5F07A

Crystal structure of glutathione transferase f8 from populus trichocarpa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
212
structure length
212
Chain Sequence
VVKVYGPAVAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLKQPFGQVPVVEDGDFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVILPRIGQQGDSELVRTYEEKLEKVLDVYEKRLSKSKYLAGDSFTLADLSHLPATRYLVNEAGLGHLVKDRKKLNAWWEDISSRPAWKKLMNLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glutathione S-transferase family protein
publication title Structural plasticity among glutathione transferase Phi members: natural combination of catalytic residues confers dual biochemical activities.
pubmed doi rcsb
source organism Populus trichocarpa
molecule tags Transferase
total genus 81
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5f07A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5f07A01
1SD9A 2B5EA 4XS4B 4JR4A 2YANA 4FO5A 3BCKA 1V57A 4CW9A 2KP1A 2F9SA 4Q5RA 2L4CA 2HE3A 5F06A 2H70A 3R3EA 2FLSA 4V2LA 2X64A 3IR4A 1KEBA 3GYKA 3D6IA 3UL3A 3IC8A 2LJAA 5AGYA 3ZIJA 1BEDA 3TRQA 4MMMA 1B9YC 4PQ1A 3J7Yk 1FB6A 3KMOA 1K0BA 1X9WB 4G19A 3ZVJD 3CMIA 5AISA 2X99A 1WE0A 4JBBA 2F8AA 3C73A 1SU9A 1OE7A 2L5LA 1NM3A 4TXOB 1AQVA 3O6TA 4WETA 1FVJA 2IFQA 1TU8A 5GAPD 1V2AA 3N5OA 3BD2A 4HI7A 4HZ4A 2M80A 4H86A 1M0UA 1X5DA 1XWGA 2YWNA 1O73A 5J5NA 4EO3A 1WPIA 4GSNA 1YEPA 3P7XA 2VM1A 2H76A 2LSTA 3H93A 2V6OA 1SKSB 1GUKA 1PMTA 2NDOA 3QPMA 4NV2A 4K7IA 3HVVA 4N10A 4FIWA 2B6MA 2K8SA 1GTIA 3HA9A 3FZ5A 1ML6A 2FWGA 3CBUA 2N5AA 3VI5A 2IMIA 1SK1A 2M72A 4JEDA 5JCWA 3UJ1A 3LGCA 2HZEB 5HFIA 2PN8A 4TR4A 1OKDA 2L6DA 2O7KA 3PR8A 3MAKA 3QR6A 4N0VA 2H8LA 2FD3A 3TCOA 2C4JA 1MDJA 4GQFA 4KX4A 2NVLA 3IDVA 3K8NA 4AJ8A 3U5RE 5JCUA 1PQNA 4ZBAA 3FKFA 2V1MA 1DUGA 3HXSA 2C3QA 4KDXA 1PD21 1EZKA 3WD6A 3M8NA 3A2XA 2FWHA 2LNSA 5GZZB 3H1NA 2V2GA 3HZ4A 2H73A 2BMXA 4FQUA 2REMA 3ED3A 2HSMB 3PINA 3WT1A 1UA5A 4ZILA 1ZL9A 2V32A 2H1GA 1A8YA 3KD0A 1VF2A 3TKSE 16GSA 1XVQA 2HT9A 3IK7A 4I5QA 3LORA 3D5JA 5GSTA 4O5RA 4JR6A 2HZFA 2YCDA 4KSOA 5A4WA 2X8GA 2H0GA 1JLVA 4O32A 1O7UA 4GXZA 2AHEA 1V9WA 3GH6A 3ZITA 1PRXA 2EC4A 3W8SA 5DJLA 1XW9A 3P2AA 3QOUA 4TR0A 4XTSA 1Z3EA 3RPNA 2GQLA 3HZ8A 2H71A 3C71A 2I3YA 1GLQA 4F2IA 4KF9A 4NHZA 1F9MA 3L9VA 22GSA 3LWAA 4AJ7A 4X0XA 3GNJA 5J3RA 2FGXA 1X5EA 1IYIA 2H0HA 4QQ7A 4IP1A 3L78A 2HQTA 7GSSA 3RHCA 1AQXA 1SD8A 2HFDA 2XPEA 4K0NA 2H72A 1WOUA 4MLYA 4G0KA 2OE3A 5DALA 6GSVA 2WCIA 1XPVA 1G0TA 4AF2A 2MMNA 2JZRA 1WMJA 1XWCA 3BBYA 4GTUA 3APSA 3GL3A 4WXTA 1Z7RA 2CQ9A 1U88A 1NHOA 4ECJA 3OR5A 1GSYA 1OC3A 1XWKA 1O81A 1JZWA 2KP2A 1T8EB 3F4SA 4WF5A 4PTSA 3GRXA 2RUFA 1YDKA 3QDNA 4ILFA 3RBTA 4HJMA 3U6VA 1GL8A 4G0IA 4TVEA 1LBKA 4XRAA 4LMVA 5F05A 1JLWA 5KEJA 1PX7A 3Q74A 1GSUA 4YAPA 2HYXA 2C3TA 1T00A 4EDYA 3L9UA 1XW5A 1GTAA 1TJDA 1AQWA 3LYKA 4NWYA 2YZUA 3FRCA 5EPFA 1HQOA 3GTUB 3DKSA 2OACA 2GSTA 4MJAA 2VCWA 4AJ6A 1F37A 1XCCA 2B1LA 4I6XA 3F6DA 2VM2A 1SYXA 3IPZA 13GSA 4MF7A 1AUCA 4MZBA 1X9MB 3UAPA 2DSAA 2RM5A 3KEBA 4K7OA 2ES7A 1UN2A 2R3XA 3S9FA 3D4MA 3RPPA 3WGDA 4NHWA 1TOFA 4QL7A 1YKCA 2FA4A 2O85A 5GAND 1YY7A 5EL8A 5ECPB 1WJKA 4F0BA 1B8XA 2PWJA 5LD0A 4XS4A 4TW5A 3ZMKA 2EIRA 3ZMLA 2L59A 3ZTLA 2N5FA 1XWBA 5CO3A 4ACSA 1X0RA 5DALB 3MDKA 5JCGA 1G6WA 1VRSD 1AIUA 3SWLA 5B8AA 3F63A 2IMDA 2LJKA 2E7PA 1TP9A 3GSSA 5EY6A 2HLSA 3L9SA 2H74A 3DXBA 3IOSA 3HCZA 3EINA 4RQRA 3VWWA 1T4YA 2H1BA 3FR6A 3O76A 4ZL7A 3VWVA 3HY2A 4NPBA 3GHAA 5G2ZA 1HNCA 3VI7A 1MDIA 1EV4A 4G10A 3HYPA 4IN0A 1F2EA 5B6NA 4PNGA 4BWQA 2FHEA 5AIVA 1EP8A 2CT6A 1NHYA 4EUYA 2N5BA 1T7PB 3KM6A 1XXUA 5LCZA 2LKUA 2IPAA 4Q5FA 2P0GA 3DIEA 1SL1B 1A8LA 5HR3A 1ERVA 4LL4B 3TDGA 1OE8A 3DEXA 3J7Yb 1M99A 1V98A 3M9JA 3IA1A 2VD0A 3EC3A 1K3OA 1ERUA 4ID0A 1GULA 1N8JA 1F3BA 1PA3A 2YN1A 1YKAA 4PUFC 1MDKA 3GL5A 5G31A 3E3EA 2VCZA 2YNXA 10GSA 2OKAA 1JZRA 3F3QA 1A0FA 4NXIA 5ELAA 5AN1A 1Q4JA 3QAWA 2P31A 1AW9A 3HJMA 4J56E 5D9WA 4L5LA 1DSBA 1A2LA 4I8BA 2OBKA 3KH9A 2K8VA 2LQQA 1R5PA 4CHSA 1R5AA 2GSSA 3GSTA 3Q19A 3I69A 2CA8A 4KW6A 3D22A 2DJ1A 1ACVA 2FUG2 2K9FA 2RUEA 1XWAA 1EV9A 5IMVA 5DQSA 2DC5A 1ERWA 4L8EA 6GSUA 1Z5YE 1TI3A 3TOUA 1E6BA 4PURA 2HRKA 1Z6MA 1OKTA 1PX6A 6GSXA 4Z7XA 2VAFA 1U87A 1U6TA 4J57E 4MF6A 2ON5A 2F8FA 2OJLA 3PPUA 1EWXA 1F6MC 2XPDA 3GKNA 4WBJA 2HSMA 4Q5QA 3G7YA 2H01A 1SJIA 4POBA 4GSTA 3JCML 5D93A 1USBA 4MPFA 4YQMA 5H5QA 5KN2A 2KHPA 3NOFA 3VURA 4LA1A 2PPTA 4PQHA 5HR1A 1A24A 1TRVA 1HNBA 2DMLA 1YZXA 4N0ZA 1PKWA 4KDYA 1K0MA 3EVIA 4QL9A 4IBPA 1GSQA 2B5YA 1PGTA 5G5FA 2IWTA 2NPBA 4V2NA 4E8EA 4BL7B 1G6YA 3GUSA 2CV4A 2H6YA 4HDEA 3A5WA 2QC7A 3ERFA 1K0DA 2B5XA 3EMXA 4Q5NA 5A5KA 5DAKB 5IOXA 1QFNA 1WP0A 3IC4A 1QXHA 1OC8A 2QKEA 4IP6A 5DCHA 4GLTA 3DYRA 3VLNA 3FEUA 4MJCA 5G1KA 5IMDA 3NZNA 1J08A 1O6JA 1S3AA 1H4OA 3F3RA 2A4VA 3GX0A 4NV5A 3LXZA 2Z9SA 1Y25A 1U3AA 1OYJA 2C3NA 3KH7A 1V58A 1XFLA 1GLPA 2CZ2A 2X8HA 4ZIJA 1PL1A 1JZDA 1SENA 1IYHA 4EF0A 4K2DA 4DSRA 3TKSC 4KNDA 1WRYA 3LJRA 3CRTA 2WFCA 1VF1A 5ECQB 2O89A 1FW1A 1TK8B 5J41A 4D73B 5F0GA 3WGXA 5JWOB 1ILOA 3EU4A 2PU9C 1A0RP 4IJIA 2HRKB 2R5GA 3G7JA 3ERGA 1DE2A 3ZRDA 1G7OA 2CAIA 5INYA 4OFTA 4L0UA 4KSMA 4F03A 3KTBA 3TJGA 4KGIA 5HFKA 1ZGNA 6GSTA 4DVCA 4L0WA 2ALBA 4DSSA 1M9AA 1O85A 1YF0A 5JWQB 2IMEA 2DIYA 3ZL5A 4K8MA 2GS3A 3GTUA 3IHQA 1A2JA 1TRWA 4RQXA 4IJ3A 2VD1A 3TJBA 2I1UA 2GSRA 2X8CA 1TXXA 3AY8A 4PQIA 1T1VA 2C0FA 3IAS2 2G2QA 1B4QA 3EYTA 3ZLPA 4GRFA 4KUNA 4HOJA 3FZ4A 2DJKA 1ST9A 4ULXA 4OCFA 1HD2A 5ECKB 2LUSA 1HYUA 2VO4A 2EIQA 3TJFA 3GKMA 4EXJA 5D9VA 2JADA 2VUPA 4V1Ap 5IMZA 1SK2A 4WBRD 4BPYA 2YOIA 2OA7A 2PVOC 4MJEA 4HUAA 1YF1A 2PERA 4MPGA 2L5OA 4IKHA 1SYRA 3CYNA 2F51A 3APOA 1WWJA 1MEKA 5HQPA 1GSEA 4F82A 3HKRA 2CX4A 4IS0A 1A2MA 2LRCA 1NSWA 1SJ6A 5J9BA 5DJMA 1ABAA 4BWSA 2NTOA 1WIKA 2VCXA 1SKRB 2FY6A 3MNGA 1GTUA 3FR3A 1S3CA 3C1RA 5F07A 3GKXA 1VGLA 20GSA 3F4TA 3IBHA 3FR9A 2JACA 1KBNA 3FY7A 1SK0A 4MK3A 2GQKA 1T4ZA 2D2ZA 3N9JA 1GSDA 1AAZA 1BAYA 6GSYA 5HR0A 4WF4A 5IOWA 4ZB8A 2C8UA 4DSSB 2TRXA 4I2TA 4YAVA 2DJ3A 1TW9A 2LNTA 2WJUA 2E0QA 19GSA 1W4VA 1K3LA 2QGVA 4MA9A 1GTBA 1TTZA 1TU7A 1BYEA 2VL9A 3TKSA 2KLXA 4YH2A 2HRNA 2GZYA 4MH3A 4CDOA 5ELGA 5JWRB 4PNFA 2DJ2A 4G9HA 5ECOB 4X43A 4ISDA 1SL0B 4ZBDA 3VWXA 3D4TA 2H6ZA 2P5RA 4P3YB 1XBSA 3ME7A 4FYCA 4ZBBA 3IAM2 4WEYA 2MBTA 5IM9A 4GSSA 1PL2A 2GDRA 11GSA 1KNGA 1QK8A 4KH7A 2VCTA 4KE3A 2RM6A 2LS5A 4POLA 3WGEA 5DDLA 3HJOA 1JHBA 2RIIA 2AV4A 4KDUA 4BA7A 3QFAC 2PUKC 4J2FA 4XCSA 5D9XA 5FT3A 2C1YA 2M46A 1I5GA 2YZHA 5CREA 1M2AA 3F8UA 2R6KA 1OVNA 4V1Ag 3QMXA 4IGJA 5G30A 2LRTA 3HVSA 5CRGA 1O8XA 2H30A 3RDWA 2LEGA 5HR2A 2MMAA 2YP6A 2JL4A 3IXRA 2YV7A 4I2UA 4XHMA 3VFIA 2L6CA 4MJBA 5IIZA 3EURA 4O7HA 5E59A 2H0IA 5IO2A 5ECMB 3LQ7A 1XOAA 2VIMA 9GSSA 2IMKA 2J9HA 1ZMAA 2NBSA 3SBCA 2XC2A 1GNEA 4BVYA 4POMA 3RAZA 5ENUA 1PKZA 4BL7A 3H79A 1TRSA 4EC0A 2C0EA 1LJRA 5EVOA 5DQYA 4ZL8A 2OE0A 2ZCTA 3KZQA 1T3BA 5DAKA 2ZNMA 1RQMA 1VF3A 3CSIA 2H75A 3APQA 4FH8A 4ECCA 2KUCA 4N30A 2H1DA 5CYYA 5H5RA 3GKKA 2B7JA 1XVWA 3KJYA 2J23A 1PN9A 4XS6A 1DE1A 2C0DA 1CQGA 1C72A 4MF5A 3ZVJA 1NW2A 5IPHA 2OE1A 3GIXA 2YV9A 1TDIA 4OO5A 2YWIA 1FB0A 4JE1A 2I81A 4TRXA 2EIOA 5C00A 4JZQA 4TKYA 3CTFA 5F8BA 3ZFBA 1SKWB 3CTGA 3GFKA 5B7CA 2HI7A 3LXTA 3QAGA 1Y6EA 5GSSA 4HQZA 3KXOA 2C0GA 3V1WA 1BJXA 4IELA 2WULA 2BTOT 5KN0A 2IIYA 3EU3A 2MMZA 4YQUA 5L71A 4D73A 2K6VA 2IL3A 1B4PA 2V6KA 2B1KA 2LRNA 4OO4A 1ERTA 4I97A 3KIJA 5D96A 4GWRA 4IQAA 5ABRA 4EVMA 3O3TA 4HQSA 1UC7A 2AYTA 3TJJA 1J9BA 3PGTA 2TIRA 1FOVA 4MZCA 1URMA 5FWGA 1GH2A 2O87A 1O8WA 2G0FA 12GSA 1JZOA 3DMLA 2H1AA 2R37A 2JSYA 1OC9A 4POKA 1GSFA 4TN8A 3GMFA 2FCHA 4HJ2A 2YWOA 4BVYB 2MZCA 2JU5A 4MABA 3EWLA 2CAQA 17GSA 2B3SA 2JZTA 1G7EA 3FZAA 2YJ7A 3TKQA 1RW1A 1XOBA 5ECRB 4IW9A 4LMWA 1K3YA 5FHIA 1R26A 2DMMA 2VL2C 1TK0B 2HSHA 1X9SB 3EE2A 4TR3A 5A4VA 2XHFA 2ZUPA 3MSZA 4RI6A 3F4RA 2WB9A 3H8QA 4XS1A 4EKZA 5DVBA 2PBJA 1EP7A 2BJXA 2VLTA 2HNLA 5DBQA 3R2QA 1QQ2A 3A3TA 3Q6OA 4USSA 2H66A 3DRNA 3KCMA 2WDUA 1A23A 1I9DA 1K0CA 2F3MA 3HDCA 5ECSA 4TR1A 1UVZA 3DWVA 5IO0A 5ID2A 2GT6A 1Z7PA 3TKPA 3LYPA 4BVXB 3KP9A 3UVTA 3EMPA 2AUVA 2XBQA 2JSZA 4OCEA 2HSNB 3W6GA 3TGZA 4V2MA 3IRAA 1M7TA 3FYGA 8GSSA 5CAXA 3US3A 3ZIVA 1E2YA 5BMUA 1ON4A 1GSSA 1TI1A 2FWEA 2CX3A 2GSQA 2H6XA 2WZ9A 3P90A 5IPGA 4RI7A 2JZSA 3DVXA 5A4UA 1K0OA 1BG5A 1GUMA 3M3MA 2VLUA 3Q18A 2WRTA 2MYGA 3F9UA 1EEMA 2GZPA 4KA0A 1R7HA 2IN3A 4HEA2 4GF0A 3TJKA 1X5CA 4RUVA 5G5EA 1ZYEA 2LTKA 4HU7A 3UOMA 3ZYWA 4G2EA 1B48A 4OD7A 3D0ZA 1Q98A 4JU5A 4KB3A 1ZYQB 1GP1A 2UZ8A 1GUHA 2CVDA 3DVWA 1OC9B 1M9BA 4KCEA 3M9KA 4MZWA 2A2RA 4X1UA 3KMNA 4K0GA 4K1FA 5COHA 1GNWA 1CQHA 4AGSA 2FA8A 4F9ZA 2LV3A 5IQYA 2IFQB 4DEJA 3GV1A 3WT2A 2L4QA 3P8WA 4L5OA 4ZB6A 1ZCPA 4IVFA 3TOTA 1AXDA 14GSA 4KAEA 5D73A 4PXOA 3HD5A 5DCGA 4IHUA 1HNAA 4EE0A 2RLIA 4K6XA 3TKRA 4G0LA 3LEFA 3TUEA 4OFMA 4ZXGA 3FK8A 3HVXA 3ZFLA 3L4NA 4XRDA 5CRDA 2GVPA 1K0NA 1B9XC 1J0FA 4TR1B 5ID2B 5CRHA 5B6MA 2IMFA 3H4KA 4O92A 2H19A 3GH9A 3C1SA 4K7NA 1FVKA 4GQCA 3UARA 1Z9HA 2CZ3A 3PH9A 5D8IA 1EEJA 3KGKA 4ZB9A 2AAWA 3C8EA 3QFBC 18GSA 2LJRA 1ZOFA 2WGRA 2XBIA 1F3AA 3GN3A 3GX8A 1SJZA 2DJ0A 2LQOA 2ON7A 3KP8A 3C7MA 2E2MA 2VL2A 3RHBA 1VF4A 3A2VA 1U3IA 1XW6A 4HZ2A 2HXKA 3A2WA 5IMCA 4ECBA 3CSJA 3BCIA 3BJ5A 3CSHA 3FHKA 3W8JA 4OFNA 2B7KA 1LU4A 3IV4A 2OADA 3VPTA 6GSSA 5ECIB 4FYBA 3UVHA 4IQ1A 3NIVA 2DJJA 4XIHA 2YJHA 4MDCA 1GWCA 1BX9A 1H75A 1R4WA 2DIZA 1Z6NA 4WKWA 4NAXA 4OWYA 3ZZXA 4KCAA 2VCVA 1DBYA 2FNOA 3TRPA 5J4UA 3CXGA 2GLRA 3G9BA 4N11A 3UIWA 3UEMA 4TOPA 4FYUA 2FWFA 5CNWA 3HHVA 3F0IA 1SL2B 4EL1A 2E2GA 3GA4A 2PVQA 5D9TA 2L57A 1M2BA 3VWUA 1K0AA 3WYWA 2HRAA 1MD3A 2P5QA 4HU9A 3M0FA 5C04A 4MCUA 3LSZA 2GZZA 5LNKe 1FO5A 5ECNB 2O8VB 5H5SA 4LL1B 1ZZYA 1KTEA 4MP4A 4YQVA 4JRRA 1JFUA 3CRUA 5IMFA 2WS2A 3ZREA 3GURA 3MWHA 3BOAA 4TXVA 5B8BA 1EGRA 2PMTA 5ECHB 3HJPA 3DD3A 3I43A 2R4VA 1THOA 1XIYA 3L0HA 3FW2A 3UBKA 3D21A 2DBCA 3M1GA 1OAZA 1TRUA 1TK5B 1FHEA 1GRXA 1AC1A 1QUWA 2QSIA 1EOHA 1XZOA 3QD9A 4GCIA 1N2AA 5AIXA 4K9ZA 2K18A 4ECIA 2VCQA 3LFLA 4ZL9A 5KN3A 2GTUA 1FAAA 3TRXA 1BQ7A 2TRCP 2AJQB 5HFGA 4WR5A 2YPMA 4ML1A 6GSWA 2I9HA 2AB6A 1RK4A 4NMUA 4PX1A 3I6AA 2MMOA 4OMVA 1MD4A 4TXOA 5KN1A 5IMAA 3DGQA 3ISOA 3IK9A 1QGVA 2VOCA 2CVBA 1THXA 3QCPA 1S3DA 1EOGA 3F6FA 3E0UA 3LG6A 2IJYA 4ML6A 2VL3A 2I4AA 2C80A 5G1LA 4F0CA 1V40A 2HSYA 5J9CA 1YEXA 4PGTA 2HRFA 2DLXA 2MBSA 3UBLA 3FZ9A 4DSQA 3IE3A 1FG4A 2V41A 2VLVA 4HS1A 5ECLB 1W89A 4PUAA 2YWMA 1TKDB 4E8HA 1EGOA 2PGTA 3TB2A 4MH2A 3I9V2 1YJ6A 5CRWA 3QAVA 3VK9A 3ERWA 3UMAA 4BVXA 3KTLA 2HZEA 2OBIA 1YQ1A 3ME8A 1M2DA 2R2JA 2GGTA 1PSQA 2A2SA 2CVKA 4LLRA 2GT5A 1MTCA 2GQMA 4WR4A 1QMVA 4EDZA 5E4WA 3E9JB 3VPQA 3G7IA 5CP1A 2KOKA
