2YV7A 2VLTA 3K8NA 5E4WA 1XZOA 3ZVJA 4G01A 4NAXA 4HUAA 1T8EB 3RBTA 1XVQA 1ZZYA 1GTIA 4YAPA 4OFMA 3VPQA 2JZTA 5DJMA 2YV9A 4HDEA 1RQMA 1U6TA 1J08A 1YZXA 2KP2A 3Q74A 1GSYA 4HU7A 4KH7A 5FHIA 3P7XA 5A4VA 4L0WA 4ZILA 3APOA 1XBSA 1CQHA 3FR6A 2IMEA 4RQXA 5J4VA 3DVWA 2I3YA 5CYYA 5ECRB 1GP1A 2HFDA 5F0GA 4BVXB 1XXUA 4MZWA 1U3IA 3WGXA 5CREA 4MJAA 4I97A 5A34A 2XHFA 3HJMA 3F4RA 2R4VA 1ZOFA 1AC1A 2OKAA 3DD3A 4AF2A 2IJYA 3UARA 1FW1A 4I8BA 4G19A 4PHZC 4LMVA 3UVHA 2HYXA 3HA9A 2H6XA 1UN2A 3KMOA 2UZ8A 3UOMA 2MMAA 3CMIA 3GH9A 4MMMA 2O85A 3ZFLA 4G9HA 4ECIA 3RPNA 3CRUA 3C8EA 2H75A 3KEBA 3GSSA 2QA1A 2I4AA 4GWRA 3ZZXA 4MH3A 4F9ZA 1PSQA 3F4SA 2O36A 4CY8A 4HQSA 5ECMB 3EVIA 4K6XA 3LW9A 1T00A 2PWJA 1AQWA 1XWKA 3TUEA 4QMKA 4AGSA 1K3YA 4K2XA 1YDKA 4MPFA 2WW0A 3H79A 4TN8A 3CSHA 3G9BA 5B8AA 8GSSA 2FA4A 2QSIA 4J2FA 3D22A 3GUSA 1E6BA 2HSHA 4KDUA 2XBQA 2K6VA 4PXOA 3GSTA 1LJRA 1FB0A 1BF5A 2DJ0A 4K9ZA 1A24A 2OBKA 3GKKA 4EDZA 2XC2A 2EC4A 3ME8A 4X0XA 3WGDA 2WJUA 4HSCX 4TRXA 3WGEA 2PERA 1SKSB 3VWXA 4BPYA 2LSTA 3D5JA 2X8GA 1K3OA 3BD2A 1TP9A 3TJKA 3QDNA 4X43A 4PNGA 1K0DA 3ZMKA 1ST9A 1VF1A 2BMXA 3ERWA 2JZRA 5B6NA 1CQGA 2VM1A 5AIXA 5DALA 5AN1A 4ZB8A 2HSMA 3ZIVA 12GSA 5GAPD 1UA5A 5IO0A 5B8BA 4ZBDA 4KW6A 5ID2A 1S3CA 4J57E 4BL7B 3APSA 2PPTA 4HQZA 2AUVA 2YZUA 1PFOA 3LFLA 3GX8A 3HHVA 2C0DA 2F51A 2H76A 4HZ4A 1T1VA 3NIVA 4KF9A 1GNWA 4GSTA 2IMDA 3F0IA 3HDCA 1SYXA 2LKUA 5J9BA 3IDVA 1B48A 5DJLA 3P90A 3A3TA 4PUAA 1X5DA 1GULA 4GSNA 3N9JA 1GUMA 4GSSA 4Q5QA 2IL3A 2VL9A 3C7MA 1FOHA 3MWHA 3P8WA 4TR4A 1OC8A 2X8HA 3F4TA 2X64A 3FW2A 4MF7A 2NBSA 1Z3EA 1R5PA 1BQ7A 2IMFA 5HR0A 3KD0A 1IYHA 2UV8G 3CRTA 3DEXA 5ENUA 4F2IA 4IP1A 4KB3A 1M2BA 2B1LA 5IO2A 4K7IA 4POMA 3GNJA 1A2JA 6GSSA 3D0ZA 2R0PA 3QR6A 4ZB9A 1THOA 2AV4A 2IFQA 4HS1A 3I9V2 4KUNA 3IPZA 4V1Ap 2KUCA 2V32A 5C00A 2DMMA 2H1LA 3I6AA 5FWGA 1A23A 1ERTA 3VLNA 1YKAA 1ON4A 1A8YA 4WF5A 3KH9A 1TK5B 1AW9A 3DIEA 1JZOA 2VOCA 2WB9A 1KTEA 1EWXA 1DUGA 2H1AA 1XOBA 5J3RA 1ZYQB 1X5EA 5DALB 3UIWA 2HSMB 1JZRA 3UBKA 1QGVA 1N25A 1A0RP 2J9HA 2VD1A 3DVXA 5ID2B 1YEWC 3LEFA 1O85A 2HI7A 4TR1A 1O7UA 4MP4A 3EURA 4N10A 3RDWA 1AIUA 1SVOA 3FRCA 3LJRA 2VL2A 2HZEA 1FVJA 1FVKA 3RFRC 2HT9A 3O76A 5F05A 1M2AA 3GA4A 1EOHA 1WMJA 2GSRA 2IWTA 1M3IA 2NPBA 4N0VA 3W6GA 1GSUA 3FZ4A 2F3MA 1Z5YE 4IW9A 2CAIA 2LRNA 1YY7A 2YZHA 2GQMA 3VPTA 1Z6NA 3VWUA 3CSJA 2GSTA 3ZMLA 2NDOA 4OFTA 2WCIA 3QD9A 2N5AA 1GSFA 4YAVA 16GSA 4ZBAA 4LA1A 2HRAA 2WZ9A 3UL3A 2EFCA 1Z7PA 2KP1A 2GZPA 4GDFA 1XWCA 4EUYA 2IFQB 1BYEA 5CRWA 2EFDA 2DJKA 4MK3A 4O92A 4DSQA 4G0IA 5IMVA 1GSQA 5J5NA 2C80A 1K0OA 5IPGA 5G5FA 2VD0A 1WP0A 2VO4A 2YCDA 3ERFA 1NHYA 2YWMA 2HSNB 4XCSA 2R5GA 4AJ7A 5A5HA 2FWFA 3KMNA 1T4YA 4XIHA 3HMJG 4TR3A 2M46A 3LGCA 1V58A 4MJCA 3FHKA 2FWGA 3A2VA 5KEJA 2RUFA 4YQUA 2C8UA 1PKZA 3FYGA 1GUHA 2H1BA 2DJJA 5CNWA 4RI7A 4POKA 2L59A 1TU7A 1H4OA 2JZSA 4FQUA 4ISDA 4RI6A 4BVXA 5F07A 3MYDA 3QCPA 3GN3A 1Z6MA 2GQLA 4IKHA 1KEBA 4L5OA 3IBHA 2HXKA 2VCTA 2JSZA 1B9YC 3VWVA 3FZ9A 1GNEA 2K18A 2VIMA 2EIOA 3VK9A 4OCEA 2HZEB 4POLA 2WS2A 3EINA 3H4KA 1WRYA 1V57A 4GXZA 5ECQB 1EP8A 2LJKA 1WJKA 2NVLA 3GFKA 3WT2A 2KHPA 3TJFA 4CW9A 5KN2A 3HJPA 3ZYWA 2R6KA 3OR5A 1JHBA 1M7TA 4PQHA 4FXYP 3M1GA 5J9CA 1JFUA 4ZL7A 4AJ8A 1MTCA 2C3NA 1N2AA 1ACVA 2HNLA 1QK8A 2HRNA 3TRQA 3CHXC 4ZB7A 2MZCA 3IHQA 1JZWA 2G0FA 3TKQA 1NHOA 3HVNA 2CQ9A 5COHA 4MA9A 2ZNMA 3U5RE 1F2EA 1PN0A 2YOIA 3QOUA 3QMXA 4LL4B 4AKIA 5IMZA 3APQA 4FYBA 4JE1A 2B6MA 5DVBA 1GTBA 4HZ2A 3F6DA 3ZL5A 2L5LA 1SJIA 4JEDA 3KZQA 2FHEA 2C0EA 5B7CA 2PVQA 2REMA 2MMOA 5A5HB 3UJ1A 1A2MA 3KIJA 1Z7RA 1O8WA 2C3QA 4O5UA 5ECHB 1HNCA 2C4JA 1V9WA 1WIKA 2FA8A 5F8BA 2GS3A 4USSA 2I1UA 2H71A 4YQMA 2WRTA 3DRNA 6GSTA 3PINA 5A1NB 4WETA 5G1LA 3W8JA 3VFIA 2H1GA 3HKRA 2HZFA 5D8IA 4TKYA 1M2DA 1S3RA 1SKWB 2WVXA 6GSXA 3LYKA 5A4UA 3KCMA 1FG4A 4D73B 1AAZA 4MZBA 2VCZA 3EMPA 2R37A 5ECSA 1PL1A 3LXTA 3F8UA 2WW2A 1PKWA 2QC7A 2YN1A 1SYRA 1JLWA 1PRXA 4BL7A 3CXGA 1TRVA 2YJ7A 3NZNA 2YWOA 3GHAA 3ERGA 4YKGA 5GSTA 2PUKC 4MCUA 4IVFA 4EDYA 4K0NA 3RAZA 4KDYA 3DWVA 4DSRA 1AQVA 3LORA 1PGTA 4N30A 1PA3A 3CSIA 4DSSA 1TK0B 2C1YA 2FWHA 2CVBA 4NXIA 1MDJA 1X0RA 2YNXA 1ZGNA 1QUWA 5IM9A 1QMVA 3UEMA 17GSA 3TJGA 4ML1A 4OD7A 4Q5RA 2H73A 4O5RA 5G5EA 4RQRA 4I2TA 4KX4A 5AGYA 1GL8A 4PX1A 3NOFA 1VRSD 4G0KA 2YWIA 4L0UA 7GSSA 3KP9A 1XWGA 3R3EA 1K0MA 4PNFA 2FNOA 4F0CA 3GKMA 4GF0A 3EYTA 3PGTA 1EGRA 2V41A 5DBQA 1MDKA 1SU9A 2OE1A 2FWEA 3TCOA 2YPMA 1T3BA 1HNBA 3DMLA 2RLIA 4N11A 2DKHA 1X9SB 1T7PB 2WVXB 4XRDA 4Z7XA 2LRTA 2H19A 2XBIA 2IN3A 2A4HA 5A4WA 3HJOA 1KNGA 3R2QA 4L8EA 5AIVA 3QAVA 2PMTA 4XRAA 1FO5A 3QAGA 4N3ZA 1R26A 1ERVA 2O8VB 4E8HA 4PQIA 2AYTA 3TDGA 3FKFA 3KM6A 2DLXA 5HFKA 3D21A 2LTKA 2DJ1A 2E7PA 4V2MA 1TKDB 1GRXA 6GSUA 3TKRA 2FCHA 3DXBA 2B5EA 2C3TA 4TXVA 2HLSA 2IMIA 1XCCA 3F3RA 3CTFA 3UMAA 2ES7A 4HJ2A 2B7JA 1XOAA 5J41A 3C71A 5IQYA 1SD9A 4ULXA 2LJAA 3E3EA 2VL2C 4O32A 2FD3A 1YQ1A 1PX7A 4GQFA 3KJYA 4DSSB 5HQPA 4W66A 3ZIJA 4F0BA 2GT5A 4ICYA 5CP1A 3KP8A 1XW5A 3LG6A 1OKTA 2N5FA 4Z2UA 3HY2A 2HQTA 1XW9A 3E0UA 2H70A 4IP6A 2JL4A 1J9BA 2R0GA 1R7HA 4JU5A 3Q19A 1YF0A 1GUKA 5EPFA 4EL1A 1OVNA 5ECIB 5IMFA 5BMUA 2MMNA 3PR8A 3QPMA 1I1IP 1FAAA 3GKXA 4NV5A 4FYUA 3KGKA 2H0HA 4WKWA 2DBCA 4HEA2 4HI7A 4ZIJA 1OAZA 4POBA 1F3AA 3L9VA 4QL7A 3GH6A 3FZ5A 3D6IA 4IQAA 5KOXA 4KA0A 2RIIA 3TRXA 2HSNA 2I9HA 2IIYA 2RM6A 3IC8A 4TR0A 5DDLA 3ZREA 4F03A 2B5XA 1NSWA 1ZCPA 4ID0A 3TOUA 2VCWA 4BWSA 4K5RA 3F63A 1BEDA 2V6OA 3CTGA 3ISOA 1TXUA 1A2LA 3H1NA 2ALBA 1OC9B 4EE0A 2JACA 1FOVA 1SK2A 2WULA 3IRAA 4WF4A 2A4VA 3EE2A 1OC3A 1WWJA 2I81A 2B3SA 1C72A 1YF1A 4JBBA 2PBJA 2O3EA 4LL1B 4WEYA 1MD3A 1GLPA 4AI6A 3RGBC 4O5QA 2H66A 4K7OA 4ZL8A 4EIPA 3UBLA 3UVTA 5H5SA 2D2ZA 10GSA 1SK0A 3KXOA 1U87A 4ZXGA 2FGXA 1ILOA 3MIXA 4ML6A 1EV9A 3HVXA 2ZCTA 2L6DA 4WR4A 4KCEA 4GQCA 4NMUA 2E2GA 2XPEA 3GV1A 2GLRA 2M72A 2YP6A 1O6JA 4NV2A 1BG5A 5CO3A 5ABRA 1BX9A 4O7HA 1KBNA 3L9SA 3AY8A 3A5IA 5BMUB 1TRWA 2QGVA 2PGTA 3JCML 2TRCP 1VF4A 3U6VA 1XIYA 1TI3A 3TJJA 2HSYA 3ZTLA 1XFLA 5CRGA 4MF6A 2H1DA 4EKZA 3QFBC 3ED3A 1GTUA 4IJIA 2C0GA 3GRXA 4E68A 2H6YA 2PU9C 6GSVA 4I2UA 5HR1A 3BCIA 4MJEA 4FO5A 1PL2A 2BTOT 2LNTA 1XPVA 1W89A 22GSA 3EMXA 4QL9A 1GH2A 1UC7A 3Q18A 1HD2A 4X4JA 4PQ1A 1DE1A 3UAPA 5A1NA 3DYRA 1Q98A 3IR4A 1EEJA 1XWBA 3EPTA 1V2AA 4IJ3A 2BJXA 3GIXA 3M8NA 4HU9A 4TXOA 4IGJA 2WGRA 1VF2A 1G6WA 2MBTA 3BJ5A 4D73A 4FH8A 3FEUA 1TU8A 4QQ7A 2L5OA 3CWGA 2AAWA 4ECJA 4KE3A 2CZ3A 3FR9A 3H8QA 5CAXA 4XS6A 3ZITA 4YH2A 4TVEA 3CQFA 4V1Ag 5AISA 4MF5A 1YVLA 3EU4A 2F8FA 5ECLB 4V2LA 3QAWA 5DCGA 5D93A 1S3AA 2A2RA 1YEPA 1ZYNA 1SVLA 1G7OA 3C1RA 4KDXA 3TKSA 3GX0A 4AKXB 2WW3A 4OO5A 4MZCA 1ZL9A 3FK8A 2CZ2A 1GTAA 3IV4A 2PN8A 1AQXA 1TDIA 5EY6A 1THXA 4NWYA 1MDIA 3V1WA 2TRXA 1Y6EA 3N5OA 5DAKA 2CVKA 2V1MA 4AJ6A 2MYGA 4GLTA 2K8SA 4K1FA 2XPDA 3HZ8A 1F37A 1VF3A 2PVOC 1MD4A 1GSSA 1TW9A 1EEMA 2LUSA 2LEGA 5IMCA 5ECKB 2LQQA 2ZUPA 3ZFBA 4AKHA 1O8XA 2JU5A 3EU3A 5J4UA 1SL0B 2OE3A 1I9DA 1SJZA 3VI7A 4AKGA 5JWQB 2Z9SA 3W8SA 1LU4A 3GKNA 5D9XA 3DGQA 3VURA 1TOFA 5J4YA 2VCVA 2B5YA 3FMWA 5LNKe 2L4CA 1GLQA 2DJ3A 2R3XA 4KSMA 3HXSA 4IBPA 1DSBA 5C04A 2GDRA 1SL1B 4Z2RA 5J47A 2EFHA 3M0FA 3HVVA 1TK8B 2O89A 4MDCA 5CRDA 4FIWA 2DIYA 4TXOB 1T4ZA 4HOJA 4TOPA 2QKEA 1K0AA 3C73A 1YJ6A 2IPAA 2R2JA 3M9KA 2G2QA 3I69A 1M9AA 4OFNA 4FYCA 2YANA 5HFIA 1SVMA 4CY6A 3A5WA 3P2AA 4IHUA 1JLVA 4TW5A 1A8LA 2MBSA 2P0GA 2X49A 3LXZA 4V2NA 2L57A 3ME7A 4IN0A 3M3MA 1K0CA 2HRFA 1BAYA 5G2ZA 5KN0A 4JR4A 3HVSA 2RM5A 1BJXA 3IXRA 4XHMA 3L4NA 5ELAA 2DMLA 2LJRA 2FLSA 2DJ2A 4MNNA 4KSOA 1B8XA 2K8VA 2A2SA 4MPGA 2C0FA 1S4BP 4WBJA 1F3BA 1J0FA 1G0TA 3L9UA 1AXDA 1SD8A 2M80A 3IC4A 3ZVJD 3D4TA 4PI2C 3L0HA 2VLUA 5DAKB 2LRCA 4MH2A 3SWLA 2TIRA 3IAS2 5L71A 1O73A 3RHBA 1BG1A 2LNSA 3IA1A 1GSEA 1PD21 1FB6A 5HFGA 19GSA 2KLXA 3F9UA 20GSA 3GL5A 3IK9A 4BA7A 1TJDA 1GWCA 1ML6A 2H0IA 3ZLPA 3ZRDA 4EC0A 3J7Yb 2GQKA 1PX6A 1DBYA 14GSA 2NTOA 5E59A 5A5KA 1B4QA 2H30A 1B9XC 1U88A 4IS0A 4WXTA 1HNAA 3PPUA 1SKRB 2EIRA 3G7IA 5HR3A 4CHSA 2OA7A 1OYJA 4PGTA 4KAEA 1ZYPA 4I6XA 5ECOB 1R4WA 2VCXA 1PQNA 4G2EA 2RUEA 3LQ7A 4G10A 4OMVA 3GTUA 1HQOA 3IE3A 4PTSA 4OWYA 1ZMAA 3HD5A 2H8LA 2FUG2 2R0CA 5A34B 3FZAA 1RK4A 3HZ4A 1OC9A 2WDUA 4F82A 3IHGA 4PURA 2YJHA 2E0QA 5GZZB 1M0UA 18GSA 4YKFA 2GSQA 