1EV4A

Rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
SGKPVLHYFNARGRMECIRFLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNKLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE A1-1
publication title Localization of the C-terminus of rat glutathione S-transferase A1-1: crystal structure of mutants W21F and W21F/F220Y.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 77
structure length 221
sequence length 221
chains with identical sequence C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1ev4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ev4A01
2C0EA 1JZRA 3ZVJA 2JZTA 6GSYA 4FQUA 2VM2A 2E2MA 3DGQA 2YNXA 1DE2A 3FR9A 3BD2A 2GSSA 1ILOA 4G10A 2VCTA 3M0FA 1R26A 1GSYA 5H5RA 2CV4A 4PNFA 4AF2A 4KF9A 2FY6A 1AIUA 1OC9B 1F9MA 1Q4JA 1HQOA 3IC4A 2CVBA 2YWOA 1Z7RA 1M9BA 1TW9A 1G6YA 4NWYA 1XW9A 2EIRA 3ME7A 3TKSC 5G5FA 1B48A 1YJ6A 1SYXA 1U3IA 2XPDA 3KH7A 5DCGA 2VOCA 2LJKA 2M46A 1T7PB 2DJ3A 4YQUA 3WD6A 1YEPA 6GSWA 19GSA 1XWCA 3P2AA 5LCZA 1RW1A 2CX3A 2KLXA 1V57A 4GQCA 5INYA 1GL8A 1DE1A 2OACA 4I2UA 3EINA 5F06A 2VL9A 5AIVA 5IMZA 3KEBA 4KSMA 3HJMA 2AV4A 4XCSA 5D9TA 6GSSA 2FHEA 4QL7A 5A4UA 1S3DA 1XWGA 1A24A 1FB6A 3CSJA 4F0CA 4OCFA 2H1BA 5GAND 2AAWA 5ECPB 4X1UA 3EURA 3TB2A 4NAXA 1OKDA 4L8EA 1K0BA 1R5PA 1U3AA 3BCIA 4PTSA 4WF4A 2LQOA 4BWSA 4XIHA 3L78A 1JHBA 2VAFA 3E3EA 1ZMAA 2IMEA 4ZB8A 2ZNMA 2NBSA 4MJBA 1HNCA 3HHVA 3TJFA 1K0OA 1Y25A 2V6OA 4MABA 2HLSA 4CDOA 4ZXGA 2DJ1A 3DYRA 2OBKA 1WPIA 3VPTA 3WGEA 6GSUA 2B3SA 4LA1A 5DJMA 5ECLB 2H1DA 5IMVA 1OAZA 3QD9A 4Z7XA 4F03A 3TOTA 3ZIJA 2VL2C 1YY7A 1TRVA 1OKTA 2L5LA 4TVEA 2L59A 2I81A 3RPNA 3M1GA 2HE3A 4KDXA 1PMTA 2LRNA 5DALB 5IOXA 1J08A 4RI7A 2UZ8A 1XOBA 1YZXA 1AW9A 1E2YA 3V1WA 3H93A 4K8MA 1U87A 3CRTA 3ISOA 4G0IA 4FYCA 2N5FA 3VPQA 1FHEA 4F0BA 2C3TA 2I3YA 2PN8A 2H70A 2LEGA 3GYKA 3QFAC 3IV4A 4MPFA 1TTZA 5ID2A 2O85A 2IMDA 3ZYWA 4WR4A 2K9FA 4NMUA 3HVXA 4IQAA 3MSZA 5ENUA 1BG5A 2G2QA 3HKRA 1Z7PA 2O8VB 2H75A 4NHZA 2LUSA 2CAQA 4PUAA 1NHOA 4IJIA 1G7OA 3VWVA 2CZ2A 5DVBA 1BQ7A 3LYPA 1O81A 4D73B 1GP1A 2VD0A 3D4MA 1LU4A 2X64A 4GSNA 4XRAA 3S9FA 2ES7A 4L5OA 4J2FA 9GSSA 1VF2A 5C04A 1PL1A 2L4CA 3EWLA 3ZFLA 1J9BA 2B1LA 1OE8A 4CW9A 2V32A 3E0UA 4DSQA 4XS6A 1JZWA 2PVQA 3FEUA 1G0TA 1YQ1A 5G2ZA 1CQGA 17GSA 1JLWA 4ECJA 2WZ9A 3TOUA 1ABAA 3DXBA 3KIJA 1MDIA 1EV9A 5D9WA 3O6TA 1DUGA 2FLSA 4L0UA 1N8JA 1YKAA 1THXA 5GAPD 3WGDA 1H75A 3KTLA 4WEYA 3L0HA 3QR6A 3QPMA 2HYXA 4GTUA 2H0HA 4EF0A 1WIKA 2C4JA 3IBHA 5IO0A 1RQMA 1EV4A 3TKRA 4O32A 3ZFBA 1MD3A 3VI5A 1S3CA 3G7YA 3TGZA 1LJRA 1AQXA 2YOIA 2WS2A 4HZ2A 4ZBBA 3FK8A 4I2TA 2LV3A 1SK2A 1ON4A 1B4PA 4F82A 3FZAA 2X8CA 13GSA 3KMOA 4EL1A 3DIEA 3HDCA 5ELGA 1M9AA 4GCIA 1TRUA 1GUKA 1QK8A 2B5YA 3U5RE 3HZ8A 4OO4A 3SWLA 4TXOB 1EZKA 3NIVA 2H6YA 3O76A 5G31A 2H0GA 4WBRD 2JZSA 3UMAA 5J3RA 6GSTA 3C71A 4ZILA 2P0GA 3W6GA 4E8HA 1TK5B 2B7JA 3FYGA 1XVWA 3H8QA 1EP8A 1R7HA 2AB6A 2AUVA 2IMFA 3GHAA 2FWGA 1TRWA 4BPYA 4PGTA 2F9SA 5GZZB 1QQ2A 5IPGA 1M0UA 3IK9A 2ZUPA 3ZITA 4JE1A 3RHBA 2HZEB 5JWOB 3VFIA 4ECIA 4PNGA 4MF6A 3PINA 4IS0A 4IP1A 1FOVA 1PX7A 2VM1A 4OFTA 1GSFA 6GSXA 2GSQA 1GUHA 3KCMA 2LSTA 4P3YB 5CYYA 1Z6MA 4HS1A 3GH9A 2F3MA 1THOA 4IKHA 2GZPA 2K8VA 1ZYEA 2FD3A 1IYHA 2BTOT 2C3QA 4L0WA 4LMVA 2DJ0A 2F51A 2O87A 2PBJA 3TJBA 1GWCA 4IBPA 3M8NA 2N5BA 3IAS2 2I4AA 4DSSA 1T00A 2Z9SA 11GSA 14GSA 1ERUA 2FWFA 3I9V2 3UIWA 3IK7A 3P7XA 4BA7A 5ECQB 4IP6A 3UVTA 5ECOB 1XPVA 5D96A 4BWQA 5DQYA 3HJPA 4ECCA 3TKSE 4YQVA 1M99A 2DLXA 5B8BA 3DKSA 3O3TA 1OE7A 5DDLA 3TKSA 2MZCA 4OO5A 4EE0A 3WGXA 4LL4B 4MJCA 4WXTA 5DAKA 3DVWA 1V58A 4LMWA 5HFKA 3DWVA 5C00A 3F4SA 3I43A 2LRTA 1BYEA 3LGCA 4BL7A 1MDKA 5HR1A 2A2RA 4HI7A 1WOUA 1HD2A 4ZL8A 4JBBA 3VWWA 4YQMA 2DSAA 2ALBA 2HSMB 2YV7A 4L5LA 2IFQB 4F2IA 2REMA 3HVSA 1AQWA 1TJDA 2A2SA 2C80A 2VD1A 2L5OA 4ID0A 4GWRA 3TDGA 2WGRA 4OFNA 4KCEA 1PGTA 4EXJA 2WB9A 2NDOA 4K9ZA 2CA8A 2B6MA 1F37A 3E9JB 2GSTA 1B4QA 2TIRA 1O8XA 4ML1A 4IHUA 5D9XA 2IN3A 4H86A 1W89A 4HOJA 2V6KA 4I8BA 2PGTA 3M9KA 4RUVA 4PQIA 3KTBA 3IAM2 4GQFA 5H5QA 3VLNA 3KM6A 4TR1A 4N0VA 2GLRA 3VWUA 4MLYA 4MK3A 4TOPA 3GSSA 2VCQA 4ZB9A 1XCCA 3F63A 4GSSA 1DSBA 1EOHA 3HYPA 4BVXB 3GRXA 1GNWA 2IIYA 3D22A 3FY7A 1TP9A 3G7IA 3KP8A 1NSWA 4XS1A 5CRWA 2E7PA 2VL2A 2X8HA 3ZL5A 4YH2A 4MH3A 1A0RP 1LBKA 1TK0B 3M3MA 3ZREA 2ON5A 5A4WA 4DVCA 1HNAA 2YJ7A 2HQTA 2YWMA 2KOKA 1X5EA 4BVYA 1O85A 3UAPA 4NV5A 3I6AA 2GTUA 4XRDA 4ZL7A 3P8WA 1SKWB 2K6VA 3F6FA 2H0IA 5B6NA 2FNOA 3W8JA 3G7JA 4IGJA 5BMUA 2YZUA 4Q5RA 5JCUA 1VF3A 3QFBC 2ZCTA 1TU7A 4OCEA 2CT6A 4KGIA 3ZTLA 3GURA 1Y6EA 3F4TA 2OE3A 4NHWA 5J41A 1WWJA 3A2XA 1UN2A 1X9SB 1OC9A 4TR4A 2HRFA 1C72A 2L4QA 4TN8A 1SYRA 3EU4A 3F3QA 3UBLA 1BX9A 3NOFA 2B7KA 1USBA 2VLVA 1SU9A 3MWHA 4Q5NA 1SK0A 4N10A 1T1VA 4FO5A 3M9JA 5FT3A 3GSTA 2QSIA 4KA0A 3EMXA 2VL3A 3ME8A 3C73A 4K6XA 3IHQA 1F3AA 3AY8A 3UBKA 2RLIA 1GTIA 2RUFA 1TK8B 3EVIA 4IVFA 1Q98A 2R2JA 1T8EB 2LS5A 5ELAA 3CSIA 3VI7A 1GNEA 5KN2A 1J0FA 1BJXA 1AC1A 2H6ZA 1A8LA 2GGTA 4KW6A 1AXDA 1JZOA 1HYUA 2KP2A 3KMNA 2FA4A 3A2WA 3CSHA 5B6MA 3MAKA 3N9JA 3NZNA 4G0LA 1TKDB 3HVVA 5G1LA 2H1AA 1F2EA 5CAXA 1O8WA 1V98A 4POKA 4TRXA 4KB3A 1G6WA 2ON7A 1A23A 5LNKe 2QGVA 2GQMA 3GN3A 1XXUA 3EMPA 5IOWA 5COHA 4WF5A 2X8GA 5J9BA 5FWGA 3FZ9A 3TKQA 2VO4A 2HRKB 4O5RA 2TRCP 4WKWA 4MZCA 2PU9C 5IMDA 3ERGA 4Q5QA 2PMTA 4MP4A 4RI6A 4JU5A 1H4OA 4POMA 5DALA 2PUKC 1MDJA 5ABRA 4ISDA 3C1RA 4MJEA 4FYUA 5DBQA 3F3RA 5ECNB 3N5OA 1M2DA 2RM5A 5HFIA 4GXZA 3TJKA 3ERFA 2I9HA 2C0DA 1IYIA 2AHEA 1B9XC 1R4WA 2H6XA 2R3XA 4JR6A 4TW5A 3ZVJD 2R37A 4YAPA 3L9VA 3IC8A 4MZWA 3BJ5A 4HQZA 3HZ4A 4G0KA 3F8UA 3GTUB 5CP1A 4XS4B 1URMA 2CVKA 4EDZA 2X99A 1YF1A 4ACSA 2OA7A 4PXOA 1XWKA 2FGXA 3IR4A 1T4YA 1GLQA 3FHKA 1JFUA 2KUCA 2OBIA 3Q18A 4KNDA 4Q5FA 3ZLPA 4D73A 1FO5A 3TCOA 4NPBA 1PL2A 4ECBA 3GL3A 1T4ZA 2YN1A 1EP7A 2HI7A 2F8AA 3F9UA 4NXIA 1FB0A 1ZL9A 3RHCA 3D5JA 4HJMA 5D73A 5F0GA 3FRCA 1I9DA 1UVZA 2N5AA 3LEFA 4MF7A 2F8FA 5AGYA 2MMZA 4N30A 5GSSA 3CTGA 2GT6A 1ERWA 1A2MA 1XW6A 1EWXA 3MDKA 3F0IA 3LG6A 4RQXA 5E59A 2C0GA 1VF1A 5B8AA 4ULXA 2HSHA 2BMXA 1OC3A 1X0RA 2FUG2 1TXXA 1QMVA 4MPGA 3IDVA 5B7CA 2DBCA 3UARA 1ZZYA 1UC7A 4MMMA 3F6DA 3EU3A 3H4KA 4QQ7A 2GQKA 2HZFA 2RUEA 4O7HA 2XC2A 4NV2A 1GSEA 3KXOA 1XWAA 3K8NA 4X43A 1RK4A 4WBJA 1EOGA 4AJ8A 4HZ4A 1NW2A 2LRCA 1QFNA 1SKRB 3GX0A 4MF5A 1KBNA 4WR5A 3BOAA 2KHPA 3F4RA 4TXOA 2KP1A 5CRGA 4LLRA 1A0FA 3QOUA 2YCDA 3LYKA 5ECSA 2IL3A 2YV9A 2CX4A 4KUNA 5G5EA 3HJOA 18GSA 4G19A 5A4VA 3ZZXA 2GZZA 3KGKA 3QAWA 3L9SA 1VRSD 3SBCA 2MMAA 1MTCA 3BCKA 5D93A 1CQHA 2OKAA 1Z9HA 3ZMLA 10GSA 2H76A 5D9VA 2GVPA 4FIWA 4MCUA 3MNGA 3DEXA 1A2LA 3CTFA 5IMCA 5J9CA 1SJ6A 2HZEA 3C1SA 2DMLA 1E6BA 3ZRDA 2NTOA 1SJIA 3WYWA 2EIQA 1F3BA 3RPPA 2PWJA 2EC4A 2V41A 3LXTA 1FAAA 1EEMA 4K0GA 3GIXA 1OC8A 5A5KA 4E8EA 1M2AA 2DMMA 3IPZA 2VIMA 4ZBDA 4OMVA 5DCHA 1GUMA 3FR6A 3HD5A 2XHFA 3L9UA 2D2ZA 5IO2A 5J4UA 2C3NA 4G9HA 2WULA 1G7EA 1Z3EA 2JSZA 2GT5A 4V1Ag 3QAVA 2YZHA 4I6XA 3Q19A 3GMFA 3GFKA 2IPAA 1ERTA 3C7MA 2VCZA 3GL5A 3I69A 3GV1A 2XBQA 2YP6A 5H5SA 1K0CA 1TOFA 1PA3A 2HT9A 3FZ5A 5ECIB 3HY2A 4XHMA 3L4NA 2CZ3A 2L6CA 3GKMA 2MBSA 4ZBAA 1SD9A 5JCGA 1ZGNA 3ERWA 4IW9A 2YJHA 3FW2A 1XFLA 1B8XA 3CRUA 3LSZA 2HNLA 1GSDA 3TRPA 4HQSA 4V2MA 3UOMA 5ECHB 3DD3A 1A8YA 4TKYA 2GQLA 5G1KA 2RIIA 4IELA 4KE3A 4EKZA 1PKZA 3HCZA 3C8EA 3H1NA 2BJXA 3APOA 1X9WB 2HFDA 1B9YC 1GH2A 2HSMA 1QUWA 1K3LA 4MA9A 3A2VA 2IFQA 2PVOC 1K0DA 1M2BA 2IMKA 3WT1A 5EY6A 4POBA 4GLTA 2WDUA 5IMAA 4KDUA 4PUFC 1TI1A 3TRQA 7GSSA 1QGVA 2GZYA 1PKWA 2P5RA 5CNWA 4YAVA 3GKKA 4KX4A 3ZIVA 2K8SA 2TRXA 2NVLA 4KAEA 2GDRA 3HA9A 3U6VA 1JLVA 1XIYA 4HU7A 3LJRA 4EDYA 3KP9A 3GH6A 4EO3A 5ID2B 3IXRA 1SL1B 4ZL9A 3ZMKA 1GSSA 1K0AA 2FWHA 2R6KA 4KDYA 4I5QA 1GTBA 4JZQA 3PH9A 4JEDA 1GLPA 4K7OA 1TI3A 3FKFA 4BVXA 5IIZA 3ED3A 4V1Ap 2C8UA 3KZQA 4I97A 4F9ZA 5AIXA 4ML6A 5EPFA 2OADA 1DBYA 1BEDA 3VK9A 1K3OA 5EL8A 2H19A 3US3A 3BBYA 2VCVA 1SJZA 1WP0A 1GTAA 2CVDA 1VGLA 3D6IA 1M7TA 3RAZA 2H74A 2YPMA 1WJKA 2V1MA 1K3YA 3APSA 2P31A 2R4VA 4OD7A 3KH9A 5D8IA 3OR5A 2L6DA 1PSQA 2J9HA 5HFGA 2C0FA 4USSA 1TRSA 1YEXA 1WMJA 2LNSA 3DVXA 2WFCA 2LJAA 5IPHA 5G30A 1YKCA 4GRFA 2M80A 2JACA 3QAGA 1V40A 4OFMA 3VWXA 5JWRB 2HSNB 4EUYA 3EC3A 3EYTA 2AJQB 1NM3A 5IMFA 2QKEA 1FG4A 2WJUA 5KN1A 3LWAA 4IQ1A 4RQRA 3QDNA 5CO3A 2R5GA 2MMNA 1HNBA 4MJAA 1PN9A 1OVNA 1SENA 4MZBA 1PX6A 1R5AA 1ZOFA 5AISA 2M72A 1GRXA 1W4VA 4MDCA 2L57A 1SKSB 1EEJA 4TXVA 3TJGA 5L71A 3APQA 4IJ3A 5HQPA 2GSRA 1ACVA 1JZDA 4JRRA 2WRTA 2DIZA 2B5XA 2WCIA 4GF0A 1SL0B 5ECKB 1ZCPA 5DJLA 1SK1A 4KSOA 3IOSA 4EC0A 5HR0A 2YWIA 1PD21 4WETA 2IWTA 4J57E 2VCXA 5LD0A 1X5DA 3CXGA 