chains in the Genus database with same CATH superfamily
1SD9A 2B5EA 4XS4B 4JR4A 2YANA 4FO5A 3BCKA 1V57A 4CW9A 2KP1A 2F9SA 4Q5RA 2L4CA 2HE3A 5F06A 2H70A 4K5SA 3R3EA 2FLSA 4V2LA 2X64A 3IR4A 1KEBA 3GYKA 3D6IA 2WVZA 3UL3A 3IC8A 2LJAA 5AGYA 3ZIJA 1BEDA 3TRQA 4MMMA 1B9YC 4PQ1A 3J7Yk 3MYDA 1FB6A 3KMOA 1K0BA 4QMKA 1X9WB 4G19A 3ZVJD 4ZB7A 3CMIA 5AISA 2X99A 1WE0A 4A5PA 4JBBA 2F8AA 3C73A 1SU9A 1OE7A 2L5LA 1NM3A 4TXOB 1AQVA 3O6TA 4WETA 1FVJA 2IFQA 1TU8A 5GAPD 1V2AA 3N5OA 3BD2A 4HI7A 4HZ4A 2M80A 4H86A 1M0UA 1X5DA 1XWGA 2YWNA 1O73A 5J5NA 4EO3A 1WPIA 4GSNA 1YEPA 4GDFA 2VM1A 3P7XA 2WVXA 2H76A 2LSTA 3H93A 2V6OA 4X4JA 1SKSB 1GUKA 1PMTA 5A1NB 2NDOA 3QPMA 4NV2A 4K7IA 3HVVA 4N10A 4FIWA 2B6MA 2K8SA 1GTIA 3HA9A 3FZ5A 1ML6A 2FWGA 3CBUA 2N5AA 3VI5A 2IMIA 1SK1A 2M72A 4JEDA 5JCWA 3UJ1A 3LGCA 2HZEB 5HFIA 2PN8A 4TR4A 1OKDA 2L6DA 2O7KA 3PR8A 3MAKA 3QR6A 4N0VA 2H8LA 2FD3A 3TCOA 2C4JA 1MDJA 4GQFA 4KX4A 2NVLA 3IDVA 3K8NA 4AJ8A 3U5RE 5JCUA 1PQNA 4ZBAA 3FKFA 2V1MA 1DUGA 3HXSA 2C3QA 4KDXA 2WW1A 4HSCX 1PD21 1EZKA 3WD6A 3M8NA 3A2XA 2FWHA 2LNSA 5GZZB 3H1NA 2V2GA 3HZ4A 2H73A 2BMXA 4FQUA 2REMA 3ED3A 2HSMB 3PINA 3WT1A 1UA5A 4ZILA 1ZL9A 2V32A 2H1GA 1A8YA 3KD0A 1VF2A 3TKSE 16GSA 1XVQA 2HT9A 3IK7A 4I5QA 3LORA 3D5JA 5GSTA 4O5RA 2O3EA 4JR6A 2HZFA 2YCDA 4KSOA 5A4WA 2X8GA 2H0GA 1JLVA 4O32A 1O7UA 4GXZA 2AHEA 1V9WA 3GH6A 3ZITA 1PRXA 2EC4A 4AKGA 3W8SA 5DJLA 1XW9A 3P2AA 3QOUA 4TR0A 4XTSA 1Z3EA 3RPNA 2GQLA 3HZ8A 2H71A 3C71A 2I3YA 4EIPA 1GLQA 4F2IA 4KF9A 4NHZA 1F9MA 3L9VA 22GSA 3LWAA 4AJ7A 4X0XA 3GNJA 5J3RA 2FGXA 1Y1UA 1X5EA 1IYIA 2H0HA 4QQ7A 4IP1A 3L78A 2HQTA 7GSSA 3RHCA 1AQXA 1SD8A 2HFDA 2XPEA 4K0NA 2H72A 1WOUA 4MLYA 4G0KA 4Z2TA 2OE3A 5DALA 6GSVA 2WCIA 1XPVA 4AKIA 1G0TA 4AF2A 2MMNA 2JZRA 1WMJA 1XWCA 3BBYA 4GTUA 3GL3A 3APSA 5A34A 1Z7RA 4WXTA 2CQ9A 4MNNA 1U88A 1NHOA 4ECJA 3OR5A 1GSYA 1OC3A 1XWKA 1O81A 4PHZC 1JZWA 2KP2A 1T8EB 3F4SA 4WF5A 4PTSA 3GRXA 2RUFA 1YDKA 3QDNA 4ILFA 3RBTA 4HJMA 3U6VA 1GL8A 4G0IA 4TVEA 1LBKA 4XRAA 4LMVA 5F05A 1JLWA 5KEJA 1PX7A 3Q74A 1GSUA 4YAPA 2HYXA 2C3TA 1T00A 1N25A 4EDYA 3L9UA 1XW5A 1GTAA 1FOHA 1TJDA 1AQWA 3LYKA 4NWYA 2YZUA 3FRCA 5EPFA 1HQOA 3GTUB 3DKSA 2OACA 2GSTA 4MJAA 2VCWA 4AJ6A 1F37A 1XCCA 2B1LA 4I6XA 3F6DA 2VM2A 1SYXA 3IPZA 13GSA 4MF7A 1AUCA 4MZBA 1X9MB 3RFRC 3UAPA 2DSAA 2RM5A 3KEBA 4K7OA 2ES7A 1UN2A 2R3XA 4CY6A 3S9FA 3D4MA 3RPPA 3WGDA 4NHWA 1TOFA 4QL7A 1YKCA 5J4VA 2FA4A 2O85A 1PFOA 5GAND 1YY7A 5EL8A 5ECPB 1WJKA 4F0BA 1B8XA 2PWJA 5LD0A 4XS4A 4TW5A 3ZMKA 2EIRA 3ZMLA 2L59A 4AKHA 3ZTLA 2N5FA 1XWBA 5CO3A 4ACSA 1X0RA 5DALB 3MDKA 5JCGA 1G6WA 1VRSD 1AIUA 3SWLA 2R0CA 5B8AA 3F63A 2IMDA 2LJKA 2E7PA 1TP9A 3GSSA 5EY6A 2HLSA 3L9SA 2H74A 3DXBA 3IOSA 3HCZA 3EINA 4RQRA 5A34B 3VWWA 1T4YA 2H1BA 3FR6A 3O76A 4ZL7A 3VWVA 3HY2A 4NPBA 3GHAA 5G2ZA 1HNCA 3VI7A 1MDIA 1EV4A 4G10A 3HYPA 4YKGA 4O5QA 4IN0A 1F2EA 5B6NA 4K2XA 4PNGA 4BWQA 2FHEA 2H1LA 5AIVA 1EP8A 2CT6A 4ICYA 1NHYA 4EUYA 2N5BA 1T7PB 3KM6A 1XXUA 5LCZA 2LKUA 2IPAA 4Q5FA 2P0GA 3DIEA 2UV8G 1SL1B 1A8LA 5HR3A 1ERVA 4LL4B 3TDGA 1OE8A 3DEXA 3J7Yb 1M99A 1V98A 3M9JA 3IA1A 2VD0A 3EC3A 1K3OA 1ERUA 4ID0A 1GULA 1N8JA 1F3BA 1PA3A 2YN1A 1YKAA 4PUFC 5KOXA 1MDKA 3GL5A 5G31A 3E3EA 2VCZA 2YNXA 10GSA 2OKAA 1JZRA 3F3QA 1A0FA 4NXIA 5ELAA 2EFCA 5AN1A 1Q4JA 3QAWA 2P31A 1AW9A 3HJMA 4J56E 5D9WA 4L5LA 1DSBA 1A2LA 4I8BA 2OBKA 3KH9A 2K8VA 2LQQA 1R5PA 4CHSA 1R5AA 3GSTA 2GSSA 3Q19A 3I69A 2CA8A 4KW6A 3D22A 2DJ1A 1ACVA 2FUG2 2K9FA 2RUEA 1XWAA 3MIXA 1EV9A 5IMVA 5DQSA 2DC5A 1ERWA 4L8EA 6GSUA 1Z5YE 1TI3A 3TOUA 1E6BA 4PURA 2HRKA 1Z6MA 1OKTA 1BF5A 1PX6A 6GSXA 4Z7XA 2VAFA 1U87A 1U6TA 4J57E 4MF6A 2ON5A 2F8FA 2OJLA 3PPUA 1EWXA 1F6MC 2XPDA 3GKNA 4WBJA 2HSMA 4Q5QA 3G7YA 2H01A 1SJIA 4POBA 1M3JA 4GSTA 3JCML 5D93A 1USBA 4MPFA 4YQMA 5H5QA 5KN2A 2KHPA 2R0PA 3NOFA 3VURA 4LA1A 2PPTA 4PQHA 5HR1A 1A24A 1TRVA 2EFDA 1HNBA 2DMLA 1YZXA 4N0ZA 1PKWA 4KDYA 1K0MA 3EVIA 4QL9A 4IBPA 1GSQA 2B5YA 1PGTA 5G5FA 2IWTA 2NPBA 4V2NA 4E8EA 4BL7B 1G6YA 3GUSA 2CV4A 2H6YA 2DKIA 4HDEA 3A5WA 2QC7A 3ERFA 1K0DA 2B5XA 3EMXA 4Q5NA 5A5KA 5DAKB 5IOXA 1QFNA 1WP0A 3IC4A 1QXHA 1OC8A 2QKEA 4IP6A 5DCHA 4GLTA 3DYRA 3VLNA 3FEUA 4MJCA 5G1KA 5IMDA 3NZNA 1J08A 1O6JA 1S3AA 1H4OA 3F3RA 2A4VA 3GX0A 4NV5A 3LXZA 2Z9SA 1Y25A 1U3AA 4BIKA 1OYJA 2C3NA 3KH7A 1V58A 1XFLA 1GLPA 2CZ2A 2X8HA 4ZIJA 1PL1A 1JZDA 1SENA 1IYHA 4EF0A 4K2DA 4DSRA 3TKSC 3LW9A 4KNDA 1WRYA 3LJRA 3CRTA 2WFCA 1VF1A 5ECQB 2O89A 1FW1A 1TK8B 5J41A 4D73B 5F0GA 3WGXA 5JWOB 1ILOA 3EU4A 2PU9C 1A0RP 4IJIA 2HRKB 2R5GA 3G7JA 3ERGA 1DE2A 3ZRDA 1G7OA 2CAIA 5INYA 4OFTA 4L0UA 4KSMA 4F03A 3KTBA 3TJGA 4KGIA 5HFKA 1ZGNA 6GSTA 4DVCA 4L0WA 2ALBA 4DSSA 1M9AA 1O85A 1YF0A 5JWQB 2IMEA 2DIYA 3ZL5A 4K8MA 2VKZG 2GS3A 3GTUA 3IHQA 1A2JA 1TRWA 4RQXA 4IJ3A 2VD1A 3TJBA 2I1UA 2GSRA 3A5IA 2X8CA 3TU3B 1TXXA 3AY8A 4PQIA 1T1VA 2C0FA 3IAS2 2G2QA 1B4QA 3EYTA 3ZLPA 4GRFA 4KUNA 4HOJA 3FZ4A 2DJKA 1ST9A 4ULXA 4OCFA 1HD2A 5ECKB 2LUSA 1HYUA 2VO4A 1S3RA 2EIQA 3TJFA 3GKMA 4EXJA 5D9VA 2JADA 2VUPA 2EFEA 4AKXB 3EPTA 4V1Ap 5IMZA 1SK2A 4WBRD 4BPYA 2YOIA 2OA7A 2PVOC 4MJEA 4HUAA 1YF1A 2PERA 4MPGA 2L5OA 4IKHA 1SYRA 3CYNA 2F51A 3APOA 1WWJA 1MEKA 5HQPA 1GSEA 4F82A 3HKRA 2CX4A 4IS0A 1A2MA 2LRCA 1NSWA 1SJ6A 5J9BA 5DJMA 1ABAA 4BWSA 2NTOA 1WIKA 2VCXA 1SKRB 2FY6A 3HVNA 3MNGA 2R0GA 1GTUA 3FR3A 1S3CA 3C1RA 5F07A 3GKXA 1VGLA 20GSA 3F4TA 3IBHA 3FR9A 2JACA 1KBNA 3FY7A 2X4AA 1SK0A 4MK3A 2GQKA 1T4ZA 2D2ZA 5KOWA 3N9JA 1GSDA 1AAZA 1BAYA 2WW0A 6GSYA 5HR0A 2WW2A 4WF4A 5IOWA 4ZB8A 2C8UA 4DSSB 2TRXA 4I2TA 4YAVA 2DJ3A 1TW9A 2LNTA 2WJUA 2E0QA 19GSA 1W4VA 1K3LA 2QGVA 4MA9A 1GTBA 1TTZA 5A5HB 1TU7A 1BYEA 2VL9A 3TKSA 2KLXA 4YH2A 2HRNA 2GZYA 4MH3A 4CDOA 5ELGA 5JWRB 4PNFA 2DJ2A 4G9HA 5ECOB 2QA2A 4X43A 4ISDA 1SL0B 4ZBDA 3VWXA 3D4TA 2H6ZA 2P5RA 4P3YB 1XBSA 3ME7A 4FYCA 4ZBBA 3IAM2 4WEYA 2MBTA 5IM9A 4GSSA 1PL2A 2GDRA 11GSA 1KNGA 1QK8A 4KH7A 2VCTA 4KE3A 1M3IA 2RM6A 2LS5A 4POLA 2EFHA 3WGEA 5DDLA 3HJOA 1JHBA 2RIIA 2AV4A 4KDUA 4BA7A 3QFAC 2PUKC 4J2FA 4XCSA 5D9XA 5FT3A 2C1YA 2M46A 1I5GA 2YZHA 5CREA 1M2AA 3F8UA 2R6KA 1OVNA 4V1Ag 3QMXA 4IGJA 5G30A 2LRTA 3HVSA 5CRGA 1O8XA 2H30A 3RDWA 2LEGA 5HR2A 2MMAA 2YP6A 2JL4A 3IXRA 2YV7A 4I2UA 4XHMA 3VFIA 2L6CA 4MJBA 5IIZA 3EURA 4O7HA 5E59A 2H0IA 5IO2A 5ECMB 3LQ7A 1XOAA 2VIMA 9GSSA 2IMKA 2J9HA 2O5VA 1ZMAA 2NBSA 3SBCA 2XC2A 4PI2C 1GNEA 4BVYA 4POMA 3RAZA 5ENUA 1PKZA 4BL7A 3H79A 1TRSA 4EC0A 2C0EA 1LJRA 5EVOA 5DQYA 4ZL8A 2OE0A 2ZCTA 3KZQA 1T3BA 5DAKA 2ZNMA 1RQMA 1VF3A 3CSIA 4CY8A 2H75A 3APQA 4FH8A 4ECCA 2KUCA 4N30A 2H1DA 5CYYA 5H5RA 3GKKA 2B7JA 1XVWA 3KJYA 2J23A 1PN9A 4XS6A 5J47A 1DE1A 2C0DA 1CQGA 4W66A 1C72A 4MF5A 3ZVJA 1NW2A 4Z2RA 5IPHA 2OE1A 3GIXA 2YV9A 1TDIA 4OO5A 2YWIA 1FB0A 4JE1A 2I81A 4TRXA 2EIOA 5C00A 4JZQA 4TKYA 2HSNA 3CTFA 5F8BA 3ZFBA 1SKWB 3CTGA 4K5RA 3GFKA 5B7CA 2HI7A 3LXTA 3QAGA 1Y6EA 5GSSA 4HQZA 3KXOA 5J4YA 2C0GA 3V1WA 1BJXA 4FXYP 4IELA 2WULA 2BTOT 5KN0A 2IIYA 3EU3A 2MMZA 4YQUA 5L71A 4D73A 2K6VA 2IL3A 1B4PA 2V6KA 2B1KA 2LRNA 4OO4A 1ERTA 4I97A 3KIJA 5D96A 4GWRA 4IQAA 5ABRA 4EVMA 3O3TA 4HQSA 1UC7A 2AYTA 3TJJA 1J9BA 3PGTA 4AI6A 2TIRA 1FOVA 4MZCA 1URMA 5FWGA 1GH2A 2O87A 1O8WA 2G0FA 12GSA 1JZOA 3DMLA 2H1AA 2R37A 2JSYA 3FMWA 1OC9A 4POKA 1GSFA 4TN8A 3GMFA 2FCHA 4HJ2A 2YWOA 4BVYB 2MZCA 2JU5A 4MABA 3EWLA 2CAQA 17GSA 2B3SA 2JZTA 1G7EA 3FZAA 2YJ7A 3TKQA 1RW1A 1XOBA 5ECRB 4IW9A 4LMWA 1K3YA 5FHIA 1R26A 4G01A 2DMMA 2VL2C 1TK0B 2HSHA 1X9SB 3EE2A 4TR3A 5A4VA 2XHFA 2ZUPA 3MSZA 4RI6A 3F4RA 2WB9A 3H8QA 4XS1A 4EKZA 5DVBA 2PBJA 1EP7A 2BJXA 2VLTA 2A2PA 2HNLA 5DBQA 3R2QA 1QQ2A 3A3TA 3Q6OA 4USSA 2H66A 2OT3A 3DRNA 3KCMA 2WDUA 1A23A 1I9DA 1K0CA 2F3MA 3HDCA 5ECSA 4TR1A 1UVZA 3DWVA 5IO0A 5ID2A 2GT6A 1Z7PA 3TKPA 3LYPA 4BVXB 3KP9A 3UVTA 3EMPA 2AUVA 2XBQA 2JSZA 4OCEA 2HSNB 3W6GA 3TGZA 4V2MA 4Z2UA 1BG1A 3IRAA 1M7TA 8GSSA 3FYGA 5CAXA 2WVYA 3US3A 3ZIVA 1E2YA 5BMUA 1ON4A 1GSSA 1TI1A 2FWEA 2CX3A 2GSQA 2H6XA 2WZ9A 3P90A 5IPGA 4RI7A 2JZSA 3DVXA 5A4UA 1K0OA 1BG5A 1GUMA 3M3MA 2VLUA 3Q18A 2WRTA 2MYGA 3F9UA 4E68A 1EEMA 2GZPA 4KA0A 1R7HA 2IN3A 4HEA2 4GF0A 3TJKA 1X5CA 4RUVA 1TXUA 5G5EA 1ZYEA 2LTKA 4HU7A 3UOMA 3ZYWA 4G2EA 1B48A 4OD7A 3D0ZA 1Q98A 4JU5A 4KB3A 1ZYQB 2O36A 1GP1A 2UZ8A 1GUHA 2CVDA 3DVWA 1OC9B 1M9BA 4KCEA 3M9KA 4MZWA 2A2RA 4X1UA 3KMNA 5A5HA 4K0GA 4K1FA 5COHA 5J40A 1GNWA 1CQHA 4AGSA 2FA8A 4F9ZA 2LV3A 5IQYA 2IFQB 4DEJA 3GV1A 3WT2A 2L4QA 3P8WA 4L5OA 4ZB6A 3RGBC 1ZCPA 4IVFA 3TOTA 1AXDA 14GSA 4KAEA 5D73A 4PXOA 3HD5A 5DCGA 2WVXB 4IHUA 1HNAA 1ZYPA 4EE0A 2RLIA 4K6XA 3TKRA 4G0LA 3LEFA 3TUEA 4OFMA 4ZXGA 3FK8A 3IHGA 3HVXA 3ZFLA 3L4NA 4XRDA 5CRDA 2GVPA 1K0NA 1B9XC 1J0FA 4TR1B 5ID2B 5CRHA 5B6MA 2IMFA 3H4KA 4O92A 2H19A 3GH9A 3C1SA 4K7NA 1FVKA 4GQCA 3UARA 1SVLA 1Z9HA 2CZ3A 3PH9A 5D8IA 1EEJA 3KGKA 