4XS1A 2WZSA 3TGZA 4WBRD 3A2XA 5ELGA 4EVMA 3HYPA 2JSYA 1F9MA 4ILFA 2O87A 5LD0A 4XTSA 5F06A 3L78A 1HYUA 4RUVA 4NPBA 5IMDA 5G30A 1JZDA 2DIZA 1A0FA 4ECCA 2WFCA 3CYNA 2LV3A 4KCAA 5ECPB 4X1UA 3CBUA 2OT3A 3M9JA 5DQSA 3H93A 4DVCA 1ZYEA 2QA2A 2H6ZA 3LSZA 5IIZA 3MDKA 1IYIA 2E2MA 2OACA 2VM2A 3MNGA 4JR6A 4Q5FA 1SK1A 4LMWA 4JRRA 9GSSA 3F6FA 2L4QA 1B4PA 3WYWA 2B7KA 2HE3A 2LQOA 1RW1A 3S9FA 2KOKA 1EP7A 2ON7A 4PI0C 3EC3A 1F6MC 2GGTA 3O3TA 4P3YB 1EV4A 3LWAA 1H75A 2CX3A 3BOAA 2VL3A 1R5AA 1AUCA 2VLVA 3IOSA 2HRKA 3GTUB 2L6CA 2CT6A 2MMZA 4IQ1A 1Y25A 1V98A 4ZBBA 1O81A 5D9WA 4EO3A 2V6KA 1TXXA 2H72A 2EIQA 4A5PA 3TRPA 2F9SA 4G0LA 4JZQA 5LCZA 6GSYA 1DE2A 2OE0A 1E2YA 5JCUA 1WE0A 5IMAA 1XVWA 4KNDA 1EZKA 2LS5A 1WPIA 4MABA 3KTBA 2X4AA 2FY6A 2GTUA 1Y1UA 1K0NA 3I43A 1SL2B 2N5BA 5B6MA 4KGIA 4XS4A 2H01A 5H5RA 2CVDA 5IOXA 5GSSA 5GAND 2O5VA 2X8CA 3O6TA 5IPHA 6GSWA 1TI1A 4GTUA 2AB6A 2VAFA 2ON5A 3TU3B 3EWLA 1OE7A 5G31A 3GURA 2VCQA 1MEKA 1XWAA 4Q5NA 3DKSA 3VWWA 5FT3A 1M3JA 4ZB6A 3D4MA 5CRHA 4CDOA 4MJBA 5D96A 2K9FA 3TKSC 4LLRA 2GT6A 4DEJA 2OADA 4L5LA 3G7JA 5H5QA 1EGOA 1NW2A 4BWQA 4K5SA 1K3LA 4ACSA 1WOUA 1G7EA 1ABAA 2B1KA 11GSA 2DKIA 5JCWA 5BRTA 2J23A 5G1KA 4HJMA 1Z9HA 5D73A 1PN9A 3FR3A 2GZYA 5INYA 3WD6A 1I5GA 1SENA 4MLYA 5DQYA 5EL8A 4GCIA 1W4VA 3GYKA 4BVYA 2CA8A 1QXHA 2GZZA 2WVZA 1TTZA 3SBCA 3IAM2 3US3A 1XG8A 1OE8A 3VI5A 1X5CA 1UVZA 1VGLA
chains in the Genus database with same CATH topology
1M99A 2HRKB 1X9MB 2GVPA 1S3DA 3WT1A 2IMKA 3MAKA 1OKDA 3KH7A 2CV4A 5JWOB 1K0BA 3C1SA 2AHEA 4ECBA 13GSA 2VUPA 5KN1A 1N8JA 2P5QA 4OCFA 1V40A 5D9VA 4K8MA 1X9WB 1G6YA 4NHWA 1USBA 1SJ6A 1ERUA 3E9JB 4OO4A 5KOWA 3KTLA 1NM3A 1YKCA 4XS4B 4TR1B 2DSAA 3J7Yk 3BBYA 3TKSE 1Q4JA 2DC5A 3LYPA 4ZL9A 1EOGA 2H0GA 4EIQA 5J40A 2V2GA 1GSDA 3G7YA 2GSSA 2AJQB 3GL3A 4I5QA 4PUFC 1QQ2A 5EVOA 3TJBA 5D9TA 3PH9A 2P31A 2VKZG 4WR5A 5IOWA 1XW6A 3A2WA 3TKPA 1QFNA 2OBIA 4H86A 2X99A 4EXJA 4NHZA 5JCGA 2JADA 5HR2A 1M9BA 1PMTA 4EF0A 2OJLA 3IK7A 5JWRB 3RHCA 3MSZA 1FHEA 2CAQA 3RPPA 3FY7A 4Z2TA 3TOTA 5KN3A 4K2DA 2A2PA 3TB2A 4K0GA 4J56E 3F3QA 1URMA 2P5RA 1U3AA 4E8EA 4YQVA 1TRSA 2O7KA 2YWNA 3BCKA 1TRUA 2EFEA 1ERWA 3Q6OA 3QFAC 4IELA 1YEXA 1LBKA 2CX4A 3GMFA 2F8AA 4GRFA 5DCHA 4K7NA 4N0ZA 4BVYB 3HCZA 5ECNB 2H74A 2YV7A 2VLTA 3K8NA 5E4WA 1XZOA 3ZVJA 4G01A 4NAXA 4HUAA 1T8EB 3RBTA 1XVQA 1ZZYA 1GTIA 4YAPA 4OFMA 3VPQA 2JZTA 5DJMA 2YV9A 4HDEA 1RQMA 1U6TA 1J08A 1YZXA 2KP2A 3Q74A 1GSYA 4HU7A 4KH7A 5FHIA 3P7XA 5A4VA 4L0WA 4ZILA 3APOA 1XBSA 1CQHA 3FR6A 2IMEA 4RQXA 5J4VA 3DVWA 2I3YA 5CYYA 5ECRB 1GP1A 2HFDA 5F0GA 4BVXB 1XXUA 4MZWA 1U3IA 3WGXA 5CREA 4MJAA 4I97A 5A34A 2XHFA 3HJMA 3F4RA 2R4VA 1ZOFA 1AC1A 2OKAA 3DD3A 4AF2A 2IJYA 3UARA 1FW1A 4I8BA 4G19A 4LMVA 3UVHA 2HYXA 3HA9A 2H6XA 1UN2A 3KMOA 2UZ8A 3UOMA 2MMAA 3CMIA 3GH9A 4MMMA 2O85A 3ZFLA 4G9HA 4ECIA 3RPNA 3CRUA 3C8EA 2H75A 3KEBA 3GSSA 2QA1A 2I4AA 4GWRA 3ZZXA 4MH3A 4F9ZA 1PSQA 3F4SA 4CY8A 4HQSA 5ECMB 3EVIA 4K6XA 3LW9A 1T00A 2PWJA 1AQWA 1XWKA 3TUEA 4QMKA 4AGSA 1K3YA 4K2XA 1YDKA 4MPFA 3H79A 4TN8A 3CSHA 3G9BA 5B8AA 8GSSA 2FA4A 2QSIA 4J2FA 3D22A 3GUSA 1E6BA 2HSHA 4KDUA 2XBQA 2K6VA 4PXOA 3GSTA 1LJRA 1FB0A 1BF5A 2DJ0A 4K9ZA 1A24A 2OBKA 3GKKA 4EDZA 2XC2A 2EC4A 3ME8A 4X0XA 3WGDA 2WJUA 4TRXA 3WGEA 2PERA 1SKSB 3VWXA 4BPYA 2LSTA 3D5JA 2X8GA 1K3OA 3BD2A 1TP9A 3TJKA 3QDNA 4X43A 4PNGA 1K0DA 3ZMKA 1ST9A 1VF1A 2BMXA 3ERWA 2JZRA 5B6NA 1CQGA 2VM1A 5AIXA 5DALA 5AN1A 4ZB8A 2HSMA 3ZIVA 12GSA 5GAPD 1UA5A 5IO0A 5B8BA 4ZBDA 4KW6A 5ID2A 1S3CA 4J57E 4BL7B 3APSA 2PPTA 4HQZA 2AUVA 2YZUA 3LFLA 3GX8A 3HHVA 2C0DA 2F51A 2H76A 4HZ4A 1T1VA 3NIVA 4KF9A 1GNWA 4GSTA 2IMDA 3F0IA 3HDCA 1SYXA 2LKUA 5J9BA 3IDVA 1B48A 5DJLA 3P90A 3A3TA 4PUAA 1X5DA 1GULA 4GSNA 3N9JA 1GUMA 4GSSA 4Q5QA 2IL3A 2VL9A 3C7MA 3MWHA 1FOHA 3P8WA 4TR4A 1OC8A 2X8HA 3F4TA 2X64A 3FW2A 4MF7A 2NBSA 1Z3EA 1R5PA 1BQ7A 2IMFA 5HR0A 3KD0A 1IYHA 2UV8G 3CRTA 3DEXA 5ENUA 4F2IA 4IP1A 4KB3A 1M2BA 2B1LA 5IO2A 4K7IA 4POMA 3GNJA 1A2JA 6GSSA 3D0ZA 3QR6A 4ZB9A 2R0PA 1THOA 2AV4A 2IFQA 4HS1A 3I9V2 4KUNA 3IPZA 4V1Ap 2KUCA 2V32A 5C00A 2DMMA 2H1LA 3I6AA 5FWGA 1A23A 1ERTA 3VLNA 1YKAA 1ON4A 1A8YA 4WF5A 3KH9A 1TK5B 1AW9A 3DIEA 1JZOA 2VOCA 2WB9A 1KTEA 1EWXA 1DUGA 2H1AA 1XOBA 5J3RA 1ZYQB 1X5EA 5DALB 3UIWA 2HSMB 1JZRA 3UBKA 1QGVA 1N25A 1A0RP 2J9HA 2VD1A 3DVXA 5ID2B 3LEFA 1O85A 2HI7A 4TR1A 1O7UA 4MP4A 3EURA 4N10A 3RDWA 1AIUA 1SVOA 3FRCA 3LJRA 2VL2A 2HZEA 1FVJA 1FVKA 2HT9A 3O76A 5F05A 1M2AA 3GA4A 1EOHA 1WMJA 2GSRA 2IWTA 2NPBA 4N0VA 3W6GA 1GSUA 3FZ4A 2F3MA 1Z5YE 4IW9A 2CAIA 2LRNA 1YY7A 2YZHA 2GQMA 3VPTA 1Z6NA 3VWUA 3CSJA 2GSTA 3ZMLA 2NDOA 4OFTA 2WCIA 3QD9A 2N5AA 1GSFA 4YAVA 16GSA 4ZBAA 4LA1A 2HRAA 2WZ9A 3UL3A 2EFCA 1Z7PA 2KP1A 2GZPA 4GDFA 1XWCA 4EUYA 2IFQB 1BYEA 5CRWA 2EFDA 2DJKA 4MK3A 4O92A 4DSQA 4G0IA 5IMVA 1GSQA 5J5NA 2C80A 1K0OA 5IPGA 5G5FA 2VD0A 1WP0A 2VO4A 2YCDA 3ERFA 1NHYA 2YWMA 2HSNB 4XCSA 2R5GA 4AJ7A 5A5HA 2FWFA 3KMNA 1T4YA 4XIHA 3HMJG 4TR3A 2M46A 3LGCA 1V58A 4MJCA 3FHKA 2FWGA 3A2VA 5KEJA 2RUFA 4YQUA 2C8UA 1PKZA 3FYGA 1GUHA 2H1BA 2DJJA 5CNWA 4RI7A 4POKA 2L59A 1TU7A 1H4OA 2JZSA 4FQUA 4ISDA 4RI6A 4BVXA 5F07A 3MYDA 3QCPA 3GN3A 1Z6MA 2GQLA 4IKHA 1KEBA 4L5OA 3IBHA 2HXKA 2VCTA 2JSZA 1B9YC 3VWVA 3FZ9A 1GNEA 2K18A 2VIMA 2EIOA 3VK9A 4OCEA 2HZEB 4POLA 2WS2A 3EINA 3H4KA 1WRYA 1V57A 4GXZA 5ECQB 1EP8A 2LJKA 1WJKA 2NVLA 3GFKA 3WT2A 2KHPA 3TJFA 4CW9A 5KN2A 3HJPA 3ZYWA 2R6KA 3OR5A 1JHBA 1M7TA 4PQHA 3M1GA 5J9CA 1JFUA 4ZL7A 4AJ8A 1MTCA 2C3NA 1N2AA 1ACVA 2HNLA 1QK8A 2HRNA 3TRQA 4ZB7A 2MZCA 3IHQA 1JZWA 2G0FA 3TKQA 1NHOA 2CQ9A 5COHA 4MA9A 2ZNMA 3U5RE 1F2EA 1PN0A 2YOIA 3QOUA 3QMXA 4LL4B 4AKIA 5IMZA 3APQA 4FYBA 4JE1A 2B6MA 5DVBA 1GTBA 4HZ2A 3F6DA 3ZL5A 2L5LA 1SJIA 4JEDA 3KZQA 2FHEA 2C0EA 5B7CA 2PVQA 2REMA 2MMOA 5A5HB 3UJ1A 1A2MA 3KIJA 1Z7RA 1O8WA 2C3QA 4O5UA 5ECHB 1HNCA 2C4JA 1V9WA 1WIKA 2FA8A 5F8BA 2GS3A 4USSA 2I1UA 2H71A 4YQMA 2WRTA 3DRNA 6GSTA 3PINA 5A1NB 4WETA 5G1LA 3W8JA 3VFIA 2H1GA 3HKRA 2HZFA 5D8IA 4TKYA 1M2DA 1SKWB 6GSXA 3LYKA 5A4UA 3KCMA 1FG4A 4D73B 1AAZA 4MZBA 2VCZA 3EMPA 2R37A 5ECSA 1PL1A 3LXTA 3F8UA 1PKWA 2QC7A 2YN1A 1SYRA 1JLWA 1PRXA 4BL7A 3CXGA 1TRVA 2YJ7A 3NZNA 2YWOA 3GHAA 3ERGA 4YKGA 5GSTA 2PUKC 4MCUA 4IVFA 4EDYA 4K0NA 3RAZA 4KDYA 3DWVA 4DSRA 1AQVA 3LORA 1PGTA 4N30A 1PA3A 3CSIA 4DSSA 1TK0B 2C1YA 2FWHA 2CVBA 4NXIA 1MDJA 1X0RA 2YNXA 1ZGNA 1QUWA 5IM9A 1QMVA 3UEMA 17GSA 3TJGA 4ML1A 4OD7A 4Q5RA 2H73A 4O5RA 5G5EA 4RQRA 4I2TA 4KX4A 5AGYA 1GL8A 4PX1A 3NOFA 1VRSD 4G0KA 2YWIA 4L0UA 7GSSA 3KP9A 1XWGA 3R3EA 1K0MA 4PNFA 2FNOA 4F0CA 3GKMA 4GF0A 3EYTA 3PGTA 1EGRA 2V41A 5DBQA 1MDKA 1SU9A 2OE1A 2FWEA 3TCOA 2YPMA 1T3BA 1HNBA 3DMLA 2RLIA 4N11A 2DKHA 1X9SB 1T7PB 4XRDA 4Z7XA 2LRTA 2H19A 2XBIA 2IN3A 2A4HA 5A4WA 3HJOA 1KNGA 3R2QA 4L8EA 5AIVA 3QAVA 2PMTA 4XRAA 1FO5A 3QAGA 4N3ZA 1R26A 1ERVA 2O8VB 4E8HA 4PQIA 2AYTA 3TDGA 3FKFA 3KM6A 2DLXA 5HFKA 3D21A 2LTKA 2DJ1A 2E7PA 4V2MA 1TKDB 1GRXA 6GSUA 3TKRA 2FCHA 3DXBA 2B5EA 2C3TA 4TXVA 2HLSA 2IMIA 1XCCA 3F3RA 3CTFA 3UMAA 2ES7A 4HJ2A 2B7JA 1XOAA 5J41A 3C71A 5IQYA 1SD9A 4ULXA 2LJAA 3E3EA 2VL2C 4O32A 2FD3A 1YQ1A 1PX7A 4GQFA 3KJYA 4DSSB 5HQPA 4W66A 3ZIJA 4F0BA 2GT5A 4ICYA 5CP1A 3KP8A 1XW5A 3LG6A 1OKTA 2N5FA 4Z2UA 3HY2A 2HQTA 1XW9A 3E0UA 2H70A 4IP6A 2JL4A 1J9BA 2R0GA 1R7HA 4JU5A 3Q19A 1YF0A 1GUKA 5EPFA 4EL1A 1OVNA 5ECIB 5IMFA 5BMUA 2MMNA 3PR8A 3QPMA 1FAAA 3GKXA 4NV5A 4FYUA 3KGKA 2H0HA 4WKWA 2DBCA 4HEA2 4HI7A 4ZIJA 1OAZA 4POBA 1F3AA 3L9VA 4QL7A 3GH6A 3FZ5A 3D6IA 4IQAA 5KOXA 4KA0A 2RIIA 3TRXA 2HSNA 2I9HA 2IIYA 2RM6A 3IC8A 4TR0A 5DDLA 3ZREA 4F03A 2B5XA 1NSWA 1ZCPA 4ID0A 3TOUA 2VCWA 4BWSA 4K5RA 3F63A 1BEDA 2V6OA 3CTGA 3ISOA 1TXUA 1A2LA 3H1NA 2ALBA 1OC9B 4EE0A 2JACA 1FOVA 1SK2A 2WULA 3IRAA 4WF4A 2A4VA 3EE2A 1OC3A 1WWJA 2I81A 2B3SA 1C72A 1YF1A 4JBBA 2PBJA 4LL1B 4WEYA 1MD3A 1GLPA 4AI6A 4O5QA 2H66A 4K7OA 4ZL8A 4EIPA 3UBLA 3UVTA 5H5SA 2D2ZA 10GSA 1SK0A 3KXOA 1U87A 4ZXGA 2FGXA 1ILOA 3MIXA 4ML6A 1EV9A 3HVXA 2ZCTA 2L6DA 4WR4A 4KCEA 4GQCA 4NMUA 2E2GA 2XPEA 3GV1A 2GLRA 2M72A 2YP6A 1O6JA 4NV2A 1BG5A 5CO3A 5ABRA 1BX9A 4O7HA 1KBNA 3L9SA 3AY8A 3A5IA 5BMUB 1TRWA 2QGVA 2PGTA 3JCML 2TRCP 1VF4A 3U6VA 1XIYA 1TI3A 3TJJA 2HSYA 3ZTLA 1XFLA 5CRGA 4MF6A 2H1DA 4EKZA 3QFBC 3ED3A 1GTUA 4IJIA 2C0GA 3GRXA 4E68A 2H6YA 2PU9C 