1TU8A 1PRXA 4PX1A 1YF0A 3H79A 4TR0A 2B1KA 4PQ1A 12GSA 2A4VA 2XBIA 1VF4A 2NPBA 1SL2B 2DJ2A 3DMLA 1YDKA 5CRDA 4HDEA 1U88A 4GSTA 3D4TA 5CREA 4K2DA 1EGOA 4FYBA 2H1GA 4ILFA 2EIOA 4DEJA 2MYGA 3GUSA 4QL9A 4DSRA 2E0QA 2I1UA 2YANA 2DJJA 1Z5YE 1ZYQB 2MMOA 2H30A 3EE2A 3VURA 3RBTA 3DRNA 1XW5A 3W8SA 3D21A 2FA8A 3UJ1A 1XWBA 2VLUA 4ZB6A 2LQQA 1XZOA 2OE1A 5HR3A 3RDWA 1GULA 2V2GA 5IM9A 2C1YA 1O6JA 4V2LA 5F8BA 3PPUA 1FVKA 2DJKA 3TJJA 4K0NA 1GSUA 5AN1A 4K7NA 3LQ7A 2VUPA 3HXSA 1GTUA 2G0FA 3D0ZA 2MBTA 2HRAA 1X5CA 5HR2A 1GSQA 2HRKA 1XVQA 3PR8A 5CRHA 2O89A 1X9MB 4G2EA 1K0NA 1FVJA 1ML6A 4K1FA 2VLTA 5F05A 3GKNA 3G9BA 4X0XA 4AGSA 4HEA2 4DSSB 4PQHA 5EVOA 1MEKA 3UL3A 2LNTA 4HJ2A 2JSYA 2OE0A 3J7Yk 5JCWA 4TR3A 3GNJA 3GKXA 1K0MA 2P5QA 3TKPA 3CMIA 3LFLA 1O7UA 1XBSA 5E4WA 2J23A 4FH8A 1S3AA 3GTUA 4XS4A 2IMIA 16GSA 3TRXA 3JCML 3QCPA 4PURA 4K7IA 3FR3A 20GSA 3LORA 2H66A 5DAKB 3A5WA 2PERA 2H72A 3CYNA 5KEJA 3IA1A 5GSTA 1XOAA 2QC7A 1QXHA 1WE0A 4AJ7A 2HXKA 4BL7B 4CHSA 4V2NA 2DIYA 5IQYA 3WT2A 1I5GA 3LXZA 2YWNA 2H8LA 2LJRA 2B5EA 1FW1A 3PGTA 4IN0A 1N2AA 3IE3A 2JU5A 4AJ6A 1KTEA 1KEBA 3UEMA 2FWEA 3GX8A 2XPEA 2PPTA 4LL1B 1WRYA 1TDIA 1AQVA 1Z6NA 1ST9A 2H01A 2JZRA 3CBUA 1KNGA 5F07A 4HU9A 2CAIA 5JWQB 3R2QA 3J7Yb 4OWYA 8GSSA 2DC5A 3QMXA 4O92A 2LKUA 4KH7A 2JADA 2OJLA 4HUAA 3KJYA 4POLA 4TR1B 5FHIA 2H71A 1EGRA 3R3EA 3KD0A 2VCWA 3Q74A 3Q6OA 2JL4A 2H73A 3A3TA 1BAYA 5DQSA 4KCAA 2HRNA 1ERVA 2E2GA 5ECRB 2K18A 4N0ZA 5KN0A 3IRAA 4EVMA 1V2AA 4JR4A 2FCHA 1MD4A 4ZIJA 2RM6A 3UVHA 3P90A 5J5NA 1OYJA 1A2JA 1UA5A 2AYTA 1SD8A 2CQ9A 2O7KA 1F6MC 2HSYA 3GA4A 1O73A 1T3BA 5ECMB 5KN3A 2GS3A 4N11A 1V9WA 4BVYB 4MH2A 4XTSA 2IJYA 22GSA 1AAZA 3FZ4A 1AUCA 1PQNA 6GSVA 1U6TA 2LTKA 4J56E 1NHYA 3TUEA
chains in the Genus database with same CATH superfamily
2C0EA 1JZRA 3ZVJA 2JZTA 5BMUB 6GSYA 4FQUA 2EFDA 2VM2A 2E2MA 3DGQA 2YNXA 1DE2A 3FR9A 3BD2A 2GSSA 1ILOA 4ICYA 4G10A 2VCTA 3M0FA 1R26A 1GSYA 5H5RA 2CV4A 4PNFA 4AF2A 4KF9A 2FY6A 1AIUA 1OC9B 1F9MA 1Q4JA 1HQOA 2WVXA 3IC4A 2CVBA 2YWOA 1Z7RA 1M9BA 1TW9A 1G6YA 4NWYA 1XW9A 2EIRA 3ME7A 3TKSC 5G5FA 1B48A 1YJ6A 1SYXA 1U3IA 2XPDA 3KH7A 5DCGA 2VOCA 1ZYPA 2LJKA 2M46A 1T7PB 2DJ3A 1XG8A 4YQUA 3WD6A 1YEPA 6GSWA 4K5RA 19GSA 1XWCA 3P2AA 5LCZA 1RW1A 2CX3A 2KLXA 1V57A 4GQCA 5INYA 1GL8A 1DE1A 2OACA 4I2UA 3EINA 5F06A 2VL9A 5AIVA 5IMZA 3KEBA 4KSMA 3HJMA 2AV4A 4XCSA 5D9TA 6GSSA 2FHEA 4QL7A 5A4UA 1S3DA 1XWGA 1A24A 1FB6A 4YKGA 3CSJA 4F0CA 3LW9A 4OCFA 2H1BA 4MNNA 5GAND 2AAWA 5ECPB 4X1UA 3EURA 3TB2A 4NAXA 4Z2UA 1OKDA 4L8EA 1K0BA 1R5PA 1U3AA 3BCIA 2WW2A 4PTSA 2LQOA 4WF4A 4BWSA 4XIHA 3L78A 3A5IA 1JHBA 2VAFA 3E3EA 1ZMAA 2IMEA 4K5SA 4ZB8A 2ZNMA 2NBSA 4MJBA 1HNCA 3HHVA 3TJFA 1K0OA 1Y25A 2V6OA 4MABA 2HLSA 4CDOA 4ZXGA 2DJ1A 3DYRA 2OBKA 4W66A 1WPIA 4Z2TA 3VPTA 3WGEA 6GSUA 2B3SA 4LA1A 5DJMA 5ECLB 2H1DA 5IMVA 1OAZA 2EFEA 3QD9A 4Z7XA 4F03A 3TOTA 3ZIJA 2VL2C 1YY7A 1TRVA 1OKTA 2L5LA 4TVEA 2L59A 2I81A 2VKZG 3RPNA 5A34A 3M1GA 2HE3A 4KDXA 1PMTA 2LRNA 5DALB 5IOXA 1J08A 4RI7A 2UZ8A 1XOBA 1SVMA 1YZXA 1AW9A 1E2YA 3V1WA 3H93A 4K8MA 1U87A 3CRTA 3ISOA 4G0IA 4FYCA 2N5FA 3VPQA 1FHEA 4F0BA 2C3TA 2I3YA 2WW0A 2PN8A 2H70A 2LEGA 3GYKA 3QFAC 3IV4A 4MPFA 1TTZA 5ID2A 2O85A 2IMDA 3ZYWA 4WR4A 2K9FA 4NMUA 3HVXA 4IQAA 3MSZA 5ENUA 1BG5A 2G2QA 3HKRA 1Z7PA 2O8VB 2H75A 4NHZA 2LUSA 2CAQA 4PUAA 1NHOA 4IJIA 1G7OA 3VWVA 2CZ2A 5DVBA 1BQ7A 3LYPA 1O81A 4D73B 1GP1A 2VD0A 3EPTA 3D4MA 1LU4A 2X64A 4GSNA 4XRAA 1Y1UA 3S9FA 2ES7A 4L5OA 4J2FA 9GSSA 1VF2A 5C04A 1PL1A 2L4CA 3EWLA 3ZFLA 1J9BA 2B1LA 1OE8A 4CW9A 4Z2RA 2V32A 3E0UA 4DSQA 4XS6A 1JZWA 5BRTA 2WVYA 2PVQA 3FEUA 1G0TA 1YQ1A 5G2ZA 1CQGA 17GSA 1JLWA 4ECJA 2WZ9A 2DKHA 3TOUA 2HSNA 4O5QA 1ABAA 3DXBA 3KIJA 1MDIA 4EIQA 1EV9A 5D9WA 3O6TA 1DUGA 2FLSA 4L0UA 1N8JA 1YKAA 1THXA 5GAPD 3WGDA 1H75A 3KTLA 2A4HA 4WEYA 3L0HA 3QR6A 3QPMA 2HYXA 4GTUA 2H0HA 4EF0A 1WIKA 2C4JA 3IBHA 5IO0A 1RQMA 1EV4A 3TKRA 4PI0C 4O32A 3ZFBA 1MD3A 3VI5A 1S3CA 3G7YA 3TGZA 1LJRA 1AQXA 2YOIA 2WS2A 4HZ2A 4ZBBA 4HSCX 3FK8A 4I2TA 2LV3A 1SK2A 1ON4A 1B4PA 1N25A 4F82A 3FZAA 2X8CA 13GSA 3KMOA 4EL1A 3DIEA 3CWGA 2R0CA 3HDCA 5ELGA 1M9AA 4GCIA 1TRUA 1GUKA 1QK8A 2B5YA 3U5RE 3HZ8A 4OO4A 3SWLA 4TXOB 1EZKA 3NIVA 2H6YA 3O76A 5G31A 2H0GA 4WBRD 2JZSA 3UMAA 5J3RA 6GSTA 2O3EA 3C71A 4ZILA 4QMKA 2P0GA 3W6GA 4E8HA 1TK5B 2B7JA 3FYGA 1XVWA 3H8QA 1EP8A 1R7HA 2AB6A 3GHAA 2AUVA 2IMFA 2FWGA 1TRWA 4BPYA 4PGTA 2F9SA 5GZZB 1QQ2A 5IPGA 1M0UA 3IK9A 2ZUPA 1FOHA 3ZITA 4JE1A 3RHBA 2HZEB 5JWOB 3VFIA 4ECIA 4PNGA 4MF6A 3PINA 4IS0A 4IP1A 1FOVA 1PX7A 2VM1A 4OFTA 1GSFA 6GSXA 2GSQA 1GUHA 3KCMA 2LSTA 4P3YB 5CYYA 1Z6MA 4HS1A 5J47A 3GH9A 2F3MA 1THOA 4IKHA 2GZPA 2K8VA 1ZYEA 3CHXC 2FD3A 1IYHA 2BTOT 2C3QA 4L0WA 4LMVA 2DJ0A 2F51A 2O87A 2PBJA 3TJBA 1GWCA 4IBPA 3M8NA 2N5BA 3IAS2 2I4AA 4DSSA 1T00A 2Z9SA 11GSA 14GSA 1ERUA 2FWFA 3I9V2 3UIWA 3IK7A 3P7XA 4BA7A 5KOWA 5ECQB 4IP6A 3UVTA 5ECOB 1XPVA 5D96A 4BWQA 5DQYA 3HJPA 4ECCA 3TKSE 4YQVA 1M99A 2DLXA 3FMWA 5B8BA 3DKSA 3O3TA 1OE7A 5DDLA 3TKSA 2MZCA 4OO5A 4EE0A 1ZYNA 3WGXA 4LL4B 5J4VA 4MJCA 4WXTA 5DAKA 3DVWA 1V58A 4EIPA 4LMWA 5HFKA 3DWVA 5C00A 3F4SA 3I43A 2LRTA 1BYEA 3LGCA 4BL7A 1MDKA 5HR1A 2A2RA 4HI7A 1WOUA 1HD2A 4ZL8A 4JBBA 3VWWA 2O36A 4YQMA 2DSAA 2ALBA 2HSMB 2YV7A 4L5LA 2IFQB 4F2IA 2REMA 3HVSA 1AQWA 1TJDA 2A2SA 2C80A 2VD1A 2L5OA 4ID0A 4GWRA 3TDGA 2WGRA 4OFNA 4KCEA 1PGTA 2WZSA 2R0PA 4EXJA 2WB9A 2NDOA 4K9ZA 2CA8A 2B6MA 1F37A 3E9JB 2GSTA 1B4QA 2TIRA 1O8XA 4ML1A 4IHUA 5D9XA 2IN3A 4H86A 1W89A 4HOJA 2V6KA 4I8BA 2PGTA 3M9KA 4RUVA 4PQIA 3KTBA 3IAM2 5A1NA 4GQFA 5H5QA 3VLNA 3KM6A 4TR1A 4N0VA 2GLRA 3VWUA 4MLYA 4MK3A 4TOPA 3GSSA 2VCQA 4ZB9A 1XCCA 3F63A 4GSSA 1DSBA 1EOHA 3HYPA 4BVXB 3GRXA 1GNWA 4PI2C 2IIYA 3D22A 3FY7A 1TP9A 3G7IA 3KP8A 1NSWA 4XS1A 5CRWA 2E7PA 2VL2A 2X8HA 2H1LA 3ZL5A 4YH2A 4MH3A 1A0RP 1LBKA 1TK0B 3M3MA 3ZREA 2ON5A 2EFCA 5A4WA 4DVCA 1I1IP 1HNAA 2YJ7A 2HQTA 2YWMA 2KOKA 1X5EA 4BVYA 1O85A 3UAPA 4NV5A 3I6AA 2GTUA 4XRDA 4ZL7A 2QA1A 3P8WA 1SKWB 2K6VA 3F6FA 2H0IA 5B6NA 2FNOA 3W8JA 3G7JA 4IGJA 5BMUA 2YZUA 4Q5RA 5JCUA 1VF3A 3CQFA 3QFBC 2ZCTA 1TU7A 4OCEA 2CT6A 4KGIA 3ZTLA 3GURA 1Y6EA 3F4TA 2OE3A 4NHWA 5J41A 1WWJA 4A5PA 3A2XA 1UN2A 1X9SB 1OC9A 4TR4A 3HVNA 2HRFA 1C72A 2L4QA 4TN8A 1SYRA 3EU4A 3F3QA 3UBLA 1BX9A 3NOFA 2B7KA 3MYDA 1USBA 2VLVA 1SU9A 3MWHA 4Q5NA 1SK0A 5A5HB 3IHGA 4N10A 1T1VA 4FO5A 3M9JA 5FT3A 3GSTA 2QSIA 4KA0A 3EMXA 2VL3A 3ME8A 3C73A 4K6XA 3IHQA 1F3AA 3AY8A 3UBKA 2RLIA 1GTIA 2RUFA 1TK8B 3EVIA 4IVFA 1Q98A 2R2JA 1T8EB 2LS5A 5ELAA 3CSIA 3VI7A 1GNEA 5KN2A 4CY8A 1J0FA 1BJXA 1AC1A 2H6ZA 1A8LA 2GGTA 4KW6A 1AXDA 1JZOA 1HYUA 2KP2A 3KMNA 2FA4A 3A2WA 3CSHA 4PHZC 5B6MA 3MAKA 4YKFA 3N9JA 3NZNA 4G0LA 1TKDB 3HVVA 5G1LA 2H1AA 1F2EA 5CAXA 1O8WA 1V98A 4POKA 4TRXA 4KB3A 1G6WA 2ON7A 1A23A 5LNKe 2QGVA 2GQMA 3GN3A 1XXUA 3EMPA 5IOWA 5COHA 4WF5A 2X8GA 5J9BA 5FWGA 3FZ9A 3TKQA 2VO4A 2HRKB 4O5RA 2TRCP 4WKWA 4MZCA 2PU9C 5IMDA 3ERGA 4Q5QA 1YVLA 2PMTA 4AI6A 4MP4A 4RI6A 4JU5A 1H4OA 4POMA 5DALA 2PUKC 1MDJA 5ABRA 4ISDA 3C1RA 4MJEA 4FYUA 5DBQA 3F3RA 5ECNB 3N5OA 1M2DA 2RM5A 5HFIA 4GXZA 3TJKA 3ERFA 2I9HA 2C0DA 1IYIA 2AHEA 1B9XC 1R4WA 2H6XA 2R3XA 4JR6A 4TW5A 3ZVJD 2R37A 4YAPA 3L9VA 3IC8A 4CY6A 4MZWA 3BJ5A 4HQZA 3HZ4A 4G0KA 3F8UA 3GTUB 5CP1A 4XS4B 1URMA 2EFHA 2CVKA 4EDZA 2X99A 1YF1A 4ACSA 2OA7A 2WW3A 4PXOA 1XWKA 1S3RA 2FGXA 3IR4A 1T4YA 1GLQA 3FHKA 1JFUA 2KUCA 2OBIA 3Q18A 4KNDA 4Q5FA 3ZLPA 4D73A 1FO5A 3TCOA 4NPBA 4AKHA 1PL2A 4ECBA 1M3JA 3GL3A 1T4ZA 2YN1A 1EP7A 2HI7A 2F8AA 3F9UA 4NXIA 1FB0A 1ZL9A 3RHCA 3D5JA 4HJMA 5D73A 5F0GA 3FRCA 3HMJG 1I9DA 1UVZA 2N5AA 3LEFA 4MF7A 2F8FA 5AGYA 2MMZA 4N30A 1S4BP 5GSSA 3CTGA 2GT6A 1ERWA 1A2MA 1XW6A 1EWXA 3MDKA 3F0IA 3LG6A 4RQXA 5E59A 2C0GA 1VF1A 5B8AA 4ULXA 2HSHA 2BMXA 1OC3A 1X0RA 2FUG2 1TXXA 1QMVA 4MPGA 3IDVA 5B7CA 2DBCA 3UARA 1ZZYA 1UC7A 4MMMA 3F6DA 3EU3A 3H4KA 4QQ7A 2A2PA 2GQKA 2HZFA 2RUEA 4O7HA 2XC2A 4NV2A 1GSEA 3KXOA 1XWAA 3K8NA 4X43A 1RK4A 4WBJA 1EOGA 4AJ8A 4HZ4A 1NW2A 2LRCA 1QFNA 1SKRB 3GX0A 4MF5A 1KBNA 4WR5A 3BOAA 2KHPA 3F4RA 4TXOA 2KP1A 5CRGA 4LLRA 1A0FA 3QOUA 2YCDA 3LYKA 5ECSA 2IL3A 2YV9A 2CX4A 4KUNA 1BG1A 5G5EA 2QA2A 3HJOA 18GSA 4G19A 5A4VA 3ZZXA 2GZZA 3KGKA 3QAWA 5J40A 3L9SA 2WVZA 1VRSD 3SBCA 2MMAA 1MTCA 3BCKA 5D93A 1CQHA 2OKAA 1Z9HA 3ZMLA 10GSA 2H76A 5D9VA 2GVPA 4FIWA 4MCUA 3MNGA 3DEXA 1A2LA 4AKIA 3CTFA 5IMCA 5J9CA 1SJ6A 2HZEA 2WVXB 3C1SA 1BF5A 2DMLA 1E6BA 3ZRDA 4FXYP 3RGBC 2NTOA 1SJIA 3WYWA 2EIQA 1F3BA 3RPPA 2PWJA 2EC4A 2V41A 3LXTA 1FAAA 1EEMA 4K0GA 3GIXA 1OC8A 5A5KA 4E8EA 1M2AA 2DMMA 3IPZA 2X4AA 2VIMA 4ZBDA 4OMVA 5DCHA 1GUMA 3FR6A 3HD5A 2XHFA 3L9UA 2D2ZA 5IO2A 5J4UA 2C3NA 4G9HA 