4ZB9A 2AAWA 3C8EA 3QFBC 18GSA 2LJRA 1ZOFA 2WGRA 2XBIA 5BMUB 1F3AA 3GN3A 3GX8A 1SJZA 2DJ0A 2LQOA 2ON7A 3KP8A 3C7MA 2E2MA 2VL2A 3RHBA 1VF4A 3A2VA 1U3IA 1XW6A 4HZ2A 2HXKA 3A2WA 5IMCA 4ECBA 3CSJA 3BCIA 3BJ5A 3CSHA 3FHKA 3W8JA 4OFNA 2B7KA 1LU4A 3IV4A 2OADA 3VPTA 6GSSA 5ECIB 4FYBA 3UVHA 4IQ1A 3NIVA 2DJJA 4XIHA 2YJHA 4MDCA 1GWCA 1BX9A 1H75A 1R4WA 2DIZA 1Z6NA 4WKWA 4NAXA 4OWYA 3ZZXA 4KCAA 2VCVA 1DBYA 2FNOA 3TRPA 5J4UA 3CXGA 4YKFA 2GLRA 3G9BA 4N11A 3UIWA 3UEMA 4TOPA 4FYUA 2FWFA 5CNWA 3HHVA 3F0IA 2A4HA 1SL2B 4EL1A 2E2GA 3GA4A 2PVQA 5D9TA 2L57A 1M2BA 3VWUA 1K0AA 3WYWA 2HRAA 1MD3A 2P5QA 4HU9A 3M0FA 5C04A 4MCUA 3LSZA 2GZZA 5LNKe 1FO5A 5ECNB 2O8VB 5H5SA 4LL1B 1ZZYA 1S4BP 1KTEA 4MP4A 5BRTA 4YQVA 4JRRA 1JFUA 3CRUA 5IMFA 2WS2A 3ZREA 3GURA 3MWHA 3BOAA 2WZSA 4TXVA 5B8BA 1SVMA 1EGRA 2PMTA 5ECHB 2X49A 2WW3A 3HJPA 3DD3A 3I43A 2R4VA 1THOA 1XIYA 3L0HA 3FW2A 4PI0C 3UBKA 3D21A 2DBCA 3M1GA 1OAZA 1TRUA 1TK5B 1FHEA 1GRXA 1AC1A 1QUWA 2QSIA 1EOHA 1XZOA 3QD9A 4GCIA 2DKHA 1N2AA 5AIXA 1YVLA 4K9ZA 2K18A 4ECIA 2VCQA 3LFLA 4ZL9A 5KN3A 2GTUA 1FAAA 3TRXA 1BQ7A 2TRCP 2AJQB 4O5UA 5HFGA 4WR5A 2YPMA 4ML1A 6GSWA 2I9HA 2AB6A 1RK4A 4NMUA 4PX1A 3I6AA 2MMOA 4OMVA 1MD4A 4TXOA 5KN1A 5IMAA 3DGQA 3ISOA 3IK9A 1QGVA 2VOCA 2CVBA 1THXA 3QCPA 1S3DA 1XG8A 1EOGA 1SVOA 3F6FA 2QA1A 3E0UA 3LG6A 2IJYA 4ML6A 2VL3A 3CWGA 2I4AA 2C80A 5G1LA 4F0CA 1YEWC 1V40A 2HSYA 5J9CA 1YEXA 4PGTA 5A1NA 2HRFA 2DLXA 4EIQA 2MBSA 3UBLA 3FZ9A 4DSQA 3IE3A 1FG4A 1PN0A 2V41A 2VLVA 4HS1A 5ECLB 1W89A 4PUAA 3HMJG 2YWMA 1TKDB 4E8HA 1EGOA 2PGTA 3TB2A 4MH2A 3CQFA 3I9V2 1YJ6A 5CRWA 3QAVA 3VK9A 3ERWA 3UMAA 4BVXA 3KTLA 1ZYNA 2HZEA 2OBIA 1YQ1A 3ME8A 1M2DA 2R2JA 2GGTA 1PSQA 2A2SA 2CVKA 4LLRA 2GT5A 1I1IP 1MTCA 2GQMA 4WR4A 1QMVA 3CHXC 4EDZA 5E4WA 3E9JB 3VPQA 4N3ZA 3G7IA 5CP1A 2KOKA
chains in the Genus database with same CATH topology
1SD9A 2B5EA 4XS4B 4JR4A 2YANA 4FO5A 3BCKA 1V57A 4CW9A 2KP1A 2F9SA 4Q5RA 2L4CA 2HE3A 5F06A 2H70A 4K5SA 3R3EA 2FLSA 4V2LA 2X64A 3IR4A 1KEBA 3GYKA 3D6IA 3UL3A 3IC8A 2LJAA 5AGYA 3ZIJA 1BEDA 3TRQA 4MMMA 1B9YC 4PQ1A 3J7Yk 3MYDA 1FB6A 3KMOA 1K0BA 4QMKA 1X9WB 4G19A 3ZVJD 4ZB7A 3CMIA 5AISA 2X99A 1WE0A 4A5PA 4JBBA 2F8AA 3C73A 1SU9A 1OE7A 2L5LA 1NM3A 4TXOB 1AQVA 3O6TA 4WETA 1FVJA 2IFQA 1TU8A 5GAPD 1V2AA 3N5OA 3BD2A 4HI7A 4HZ4A 2M80A 4H86A 1M0UA 1X5DA 1XWGA 2YWNA 1O73A 5J5NA 4EO3A 1WPIA 4GSNA 1YEPA 4GDFA 2VM1A 3P7XA 2H76A 2LSTA 3H93A 2V6OA 4X4JA 1SKSB 1GUKA 1PMTA 5A1NB 2NDOA 3QPMA 4NV2A 4K7IA 3HVVA 4N10A 4FIWA 2B6MA 2K8SA 1GTIA 3HA9A 3FZ5A 1ML6A 2FWGA 3CBUA 2N5AA 3VI5A 2IMIA 1SK1A 2M72A 4JEDA 5JCWA 3UJ1A 3LGCA 2HZEB 5HFIA 2PN8A 4TR4A 1OKDA 2L6DA 2O7KA 3PR8A 3MAKA 3QR6A 4N0VA 2H8LA 2FD3A 3TCOA 2C4JA 1MDJA 4GQFA 4KX4A 2NVLA 3IDVA 3K8NA 4AJ8A 3U5RE 5JCUA 1PQNA 4ZBAA 3FKFA 2V1MA 1DUGA 3HXSA 2C3QA 4KDXA 1PD21 1EZKA 3WD6A 3M8NA 3A2XA 2FWHA 2LNSA 5GZZB 3H1NA 2V2GA 3HZ4A 2H73A 2BMXA 4FQUA 2REMA 3ED3A 2HSMB 3PINA 3WT1A 1UA5A 4ZILA 1ZL9A 2V32A 2H1GA 1A8YA 3KD0A 1VF2A 3TKSE 16GSA 1XVQA 2HT9A 3IK7A 4I5QA 3LORA 3D5JA 5GSTA 4O5RA 4JR6A 2HZFA 2YCDA 4KSOA 5A4WA 2X8GA 2H0GA 1JLVA 4O32A 1O7UA 4GXZA 2AHEA 1V9WA 3GH6A 3ZITA 1PRXA 2EC4A 4AKGA 3W8SA 5DJLA 1XW9A 3P2AA 3QOUA 4TR0A 4XTSA 1Z3EA 3RPNA 2GQLA 3HZ8A 2H71A 3C71A 2I3YA 4EIPA 1GLQA 4F2IA 4KF9A 4NHZA 1F9MA 3L9VA 22GSA 3LWAA 4AJ7A 4X0XA 3GNJA 5J3RA 2FGXA 1Y1UA 1X5EA 1IYIA 2H0HA 4QQ7A 4IP1A 3L78A 2HQTA 7GSSA 3RHCA 1AQXA 1SD8A 2HFDA 2XPEA 4K0NA 2H72A 1WOUA 4MLYA 4G0KA 4Z2TA 2OE3A 5DALA 6GSVA 2WCIA 1XPVA 4AKIA 1G0TA 4AF2A 2MMNA 2JZRA 1WMJA 1XWCA 3BBYA 4GTUA 3GL3A 3APSA 5A34A 1Z7RA 4WXTA 2CQ9A 4MNNA 1U88A 1NHOA 4ECJA 3OR5A 1GSYA 1OC3A 1XWKA 1O81A 1JZWA 2KP2A 1T8EB 3F4SA 4WF5A 4PTSA 3GRXA 2RUFA 1YDKA 3QDNA 4ILFA 3RBTA 4HJMA 3U6VA 1GL8A 4G0IA 4TVEA 1LBKA 4XRAA 4LMVA 5F05A 1JLWA 5KEJA 1PX7A 3Q74A 1GSUA 4YAPA 2HYXA 2C3TA 1T00A 1N25A 4EDYA 3L9UA 1XW5A 1GTAA 1FOHA 1TJDA 1AQWA 3LYKA 4NWYA 2YZUA 3FRCA 5EPFA 1HQOA 3GTUB 3DKSA 2OACA 2GSTA 4MJAA 2VCWA 4AJ6A 1F37A 1XCCA 2B1LA 4I6XA 3F6DA 2VM2A 1SYXA 3IPZA 13GSA 4MF7A 1AUCA 4MZBA 1X9MB 3UAPA 2DSAA 2RM5A 3KEBA 4K7OA 2ES7A 1UN2A 2R3XA 4CY6A 3S9FA 3D4MA 3RPPA 3WGDA 4NHWA 1TOFA 4QL7A 1YKCA 5J4VA 2FA4A 2O85A 5GAND 1YY7A 5EL8A 5ECPB 1WJKA 4F0BA 1B8XA 2PWJA 5LD0A 4XS4A 4TW5A 3ZMKA 2EIRA 3ZMLA 2L59A 4AKHA 3ZTLA 2N5FA 1XWBA 5CO3A 4ACSA 1X0RA 5DALB 3MDKA 5JCGA 1G6WA 1VRSD 1AIUA 3SWLA 2R0CA 5B8AA 3F63A 2IMDA 2LJKA 2E7PA 1TP9A 3GSSA 5EY6A 2HLSA 3L9SA 2H74A 3DXBA 3IOSA 3HCZA 3EINA 4RQRA 5A34B 3VWWA 1T4YA 2H1BA 3FR6A 3O76A 4ZL7A 3VWVA 3HY2A 4NPBA 3GHAA 5G2ZA 1HNCA 3VI7A 1MDIA 1EV4A 4G10A 3HYPA 4YKGA 4O5QA 4IN0A 1F2EA 5B6NA 4K2XA 4PNGA 4BWQA 2FHEA 2H1LA 5AIVA 1EP8A 2CT6A 4ICYA 1NHYA 4EUYA 2N5BA 1T7PB 3KM6A 1XXUA 5LCZA 2LKUA 2IPAA 4Q5FA 2P0GA 3DIEA 2UV8G 1SL1B 1A8LA 5HR3A 1ERVA 4LL4B 3TDGA 1OE8A 3DEXA 3J7Yb 1M99A 1V98A 3M9JA 3IA1A 2VD0A 3EC3A 1K3OA 1ERUA 4ID0A 1GULA 1N8JA 1F3BA 1PA3A 2YN1A 1YKAA 4PUFC 5KOXA 1MDKA 3GL5A 5G31A 3E3EA 2VCZA 2YNXA 10GSA 2OKAA 1JZRA 3F3QA 1A0FA 4NXIA 5ELAA 2EFCA 5AN1A 1Q4JA 3QAWA 2P31A 1AW9A 3HJMA 4J56E 5D9WA 4L5LA 1DSBA 1A2LA 4I8BA 2OBKA 3KH9A 2K8VA 2LQQA 1R5PA 4CHSA 1R5AA 2GSSA 3GSTA 3Q19A 3I69A 2CA8A 4KW6A 3D22A 2DJ1A 1ACVA 2FUG2 2K9FA 2RUEA 1XWAA 3MIXA 1EV9A 5IMVA 5DQSA 2DC5A 1ERWA 4L8EA 6GSUA 1Z5YE 1TI3A 3TOUA 1E6BA 4PURA 2HRKA 1Z6MA 1OKTA 1BF5A 1PX6A 6GSXA 4Z7XA 2VAFA 1U87A 1U6TA 4J57E 4MF6A 2ON5A 2F8FA 2OJLA 3PPUA 1EWXA 1F6MC 2XPDA 3GKNA 4WBJA 2HSMA 4Q5QA 3G7YA 2H01A 1SJIA 4POBA 4GSTA 3JCML 5D93A 1USBA 4MPFA 4YQMA 5H5QA 5KN2A 2KHPA 2R0PA 3NOFA 3VURA 4LA1A 2PPTA 4PQHA 5HR1A 1A24A 1TRVA 2EFDA 1HNBA 2DMLA 1YZXA 4N0ZA 1PKWA 4KDYA 1K0MA 3EVIA 4QL9A 4IBPA 1GSQA 2B5YA 1PGTA 5G5FA 2IWTA 2NPBA 4V2NA 4E8EA 4BL7B 1G6YA 3GUSA 2CV4A 2H6YA 2DKIA 4HDEA 3A5WA 2QC7A 3ERFA 1K0DA 2B5XA 3EMXA 4Q5NA 5A5KA 5DAKB 5IOXA 1QFNA 1WP0A 3IC4A 1QXHA 1OC8A 2QKEA 4IP6A 5DCHA 4GLTA 3DYRA 3VLNA 3FEUA 4MJCA 5G1KA 5IMDA 3NZNA 1J08A 1O6JA 1S3AA 1H4OA 3F3RA 2A4VA 3GX0A 4NV5A 3LXZA 2Z9SA 1Y25A 1U3AA 1OYJA 2C3NA 3KH7A 1V58A 1XFLA 1GLPA 2CZ2A 2X8HA 4ZIJA 1PL1A 1JZDA 1SENA 1IYHA 4EF0A 4K2DA 4DSRA 3TKSC 3LW9A 4KNDA 1WRYA 3LJRA 3CRTA 2WFCA 1VF1A 5ECQB 2O89A 1FW1A 1TK8B 5J41A 4D73B 5F0GA 3WGXA 5JWOB 1ILOA 3EU4A 2PU9C 1A0RP 4IJIA 2HRKB 2R5GA 3G7JA 3ERGA 1DE2A 3ZRDA 1G7OA 2CAIA 5INYA 4OFTA 4L0UA 4KSMA 4F03A 3KTBA 3TJGA 4KGIA 5HFKA 1ZGNA 6GSTA 4DVCA 4L0WA 2ALBA 4DSSA 1M9AA 1O85A 1YF0A 5JWQB 2IMEA 2DIYA 3ZL5A 4K8MA 2VKZG 2GS3A 3GTUA 3IHQA 1A2JA 1TRWA 4RQXA 4IJ3A 2VD1A 3TJBA 2I1UA 2GSRA 3A5IA 2X8CA 3TU3B 1TXXA 3AY8A 4PQIA 1T1VA 2C0FA 3IAS2 2G2QA 1B4QA 3EYTA 3ZLPA 4GRFA 4KUNA 4HOJA 3FZ4A 2DJKA 1ST9A 4ULXA 4OCFA 1HD2A 5ECKB 2LUSA 1HYUA 2VO4A 2EIQA 3TJFA 3GKMA 4EXJA 5D9VA 2JADA 2VUPA 2EFEA 4AKXB 3EPTA 4V1Ap 5IMZA 1SK2A 4WBRD 4BPYA 2YOIA 2OA7A 2PVOC 4MJEA 4HUAA 1YF1A 2PERA 4MPGA 2L5OA 4IKHA 1SYRA 3CYNA 2F51A 3APOA 1WWJA 1MEKA 5HQPA 1GSEA 4F82A 3HKRA 2CX4A 4IS0A 1A2MA 2LRCA 1NSWA 1SJ6A 5J9BA 5DJMA 1ABAA 4BWSA 2NTOA 1WIKA 2VCXA 1SKRB 2FY6A 3MNGA 2R0GA 1GTUA 3FR3A 1S3CA 3C1RA 5F07A 3GKXA 1VGLA 20GSA 3F4TA 3IBHA 3FR9A 2JACA 1KBNA 3FY7A 2X4AA 1SK0A 4MK3A 2GQKA 1T4ZA 2D2ZA 5KOWA 3N9JA 1GSDA 1AAZA 1BAYA 6GSYA 5HR0A 4WF4A 5IOWA 4ZB8A 2C8UA 4DSSB 2TRXA 4I2TA 4YAVA 2DJ3A 1TW9A 2LNTA 2WJUA 2E0QA 19GSA 1W4VA 1K3LA 2QGVA 4MA9A 1GTBA 1TTZA 5A5HB 1TU7A 1BYEA 2VL9A 3TKSA 2KLXA 4YH2A 2HRNA 2GZYA 4MH3A 4CDOA 5ELGA 5JWRB 4PNFA 2DJ2A 4G9HA 5ECOB 2QA2A 4X43A 4ISDA 1SL0B 4ZBDA 3VWXA 3D4TA 2H6ZA 2P5RA 4P3YB 1XBSA 3ME7A 4FYCA 4ZBBA 3IAM2 4WEYA 2MBTA 5IM9A 4GSSA 1PL2A 2GDRA 11GSA 1KNGA 1QK8A 4KH7A 2VCTA 4KE3A 2RM6A 2LS5A 4POLA 2EFHA 3WGEA 5DDLA 3HJOA 1JHBA 2RIIA 2AV4A 4KDUA 4BA7A 3QFAC 2PUKC 4J2FA 4XCSA 5D9XA 5FT3A 2C1YA 2M46A 1I5GA 2YZHA 5CREA 1M2AA 3F8UA 2R6KA 1OVNA 4V1Ag 3QMXA 4IGJA 5G30A 2LRTA 3HVSA 5CRGA 1O8XA 2H30A 3RDWA 2LEGA 5HR2A 2MMAA 2YP6A 2JL4A 3IXRA 2YV7A 4I2UA 4XHMA 3VFIA 2L6CA 4MJBA 5IIZA 3EURA 4O7HA 5E59A 2H0IA 5IO2A 5ECMB 3LQ7A 1XOAA 2VIMA 9GSSA 2IMKA 2J9HA 2O5VA 1ZMAA 2NBSA 3SBCA 2XC2A 1GNEA 4BVYA 4POMA 3RAZA 5ENUA 1PKZA 4BL7A 3H79A 1TRSA 4EC0A 2C0EA 1LJRA 5EVOA 5DQYA 4ZL8A 2OE0A 2ZCTA 3KZQA 1T3BA 5DAKA 2ZNMA 1RQMA 1VF3A 3CSIA 4CY8A 2H75A 3APQA 4FH8A 4ECCA 2KUCA 4N30A 2H1DA 5CYYA 5H5RA 3GKKA 2B7JA 1XVWA 3KJYA 2J23A 1PN9A 4XS6A 5J47A 1DE1A 2C0DA 1CQGA 4W66A 1C72A 4MF5A 3ZVJA 1NW2A 4Z2RA 5IPHA 2OE1A 3GIXA 2YV9A 1TDIA 4OO5A 2YWIA 1FB0A 4JE1A 2I81A 4TRXA 2EIOA 5C00A 4JZQA 4TKYA 2HSNA 3CTFA 5F8BA 3ZFBA 1SKWB 3CTGA 4K5RA 3GFKA 5B7CA 2HI7A 3LXTA 3QAGA 1Y6EA 5GSSA 4HQZA 3KXOA 5J4YA 2C0GA 3V1WA 1BJXA 4IELA 2WULA 2BTOT 5KN0A 2IIYA 3EU3A 2MMZA 4YQUA 5L71A 4D73A 2K6VA 2IL3A 1B4PA 2V6KA 2B1KA 2LRNA 4OO4A 1ERTA 4I97A 3KIJA 5D96A 4GWRA 4IQAA 5ABRA 4EVMA 3O3TA 4HQSA 1UC7A 2AYTA 3TJJA 1J9BA 3PGTA 4AI6A 2TIRA 1FOVA 4MZCA 1URMA 5FWGA 1GH2A 2O87A 1O8WA 2G0FA 12GSA 1JZOA 3DMLA 2H1AA 2R37A 2JSYA 3FMWA 1OC9A 4POKA 1GSFA 4TN8A 3GMFA 2FCHA 4HJ2A 2YWOA 4BVYB 2MZCA 2JU5A 4MABA 3EWLA 2CAQA 17GSA 2B3SA 2JZTA 1G7EA 3FZAA 2YJ7A 3TKQA 1RW1A 1XOBA 5ECRB 4IW9A 4LMWA 1K3YA 5FHIA 1R26A 4G01A 2DMMA 2VL2C 1TK0B 2HSHA 1X9SB 3EE2A 4TR3A 5A4VA 2XHFA 2ZUPA 3MSZA 4RI6A 3F4RA 2WB9A 3H8QA 4XS1A 4EKZA 5DVBA 2PBJA 1EP7A 2BJXA 2VLTA 2A2PA 2HNLA 5DBQA 3R2QA 1QQ2A 3A3TA 3Q6OA 4USSA 2H66A 2OT3A 3DRNA 3KCMA 2WDUA 1A23A 1I9DA 1K0CA 2F3MA 3HDCA 5ECSA 4TR1A 1UVZA 3DWVA 5IO0A 5ID2A 2GT6A 1Z7PA 3TKPA 3LYPA 4BVXB 3KP9A 3UVTA 3EMPA 2AUVA 2XBQA 2JSZA 4OCEA 2HSNB 3W6GA 3TGZA 4V2MA 4Z2UA 1BG1A 3IRAA 1M7TA 3FYGA 8GSSA 5CAXA 3US3A 3ZIVA 1E2YA 5BMUA 1ON4A 1GSSA 1TI1A 2FWEA 2CX3A 2GSQA 2H6XA 2WZ9A 3P90A 5IPGA 4RI7A 2JZSA 3DVXA 5A4UA 1K0OA 1BG5A 1GUMA 3M3MA 2VLUA 3Q18A 2WRTA 2MYGA 3F9UA 4E68A 