6GSVA 4I2UA 5HR1A 3BCIA 4MJEA 4FO5A 1PL2A 2BTOT 2LNTA 1XPVA 1W89A 22GSA 3EMXA 4QL9A 1GH2A 1UC7A 3Q18A 1HD2A 4X4JA 4PQ1A 1DE1A 3UAPA 5A1NA 3DYRA 1Q98A 3IR4A 1EEJA 1XWBA 3EPTA 1V2AA 4IJ3A 2BJXA 3GIXA 3M8NA 4HU9A 4TXOA 4IGJA 2WGRA 1VF2A 1G6WA 2MBTA 3BJ5A 4D73A 4FH8A 3FEUA 1TU8A 4QQ7A 2L5OA 3CWGA 2AAWA 4ECJA 4KE3A 2CZ3A 3FR9A 3H8QA 5CAXA 4XS6A 3ZITA 4YH2A 4TVEA 4V1Ag 5AISA 4MF5A 1YVLA 3EU4A 2F8FA 5ECLB 4V2LA 3QAWA 5DCGA 5D93A 1S3AA 2A2RA 1YEPA 1ZYNA 1SVLA 1G7OA 3C1RA 4KDXA 3TKSA 3GX0A 4AKXB 4OO5A 4MZCA 1ZL9A 3FK8A 2CZ2A 1GTAA 3IV4A 2PN8A 1AQXA 1TDIA 5EY6A 1THXA 4NWYA 1MDIA 3V1WA 2TRXA 1Y6EA 3N5OA 5DAKA 2CVKA 2V1MA 4AJ6A 2MYGA 4GLTA 2K8SA 4K1FA 2XPDA 3HZ8A 1F37A 1VF3A 2PVOC 1MD4A 1GSSA 1TW9A 1EEMA 2LUSA 2LEGA 5IMCA 5ECKB 2LQQA 2ZUPA 3ZFBA 4AKHA 1O8XA 2JU5A 3EU3A 5J4UA 1SL0B 2OE3A 1I9DA 1SJZA 3VI7A 4AKGA 5JWQB 2Z9SA 3W8SA 1LU4A 3GKNA 5D9XA 3DGQA 3VURA 1TOFA 5J4YA 2VCVA 2B5YA 3FMWA 5LNKe 2L4CA 1GLQA 2DJ3A 2R3XA 4KSMA 3HXSA 4IBPA 1DSBA 5C04A 2GDRA 1SL1B 4Z2RA 5J47A 2EFHA 3M0FA 3HVVA 1TK8B 2O89A 4MDCA 5CRDA 4FIWA 2DIYA 4TXOB 1T4ZA 4HOJA 4TOPA 2QKEA 1K0AA 3C73A 1YJ6A 2IPAA 2R2JA 3M9KA 2G2QA 3I69A 1M9AA 4OFNA 4FYCA 2YANA 5HFIA 1SVMA 4CY6A 3A5WA 3P2AA 4IHUA 1JLVA 4TW5A 1A8LA 2MBSA 2P0GA 2X49A 3LXZA 4V2NA 2L57A 3ME7A 4IN0A 3M3MA 1K0CA 2HRFA 1BAYA 5G2ZA 5KN0A 4JR4A 3HVSA 2RM5A 1BJXA 3IXRA 4XHMA 3L4NA 5ELAA 2DMLA 2LJRA 2FLSA 2DJ2A 4MNNA 4KSOA 1B8XA 2K8VA 2A2SA 4MPGA 2C0FA 4WBJA 1F3BA 1J0FA 1G0TA 3L9UA 1AXDA 1SD8A 2M80A 3IC4A 3ZVJD 3D4TA 3L0HA 2VLUA 5DAKB 2LRCA 4MH2A 3SWLA 2TIRA 3IAS2 5L71A 1O73A 3RHBA 1BG1A 2LNSA 3IA1A 1GSEA 1PD21 1FB6A 5HFGA 19GSA 2KLXA 3F9UA 20GSA 3GL5A 3IK9A 4BA7A 1TJDA 1GWCA 1ML6A 2H0IA 3ZLPA 3ZRDA 4EC0A 3J7Yb 2GQKA 1PX6A 1DBYA 14GSA 2NTOA 5E59A 5A5KA 1B4QA 2H30A 1B9XC 1U88A 4IS0A 4WXTA 1HNAA 3PPUA 1SKRB 2EIRA 3G7IA 5HR3A 4CHSA 2OA7A 1OYJA 4PGTA 4KAEA 1ZYPA 4I6XA 5ECOB 1R4WA 2VCXA 1PQNA 4G2EA 2RUEA 3LQ7A 4G10A 4OMVA 3GTUA 1HQOA 3IE3A 4PTSA 4OWYA 1ZMAA 3HD5A 2H8LA 2FUG2 2R0CA 5A34B 3FZAA 1RK4A 3HZ4A 1OC9A 2WDUA 4F82A 3IHGA 4PURA 2YJHA 2E0QA 5GZZB 1M0UA 18GSA 4YKFA 2GSQA 4XS1A 3TGZA 4WBRD 3A2XA 5ELGA 4EVMA 3HYPA 2JSYA 1F9MA 4ILFA 2O87A 5LD0A 4XTSA 5F06A 3L78A 1HYUA 4RUVA 4NPBA 5IMDA 5G30A 1JZDA 2DIZA 1A0FA 4ECCA 2WFCA 3CYNA 2LV3A 4KCAA 5ECPB 4X1UA 3CBUA 2OT3A 3M9JA 5DQSA 3H93A 4DVCA 1ZYEA 2QA2A 2H6ZA 3LSZA 5IIZA 3MDKA 1IYIA 2E2MA 2OACA 2VM2A 3MNGA 4JR6A 4Q5FA 1SK1A 4LMWA 4JRRA 9GSSA 3F6FA 2L4QA 1B4PA 3WYWA 2B7KA 2HE3A 2LQOA 1RW1A 3S9FA 2KOKA 1EP7A 2ON7A 3EC3A 1F6MC 2GGTA 3O3TA 4P3YB 1EV4A 3LWAA 1H75A 2CX3A 3BOAA 2VL3A 1R5AA 1AUCA 2VLVA 3IOSA 2HRKA 3GTUB 2L6CA 2CT6A 2MMZA 4IQ1A 1Y25A 1V98A 4ZBBA 1O81A 5D9WA 4EO3A 2V6KA 1TXXA 2H72A 2EIQA 4A5PA 3TRPA 2F9SA 4G0LA 4JZQA 5LCZA 6GSYA 1DE2A 2OE0A 1E2YA 5JCUA 1WE0A 5IMAA 1XVWA 4KNDA 1EZKA 2LS5A 1WPIA 4MABA 3KTBA 2X4AA 2FY6A 2GTUA 1Y1UA 1K0NA 3I43A 1SL2B 2N5BA 5B6MA 4KGIA 4XS4A 2H01A 5H5RA 2CVDA 5IOXA 5GSSA 5GAND 2O5VA 2X8CA 3O6TA 5IPHA 6GSWA 1TI1A 4GTUA 2AB6A 2VAFA 2ON5A 3TU3B 3EWLA 1OE7A 5G31A 3GURA 2VCQA 1MEKA 1XWAA 4Q5NA 3DKSA 3VWWA 5FT3A 4ZB6A 3D4MA 5CRHA 4CDOA 4MJBA 5D96A 2K9FA 3TKSC 4LLRA 2GT6A 4DEJA 2OADA 4L5LA 3G7JA 5H5QA 1EGOA 1NW2A 4BWQA 4K5SA 1K3LA 4ACSA 1WOUA 1G7EA 1ABAA 2B1KA 11GSA 2DKIA 5JCWA 5BRTA 2J23A 5G1KA 4HJMA 1Z9HA 5D73A 1PN9A 3FR3A 2GZYA 5INYA 3WD6A 1I5GA 1SENA 4MLYA 5DQYA 5EL8A 4GCIA 1W4VA 3GYKA 4BVYA 2CA8A 1QXHA 2GZZA 3SBCA 1TTZA 3IAM2 3US3A 1OE8A 3VI5A 1X5CA 1UVZA 1VGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M99 A;  2HRK B;  1X9M B;  2GVP A;  1S3D A;  3WT1 A;  2IMK A;  3MAK A;  1OKD A;  3KH7 A;  2CV4 A;  5JWO B;  1K0B A;  3C1S A;  2AHE A;  4ECB A;  13GS A;  2VUP A;  5KN1 A;  1N8J A;  2P5Q A;  4OCF A;  1V40 A;  5D9V A;  4K8M A;  1X9W B;  1G6Y A;  4NHW A;  1USB A;  1SJ6 A;  1ERU A;  3E9J B;  4OO4 A;  3KTL A;  1NM3 A;  1YKC A;  4XS4 B;  4TR1 B;  2DSA A;  3J7Y k;  3BBY A;  3TKS E;  1Q4J A;  2DC5 A;  3LYP A;  4ZL9 A;  1EOG A;  2H0G A;  2V2G A;  1GSD A;  3G7Y A;  2GSS A;  2AJQ B;  3GL3 A;  4I5Q A;  4PUF C;  1QQ2 A;  5EVO A;  3TJB A;  5D9T A;  3PH9 A;  2P31 A;  4WR5 A;  5IOW A;  1XW6 A;  3A2W A;  3TKP A;  1QFN A;  2OBI A;  4H86 A;  2X99 A;  4EXJ A;  4NHZ A;  5JCG A;  2JAD A;  5HR2 A;  1M9B A;  1PMT A;  4EF0 A;  2OJL A;  3IK7 A;  5JWR B;  3RHC A;  3MSZ A;  1FHE A;  2CAQ A;  3RPP A;  3FY7 A;  3TOT A;  5KN3 A;  4K2D A;  3TB2 A;  4K0G A;  4J56 E;  3F3Q A;  1URM A;  2P5R A;  1U3A A;  4E8E A;  4YQV A;  1TRS A;  2O7K A;  2YWN A;  3BCK A;  1TRU A;  1ERW A;  3Q6O A;  3QFA C;  4IEL A;  1YEX A;  1LBK A;  2CX4 A;  3GMF A;  2F8A A;  4GRF A;  5DCH A;  4K7N A;  4N0Z A;  4BVY B;  3HCZ A;  5ECN B;  2H74 A;  2YV7 A;  2VLT A;  3K8N A;  5E4W A;  1XZO A;  3ZVJ A;  4NAX A;  4HUA A;  1T8E B;  3RBT A;  1XVQ A;  1ZZY A;  1GTI A;  4YAP A;  4OFM A;  3VPQ A;  2JZT A;  5DJM A;  2YV9 A;  4HDE A;  1RQM A;  1U6T A;  1J08 A;  1YZX A;  2KP2 A;  3Q74 A;  1GSY A;  4HU7 A;  4KH7 A;  5FHI A;  3P7X A;  5A4V A;  4L0W A;  4ZIL A;  3APO A;  1XBS A;  1CQH A;  3FR6 A;  2IME A;  4RQX A;  3DVW A;  2I3Y A;  5CYY A;  5ECR B;  1GP1 A;  2HFD A;  5F0G A;  4BVX B;  1XXU A;  4MZW A;  1U3I A;  3WGX A;  5CRE A;  4MJA A;  4I97 A;  2XHF A;  3HJM A;  3F4R A;  2R4V A;  1ZOF A;  1AC1 A;  2OKA A;  3DD3 A;  4AF2 A;  2IJY A;  3UAR A;  1FW1 A;  4I8B A;  4G19 A;  4LMV A;  3UVH A;  2HYX A;  3HA9 A;  2H6X A;  1UN2 A;  3KMO A;  2UZ8 A;  3UOM A;  2MMA A;  3CMI A;  3GH9 A;  4MMM A;  2O85 A;  3ZFL A;  4G9H A;  4ECI A;  3RPN A;  3CRU A;  3C8E A;  2H75 A;  3KEB A;  3GSS A;  2I4A A;  4GWR A;  3ZZX A;  4MH3 A;  4F9Z A;  1PSQ A;  3F4S A;  4HQS A;  5ECM B;  3EVI A;  4K6X A;  1T00 A;  2PWJ A;  1AQW A;  1XWK A;  3TUE A;  4AGS A;  1K3Y A;  1YDK A;  4MPF A;  3H79 A;  4TN8 A;  3CSH A;  3G9B A;  5B8A A;  8GSS A;  2FA4 A;  2QSI A;  4J2F A;  3D22 A;  3GUS A;  1E6B A;  2HSH A;  4KDU A;  2XBQ A;  2K6V A;  4PXO A;  3GST A;  1LJR A;  1FB0 A;  2DJ0 A;  4K9Z A;  1A24 A;  2OBK A;  3GKK A;  4EDZ A;  2XC2 A;  2EC4 A;  3ME8 A;  4X0X A;  3WGD A;  2WJU A;  4TRX A;  3WGE A;  2PER A;  1SKS B;  3VWX A;  4BPY A;  2LST A;  3D5J A;  2X8G A;  1K3O A;  3BD2 A;  1TP9 A;  3TJK A;  3QDN A;  4X43 A;  4PNG A;  1K0D A;  3ZMK A;  1ST9 A;  1VF1 A;  2BMX A;  3ERW A;  2JZR A;  5B6N A;  1CQG A;  2VM1 A;  5AIX A;  5DAL A;  5AN1 A;  4ZB8 A;  2HSM A;  3ZIV A;  12GS A;  5GAP D;  1UA5 A;  5IO0 A;  5B8B A;  4ZBD A;  4KW6 A;  5ID2 A;  1S3C A;  4J57 E;  4BL7 B;  3APS A;  2PPT A;  4HQZ A;  2AUV A;  2YZU A;  3LFL A;  3GX8 A;  3HHV A;  2C0D A;  2F51 A;  2H76 A;  4HZ4 A;  1T1V A;  3NIV A;  4KF9 A;  1GNW A;  4GST A;  2IMD A;  3F0I A;  3HDC A;  1SYX A;  2LKU A;  5J9B A;  3IDV A;  1B48 A;  5DJL A;  3P90 A;  3A3T A;  4PUA A;  1X5D A;  1GUL A;  4GSN A;  3N9J A;  1GUM A;  4GSS A;  4Q5Q A;  2IL3 A;  2VL9 A;  3C7M A;  3MWH A;  3P8W A;  4TR4 A;  1OC8 A;  2X8H A;  3F4T A;  2X64 A;  3FW2 A;  4MF7 A;  2NBS A;  1Z3E A;  1R5P A;  1BQ7 A;  2IMF A;  5HR0 A;  3KD0 A;  1IYH A;  3CRT A;  3DEX A;  5ENU A;  4F2I A;  4IP1 A;  4KB3 A;  1M2B A;  2B1L A;  5IO2 A;  4K7I A;  4POM A;  3GNJ A;  1A2J A;  6GSS A;  3D0Z A;  3QR6 A;  4ZB9 A;  1THO A;  2AV4 A;  2IFQ A;  4HS1 A;  3I9V 2;  4KUN A;  3IPZ A;  4V1A p;  2KUC A;  2V32 A;  5C00 A;  2DMM A;  3I6A A;  5FWG A;  1A23 A;  1ERT A;  3VLN A;  1YKA A;  1ON4 A;  1A8Y A;  4WF5 A;  3KH9 A;  1TK5 B;  1AW9 A;  3DIE A;  1JZO A;  2VOC A;  2WB9 A;  1KTE A;  1EWX A;  1DUG A;  2H1A A;  1XOB A;  5J3R A;  1ZYQ B;  1X5E A;  5DAL B;  3UIW A;  2HSM B;  1JZR A;  3UBK A;  1QGV A;  1A0R P;  2J9H A;  2VD1 A;  3DVX A;  5ID2 B;  3LEF A;  1O85 A;  2HI7 A;  4TR1 A;  1O7U A;  4MP4 A;  3EUR A;  4N10 A;  3RDW A;  1AIU A;  3FRC A;  3LJR A;  2VL2 A;  2HZE A;  1FVJ A;  1FVK A;  2HT9 A;  3O76 A;  5F05 A;  1M2A A;  3GA4 A;  1EOH A;  1WMJ A;  2GSR A;  2IWT A;  2NPB A;  4N0V A;  3W6G A;  1GSU A;  3FZ4 A;  2F3M A;  1Z5Y E;  4IW9 A;  2CAI A;  2LRN A;  1YY7 A;  2YZH A;  2GQM A;  3VPT A;  1Z6N A;  3VWU A;  3CSJ A;  2GST A;  3ZML A;  2NDO A;  4OFT A;  2WCI A;  3QD9 A;  2N5A A;  1GSF A;  4YAV A;  16GS A;  4ZBA A;  4LA1 A;  2HRA A;  2WZ9 A;  3UL3 A;  1Z7P A;  2KP1 A;  2GZP A;  1XWC A;  4EUY A;  2IFQ B;  