2WULA 1G7EA 1Z3EA 2JSZA 2GT5A 4V1Ag 4BIKA 3QAVA 2YZHA 4I6XA 3Q19A 3GMFA 3GFKA 2IPAA 1ERTA 3C7MA 2VCZA 3GL5A 3I69A 3GV1A 2XBQA 2YP6A 5H5SA 1K0CA 1TOFA 1PA3A 2HT9A 3FZ5A 5ECIB 3HY2A 4XHMA 3L4NA 1SVLA 2CZ3A 2L6CA 3GKMA 2MBSA 4ZBAA 1SD9A 5JCGA 1ZGNA 3ERWA 4IW9A 2YJHA 3FW2A 1XFLA 1B8XA 3CRUA 3LSZA 2HNLA 1GSDA 3TRPA 4HQSA 4V2MA 3UOMA 5ECHB 3DD3A 1A8YA 1PFOA 2GQLA 4TKYA 5G1KA 2RIIA 4IELA 4KE3A 4EKZA 1PKZA 3HCZA 3C8EA 3H1NA 2BJXA 3APOA 1X9WB 2HFDA 1B9YC 1GH2A 2HSMA 1QUWA 1K3LA 4MA9A 3A2VA 2IFQA 2PVOC 1K0DA 1M2BA 2IMKA 3WT1A 5EY6A 4POBA 4GLTA 2UV8G 2WDUA 5IMAA 4KDUA 5A34B 4PUFC 1M3IA 1TXUA 1TI1A 3TRQA 7GSSA 1QGVA 2GZYA 1PKWA 2P5RA 5CNWA 4YAVA 3GKKA 4KX4A 3ZIVA 2K8SA 2TRXA 2NVLA 4KAEA 2GDRA 3HA9A 3U6VA 1JLVA 1XIYA 4HU7A 3LJRA 4EDYA 4AKXB 3KP9A 3GH6A 4EO3A 5ID2B 3IXRA 1SL1B 5J4YA 4GDFA 4ZL9A 3ZMKA 1GSSA 4X4JA 1K0AA 2FWHA 2R6KA 4KDYA 4I5QA 1GTBA 4JZQA 3PH9A 4JEDA 1GLPA 4K7OA 1TI3A 3FKFA 4BVXA 5IIZA 3ED3A 4V1Ap 2C8UA 3KZQA 4I97A 4F9ZA 5AIXA 4ML6A 1YEWC 5EPFA 2OADA 1DBYA 1BEDA 3VK9A 1K3OA 5EL8A 2H19A 3US3A 3BBYA 2VCVA 1SJZA 1WP0A 1GTAA 2CVDA 1VGLA 3D6IA 1M7TA 3RAZA 2WW1A 2H74A 2YPMA 1WJKA 2V1MA 1K3YA 3APSA 2P31A 2R4VA 4OD7A 3KH9A 5D8IA 3OR5A 2L6DA 2X49A 1PSQA 2J9HA 5HFGA 2C0FA 4USSA 1TRSA 1YEXA 1WMJA 4E68A 2LNSA 3DVXA 2WFCA 2LJAA 5IPHA 5G30A 1YKCA 4GRFA 2M80A 2JACA 3QAGA 1V40A 4OFMA 3VWXA 5JWRB 2HSNB 4EUYA 3EC3A 3EYTA 2AJQB 1NM3A 5IMFA 2QKEA 1FG4A 2WJUA 5KN1A 3LWAA 4IQ1A 4RQRA 3QDNA 5CO3A 2R5GA 2MMNA 1HNBA 4MJAA 1PN9A 1OVNA 1SENA 4MZBA 1PX6A 1R5AA 1ZOFA 5AISA 2M72A 3MIXA 1W4VA 4MDCA 1GRXA 2L57A 4AKGA 1SKSB 1EEJA 4TXVA 5A5HA 3TJGA 5L71A 3APQA 4IJ3A 5HQPA 2GSRA 1ACVA 1JZDA 4JRRA 2WRTA 2DIZA 2B5XA 2WCIA 4GF0A 1SL0B 5ECKB 1ZCPA 5DJLA 1SK1A 4KSOA 3IOSA 4EC0A 5HR0A 2YWIA 1PD21 2DKIA 4WETA 2IWTA 4J57E 2VCXA 5LD0A 1X5DA 3CXGA 1TU8A 1PRXA 4PX1A 1YF0A 3H79A 4TR0A 3RFRC 2B1KA 4PQ1A 12GSA 2A4VA 2XBIA 1VF4A 2NPBA 1SL2B 2DJ2A 3DMLA 1YDKA 5CRDA 4HDEA 1U88A 4GSTA 3D4TA 5CREA 4K2DA 4G01A 1EGOA 4FYBA 4N3ZA 1PN0A 2H1GA 4ILFA 2EIOA 4DEJA 2MYGA 3GUSA 4QL9A 4DSRA 2E0QA 2I1UA 2YANA 2DJJA 1Z5YE 1ZYQB 2MMOA 5KOXA 2H30A 3EE2A 3VURA 3RBTA 3DRNA 1XW5A 3W8SA 3D21A 2FA8A 3UJ1A 1XWBA 2VLUA 4ZB6A 2LQQA 1XZOA 2OE1A 5HR3A 3RDWA 1GULA 2V2GA 5IM9A 2C1YA 1O6JA 4V2LA 5F8BA 3PPUA 1FVKA 2DJKA 3TJJA 1SVOA 4K0NA 1GSUA 5AN1A 3LQ7A 2VUPA 4K7NA 3HXSA 1GTUA 2G0FA 3D0ZA 2MBTA 2HRAA 1X5CA 2OT3A 5HR2A 1GSQA 2HRKA 1XVQA 3PR8A 5CRHA 2O89A 1X9MB 4G2EA 1K0NA 1FVJA 1ML6A 4K1FA 2VLTA 5F05A 3GKNA 3G9BA 4X0XA 4AGSA 4HEA2 4DSSB 4PQHA 5EVOA 1MEKA 3UL3A 2LNTA 4K2XA 4HJ2A 2JSYA 2OE0A 3J7Yk 5JCWA 4TR3A 3GNJA 3GKXA 1K0MA 2P5QA 3TKPA 3CMIA 3LFLA 1O7UA 1XBSA 5E4WA 2J23A 4FH8A 1S3AA 3GTUA 4XS4A 2IMIA 16GSA 3TRXA 3JCML 3QCPA 4PURA 4K7IA 3FR3A 20GSA 3LORA 4ZB7A 2H66A 5DAKB 3A5WA 2PERA 2H72A 3CYNA 5KEJA 3IA1A 5GSTA 1XOAA 2QC7A 1QXHA 1WE0A 4AJ7A 2HXKA 4BL7B 4CHSA 4V2NA 2DIYA 5IQYA 3WT2A 1I5GA 3LXZA 2YWNA 2H8LA 2LJRA 2B5EA 1FW1A 3PGTA 4IN0A 1N2AA 3IE3A 2JU5A 4AJ6A 1KTEA 1KEBA 3UEMA 2FWEA 3GX8A 2XPEA 2PPTA 4LL1B 1WRYA 1TDIA 1AQVA 1Z6NA 1ST9A 2O5VA 2H01A 2JZRA 3CBUA 1KNGA 5F07A 4HU9A 2CAIA 5JWQB 3R2QA 3J7Yb 4OWYA 8GSSA 2DC5A 3QMXA 4O92A 2LKUA 4O5UA 4KH7A 5A1NB 2JADA 2OJLA 4HUAA 3KJYA 4POLA 4TR1B 5FHIA 2H71A 1EGRA 3R3EA 3KD0A 2VCWA 3Q74A 3Q6OA 2JL4A 2H73A 3A3TA 1BAYA 5DQSA 4KCAA 2HRNA 1ERVA 2E2GA 5ECRB 2K18A 4N0ZA 5KN0A 3IRAA 4EVMA 1V2AA 4JR4A 3TU3B 2FCHA 1MD4A 4ZIJA 2RM6A 3UVHA 3P90A 5J5NA 1OYJA 1A2JA 1UA5A 2AYTA 1SD8A 2CQ9A 2O7KA 1F6MC 2HSYA 3GA4A 1O73A 1T3BA 5ECMB 5KN3A 2GS3A 4N11A 1V9WA 4BVYB 2R0GA 4MH2A 2IJYA 4XTSA 22GSA 1AAZA 3FZ4A 1AUCA 1PQNA 6GSVA 1U6TA 2LTKA 4J56E 1NHYA 3TUEA
chains in the Genus database with same CATH topology
2C0EA 1JZRA 3ZVJA 2JZTA 5BMUB 6GSYA 4FQUA 2EFDA 2VM2A 2E2MA 3DGQA 2YNXA 1DE2A 3FR9A 3BD2A 2GSSA 1ILOA 4ICYA 4G10A 2VCTA 3M0FA 1R26A 1GSYA 5H5RA 2CV4A 4PNFA 4AF2A 4KF9A 2FY6A 1AIUA 1OC9B 1F9MA 1Q4JA 1HQOA 3IC4A 2CVBA 2YWOA 1Z7RA 1M9BA 1TW9A 1G6YA 4NWYA 1XW9A 2EIRA 3ME7A 3TKSC 5G5FA 1B48A 1YJ6A 1SYXA 1U3IA 2XPDA 3KH7A 5DCGA 2VOCA 1ZYPA 2LJKA 2M46A 1T7PB 2DJ3A 4YQUA 3WD6A 1YEPA 6GSWA 4K5RA 19GSA 1XWCA 3P2AA 5LCZA 1RW1A 2CX3A 2KLXA 1V57A 4GQCA 5INYA 1GL8A 1DE1A 2OACA 4I2UA 3EINA 5F06A 2VL9A 5AIVA 5IMZA 3KEBA 4KSMA 3HJMA 2AV4A 4XCSA 5D9TA 6GSSA 2FHEA 4QL7A 5A4UA 1S3DA 1XWGA 1A24A 1FB6A 4YKGA 3CSJA 4F0CA 3LW9A 4OCFA 2H1BA 4MNNA 5GAND 2AAWA 5ECPB 4X1UA 3EURA 3TB2A 4NAXA 4Z2UA 1OKDA 4L8EA 1K0BA 1R5PA 1U3AA 3BCIA 4PTSA 4WF4A 2LQOA 4BWSA 4XIHA 3L78A 3A5IA 1JHBA 2VAFA 3E3EA 1ZMAA 2IMEA 4K5SA 4ZB8A 2ZNMA 2NBSA 4MJBA 1HNCA 3HHVA 3TJFA 1K0OA 1Y25A 2V6OA 4MABA 2HLSA 4CDOA 4ZXGA 2DJ1A 3DYRA 2OBKA 4W66A 1WPIA 4Z2TA 3VPTA 3WGEA 6GSUA 2B3SA 4LA1A 5DJMA 5ECLB 2H1DA 5IMVA 1OAZA 2EFEA 3QD9A 4Z7XA 4F03A 3TOTA 3ZIJA 2VL2C 1YY7A 1TRVA 1OKTA 2L5LA 4TVEA 2L59A 2I81A 2VKZG 3RPNA 5A34A 3M1GA 2HE3A 4KDXA 1PMTA 2LRNA 5DALB 5IOXA 1J08A 4RI7A 2UZ8A 1XOBA 1SVMA 1YZXA 1AW9A 1E2YA 3V1WA 3H93A 4K8MA 1U87A 3CRTA 3ISOA 4G0IA 4FYCA 2N5FA 3VPQA 1FHEA 4F0BA 2C3TA 2I3YA 2PN8A 2H70A 2LEGA 3GYKA 3QFAC 3IV4A 4MPFA 1TTZA 5ID2A 2O85A 2IMDA 3ZYWA 4WR4A 2K9FA 4NMUA 3HVXA 4IQAA 3MSZA 5ENUA 1BG5A 2G2QA 3HKRA 1Z7PA 2O8VB 2H75A 4NHZA 2LUSA 2CAQA 4PUAA 1NHOA 4IJIA 1G7OA 3VWVA 2CZ2A 5DVBA 1BQ7A 3LYPA 1O81A 4D73B 1GP1A 2VD0A 3EPTA 3D4MA 1LU4A 2X64A 4GSNA 4XRAA 1Y1UA 3S9FA 2ES7A 4L5OA 4J2FA 9GSSA 1VF2A 5C04A 1PL1A 2L4CA 3EWLA 3ZFLA 1J9BA 2B1LA 1OE8A 4CW9A 4Z2RA 2V32A 3E0UA 4DSQA 4XS6A 1JZWA 5BRTA 2PVQA 3FEUA 1G0TA 1YQ1A 5G2ZA 1CQGA 17GSA 1JLWA 4ECJA 2WZ9A 2DKHA 3TOUA 2HSNA 4O5QA 1ABAA 3DXBA 3KIJA 1MDIA 4EIQA 1EV9A 5D9WA 3O6TA 1DUGA 2FLSA 4L0UA 1N8JA 1YKAA 1THXA 5GAPD 3WGDA 1H75A 3KTLA 2A4HA 4WEYA 3L0HA 3QR6A 3QPMA 2HYXA 4GTUA 2H0HA 4EF0A 1WIKA 2C4JA 3IBHA 5IO0A 1RQMA 1EV4A 3TKRA 4O32A 3ZFBA 1MD3A 3VI5A 1S3CA 3G7YA 3TGZA 1LJRA 1AQXA 2YOIA 2WS2A 4HZ2A 4ZBBA 3FK8A 4I2TA 2LV3A 1SK2A 1ON4A 1B4PA 1N25A 4F82A 3FZAA 2X8CA 13GSA 3KMOA 4EL1A 3DIEA 3CWGA 2R0CA 3HDCA 5ELGA 1M9AA 4GCIA 1TRUA 1GUKA 1QK8A 2B5YA 3U5RE 3HZ8A 4OO4A 3SWLA 4TXOB 1EZKA 3NIVA 2H6YA 3O76A 5G31A 2H0GA 4WBRD 2JZSA 3UMAA 5J3RA 6GSTA 3C71A 4ZILA 4QMKA 2P0GA 3W6GA 4E8HA 1TK5B 2B7JA 3FYGA 1XVWA 3H8QA 1EP8A 1R7HA 2AB6A 2AUVA 2IMFA 3GHAA 2FWGA 1TRWA 4BPYA 4PGTA 2F9SA 5GZZB 1QQ2A 5IPGA 1M0UA 3IK9A 2ZUPA 1FOHA 3ZITA 4JE1A 3RHBA 2HZEB 5JWOB 3VFIA 4ECIA 4PNGA 4MF6A 3PINA 4IS0A 4IP1A 1FOVA 1PX7A 2VM1A 4OFTA 1GSFA 6GSXA 2GSQA 1GUHA 3KCMA 2LSTA 4P3YB 5CYYA 1Z6MA 4HS1A 5J47A 3GH9A 2F3MA 1THOA 4IKHA 2GZPA 2K8VA 1ZYEA 2FD3A 1IYHA 2BTOT 2C3QA 4L0WA 4LMVA 2DJ0A 2F51A 2O87A 2PBJA 3TJBA 1GWCA 4IBPA 3M8NA 2N5BA 3IAS2 2I4AA 4DSSA 1T00A 2Z9SA 11GSA 14GSA 1ERUA 2FWFA 3I9V2 3UIWA 3IK7A 3P7XA 4BA7A 5KOWA 5ECQB 4IP6A 3UVTA 5ECOB 1XPVA 5D96A 4BWQA 5DQYA 3HJPA 4ECCA 3TKSE 4YQVA 1M99A 2DLXA 3FMWA 5B8BA 3DKSA 3O3TA 1OE7A 5DDLA 3TKSA 2MZCA 4OO5A 4EE0A 1ZYNA 3WGXA 4LL4B 5J4VA 4MJCA 4WXTA 5DAKA 3DVWA 1V58A 4EIPA 4LMWA 5HFKA 3DWVA 5C00A 3F4SA 3I43A 2LRTA 1BYEA 3LGCA 4BL7A 1MDKA 5HR1A 2A2RA 4HI7A 1WOUA 1HD2A 4ZL8A 4JBBA 3VWWA 4YQMA 2DSAA 2ALBA 2HSMB 2YV7A 4L5LA 2IFQB 4F2IA 2REMA 3HVSA 1AQWA 1TJDA 2A2SA 2C80A 2VD1A 2L5OA 4ID0A 4GWRA 3TDGA 2WGRA 4OFNA 4KCEA 1PGTA 2R0PA 4EXJA 2WB9A 2NDOA 4K9ZA 2CA8A 2B6MA 1F37A 3E9JB 2GSTA 1B4QA 2TIRA 1O8XA 4ML1A 4IHUA 5D9XA 2IN3A 4H86A 1W89A 4HOJA 2V6KA 4I8BA 2PGTA 3M9KA 4RUVA 4PQIA 3KTBA 3IAM2 5A1NA 4GQFA 5H5QA 3VLNA 3KM6A 4TR1A 4N0VA 2GLRA 3VWUA 4MLYA 4MK3A 4TOPA 3GSSA 2VCQA 4ZB9A 1XCCA 3F63A 4GSSA 1DSBA 1EOHA 3HYPA 4BVXB 3GRXA 1GNWA 2IIYA 3D22A 3FY7A 1TP9A 3G7IA 3KP8A 1NSWA 4XS1A 5CRWA 2E7PA 2VL2A 2X8HA 2H1LA 3ZL5A 4YH2A 4MH3A 1A0RP 1LBKA 1TK0B 3M3MA 3ZREA 2ON5A 2EFCA 5A4WA 4DVCA 1HNAA 2YJ7A 2HQTA 2YWMA 2KOKA 1X5EA 4BVYA 1O85A 3UAPA 4NV5A 3I6AA 2GTUA 4XRDA 4ZL7A 2QA1A 3P8WA 1SKWB 2K6VA 3F6FA 2H0IA 5B6NA 2FNOA 3W8JA 3G7JA 4IGJA 5BMUA 2YZUA 4Q5RA 5JCUA 1VF3A 3QFBC 2ZCTA 1TU7A 4OCEA 2CT6A 4KGIA 3ZTLA 3GURA 1Y6EA 3F4TA 2OE3A 4NHWA 5J41A 1WWJA 4A5PA 3A2XA 1UN2A 1X9SB 1OC9A 4TR4A 2HRFA 1C72A 2L4QA 4TN8A 1SYRA 3EU4A 3F3QA 3UBLA 1BX9A 3NOFA 2B7KA 3MYDA 1USBA 2VLVA 1SU9A 3MWHA 4Q5NA 1SK0A 5A5HB 3IHGA 4N10A 1T1VA 4FO5A 3M9JA 5FT3A 3GSTA 2QSIA 4KA0A 3EMXA 2VL3A 3ME8A 3C73A 4K6XA 3IHQA 1F3AA 3AY8A 3UBKA 2RLIA 1GTIA 2RUFA 1TK8B 3EVIA 4IVFA 1Q98A 2R2JA 1T8EB 2LS5A 5ELAA 3CSIA 3VI7A 1GNEA 5KN2A 4CY8A 1J0FA 1BJXA 1AC1A 2H6ZA 1A8LA 2GGTA 4KW6A 1AXDA 1JZOA 1HYUA 2KP2A 3KMNA 2FA4A 3A2WA 3CSHA 5B6MA 3MAKA 4YKFA 3N9JA 3NZNA 4G0LA 1TKDB 3HVVA 5G1LA 2H1AA 1F2EA 5CAXA 1O8WA 1V98A 4POKA 4TRXA 4KB3A 1G6WA 2ON7A 1A23A 5LNKe 2QGVA 2GQMA 3GN3A 