1EEMA 2GZPA 4KA0A 1R7HA 2IN3A 4HEA2 4GF0A 3TJKA 1X5CA 4RUVA 1TXUA 5G5EA 1ZYEA 2LTKA 4HU7A 3UOMA 3ZYWA 4G2EA 1B48A 4OD7A 3D0ZA 1Q98A 4JU5A 4KB3A 1ZYQB 1GP1A 2UZ8A 1GUHA 2CVDA 3DVWA 1OC9B 1M9BA 4KCEA 3M9KA 4MZWA 2A2RA 4X1UA 3KMNA 5A5HA 4K0GA 4K1FA 5COHA 5J40A 1GNWA 1CQHA 4AGSA 2FA8A 4F9ZA 2LV3A 5IQYA 2IFQB 4DEJA 3GV1A 3WT2A 2L4QA 3P8WA 4L5OA 4ZB6A 1ZCPA 4IVFA 3TOTA 1AXDA 14GSA 4KAEA 5D73A 4PXOA 3HD5A 5DCGA 4IHUA 1HNAA 1ZYPA 4EE0A 2RLIA 4K6XA 3TKRA 4G0LA 3LEFA 3TUEA 4OFMA 4ZXGA 3FK8A 3IHGA 3HVXA 3ZFLA 3L4NA 4XRDA 5CRDA 2GVPA 1K0NA 1B9XC 1J0FA 4TR1B 5ID2B 5CRHA 5B6MA 2IMFA 3H4KA 4O92A 2H19A 3GH9A 3C1SA 4K7NA 1FVKA 4GQCA 3UARA 1SVLA 1Z9HA 2CZ3A 3PH9A 5D8IA 1EEJA 3KGKA 4ZB9A 2AAWA 3C8EA 3QFBC 18GSA 2LJRA 1ZOFA 2WGRA 2XBIA 5BMUB 1F3AA 3GN3A 3GX8A 1SJZA 2DJ0A 2LQOA 2ON7A 3KP8A 3C7MA 2E2MA 2VL2A 3RHBA 1VF4A 3A2VA 1U3IA 1XW6A 4HZ2A 2HXKA 3A2WA 5IMCA 4ECBA 3CSJA 3BCIA 3BJ5A 3CSHA 3FHKA 3W8JA 4OFNA 2B7KA 1LU4A 3IV4A 2OADA 3VPTA 6GSSA 5ECIB 4FYBA 3UVHA 4IQ1A 3NIVA 2DJJA 4XIHA 2YJHA 4MDCA 1GWCA 1BX9A 1H75A 1R4WA 2DIZA 1Z6NA 4WKWA 4NAXA 4OWYA 3ZZXA 4KCAA 2VCVA 1DBYA 2FNOA 3TRPA 5J4UA 3CXGA 4YKFA 2GLRA 3G9BA 4N11A 3UIWA 3UEMA 4TOPA 4FYUA 2FWFA 5CNWA 3HHVA 3F0IA 2A4HA 1SL2B 4EL1A 2E2GA 3GA4A 2PVQA 5D9TA 2L57A 1M2BA 3VWUA 1K0AA 3WYWA 2HRAA 1MD3A 2P5QA 4HU9A 3M0FA 5C04A 4MCUA 3LSZA 2GZZA 5LNKe 1FO5A 5ECNB 2O8VB 5H5SA 4LL1B 1ZZYA 1KTEA 4MP4A 5BRTA 4YQVA 4JRRA 1JFUA 3CRUA 5IMFA 2WS2A 3ZREA 3GURA 3MWHA 3BOAA 4TXVA 5B8BA 1SVMA 1EGRA 2PMTA 5ECHB 2X49A 3HJPA 3DD3A 3I43A 2R4VA 1THOA 1XIYA 3L0HA 3FW2A 3UBKA 3D21A 2DBCA 3M1GA 1OAZA 1TRUA 1TK5B 1FHEA 1GRXA 1AC1A 1QUWA 2QSIA 1EOHA 1XZOA 3QD9A 4GCIA 2DKHA 1N2AA 5AIXA 1YVLA 4K9ZA 2K18A 4ECIA 2VCQA 3LFLA 4ZL9A 5KN3A 2GTUA 1FAAA 3TRXA 1BQ7A 2TRCP 2AJQB 4O5UA 5HFGA 4WR5A 2YPMA 4ML1A 6GSWA 2I9HA 2AB6A 1RK4A 4NMUA 4PX1A 3I6AA 2MMOA 4OMVA 1MD4A 4TXOA 5KN1A 5IMAA 3DGQA 3ISOA 3IK9A 1QGVA 2VOCA 2CVBA 1THXA 3QCPA 1S3DA 1EOGA 1SVOA 3F6FA 2QA1A 3E0UA 3LG6A 2IJYA 4ML6A 2VL3A 3CWGA 2I4AA 2C80A 5G1LA 4F0CA 1V40A 2HSYA 5J9CA 1YEXA 4PGTA 5A1NA 2HRFA 2DLXA 4EIQA 2MBSA 3UBLA 3FZ9A 4DSQA 3IE3A 1FG4A 1PN0A 2V41A 2VLVA 4HS1A 5ECLB 1W89A 4PUAA 3HMJG 2YWMA 1TKDB 4E8HA 1EGOA 2PGTA 3TB2A 4MH2A 3I9V2 1YJ6A 5CRWA 3QAVA 3VK9A 3ERWA 3UMAA 4BVXA 3KTLA 1ZYNA 2HZEA 2OBIA 1YQ1A 3ME8A 1M2DA 2R2JA 2GGTA 1PSQA 2A2SA 2CVKA 4LLRA 2GT5A 1MTCA 2GQMA 4WR4A 1QMVA 4EDZA 5E4WA 3E9JB 3VPQA 4N3ZA 3G7IA 5CP1A 2KOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD9 A;  2B5E A;  4XS4 B;  4JR4 A;  2YAN A;  4FO5 A;  3BCK A;  1V57 A;  4CW9 A;  2KP1 A;  2F9S A;  4Q5R A;  2L4C A;  2HE3 A;  5F06 A;  2H70 A;  3R3E A;  2FLS A;  4V2L A;  2X64 A;  3IR4 A;  1KEB A;  3GYK A;  3D6I A;  3UL3 A;  3IC8 A;  2LJA A;  5AGY A;  3ZIJ A;  1BED A;  3TRQ A;  4MMM A;  1B9Y C;  4PQ1 A;  3J7Y k;  1FB6 A;  3KMO A;  1K0B A;  1X9W B;  4G19 A;  3ZVJ D;  3CMI A;  5AIS A;  2X99 A;  1WE0 A;  4JBB A;  2F8A A;  3C73 A;  1SU9 A;  1OE7 A;  2L5L A;  1NM3 A;  4TXO B;  1AQV A;  3O6T A;  4WET A;  1FVJ A;  2IFQ A;  1TU8 A;  5GAP D;  1V2A A;  3N5O A;  3BD2 A;  4HI7 A;  4HZ4 A;  2M80 A;  4H86 A;  1M0U A;  1X5D A;  1XWG A;  2YWN A;  1O73 A;  5J5N A;  4EO3 A;  1WPI A;  4GSN A;  1YEP A;  3P7X A;  2VM1 A;  2H76 A;  2LST A;  3H93 A;  2V6O A;  1SKS B;  1GUK A;  1PMT A;  2NDO A;  3QPM A;  4NV2 A;  4K7I A;  3HVV A;  4N10 A;  4FIW A;  2B6M A;  2K8S A;  1GTI A;  3HA9 A;  3FZ5 A;  1ML6 A;  2FWG A;  3CBU A;  2N5A A;  3VI5 A;  2IMI A;  1SK1 A;  2M72 A;  4JED A;  5JCW A;  3UJ1 A;  3LGC A;  2HZE B;  5HFI A;  2PN8 A;  4TR4 A;  1OKD A;  2L6D A;  2O7K A;  3PR8 A;  3MAK A;  3QR6 A;  4N0V A;  2H8L A;  2FD3 A;  3TCO A;  2C4J A;  1MDJ A;  4GQF A;  4KX4 A;  2NVL A;  3IDV A;  3K8N A;  4AJ8 A;  3U5R E;  5JCU A;  1PQN A;  4ZBA A;  3FKF A;  2V1M A;  1DUG A;  3HXS A;  2C3Q A;  4KDX A;  1PD2 1;  1EZK A;  3WD6 A;  3M8N A;  3A2X A;  2FWH A;  2LNS A;  5GZZ B;  3H1N A;  2V2G A;  3HZ4 A;  2H73 A;  2BMX A;  4FQU A;  2REM A;  3ED3 A;  2HSM B;  3PIN A;  3WT1 A;  1UA5 A;  4ZIL A;  1ZL9 A;  2V32 A;  2H1G A;  1A8Y A;  3KD0 A;  1VF2 A;  3TKS E;  16GS A;  1XVQ A;  2HT9 A;  3IK7 A;  4I5Q A;  3LOR A;  3D5J A;  5GST A;  4O5R A;  4JR6 A;  2HZF A;  2YCD A;  4KSO A;  5A4W A;  2X8G A;  2H0G A;  1JLV A;  4O32 A;  1O7U A;  4GXZ A;  2AHE A;  1V9W A;  3GH6 A;  3ZIT A;  1PRX A;  2EC4 A;  3W8S A;  5DJL A;  1XW9 A;  3P2A A;  3QOU A;  4TR0 A;  4XTS A;  1Z3E A;  3RPN A;  2GQL A;  3HZ8 A;  2H71 A;  3C71 A;  2I3Y A;  1GLQ A;  4F2I A;  4KF9 A;  4NHZ A;  1F9M A;  3L9V A;  22GS A;  3LWA A;  4AJ7 A;  4X0X A;  3GNJ A;  5J3R A;  2FGX A;  1X5E A;  1IYI A;  2H0H A;  4QQ7 A;  4IP1 A;  3L78 A;  2HQT A;  7GSS A;  3RHC A;  1AQX A;  1SD8 A;  2HFD A;  2XPE A;  4K0N A;  2H72 A;  1WOU A;  4MLY A;  4G0K A;  2OE3 A;  5DAL A;  6GSV A;  2WCI A;  1XPV A;  1G0T A;  4AF2 A;  2MMN A;  2JZR A;  1WMJ A;  1XWC A;  3BBY A;  4GTU A;  3APS A;  3GL3 A;  4WXT A;  1Z7R A;  2CQ9 A;  1U88 A;  1NHO A;  4ECJ A;  3OR5 A;  1GSY A;  1OC3 A;  1XWK A;  1O81 A;  1JZW A;  2KP2 A;  1T8E B;  3F4S A;  4WF5 A;  4PTS A;  3GRX A;  2RUF A;  1YDK A;  3QDN A;  4ILF A;  3RBT A;  4HJM A;  3U6V A;  1GL8 A;  4G0I A;  4TVE A;  1LBK A;  4XRA A;  4LMV A;  5F05 A;  1JLW A;  5KEJ A;  1PX7 A;  3Q74 A;  1GSU A;  4YAP A;  2HYX A;  2C3T A;  1T00 A;  4EDY A;  3L9U A;  1XW5 A;  1GTA A;  1TJD A;  1AQW A;  3LYK A;  4NWY A;  2YZU A;  3FRC A;  5EPF A;  1HQO A;  3GTU B;  3DKS A;  2OAC A;  2GST A;  4MJA A;  2VCW A;  4AJ6 A;  1F37 A;  1XCC A;  2B1L A;  4I6X A;  3F6D A;  2VM2 A;  1SYX A;  3IPZ A;  13GS A;  4MF7 A;  1AUC A;  4MZB A;  1X9M B;  3UAP A;  2DSA A;  2RM5 A;  3KEB A;  4K7O A;  2ES7 A;  1UN2 A;  2R3X A;  3S9F A;  3D4M A;  3RPP A;  3WGD A;  4NHW A;  1TOF A;  4QL7 A;  1YKC A;  2FA4 A;  2O85 A;  5GAN D;  1YY7 A;  5EL8 A;  5ECP B;  1WJK A;  4F0B A;  1B8X A;  2PWJ A;  5LD0 A;  4XS4 A;  4TW5 A;  3ZMK A;  2EIR A;  3ZML A;  2L59 A;  3ZTL A;  2N5F A;  1XWB A;  5CO3 A;  4ACS A;  1X0R A;  5DAL B;  3MDK A;  5JCG A;  1G6W A;  1VRS D;  1AIU A;  3SWL A;  5B8A A;  3F63 A;  2IMD A;  2LJK A;  2E7P A;  1TP9 A;  3GSS A;  5EY6 A;  2HLS A;  3L9S A;  2H74 A;  3DXB A;  3IOS A;  3HCZ A;  3EIN A;  4RQR A;  3VWW A;  1T4Y A;  2H1B A;  3FR6 A;  3O76 A;  4ZL7 A;  3VWV A;  3HY2 A;  4NPB A;  3GHA A;  5G2Z A;  1HNC A;  3VI7 A;  1MDI A;  1EV4 A;  4G10 A;  3HYP A;  4IN0 A;  1F2E A;  5B6N A;  4PNG A;  4BWQ A;  2FHE A;  5AIV A;  1EP8 A;  2CT6 A;  1NHY A;  4EUY A;  2N5B A;  1T7P B;  3KM6 A;  1XXU A;  5LCZ A;  2LKU A;  2IPA A;  4Q5F A;  2P0G A;  3DIE A;  1SL1 B;  1A8L A;  5HR3 A;  1ERV A;  4LL4 B;  3TDG A;  1OE8 A;  3DEX A;  3J7Y b;  1M99 A;  1V98 A;  3M9J A;  3IA1 A;  2VD0 A;  3EC3 A;  1K3O A;  1ERU A;  4ID0 A;  1GUL A;  1N8J A;  1F3B A;  1PA3 A;  2YN1 A;  1YKA A;  4PUF C;  1MDK A;  3GL5 A;  5G31 A;  3E3E A;  2VCZ A;  2YNX A;  10GS A;  2OKA A;  1JZR A;  3F3Q A;  1A0F A;  4NXI A;  5ELA A;  5AN1 A;  1Q4J A;  3QAW A;  2P31 A;  1AW9 A;  3HJM A;  4J56 E;  5D9W A;  4L5L A;  1DSB A;  1A2L A;  4I8B A;  2OBK A;  3KH9 A;  2K8V A;  2LQQ A;  1R5P A;  4CHS A;  1R5A A;  2GSS A;  3GST A;  3Q19 A;  3I69 A;  2CA8 A;  4KW6 A;  3D22 A;  2DJ1 A;  1ACV A;  2FUG 2;  2K9F A;  2RUE A;  1XWA A;  1EV9 A;  5IMV A;  5DQS A;  2DC5 A;  1ERW A;  4L8E A;  6GSU A;  1Z5Y E;  1TI3 A;  3TOU A;  1E6B A;  4PUR A;  2HRK A;  1Z6M A;  1OKT A;  1PX6 A;  6GSX A;  4Z7X A;  2VAF A;  1U87 A;  1U6T A;  4J57 E;  4MF6 A;  2ON5 A;  2F8F A;  2OJL A;  3PPU A;  1EWX A;  1F6M C;  2XPD A;  3GKN A;  4WBJ A;  2HSM A;  4Q5Q A;  3G7Y A;  2H01 A;  1SJI A;  4POB A;  4GST A;  3JCM L;  5D93 A;  1USB A;  4MPF A;  4YQM A;  5H5Q A;  5KN2 A;  2KHP A;  3NOF A;  3VUR A;  4LA1 A;  2PPT A;  4PQH A;  5HR1 A;  1A24 A;  1TRV A;  1HNB A;  2DML A;  1YZX A;  4N0Z A;  1PKW A;  4KDY A;  1K0M A;  3EVI A;  4QL9 A;  4IBP A;  1GSQ A;  2B5Y A;  1PGT A;  5G5F A;  2IWT A;  2NPB A;  4V2N A;  4E8E A;  4BL7 B;  1G6Y A;  3GUS A;  2CV4 A;  2H6Y A;  4HDE A;  3A5W A;  2QC7 A;  3ERF A;  1K0D A;  2B5X A;  3EMX A;  4Q5N A;  5A5K A;  5DAK B;  5IOX A;  1QFN A;  1WP0 A;  3IC4 A;  1QXH A;  1OC8 A;  2QKE A;  4IP6 A;  5DCH A;  4GLT A;  3DYR A;  3VLN A;  3FEU A;  4MJC A;  5G1K A;  5IMD A;  3NZN A;  1J08 A;  1O6J A;  1S3A A;  1H4O A;  3F3R A;  2A4V A;  3GX0 A;  4NV5 A;  3LXZ A;  2Z9S A;  1Y25 A;  1U3A A;  1OYJ A;  2C3N A;  3KH7 A;  1V58 A;  1XFL A;  1GLP A;  2CZ2 A;  2X8H A;  4ZIJ A;  1PL1 A;  1JZD A;  1SEN A;  1IYH A;  4EF0 A;  4K2D A;  4DSR A;  3TKS C;  4KND A;  1WRY A;  3LJR A;  3CRT A;  2WFC A;  1VF1 A;  5ECQ B;  2O89 A;  1FW1 A;  1TK8 B;  5J41 A;  4D73 B;  5F0G A;  3WGX A;  5JWO B;  1ILO A;  3EU4 A;  2PU9 C;  1A0R P;  4IJI A;  2HRK B;  2R5G A;  3G7J A;  3ERG A;  1DE2 A;  3ZRD A;  1G7O A;  2CAI A;  5INY A;  4OFT A;  4L0U A;  4KSM A;  4F03 A;  3KTB A;  3TJG A;  4KGI A;  5HFK A;  1ZGN A;  6GST A;  4DVC A;  4L0W A;  2ALB A;  4DSS A;  1M9A A;  1O85 A;  1YF0 A;  5JWQ B;  2IME A;  2DIY A;  3ZL5 A;  4K8M A;  2GS3 A;  3GTU A;  3IHQ A;  1A2J A;  1TRW A;  4RQX A;  4IJ3 A;  2VD1 A;  3TJB A;  2I1U A;  2GSR A;  2X8C A;  1TXX A;  3AY8 A;  4PQI A;  1T1V A;  2C0F A;  3IAS 2;  2G2Q A;  1B4Q A;  3EYT A;  3ZLP A;  4GRF A;  4KUN A;  4HOJ A;  3FZ4 A;  2DJK A;  1ST9 A;  4ULX A;  4OCF A;  1HD2 A;  5ECK B;  2LUS A;  1HYU A;  2VO4 A;  2EIQ A;  3TJF A;  3GKM A;  4EXJ A;  5D9V A;  2JAD A;  2VUP A;  4V1A p;  5IMZ A;  1SK2 A;  4WBR D;  4BPY A;  2YOI A;  2OA7 A;  2PVO C;  4MJE A;  4HUA A;  1YF1 A;  2PER A;  4MPG A;  2L5O A;  4IKH A;  1SYR A;  3CYN A;  2F51 A;  3APO A;  1WWJ A;  1MEK A;  5HQP A;  1GSE A;  4F82 A;  3HKR A;  2CX4 