1BYE A;  5CRW A;  2DJK A;  4MK3 A;  4O92 A;  4DSQ A;  4G0I A;  5IMV A;  1GSQ A;  5J5N A;  2C80 A;  1K0O A;  5IPG A;  5G5F A;  2VD0 A;  1WP0 A;  2VO4 A;  2YCD A;  3ERF A;  1NHY A;  2YWM A;  2HSN B;  4XCS A;  2R5G A;  4AJ7 A;  2FWF A;  3KMN A;  1T4Y A;  4XIH A;  4TR3 A;  2M46 A;  3LGC A;  1V58 A;  4MJC A;  3FHK A;  2FWG A;  3A2V A;  5KEJ A;  2RUF A;  4YQU A;  2C8U A;  1PKZ A;  3FYG A;  1GUH A;  2H1B A;  2DJJ A;  5CNW A;  4RI7 A;  4POK A;  2L59 A;  1TU7 A;  1H4O A;  2JZS A;  4FQU A;  4ISD A;  4RI6 A;  4BVX A;  5F07 A;  3QCP A;  3GN3 A;  1Z6M A;  2GQL A;  4IKH A;  1KEB A;  4L5O A;  3IBH A;  2HXK A;  2VCT A;  2JSZ A;  1B9Y C;  3VWV A;  3FZ9 A;  1GNE A;  2K18 A;  2VIM A;  2EIO A;  3VK9 A;  4OCE A;  2HZE B;  4POL A;  2WS2 A;  3EIN A;  3H4K A;  1WRY A;  1V57 A;  4GXZ A;  5ECQ B;  1EP8 A;  2LJK A;  1WJK A;  2NVL A;  3GFK A;  3WT2 A;  2KHP A;  3TJF A;  4CW9 A;  5KN2 A;  3HJP A;  3ZYW A;  2R6K A;  3OR5 A;  1JHB A;  1M7T A;  4PQH A;  3M1G A;  5J9C A;  1JFU A;  4ZL7 A;  4AJ8 A;  1MTC A;  2C3N A;  1N2A A;  1ACV A;  2HNL A;  1QK8 A;  2HRN A;  3TRQ A;  2MZC A;  3IHQ A;  1JZW A;  2G0F A;  3TKQ A;  1NHO A;  2CQ9 A;  5COH A;  4MA9 A;  2ZNM A;  3U5R E;  1F2E A;  2YOI A;  3QOU A;  3QMX A;  4LL4 B;  5IMZ A;  3APQ A;  4FYB A;  4JE1 A;  2B6M A;  5DVB A;  1GTB A;  4HZ2 A;  3F6D A;  3ZL5 A;  2L5L A;  1SJI A;  4JED A;  3KZQ A;  2FHE A;  2C0E A;  5B7C A;  2PVQ A;  2REM A;  2MMO A;  3UJ1 A;  1A2M A;  3KIJ A;  1Z7R A;  1O8W A;  2C3Q A;  5ECH B;  1HNC A;  2C4J A;  1V9W A;  1WIK A;  2FA8 A;  5F8B A;  2GS3 A;  4USS A;  2I1U A;  2H71 A;  4YQM A;  2WRT A;  3DRN A;  6GST A;  3PIN A;  4WET A;  5G1L A;  3W8J A;  3VFI A;  2H1G A;  3HKR A;  2HZF A;  5D8I A;  4TKY A;  1M2D A;  1SKW B;  6GSX A;  3LYK A;  5A4U A;  3KCM A;  1FG4 A;  4D73 B;  1AAZ A;  4MZB A;  2VCZ A;  3EMP A;  2R37 A;  5ECS A;  1PL1 A;  3LXT A;  3F8U A;  1PKW A;  2QC7 A;  2YN1 A;  1SYR A;  1JLW A;  1PRX A;  4BL7 A;  3CXG A;  1TRV A;  2YJ7 A;  3NZN A;  2YWO A;  3GHA A;  3ERG A;  5GST A;  2PUK C;  4MCU A;  4IVF A;  4EDY A;  4K0N A;  3RAZ A;  4KDY A;  3DWV A;  4DSR A;  1AQV A;  3LOR A;  1PGT A;  4N30 A;  1PA3 A;  3CSI A;  4DSS A;  1TK0 B;  2C1Y A;  2FWH A;  2CVB A;  4NXI A;  1MDJ A;  1X0R A;  2YNX A;  1ZGN A;  1QUW A;  5IM9 A;  1QMV A;  3UEM A;  17GS A;  3TJG A;  4ML1 A;  4OD7 A;  4Q5R A;  2H73 A;  4O5R A;  5G5E A;  4RQR A;  4I2T A;  4KX4 A;  5AGY A;  1GL8 A;  4PX1 A;  3NOF A;  1VRS D;  4G0K A;  2YWI A;  4L0U A;  7GSS A;  3KP9 A;  1XWG A;  3R3E A;  1K0M A;  4PNF A;  2FNO A;  4F0C A;  3GKM A;  4GF0 A;  3EYT A;  3PGT A;  1EGR A;  2V41 A;  5DBQ A;  1MDK A;  1SU9 A;  2OE1 A;  2FWE A;  3TCO A;  2YPM A;  1T3B A;  1HNB A;  3DML A;  2RLI A;  4N11 A;  1X9S B;  1T7P B;  4XRD A;  4Z7X A;  2LRT A;  2H19 A;  2XBI A;  2IN3 A;  5A4W A;  3HJO A;  1KNG A;  3R2Q A;  4L8E A;  5AIV A;  3QAV A;  2PMT A;  4XRA A;  1FO5 A;  3QAG A;  1R26 A;  1ERV A;  2O8V B;  4E8H A;  4PQI A;  2AYT A;  3TDG A;  3FKF A;  3KM6 A;  2DLX A;  5HFK A;  3D21 A;  2LTK A;  2DJ1 A;  2E7P A;  4V2M A;  1TKD B;  1GRX A;  6GSU A;  3TKR A;  2FCH A;  3DXB A;  2B5E A;  2C3T A;  4TXV A;  2HLS A;  2IMI A;  1XCC A;  3F3R A;  3CTF A;  3UMA A;  2ES7 A;  4HJ2 A;  2B7J A;  1XOA A;  5J41 A;  3C71 A;  5IQY A;  1SD9 A;  4ULX A;  2LJA A;  3E3E A;  2VL2 C;  4O32 A;  2FD3 A;  1YQ1 A;  1PX7 A;  4GQF A;  3KJY A;  4DSS B;  5HQP A;  3ZIJ A;  4F0B A;  2GT5 A;  5CP1 A;  3KP8 A;  1XW5 A;  3LG6 A;  1OKT A;  2N5F A;  3HY2 A;  2HQT A;  1XW9 A;  3E0U A;  2H70 A;  4IP6 A;  2JL4 A;  1J9B A;  1R7H A;  4JU5 A;  3Q19 A;  1YF0 A;  1GUK A;  5EPF A;  4EL1 A;  1OVN A;  5ECI B;  5IMF A;  5BMU A;  2MMN A;  3PR8 A;  3QPM A;  1FAA A;  3GKX A;  4NV5 A;  4FYU A;  3KGK A;  2H0H A;  4WKW A;  2DBC A;  4HEA 2;  4HI7 A;  4ZIJ A;  1OAZ A;  4POB A;  1F3A A;  3L9V A;  4QL7 A;  3GH6 A;  3FZ5 A;  3D6I A;  4IQA A;  4KA0 A;  2RII A;  3TRX A;  2I9H A;  2IIY A;  2RM6 A;  3IC8 A;  4TR0 A;  5DDL A;  3ZRE A;  4F03 A;  2B5X A;  1NSW A;  1ZCP A;  4ID0 A;  3TOU A;  2VCW A;  4BWS A;  3F63 A;  1BED A;  2V6O A;  3CTG A;  3ISO A;  1A2L A;  3H1N A;  2ALB A;  1OC9 B;  4EE0 A;  2JAC A;  1FOV A;  1SK2 A;  2WUL A;  3IRA A;  4WF4 A;  2A4V A;  3EE2 A;  1OC3 A;  1WWJ A;  2I81 A;  2B3S A;  1C72 A;  1YF1 A;  4JBB A;  2PBJ A;  4LL1 B;  4WEY A;  1MD3 A;  1GLP A;  2H66 A;  4K7O A;  4ZL8 A;  3UBL A;  3UVT A;  5H5S A;  2D2Z A;  10GS A;  1SK0 A;  3KXO A;  1U87 A;  4ZXG A;  2FGX A;  1ILO A;  4ML6 A;  1EV9 A;  3HVX A;  2ZCT A;  2L6D A;  4WR4 A;  4KCE A;  4GQC A;  4NMU A;  2E2G A;  2XPE A;  3GV1 A;  2GLR A;  2M72 A;  2YP6 A;  1O6J A;  4NV2 A;  1BG5 A;  5CO3 A;  5ABR A;  1BX9 A;  4O7H A;  1KBN A;  3L9S A;  3AY8 A;  1TRW A;  2QGV A;  2PGT A;  3JCM L;  2TRC P;  1VF4 A;  3U6V A;  1XIY A;  1TI3 A;  3TJJ A;  2HSY A;  3ZTL A;  1XFL A;  5CRG A;  4MF6 A;  2H1D A;  4EKZ A;  3QFB C;  3ED3 A;  1GTU A;  4IJI A;  2C0G A;  3GRX A;  2H6Y A;  2PU9 C;  6GSV A;  4I2U A;  5HR1 A;  3BCI A;  4MJE A;  4FO5 A;  1PL2 A;  2BTO T;  2LNT A;  1XPV A;  1W89 A;  22GS A;  3EMX A;  4QL9 A;  1GH2 A;  1UC7 A;  3Q18 A;  1HD2 A;  4PQ1 A;  1DE1 A;  3UAP A;  3DYR A;  1Q98 A;  3IR4 A;  1EEJ A;  1XWB A;  1V2A A;  4IJ3 A;  2BJX A;  3GIX A;  3M8N A;  4HU9 A;  4TXO A;  4IGJ A;  2WGR A;  1VF2 A;  1G6W A;  2MBT A;  3BJ5 A;  4D73 A;  4FH8 A;  3FEU A;  1TU8 A;  4QQ7 A;  2L5O A;  2AAW A;  4ECJ A;  4KE3 A;  2CZ3 A;  3FR9 A;  3H8Q A;  5CAX A;  4XS6 A;  3ZIT A;  4YH2 A;  4TVE A;  4V1A g;  5AIS A;  4MF5 A;  3EU4 A;  2F8F A;  5ECL B;  4V2L A;  3QAW A;  5DCG A;  5D93 A;  1S3A A;  2A2R A;  1YEP A;  1G7O A;  3C1R A;  4KDX A;  3TKS A;  3GX0 A;  4OO5 A;  4MZC A;  1ZL9 A;  3FK8 A;  2CZ2 A;  1GTA A;  3IV4 A;  2PN8 A;  1AQX A;  1TDI A;  5EY6 A;  1THX A;  4NWY A;  1MDI A;  3V1W A;  2TRX A;  1Y6E A;  3N5O A;  5DAK A;  2CVK A;  2V1M A;  4AJ6 A;  2MYG A;  4GLT A;  2K8S A;  4K1F A;  2XPD A;  3HZ8 A;  1F37 A;  1VF3 A;  2PVO C;  1MD4 A;  1GSS A;  1TW9 A;  1EEM A;  2LUS A;  2LEG A;  5IMC A;  5ECK B;  2LQQ A;  2ZUP A;  3ZFB A;  1O8X A;  2JU5 A;  3EU3 A;  5J4U A;  1SL0 B;  2OE3 A;  1I9D A;  1SJZ A;  3VI7 A;  5JWQ B;  2Z9S A;  3W8S A;  1LU4 A;  3GKN A;  5D9X A;  3DGQ A;  3VUR A;  1TOF A;  2VCV A;  2B5Y A;  5LNK e;  2L4C A;  1GLQ A;  2DJ3 A;  2R3X A;  4KSM A;  3HXS A;  4IBP A;  1DSB A;  5C04 A;  2GDR A;  1SL1 B;  3M0F A;  3HVV A;  1TK8 B;  2O89 A;  4MDC A;  5CRD A;  4FIW A;  2DIY A;  4TXO B;  1T4Z A;  4HOJ A;  4TOP A;  2QKE A;  1K0A A;  3C73 A;  1YJ6 A;  2IPA A;  2R2J A;  3M9K A;  2G2Q A;  3I69 A;  1M9A A;  4OFN A;  4FYC A;  2YAN A;  5HFI A;  3A5W A;  3P2A A;  4IHU A;  1JLV A;  4TW5 A;  1A8L A;  2MBS A;  2P0G A;  3LXZ A;  4V2N A;  2L57 A;  3ME7 A;  4IN0 A;  3M3M A;  1K0C A;  2HRF A;  1BAY A;  5G2Z A;  5KN0 A;  4JR4 A;  3HVS A;  2RM5 A;  1BJX A;  3IXR A;  4XHM A;  3L4N A;  5ELA A;  2DML A;  2LJR A;  2FLS A;  2DJ2 A;  4KSO A;  1B8X A;  2K8V A;  2A2S A;  4MPG A;  2C0F A;  4WBJ A;  1F3B A;  1J0F A;  1G0T A;  3L9U A;  1AXD A;  1SD8 A;  2M80 A;  3IC4 A;  3ZVJ D;  3D4T A;  3L0H A;  2VLU A;  5DAK B;  2LRC A;  4MH2 A;  3SWL A;  2TIR A;  3IAS 2;  5L71 A;  1O73 A;  3RHB A;  2LNS A;  3IA1 A;  1GSE A;  1PD2 1;  1FB6 A;  5HFG A;  19GS A;  2KLX A;  3F9U A;  20GS A;  3GL5 A;  3IK9 A;  4BA7 A;  1TJD A;  1GWC A;  1ML6 A;  2H0I A;  3ZLP A;  3ZRD A;  4EC0 A;  3J7Y b;  2GQK A;  1PX6 A;  1DBY A;  14GS A;  2NTO A;  5E59 A;  5A5K A;  1B4Q A;  2H30 A;  1B9X C;  1U88 A;  4IS0 A;  4WXT A;  1HNA A;  3PPU A;  1SKR B;  2EIR A;  3G7I A;  5HR3 A;  4CHS A;  2OA7 A;  1OYJ A;  4PGT A;  4KAE A;  4I6X A;  5ECO B;  1R4W A;  2VCX A;  1PQN A;  4G2E A;  2RUE A;  3LQ7 A;  4G10 A;  4OMV A;  3GTU A;  1HQO A;  3IE3 A;  4PTS A;  4OWY A;  1ZMA A;  3HD5 A;  2H8L A;  2FUG 2;  3FZA A;  1RK4 A;  3HZ4 A;  1OC9 A;  2WDU A;  4F82 A;  4PUR A;  2YJH A;  2E0Q A;  5GZZ B;  1M0U A;  18GS A;  2GSQ A;  4XS1 A;  3TGZ A;  4WBR D;  3A2X A;  5ELG A;  4EVM A;  3HYP A;  2JSY A;  1F9M A;  4ILF A;  2O87 A;  5LD0 A;  4XTS A;  5F06 A;  3L78 A;  1HYU A;  4RUV A;  4NPB A;  5IMD A;  5G30 A;  1JZD A;  2DIZ A;  1A0F A;  4ECC A;  2WFC A;  3CYN A;  2LV3 A;  4KCA A;  5ECP B;  4X1U A;  3CBU A;  3M9J