1XXUA 3EMPA 5IOWA 5COHA 4WF5A 2X8GA 5J9BA 5FWGA 3FZ9A 3TKQA 2VO4A 2HRKB 4O5RA 2TRCP 4WKWA 4MZCA 2PU9C 5IMDA 3ERGA 4Q5QA 1YVLA 2PMTA 4AI6A 4MP4A 4RI6A 4JU5A 1H4OA 4POMA 5DALA 2PUKC 1MDJA 5ABRA 4ISDA 3C1RA 4MJEA 4FYUA 5DBQA 3F3RA 5ECNB 3N5OA 1M2DA 2RM5A 5HFIA 4GXZA 3TJKA 3ERFA 2I9HA 2C0DA 1IYIA 2AHEA 1B9XC 1R4WA 2H6XA 2R3XA 4JR6A 4TW5A 3ZVJD 2R37A 4YAPA 3L9VA 3IC8A 4CY6A 4MZWA 3BJ5A 4HQZA 3HZ4A 4G0KA 3F8UA 3GTUB 5CP1A 4XS4B 1URMA 2EFHA 2CVKA 4EDZA 2X99A 1YF1A 4ACSA 2OA7A 4PXOA 1XWKA 2FGXA 3IR4A 1T4YA 1GLQA 3FHKA 1JFUA 2KUCA 2OBIA 3Q18A 4KNDA 4Q5FA 3ZLPA 4D73A 1FO5A 3TCOA 4NPBA 4AKHA 1PL2A 4ECBA 3GL3A 1T4ZA 2YN1A 1EP7A 2HI7A 2F8AA 3F9UA 4NXIA 1FB0A 1ZL9A 3RHCA 3D5JA 4HJMA 5D73A 5F0GA 3FRCA 3HMJG 1I9DA 1UVZA 2N5AA 3LEFA 4MF7A 2F8FA 5AGYA 2MMZA 4N30A 5GSSA 3CTGA 2GT6A 1ERWA 1A2MA 1XW6A 1EWXA 3MDKA 3F0IA 3LG6A 4RQXA 5E59A 2C0GA 1VF1A 5B8AA 4ULXA 2HSHA 2BMXA 1OC3A 1X0RA 2FUG2 1TXXA 1QMVA 4MPGA 3IDVA 5B7CA 2DBCA 3UARA 1ZZYA 1UC7A 4MMMA 3F6DA 3EU3A 3H4KA 4QQ7A 2A2PA 2GQKA 2HZFA 2RUEA 4O7HA 2XC2A 4NV2A 1GSEA 3KXOA 1XWAA 3K8NA 4X43A 1RK4A 4WBJA 1EOGA 4AJ8A 4HZ4A 1NW2A 2LRCA 1QFNA 1SKRB 3GX0A 4MF5A 1KBNA 4WR5A 3BOAA 2KHPA 3F4RA 4TXOA 2KP1A 5CRGA 4LLRA 1A0FA 3QOUA 2YCDA 3LYKA 5ECSA 2IL3A 2YV9A 2CX4A 4KUNA 1BG1A 5G5EA 2QA2A 3HJOA 18GSA 4G19A 5A4VA 3ZZXA 2GZZA 3KGKA 3QAWA 5J40A 3L9SA 1VRSD 3SBCA 2MMAA 1MTCA 3BCKA 5D93A 1CQHA 2OKAA 1Z9HA 3ZMLA 10GSA 2H76A 5D9VA 2GVPA 4FIWA 4MCUA 3MNGA 3DEXA 1A2LA 4AKIA 3CTFA 5IMCA 5J9CA 1SJ6A 2HZEA 3C1SA 1BF5A 2DMLA 1E6BA 3ZRDA 2NTOA 1SJIA 3WYWA 2EIQA 1F3BA 3RPPA 2PWJA 2EC4A 2V41A 3LXTA 1FAAA 1EEMA 4K0GA 3GIXA 1OC8A 5A5KA 4E8EA 1M2AA 2DMMA 3IPZA 2X4AA 2VIMA 4ZBDA 4OMVA 5DCHA 1GUMA 3FR6A 3HD5A 2XHFA 3L9UA 2D2ZA 5IO2A 5J4UA 2C3NA 4G9HA 2WULA 1G7EA 1Z3EA 2JSZA 2GT5A 4V1Ag 3QAVA 2YZHA 4I6XA 3Q19A 3GMFA 3GFKA 2IPAA 1ERTA 3C7MA 2VCZA 3GL5A 3I69A 3GV1A 2XBQA 2YP6A 5H5SA 1K0CA 1TOFA 1PA3A 2HT9A 3FZ5A 5ECIB 3HY2A 4XHMA 3L4NA 1SVLA 2CZ3A 2L6CA 3GKMA 2MBSA 4ZBAA 1SD9A 5JCGA 1ZGNA 3ERWA 4IW9A 2YJHA 3FW2A 1XFLA 1B8XA 3CRUA 3LSZA 2HNLA 1GSDA 3TRPA 4HQSA 4V2MA 3UOMA 5ECHB 3DD3A 1A8YA 4TKYA 2GQLA 5G1KA 2RIIA 4IELA 4KE3A 4EKZA 1PKZA 3HCZA 3C8EA 3H1NA 2BJXA 3APOA 1X9WB 2HFDA 1B9YC 1GH2A 2HSMA 1QUWA 1K3LA 4MA9A 3A2VA 2IFQA 2PVOC 1K0DA 1M2BA 2IMKA 3WT1A 5EY6A 4POBA 4GLTA 2UV8G 2WDUA 5IMAA 4KDUA 5A34B 4PUFC 1TXUA 1TI1A 3TRQA 7GSSA 1QGVA 2GZYA 1PKWA 2P5RA 5CNWA 4YAVA 3GKKA 4KX4A 3ZIVA 2K8SA 2TRXA 2NVLA 4KAEA 2GDRA 3HA9A 3U6VA 1JLVA 1XIYA 4HU7A 3LJRA 4EDYA 4AKXB 3KP9A 3GH6A 4EO3A 5ID2B 3IXRA 1SL1B 5J4YA 4GDFA 4ZL9A 3ZMKA 1GSSA 4X4JA 1K0AA 2FWHA 2R6KA 4KDYA 4I5QA 1GTBA 4JZQA 3PH9A 4JEDA 1GLPA 4K7OA 1TI3A 3FKFA 4BVXA 5IIZA 3ED3A 4V1Ap 2C8UA 3KZQA 4I97A 4F9ZA 5AIXA 4ML6A 5EPFA 2OADA 1DBYA 1BEDA 3VK9A 1K3OA 5EL8A 2H19A 3US3A 3BBYA 2VCVA 1SJZA 1WP0A 1GTAA 2CVDA 1VGLA 3D6IA 1M7TA 3RAZA 2H74A 2YPMA 1WJKA 2V1MA 1K3YA 3APSA 2P31A 2R4VA 4OD7A 3KH9A 5D8IA 3OR5A 2L6DA 2X49A 1PSQA 2J9HA 5HFGA 2C0FA 4USSA 1TRSA 1YEXA 1WMJA 4E68A 2LNSA 3DVXA 2WFCA 2LJAA 5IPHA 5G30A 1YKCA 4GRFA 2M80A 2JACA 3QAGA 1V40A 4OFMA 3VWXA 5JWRB 2HSNB 4EUYA 3EC3A 3EYTA 2AJQB 1NM3A 5IMFA 2QKEA 1FG4A 2WJUA 5KN1A 3LWAA 4IQ1A 4RQRA 3QDNA 5CO3A 2R5GA 2MMNA 1HNBA 4MJAA 1PN9A 1OVNA 1SENA 4MZBA 1PX6A 1R5AA 1ZOFA 5AISA 2M72A 3MIXA 1W4VA 4MDCA 1GRXA 2L57A 4AKGA 1SKSB 1EEJA 4TXVA 5A5HA 3TJGA 5L71A 3APQA 4IJ3A 5HQPA 2GSRA 1ACVA 1JZDA 4JRRA 2WRTA 2DIZA 2B5XA 2WCIA 4GF0A 1SL0B 5ECKB 1ZCPA 5DJLA 1SK1A 4KSOA 3IOSA 4EC0A 5HR0A 2YWIA 1PD21 2DKIA 4WETA 2IWTA 4J57E 2VCXA 5LD0A 1X5DA 3CXGA 1TU8A 1PRXA 4PX1A 1YF0A 3H79A 4TR0A 2B1KA 4PQ1A 12GSA 2A4VA 2XBIA 1VF4A 2NPBA 1SL2B 2DJ2A 3DMLA 1YDKA 5CRDA 4HDEA 1U88A 4GSTA 3D4TA 5CREA 4K2DA 4G01A 1EGOA 4FYBA 4N3ZA 1PN0A 2H1GA 4ILFA 2EIOA 4DEJA 2MYGA 3GUSA 4QL9A 4DSRA 2E0QA 2I1UA 2YANA 2DJJA 1Z5YE 1ZYQB 2MMOA 5KOXA 2H30A 3EE2A 3VURA 3RBTA 3DRNA 1XW5A 3W8SA 3D21A 2FA8A 3UJ1A 1XWBA 2VLUA 4ZB6A 2LQQA 1XZOA 2OE1A 5HR3A 3RDWA 1GULA 2V2GA 5IM9A 2C1YA 1O6JA 4V2LA 5F8BA 3PPUA 1FVKA 2DJKA 3TJJA 1SVOA 4K0NA 1GSUA 5AN1A 3LQ7A 2VUPA 4K7NA 3HXSA 1GTUA 2G0FA 3D0ZA 2MBTA 2HRAA 1X5CA 2OT3A 5HR2A 1GSQA 2HRKA 1XVQA 3PR8A 5CRHA 2O89A 1X9MB 4G2EA 1K0NA 1FVJA 1ML6A 4K1FA 2VLTA 5F05A 3GKNA 3G9BA 4X0XA 4AGSA 4HEA2 4DSSB 4PQHA 5EVOA 1MEKA 3UL3A 2LNTA 4K2XA 4HJ2A 2JSYA 2OE0A 3J7Yk 5JCWA 4TR3A 3GNJA 3GKXA 1K0MA 2P5QA 3TKPA 3CMIA 3LFLA 1O7UA 1XBSA 5E4WA 2J23A 4FH8A 1S3AA 3GTUA 4XS4A 2IMIA 16GSA 3TRXA 3JCML 3QCPA 4PURA 4K7IA 3FR3A 20GSA 3LORA 4ZB7A 2H66A 5DAKB 3A5WA 2PERA 2H72A 3CYNA 5KEJA 3IA1A 5GSTA 1XOAA 2QC7A 1QXHA 1WE0A 4AJ7A 2HXKA 4BL7B 4CHSA 4V2NA 2DIYA 5IQYA 3WT2A 1I5GA 3LXZA 2YWNA 2H8LA 2LJRA 2B5EA 1FW1A 3PGTA 4IN0A 1N2AA 3IE3A 2JU5A 4AJ6A 1KTEA 1KEBA 3UEMA 2FWEA 3GX8A 2XPEA 2PPTA 4LL1B 1WRYA 1TDIA 1AQVA 1Z6NA 1ST9A 2O5VA 2H01A 2JZRA 3CBUA 1KNGA 5F07A 4HU9A 2CAIA 5JWQB 3R2QA 3J7Yb 4OWYA 8GSSA 2DC5A 3QMXA 4O92A 2LKUA 4O5UA 4KH7A 5A1NB 2JADA 2OJLA 4HUAA 3KJYA 4POLA 4TR1B 5FHIA 2H71A 1EGRA 3R3EA 3KD0A 2VCWA 3Q74A 3Q6OA 2JL4A 2H73A 3A3TA 1BAYA 5DQSA 4KCAA 2HRNA 1ERVA 2E2GA 5ECRB 2K18A 4N0ZA 5KN0A 3IRAA 4EVMA 1V2AA 4JR4A 3TU3B 2FCHA 1MD4A 4ZIJA 2RM6A 3UVHA 3P90A 5J5NA 1OYJA 1A2JA 1UA5A 2AYTA 1SD8A 2CQ9A 2O7KA 1F6MC 2HSYA 3GA4A 1O73A 1T3BA 5ECMB 5KN3A 2GS3A 4N11A 1V9WA 4BVYB 2R0GA 4MH2A 2IJYA 4XTSA 22GSA 1AAZA 3FZ4A 1AUCA 1PQNA 6GSVA 1U6TA 2LTKA 4J56E 1NHYA 3TUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0E A;  1JZR A;  3ZVJ A;  2JZT A;  6GSY A;  4FQU A;  2VM2 A;  2E2M A;  3DGQ A;  2YNX A;  1DE2 A;  3FR9 A;  3BD2 A;  2GSS A;  1ILO A;  4G10 A;  2VCT A;  3M0F A;  1R26 A;  1GSY A;  5H5R A;  2CV4 A;  4PNF A;  4AF2 A;  4KF9 A;  2FY6 A;  1AIU A;  1OC9 B;  1F9M A;  1Q4J A;  1HQO A;  3IC4 A;  2CVB A;  2YWO A;  1Z7R A;  1M9B A;  1TW9 A;  1G6Y A;  4NWY A;  1XW9 A;  2EIR A;  3ME7 A;  3TKS C;  5G5F A;  1B48 A;  1YJ6 A;  1SYX A;  1U3I A;  2XPD A;  3KH7 A;  5DCG A;  2VOC A;  2LJK A;  2M46 A;  1T7P B;  2DJ3 A;  4YQU A;  3WD6 A;  1YEP A;  6GSW A;  19GS A;  1XWC A;  3P2A A;  5LCZ A;  1RW1 A;  2CX3 A;  2KLX A;  1V57 A;  4GQC A;  5INY A;  1GL8 A;  1DE1 A;  2OAC A;  4I2U A;  3EIN A;  5F06 A;  2VL9 A;  5AIV A;  5IMZ A;  3KEB A;  4KSM A;  3HJM A;  2AV4 A;  4XCS A;  5D9T A;  6GSS A;  2FHE A;  4QL7 A;  5A4U A;  1S3D A;  1XWG A;  1A24 A;  1FB6 A;  3CSJ A;  4F0C A;  4OCF A;  2H1B A;  5GAN D;  2AAW A;  5ECP B;  4X1U A;  3EUR A;  3TB2 A;  4NAX A;  1OKD A;  4L8E A;  1K0B A;  1R5P A;  1U3A A;  3BCI A;  4PTS A;  4WF4 A;  2LQO A;  4BWS A;  4XIH A;  3L78 A;  1JHB A;  2VAF A;  3E3E A;  1ZMA A;  2IME A;  4ZB8 A;  2ZNM A;  2NBS A;  4MJB A;  1HNC A;  3HHV A;  3TJF A;  1K0O A;  1Y25 A;  2V6O A;  4MAB A;  2HLS A;  4CDO A;  4ZXG A;  2DJ1 A;  3DYR A;  2OBK A;  1WPI A;  3VPT A;  3WGE A;  6GSU A;  2B3S A;  4LA1 A;  5DJM A;  5ECL B;  2H1D A;  5IMV A;  1OAZ A;  3QD9 A;  4Z7X A;  4F03 A;  3TOT A;  3ZIJ A;  2VL2 C;  1YY7 A;  1TRV A;  1OKT A;  2L5L A;  4TVE A;  2L59 A;  2I81 A;  3RPN A;  3M1G A;  2HE3 A;  4KDX A;  1PMT A;  2LRN A;  5DAL B;  5IOX A;  1J08 A;  4RI7 A;  2UZ8 A;  1XOB A;  1YZX A;  1AW9 A;  1E2Y A;  3V1W A;  3H93 A;  4K8M A;  1U87 A;  3CRT A;  3ISO A;  4G0I A;  4FYC A;  2N5F A;  3VPQ A;  1FHE A;  4F0B A;  2C3T A;  2I3Y A;  2PN8 A;  2H70 A;  2LEG A;  3GYK A;  3QFA C;  3IV4 A;  4MPF A;  1TTZ A;  5ID2 A;  2O85 A;  2IMD A;  3ZYW A;  4WR4 A;  2K9F A;  4NMU A;  3HVX A;  4IQA A;  3MSZ A;  5ENU A;  1BG5 A;  2G2Q A;  3HKR A;  1Z7P A;  2O8V B;  2H75 A;  4NHZ A;  2LUS A;  2CAQ A;  4PUA A;  1NHO A;  4IJI A;  1G7O A;  3VWV A;  2CZ2 A;  5DVB A;  1BQ7 A;  3LYP A;  1O81 A;  4D73 B;  1GP1 A;  2VD0 A;  3D4M A;  1LU4 A;  2X64 A;  4GSN A;  4XRA A;  3S9F A;  2ES7 A;  4L5O A;  4J2F A;  9GSS A;  1VF2 A;  5C04 A;  1PL1 A;  2L4C A;  3EWL A;  3ZFL A;  1J9B A;  2B1L A;  1OE8 A;  4CW9 A;  2V32 A;  3E0U A;  4DSQ A;  4XS6 A;  1JZW A;  2PVQ A;  3FEU A;  1G0T A;  1YQ1 A;  5G2Z A;  1CQG A;  17GS A;  1JLW A;  4ECJ A;  2WZ9 A;  3TOU A;  1ABA A;  3DXB A;  3KIJ A;  1MDI A;  1EV9 A;  5D9W A;  3O6T A;  1DUG A;  2FLS A;  4L0U A;  1N8J A;  1YKA A;  1THX A;  5GAP D;  3WGD A;  1H75 A;  3KTL A;  4WEY A;  3L0H A;  3QR6 A;  3QPM A;  2HYX A;  4GTU A;  2H0H A;  4EF0 A;  1WIK A;  2C4J A;  3IBH A;  5IO0 A;  1RQM A;  1EV4 A;  3TKR A;  4O32 A;  3ZFB A;  1MD3 A;  3VI5 A;  1S3C A;  3G7Y A;  3TGZ A;  1LJR A;  1AQX A;  2YOI A;  2WS2 A;  4HZ2 A;  4ZBB A;  3FK8 A;  4I2T A;  2LV3 A;  1SK2 A;  1ON4 A;  1B4P A;  4F82 A;  3FZA A;  2X8C A;  13GS A;  3KMO A;  4EL1 A;  3DIE A;  3HDC A;  5ELG A;  1M9A A;  4GCI A;  