A;  4IS0 A;  1A2M A;  2LRC A;  1NSW A;  1SJ6 A;  5J9B A;  5DJM A;  1ABA A;  4BWS A;  2NTO A;  1WIK A;  2VCX A;  1SKR B;  2FY6 A;  3MNG A;  1GTU A;  3FR3 A;  1S3C A;  3C1R A;  5F07 A;  3GKX A;  1VGL A;  20GS A;  3F4T A;  3IBH A;  3FR9 A;  2JAC A;  1KBN A;  3FY7 A;  1SK0 A;  4MK3 A;  2GQK A;  1T4Z A;  2D2Z A;  3N9J A;  1GSD A;  1AAZ A;  1BAY A;  6GSY A;  5HR0 A;  4WF4 A;  5IOW A;  4ZB8 A;  2C8U A;  4DSS B;  2TRX A;  4I2T A;  4YAV A;  2DJ3 A;  1TW9 A;  2LNT A;  2WJU A;  2E0Q A;  19GS A;  1W4V A;  1K3L A;  2QGV A;  4MA9 A;  1GTB A;  1TTZ A;  1TU7 A;  1BYE A;  2VL9 A;  3TKS A;  2KLX A;  4YH2 A;  2HRN A;  2GZY A;  4MH3 A;  4CDO A;  5ELG A;  5JWR B;  4PNF A;  2DJ2 A;  4G9H A;  5ECO B;  4X43 A;  4ISD A;  1SL0 B;  4ZBD A;  3VWX A;  3D4T A;  2H6Z A;  2P5R A;  4P3Y B;  1XBS A;  3ME7 A;  4FYC A;  4ZBB A;  3IAM 2;  4WEY A;  2MBT A;  5IM9 A;  4GSS A;  1PL2 A;  2GDR A;  11GS A;  1KNG A;  1QK8 A;  4KH7 A;  2VCT A;  4KE3 A;  2RM6 A;  2LS5 A;  4POL A;  3WGE A;  5DDL A;  3HJO A;  1JHB A;  2RII A;  2AV4 A;  4KDU A;  4BA7 A;  3QFA C;  2PUK C;  4J2F A;  4XCS A;  5D9X A;  5FT3 A;  2C1Y A;  2M46 A;  1I5G A;  2YZH A;  5CRE A;  1M2A A;  3F8U A;  2R6K A;  1OVN A;  4V1A g;  3QMX A;  4IGJ A;  5G30 A;  2LRT A;  3HVS A;  5CRG A;  1O8X A;  2H30 A;  3RDW A;  2LEG A;  5HR2 A;  2MMA A;  2YP6 A;  2JL4 A;  3IXR A;  2YV7 A;  4I2U A;  4XHM A;  3VFI A;  2L6C A;  4MJB A;  5IIZ A;  3EUR A;  4O7H A;  5E59 A;  2H0I A;  5IO2 A;  5ECM B;  3LQ7 A;  1XOA A;  2VIM A;  9GSS A;  2IMK A;  2J9H A;  1ZMA A;  2NBS A;  3SBC A;  2XC2 A;  1GNE A;  4BVY A;  4POM A;  3RAZ A;  5ENU A;  1PKZ A;  4BL7 A;  3H79 A;  1TRS A;  4EC0 A;  2C0E A;  1LJR A;  5EVO A;  5DQY A;  4ZL8 A;  2OE0 A;  2ZCT A;  3KZQ A;  1T3B A;  5DAK A;  2ZNM A;  1RQM A;  1VF3 A;  3CSI A;  2H75 A;  3APQ A;  4FH8 A;  4ECC A;  2KUC A;  4N30 A;  2H1D A;  5CYY A;  5H5R A;  3GKK A;  2B7J A;  1XVW A;  3KJY A;  2J23 A;  1PN9 A;  4XS6 A;  1DE1 A;  2C0D A;  1CQG A;  1C72 A;  4MF5 A;  3ZVJ A;  1NW2 A;  5IPH A;  2OE1 A;  3GIX A;  2YV9 A;  1TDI A;  4OO5 A;  2YWI A;  1FB0 A;  4JE1 A;  2I81 A;  4TRX A;  2EIO A;  5C00 A;  4JZQ A;  4TKY A;  3CTF A;  5F8B A;  3ZFB A;  1SKW B;  3CTG A;  3GFK A;  5B7C A;  2HI7 A;  3LXT A;  3QAG A;  1Y6E A;  5GSS A;  4HQZ A;  3KXO A;  2C0G A;  3V1W A;  1BJX A;  4IEL A;  2WUL A;  2BTO T;  5KN0 A;  2IIY A;  3EU3 A;  2MMZ A;  4YQU A;  5L71 A;  4D73 A;  2K6V A;  2IL3 A;  1B4P A;  2V6K A;  2B1K A;  2LRN A;  4OO4 A;  1ERT A;  4I97 A;  3KIJ A;  5D96 A;  4GWR A;  4IQA A;  5ABR A;  4EVM A;  3O3T A;  4HQS A;  1UC7 A;  2AYT A;  3TJJ A;  1J9B A;  3PGT A;  2TIR A;  1FOV A;  4MZC A;  1URM A;  5FWG A;  1GH2 A;  2O87 A;  1O8W A;  2G0F A;  12GS A;  1JZO A;  3DML A;  2H1A A;  2R37 A;  2JSY A;  1OC9 A;  4POK A;  1GSF A;  4TN8 A;  3GMF A;  2FCH A;  4HJ2 A;  2YWO A;  4BVY B;  2MZC A;  2JU5 A;  4MAB A;  3EWL A;  2CAQ A;  17GS A;  2B3S A;  2JZT A;  1G7E A;  3FZA A;  2YJ7 A;  3TKQ A;  1RW1 A;  1XOB A;  5ECR B;  4IW9 A;  4LMW A;  1K3Y A;  5FHI A;  1R26 A;  2DMM A;  2VL2 C;  1TK0 B;  2HSH A;  1X9S B;  3EE2 A;  4TR3 A;  5A4V A;  2XHF A;  2ZUP A;  3MSZ A;  4RI6 A;  3F4R A;  2WB9 A;  3H8Q A;  4XS1 A;  4EKZ A;  5DVB A;  2PBJ A;  1EP7 A;  2BJX A;  2VLT A;  2HNL A;  5DBQ A;  3R2Q A;  1QQ2 A;  3A3T A;  3Q6O A;  4USS A;  2H66 A;  3DRN A;  3KCM A;  2WDU A;  1A23 A;  1I9D A;  1K0C A;  2F3M A;  3HDC A;  5ECS A;  4TR1 A;  1UVZ A;  3DWV A;  5IO0 A;  5ID2 A;  2GT6 A;  1Z7P A;  3TKP A;  3LYP A;  4BVX B;  3KP9 A;  3UVT A;  3EMP A;  2AUV A;  2XBQ A;  2JSZ A;  4OCE A;  2HSN B;  3W6G A;  3TGZ A;  4V2M A;  3IRA A;  1M7T A;  3FYG A;  8GSS A;  5CAX A;  3US3 A;  3ZIV A;  1E2Y A;  5BMU A;  1ON4 A;  1GSS A;  1TI1 A;  2FWE A;  2CX3 A;  2GSQ A;  2H6X A;  2WZ9 A;  3P90 A;  5IPG A;  4RI7 A;  2JZS A;  3DVX A;  5A4U A;  1K0O A;  1BG5 A;  1GUM A;  3M3M A;  2VLU A;  3Q18 A;  2WRT A;  2MYG A;  3F9U A;  1EEM A;  2GZP A;  4KA0 A;  1R7H A;  2IN3 A;  4HEA 2;  4GF0 A;  3TJK A;  1X5C A;  4RUV A;  5G5E A;  1ZYE A;  2LTK A;  4HU7 A;  3UOM A;  3ZYW A;  4G2E A;  1B48 A;  4OD7 A;  3D0Z A;  1Q98 A;  4JU5 A;  4KB3 A;  1ZYQ B;  1GP1 A;  2UZ8 A;  1GUH A;  2CVD A;  3DVW A;  1OC9 B;  1M9B A;  4KCE A;  3M9K A;  4MZW A;  2A2R A;  4X1U A;  3KMN A;  4K0G A;  4K1F A;  5COH A;  1GNW A;  1CQH A;  4AGS A;  2FA8 A;  4F9Z A;  2LV3 A;  5IQY A;  2IFQ B;  4DEJ A;  3GV1 A;  3WT2 A;  2L4Q A;  3P8W A;  4L5O A;  4ZB6 A;  1ZCP A;  4IVF A;  3TOT A;  1AXD A;  14GS A;  4KAE A;  5D73 A;  4PXO A;  3HD5 A;  5DCG A;  4IHU A;  1HNA A;  4EE0 A;  2RLI A;  4K6X A;  3TKR A;  4G0L A;  3LEF A;  3TUE A;  4OFM A;  4ZXG A;  3FK8 A;  3HVX A;  3ZFL A;  3L4N A;  4XRD A;  5CRD A;  2GVP A;  1K0N A;  1B9X C;  1J0F A;  4TR1 B;  5ID2 B;  5CRH A;  5B6M A;  2IMF A;  3H4K A;  4O92 A;  2H19 A;  3GH9 A;  3C1S A;  4K7N A;  1FVK A;  4GQC A;  3UAR A;  1Z9H A;  2CZ3 A;  3PH9 A;  5D8I A;  1EEJ A;  3KGK A;  4ZB9 A;  2AAW A;  3C8E A;  3QFB C;  18GS A;  2LJR A;  1ZOF A;  2WGR A;  2XBI A;  1F3A A;  3GN3 A;  3GX8 A;  1SJZ A;  2DJ0 A;  2LQO A;  2ON7 A;  3KP8 A;  3C7M A;  2E2M A;  2VL2 A;  3RHB A;  1VF4 A;  3A2V A;  1U3I A;  1XW6 A;  4HZ2 A;  2HXK A;  3A2W A;  5IMC A;  4ECB A;  3CSJ A;  3BCI A;  3BJ5 A;  3CSH A;  3FHK A;  3W8J A;  4OFN A;  2B7K A;  1LU4 A;  3IV4 A;  2OAD A;  3VPT A;  6GSS A;  5ECI B;  4FYB A;  3UVH A;  4IQ1 A;  3NIV A;  2DJJ A;  4XIH A;  2YJH A;  4MDC A;  1GWC A;  1BX9 A;  1H75 A;  1R4W A;  2DIZ A;  1Z6N A;  4WKW A;  4NAX A;  4OWY A;  3ZZX A;  4KCA A;  2VCV A;  1DBY A;  2FNO A;  3TRP A;  5J4U A;  3CXG A;  2GLR A;  3G9B A;  4N11 A;  3UIW A;  3UEM A;  4TOP A;  4FYU A;  2FWF A;  5CNW A;  3HHV A;  3F0I A;  1SL2 B;  4EL1 A;  2E2G A;  3GA4 A;  2PVQ A;  5D9T A;  2L57 A;  1M2B A;  3VWU A;  1K0A A;  3WYW A;  2HRA A;  1MD3 A;  2P5Q A;  4HU9 A;  3M0F A;  5C04 A;  4MCU A;  3LSZ A;  2GZZ A;  5LNK e;  1FO5 A;  5ECN B;  2O8V B;  5H5S A;  4LL1 B;  1ZZY A;  1KTE A;  4MP4 A;  4YQV A;  4JRR A;  1JFU A;  3CRU A;  5IMF A;  2WS2 A;  3ZRE A;  3GUR A;  3MWH A;  3BOA A;  4TXV A;  5B8B A;  1EGR A;  2PMT A;  5ECH B;  3HJP A;  3DD3 A;  3I43 A;  2R4V A;  1THO A;  1XIY A;  3L0H A;  3FW2 A;  3UBK A;  3D21 A;  2DBC A;  3M1G A;  1OAZ A;  1TRU A;  1TK5 B;  1FHE A;  1GRX A;  1AC1 A;  1QUW A;  2QSI A;  1EOH A;  1XZO A;  3QD9 A;  4GCI A;  1N2A A;  5AIX A;  4K9Z A;  2K18 A;  4ECI A;  2VCQ A;  3LFL A;  4ZL9 A;  5KN3 A;  2GTU A;  1FAA A;  3TRX A;  1BQ7 A;  2TRC P;  2AJQ B;  5HFG A;  4WR5 A;  2YPM A;  4ML1 A;  6GSW A;  2I9H A;  2AB6 A;  1RK4 A;  4NMU A;  4PX1 A;  3I6A A;  2MMO A;  4OMV A;  1MD4 A;  4TXO A;  5KN1 A;  5IMA A;  3DGQ A;  3ISO A;  3IK9 A;  1QGV A;  2VOC A;  2CVB A;  1THX A;  3QCP A;  1S3D A;  1EOG A;  3F6F A;  3E0U A;  3LG6 A;  2IJY A;  4ML6 A;  2VL3 A;  2I4A A;  2C80 A;  5G1L A;  4F0C A;  1V40 A;  2HSY A;  5J9C A;  1YEX A;  4PGT A;  2HRF A;  2DLX A;  2MBS A;  3UBL A;  3FZ9 A;  4DSQ A;  3IE3 A;  1FG4 A;  2V41 A;  2VLV A;  4HS1 A;  5ECL B;  1W89 A;  4PUA A;  2YWM A;  1TKD B;  4E8H A;  1EGO A;  2PGT A;  3TB2 A;  4MH2 A;  3I9V 2;  1YJ6 A;  5CRW A;  3QAV A;  3VK9 A;  3ERW A;  3UMA A;  4BVX A;  3KTL A;  2HZE A;  2OBI A;  1YQ1 A;  3ME8 A;  1M2D A;  2R2J A;  2GGT A;  1PSQ A;  2A2S A;  2CVK A;  4LLR A;  2GT5 A;  1MTC A;  2GQM A;  4WR4 A;  1QMV A;  4EDZ A;  5E4W A;  3E9J B;  3VPQ A;  3G7I A;  5CP1 A;  2KOK A; 
#chains in the Genus database with same CATH topology
 1SD9 A;  2B5E A;  4XS4 B;  4JR4 A;  2YAN A;  4FO5 A;  3BCK A;  1V57 A;  4CW9 A;  2KP1 A;  2F9S A;  4Q5R A;  2L4C A;  2HE3 A;  5F06 A;  2H70 A;  4K5S A;  3R3E A;  2FLS A;  4V2L A;  2X64 A;  3IR4 A;  1KEB A;  3GYK A;  3D6I A;  2WVZ A;  3UL3 A;  3IC8 A;  2LJA A;  5AGY A;  3ZIJ A;  1BED A;  3TRQ A;  4MMM A;  1B9Y C;  4PQ1 A;  3J7Y k;  3MYD A;  1FB6 A;  3KMO A;  1K0B A;  4QMK A;  1X9W B;  4G19 A;  3ZVJ D;  4ZB7 A;  3CMI A;  5AIS A;  2X99 A;  1WE0 A;  4A5P A;  4JBB A;  2F8A A;  3C73 A;  1SU9 A;  1OE7 A;  2L5L A;  1NM3 A;  4TXO B;  1AQV A;  3O6T A;  4WET A;  1FVJ A;  2IFQ A;  1TU8 A;  5GAP D;  1V2A A;  3N5O A;  3BD2 A;  4HI7 A;  4HZ4 A;  2M80 A;  4H86 A;  1M0U A;  1X5D A;  1XWG A;  2YWN A;  1O73 A;  5J5N A;  4EO3 A;  1WPI A;  4GSN A;  1YEP A;  4GDF A;  2VM1 A;  3P7X A;  2WVX A;  2H76 A;  2LST A;  3H93 A;  2V6O A;  4X4J A;  1SKS B;  1GUK A;  1PMT A;  5A1N B;  2NDO A;  3QPM A;  4NV2 A;  4K7I A;  3HVV A;  4N10 A;  4FIW A;  2B6M A;  2K8S A;  1GTI A;  3HA9 A;  3FZ5 A;  1ML6 A;  2FWG A;  3CBU A;  2N5A A;  3VI5 A;  2IMI A;  1SK1 A;  2M72 A;  4JED A;  5JCW A;  3UJ1 A;  3LGC A;  2HZE B;  5HFI A;  2PN8 A;  4TR4 A;  1OKD A;  2L6D A;  2O7K A;  3PR8 A;  3MAK A;  3QR6 A;  4N0V A;  2H8L A;  2FD3 A;  3TCO A;  2C4J A;  1MDJ A;  4GQF A;  4KX4 A;  2NVL A;  3IDV A;  3K8N A;  4AJ8 A;  3U5R E;  5JCU A;  1PQN A;  4ZBA A;  3FKF A;  2V1M A;  1DUG A;  3HXS A;  2C3Q A;  4KDX A;  2WW1 A;  4HSC X;  1PD2 1;  1EZK A;  3WD6 A;  3M8N A;  3A2X A;  2FWH A;  2LNS A;  5GZZ B;  3H1N A;  2V2G A;  3HZ4 A;  2H73 A;  2BMX A;  4FQU A;  2REM A;  3ED3 A;  2HSM B;  3PIN A;  3WT1 A;  1UA5 A;  4ZIL A;  1ZL9 A;  2V32 A;  2H1G A;  1A8Y A;  3KD0 A;  1VF2 A;  3TKS E;  16GS A;  1XVQ A;  2HT9 A;  3IK7 A;  4I5Q A;  3LOR A;  3D5J A;  5GST A;  4O5R A;  2O3E A;  4JR6 A;  2HZF A;  2YCD A;  4KSO A;  5A4W A;  2X8G A;  2H0G A;  1JLV A;  4O32 A;  1O7U A;  4GXZ A;  2AHE A;  1V9W A;  3GH6 A;  3ZIT A;  1PRX A;  2EC4 A;  4AKG A;  3W8S A;  5DJL A;  1XW9 A;  3P2A A;  3QOU A;  4TR0 A;  4XTS A;  1Z3E A;  3RPN A;  2GQL A;  3HZ8 A;  2H71 A;  3C71 A;  2I3Y A;  4EIP A;  1GLQ A;  4F2I A;  4KF9 A;  4NHZ A;  1F9M A;  3L9V A;  