A;  5DQS A;  3H93 A;  4DVC A;  1ZYE A;  2H6Z A;  3LSZ A;  5IIZ A;  3MDK A;  1IYI A;  2E2M A;  2OAC A;  2VM2 A;  3MNG A;  4JR6 A;  4Q5F A;  1SK1 A;  4LMW A;  4JRR A;  9GSS A;  3F6F A;  2L4Q A;  1B4P A;  3WYW A;  2B7K A;  2HE3 A;  2LQO A;  1RW1 A;  3S9F A;  2KOK A;  1EP7 A;  2ON7 A;  3EC3 A;  1F6M C;  2GGT A;  3O3T A;  4P3Y B;  1EV4 A;  3LWA A;  1H75 A;  2CX3 A;  3BOA A;  2VL3 A;  1R5A A;  1AUC A;  2VLV A;  3IOS A;  2HRK A;  3GTU B;  2L6C A;  2CT6 A;  2MMZ A;  4IQ1 A;  1Y25 A;  1V98 A;  4ZBB A;  1O81 A;  5D9W A;  4EO3 A;  2V6K A;  1TXX A;  2H72 A;  2EIQ A;  3TRP A;  2F9S A;  4G0L A;  4JZQ A;  5LCZ A;  6GSY A;  1DE2 A;  2OE0 A;  1E2Y A;  5JCU A;  1WE0 A;  5IMA A;  1XVW A;  4KND A;  1EZK A;  2LS5 A;  1WPI A;  4MAB A;  3KTB A;  2FY6 A;  2GTU A;  1K0N A;  3I43 A;  1SL2 B;  2N5B A;  5B6M A;  4KGI A;  4XS4 A;  2H01 A;  5H5R A;  2CVD A;  5IOX A;  5GSS A;  5GAN D;  2X8C A;  3O6T A;  5IPH A;  6GSW A;  1TI1 A;  4GTU A;  2AB6 A;  2VAF A;  2ON5 A;  3EWL A;  1OE7 A;  5G31 A;  3GUR A;  2VCQ A;  1MEK A;  1XWA A;  4Q5N A;  3DKS A;  3VWW A;  5FT3 A;  4ZB6 A;  3D4M A;  5CRH A;  4CDO A;  4MJB A;  5D96 A;  2K9F A;  3TKS C;  4LLR A;  2GT6 A;  4DEJ A;  2OAD A;  4L5L A;  3G7J A;  5H5Q A;  1EGO A;  1NW2 A;  4BWQ A;  1K3L A;  4ACS A;  1WOU A;  1G7E A;  1ABA A;  2B1K A;  11GS A;  5JCW A;  2J23 A;  5G1K A;  4HJM A;  1Z9H A;  5D73 A;  1PN9 A;  3FR3 A;  2GZY A;  5INY A;  3WD6 A;  1I5G A;  1SEN A;  4MLY A;  5DQY A;  5EL8 A;  4GCI A;  1W4V A;  3GYK A;  4BVY A;  2CA8 A;  1QXH A;  2GZZ A;  3SBC A;  1TTZ A;  3IAM 2;  3US3 A;  1OE8 A;  3VI5 A;  1X5C A;  1UVZ A;  1VGL A; 
#chains in the Genus database with same CATH topology
 1M99 A;  2HRK B;  1X9M B;  2GVP A;  1S3D A;  3WT1 A;  2IMK A;  3MAK A;  1OKD A;  3KH7 A;  2CV4 A;  5JWO B;  1K0B A;  3C1S A;  2AHE A;  4ECB A;  13GS A;  2VUP A;  5KN1 A;  1N8J A;  2P5Q A;  4OCF A;  1V40 A;  5D9V A;  4K8M A;  1X9W B;  1G6Y A;  4NHW A;  1USB A;  1SJ6 A;  1ERU A;  3E9J B;  4OO4 A;  5KOW A;  3KTL A;  1NM3 A;  1YKC A;  4XS4 B;  4BIK A;  4TR1 B;  2DSA A;  3J7Y k;  3BBY A;  3TKS E;  1Q4J A;  2DC5 A;  3LYP A;  4ZL9 A;  1EOG A;  2H0G A;  4EIQ A;  5J40 A;  2V2G A;  1GSD A;  3G7Y A;  2GSS A;  2WW1 A;  2AJQ B;  3GL3 A;  4I5Q A;  4PUF C;  1QQ2 A;  5EVO A;  3TJB A;  5D9T A;  3PH9 A;  2P31 A;  2VKZ G;  4WR5 A;  5IOW A;  1XW6 A;  3A2W A;  3TKP A;  1QFN A;  2OBI A;  4H86 A;  2X99 A;  4EXJ A;  4NHZ A;  5JCG A;  2JAD A;  5HR2 A;  1M9B A;  1PMT A;  4EF0 A;  2OJL A;  3IK7 A;  5JWR B;  3RHC A;  3MSZ A;  1FHE A;  2CAQ A;  2WVY A;  3RPP A;  3FY7 A;  4Z2T A;  3TOT A;  5KN3 A;  4K2D A;  2A2P A;  3TB2 A;  4K0G A;  4J56 E;  3F3Q A;  1URM A;  2P5R A;  1U3A A;  4E8E A;  4YQV A;  1TRS A;  2O7K A;  2YWN A;  3BCK A;  1TRU A;  2EFE A;  1ERW A;  3Q6O A;  3QFA C;  4IEL A;  1YEX A;  1LBK A;  2CX4 A;  3GMF A;  2F8A A;  4GRF A;  5DCH A;  4K7N A;  4N0Z A;  4BVY B;  3HCZ A;  5ECN B;  2H74 A;  2YV7 A;  2VLT A;  3K8N A;  5E4W A;  1XZO A;  3ZVJ A;  4G01 A;  4NAX A;  4HUA A;  1T8E B;  3RBT A;  1XVQ A;  1ZZY A;  1GTI A;  4YAP A;  4OFM A;  3VPQ A;  2JZT A;  5DJM A;  2YV9 A;  4HDE A;  1RQM A;  1U6T A;  1J08 A;  1YZX A;  2KP2 A;  3Q74 A;  1GSY A;  4HU7 A;  4KH7 A;  5FHI A;  3P7X A;  5A4V A;  4L0W A;  4ZIL A;  3APO A;  1XBS A;  1CQH A;  3FR6 A;  2IME A;  4RQX A;  5J4V A;  3DVW A;  2I3Y A;  5CYY A;  5ECR B;  1GP1 A;  2HFD A;  5F0G A;  4BVX B;  1XXU A;  4MZW A;  1U3I A;  3WGX A;  5CRE A;  4MJA A;  4I97 A;  5A34 A;  2XHF A;  3HJM A;  3F4R A;  2R4V A;  1ZOF A;  1AC1 A;  2OKA A;  3DD3 A;  4AF2 A;  2IJY A;  3UAR A;  1FW1 A;  4I8B A;  4G19 A;  4PHZ C;  4LMV A;  3UVH A;  2HYX A;  3HA9 A;  2H6X A;  1UN2 A;  3KMO A;  2UZ8 A;  3UOM A;  2MMA A;  3CMI A;  3GH9 A;  4MMM A;  2O85 A;  3ZFL A;  4G9H A;  4ECI A;  3RPN A;  3CRU A;  3C8E A;  2H75 A;  3KEB A;  3GSS A;  2QA1 A;  2I4A A;  4GWR A;  3ZZX A;  4MH3 A;  4F9Z A;  1PSQ A;  3F4S A;  2O36 A;  4CY8 A;  4HQS A;  5ECM B;  3EVI A;  4K6X A;  3LW9 A;  1T00 A;  2PWJ A;  1AQW A;  1XWK A;  3TUE A;  4QMK A;  4AGS A;  1K3Y A;  4K2X A;  1YDK A;  4MPF A;  2WW0 A;  3H79 A;  4TN8 A;  3CSH A;  3G9B A;  5B8A A;  8GSS A;  2FA4 A;  2QSI A;  4J2F A;  3D22 A;  3GUS A;  1E6B A;  2HSH A;  4KDU A;  2XBQ A;  2K6V A;  4PXO A;  3GST A;  1LJR A;  1FB0 A;  1BF5 A;  2DJ0 A;  4K9Z A;  1A24 A;  2OBK A;  3GKK A;  4EDZ A;  2XC2 A;  2EC4 A;  3ME8 A;  4X0X A;  3WGD A;  2WJU A;  4HSC X;  4TRX A;  3WGE A;  2PER A;  1SKS B;  3VWX A;  4BPY A;  2LST A;  3D5J A;  2X8G A;  1K3O A;  3BD2 A;  1TP9 A;  3TJK A;  3QDN A;  4X43 A;  4PNG A;  1K0D A;  3ZMK A;  1ST9 A;  1VF1 A;  2BMX A;  3ERW A;  2JZR A;  5B6N A;  1CQG A;  2VM1 A;  5AIX A;  5DAL A;  5AN1 A;  4ZB8 A;  2HSM A;  3ZIV A;  12GS A;  5GAP D;  1UA5 A;  5IO0 A;  5B8B A;  4ZBD A;  4KW6 A;  5ID2 A;  1S3C A;  4J57 E;  4BL7 B;  3APS A;  2PPT A;  4HQZ A;  2AUV A;  2YZU A;  1PFO A;  3LFL A;  3GX8 A;  3HHV A;  2C0D A;  2F51 A;  2H76 A;  4HZ4 A;  1T1V A;  3NIV A;  4KF9 A;  1GNW A;  4GST A;  2IMD A;  3F0I A;  3HDC A;  1SYX A;  2LKU A;  5J9B A;  3IDV A;  1B48 A;  5DJL A;  3P90 A;  3A3T A;  4PUA A;  1X5D A;  1GUL A;  4GSN A;  3N9J A;  1GUM A;  4GSS A;  4Q5Q A;  2IL3 A;  2VL9 A;  3C7M A;  1FOH A;  3MWH A;  3P8W A;  4TR4 A;  1OC8 A;  2X8H A;  3F4T A;  2X64 A;  3FW2 A;  4MF7 A;  2NBS A;  1Z3E A;  1R5P A;  1BQ7 A;  2IMF A;  5HR0 A;  3KD0 A;  1IYH A;  2UV8 G;  3CRT A;  3DEX A;  5ENU A;  4F2I A;  4IP1 A;  4KB3 A;  1M2B A;  2B1L A;  5IO2 A;  4K7I A;  4POM A;  3GNJ A;  1A2J A;  6GSS A;  3D0Z A;  2R0P A;  3QR6 A;  4ZB9 A;  1THO A;  2AV4 A;  2IFQ A;  4HS1 A;  3I9V 2;  4KUN A;  3IPZ A;  4V1A p;  2KUC A;  2V32 A;  5C00 A;  2DMM A;  2H1L A;  3I6A A;  5FWG A;  1A23 A;  1ERT A;  3VLN A;  1YKA A;  1ON4 A;  1A8Y A;  4WF5 A;  3KH9 A;  1TK5 B;  1AW9 A;  3DIE A;  1JZO A;  2VOC A;  2WB9 A;  1KTE A;  1EWX A;  1DUG A;  2H1A A;  1XOB A;  5J3R A;  1ZYQ B;  1X5E A;  5DAL B;  3UIW A;  2HSM B;  1JZR A;  3UBK A;  1QGV A;  1N25 A;  1A0R P;  2J9H A;  2VD1 A;  3DVX A;  5ID2 B;  1YEW C;  3LEF A;  1O85 A;  2HI7 A;  4TR1 A;  1O7U A;  4MP4 A;  3EUR A;  4N10 A;  3RDW A;  1AIU A;  1SVO A;  3FRC A;  3LJR A;  2VL2 A;  2HZE A;  1FVJ A;  1FVK A;  3RFR C;  2HT9 A;  3O76 A;  5F05 A;  1M2A A;  3GA4 A;  1EOH A;  1WMJ A;  2GSR A;  2IWT A;  1M3I A;  2NPB A;  4N0V A;  3W6G A;  1GSU A;  3FZ4 A;  2F3M A;  1Z5Y E;  4IW9 A;  2CAI A;  2LRN A;  1YY7 A;  2YZH A;  2GQM A;  3VPT A;  1Z6N A;  3VWU A;  3CSJ A;  2GST A;  3ZML A;  2NDO A;  4OFT A;  2WCI A;  3QD9 A;  2N5A A;  1GSF A;  4YAV A;  16GS A;  4ZBA A;  4LA1 A;  2HRA A;  2WZ9 A;  3UL3 A;  2EFC A;  1Z7P A;  2KP1 A;  2GZP A;  4GDF A;  1XWC A;  4EUY A;  2IFQ B;  1BYE A;  5CRW A;  2EFD A;  2DJK A;  4MK3 A;  4O92 A;  4DSQ A;  4G0I A;  5IMV A;  1GSQ A;  5J5N A;  2C80 A;  1K0O A;  5IPG A;  5G5F A;  2VD0 A;  1WP0 A;  2VO4 A;  2YCD A;  3ERF A;  1NHY A;  2YWM A;  2HSN B;  4XCS A;  2R5G A;  4AJ7 A;  5A5H A;  2FWF A;  3KMN A;  1T4Y A;  4XIH A;  3HMJ G;  4TR3 A;  2M46 A;  3LGC A;  1V58 A;  4MJC A;  3FHK A;  2FWG A;  3A2V A;  5KEJ A;  2RUF A;  4YQU A;  2C8U A;  1PKZ A;  3FYG A;  1GUH A;  2H1B A;  2DJJ A;  5CNW A;  4RI7 A;  4POK A;  2L59 A;  1TU7 A;  1H4O A;  2JZS A;  4FQU A;  4ISD A;  4RI6 A;  4BVX A;  5F07 A;  3MYD A;  3QCP A;  3GN3 A;  1Z6M A;  2GQL A;  4IKH A;  1KEB A;  4L5O A;  3IBH A;  2HXK A;  2VCT A;  2JSZ A;  1B9Y C;  3VWV A;  3FZ9 A;  1GNE A;  2K18 A;  2VIM A;  2EIO A;  3VK9 A;  4OCE A;  2HZE B;  4POL A;  2WS2 A;  3EIN A;  3H4K A;  1WRY A;  1V57 A;  4GXZ A;  5ECQ B;  1EP8 A;  2LJK A;  1WJK A;  2NVL A;  3GFK A;  3WT2 A;  2KHP A;  3TJF A;  4CW9 A;  5KN2 A;  3HJP A;  3ZYW A;  2R6K A;  3OR5 A;  1JHB A;  1M7T A;  4PQH A;  4FXY P;  3M1G A;  5J9C A;  1JFU A;  4ZL7 A;  4AJ8 A;  1MTC A;  2C3N A;  1N2A A;  1ACV A;  2HNL A;  1QK8 A;  2HRN A;  3TRQ A;  3CHX C;  4ZB7 A;  2MZC A;  3IHQ A;  1JZW A;  2G0F A;  3TKQ A;  1NHO A;  3HVN A;  2CQ9 A;  5COH A;  4MA9 A;  2ZNM A;  3U5R E;  1F2E A;  1PN0 A;  2YOI A;  3QOU A;  3QMX A;  4LL4 B;  4AKI A;  5IMZ A;  3APQ A;  4FYB A;  4JE1 A;  2B6M A;  5DVB A;  1GTB A;  4HZ2 A;  3F6D A;  3ZL5 A;  2L5L A;  1SJI A;  4JED A;  3KZQ A;  2FHE