1TRU A;  1GUK A;  1QK8 A;  2B5Y A;  3U5R E;  3HZ8 A;  4OO4 A;  3SWL A;  4TXO B;  1EZK A;  3NIV A;  2H6Y A;  3O76 A;  5G31 A;  2H0G A;  4WBR D;  2JZS A;  3UMA A;  5J3R A;  6GST A;  3C71 A;  4ZIL A;  2P0G A;  3W6G A;  4E8H A;  1TK5 B;  2B7J A;  3FYG A;  1XVW A;  3H8Q A;  1EP8 A;  1R7H A;  2AB6 A;  2AUV A;  2IMF A;  3GHA A;  2FWG A;  1TRW A;  4BPY A;  4PGT A;  2F9S A;  5GZZ B;  1QQ2 A;  5IPG A;  1M0U A;  3IK9 A;  2ZUP A;  3ZIT A;  4JE1 A;  3RHB A;  2HZE B;  5JWO B;  3VFI A;  4ECI A;  4PNG A;  4MF6 A;  3PIN A;  4IS0 A;  4IP1 A;  1FOV A;  1PX7 A;  2VM1 A;  4OFT A;  1GSF A;  6GSX A;  2GSQ A;  1GUH A;  3KCM A;  2LST A;  4P3Y B;  5CYY A;  1Z6M A;  4HS1 A;  3GH9 A;  2F3M A;  1THO A;  4IKH A;  2GZP A;  2K8V A;  1ZYE A;  2FD3 A;  1IYH A;  2BTO T;  2C3Q A;  4L0W A;  4LMV A;  2DJ0 A;  2F51 A;  2O87 A;  2PBJ A;  3TJB A;  1GWC A;  4IBP A;  3M8N A;  2N5B A;  3IAS 2;  2I4A A;  4DSS A;  1T00 A;  2Z9S A;  11GS A;  14GS A;  1ERU A;  2FWF A;  3I9V 2;  3UIW A;  3IK7 A;  3P7X A;  4BA7 A;  5ECQ B;  4IP6 A;  3UVT A;  5ECO B;  1XPV A;  5D96 A;  4BWQ A;  5DQY A;  3HJP A;  4ECC A;  3TKS E;  4YQV A;  1M99 A;  2DLX A;  5B8B A;  3DKS A;  3O3T A;  1OE7 A;  5DDL A;  3TKS A;  2MZC A;  4OO5 A;  4EE0 A;  3WGX A;  4LL4 B;  4MJC A;  4WXT A;  5DAK A;  3DVW A;  1V58 A;  4LMW A;  5HFK A;  3DWV A;  5C00 A;  3F4S A;  3I43 A;  2LRT A;  1BYE A;  3LGC A;  4BL7 A;  1MDK A;  5HR1 A;  2A2R A;  4HI7 A;  1WOU A;  1HD2 A;  4ZL8 A;  4JBB A;  3VWW A;  4YQM A;  2DSA A;  2ALB A;  2HSM B;  2YV7 A;  4L5L A;  2IFQ B;  4F2I A;  2REM A;  3HVS A;  1AQW A;  1TJD A;  2A2S A;  2C80 A;  2VD1 A;  2L5O A;  4ID0 A;  4GWR A;  3TDG A;  2WGR A;  4OFN A;  4KCE A;  1PGT A;  4EXJ A;  2WB9 A;  2NDO A;  4K9Z A;  2CA8 A;  2B6M A;  1F37 A;  3E9J B;  2GST A;  1B4Q A;  2TIR A;  1O8X A;  4ML1 A;  4IHU A;  5D9X A;  2IN3 A;  4H86 A;  1W89 A;  4HOJ A;  2V6K A;  4I8B A;  2PGT A;  3M9K A;  4RUV A;  4PQI A;  3KTB A;  3IAM 2;  4GQF A;  5H5Q A;  3VLN A;  3KM6 A;  4TR1 A;  4N0V A;  2GLR A;  3VWU A;  4MLY A;  4MK3 A;  4TOP A;  3GSS A;  2VCQ A;  4ZB9 A;  1XCC A;  3F63 A;  4GSS A;  1DSB A;  1EOH A;  3HYP A;  4BVX B;  3GRX A;  1GNW A;  2IIY A;  3D22 A;  3FY7 A;  1TP9 A;  3G7I A;  3KP8 A;  1NSW A;  4XS1 A;  5CRW A;  2E7P A;  2VL2 A;  2X8H A;  3ZL5 A;  4YH2 A;  4MH3 A;  1A0R P;  1LBK A;  1TK0 B;  3M3M A;  3ZRE A;  2ON5 A;  5A4W A;  4DVC A;  1HNA A;  2YJ7 A;  2HQT A;  2YWM A;  2KOK A;  1X5E A;  4BVY A;  1O85 A;  3UAP A;  4NV5 A;  3I6A A;  2GTU A;  4XRD A;  4ZL7 A;  3P8W A;  1SKW B;  2K6V A;  3F6F A;  2H0I A;  5B6N A;  2FNO A;  3W8J A;  3G7J A;  4IGJ A;  5BMU A;  2YZU A;  4Q5R A;  5JCU A;  1VF3 A;  3QFB C;  2ZCT A;  1TU7 A;  4OCE A;  2CT6 A;  4KGI A;  3ZTL A;  3GUR A;  1Y6E A;  3F4T A;  2OE3 A;  4NHW A;  5J41 A;  1WWJ A;  3A2X A;  1UN2 A;  1X9S B;  1OC9 A;  4TR4 A;  2HRF A;  1C72 A;  2L4Q A;  4TN8 A;  1SYR A;  3EU4 A;  3F3Q A;  3UBL A;  1BX9 A;  3NOF A;  2B7K A;  1USB A;  2VLV A;  1SU9 A;  3MWH A;  4Q5N A;  1SK0 A;  4N10 A;  1T1V A;  4FO5 A;  3M9J A;  5FT3 A;  3GST A;  2QSI A;  4KA0 A;  3EMX A;  2VL3 A;  3ME8 A;  3C73 A;  4K6X A;  3IHQ A;  1F3A A;  3AY8 A;  3UBK A;  2RLI A;  1GTI A;  2RUF A;  1TK8 B;  3EVI A;  4IVF A;  1Q98 A;  2R2J A;  1T8E B;  2LS5 A;  5ELA A;  3CSI A;  3VI7 A;  1GNE A;  5KN2 A;  1J0F A;  1BJX A;  1AC1 A;  2H6Z A;  1A8L A;  2GGT A;  4KW6 A;  1AXD A;  1JZO A;  1HYU A;  2KP2 A;  3KMN A;  2FA4 A;  3A2W A;  3CSH A;  5B6M A;  3MAK A;  3N9J A;  3NZN A;  4G0L A;  1TKD B;  3HVV A;  5G1L A;  2H1A A;  1F2E A;  5CAX A;  1O8W A;  1V98 A;  4POK A;  4TRX A;  4KB3 A;  1G6W A;  2ON7 A;  1A23 A;  5LNK e;  2QGV A;  2GQM A;  3GN3 A;  1XXU A;  3EMP A;  5IOW A;  5COH A;  4WF5 A;  2X8G A;  5J9B A;  5FWG A;  3FZ9 A;  3TKQ A;  2VO4 A;  2HRK B;  4O5R A;  2TRC P;  4WKW A;  4MZC A;  2PU9 C;  5IMD A;  3ERG A;  4Q5Q A;  2PMT A;  4MP4 A;  4RI6 A;  4JU5 A;  1H4O A;  4POM A;  5DAL A;  2PUK C;  1MDJ A;  5ABR A;  4ISD A;  3C1R A;  4MJE A;  4FYU A;  5DBQ A;  3F3R A;  5ECN B;  3N5O A;  1M2D A;  2RM5 A;  5HFI A;  4GXZ A;  3TJK A;  3ERF A;  2I9H A;  2C0D A;  1IYI A;  2AHE A;  1B9X C;  1R4W A;  2H6X A;  2R3X A;  4JR6 A;  4TW5 A;  3ZVJ D;  2R37 A;  4YAP A;  3L9V A;  3IC8 A;  4MZW A;  3BJ5 A;  4HQZ A;  3HZ4 A;  4G0K A;  3F8U A;  3GTU B;  5CP1 A;  4XS4 B;  1URM A;  2CVK A;  4EDZ A;  2X99 A;  1YF1 A;  4ACS A;  2OA7 A;  4PXO A;  1XWK A;  2FGX A;  3IR4 A;  1T4Y A;  1GLQ A;  3FHK A;  1JFU A;  2KUC A;  2OBI A;  3Q18 A;  4KND A;  4Q5F A;  3ZLP A;  4D73 A;  1FO5 A;  3TCO A;  4NPB A;  1PL2 A;  4ECB A;  3GL3 A;  1T4Z A;  2YN1 A;  1EP7 A;  2HI7 A;  2F8A A;  3F9U A;  4NXI A;  1FB0 A;  1ZL9 A;  3RHC A;  3D5J A;  4HJM A;  5D73 A;  5F0G A;  3FRC A;  1I9D A;  1UVZ A;  2N5A A;  3LEF A;  4MF7 A;  2F8F A;  5AGY A;  2MMZ A;  4N30 A;  5GSS A;  3CTG A;  2GT6 A;  1ERW A;  1A2M A;  1XW6 A;  1EWX A;  3MDK A;  3F0I A;  3LG6 A;  4RQX A;  5E59 A;  2C0G A;  1VF1 A;  5B8A A;  4ULX A;  2HSH A;  2BMX A;  1OC3 A;  1X0R A;  2FUG 2;  1TXX A;  1QMV A;  4MPG A;  3IDV A;  5B7C A;  2DBC A;  3UAR A;  1ZZY A;  1UC7 A;  4MMM A;  3F6D A;  3EU3 A;  3H4K A;  4QQ7 A;  2GQK A;  2HZF A;  2RUE A;  4O7H A;  2XC2 A;  4NV2 A;  1GSE A;  3KXO A;  1XWA A;  3K8N A;  4X43 A;  1RK4 A;  4WBJ A;  1EOG A;  4AJ8 A;  4HZ4 A;  1NW2 A;  2LRC A;  1QFN A;  1SKR B;  3GX0 A;  4MF5 A;  1KBN A;  4WR5 A;  3BOA A;  2KHP A;  3F4R A;  4TXO A;  2KP1 A;  5CRG A;  4LLR A;  1A0F A;  3QOU A;  2YCD A;  3LYK A;  5ECS A;  2IL3 A;  2YV9 A;  2CX4 A;  4KUN A;  5G5E A;  3HJO A;  18GS A;  4G19 A;  5A4V A;  3ZZX A;  2GZZ A;  3KGK A;  3QAW A;  3L9S A;  1VRS D;  3SBC A;  2MMA A;  1MTC A;  3BCK A;  5D93 A;  1CQH A;  2OKA A;  1Z9H A;  3ZML A;  10GS A;  2H76 A;  5D9V A;  2GVP A;  4FIW A;  4MCU A;  3MNG A;  3DEX A;  1A2L A;  3CTF A;  5IMC A;  5J9C A;  1SJ6 A;  2HZE A;  3C1S A;  2DML A;  1E6B A;  3ZRD A;  2NTO A;  1SJI A;  3WYW A;  2EIQ A;  1F3B A;  3RPP A;  2PWJ A;  2EC4 A;  2V41 A;  3LXT A;  1FAA A;  1EEM A;  4K0G A;  3GIX A;  1OC8 A;  5A5K A;  4E8E A;  1M2A A;  2DMM A;  3IPZ A;  2VIM A;  4ZBD A;  4OMV A;  5DCH A;  1GUM A;  3FR6 A;  3HD5 A;  2XHF A;  3L9U A;  2D2Z A;  5IO2 A;  5J4U A;  2C3N A;  4G9H A;  2WUL A;  1G7E A;  1Z3E A;  2JSZ A;  2GT5 A;  4V1A g;  3QAV A;  2YZH A;  4I6X A;  3Q19 A;  3GMF A;  3GFK A;  2IPA A;  1ERT A;  3C7M A;  2VCZ A;  3GL5 A;  3I69 A;  3GV1 A;  2XBQ A;  2YP6 A;  5H5S A;  1K0C A;  1TOF A;  1PA3 A;  2HT9 A;  3FZ5 A;  5ECI B;  3HY2 A;  4XHM A;  3L4N A;  2CZ3 A;  2L6C A;  3GKM A;  2MBS A;  4ZBA A;  1SD9 A;  5JCG A;  1ZGN A;  3ERW A;  4IW9 A;  2YJH A;  3FW2 A;  1XFL A;  1B8X A;  3CRU A;  3LSZ A;  2HNL A;  1GSD A;  3TRP A;  4HQS A;  4V2M A;  3UOM A;  5ECH B;  3DD3 A;  1A8Y A;  4TKY A;  2GQL A;  5G1K A;  2RII A;  4IEL A;  4KE3 A;  4EKZ A;  1PKZ A;  3HCZ A;  3C8E A;  3H1N A;  2BJX A;  3APO A;  1X9W B;  2HFD A;  1B9Y C;  1GH2 A;  2HSM A;  1QUW A;  1K3L A;  4MA9 A;  3A2V A;  2IFQ A;  2PVO C;  1K0D A;  1M2B A;  2IMK A;  3WT1 A;  5EY6 A;  4POB A;  4GLT A;  2WDU A;  5IMA A;  4KDU A;  4PUF C;  1TI1 A;  3TRQ A;  7GSS A;  1QGV A;  2GZY A;  1PKW A;  2P5R A;  5CNW A;  4YAV A;  3GKK A;  4KX4 A;  3ZIV A;  2K8S A;  2TRX A;  2NVL A;  4KAE A;  2GDR A;  3HA9 A;  3U6V A;  1JLV A;  1XIY A;  4HU7 A;  3LJR A;  4EDY A;  3KP9 A;  3GH6 A;  4EO3 A;  5ID2 B;  3IXR A;  1SL1 B;  4ZL9 A;  3ZMK A;  1GSS A;  1K0A A;  2FWH A;  2R6K A;  4KDY A;  4I5Q A;  1GTB A;  4JZQ A;  3PH9 A;  4JED A;  1GLP A;  4K7O A;  1TI3 A;  3FKF A;  4BVX A;  5IIZ A;  3ED3 A;  4V1A p;  2C8U A;  3KZQ A;  4I97 A;  4F9Z A;  5AIX A;  4ML6 A;  5EPF A;  2OAD A;  1DBY A;  1BED A;  3VK9 A;  1K3O A;  5EL8 A;  2H19 A;  3US3 A;  3BBY A;  2VCV A;  1SJZ A;  1WP0 A;  1GTA A;  2CVD A;  1VGL A;  3D6I A;  1M7T A;  3RAZ A;  2H74 A;  2YPM A;  1WJK A;  2V1M A;  1K3Y A;  3APS A;  2P31 A;  2R4V A;  4OD7 A;  3KH9 A;  5D8I A;  3OR5 A;  2L6D A;  1PSQ A;  2J9H A;  5HFG A;  2C0F A;  4USS A;  1TRS A;  1YEX A;  1WMJ A;  2LNS A;  3DVX A;  2WFC A;  2LJA A;  5IPH A;  5G30 A;  1YKC A;  4GRF A;  2M80 A;  2JAC A;  3QAG A;  1V40 A;  4OFM A;  3VWX A;  5JWR B;  2HSN B;  4EUY A;  3EC3 A;  3EYT A;  2AJQ B;  1NM3 A;  5IMF A;  2QKE A;  1FG4 A;  2WJU A;  5KN1 A;  3LWA A;  4IQ1 A;  4RQR A;  3QDN A;  5CO3 A;  2R5G A;  2MMN A;  1HNB A;  4MJA A;  1PN9 A;  1OVN A;  1SEN A;  4MZB A;  1PX6 A;  1R5A A;  1ZOF A;  5AIS A;  2M72 A;  1GRX A;  1W4V A;  4MDC A;  2L57 A;  1SKS B;  1EEJ A;  4TXV A;  3TJG A;  5L71 A;  3APQ A;  4IJ3 A;  5HQP A;  2GSR A;  1ACV A;  1JZD A;  4JRR