22GS A;  3LWA A;  4AJ7 A;  4X0X A;  3GNJ A;  5J3R A;  2FGX A;  1Y1U A;  1X5E A;  1IYI A;  2H0H A;  4QQ7 A;  4IP1 A;  3L78 A;  2HQT A;  7GSS A;  3RHC A;  1AQX A;  1SD8 A;  2HFD A;  2XPE A;  4K0N A;  2H72 A;  1WOU A;  4MLY A;  4G0K A;  4Z2T A;  2OE3 A;  5DAL A;  6GSV A;  2WCI A;  1XPV A;  4AKI A;  1G0T A;  4AF2 A;  2MMN A;  2JZR A;  1WMJ A;  1XWC A;  3BBY A;  4GTU A;  3GL3 A;  3APS A;  5A34 A;  1Z7R A;  4WXT A;  2CQ9 A;  4MNN A;  1U88 A;  1NHO A;  4ECJ A;  3OR5 A;  1GSY A;  1OC3 A;  1XWK A;  1O81 A;  4PHZ C;  1JZW A;  2KP2 A;  1T8E B;  3F4S A;  4WF5 A;  4PTS A;  3GRX A;  2RUF A;  1YDK A;  3QDN A;  4ILF A;  3RBT A;  4HJM A;  3U6V A;  1GL8 A;  4G0I A;  4TVE A;  1LBK A;  4XRA A;  4LMV A;  5F05 A;  1JLW A;  5KEJ A;  1PX7 A;  3Q74 A;  1GSU A;  4YAP A;  2HYX A;  2C3T A;  1T00 A;  1N25 A;  4EDY A;  3L9U A;  1XW5 A;  1GTA A;  1FOH A;  1TJD A;  1AQW A;  3LYK A;  4NWY A;  2YZU A;  3FRC A;  5EPF A;  1HQO A;  3GTU B;  3DKS A;  2OAC A;  2GST A;  4MJA A;  2VCW A;  4AJ6 A;  1F37 A;  1XCC A;  2B1L A;  4I6X A;  3F6D A;  2VM2 A;  1SYX A;  3IPZ A;  13GS A;  4MF7 A;  1AUC A;  4MZB A;  1X9M B;  3RFR C;  3UAP A;  2DSA A;  2RM5 A;  3KEB A;  4K7O A;  2ES7 A;  1UN2 A;  2R3X A;  4CY6 A;  3S9F A;  3D4M A;  3RPP A;  3WGD A;  4NHW A;  1TOF A;  4QL7 A;  1YKC A;  5J4V A;  2FA4 A;  2O85 A;  1PFO A;  5GAN D;  1YY7 A;  5EL8 A;  5ECP B;  1WJK A;  4F0B A;  1B8X A;  2PWJ A;  5LD0 A;  4XS4 A;  4TW5 A;  3ZMK A;  2EIR A;  3ZML A;  2L59 A;  4AKH A;  3ZTL A;  2N5F A;  1XWB A;  5CO3 A;  4ACS A;  1X0R A;  5DAL B;  3MDK A;  5JCG A;  1G6W A;  1VRS D;  1AIU A;  3SWL A;  2R0C A;  5B8A A;  3F63 A;  2IMD A;  2LJK A;  2E7P A;  1TP9 A;  3GSS A;  5EY6 A;  2HLS A;  3L9S A;  2H74 A;  3DXB A;  3IOS A;  3HCZ A;  3EIN A;  4RQR A;  5A34 B;  3VWW A;  1T4Y A;  2H1B A;  3FR6 A;  3O76 A;  4ZL7 A;  3VWV A;  3HY2 A;  4NPB A;  3GHA A;  5G2Z A;  1HNC A;  3VI7 A;  1MDI A;  1EV4 A;  4G10 A;  3HYP A;  4YKG A;  4O5Q A;  4IN0 A;  1F2E A;  5B6N A;  4K2X A;  4PNG A;  4BWQ A;  2FHE A;  2H1L A;  5AIV A;  1EP8 A;  2CT6 A;  4ICY A;  1NHY A;  4EUY A;  2N5B A;  1T7P B;  3KM6 A;  1XXU A;  5LCZ A;  2LKU A;  2IPA A;  4Q5F A;  2P0G A;  3DIE A;  2UV8 G;  1SL1 B;  1A8L A;  5HR3 A;  1ERV A;  4LL4 B;  3TDG A;  1OE8 A;  3DEX A;  3J7Y b;  1M99 A;  1V98 A;  3M9J A;  3IA1 A;  2VD0 A;  3EC3 A;  1K3O A;  1ERU A;  4ID0 A;  1GUL A;  1N8J A;  1F3B A;  1PA3 A;  2YN1 A;  1YKA A;  4PUF C;  5KOX A;  1MDK A;  3GL5 A;  5G31 A;  3E3E A;  2VCZ A;  2YNX A;  10GS A;  2OKA A;  1JZR A;  3F3Q A;  1A0F A;  4NXI A;  5ELA A;  2EFC A;  5AN1 A;  1Q4J A;  3QAW A;  2P31 A;  1AW9 A;  3HJM A;  4J56 E;  5D9W A;  4L5L A;  1DSB A;  1A2L A;  4I8B A;  2OBK A;  3KH9 A;  2K8V A;  2LQQ A;  1R5P A;  4CHS A;  1R5A A;  3GST A;  2GSS A;  3Q19 A;  3I69 A;  2CA8 A;  4KW6 A;  3D22 A;  2DJ1 A;  1ACV A;  2FUG 2;  2K9F A;  2RUE A;  1XWA A;  3MIX A;  1EV9 A;  5IMV A;  5DQS A;  2DC5 A;  1ERW A;  4L8E A;  6GSU A;  1Z5Y E;  1TI3 A;  3TOU A;  1E6B A;  4PUR A;  2HRK A;  1Z6M A;  1OKT A;  1BF5 A;  1PX6 A;  6GSX A;  4Z7X A;  2VAF A;  1U87 A;  1U6T A;  4J57 E;  4MF6 A;  2ON5 A;  2F8F A;  2OJL A;  3PPU A;  1EWX A;  1F6M C;  2XPD A;  3GKN A;  4WBJ A;  2HSM A;  4Q5Q A;  3G7Y A;  2H01 A;  1SJI A;  4POB A;  1M3J A;  4GST A;  3JCM L;  5D93 A;  1USB A;  4MPF A;  4YQM A;  5H5Q A;  5KN2 A;  2KHP A;  2R0P A;  3NOF A;  3VUR A;  4LA1 A;  2PPT A;  4PQH A;  5HR1 A;  1A24 A;  1TRV A;  2EFD A;  1HNB A;  2DML A;  1YZX A;  4N0Z A;  1PKW A;  4KDY A;  1K0M A;  3EVI A;  4QL9 A;  4IBP A;  1GSQ A;  2B5Y A;  1PGT A;  5G5F A;  2IWT A;  2NPB A;  4V2N A;  4E8E A;  4BL7 B;  1G6Y A;  3GUS A;  2CV4 A;  2H6Y A;  2DKI A;  4HDE A;  3A5W A;  2QC7 A;  3ERF A;  1K0D A;  2B5X A;  3EMX A;  4Q5N A;  5A5K A;  5DAK B;  5IOX A;  1QFN A;  1WP0 A;  3IC4 A;  1QXH A;  1OC8 A;  2QKE A;  4IP6 A;  5DCH A;  4GLT A;  3DYR A;  3VLN A;  3FEU A;  4MJC A;  5G1K A;  5IMD A;  3NZN A;  1J08 A;  1O6J A;  1S3A A;  1H4O A;  3F3R A;  2A4V A;  3GX0 A;  4NV5 A;  3LXZ A;  2Z9S A;  1Y25 A;  1U3A A;  4BIK A;  1OYJ A;  2C3N A;  3KH7 A;  1V58 A;  1XFL A;  1GLP A;  2CZ2 A;  2X8H A;  4ZIJ A;  1PL1 A;  1JZD A;  1SEN A;  1IYH A;  4EF0 A;  4K2D A;  4DSR A;  3TKS C;  3LW9 A;  4KND A;  1WRY A;  3LJR A;  3CRT A;  2WFC A;  1VF1 A;  5ECQ B;  2O89 A;  1FW1 A;  1TK8 B;  5J41 A;  4D73 B;  5F0G A;  3WGX A;  5JWO B;  1ILO A;  3EU4 A;  2PU9 C;  1A0R P;  4IJI A;  2HRK B;  2R5G A;  3G7J A;  3ERG A;  1DE2 A;  3ZRD A;  1G7O A;  2CAI A;  5INY A;  4OFT A;  4L0U A;  4KSM A;  4F03 A;  3KTB A;  3TJG A;  4KGI A;  5HFK A;  1ZGN A;  6GST A;  4DVC A;  4L0W A;  2ALB A;  4DSS A;  1M9A A;  1O85 A;  1YF0 A;  5JWQ B;  2IME A;  2DIY A;  3ZL5 A;  4K8M A;  2VKZ G;  2GS3 A;  3GTU A;  3IHQ A;  1A2J A;  1TRW A;  4RQX A;  4IJ3 A;  2VD1 A;  3TJB A;  2I1U A;  2GSR A;  3A5I A;  2X8C A;  3TU3 B;  1TXX A;  3AY8 A;  4PQI A;  1T1V A;  2C0F A;  3IAS 2;  2G2Q A;  1B4Q A;  3EYT A;  3ZLP A;  4GRF A;  4KUN A;  4HOJ A;  3FZ4 A;  2DJK A;  1ST9 A;  4ULX A;  4OCF A;  1HD2 A;  5ECK B;  2LUS A;  1HYU A;  2VO4 A;  1S3R A;  2EIQ A;  3TJF A;  3GKM A;  4EXJ A;  5D9V A;  2JAD A;  2VUP A;  2EFE A;  4AKX B;  3EPT A;  4V1A p;  5IMZ A;  1SK2 A;  4WBR D;  4BPY A;  2YOI A;  2OA7 A;  2PVO C;  4MJE A;  4HUA A;  1YF1 A;  2PER A;  4MPG A;  2L5O A;  4IKH A;  1SYR A;  3CYN A;  2F51 A;  3APO A;  1WWJ A;  1MEK A;  5HQP A;  1GSE A;  4F82 A;  3HKR A;  2CX4 A;  4IS0 A;  1A2M A;  2LRC A;  1NSW A;  1SJ6 A;  5J9B A;  5DJM A;  1ABA A;  4BWS A;  2NTO A;  1WIK A;  2VCX A;  1SKR B;  2FY6 A;  3HVN A;  3MNG A;  2R0G A;  1GTU A;  3FR3 A;  1S3C A;  3C1R A;  5F07 A;  3GKX A;  1VGL A;  20GS A;  3F4T A;  3IBH A;  3FR9 A;  2JAC A;  1KBN A;  3FY7 A;  2X4A A;  1SK0 A;  4MK3 A;  2GQK A;  1T4Z A;  2D2Z A;  5KOW A;  3N9J A;  1GSD A;  1AAZ A;  1BAY A;  2WW0 A;  6GSY A;  5HR0 A;  2WW2 A;  4WF4 A;  5IOW A;  4ZB8 A;  2C8U A;  4DSS B;  2TRX A;  4I2T A;  4YAV A;  2DJ3 A;  1TW9 A;  2LNT A;  2WJU A;  2E0Q A;  19GS A;  1W4V A;  1K3L A;  2QGV A;  4MA9 A;  1GTB A;  1TTZ A;  5A5H B;  1TU7 A;  1BYE A;  2VL9 A;  3TKS A;  2KLX A;  4YH2 A;  2HRN A;  2GZY A;  4MH3 A;  4CDO A;  5ELG A;  5JWR B;  4PNF A;  2DJ2 A;  4G9H A;  5ECO B;  2QA2 A;  4X43 A;  4ISD A;  1SL0 B;  4ZBD A;  3VWX A;  3D4T A;  2H6Z A;  2P5R A;  4P3Y B;  1XBS A;  3ME7 A;  4FYC A;  4ZBB A;  3IAM 2;  4WEY A;  2MBT A;  5IM9 A;  4GSS A;  1PL2 A;  2GDR A;  11GS A;  1KNG A;  1QK8 A;  4KH7 A;  2VCT A;  4KE3 A;  1M3I A;  2RM6 A;  2LS5 A;  4POL A;  2EFH A;  3WGE A;  5DDL A;  3HJO A;  1JHB A;  2RII A;  2AV4 A;  4KDU A;  4BA7 A;  3QFA C;  2PUK C;  4J2F A;  4XCS A;  5D9X A;  5FT3 A;  2C1Y A;  2M46 A;  1I5G A;  2YZH A;  5CRE A;  1M2A A;  3F8U A;  2R6K A;  1OVN A;  4V1A g;  3QMX A;  4IGJ A;  5G30 A;  2LRT A;  3HVS A;  5CRG A;  1O8X A;  2H30 A;  3RDW A;  2LEG A;  5HR2 A;  2MMA A;  2YP6 A;  2JL4 A;  3IXR A;  2YV7 A;  4I2U A;  4XHM A;  3VFI A;  2L6C A;  4MJB A;  5IIZ A;  3EUR A;  4O7H A;  5E59 A;  2H0I A;  5IO2 A;  5ECM B;  3LQ7 A;  1XOA A;  2VIM A;  9GSS A;  2IMK A;  2J9H A;  2O5V A;  1ZMA A;  2NBS A;  3SBC A;  2XC2 A;  4PI2 C;  1GNE A;  4BVY A;  4POM A;  3RAZ A;  5ENU A;  1PKZ A;  4BL7 A;  3H79 A;  1TRS A;  4EC0 A;  2C0E A;  1LJR A;  5EVO A;  5DQY A;  4ZL8 A;  2OE0 A;  2ZCT A;  3KZQ A;  1T3B A;  5DAK A;  2ZNM A;  1RQM A;  1VF3 A;  3CSI A;  4CY8 A;  2H75 A;  3APQ A;  4FH8 A;  4ECC A;  2KUC A;  4N30 A;  2H1D A;  5CYY A;  5H5R A;  3GKK A;  2B7J A;  1XVW A;  3KJY A;  2J23 A;  1PN9 A;  4XS6 A;  5J47 A;  1DE1 A;  2C0D A;  1CQG A;  4W66 A;  1C72 A;  4MF5 A;  3ZVJ A;  1NW2 A;  4Z2R A;  5IPH A;  2OE1 A;  3GIX A;  2YV9 A;  1TDI A;  4OO5 A;  2YWI A;  1FB0 A;  4JE1 A;  2I81 A;  4TRX A;  2EIO A;  5C00 A;  4JZQ A;  4TKY A;  2HSN A;  3CTF A;  5F8B A;  3ZFB A;  1SKW B;  3CTG A;  4K5R A;  3GFK A;  5B7C A;  2HI7 A;  3LXT A;  3QAG A;  1Y6E A;  5GSS A;  4HQZ A;  3KXO A;  5J4Y A;  2C0G A;  3V1W A;  1BJX A;  4FXY P;  4IEL A;  2WUL A;  2BTO T;  5KN0 A;  2IIY A;  3EU3 A;  2MMZ A;  4YQU A;  5L71 A;  4D73 A;  2K6V A;  2IL3 A;  1B4P A;  2V6K A;  2B1K A;  2LRN A;  4OO4 A;  1ERT A;  4I97 A;  3KIJ A;  5D96 A;  4GWR A;  4IQA A;  5ABR A;  4EVM A;  3O3T A;  4HQS A;  1UC7 A;  2AYT A;  3TJJ A;  1J9B A;  3PGT A;  4AI6 A;  2TIR A;  1FOV A;  4MZC A;  1URM A;  5FWG A;  1GH2 A;  2O87 A;  1O8W A;  2G0F A;  12GS A;  1JZO A;  3DML A;  2H1A A;  2R37 A;  2JSY A;  3FMW A;  1OC9 A;  4POK A;  1GSF A;  4TN8 A;  3GMF A;  2FCH A;  4HJ2 A;  2YWO A;  4BVY B;  2MZC A;  2JU5 A;  4MAB A;  3EWL A;  2CAQ A;  17GS A;  2B3S A;  2JZT A;  1G7E A;  3FZA A;  2YJ7 A;  3TKQ A;  1RW1 A;  1XOB A;  5ECR B;  4IW9 A;  4LMW A;  1K3Y A;  5FHI A;  1R26 A;  4G01 A;  2DMM A;  2VL2 C;  1TK0 B;  2HSH A;  1X9S B;  3EE2 A;  4TR3 A;  5A4V A;  2XHF A;  2ZUP A;  3MSZ A;  4RI6 A;  3F4R A;  2WB9 A;  3H8Q A;  4XS1 A;  4EKZ A;  5DVB A;  2PBJ A;  1EP7 A;  2BJX A;  2VLT A;  2A2P A;  2HNL A;  5DBQ A;  3R2Q A;  1QQ2 A;  3A3T A;  3Q6O A;  4USS A;  2H66 A;  2OT3 A;  3DRN A;  3KCM A;  2WDU A;  1A23 A;  1I9D A;  1K0C A;  2F3M A;  3HDC A;  5ECS A;  4TR1 A;  1UVZ A;  3DWV A;  5IO0 A;  5ID2 A;  2GT6 A;  1Z7P A;  3TKP A;  3LYP A;  4BVX B;  3KP9 A;  3UVT A;  3EMP A;  2AUV A;  2XBQ A;  2JSZ A;  4OCE A;  2HSN B;  3W6G A;  3TGZ A;  4V2M A;  4Z2U A;  1BG1 A;  3IRA A;  1M7T A;  8GSS A;  3FYG A;  5CAX A;  2WVY A;  3US3 A;  3ZIV A;  1E2Y A;  5BMU A;  1ON4 A;  1GSS A;  1TI1 A;  2FWE A;  2CX3 A;  2GSQ A;  2H6X A;  2WZ9 A;  3P90 A;  5IPG A;  4RI7 A;  2JZS A;  3DVX A;  5A4U A;  1K0O A;  1BG5 A;  1GUM A;  3M3M A;  2VLU A;  3Q18 A;  2WRT A;  2MYG A;  3F9U