A;  2C0E A;  5B7C A;  2PVQ A;  2REM A;  2MMO A;  5A5H B;  3UJ1 A;  1A2M A;  3KIJ A;  1Z7R A;  1O8W A;  2C3Q A;  4O5U A;  5ECH B;  1HNC A;  2C4J A;  1V9W A;  1WIK A;  2FA8 A;  5F8B A;  2GS3 A;  4USS A;  2I1U A;  2H71 A;  4YQM A;  2WRT A;  3DRN A;  6GST A;  3PIN A;  5A1N B;  4WET A;  5G1L A;  3W8J A;  3VFI A;  2H1G A;  3HKR A;  2HZF A;  5D8I A;  4TKY A;  1M2D A;  1S3R A;  1SKW B;  2WVX A;  6GSX A;  3LYK A;  5A4U A;  3KCM A;  1FG4 A;  4D73 B;  1AAZ A;  4MZB A;  2VCZ A;  3EMP A;  2R37 A;  5ECS A;  1PL1 A;  3LXT A;  3F8U A;  2WW2 A;  1PKW A;  2QC7 A;  2YN1 A;  1SYR A;  1JLW A;  1PRX A;  4BL7 A;  3CXG A;  1TRV A;  2YJ7 A;  3NZN A;  2YWO A;  3GHA A;  3ERG A;  4YKG A;  5GST A;  2PUK C;  4MCU A;  4IVF A;  4EDY A;  4K0N A;  3RAZ A;  4KDY A;  3DWV A;  4DSR A;  1AQV A;  3LOR A;  1PGT A;  4N30 A;  1PA3 A;  3CSI A;  4DSS A;  1TK0 B;  2C1Y A;  2FWH A;  2CVB A;  4NXI A;  1MDJ A;  1X0R A;  2YNX A;  1ZGN A;  1QUW A;  5IM9 A;  1QMV A;  3UEM A;  17GS A;  3TJG A;  4ML1 A;  4OD7 A;  4Q5R A;  2H73 A;  4O5R A;  5G5E A;  4RQR A;  4I2T A;  4KX4 A;  5AGY A;  1GL8 A;  4PX1 A;  3NOF A;  1VRS D;  4G0K A;  2YWI A;  4L0U A;  7GSS A;  3KP9 A;  1XWG A;  3R3E A;  1K0M A;  4PNF A;  2FNO A;  4F0C A;  3GKM A;  4GF0 A;  3EYT A;  3PGT A;  1EGR A;  2V41 A;  5DBQ A;  1MDK A;  1SU9 A;  2OE1 A;  2FWE A;  3TCO A;  2YPM A;  1T3B A;  1HNB A;  3DML A;  2RLI A;  4N11 A;  2DKH A;  1X9S B;  1T7P B;  2WVX B;  4XRD A;  4Z7X A;  2LRT A;  2H19 A;  2XBI A;  2IN3 A;  2A4H A;  5A4W A;  3HJO A;  1KNG A;  3R2Q A;  4L8E A;  5AIV A;  3QAV A;  2PMT A;  4XRA A;  1FO5 A;  3QAG A;  4N3Z A;  1R26 A;  1ERV A;  2O8V B;  4E8H A;  4PQI A;  2AYT A;  3TDG A;  3FKF A;  3KM6 A;  2DLX A;  5HFK A;  3D21 A;  2LTK A;  2DJ1 A;  2E7P A;  4V2M A;  1TKD B;  1GRX A;  6GSU A;  3TKR A;  2FCH A;  3DXB A;  2B5E A;  2C3T A;  4TXV A;  2HLS A;  2IMI A;  1XCC A;  3F3R A;  3CTF A;  3UMA A;  2ES7 A;  4HJ2 A;  2B7J A;  1XOA A;  5J41 A;  3C71 A;  5IQY A;  1SD9 A;  4ULX A;  2LJA A;  3E3E A;  2VL2 C;  4O32 A;  2FD3 A;  1YQ1 A;  1PX7 A;  4GQF A;  3KJY A;  4DSS B;  5HQP A;  4W66 A;  3ZIJ A;  4F0B A;  2GT5 A;  4ICY A;  5CP1 A;  3KP8 A;  1XW5 A;  3LG6 A;  1OKT A;  2N5F A;  4Z2U A;  3HY2 A;  2HQT A;  1XW9 A;  3E0U A;  2H70 A;  4IP6 A;  2JL4 A;  1J9B A;  2R0G A;  1R7H A;  4JU5 A;  3Q19 A;  1YF0 A;  1GUK A;  5EPF A;  4EL1 A;  1OVN A;  5ECI B;  5IMF A;  5BMU A;  2MMN A;  3PR8 A;  3QPM A;  1I1I P;  1FAA A;  3GKX A;  4NV5 A;  4FYU A;  3KGK A;  2H0H A;  4WKW A;  2DBC A;  4HEA 2;  4HI7 A;  4ZIJ A;  1OAZ A;  4POB A;  1F3A A;  3L9V A;  4QL7 A;  3GH6 A;  3FZ5 A;  3D6I A;  4IQA A;  5KOX A;  4KA0 A;  2RII A;  3TRX A;  2HSN A;  2I9H A;  2IIY A;  2RM6 A;  3IC8 A;  4TR0 A;  5DDL A;  3ZRE A;  4F03 A;  2B5X A;  1NSW A;  1ZCP A;  4ID0 A;  3TOU A;  2VCW A;  4BWS A;  4K5R A;  3F63 A;  1BED A;  2V6O A;  3CTG A;  3ISO A;  1TXU A;  1A2L A;  3H1N A;  2ALB A;  1OC9 B;  4EE0 A;  2JAC A;  1FOV A;  1SK2 A;  2WUL A;  3IRA A;  4WF4 A;  2A4V A;  3EE2 A;  1OC3 A;  1WWJ A;  2I81 A;  2B3S A;  1C72 A;  1YF1 A;  4JBB A;  2PBJ A;  2O3E A;  4LL1 B;  4WEY A;  1MD3 A;  1GLP A;  4AI6 A;  3RGB C;  4O5Q A;  2H66 A;  4K7O A;  4ZL8 A;  4EIP A;  3UBL A;  3UVT A;  5H5S A;  2D2Z A;  10GS A;  1SK0 A;  3KXO A;  1U87 A;  4ZXG A;  2FGX A;  1ILO A;  3MIX A;  4ML6 A;  1EV9 A;  3HVX A;  2ZCT A;  2L6D A;  4WR4 A;  4KCE A;  4GQC A;  4NMU A;  2E2G A;  2XPE A;  3GV1 A;  2GLR A;  2M72 A;  2YP6 A;  1O6J A;  4NV2 A;  1BG5 A;  5CO3 A;  5ABR A;  1BX9 A;  4O7H A;  1KBN A;  3L9S A;  3AY8 A;  3A5I A;  5BMU B;  1TRW A;  2QGV A;  2PGT A;  3JCM L;  2TRC P;  1VF4 A;  3U6V A;  1XIY A;  1TI3 A;  3TJJ A;  2HSY A;  3ZTL A;  1XFL A;  5CRG A;  4MF6 A;  2H1D A;  4EKZ A;  3QFB C;  3ED3 A;  1GTU A;  4IJI A;  2C0G A;  3GRX A;  4E68 A;  2H6Y A;  2PU9 C;  6GSV A;  4I2U A;  5HR1 A;  3BCI A;  4MJE A;  4FO5 A;  1PL2 A;  2BTO T;  2LNT A;  1XPV A;  1W89 A;  22GS A;  3EMX A;  4QL9 A;  1GH2 A;  1UC7 A;  3Q18 A;  1HD2 A;  4X4J A;  4PQ1 A;  1DE1 A;  3UAP A;  5A1N A;  3DYR A;  1Q98 A;  3IR4 A;  1EEJ A;  1XWB A;  3EPT A;  1V2A A;  4IJ3 A;  2BJX A;  3GIX A;  3M8N A;  4HU9 A;  4TXO A;  4IGJ A;  2WGR A;  1VF2 A;  1G6W A;  2MBT A;  3BJ5 A;  4D73 A;  4FH8 A;  3FEU A;  1TU8 A;  4QQ7 A;  2L5O A;  3CWG A;  2AAW A;  4ECJ A;  4KE3 A;  2CZ3 A;  3FR9 A;  3H8Q A;  5CAX A;  4XS6 A;  3ZIT A;  4YH2 A;  4TVE A;  3CQF A;  4V1A g;  5AIS A;  4MF5 A;  1YVL A;  3EU4 A;  2F8F A;  5ECL B;  4V2L A;  3QAW A;  5DCG A;  5D93 A;  1S3A A;  2A2R A;  1YEP A;  1ZYN A;  1SVL A;  1G7O A;  3C1R A;  4KDX A;  3TKS A;  3GX0 A;  4AKX B;  2WW3 A;  4OO5 A;  4MZC A;  1ZL9 A;  3FK8 A;  2CZ2 A;  1GTA A;  3IV4 A;  2PN8 A;  1AQX A;  1TDI A;  5EY6 A;  1THX A;  4NWY A;  1MDI A;  3V1W A;  2TRX A;  1Y6E A;  3N5O A;  5DAK A;  2CVK A;  2V1M A;  4AJ6 A;  2MYG A;  4GLT A;  2K8S A;  4K1F A;  2XPD A;  3HZ8 A;  1F37 A;  1VF3 A;  2PVO C;  1MD4 A;  1GSS A;  1TW9 A;  1EEM A;  2LUS A;  2LEG A;  5IMC A;  5ECK B;  2LQQ A;  2ZUP A;  3ZFB A;  4AKH A;  1O8X A;  2JU5 A;  3EU3 A;  5J4U A;  1SL0 B;  2OE3 A;  1I9D A;  1SJZ A;  3VI7 A;  4AKG A;  5JWQ B;  2Z9S A;  3W8S A;  1LU4 A;  3GKN A;  5D9X A;  3DGQ A;  3VUR A;  1TOF A;  5J4Y A;  2VCV A;  2B5Y A;  3FMW A;  5LNK e;  2L4C A;  1GLQ A;  2DJ3 A;  2R3X A;  4KSM A;  3HXS A;  4IBP A;  1DSB A;  5C04 A;  2GDR A;  1SL1 B;  4Z2R A;  5J47 A;  2EFH A;  3M0F A;  3HVV A;  1TK8 B;  2O89 A;  4MDC A;  5CRD A;  4FIW A;  2DIY A;  4TXO B;  1T4Z A;  4HOJ A;  4TOP A;  2QKE A;  1K0A A;  3C73 A;  1YJ6 A;  2IPA A;  2R2J A;  3M9K A;  2G2Q A;  3I69 A;  1M9A A;  4OFN A;  4FYC A;  2YAN A;  5HFI A;  1SVM A;  4CY6 A;  3A5W A;  3P2A A;  4IHU A;  1JLV A;  4TW5 A;  1A8L A;  2MBS A;  2P0G A;  2X49 A;  3LXZ A;  4V2N A;  2L57 A;  3ME7 A;  4IN0 A;  3M3M A;  1K0C A;  2HRF A;  1BAY A;  5G2Z A;  5KN0 A;  4JR4 A;  3HVS A;  2RM5 A;  1BJX A;  3IXR A;  4XHM A;  3L4N A;  5ELA A;  2DML A;  2LJR A;  2FLS A;  2DJ2 A;  4MNN A;  4KSO A;  1B8X A;  2K8V A;  2A2S A;  4MPG A;  2C0F A;  1S4B P;  4WBJ A;  1F3B A;  1J0F A;  1G0T A;  3L9U A;  1AXD A;  1SD8 A;  2M80 A;  3IC4 A;  3ZVJ D;  3D4T A;  4PI2 C;  3L0H A;  2VLU A;  5DAK B;  2LRC A;  4MH2 A;  3SWL A;  2TIR A;  3IAS 2;  5L71 A;  1O73 A;  3RHB A;  1BG1 A;  2LNS A;  3IA1 A;  1GSE A;  1PD2 1;  1FB6 A;  5HFG A;  19GS A;  2KLX A;  3F9U A;  20GS A;  3GL5 A;  3IK9 A;  4BA7 A;  1TJD A;  1GWC A;  1ML6 A;  2H0I A;  3ZLP A;  3ZRD A;  4EC0 A;  3J7Y b;  2GQK A;  1PX6 A;  1DBY A;  14GS A;  2NTO A;  5E59 A;  5A5K A;  1B4Q A;  2H30 A;  1B9X C;  1U88 A;  4IS0 A;  4WXT A;  1HNA A;  3PPU A;  1SKR B;  2EIR A;  3G7I A;  5HR3 A;  4CHS A;  2OA7 A;  1OYJ A;  4PGT A;  4KAE A;  1ZYP A;  4I6X A;  5ECO B;  1R4W A;  2VCX A;  1PQN A;  4G2E A;  2RUE A;  3LQ7 A;  4G10 A;  4OMV A;  3GTU A;  1HQO A;  3IE3 A;  4PTS A;  4OWY A;  1ZMA A;  3HD5 A;  2H8L A;  2FUG 2;  2R0C A;  5A34 B;  3FZA A;  1RK4 A;  3HZ4 A;  1OC9 A;  2WDU A;  4F82 A;  3IHG A;  4PUR A;  2YJH A;  2E0Q A;  5GZZ B;  1M0U A;  18GS A;  4YKF A;  2GSQ A;  4XS1 A;  2WZS A;  3TGZ A;  4WBR D;  3A2X A;  5ELG A;  4EVM A;  3HYP A;  2JSY A;  1F9M A;  4ILF A;  2O87 A;  5LD0 A;  4XTS A;  5F06 A;  3L78 A;  1HYU A;  4RUV A;  4NPB A;  5IMD A;  5G30 A;  1JZD A;  2DIZ A;  1A0F A;  4ECC A;  2WFC A;  3CYN A;  2LV3 A;  4KCA A;  5ECP B;  4X1U A;  3CBU A;  2OT3 A;  3M9J A;  5DQS A;  3H93 A;  4DVC A;  1ZYE A;  2QA2 A;  2H6Z A;  3LSZ A;  5IIZ A;  3MDK A;  1IYI A;  2E2M A;  2OAC A;  2VM2 A;  3MNG A;  4JR6 A;  4Q5F A;  1SK1 A;  4LMW A;  4JRR A;  9GSS A;  3F6F A;  2L4Q A;  1B4P A;  3WYW A;  2B7K A;  2HE3 A;  2LQO A;  1RW1 A;  3S9F A;  2KOK A;  1EP7 A;  2ON7 A;  4PI0 C;  3EC3 A;  1F6M C;  2GGT A;  3O3T A;  4P3Y B;  1EV4 A;  3LWA A;  1H75 A;  2CX3 A;  3BOA A;  2VL3 A;  1R5A A;  1AUC A;  2VLV A;  3IOS A;  2HRK A;  3GTU B;  2L6C A;  2CT6 A;  2MMZ A;  4IQ1 A;  1Y25 A;  1V98 A;  4ZBB A;  1O81 A;  5D9W A;  4EO3 A;  2V6K A;  1TXX A;  2H72 A;  2EIQ A;  4A5P A;  3TRP A;  2F9S A;  4G0L A;  4JZQ A;  5LCZ A;  6GSY A;  1DE2 A;  2OE0 A;  1E2Y A;  5JCU A;  1WE0 A;  5IMA A;  1XVW A;  4KND A;  1EZK A;  2LS5 A;  1WPI A;  4MAB A;  3KTB A;  2X4A A;  2FY6 A;  2GTU A;  1Y1U A;  1K0N A;  3I43 A;  1SL2 B;  2N5B A;  5B6M A;  4KGI A;  4XS4 A;  2H01 A;  5H5R A;  2CVD A;  5IOX A;  5GSS A;  5GAN D;  2O5V A;  2X8C A;  3O6T A;  5IPH A;  6GSW A;  1TI1 A;  4GTU A;  2AB6 A;  2VAF A;  2ON5 A;  3TU3 B;  3EWL A;  1OE7 A;  5G31 A;  3GUR A;  2VCQ A;  1MEK A;  1XWA A;  4Q5N A;  3DKS A;  3VWW A;  5FT3 A;  1M3J A;  4ZB6 A;  3D4M A;  5CRH A;  4CDO A;  4MJB A;  5D96 A;  2K9F A;  3TKS C;  4LLR A;  2GT6 A;  4DEJ A;  2OAD A;  4L5L A;  3G7J A;  5H5Q A;  1EGO A;  1NW2 A;  4BWQ A;  4K5S A;  1K3L A;  4ACS A;  1WOU A;  1G7E A;  1ABA A;  2B1K A;  11GS A;  2DKI A;  5JCW A;  5BRT A;  2J23 A;  5G1K A;  4HJM A;  1Z9H A;  5D73 A;  1PN9 A;  3FR3 A;  2GZY A;  5INY A;  3WD6 A;  1I5G A;  1SEN A;  4MLY A;  5DQY A;  5EL8 A;  4GCI A;  1W4V A;  3GYK A;  4BVY A;  2CA8 A;  1QXH A;  2GZZ A;  2WVZ A;  1TTZ A;  3SBC A;  3IAM 2;  3US3 A;  1XG8 A;  1OE8 A;  3VI5 A;  1X5C A;  1UVZ A;  1VGL A; 