A;  2WRT A;  2DIZ A;  2B5X A;  2WCI A;  4GF0 A;  1SL0 B;  5ECK B;  1ZCP A;  5DJL A;  1SK1 A;  4KSO A;  3IOS A;  4EC0 A;  5HR0 A;  2YWI A;  1PD2 1;  4WET A;  2IWT A;  4J57 E;  2VCX A;  5LD0 A;  1X5D A;  3CXG A;  1TU8 A;  1PRX A;  4PX1 A;  1YF0 A;  3H79 A;  4TR0 A;  2B1K A;  4PQ1 A;  12GS A;  2A4V A;  2XBI A;  1VF4 A;  2NPB A;  1SL2 B;  2DJ2 A;  3DML A;  1YDK A;  5CRD A;  4HDE A;  1U88 A;  4GST A;  3D4T A;  5CRE A;  4K2D A;  1EGO A;  4FYB A;  2H1G A;  4ILF A;  2EIO A;  4DEJ A;  2MYG A;  3GUS A;  4QL9 A;  4DSR A;  2E0Q A;  2I1U A;  2YAN A;  2DJJ A;  1Z5Y E;  1ZYQ B;  2MMO A;  2H30 A;  3EE2 A;  3VUR A;  3RBT A;  3DRN A;  1XW5 A;  3W8S A;  3D21 A;  2FA8 A;  3UJ1 A;  1XWB A;  2VLU A;  4ZB6 A;  2LQQ A;  1XZO A;  2OE1 A;  5HR3 A;  3RDW A;  1GUL A;  2V2G A;  5IM9 A;  2C1Y A;  1O6J A;  4V2L A;  5F8B A;  3PPU A;  1FVK A;  2DJK A;  3TJJ A;  4K0N A;  1GSU A;  5AN1 A;  4K7N A;  3LQ7 A;  2VUP A;  3HXS A;  1GTU A;  2G0F A;  3D0Z A;  2MBT A;  2HRA A;  1X5C A;  5HR2 A;  1GSQ A;  2HRK A;  1XVQ A;  3PR8 A;  5CRH A;  2O89 A;  1X9M B;  4G2E A;  1K0N A;  1FVJ A;  1ML6 A;  4K1F A;  2VLT A;  5F05 A;  3GKN A;  3G9B A;  4X0X A;  4AGS A;  4HEA 2;  4DSS B;  4PQH A;  5EVO A;  1MEK A;  3UL3 A;  2LNT A;  4HJ2 A;  2JSY A;  2OE0 A;  3J7Y k;  5JCW A;  4TR3 A;  3GNJ A;  3GKX A;  1K0M A;  2P5Q A;  3TKP A;  3CMI A;  3LFL A;  1O7U A;  1XBS A;  5E4W A;  2J23 A;  4FH8 A;  1S3A A;  3GTU A;  4XS4 A;  2IMI A;  16GS A;  3TRX A;  3JCM L;  3QCP A;  4PUR A;  4K7I A;  3FR3 A;  20GS A;  3LOR A;  2H66 A;  5DAK B;  3A5W A;  2PER A;  2H72 A;  3CYN A;  5KEJ A;  3IA1 A;  5GST A;  1XOA A;  2QC7 A;  1QXH A;  1WE0 A;  4AJ7 A;  2HXK A;  4BL7 B;  4CHS A;  4V2N A;  2DIY A;  5IQY A;  3WT2 A;  1I5G A;  3LXZ A;  2YWN A;  2H8L A;  2LJR A;  2B5E A;  1FW1 A;  3PGT A;  4IN0 A;  1N2A A;  3IE3 A;  2JU5 A;  4AJ6 A;  1KTE A;  1KEB A;  3UEM A;  2FWE A;  3GX8 A;  2XPE A;  2PPT A;  4LL1 B;  1WRY A;  1TDI A;  1AQV A;  1Z6N A;  1ST9 A;  2H01 A;  2JZR A;  3CBU A;  1KNG A;  5F07 A;  4HU9 A;  2CAI A;  5JWQ B;  3R2Q A;  3J7Y b;  4OWY A;  8GSS A;  2DC5 A;  3QMX A;  4O92 A;  2LKU A;  4KH7 A;  2JAD A;  2OJL A;  4HUA A;  3KJY A;  4POL A;  4TR1 B;  5FHI A;  2H71 A;  1EGR A;  3R3E A;  3KD0 A;  2VCW A;  3Q74 A;  3Q6O A;  2JL4 A;  2H73 A;  3A3T A;  1BAY A;  5DQS A;  4KCA A;  2HRN A;  1ERV A;  2E2G A;  5ECR B;  2K18 A;  4N0Z A;  5KN0 A;  3IRA A;  4EVM A;  1V2A A;  4JR4 A;  2FCH A;  1MD4 A;  4ZIJ A;  2RM6 A;  3UVH A;  3P90 A;  5J5N A;  1OYJ A;  1A2J A;  1UA5 A;  2AYT A;  1SD8 A;  2CQ9 A;  2O7K A;  1F6M C;  2HSY A;  3GA4 A;  1O73 A;  1T3B A;  5ECM B;  5KN3 A;  2GS3 A;  4N11 A;  1V9W A;  4BVY B;  4MH2 A;  4XTS A;  2IJY A;  22GS A;  1AAZ A;  3FZ4 A;  1AUC A;  1PQN A;  6GSV A;  1U6T A;  2LTK A;  4J56 E;  1NHY A;  3TUE A; 
#chains in the Genus database with same CATH topology
 2C0E A;  1JZR A;  3ZVJ A;  2JZT A;  5BMU B;  6GSY A;  4FQU A;  2EFD A;  2VM2 A;  2E2M A;  3DGQ A;  2YNX A;  1DE2 A;  3FR9 A;  3BD2 A;  2GSS A;  1ILO A;  4ICY A;  4G10 A;  2VCT A;  3M0F A;  1R26 A;  1GSY A;  5H5R A;  2CV4 A;  4PNF A;  4AF2 A;  4KF9 A;  2FY6 A;  1AIU A;  1OC9 B;  1F9M A;  1Q4J A;  1HQO A;  2WVX A;  3IC4 A;  2CVB A;  2YWO A;  1Z7R A;  1M9B A;  1TW9 A;  1G6Y A;  4NWY A;  1XW9 A;  2EIR A;  3ME7 A;  3TKS C;  5G5F A;  1B48 A;  1YJ6 A;  1SYX A;  1U3I A;  2XPD A;  3KH7 A;  5DCG A;  2VOC A;  1ZYP A;  2LJK A;  2M46 A;  1T7P B;  2DJ3 A;  1XG8 A;  4YQU A;  3WD6 A;  1YEP A;  6GSW A;  4K5R A;  19GS A;  1XWC A;  3P2A A;  5LCZ A;  1RW1 A;  2CX3 A;  2KLX A;  1V57 A;  4GQC A;  5INY A;  1GL8 A;  1DE1 A;  2OAC A;  4I2U A;  3EIN A;  5F06 A;  2VL9 A;  5AIV A;  5IMZ A;  3KEB A;  4KSM A;  3HJM A;  2AV4 A;  4XCS A;  5D9T A;  6GSS A;  2FHE A;  4QL7 A;  5A4U A;  1S3D A;  1XWG A;  1A24 A;  1FB6 A;  4YKG A;  3CSJ A;  4F0C A;  3LW9 A;  4OCF A;  2H1B A;  4MNN A;  5GAN D;  2AAW A;  5ECP B;  4X1U A;  3EUR A;  3TB2 A;  4NAX A;  4Z2U A;  1OKD A;  4L8E A;  1K0B A;  1R5P A;  1U3A A;  3BCI A;  2WW2 A;  4PTS A;  2LQO A;  4WF4 A;  4BWS A;  4XIH A;  3L78 A;  3A5I A;  1JHB A;  2VAF A;  3E3E A;  1ZMA A;  2IME A;  4K5S A;  4ZB8 A;  2ZNM A;  2NBS A;  4MJB A;  1HNC A;  3HHV A;  3TJF A;  1K0O A;  1Y25 A;  2V6O A;  4MAB A;  2HLS A;  4CDO A;  4ZXG A;  2DJ1 A;  3DYR A;  2OBK A;  4W66 A;  1WPI A;  4Z2T A;  3VPT A;  3WGE A;  6GSU A;  2B3S A;  4LA1 A;  5DJM A;  5ECL B;  2H1D A;  5IMV A;  1OAZ A;  2EFE A;  3QD9 A;  4Z7X A;  4F03 A;  3TOT A;  3ZIJ A;  2VL2 C;  1YY7 A;  1TRV A;  1OKT A;  2L5L A;  4TVE A;  2L59 A;  2I81 A;  2VKZ G;  3RPN A;  5A34 A;  3M1G A;  2HE3 A;  4KDX A;  1PMT A;  2LRN A;  5DAL B;  5IOX A;  1J08 A;  4RI7 A;  2UZ8 A;  1XOB A;  1SVM A;  1YZX A;  1AW9 A;  1E2Y A;  3V1W A;  3H93 A;  4K8M A;  1U87 A;  3CRT A;  3ISO A;  4G0I A;  4FYC A;  2N5F A;  3VPQ A;  1FHE A;  4F0B A;  2C3T A;  2I3Y A;  2WW0 A;  2PN8 A;  2H70 A;  2LEG A;  3GYK A;  3QFA C;  3IV4 A;  4MPF A;  1TTZ A;  5ID2 A;  2O85 A;  2IMD A;  3ZYW A;  4WR4 A;  2K9F A;  4NMU A;  3HVX A;  4IQA A;  3MSZ A;  5ENU A;  1BG5 A;  2G2Q A;  3HKR A;  1Z7P A;  2O8V B;  2H75 A;  4NHZ A;  2LUS A;  2CAQ A;  4PUA A;  1NHO A;  4IJI A;  1G7O A;  3VWV A;  2CZ2 A;  5DVB A;  1BQ7 A;  3LYP A;  1O81 A;  4D73 B;  1GP1 A;  2VD0 A;  3EPT A;  3D4M A;  1LU4 A;  2X64 A;  4GSN A;  4XRA A;  1Y1U A;  3S9F A;  2ES7 A;  4L5O A;  4J2F A;  9GSS A;  1VF2 A;  5C04 A;  1PL1 A;  2L4C A;  3EWL A;  3ZFL A;  1J9B A;  2B1L A;  1OE8 A;  4CW9 A;  4Z2R A;  2V32 A;  3E0U A;  4DSQ A;  4XS6 A;  1JZW A;  5BRT A;  2WVY A;  2PVQ A;  3FEU A;  1G0T A;  1YQ1 A;  5G2Z A;  1CQG A;  17GS A;  1JLW A;  4ECJ A;  2WZ9 A;  2DKH A;  3TOU A;  2HSN A;  4O5Q A;  1ABA A;  3DXB A;  3KIJ A;  1MDI A;  4EIQ A;  1EV9 A;  5D9W A;  3O6T A;  1DUG A;  2FLS A;  4L0U A;  1N8J A;  1YKA A;  1THX A;  5GAP D;  3WGD A;  1H75 A;  3KTL A;  2A4H A;  4WEY A;  3L0H A;  3QR6 A;  3QPM A;  2HYX A;  4GTU A;  2H0H A;  4EF0 A;  1WIK A;  2C4J A;  3IBH A;  5IO0 A;  1RQM A;  1EV4 A;  3TKR A;  4PI0 C;  4O32 A;  3ZFB A;  1MD3 A;  3VI5 A;  1S3C A;  3G7Y A;  3TGZ A;  1LJR A;  1AQX A;  2YOI A;  2WS2 A;  4HZ2 A;  4ZBB A;  4HSC X;  3FK8 A;  4I2T A;  2LV3 A;  1SK2 A;  1ON4 A;  1B4P A;  1N25 A;  4F82 A;  3FZA A;  2X8C A;  13GS A;  3KMO A;  4EL1 A;  3DIE A;  3CWG A;  2R0C A;  3HDC A;  5ELG A;  1M9A A;  4GCI A;  1TRU A;  1GUK A;  1QK8 A;  2B5Y A;  3U5R E;  3HZ8 A;  4OO4 A;  3SWL A;  4TXO B;  1EZK A;  3NIV A;  2H6Y A;  3O76 A;  5G31 A;  2H0G A;  4WBR D;  2JZS A;  3UMA A;  5J3R A;  6GST A;  2O3E A;  3C71 A;  4ZIL A;  4QMK A;  2P0G A;  3W6G A;  4E8H A;  1TK5 B;  2B7J A;  3FYG A;  1XVW A;  3H8Q A;  1EP8 A;  1R7H A;  2AB6 A;  3GHA A;  2AUV A;  2IMF A;  2FWG A;  1TRW A;  4BPY A;  4PGT A;  2F9S A;  5GZZ B;  1QQ2 A;  5IPG A;  1M0U A;  3IK9 A;  2ZUP A;  1FOH A;  3ZIT A;  4JE1 A;  3RHB A;  2HZE B;  5JWO B;  3VFI A;  4ECI A;  4PNG A;  4MF6 A;  3PIN A;  4IS0 A;  4IP1 A;  1FOV A;  1PX7 A;  2VM1 A;  4OFT A;  1GSF A;  6GSX A;  2GSQ A;  1GUH A;  3KCM A;  2LST A;  4P3Y B;  5CYY A;  1Z6M A;  4HS1 A;  5J47 A;  3GH9 A;  2F3M A;  1THO A;  4IKH A;  2GZP A;  2K8V A;  1ZYE A;  3CHX C;  2FD3 A;  1IYH A;  2BTO T;  2C3Q A;  4L0W A;  4LMV A;  2DJ0 A;  2F51 A;  2O87 A;  2PBJ A;  3TJB A;  1GWC A;  4IBP A;  3M8N A;  2N5B A;  3IAS 2;  2I4A A;  4DSS A;  1T00 A;  2Z9S A;  11GS A;  14GS A;  1ERU A;  2FWF A;  3I9V 2;  3UIW A;  3IK7 A;  3P7X A;  4BA7 A;  5KOW A;  5ECQ B;  4IP6 A;  3UVT A;  5ECO B;  1XPV A;  5D96 A;  4BWQ A;  5DQY A;  3HJP A;  4ECC A;  3TKS E;  4YQV A;  1M99 A;  2DLX A;  3FMW A;  5B8B A;  3DKS A;  3O3T A;  1OE7 A;  5DDL A;  3TKS A;  2MZC A;  4OO5 A;  4EE0 A;  1ZYN A;  3WGX A;  4LL4 B;  5J4V A;  4MJC A;  4WXT A;  5DAK A;  3DVW A;  1V58 A;  4EIP A;  4LMW A;  5HFK A;  3DWV A;  5C00 A;  3F4S A;  3I43 A;  2LRT A;  1BYE A;  3LGC A;  4BL7 A;  1MDK A;  5HR1 A;  2A2R A;  4HI7 A;  1WOU A;  1HD2 A;  4ZL8 A;  4JBB A;  3VWW A;  2O36 A;  4YQM A;  2DSA A;  2ALB A;  2HSM B;  2YV7 A;  4L5L A;  2IFQ B;  4F2I A;  2REM A;  3HVS A;  1AQW A;  1TJD A;  2A2S A;  2C80 A;  2VD1 A;  2L5O A;  4ID0 A;  4GWR A;  3TDG A;  2WGR A;  4OFN A;  4KCE A;  1PGT A;  2WZS A;  2R0P A;  4EXJ A;  2WB9 A;  2NDO A;  4K9Z A;  2CA8 A;  2B6M A;  1F37 A;  3E9J B;  2GST A;  1B4Q A;  2TIR A;  1O8X A;  4ML1 A;  4IHU A;  5D9X A;  2IN3 A;  4H86 A;  1W89 A;  4HOJ A;  2V6K A;  4I8B A;  2PGT A;  3M9K A;  4RUV A;  4PQI A;  3KTB A;  3IAM 2;  5A1N A;  4GQF A;  5H5Q A;  3VLN A;  3KM6 A;  4TR1 A;  4N0V A;  2GLR A;  3VWU A;  4MLY A;  4MK3 A;  4TOP