A;  4E68 A;  1EEM A;  2GZP A;  4KA0 A;  1R7H A;  2IN3 A;  4HEA 2;  4GF0 A;  3TJK A;  1X5C A;  4RUV A;  1TXU A;  5G5E A;  1ZYE A;  2LTK A;  4HU7 A;  3UOM A;  3ZYW A;  4G2E A;  1B48 A;  4OD7 A;  3D0Z A;  1Q98 A;  4JU5 A;  4KB3 A;  1ZYQ B;  2O36 A;  1GP1 A;  2UZ8 A;  1GUH A;  2CVD A;  3DVW A;  1OC9 B;  1M9B A;  4KCE A;  3M9K A;  4MZW A;  2A2R A;  4X1U A;  3KMN A;  5A5H A;  4K0G A;  4K1F A;  5COH A;  5J40 A;  1GNW A;  1CQH A;  4AGS A;  2FA8 A;  4F9Z A;  2LV3 A;  5IQY A;  2IFQ B;  4DEJ A;  3GV1 A;  3WT2 A;  2L4Q A;  3P8W A;  4L5O A;  4ZB6 A;  3RGB C;  1ZCP A;  4IVF A;  3TOT A;  1AXD A;  14GS A;  4KAE A;  5D73 A;  4PXO A;  3HD5 A;  5DCG A;  2WVX B;  4IHU A;  1HNA A;  1ZYP A;  4EE0 A;  2RLI A;  4K6X A;  3TKR A;  4G0L A;  3LEF A;  3TUE A;  4OFM A;  4ZXG A;  3FK8 A;  3IHG A;  3HVX A;  3ZFL A;  3L4N A;  4XRD A;  5CRD A;  2GVP A;  1K0N A;  1B9X C;  1J0F A;  4TR1 B;  5ID2 B;  5CRH A;  5B6M A;  2IMF A;  3H4K A;  4O92 A;  2H19 A;  3GH9 A;  3C1S A;  4K7N A;  1FVK A;  4GQC A;  3UAR A;  1SVL A;  1Z9H A;  2CZ3 A;  3PH9 A;  5D8I A;  1EEJ A;  3KGK A;  4ZB9 A;  2AAW A;  3C8E A;  3QFB C;  18GS A;  2LJR A;  1ZOF A;  2WGR A;  2XBI A;  5BMU B;  1F3A A;  3GN3 A;  3GX8 A;  1SJZ A;  2DJ0 A;  2LQO A;  2ON7 A;  3KP8 A;  3C7M A;  2E2M A;  2VL2 A;  3RHB A;  1VF4 A;  3A2V A;  1U3I A;  1XW6 A;  4HZ2 A;  2HXK A;  3A2W A;  5IMC A;  4ECB A;  3CSJ A;  3BCI A;  3BJ5 A;  3CSH A;  3FHK A;  3W8J A;  4OFN A;  2B7K A;  1LU4 A;  3IV4 A;  2OAD A;  3VPT A;  6GSS A;  5ECI B;  4FYB A;  3UVH A;  4IQ1 A;  3NIV A;  2DJJ A;  4XIH A;  2YJH A;  4MDC A;  1GWC A;  1BX9 A;  1H75 A;  1R4W A;  2DIZ A;  1Z6N A;  4WKW A;  4NAX A;  4OWY A;  3ZZX A;  4KCA A;  2VCV A;  1DBY A;  2FNO A;  3TRP A;  5J4U A;  3CXG A;  4YKF A;  2GLR A;  3G9B A;  4N11 A;  3UIW A;  3UEM A;  4TOP A;  4FYU A;  2FWF A;  5CNW A;  3HHV A;  3F0I A;  2A4H A;  1SL2 B;  4EL1 A;  2E2G A;  3GA4 A;  2PVQ A;  5D9T A;  2L57 A;  1M2B A;  3VWU A;  1K0A A;  3WYW A;  2HRA A;  1MD3 A;  2P5Q A;  4HU9 A;  3M0F A;  5C04 A;  4MCU A;  3LSZ A;  2GZZ A;  5LNK e;  1FO5 A;  5ECN B;  2O8V B;  5H5S A;  4LL1 B;  1ZZY A;  1S4B P;  1KTE A;  4MP4 A;  5BRT A;  4YQV A;  4JRR A;  1JFU A;  3CRU A;  5IMF A;  2WS2 A;  3ZRE A;  3GUR A;  3MWH A;  3BOA A;  2WZS A;  4TXV A;  5B8B A;  1SVM A;  1EGR A;  2PMT A;  5ECH B;  2X49 A;  2WW3 A;  3HJP A;  3DD3 A;  3I43 A;  2R4V A;  1THO A;  1XIY A;  3L0H A;  3FW2 A;  4PI0 C;  3UBK A;  3D21 A;  2DBC A;  3M1G A;  1OAZ A;  1TRU A;  1TK5 B;  1FHE A;  1GRX A;  1AC1 A;  1QUW A;  2QSI A;  1EOH A;  1XZO A;  3QD9 A;  4GCI A;  2DKH A;  1N2A A;  5AIX A;  1YVL A;  4K9Z A;  2K18 A;  4ECI A;  2VCQ A;  3LFL A;  4ZL9 A;  5KN3 A;  2GTU A;  1FAA A;  3TRX A;  1BQ7 A;  2TRC P;  2AJQ B;  4O5U A;  5HFG A;  4WR5 A;  2YPM A;  4ML1 A;  6GSW A;  2I9H A;  2AB6 A;  1RK4 A;  4NMU A;  4PX1 A;  3I6A A;  2MMO A;  4OMV A;  1MD4 A;  4TXO A;  5KN1 A;  5IMA A;  3DGQ A;  3ISO A;  3IK9 A;  1QGV A;  2VOC A;  2CVB A;  1THX A;  3QCP A;  1S3D A;  1XG8 A;  1EOG A;  1SVO A;  3F6F A;  2QA1 A;  3E0U A;  3LG6 A;  2IJY A;  4ML6 A;  2VL3 A;  3CWG A;  2I4A A;  2C80 A;  5G1L A;  4F0C A;  1YEW C;  1V40 A;  2HSY A;  5J9C A;  1YEX A;  4PGT A;  5A1N A;  2HRF A;  2DLX A;  4EIQ A;  2MBS A;  3UBL A;  3FZ9 A;  4DSQ A;  3IE3 A;  1FG4 A;  1PN0 A;  2V41 A;  2VLV A;  4HS1 A;  5ECL B;  1W89 A;  4PUA A;  3HMJ G;  2YWM A;  1TKD B;  4E8H A;  1EGO A;  2PGT A;  3TB2 A;  4MH2 A;  3CQF A;  3I9V 2;  1YJ6 A;  5CRW A;  3QAV A;  3VK9 A;  3ERW A;  3UMA A;  4BVX A;  3KTL A;  1ZYN A;  2HZE A;  2OBI A;  1YQ1 A;  3ME8 A;  1M2D A;  2R2J A;  2GGT A;  1PSQ A;  2A2S A;  2CVK A;  4LLR A;  2GT5 A;  1I1I P;  1MTC A;  2GQM A;  4WR4 A;  1QMV A;  3CHX C;  4EDZ A;  5E4W A;  3E9J B;  3VPQ A;  4N3Z A;  3G7I A;  5CP1 A;  2KOK A; 
#chains in the Genus database with same CATH homology
 1SD9 A;  2B5E A;  4XS4 B;  4JR4 A;  2YAN A;  4FO5 A;  3BCK A;  1V57 A;  4CW9 A;  2KP1 A;  2F9S A;  4Q5R A;  2L4C A;  2HE3 A;  5F06 A;  2H70 A;  4K5S A;  3R3E A;  2FLS A;  4V2L A;  2X64 A;  3IR4 A;  1KEB A;  3GYK A;  3D6I A;  3UL3 A;  3IC8 A;  2LJA A;  5AGY A;  3ZIJ A;  1BED A;  3TRQ A;  4MMM A;  1B9Y C;  4PQ1 A;  3J7Y k;  3MYD A;  1FB6 A;  3KMO A;  1K0B A;  4QMK A;  1X9W B;  4G19 A;  3ZVJ D;  4ZB7 A;  3CMI A;  5AIS A;  2X99 A;  1WE0 A;  4A5P A;  4JBB A;  2F8A A;  3C73 A;  1SU9 A;  1OE7 A;  2L5L A;  1NM3 A;  4TXO B;  1AQV A;  3O6T A;  4WET A;  1FVJ A;  2IFQ A;  1TU8 A;  5GAP D;  1V2A A;  3N5O A;  3BD2 A;  4HI7 A;  4HZ4 A;  2M80 A;  4H86 A;  1M0U A;  1X5D A;  1XWG A;  2YWN A;  1O73 A;  5J5N A;  4EO3 A;  1WPI A;  4GSN A;  1YEP A;  4GDF A;  2VM1 A;  3P7X A;  2H76 A;  2LST A;  3H93 A;  2V6O A;  4X4J A;  1SKS B;  1GUK A;  1PMT A;  5A1N B;  2NDO A;  3QPM A;  4NV2 A;  4K7I A;  3HVV A;  4N10 A;  4FIW A;  2B6M A;  2K8S A;  1GTI A;  3HA9 A;  3FZ5 A;  1ML6 A;  2FWG A;  3CBU A;  2N5A A;  3VI5 A;  2IMI A;  1SK1 A;  2M72 A;  4JED A;  5JCW A;  3UJ1 A;  3LGC A;  2HZE B;  5HFI A;  2PN8 A;  4TR4 A;  1OKD A;  2L6D A;  2O7K A;  3PR8 A;  3MAK A;  3QR6 A;  4N0V A;  2H8L A;  2FD3 A;  3TCO A;  2C4J A;  1MDJ A;  4GQF A;  4KX4 A;  2NVL A;  3IDV A;  3K8N A;  4AJ8 A;  3U5R E;  5JCU A;  1PQN A;  4ZBA A;  3FKF A;  2V1M A;  1DUG A;  3HXS A;  2C3Q A;  4KDX A;  1PD2 1;  1EZK A;  3WD6 A;  3M8N A;  3A2X A;  2FWH A;  2LNS A;  5GZZ B;  3H1N A;  2V2G A;  3HZ4 A;  2H73 A;  2BMX A;  4FQU A;  2REM A;  3ED3 A;  2HSM B;  3PIN A;  3WT1 A;  1UA5 A;  4ZIL A;  1ZL9 A;  2V32 A;  2H1G A;  1A8Y A;  3KD0 A;  1VF2 A;  3TKS E;  16GS A;  1XVQ A;  2HT9 A;  3IK7 A;  4I5Q A;  3LOR A;  3D5J A;  5GST A;  4O5R A;  4JR6 A;  2HZF A;  2YCD A;  4KSO A;  5A4W A;  2X8G A;  2H0G A;  1JLV A;  4O32 A;  1O7U A;  4GXZ A;  2AHE A;  1V9W A;  3GH6 A;  3ZIT A;  1PRX A;  2EC4 A;  4AKG A;  3W8S A;  5DJL A;  1XW9 A;  3P2A A;  3QOU A;  4TR0 A;  4XTS A;  1Z3E A;  3RPN A;  2GQL A;  3HZ8 A;  2H71 A;  3C71 A;  2I3Y A;  4EIP A;  1GLQ A;  4F2I A;  4KF9 A;  4NHZ A;  1F9M A;  3L9V A;  22GS A;  3LWA A;  4AJ7 A;  4X0X A;  3GNJ A;  5J3R A;  2FGX A;  1Y1U A;  1X5E A;  1IYI A;  2H0H A;  4QQ7 A;  4IP1 A;  3L78 A;  2HQT A;  7GSS A;  3RHC A;  1AQX A;  1SD8 A;  2HFD A;  2XPE A;  4K0N A;  2H72 A;  1WOU A;  4MLY A;  4G0K A;  4Z2T A;  2OE3 A;  5DAL A;  6GSV A;  2WCI A;  1XPV A;  4AKI A;  1G0T A;  4AF2 A;  2MMN A;  2JZR A;  1WMJ A;  1XWC A;  3BBY A;  4GTU A;  3GL3 A;  3APS A;  5A34 A;  1Z7R A;  4WXT A;  2CQ9 A;  4MNN A;  1U88 A;  1NHO A;  4ECJ A;  3OR5 A;  1GSY A;  1OC3 A;  1XWK A;  1O81 A;  1JZW A;  2KP2 A;  1T8E B;  3F4S A;  4WF5 A;  4PTS A;  3GRX A;  2RUF A;  1YDK A;  3QDN A;  4ILF A;  3RBT A;  4HJM A;  3U6V A;  1GL8 A;  4G0I A;  4TVE A;  1LBK A;  4XRA A;  4LMV A;  5F05 A;  1JLW A;  5KEJ A;  1PX7 A;  3Q74 A;  1GSU A;  4YAP A;  2HYX A;  2C3T A;  1T00 A;  1N25 A;  4EDY A;  3L9U A;  1XW5 A;  1GTA A;  1FOH A;  1TJD A;  1AQW A;  3LYK A;  4NWY A;  2YZU A;  3FRC A;  5EPF A;  1HQO A;  3GTU B;  3DKS A;  2OAC A;  2GST A;  4MJA A;  2VCW A;  4AJ6 A;  1F37 A;  1XCC A;  2B1L A;  4I6X A;  3F6D A;  2VM2 A;  1SYX A;  3IPZ A;  13GS A;  4MF7 A;  1AUC A;  4MZB A;  1X9M B;  3UAP A;  2DSA A;  2RM5 A;  3KEB A;  4K7O A;  2ES7 A;  1UN2 A;  2R3X A;  4CY6 A;  3S9F A;  3D4M A;  3RPP A;  3WGD A;  4NHW A;  1TOF A;  4QL7 A;  1YKC A;  5J4V A;  2FA4 A;  2O85 A;  5GAN D;  1YY7 A;  5EL8 A;  5ECP B;  1WJK A;  4F0B A;  1B8X A;  2PWJ A;  5LD0 A;  4XS4 A;  4TW5 A;  3ZMK A;  2EIR A;  3ZML A;  2L59 A;  4AKH A;  3ZTL A;  2N5F A;  1XWB A;  5CO3 A;  4ACS A;  1X0R A;  5DAL B;  3MDK A;  5JCG A;  1G6W A;  1VRS D;  1AIU A;  3SWL A;  2R0C A;  5B8A A;  3F63 A;  2IMD A;  2LJK A;  2E7P A;  1TP9 A;  3GSS A;  5EY6 A;  2HLS A;  3L9S A;  2H74 A;  3DXB A;  3IOS A;  3HCZ A;  3EIN A;  4RQR A;  5A34 B;  3VWW A;  1T4Y A;  2H1B A;  3FR6 A;  3O76 A;  4ZL7 A;  3VWV A;  3HY2 A;  4NPB A;  3GHA A;  5G2Z A;  1HNC A;  3VI7 A;  1MDI A;  1EV4 A;  4G10 A;  3HYP A;  4YKG A;  4O5Q A;  4IN0 A;  1F2E A;  5B6N A;  4K2X A;  4PNG A;  4BWQ A;  2FHE A;  2H1L A;  5AIV A;  1EP8 A;  2CT6 A;  4ICY A;  1NHY A;  4EUY A;  2N5B A;  1T7P B;  3KM6 A;  1XXU A;  5LCZ A;  2LKU A;  2IPA A;  4Q5F A;  2P0G A;  3DIE A;  2UV8 G;  1SL1 B;  1A8L A;  5HR3 A;  1ERV A;  4LL4 B;  3TDG A;  1OE8 A;  3DEX A;  3J7Y b;  1M99 A;  1V98 A;  3M9J A;  3IA1 A;  2VD0 A;  3EC3 A;  1K3O A;  1ERU A;  4ID0 A;  1GUL A;  1N8J A;  1F3B A;  1PA3 A;  2YN1 A;  1YKA A;  4PUF C;  5KOX A;  1MDK A;  3GL5 A;  5G31 A;  3E3E A;  2VCZ A;  2YNX A;  10GS A;  2OKA A;  1JZR A;  3F3Q A;  1A0F A;  4NXI A;  5ELA A;  2EFC A;  5AN1 A;  1Q4J A;  3QAW A;  2P31 A;  1AW9 A;  3HJM A;  4J56 E;  5D9W A;  4L5L A;  1DSB A;  1A2L A;  4I8B A;  2OBK A;  3KH9 A;  2K8V A;  2LQQ A;  1R5P A;  4CHS A;  1R5A A;  2GSS A;  3GST A;  3Q19 A;  3I69 A;  2CA8 A;  4KW6 A;  3D22 A;  2DJ1 A;  1ACV A;  2FUG 2;  2K9F A;  2RUE A;  1XWA A;  3MIX A;  1EV9 A;  5IMV A;  5DQS A;  2DC5 A;  1ERW A;  4L8E A;  6GSU A;  1Z5Y E;  1TI3 A;  3TOU A;  1E6B A;  4PUR A;  2HRK A;  1Z6M A;  1OKT A;  1BF5 A;  1PX6 A;  6GSX A;  4Z7X A;  2VAF A;  1U87 A;  1U6T A;  4J57 E;  4MF6 A;  2ON5 A;  2F8F A;  2OJL A;  3PPU A;  1EWX A;  1F6M C;  2XPD A;  3GKN A;  4WBJ A;  2HSM A;  4Q5Q A;  3G7Y A;  2H01 A;  1SJI A;  4POB A;  4GST A;  3JCM L;  5D93 A;  1USB A;  4MPF A;  4YQM A;  5H5Q A;  5KN2 A;  2KHP A;  2R0P A;  3NOF A;  3VUR A;  4LA1 A;  2PPT A;  4PQH A;  5HR1 A;  1A24 A;  1TRV A;  2EFD A;  1HNB A;  2DML A;  1YZX A;  4N0Z A;  1PKW A;  4KDY A;  1K0M A;  3EVI A;  4QL9 A;  4IBP A;  1GSQ A;  2B5Y A;  1PGT A;  5G5F A;  2IWT A;  2NPB A;  4V2N A;  4E8E A;  4BL7 B;  1G6Y A;  