#chains in the Genus database with same CATH homology
 1M99 A;  2HRK B;  1X9M B;  2GVP A;  1S3D A;  3WT1 A;  2IMK A;  3MAK A;  1OKD A;  3KH7 A;  2CV4 A;  5JWO B;  1K0B A;  3C1S A;  2AHE A;  4ECB A;  13GS A;  2VUP A;  5KN1 A;  1N8J A;  2P5Q A;  4OCF A;  1V40 A;  5D9V A;  4K8M A;  1X9W B;  1G6Y A;  4NHW A;  1USB A;  1SJ6 A;  1ERU A;  3E9J B;  4OO4 A;  5KOW A;  3KTL A;  1NM3 A;  1YKC A;  4XS4 B;  4TR1 B;  2DSA A;  3J7Y k;  3BBY A;  3TKS E;  1Q4J A;  2DC5 A;  3LYP A;  4ZL9 A;  1EOG A;  2H0G A;  4EIQ A;  5J40 A;  2V2G A;  1GSD A;  3G7Y A;  2GSS A;  2AJQ B;  3GL3 A;  4I5Q A;  4PUF C;  1QQ2 A;  5EVO A;  3TJB A;  5D9T A;  3PH9 A;  2P31 A;  2VKZ G;  4WR5 A;  5IOW A;  1XW6 A;  3A2W A;  3TKP A;  1QFN A;  2OBI A;  4H86 A;  2X99 A;  4EXJ A;  4NHZ A;  5JCG A;  2JAD A;  5HR2 A;  1M9B A;  1PMT A;  4EF0 A;  2OJL A;  3IK7 A;  5JWR B;  3RHC A;  3MSZ A;  1FHE A;  2CAQ A;  3RPP A;  3FY7 A;  4Z2T A;  3TOT A;  5KN3 A;  4K2D A;  2A2P A;  3TB2 A;  4K0G A;  4J56 E;  3F3Q A;  1URM A;  2P5R A;  1U3A A;  4E8E A;  4YQV A;  1TRS A;  2O7K A;  2YWN A;  3BCK A;  1TRU A;  2EFE A;  1ERW A;  3Q6O A;  3QFA C;  4IEL A;  1YEX A;  1LBK A;  2CX4 A;  3GMF A;  2F8A A;  4GRF A;  5DCH A;  4K7N A;  4N0Z A;  4BVY B;  3HCZ A;  5ECN B;  2H74 A;  2YV7 A;  2VLT A;  3K8N A;  5E4W A;  1XZO A;  3ZVJ A;  4G01 A;  4NAX A;  4HUA A;  1T8E B;  3RBT A;  1XVQ A;  1ZZY A;  1GTI A;  4YAP A;  4OFM A;  3VPQ A;  2JZT A;  5DJM A;  2YV9 A;  4HDE A;  1RQM A;  1U6T A;  1J08 A;  1YZX A;  2KP2 A;  3Q74 A;  1GSY A;  4HU7 A;  4KH7 A;  5FHI A;  3P7X A;  5A4V A;  4L0W A;  4ZIL A;  3APO A;  1XBS A;  1CQH A;  3FR6 A;  2IME A;  4RQX A;  5J4V A;  3DVW A;  2I3Y A;  5CYY A;  5ECR B;  1GP1 A;  2HFD A;  5F0G A;  4BVX B;  1XXU A;  4MZW A;  1U3I A;  3WGX A;  5CRE A;  4MJA A;  4I97 A;  5A34 A;  2XHF A;  3HJM A;  3F4R A;  2R4V A;  1ZOF A;  1AC1 A;  2OKA A;  3DD3 A;  4AF2 A;  2IJY A;  3UAR A;  1FW1 A;  4I8B A;  4G19 A;  4LMV A;  3UVH A;  2HYX A;  3HA9 A;  2H6X A;  1UN2 A;  3KMO A;  2UZ8 A;  3UOM A;  2MMA A;  3CMI A;  3GH9 A;  4MMM A;  2O85 A;  3ZFL A;  4G9H A;  4ECI A;  3RPN A;  3CRU A;  3C8E A;  2H75 A;  3KEB A;  3GSS A;  2QA1 A;  2I4A A;  4GWR A;  3ZZX A;  4MH3 A;  4F9Z A;  1PSQ A;  3F4S A;  4CY8 A;  4HQS A;  5ECM B;  3EVI A;  4K6X A;  3LW9 A;  1T00 A;  2PWJ A;  1AQW A;  1XWK A;  3TUE A;  4QMK A;  4AGS A;  1K3Y A;  4K2X A;  1YDK A;  4MPF A;  3H79 A;  4TN8 A;  3CSH A;  3G9B A;  5B8A A;  8GSS A;  2FA4 A;  2QSI A;  4J2F A;  3D22 A;  3GUS A;  1E6B A;  2HSH A;  4KDU A;  2XBQ A;  2K6V A;  4PXO A;  3GST A;  1LJR A;  1FB0 A;  1BF5 A;  2DJ0 A;  4K9Z A;  1A24 A;  2OBK A;  3GKK A;  4EDZ A;  2XC2 A;  2EC4 A;  3ME8 A;  4X0X A;  3WGD A;  2WJU A;  4TRX A;  3WGE A;  2PER A;  1SKS B;  3VWX A;  4BPY A;  2LST A;  3D5J A;  2X8G A;  1K3O A;  3BD2 A;  1TP9 A;  3TJK A;  3QDN A;  4X43 A;  4PNG A;  1K0D A;  3ZMK A;  1ST9 A;  1VF1 A;  2BMX A;  3ERW A;  2JZR A;  5B6N A;  1CQG A;  2VM1 A;  5AIX A;  5DAL A;  5AN1 A;  4ZB8 A;  2HSM A;  3ZIV A;  12GS A;  5GAP D;  1UA5 A;  5IO0 A;  5B8B A;  4ZBD A;  4KW6 A;  5ID2 A;  1S3C A;  4J57 E;  4BL7 B;  3APS A;  2PPT A;  4HQZ A;  2AUV A;  2YZU A;  3LFL A;  3GX8 A;  3HHV A;  2C0D A;  2F51 A;  2H76 A;  4HZ4 A;  1T1V A;  3NIV A;  4KF9 A;  1GNW A;  4GST A;  2IMD A;  3F0I A;  3HDC A;  1SYX A;  2LKU A;  5J9B A;  3IDV A;  1B48 A;  5DJL A;  3P90 A;  3A3T A;  4PUA A;  1X5D A;  1GUL A;  4GSN A;  3N9J A;  1GUM A;  4GSS A;  4Q5Q A;  2IL3 A;  2VL9 A;  3C7M A;  3MWH A;  1FOH A;  3P8W A;  4TR4 A;  1OC8 A;  2X8H A;  3F4T A;  2X64 A;  3FW2 A;  4MF7 A;  2NBS A;  1Z3E A;  1R5P A;  1BQ7 A;  2IMF A;  5HR0 A;  3KD0 A;  1IYH A;  2UV8 G;  3CRT A;  3DEX A;  5ENU A;  4F2I A;  4IP1 A;  4KB3 A;  1M2B A;  2B1L A;  5IO2 A;  4K7I A;  4POM A;  3GNJ A;  1A2J A;  6GSS A;  3D0Z A;  3QR6 A;  4ZB9 A;  2R0P A;  1THO A;  2AV4 A;  2IFQ A;  4HS1 A;  3I9V 2;  4KUN A;  3IPZ A;  4V1A p;  2KUC A;  2V32 A;  5C00 A;  2DMM A;  2H1L A;  3I6A A;  5FWG A;  1A23 A;  1ERT A;  3VLN A;  1YKA A;  1ON4 A;  1A8Y A;  4WF5 A;  3KH9 A;  1TK5 B;  1AW9 A;  3DIE A;  1JZO A;  2VOC A;  2WB9 A;  1KTE A;  1EWX A;  1DUG A;  2H1A A;  1XOB A;  5J3R A;  1ZYQ B;  1X5E A;  5DAL B;  3UIW A;  2HSM B;  1JZR A;  3UBK A;  1QGV A;  1N25 A;  1A0R P;  2J9H A;  2VD1 A;  3DVX A;  5ID2 B;  3LEF A;  1O85 A;  2HI7 A;  4TR1 A;  1O7U A;  4MP4 A;  3EUR A;  4N10 A;  3RDW A;  1AIU A;  1SVO A;  3FRC A;  3LJR A;  2VL2 A;  2HZE A;  1FVJ A;  1FVK A;  2HT9 A;  3O76 A;  5F05 A;  1M2A A;  3GA4 A;  1EOH A;  1WMJ A;  2GSR A;  2IWT A;  2NPB A;  4N0V A;  3W6G A;  1GSU A;  3FZ4 A;  2F3M A;  1Z5Y E;  4IW9 A;  2CAI A;  2LRN A;  1YY7 A;  2YZH A;  2GQM A;  3VPT A;  1Z6N A;  3VWU A;  3CSJ A;  2GST A;  3ZML A;  2NDO A;  4OFT A;  2WCI A;  3QD9 A;  2N5A A;  1GSF A;  4YAV A;  16GS A;  4ZBA A;  4LA1 A;  2HRA A;  2WZ9 A;  3UL3 A;  2EFC A;  1Z7P A;  2KP1 A;  2GZP A;  4GDF A;  1XWC A;  4EUY A;  2IFQ B;  1BYE A;  5CRW A;  2EFD A;  2DJK A;  4MK3 A;  4O92 A;  4DSQ A;  4G0I A;  5IMV A;  1GSQ A;  5J5N A;  2C80 A;  1K0O A;  5IPG A;  5G5F A;  2VD0 A;  1WP0 A;  2VO4 A;  2YCD A;  3ERF A;  1NHY A;  2YWM A;  2HSN B;  4XCS A;  2R5G A;  4AJ7 A;  5A5H A;  2FWF A;  3KMN A;  1T4Y A;  4XIH A;  3HMJ G;  4TR3 A;  2M46 A;  3LGC A;  1V58 A;  4MJC A;  3FHK A;  2FWG A;  3A2V A;  5KEJ A;  2RUF A;  4YQU A;  2C8U A;  1PKZ A;  3FYG A;  1GUH A;  2H1B A;  2DJJ A;  5CNW A;  4RI7 A;  4POK A;  2L59 A;  1TU7 A;  1H4O A;  2JZS A;  4FQU A;  4ISD A;  4RI6 A;  4BVX A;  5F07 A;  3MYD A;  3QCP A;  3GN3 A;  1Z6M A;  2GQL A;  4IKH A;  1KEB A;  4L5O A;  3IBH A;  2HXK A;  2VCT A;  2JSZ A;  1B9Y C;  3VWV A;  3FZ9 A;  1GNE A;  2K18 A;  2VIM A;  2EIO A;  3VK9 A;  4OCE A;  2HZE B;  4POL A;  2WS2 A;  3EIN A;  3H4K A;  1WRY A;  1V57 A;  4GXZ A;  5ECQ B;  1EP8 A;  2LJK A;  1WJK A;  2NVL A;  3GFK A;  3WT2 A;  2KHP A;  3TJF A;  4CW9 A;  5KN2 A;  3HJP A;  3ZYW A;  2R6K A;  3OR5 A;  1JHB A;  1M7T A;  4PQH A;  3M1G A;  5J9C A;  1JFU A;  4ZL7 A;  4AJ8 A;  1MTC A;  2C3N A;  1N2A A;  1ACV A;  2HNL A;  1QK8 A;  2HRN A;  3TRQ A;  4ZB7 A;  2MZC A;  3IHQ A;  1JZW A;  2G0F A;  3TKQ A;  1NHO A;  2CQ9 A;  5COH A;  4MA9 A;  2ZNM A;  3U5R E;  1F2E A;  1PN0 A;  2YOI A;  3QOU A;  3QMX A;  4LL4 B;  4AKI A;  5IMZ A;  3APQ A;  4FYB A;  4JE1 A;  2B6M A;  5DVB A;  1GTB A;  4HZ2 A;  3F6D A;  3ZL5 A;  2L5L A;  1SJI A;  4JED A;  3KZQ A;  2FHE A;  2C0E A;  5B7C A;  2PVQ A;  2REM A;  2MMO A;  5A5H B;  3UJ1 A;  1A2M A;  3KIJ A;  1Z7R A;  1O8W A;  2C3Q A;  4O5U A;  5ECH B;  1HNC A;  2C4J A;  1V9W A;  1WIK A;  2FA8 A;  5F8B A;  2GS3 A;  4USS A;  2I1U A;  2H71 A;  4YQM A;  2WRT A;  3DRN A;  6GST A;  3PIN A;  5A1N B;  4WET A;  5G1L A;  3W8J A;  3VFI A;  2H1G A;  3HKR A;  2HZF A;  5D8I A;  4TKY A;  1M2D A;  1SKW B;  6GSX A;  3LYK A;  5A4U A;  3KCM A;  1FG4 A;  4D73 B;  1AAZ A;  4MZB A;  2VCZ A;  3EMP A;  2R37 A;  5ECS A;  1PL1 A;  3LXT A;  3F8U A;  1PKW A;  2QC7 A;  2YN1 A;  1SYR A;  1JLW A;  1PRX A;  4BL7 A;  3CXG A;  1TRV A;  2YJ7 A;  3NZN A;  2YWO A;  3GHA A;  3ERG A;  4YKG A;  5GST A;  2PUK C;  4MCU A;  4IVF A;  4EDY A;  4K0N A;  3RAZ A;  4KDY A;  3DWV A;  4DSR A;  1AQV A;  3LOR A;  1PGT A;  4N30 A;  1PA3 A;  3CSI A;  4DSS A;  