A;  3GSS A;  2VCQ A;  4ZB9 A;  1XCC A;  3F63 A;  4GSS A;  1DSB A;  1EOH A;  3HYP A;  4BVX B;  3GRX A;  1GNW A;  4PI2 C;  2IIY A;  3D22 A;  3FY7 A;  1TP9 A;  3G7I A;  3KP8 A;  1NSW A;  4XS1 A;  5CRW A;  2E7P A;  2VL2 A;  2X8H A;  2H1L A;  3ZL5 A;  4YH2 A;  4MH3 A;  1A0R P;  1LBK A;  1TK0 B;  3M3M A;  3ZRE A;  2ON5 A;  2EFC A;  5A4W A;  4DVC A;  1I1I P;  1HNA A;  2YJ7 A;  2HQT A;  2YWM A;  2KOK A;  1X5E A;  4BVY A;  1O85 A;  3UAP A;  4NV5 A;  3I6A A;  2GTU A;  4XRD A;  4ZL7 A;  2QA1 A;  3P8W A;  1SKW B;  2K6V A;  3F6F A;  2H0I A;  5B6N A;  2FNO A;  3W8J A;  3G7J A;  4IGJ A;  5BMU A;  2YZU A;  4Q5R A;  5JCU A;  1VF3 A;  3CQF A;  3QFB C;  2ZCT A;  1TU7 A;  4OCE A;  2CT6 A;  4KGI A;  3ZTL A;  3GUR A;  1Y6E A;  3F4T A;  2OE3 A;  4NHW A;  5J41 A;  1WWJ A;  4A5P A;  3A2X A;  1UN2 A;  1X9S B;  1OC9 A;  4TR4 A;  3HVN A;  2HRF A;  1C72 A;  2L4Q A;  4TN8 A;  1SYR A;  3EU4 A;  3F3Q A;  3UBL A;  1BX9 A;  3NOF A;  2B7K A;  3MYD A;  1USB A;  2VLV A;  1SU9 A;  3MWH A;  4Q5N A;  1SK0 A;  5A5H B;  3IHG A;  4N10 A;  1T1V A;  4FO5 A;  3M9J A;  5FT3 A;  3GST A;  2QSI A;  4KA0 A;  3EMX A;  2VL3 A;  3ME8 A;  3C73 A;  4K6X A;  3IHQ A;  1F3A A;  3AY8 A;  3UBK A;  2RLI A;  1GTI A;  2RUF A;  1TK8 B;  3EVI A;  4IVF A;  1Q98 A;  2R2J A;  1T8E B;  2LS5 A;  5ELA A;  3CSI A;  3VI7 A;  1GNE A;  5KN2 A;  4CY8 A;  1J0F A;  1BJX A;  1AC1 A;  2H6Z A;  1A8L A;  2GGT A;  4KW6 A;  1AXD A;  1JZO A;  1HYU A;  2KP2 A;  3KMN A;  2FA4 A;  3A2W A;  3CSH A;  4PHZ C;  5B6M A;  3MAK A;  4YKF A;  3N9J A;  3NZN A;  4G0L A;  1TKD B;  3HVV A;  5G1L A;  2H1A A;  1F2E A;  5CAX A;  1O8W A;  1V98 A;  4POK A;  4TRX A;  4KB3 A;  1G6W A;  2ON7 A;  1A23 A;  5LNK e;  2QGV A;  2GQM A;  3GN3 A;  1XXU A;  3EMP A;  5IOW A;  5COH A;  4WF5 A;  2X8G A;  5J9B A;  5FWG A;  3FZ9 A;  3TKQ A;  2VO4 A;  2HRK B;  4O5R A;  2TRC P;  4WKW A;  4MZC A;  2PU9 C;  5IMD A;  3ERG A;  4Q5Q A;  1YVL A;  2PMT A;  4AI6 A;  4MP4 A;  4RI6 A;  4JU5 A;  1H4O A;  4POM A;  5DAL A;  2PUK C;  1MDJ A;  5ABR A;  4ISD A;  3C1R A;  4MJE A;  4FYU A;  5DBQ A;  3F3R A;  5ECN B;  3N5O A;  1M2D A;  2RM5 A;  5HFI A;  4GXZ A;  3TJK A;  3ERF A;  2I9H A;  2C0D A;  1IYI A;  2AHE A;  1B9X C;  1R4W A;  2H6X A;  2R3X A;  4JR6 A;  4TW5 A;  3ZVJ D;  2R37 A;  4YAP A;  3L9V A;  3IC8 A;  4CY6 A;  4MZW A;  3BJ5 A;  4HQZ A;  3HZ4 A;  4G0K A;  3F8U A;  3GTU B;  5CP1 A;  4XS4 B;  1URM A;  2EFH A;  2CVK A;  4EDZ A;  2X99 A;  1YF1 A;  4ACS A;  2OA7 A;  2WW3 A;  4PXO A;  1XWK A;  1S3R A;  2FGX A;  3IR4 A;  1T4Y A;  1GLQ A;  3FHK A;  1JFU A;  2KUC A;  2OBI A;  3Q18 A;  4KND A;  4Q5F A;  3ZLP A;  4D73 A;  1FO5 A;  3TCO A;  4NPB A;  4AKH A;  1PL2 A;  4ECB A;  1M3J A;  3GL3 A;  1T4Z A;  2YN1 A;  1EP7 A;  2HI7 A;  2F8A A;  3F9U A;  4NXI A;  1FB0 A;  1ZL9 A;  3RHC A;  3D5J A;  4HJM A;  5D73 A;  5F0G A;  3FRC A;  3HMJ G;  1I9D A;  1UVZ A;  2N5A A;  3LEF A;  4MF7 A;  2F8F A;  5AGY A;  2MMZ A;  4N30 A;  1S4B P;  5GSS A;  3CTG A;  2GT6 A;  1ERW A;  1A2M A;  1XW6 A;  1EWX A;  3MDK A;  3F0I A;  3LG6 A;  4RQX A;  5E59 A;  2C0G A;  1VF1 A;  5B8A A;  4ULX A;  2HSH A;  2BMX A;  1OC3 A;  1X0R A;  2FUG 2;  1TXX A;  1QMV A;  4MPG A;  3IDV A;  5B7C A;  2DBC A;  3UAR A;  1ZZY A;  1UC7 A;  4MMM A;  3F6D A;  3EU3 A;  3H4K A;  4QQ7 A;  2A2P A;  2GQK A;  2HZF A;  2RUE A;  4O7H A;  2XC2 A;  4NV2 A;  1GSE A;  3KXO A;  1XWA A;  3K8N A;  4X43 A;  1RK4 A;  4WBJ A;  1EOG A;  4AJ8 A;  4HZ4 A;  1NW2 A;  2LRC A;  1QFN A;  1SKR B;  3GX0 A;  4MF5 A;  1KBN A;  4WR5 A;  3BOA A;  2KHP A;  3F4R A;  4TXO A;  2KP1 A;  5CRG A;  4LLR A;  1A0F A;  3QOU A;  2YCD A;  3LYK A;  5ECS A;  2IL3 A;  2YV9 A;  2CX4 A;  4KUN A;  1BG1 A;  5G5E A;  2QA2 A;  3HJO A;  18GS A;  4G19 A;  5A4V A;  3ZZX A;  2GZZ A;  3KGK A;  3QAW A;  5J40 A;  3L9S A;  2WVZ A;  1VRS D;  3SBC A;  2MMA A;  1MTC A;  3BCK A;  5D93 A;  1CQH A;  2OKA A;  1Z9H A;  3ZML A;  10GS A;  2H76 A;  5D9V A;  2GVP A;  4FIW A;  4MCU A;  3MNG A;  3DEX A;  1A2L A;  4AKI A;  3CTF A;  5IMC A;  5J9C A;  1SJ6 A;  2HZE A;  2WVX B;  3C1S A;  1BF5 A;  2DML A;  1E6B A;  3ZRD A;  4FXY P;  3RGB C;  2NTO A;  1SJI A;  3WYW A;  2EIQ A;  1F3B A;  3RPP A;  2PWJ A;  2EC4 A;  2V41 A;  3LXT A;  1FAA A;  1EEM A;  4K0G A;  3GIX A;  1OC8 A;  5A5K A;  4E8E A;  1M2A A;  2DMM A;  3IPZ A;  2X4A A;  2VIM A;  4ZBD A;  4OMV A;  5DCH A;  1GUM A;  3FR6 A;  3HD5 A;  2XHF A;  3L9U A;  2D2Z A;  5IO2 A;  5J4U A;  2C3N A;  4G9H A;  2WUL A;  1G7E A;  1Z3E A;  2JSZ A;  2GT5 A;  4V1A g;  4BIK A;  3QAV A;  2YZH A;  4I6X A;  3Q19 A;  3GMF A;  3GFK A;  2IPA A;  1ERT A;  3C7M A;  2VCZ A;  3GL5 A;  3I69 A;  3GV1 A;  2XBQ A;  2YP6 A;  5H5S A;  1K0C A;  1TOF A;  1PA3 A;  2HT9 A;  3FZ5 A;  5ECI B;  3HY2 A;  4XHM A;  3L4N A;  1SVL A;  2CZ3 A;  2L6C A;  3GKM A;  2MBS A;  4ZBA A;  1SD9 A;  5JCG A;  1ZGN A;  3ERW A;  4IW9 A;  2YJH A;  3FW2 A;  1XFL A;  1B8X A;  3CRU A;  3LSZ A;  2HNL A;  1GSD A;  3TRP A;  4HQS A;  4V2M A;  3UOM A;  5ECH B;  3DD3 A;  1A8Y A;  1PFO A;  2GQL A;  4TKY A;  5G1K A;  2RII A;  4IEL A;  4KE3 A;  4EKZ A;  1PKZ A;  3HCZ A;  3C8E A;  3H1N A;  2BJX A;  3APO A;  1X9W B;  2HFD A;  1B9Y C;  1GH2 A;  2HSM A;  1QUW A;  1K3L A;  4MA9 A;  3A2V A;  2IFQ A;  2PVO C;  1K0D A;  1M2B A;  2IMK A;  3WT1 A;  5EY6 A;  4POB A;  4GLT A;  2UV8 G;  2WDU A;  5IMA A;  4KDU A;  5A34 B;  4PUF C;  1M3I A;  1TXU A;  1TI1 A;  3TRQ A;  7GSS A;  1QGV A;  2GZY A;  1PKW A;  2P5R A;  5CNW A;  4YAV A;  3GKK A;  4KX4 A;  3ZIV A;  2K8S A;  2TRX A;  2NVL A;  4KAE A;  2GDR A;  3HA9 A;  3U6V A;  1JLV A;  1XIY A;  4HU7 A;  3LJR A;  4EDY A;  4AKX B;  3KP9 A;  3GH6 A;  4EO3 A;  5ID2 B;  3IXR A;  1SL1 B;  5J4Y A;  4GDF A;  4ZL9 A;  3ZMK A;  1GSS A;  4X4J A;  1K0A A;  2FWH A;  2R6K A;  4KDY A;  4I5Q A;  1GTB A;  4JZQ A;  3PH9 A;  4JED A;  1GLP A;  4K7O A;  1TI3 A;  3FKF A;  4BVX A;  5IIZ A;  3ED3 A;  4V1A p;  2C8U A;  3KZQ A;  4I97 A;  4F9Z A;  5AIX A;  4ML6 A;  1YEW C;  5EPF A;  2OAD A;  1DBY A;  1BED A;  3VK9 A;  1K3O A;  5EL8 A;  2H19 A;  3US3 A;  3BBY A;  2VCV A;  1SJZ A;  1WP0 A;  1GTA A;  2CVD A;  1VGL A;  3D6I A;  1M7T A;  3RAZ A;  2WW1 A;  2H74 A;  2YPM A;  1WJK A;  2V1M A;  1K3Y A;  3APS A;  2P31 A;  2R4V A;  4OD7 A;  3KH9 A;  5D8I A;  3OR5 A;  2L6D A;  2X49 A;  1PSQ A;  2J9H A;  5HFG A;  2C0F A;  4USS A;  1TRS A;  1YEX A;  1WMJ A;  4E68 A;  2LNS A;  3DVX A;  2WFC A;  2LJA A;  5IPH A;  5G30 A;  1YKC A;  4GRF A;  2M80 A;  2JAC A;  3QAG A;  1V40 A;  4OFM A;  3VWX A;  5JWR B;  2HSN B;  4EUY A;  3EC3 A;  3EYT A;  2AJQ B;  1NM3 A;  5IMF A;  2QKE A;  1FG4 A;  2WJU A;  5KN1 A;  3LWA A;  4IQ1 A;  4RQR A;  3QDN A;  5CO3 A;  2R5G A;  2MMN A;  1HNB A;  4MJA A;  1PN9 A;  1OVN A;  1SEN A;  4MZB A;  1PX6 A;  1R5A A;  1ZOF A;  5AIS A;  2M72 A;  3MIX A;  1W4V A;  4MDC A;  1GRX A;  2L57 A;  4AKG A;  1SKS B;  1EEJ A;  4TXV A;  5A5H A;  3TJG A;  5L71 A;  3APQ A;  4IJ3 A;  5HQP A;  2GSR A;  1ACV A;  1JZD A;  4JRR A;  2WRT A;  2DIZ A;  2B5X A;  2WCI A;  4GF0 A;  1SL0 B;  5ECK B;  1ZCP A;  5DJL A;  1SK1 A;  4KSO A;  3IOS A;  4EC0 A;  5HR0 A;  2YWI A;  1PD2 1;  2DKI A;  4WET A;  2IWT A;  4J57 E;  2VCX A;  5LD0 A;  1X5D A;  3CXG A;  1TU8 A;  1PRX A;  4PX1 A;  1YF0 A;  3H79 A;  4TR0 A;  3RFR C;  2B1K A;  4PQ1 A;  12GS A;  2A4V A;  2XBI A;  1VF4 A;  2NPB A;  1SL2 B;  2DJ2 A;  3DML A;  1YDK A;  5CRD A;  4HDE A;  1U88 A;  4GST A;  3D4T A;  5CRE A;  4K2D A;  4G01 A;  1EGO A;  4FYB A;  4N3Z A;  1PN0 A;  2H1G A;  4ILF A;  2EIO A;  4DEJ A;  2MYG A;  3GUS A;  4QL9 A;  4DSR A;  2E0Q A;  2I1U A;  2YAN A;  2DJJ A;  1Z5Y E;  1ZYQ B;  2MMO A;  5KOX A;  2H30 A;  3EE2 A;  3VUR A;  3RBT A;  3DRN A;  1XW5 A;  3W8S A;  3D21 A;  2FA8 A;  3UJ1 A;  1XWB A;  2VLU A;  4ZB6 A;  2LQQ A;  1XZO A;  2OE1 A;  5HR3 A;  3RDW A;  1GUL A;  2V2G A;  5IM9 A;  2C1Y A;  1O6J A;  4V2L A;  5F8B A;  3PPU A;  1FVK A;  2DJK A;  3TJJ A;  1SVO A;  4K0N A;  1GSU A;  5AN1 A;  3LQ7 A;  2VUP A;  4K7N A;  3HXS A;  1GTU A;  2G0F A;  3D0Z A;  2MBT A;  2HRA A;  1X5C A;  2OT3 A;  5HR2 A;  1GSQ A;  2HRK A;  1XVQ A;  3PR8 A;  5CRH A;  2O89 A;  1X9M B;  4G2E A;  1K0N A;  1FVJ A;  1ML6 A;  4K1F A;  2VLT A;  5F05 A;  3GKN A;  3G9B A;  4X0X A;  4AGS A;  4HEA 2;  4DSS B;  4PQH A;  5EVO A;  1MEK A;  3UL3 A;  2LNT A;  4K2X A;  4HJ2 A;  2JSY A;  2OE0 A;  3J7Y k;  5JCW A;  4TR3 A;  3GNJ A;  3GKX A;  1K0M A;  2P5Q A;  3TKP A;  3CMI A;  3LFL A;  1O7U A;  1XBS A;  5E4W A;  2J23 A;  4FH8 A;  1S3A A;  3GTU A;  4XS4 A;  2IMI A;  16GS A;  3TRX A;  