3GUS A;  2CV4 A;  2H6Y A;  2DKI A;  4HDE A;  3A5W A;  2QC7 A;  3ERF A;  1K0D A;  2B5X A;  3EMX A;  4Q5N A;  5A5K A;  5DAK B;  5IOX A;  1QFN A;  1WP0 A;  3IC4 A;  1QXH A;  1OC8 A;  2QKE A;  4IP6 A;  5DCH A;  4GLT A;  3DYR A;  3VLN A;  3FEU A;  4MJC A;  5G1K A;  5IMD A;  3NZN A;  1J08 A;  1O6J A;  1S3A A;  1H4O A;  3F3R A;  2A4V A;  3GX0 A;  4NV5 A;  3LXZ A;  2Z9S A;  1Y25 A;  1U3A A;  1OYJ A;  2C3N A;  3KH7 A;  1V58 A;  1XFL A;  1GLP A;  2CZ2 A;  2X8H A;  4ZIJ A;  1PL1 A;  1JZD A;  1SEN A;  1IYH A;  4EF0 A;  4K2D A;  4DSR A;  3TKS C;  3LW9 A;  4KND A;  1WRY A;  3LJR A;  3CRT A;  2WFC A;  1VF1 A;  5ECQ B;  2O89 A;  1FW1 A;  1TK8 B;  5J41 A;  4D73 B;  5F0G A;  3WGX A;  5JWO B;  1ILO A;  3EU4 A;  2PU9 C;  1A0R P;  4IJI A;  2HRK B;  2R5G A;  3G7J A;  3ERG A;  1DE2 A;  3ZRD A;  1G7O A;  2CAI A;  5INY A;  4OFT A;  4L0U A;  4KSM A;  4F03 A;  3KTB A;  3TJG A;  4KGI A;  5HFK A;  1ZGN A;  6GST A;  4DVC A;  4L0W A;  2ALB A;  4DSS A;  1M9A A;  1O85 A;  1YF0 A;  5JWQ B;  2IME A;  2DIY A;  3ZL5 A;  4K8M A;  2VKZ G;  2GS3 A;  3GTU A;  3IHQ A;  1A2J A;  1TRW A;  4RQX A;  4IJ3 A;  2VD1 A;  3TJB A;  2I1U A;  2GSR A;  3A5I A;  2X8C A;  3TU3 B;  1TXX A;  3AY8 A;  4PQI A;  1T1V A;  2C0F A;  3IAS 2;  2G2Q A;  1B4Q A;  3EYT A;  3ZLP A;  4GRF A;  4KUN A;  4HOJ A;  3FZ4 A;  2DJK A;  1ST9 A;  4ULX A;  4OCF A;  1HD2 A;  5ECK B;  2LUS A;  1HYU A;  2VO4 A;  2EIQ A;  3TJF A;  3GKM A;  4EXJ A;  5D9V A;  2JAD A;  2VUP A;  2EFE A;  4AKX B;  3EPT A;  4V1A p;  5IMZ A;  1SK2 A;  4WBR D;  4BPY A;  2YOI A;  2OA7 A;  2PVO C;  4MJE A;  4HUA A;  1YF1 A;  2PER A;  4MPG A;  2L5O A;  4IKH A;  1SYR A;  3CYN A;  2F51 A;  3APO A;  1WWJ A;  1MEK A;  5HQP A;  1GSE A;  4F82 A;  3HKR A;  2CX4 A;  4IS0 A;  1A2M A;  2LRC A;  1NSW A;  1SJ6 A;  5J9B A;  5DJM A;  1ABA A;  4BWS A;  2NTO A;  1WIK A;  2VCX A;  1SKR B;  2FY6 A;  3MNG A;  2R0G A;  1GTU A;  3FR3 A;  1S3C A;  3C1R A;  5F07 A;  3GKX A;  1VGL A;  20GS A;  3F4T A;  3IBH A;  3FR9 A;  2JAC A;  1KBN A;  3FY7 A;  2X4A A;  1SK0 A;  4MK3 A;  2GQK A;  1T4Z A;  2D2Z A;  5KOW A;  3N9J A;  1GSD A;  1AAZ A;  1BAY A;  6GSY A;  5HR0 A;  4WF4 A;  5IOW A;  4ZB8 A;  2C8U A;  4DSS B;  2TRX A;  4I2T A;  4YAV A;  2DJ3 A;  1TW9 A;  2LNT A;  2WJU A;  2E0Q A;  19GS A;  1W4V A;  1K3L A;  2QGV A;  4MA9 A;  1GTB A;  1TTZ A;  5A5H B;  1TU7 A;  1BYE A;  2VL9 A;  3TKS A;  2KLX A;  4YH2 A;  2HRN A;  2GZY A;  4MH3 A;  4CDO A;  5ELG A;  5JWR B;  4PNF A;  2DJ2 A;  4G9H A;  5ECO B;  2QA2 A;  4X43 A;  4ISD A;  1SL0 B;  4ZBD A;  3VWX A;  3D4T A;  2H6Z A;  2P5R A;  4P3Y B;  1XBS A;  3ME7 A;  4FYC A;  4ZBB A;  3IAM 2;  4WEY A;  2MBT A;  5IM9 A;  4GSS A;  1PL2 A;  2GDR A;  11GS A;  1KNG A;  1QK8 A;  4KH7 A;  2VCT A;  4KE3 A;  2RM6 A;  2LS5 A;  4POL A;  2EFH A;  3WGE A;  5DDL A;  3HJO A;  1JHB A;  2RII A;  2AV4 A;  4KDU A;  4BA7 A;  3QFA C;  2PUK C;  4J2F A;  4XCS A;  5D9X A;  5FT3 A;  2C1Y A;  2M46 A;  1I5G A;  2YZH A;  5CRE A;  1M2A A;  3F8U A;  2R6K A;  1OVN A;  4V1A g;  3QMX A;  4IGJ A;  5G30 A;  2LRT A;  3HVS A;  5CRG A;  1O8X A;  2H30 A;  3RDW A;  2LEG A;  5HR2 A;  2MMA A;  2YP6 A;  2JL4 A;  3IXR A;  2YV7 A;  4I2U A;  4XHM A;  3VFI A;  2L6C A;  4MJB A;  5IIZ A;  3EUR A;  4O7H A;  5E59 A;  2H0I A;  5IO2 A;  5ECM B;  3LQ7 A;  1XOA A;  2VIM A;  9GSS A;  2IMK A;  2J9H A;  2O5V A;  1ZMA A;  2NBS A;  3SBC A;  2XC2 A;  1GNE A;  4BVY A;  4POM A;  3RAZ A;  5ENU A;  1PKZ A;  4BL7 A;  3H79 A;  1TRS A;  4EC0 A;  2C0E A;  1LJR A;  5EVO A;  5DQY A;  4ZL8 A;  2OE0 A;  2ZCT A;  3KZQ A;  1T3B A;  5DAK A;  2ZNM A;  1RQM A;  1VF3 A;  3CSI A;  4CY8 A;  2H75 A;  3APQ A;  4FH8 A;  4ECC A;  2KUC A;  4N30 A;  2H1D A;  5CYY A;  5H5R A;  3GKK A;  2B7J A;  1XVW A;  3KJY A;  2J23 A;  1PN9 A;  4XS6 A;  5J47 A;  1DE1 A;  2C0D A;  1CQG A;  4W66 A;  1C72 A;  4MF5 A;  3ZVJ A;  1NW2 A;  4Z2R A;  5IPH A;  2OE1 A;  3GIX A;  2YV9 A;  1TDI A;  4OO5 A;  2YWI A;  1FB0 A;  4JE1 A;  2I81 A;  4TRX A;  2EIO A;  5C00 A;  4JZQ A;  4TKY A;  2HSN A;  3CTF A;  5F8B A;  3ZFB A;  1SKW B;  3CTG A;  4K5R A;  3GFK A;  5B7C A;  2HI7 A;  3LXT A;  3QAG A;  1Y6E A;  5GSS A;  4HQZ A;  3KXO A;  5J4Y A;  2C0G A;  3V1W A;  1BJX A;  4IEL A;  2WUL A;  2BTO T;  5KN0 A;  2IIY A;  3EU3 A;  2MMZ A;  4YQU A;  5L71 A;  4D73 A;  2K6V A;  2IL3 A;  1B4P A;  2V6K A;  2B1K A;  2LRN A;  4OO4 A;  1ERT A;  4I97 A;  3KIJ A;  5D96 A;  4GWR A;  4IQA A;  5ABR A;  4EVM A;  3O3T A;  4HQS A;  1UC7 A;  2AYT A;  3TJJ A;  1J9B A;  3PGT A;  4AI6 A;  2TIR A;  1FOV A;  4MZC A;  1URM A;  5FWG A;  1GH2 A;  2O87 A;  1O8W A;  2G0F A;  12GS A;  1JZO A;  3DML A;  2H1A A;  2R37 A;  2JSY A;  3FMW A;  1OC9 A;  4POK A;  1GSF A;  4TN8 A;  3GMF A;  2FCH A;  4HJ2 A;  2YWO A;  4BVY B;  2MZC A;  2JU5 A;  4MAB A;  3EWL A;  2CAQ A;  17GS A;  2B3S A;  2JZT A;  1G7E A;  3FZA A;  2YJ7 A;  3TKQ A;  1RW1 A;  1XOB A;  5ECR B;  4IW9 A;  4LMW A;  1K3Y A;  5FHI A;  1R26 A;  4G01 A;  2DMM A;  2VL2 C;  1TK0 B;  2HSH A;  1X9S B;  3EE2 A;  4TR3 A;  5A4V A;  2XHF A;  2ZUP A;  3MSZ A;  4RI6 A;  3F4R A;  2WB9 A;  3H8Q A;  4XS1 A;  4EKZ A;  5DVB A;  2PBJ A;  1EP7 A;  2BJX A;  2VLT A;  2A2P A;  2HNL A;  5DBQ A;  3R2Q A;  1QQ2 A;  3A3T A;  3Q6O A;  4USS A;  2H66 A;  2OT3 A;  3DRN A;  3KCM A;  2WDU A;  1A23 A;  1I9D A;  1K0C A;  2F3M A;  3HDC A;  5ECS A;  4TR1 A;  1UVZ A;  3DWV A;  5IO0 A;  5ID2 A;  2GT6 A;  1Z7P A;  3TKP A;  3LYP A;  4BVX B;  3KP9 A;  3UVT A;  3EMP A;  2AUV A;  2XBQ A;  2JSZ A;  4OCE A;  2HSN B;  3W6G A;  3TGZ A;  4V2M A;  4Z2U A;  1BG1 A;  3IRA A;  1M7T A;  3FYG A;  8GSS A;  5CAX A;  3US3 A;  3ZIV A;  1E2Y A;  5BMU A;  1ON4 A;  1GSS A;  1TI1 A;  2FWE A;  2CX3 A;  2GSQ A;  2H6X A;  2WZ9 A;  3P90 A;  5IPG A;  4RI7 A;  2JZS A;  3DVX A;  5A4U A;  1K0O A;  1BG5 A;  1GUM A;  3M3M A;  2VLU A;  3Q18 A;  2WRT A;  2MYG A;  3F9U A;  4E68 A;  1EEM A;  2GZP A;  4KA0 A;  1R7H A;  2IN3 A;  4HEA 2;  4GF0 A;  3TJK A;  1X5C A;  4RUV A;  1TXU A;  5G5E A;  1ZYE A;  2LTK A;  4HU7 A;  3UOM A;  3ZYW A;  4G2E A;  1B48 A;  4OD7 A;  3D0Z A;  1Q98 A;  4JU5 A;  4KB3 A;  1ZYQ B;  1GP1 A;  2UZ8 A;  1GUH A;  2CVD A;  3DVW A;  1OC9 B;  1M9B A;  4KCE A;  3M9K A;  4MZW A;  2A2R A;  4X1U A;  3KMN A;  5A5H A;  4K0G A;  4K1F A;  5COH A;  5J40 A;  1GNW A;  1CQH A;  4AGS A;  2FA8 A;  4F9Z A;  2LV3 A;  5IQY A;  2IFQ B;  4DEJ A;  3GV1 A;  3WT2 A;  2L4Q A;  3P8W A;  4L5O A;  4ZB6 A;  1ZCP A;  4IVF A;  3TOT A;  1AXD A;  14GS A;  4KAE A;  5D73 A;  4PXO A;  3HD5 A;  5DCG A;  4IHU A;  1HNA A;  1ZYP A;  4EE0 A;  2RLI A;  4K6X A;  3TKR A;  4G0L A;  3LEF A;  3TUE A;  4OFM A;  4ZXG A;  3FK8 A;  3IHG A;  3HVX A;  3ZFL A;  3L4N A;  4XRD A;  5CRD A;  2GVP A;  1K0N A;  1B9X C;  1J0F A;  4TR1 B;  5ID2 B;  5CRH A;  5B6M A;  2IMF A;  3H4K A;  4O92 A;  2H19 A;  3GH9 A;  3C1S A;  4K7N A;  1FVK A;  4GQC A;  3UAR A;  1SVL A;  1Z9H A;  2CZ3 A;  3PH9 A;  5D8I A;  1EEJ A;  3KGK A;  4ZB9 A;  2AAW A;  3C8E A;  3QFB C;  18GS A;  2LJR A;  1ZOF A;  2WGR A;  2XBI A;  5BMU B;  1F3A A;  3GN3 A;  3GX8 A;  1SJZ A;  2DJ0 A;  2LQO A;  2ON7 A;  3KP8 A;  3C7M A;  2E2M A;  2VL2 A;  3RHB A;  1VF4 A;  3A2V A;  1U3I A;  1XW6 A;  4HZ2 A;  2HXK A;  3A2W A;  5IMC A;  4ECB A;  3CSJ A;  3BCI A;  3BJ5 A;  3CSH A;  3FHK A;  3W8J A;  4OFN A;  2B7K A;  1LU4 A;  3IV4 A;  2OAD A;  3VPT A;  6GSS A;  5ECI B;  4FYB A;  3UVH A;  4IQ1 A;  3NIV A;  2DJJ A;  4XIH A;  2YJH A;  4MDC A;  1GWC A;  1BX9 A;  1H75 A;  1R4W A;  2DIZ A;  1Z6N A;  4WKW A;  4NAX A;  4OWY A;  3ZZX A;  4KCA A;  2VCV A;  1DBY A;  2FNO A;  3TRP A;  5J4U A;  3CXG A;  4YKF A;  2GLR A;  3G9B A;  4N11 A;  3UIW A;  3UEM A;  4TOP A;  4FYU A;  2FWF A;  5CNW A;  3HHV A;  3F0I A;  2A4H A;  1SL2 B;  4EL1 A;  2E2G A;  3GA4 A;  2PVQ A;  5D9T A;  2L57 A;  1M2B A;  3VWU A;  1K0A A;  3WYW A;  2HRA A;  1MD3 A;  2P5Q A;  4HU9 A;  3M0F A;  5C04 A;  4MCU A;  3LSZ A;  2GZZ A;  5LNK e;  1FO5 A;  5ECN B;  2O8V B;  5H5S A;  4LL1 B;  1ZZY A;  1KTE A;  4MP4 A;  5BRT A;  4YQV A;  4JRR A;  1JFU A;  3CRU A;  5IMF A;  2WS2 A;  3ZRE A;  3GUR A;  3MWH A;  3BOA A;  4TXV A;  5B8B A;  1SVM A;  1EGR A;  2PMT A;  5ECH B;  2X49 A;  3HJP A;  3DD3 A;  3I43 A;  2R4V A;  1THO A;  1XIY A;  3L0H A;  3FW2 A;  3UBK A;  3D21 A;  2DBC A;  3M1G A;  1OAZ A;  1TRU A;  1TK5 B;  1FHE A;  1GRX A;  1AC1 A;  1QUW A;  2QSI A;  1EOH A;  1XZO A;  3QD9 A;  4GCI A;  2DKH A;  1N2A A;  5AIX A;  1YVL A;  4K9Z A;  2K18 A;  4ECI A;  2VCQ A;  3LFL A;  4ZL9 A;  5KN3 A;  2GTU A;  1FAA A;  3TRX A;  1BQ7 A;  2TRC P;  2AJQ B;  4O5U A;  5HFG A;  4WR5 A;  2YPM A;  4ML1 A;  6GSW A;  2I9H A;  2AB6 A;  1RK4 A;  4NMU A;  4PX1 A;  3I6A A;  2MMO A;  4OMV A;  1MD4 A;  4TXO A;  5KN1 A;  5IMA A;  3DGQ A;  3ISO A;  3IK9 A;  1QGV A;  2VOC A;  2CVB A;  1THX A;  3QCP A;  1S3D A;  1EOG A;  1SVO A;  3F6F A;  2QA1 A;  3E0U A;  3LG6 A;  2IJY A;  4ML6 A;  2VL3 A;  3CWG A;  2I4A A;  2C80 A;  5G1L A;  4F0C A;  1V40 A;  2HSY A;  5J9C A;  1YEX A;  4PGT A;  5A1N A;  2HRF A;  2DLX A;  4EIQ A;  2MBS A;  3UBL A;  3FZ9 A;  4DSQ A;  3IE3 A;  1FG4 A;  1PN0 A;  2V41 A;  2VLV A;  4HS1 A;  5ECL B;  1W89 A;  4PUA A;  3HMJ G;  2YWM A;  1TKD B;  4E8H A;  1EGO A;  2PGT A;  3TB2 A;  4MH2 A;  3I9V 2;  1YJ6 A;  5CRW A;  3QAV A;  3VK9 A;  3ERW A;  3UMA A;  4BVX A;  3KTL A;  1ZYN A;  2HZE A;  2OBI A;  1YQ1 A;  3ME8 A;  1M2D A;  2R2J A;  2GGT A;  1PSQ A;  2A2S A;  2CVK A;  4LLR A;  2GT5 A;  1MTC A;  2GQM A;  4WR4 A;  1QMV A;  4EDZ A;  5E4W A;  3E9J B;  3VPQ A;  4N3Z A;  3G7I A;  5CP1 A;  2KOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...