1TK0 B;  2C1Y A;  2FWH A;  2CVB A;  4NXI A;  1MDJ A;  1X0R A;  2YNX A;  1ZGN A;  1QUW A;  5IM9 A;  1QMV A;  3UEM A;  17GS A;  3TJG A;  4ML1 A;  4OD7 A;  4Q5R A;  2H73 A;  4O5R A;  5G5E A;  4RQR A;  4I2T A;  4KX4 A;  5AGY A;  1GL8 A;  4PX1 A;  3NOF A;  1VRS D;  4G0K A;  2YWI A;  4L0U A;  7GSS A;  3KP9 A;  1XWG A;  3R3E A;  1K0M A;  4PNF A;  2FNO A;  4F0C A;  3GKM A;  4GF0 A;  3EYT A;  3PGT A;  1EGR A;  2V41 A;  5DBQ A;  1MDK A;  1SU9 A;  2OE1 A;  2FWE A;  3TCO A;  2YPM A;  1T3B A;  1HNB A;  3DML A;  2RLI A;  4N11 A;  2DKH A;  1X9S B;  1T7P B;  4XRD A;  4Z7X A;  2LRT A;  2H19 A;  2XBI A;  2IN3 A;  2A4H A;  5A4W A;  3HJO A;  1KNG A;  3R2Q A;  4L8E A;  5AIV A;  3QAV A;  2PMT A;  4XRA A;  1FO5 A;  3QAG A;  4N3Z A;  1R26 A;  1ERV A;  2O8V B;  4E8H A;  4PQI A;  2AYT A;  3TDG A;  3FKF A;  3KM6 A;  2DLX A;  5HFK A;  3D21 A;  2LTK A;  2DJ1 A;  2E7P A;  4V2M A;  1TKD B;  1GRX A;  6GSU A;  3TKR A;  2FCH A;  3DXB A;  2B5E A;  2C3T A;  4TXV A;  2HLS A;  2IMI A;  1XCC A;  3F3R A;  3CTF A;  3UMA A;  2ES7 A;  4HJ2 A;  2B7J A;  1XOA A;  5J41 A;  3C71 A;  5IQY A;  1SD9 A;  4ULX A;  2LJA A;  3E3E A;  2VL2 C;  4O32 A;  2FD3 A;  1YQ1 A;  1PX7 A;  4GQF A;  3KJY A;  4DSS B;  5HQP A;  4W66 A;  3ZIJ A;  4F0B A;  2GT5 A;  4ICY A;  5CP1 A;  3KP8 A;  1XW5 A;  3LG6 A;  1OKT A;  2N5F A;  4Z2U A;  3HY2 A;  2HQT A;  1XW9 A;  3E0U A;  2H70 A;  4IP6 A;  2JL4 A;  1J9B A;  2R0G A;  1R7H A;  4JU5 A;  3Q19 A;  1YF0 A;  1GUK A;  5EPF A;  4EL1 A;  1OVN A;  5ECI B;  5IMF A;  5BMU A;  2MMN A;  3PR8 A;  3QPM A;  1FAA A;  3GKX A;  4NV5 A;  4FYU A;  3KGK A;  2H0H A;  4WKW A;  2DBC A;  4HEA 2;  4HI7 A;  4ZIJ A;  1OAZ A;  4POB A;  1F3A A;  3L9V A;  4QL7 A;  3GH6 A;  3FZ5 A;  3D6I A;  4IQA A;  5KOX A;  4KA0 A;  2RII A;  3TRX A;  2HSN A;  2I9H A;  2IIY A;  2RM6 A;  3IC8 A;  4TR0 A;  5DDL A;  3ZRE A;  4F03 A;  2B5X A;  1NSW A;  1ZCP A;  4ID0 A;  3TOU A;  2VCW A;  4BWS A;  4K5R A;  3F63 A;  1BED A;  2V6O A;  3CTG A;  3ISO A;  1TXU A;  1A2L A;  3H1N A;  2ALB A;  1OC9 B;  4EE0 A;  2JAC A;  1FOV A;  1SK2 A;  2WUL A;  3IRA A;  4WF4 A;  2A4V A;  3EE2 A;  1OC3 A;  1WWJ A;  2I81 A;  2B3S A;  1C72 A;  1YF1 A;  4JBB A;  2PBJ A;  4LL1 B;  4WEY A;  1MD3 A;  1GLP A;  4AI6 A;  4O5Q A;  2H66 A;  4K7O A;  4ZL8 A;  4EIP A;  3UBL A;  3UVT A;  5H5S A;  2D2Z A;  10GS A;  1SK0 A;  3KXO A;  1U87 A;  4ZXG A;  2FGX A;  1ILO A;  3MIX A;  4ML6 A;  1EV9 A;  3HVX A;  2ZCT A;  2L6D A;  4WR4 A;  4KCE A;  4GQC A;  4NMU A;  2E2G A;  2XPE A;  3GV1 A;  2GLR A;  2M72 A;  2YP6 A;  1O6J A;  4NV2 A;  1BG5 A;  5CO3 A;  5ABR A;  1BX9 A;  4O7H A;  1KBN A;  3L9S A;  3AY8 A;  3A5I A;  5BMU B;  1TRW A;  2QGV A;  2PGT A;  3JCM L;  2TRC P;  1VF4 A;  3U6V A;  1XIY A;  1TI3 A;  3TJJ A;  2HSY A;  3ZTL A;  1XFL A;  5CRG A;  4MF6 A;  2H1D A;  4EKZ A;  3QFB C;  3ED3 A;  1GTU A;  4IJI A;  2C0G A;  3GRX A;  4E68 A;  2H6Y A;  2PU9 C;  6GSV A;  4I2U A;  5HR1 A;  3BCI A;  4MJE A;  4FO5 A;  1PL2 A;  2BTO T;  2LNT A;  1XPV A;  1W89 A;  22GS A;  3EMX A;  4QL9 A;  1GH2 A;  1UC7 A;  3Q18 A;  1HD2 A;  4X4J A;  4PQ1 A;  1DE1 A;  3UAP A;  5A1N A;  3DYR A;  1Q98 A;  3IR4 A;  1EEJ A;  1XWB A;  3EPT A;  1V2A A;  4IJ3 A;  2BJX A;  3GIX A;  3M8N A;  4HU9 A;  4TXO A;  4IGJ A;  2WGR A;  1VF2 A;  1G6W A;  2MBT A;  3BJ5 A;  4D73 A;  4FH8 A;  3FEU A;  1TU8 A;  4QQ7 A;  2L5O A;  3CWG A;  2AAW A;  4ECJ A;  4KE3 A;  2CZ3 A;  3FR9 A;  3H8Q A;  5CAX A;  4XS6 A;  3ZIT A;  4YH2 A;  4TVE A;  4V1A g;  5AIS A;  4MF5 A;  1YVL A;  3EU4 A;  2F8F A;  5ECL B;  4V2L A;  3QAW A;  5DCG A;  5D93 A;  1S3A A;  2A2R A;  1YEP A;  1ZYN A;  1SVL A;  1G7O A;  3C1R A;  4KDX A;  3TKS A;  3GX0 A;  4AKX B;  4OO5 A;  4MZC A;  1ZL9 A;  3FK8 A;  2CZ2 A;  1GTA A;  3IV4 A;  2PN8 A;  1AQX A;  1TDI A;  5EY6 A;  1THX A;  4NWY A;  1MDI A;  3V1W A;  2TRX A;  1Y6E A;  3N5O A;  5DAK A;  2CVK A;  2V1M A;  4AJ6 A;  2MYG A;  4GLT A;  2K8S A;  4K1F A;  2XPD A;  3HZ8 A;  1F37 A;  1VF3 A;  2PVO C;  1MD4 A;  1GSS A;  1TW9 A;  1EEM A;  2LUS A;  2LEG A;  5IMC A;  5ECK B;  2LQQ A;  2ZUP A;  3ZFB A;  4AKH A;  1O8X A;  2JU5 A;  3EU3 A;  5J4U A;  1SL0 B;  2OE3 A;  1I9D A;  1SJZ A;  3VI7 A;  4AKG A;  5JWQ B;  2Z9S A;  3W8S A;  1LU4 A;  3GKN A;  5D9X A;  3DGQ A;  3VUR A;  1TOF A;  5J4Y A;  2VCV A;  2B5Y A;  3FMW A;  5LNK e;  2L4C A;  1GLQ A;  2DJ3 A;  2R3X A;  4KSM A;  3HXS A;  4IBP A;  1DSB A;  5C04 A;  2GDR A;  1SL1 B;  4Z2R A;  5J47 A;  2EFH A;  3M0F A;  3HVV A;  1TK8 B;  2O89 A;  4MDC A;  5CRD A;  4FIW A;  2DIY A;  4TXO B;  1T4Z A;  4HOJ A;  4TOP A;  2QKE A;  1K0A A;  3C73 A;  1YJ6 A;  2IPA A;  2R2J A;  3M9K A;  2G2Q A;  3I69 A;  1M9A A;  4OFN A;  4FYC A;  2YAN A;  5HFI A;  1SVM A;  4CY6 A;  3A5W A;  3P2A A;  4IHU A;  1JLV A;  4TW5 A;  1A8L A;  2MBS A;  2P0G A;  2X49 A;  3LXZ A;  4V2N A;  2L57 A;  3ME7 A;  4IN0 A;  3M3M A;  1K0C A;  2HRF A;  1BAY A;  5G2Z A;  5KN0 A;  4JR4 A;  3HVS A;  2RM5 A;  1BJX A;  3IXR A;  4XHM A;  3L4N A;  5ELA A;  2DML A;  2LJR A;  2FLS A;  2DJ2 A;  4MNN A;  4KSO A;  1B8X A;  2K8V A;  2A2S A;  4MPG A;  2C0F A;  4WBJ A;  1F3B A;  1J0F A;  1G0T A;  3L9U A;  1AXD A;  1SD8 A;  2M80 A;  3IC4 A;  3ZVJ D;  3D4T A;  3L0H A;  2VLU A;  5DAK B;  2LRC A;  4MH2 A;  3SWL A;  2TIR A;  3IAS 2;  5L71 A;  1O73 A;  3RHB A;  1BG1 A;  2LNS A;  3IA1 A;  1GSE A;  1PD2 1;  1FB6 A;  5HFG A;  19GS A;  2KLX A;  3F9U A;  20GS A;  3GL5 A;  3IK9 A;  4BA7 A;  1TJD A;  1GWC A;  1ML6 A;  2H0I A;  3ZLP A;  3ZRD A;  4EC0 A;  3J7Y b;  2GQK A;  1PX6 A;  1DBY A;  14GS A;  2NTO A;  5E59 A;  5A5K A;  1B4Q A;  2H30 A;  1B9X C;  1U88 A;  4IS0 A;  4WXT A;  1HNA A;  3PPU A;  1SKR B;  2EIR A;  3G7I A;  5HR3 A;  4CHS A;  2OA7 A;  1OYJ A;  4PGT A;  4KAE A;  1ZYP A;  4I6X A;  5ECO B;  1R4W A;  2VCX A;  1PQN A;  4G2E A;  2RUE A;  3LQ7 A;  4G10 A;  4OMV A;  3GTU A;  1HQO A;  3IE3 A;  4PTS A;  4OWY A;  1ZMA A;  3HD5 A;  2H8L A;  2FUG 2;  2R0C A;  5A34 B;  3FZA A;  1RK4 A;  3HZ4 A;  1OC9 A;  2WDU A;  4F82 A;  3IHG A;  4PUR A;  2YJH A;  2E0Q A;  5GZZ B;  1M0U A;  18GS A;  4YKF A;  2GSQ A;  4XS1 A;  3TGZ A;  4WBR D;  3A2X A;  5ELG A;  4EVM A;  3HYP A;  2JSY A;  1F9M A;  4ILF A;  2O87 A;  5LD0 A;  4XTS A;  5F06 A;  3L78 A;  1HYU A;  4RUV A;  4NPB A;  5IMD A;  5G30 A;  1JZD A;  2DIZ A;  1A0F A;  4ECC A;  2WFC A;  3CYN A;  2LV3 A;  4KCA A;  5ECP B;  4X1U A;  3CBU A;  2OT3 A;  3M9J A;  5DQS A;  3H93 A;  4DVC A;  1ZYE A;  2QA2 A;  2H6Z A;  3LSZ A;  5IIZ A;  3MDK A;  1IYI A;  2E2M A;  2OAC A;  2VM2 A;  3MNG A;  4JR6 A;  4Q5F A;  1SK1 A;  4LMW A;  4JRR A;  9GSS A;  3F6F A;  2L4Q A;  1B4P A;  3WYW A;  2B7K A;  2HE3 A;  2LQO A;  1RW1 A;  3S9F A;  2KOK A;  1EP7 A;  2ON7 A;  3EC3 A;  1F6M C;  2GGT A;  3O3T A;  4P3Y B;  1EV4 A;  3LWA A;  1H75 A;  2CX3 A;  3BOA A;  2VL3 A;  1R5A A;  1AUC A;  2VLV A;  3IOS A;  2HRK A;  3GTU B;  2L6C A;  2CT6 A;  2MMZ A;  4IQ1 A;  1Y25 A;  1V98 A;  4ZBB A;  1O81 A;  5D9W A;  4EO3 A;  2V6K A;  1TXX A;  2H72 A;  2EIQ A;  4A5P A;  3TRP A;  2F9S A;  4G0L A;  4JZQ A;  5LCZ A;  6GSY A;  1DE2 A;  2OE0 A;  1E2Y A;  5JCU A;  1WE0 A;  5IMA A;  1XVW A;  4KND A;  1EZK A;  2LS5 A;  1WPI A;  4MAB A;  3KTB A;  2X4A A;  2FY6 A;  2GTU A;  1Y1U A;  1K0N A;  3I43 A;  1SL2 B;  2N5B A;  5B6M A;  4KGI A;  4XS4 A;  2H01 A;  5H5R A;  2CVD A;  5IOX A;  5GSS A;  5GAN D;  2O5V A;  2X8C A;  3O6T A;  5IPH A;  6GSW A;  1TI1 A;  4GTU A;  2AB6 A;  2VAF A;  2ON5 A;  3TU3 B;  3EWL A;  1OE7 A;  5G31 A;  3GUR A;  2VCQ A;  1MEK A;  1XWA A;  4Q5N A;  3DKS A;  3VWW A;  5FT3 A;  4ZB6 A;  3D4M A;  5CRH A;  4CDO A;  4MJB A;  5D96 A;  2K9F A;  3TKS C;  4LLR A;  2GT6 A;  4DEJ A;  2OAD A;  4L5L A;  3G7J A;  5H5Q A;  1EGO A;  1NW2 A;  4BWQ A;  4K5S A;  1K3L A;  4ACS A;  1WOU A;  1G7E A;  1ABA A;  2B1K A;  11GS A;  2DKI A;  5JCW A;  5BRT A;  2J23 A;  5G1K A;  4HJM A;  1Z9H A;  5D73 A;  1PN9 A;  3FR3 A;  2GZY A;  5INY A;  3WD6 A;  1I5G A;  1SEN A;  4MLY A;  5DQY A;  5EL8 A;  4GCI A;  1W4V A;  3GYK A;  4BVY A;  2CA8 A;  1QXH A;  2GZZ A;  3SBC A;  1TTZ A;  3IAM 2;  3US3 A;  1OE8 A;  3VI5 A;  1X5C A;  1UVZ A;  1VGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...