3JCM L;  3QCP A;  4PUR A;  4K7I A;  3FR3 A;  20GS A;  3LOR A;  4ZB7 A;  2H66 A;  5DAK B;  3A5W A;  2PER A;  2H72 A;  3CYN A;  5KEJ A;  3IA1 A;  5GST A;  1XOA A;  2QC7 A;  1QXH A;  1WE0 A;  4AJ7 A;  2HXK A;  4BL7 B;  4CHS A;  4V2N A;  2DIY A;  5IQY A;  3WT2 A;  1I5G A;  3LXZ A;  2YWN A;  2H8L A;  2LJR A;  2B5E A;  1FW1 A;  3PGT A;  4IN0 A;  1N2A A;  3IE3 A;  2JU5 A;  4AJ6 A;  1KTE A;  1KEB A;  3UEM A;  2FWE A;  3GX8 A;  2XPE A;  2PPT A;  4LL1 B;  1WRY A;  1TDI A;  1AQV A;  1Z6N A;  1ST9 A;  2O5V A;  2H01 A;  2JZR A;  3CBU A;  1KNG A;  5F07 A;  4HU9 A;  2CAI A;  5JWQ B;  3R2Q A;  3J7Y b;  4OWY A;  8GSS A;  2DC5 A;  3QMX A;  4O92 A;  2LKU A;  4O5U A;  4KH7 A;  5A1N B;  2JAD A;  2OJL A;  4HUA A;  3KJY A;  4POL A;  4TR1 B;  5FHI A;  2H71 A;  1EGR A;  3R3E A;  3KD0 A;  2VCW A;  3Q74 A;  3Q6O A;  2JL4 A;  2H73 A;  3A3T A;  1BAY A;  5DQS A;  4KCA A;  2HRN A;  1ERV A;  2E2G A;  5ECR B;  2K18 A;  4N0Z A;  5KN0 A;  3IRA A;  4EVM A;  1V2A A;  4JR4 A;  3TU3 B;  2FCH A;  1MD4 A;  4ZIJ A;  2RM6 A;  3UVH A;  3P90 A;  5J5N A;  1OYJ A;  1A2J A;  1UA5 A;  2AYT A;  1SD8 A;  2CQ9 A;  2O7K A;  1F6M C;  2HSY A;  3GA4 A;  1O73 A;  1T3B A;  5ECM B;  5KN3 A;  2GS3 A;  4N11 A;  1V9W A;  4BVY B;  2R0G A;  4MH2 A;  2IJY A;  4XTS A;  22GS A;  1AAZ A;  3FZ4 A;  1AUC A;  1PQN A;  6GSV A;  1U6T A;  2LTK A;  4J56 E;  1NHY A;  3TUE A; 
#chains in the Genus database with same CATH homology
 2C0E A;  1JZR A;  3ZVJ A;  2JZT A;  5BMU B;  6GSY A;  4FQU A;  2EFD A;  2VM2 A;  2E2M A;  3DGQ A;  2YNX A;  1DE2 A;  3FR9 A;  3BD2 A;  2GSS A;  1ILO A;  4ICY A;  4G10 A;  2VCT A;  3M0F A;  1R26 A;  1GSY A;  5H5R A;  2CV4 A;  4PNF A;  4AF2 A;  4KF9 A;  2FY6 A;  1AIU A;  1OC9 B;  1F9M A;  1Q4J A;  1HQO A;  3IC4 A;  2CVB A;  2YWO A;  1Z7R A;  1M9B A;  1TW9 A;  1G6Y A;  4NWY A;  1XW9 A;  2EIR A;  3ME7 A;  3TKS C;  5G5F A;  1B48 A;  1YJ6 A;  1SYX A;  1U3I A;  2XPD A;  3KH7 A;  5DCG A;  2VOC A;  1ZYP A;  2LJK A;  2M46 A;  1T7P B;  2DJ3 A;  4YQU A;  3WD6 A;  1YEP A;  6GSW A;  4K5R A;  19GS A;  1XWC A;  3P2A A;  5LCZ A;  1RW1 A;  2CX3 A;  2KLX A;  1V57 A;  4GQC A;  5INY A;  1GL8 A;  1DE1 A;  2OAC A;  4I2U A;  3EIN A;  5F06 A;  2VL9 A;  5AIV A;  5IMZ A;  3KEB A;  4KSM A;  3HJM A;  2AV4 A;  4XCS A;  5D9T A;  6GSS A;  2FHE A;  4QL7 A;  5A4U A;  1S3D A;  1XWG A;  1A24 A;  1FB6 A;  4YKG A;  3CSJ A;  4F0C A;  3LW9 A;  4OCF A;  2H1B A;  4MNN A;  5GAN D;  2AAW A;  5ECP B;  4X1U A;  3EUR A;  3TB2 A;  4NAX A;  4Z2U A;  1OKD A;  4L8E A;  1K0B A;  1R5P A;  1U3A A;  3BCI A;  4PTS A;  4WF4 A;  2LQO A;  4BWS A;  4XIH A;  3L78 A;  3A5I A;  1JHB A;  2VAF A;  3E3E A;  1ZMA A;  2IME A;  4K5S A;  4ZB8 A;  2ZNM A;  2NBS A;  4MJB A;  1HNC A;  3HHV A;  3TJF A;  1K0O A;  1Y25 A;  2V6O A;  4MAB A;  2HLS A;  4CDO A;  4ZXG A;  2DJ1 A;  3DYR A;  2OBK A;  4W66 A;  1WPI A;  4Z2T A;  3VPT A;  3WGE A;  6GSU A;  2B3S A;  4LA1 A;  5DJM A;  5ECL B;  2H1D A;  5IMV A;  1OAZ A;  2EFE A;  3QD9 A;  4Z7X A;  4F03 A;  3TOT A;  3ZIJ A;  2VL2 C;  1YY7 A;  1TRV A;  1OKT A;  2L5L A;  4TVE A;  2L59 A;  2I81 A;  2VKZ G;  3RPN A;  5A34 A;  3M1G A;  2HE3 A;  4KDX A;  1PMT A;  2LRN A;  5DAL B;  5IOX A;  1J08 A;  4RI7 A;  2UZ8 A;  1XOB A;  1SVM A;  1YZX A;  1AW9 A;  1E2Y A;  3V1W A;  3H93 A;  4K8M A;  1U87 A;  3CRT A;  3ISO A;  4G0I A;  4FYC A;  2N5F A;  3VPQ A;  1FHE A;  4F0B A;  2C3T A;  2I3Y A;  2PN8 A;  2H70 A;  2LEG A;  3GYK A;  3QFA C;  3IV4 A;  4MPF A;  1TTZ A;  5ID2 A;  2O85 A;  2IMD A;  3ZYW A;  4WR4 A;  2K9F A;  4NMU A;  3HVX A;  4IQA A;  3MSZ A;  5ENU A;  1BG5 A;  2G2Q A;  3HKR A;  1Z7P A;  2O8V B;  2H75 A;  4NHZ A;  2LUS A;  2CAQ A;  4PUA A;  1NHO A;  4IJI A;  1G7O A;  3VWV A;  2CZ2 A;  5DVB A;  1BQ7 A;  3LYP A;  1O81 A;  4D73 B;  1GP1 A;  2VD0 A;  3EPT A;  3D4M A;  1LU4 A;  2X64 A;  4GSN A;  4XRA A;  1Y1U A;  3S9F A;  2ES7 A;  4L5O A;  4J2F A;  9GSS A;  1VF2 A;  5C04 A;  1PL1 A;  2L4C A;  3EWL A;  3ZFL A;  1J9B A;  2B1L A;  1OE8 A;  4CW9 A;  4Z2R A;  2V32 A;  3E0U A;  4DSQ A;  4XS6 A;  1JZW A;  5BRT A;  2PVQ A;  3FEU A;  1G0T A;  1YQ1 A;  5G2Z A;  1CQG A;  17GS A;  1JLW A;  4ECJ A;  2WZ9 A;  2DKH A;  3TOU A;  2HSN A;  4O5Q A;  1ABA A;  3DXB A;  3KIJ A;  1MDI A;  4EIQ A;  1EV9 A;  5D9W A;  3O6T A;  1DUG A;  2FLS A;  4L0U A;  1N8J A;  1YKA A;  1THX A;  5GAP D;  3WGD A;  1H75 A;  3KTL A;  2A4H A;  4WEY A;  3L0H A;  3QR6 A;  3QPM A;  2HYX A;  4GTU A;  2H0H A;  4EF0 A;  1WIK A;  2C4J A;  3IBH A;  5IO0 A;  1RQM A;  1EV4 A;  3TKR A;  4O32 A;  3ZFB A;  1MD3 A;  3VI5 A;  1S3C A;  3G7Y A;  3TGZ A;  1LJR A;  1AQX A;  2YOI A;  2WS2 A;  4HZ2 A;  4ZBB A;  3FK8 A;  4I2T A;  2LV3 A;  1SK2 A;  1ON4 A;  1B4P A;  1N25 A;  4F82 A;  3FZA A;  2X8C A;  13GS A;  3KMO A;  4EL1 A;  3DIE A;  3CWG A;  2R0C A;  3HDC A;  5ELG A;  1M9A A;  4GCI A;  1TRU A;  1GUK A;  1QK8 A;  2B5Y A;  3U5R E;  3HZ8 A;  4OO4 A;  3SWL A;  4TXO B;  1EZK A;  3NIV A;  2H6Y A;  3O76 A;  5G31 A;  2H0G A;  4WBR D;  2JZS A;  3UMA A;  5J3R A;  6GST A;  3C71 A;  4ZIL A;  4QMK A;  2P0G A;  3W6G A;  4E8H A;  1TK5 B;  2B7J A;  3FYG A;  1XVW A;  3H8Q A;  1EP8 A;  1R7H A;  2AB6 A;  2AUV A;  2IMF A;  3GHA A;  2FWG A;  1TRW A;  4BPY A;  4PGT A;  2F9S A;  5GZZ B;  1QQ2 A;  5IPG A;  1M0U A;  3IK9 A;  2ZUP A;  1FOH A;  3ZIT A;  4JE1 A;  3RHB A;  2HZE B;  5JWO B;  3VFI A;  4ECI A;  4PNG A;  4MF6 A;  3PIN A;  4IS0 A;  4IP1 A;  1FOV A;  1PX7 A;  2VM1 A;  4OFT A;  1GSF A;  6GSX A;  2GSQ A;  1GUH A;  3KCM A;  2LST A;  4P3Y B;  5CYY A;  1Z6M A;  4HS1 A;  5J47 A;  3GH9 A;  2F3M A;  1THO A;  4IKH A;  2GZP A;  2K8V A;  1ZYE A;  2FD3 A;  1IYH A;  2BTO T;  2C3Q A;  4L0W A;  4LMV A;  2DJ0 A;  2F51 A;  2O87 A;  2PBJ A;  3TJB A;  1GWC A;  4IBP A;  3M8N A;  2N5B A;  3IAS 2;  2I4A A;  4DSS A;  1T00 A;  2Z9S A;  11GS A;  14GS A;  1ERU A;  2FWF A;  3I9V 2;  3UIW A;  3IK7 A;  3P7X A;  4BA7 A;  5KOW A;  5ECQ B;  4IP6 A;  3UVT A;  5ECO B;  1XPV A;  5D96 A;  4BWQ A;  5DQY A;  3HJP A;  4ECC A;  3TKS E;  4YQV A;  1M99 A;  2DLX A;  3FMW A;  5B8B A;  3DKS A;  3O3T A;  1OE7 A;  5DDL A;  3TKS A;  2MZC A;  4OO5 A;  4EE0 A;  1ZYN A;  3WGX A;  4LL4 B;  5J4V A;  4MJC A;  4WXT A;  5DAK A;  3DVW A;  1V58 A;  4EIP A;  4LMW A;  5HFK A;  3DWV A;  5C00 A;  3F4S A;  3I43 A;  2LRT A;  1BYE A;  3LGC A;  4BL7 A;  1MDK A;  5HR1 A;  2A2R A;  4HI7 A;  1WOU A;  1HD2 A;  4ZL8 A;  4JBB A;  3VWW A;  4YQM A;  2DSA A;  2ALB A;  2HSM B;  2YV7 A;  4L5L A;  2IFQ B;  4F2I A;  2REM A;  3HVS A;  1AQW A;  1TJD A;  2A2S A;  2C80 A;  2VD1 A;  2L5O A;  4ID0 A;  4GWR A;  3TDG A;  2WGR A;  4OFN A;  4KCE A;  1PGT A;  2R0P A;  4EXJ A;  2WB9 A;  2NDO A;  4K9Z A;  2CA8 A;  2B6M A;  1F37 A;  3E9J B;  2GST A;  1B4Q A;  2TIR A;  1O8X A;  4ML1 A;  4IHU A;  5D9X A;  2IN3 A;  4H86 A;  1W89 A;  4HOJ A;  2V6K A;  4I8B A;  2PGT A;  3M9K A;  4RUV A;  4PQI A;  3KTB A;  3IAM 2;  5A1N A;  4GQF A;  5H5Q A;  3VLN A;  3KM6 A;  4TR1 A;  4N0V A;  2GLR A;  3VWU A;  4MLY A;  4MK3 A;  4TOP A;  3GSS A;  2VCQ A;  4ZB9 A;  1XCC A;  3F63 A;  4GSS A;  1DSB A;  1EOH A;  3HYP A;  4BVX B;  3GRX A;  1GNW A;  2IIY A;  3D22 A;  3FY7 A;  1TP9 A;  3G7I A;  3KP8 A;  1NSW A;  4XS1 A;  5CRW A;  2E7P A;  2VL2 A;  2X8H A;  2H1L A;  3ZL5 A;  4YH2 A;  4MH3 A;  1A0R P;  1LBK A;  1TK0 B;  3M3M A;  3ZRE A;  2ON5 A;  2EFC A;  5A4W A;  4DVC A;  1HNA A;  2YJ7 A;  2HQT A;  2YWM A;  2KOK A;  1X5E A;  4BVY A;  1O85 A;  3UAP A;  4NV5 A;  3I6A A;  2GTU A;  4XRD A;  4ZL7 A;  2QA1 A;  3P8W A;  1SKW B;  2K6V A;  3F6F A;  2H0I A;  5B6N A;  2FNO A;  3W8J A;  3G7J A;  4IGJ A;  5BMU A;  2YZU A;  4Q5R A;  5JCU A;  1VF3 A;  3QFB C;  2ZCT A;  1TU7 A;  4OCE A;  2CT6 A;  4KGI A;  3ZTL A;  3GUR A;  1Y6E A;  3F4T A;  2OE3 A;  4NHW A;  5J41 A;  1WWJ A;  4A5P A;  3A2X A;  1UN2 A;  1X9S B;  1OC9 A;  4TR4 A;  2HRF A;  1C72 A;  2L4Q A;  4TN8 A;  1SYR A;  3EU4 A;  3F3Q A;  3UBL A;  1BX9 A;  3NOF A;  2B7K A;  3MYD A;  1USB A;  2VLV A;  1SU9 A;  3MWH A;  4Q5N A;  1SK0 A;  5A5H B;  3IHG A;  4N10 A;  1T1V A;  4FO5 A;  3M9J A;  5FT3 A;  3GST A;  2QSI A;  4KA0 A;  3EMX A;  2VL3 A;  3ME8 A;  3C73 A;  4K6X A;  3IHQ A;  1F3A A;  3AY8 A;  3UBK A;  2RLI A;  1GTI A;  2RUF A;  1TK8 B;  3EVI A;  4IVF A;  1Q98 A;  2R2J A;  1T8E B;  2LS5 A;  5ELA A;  3CSI A;  3VI7 A;  1GNE A;  5KN2 A;  4CY8 A;  1J0F A;  1BJX A;  1AC1 A;  2H6Z A;  1A8L A;  2GGT A;  4KW6 A;  1AXD A;  1JZO A;  1HYU A;  2KP2 A;  3KMN A;  2FA4 A;  3A2W A;  3CSH A;  5B6M A;  3MAK A;  4YKF A;  3N9J A;  3NZN A;  4G0L A;  1TKD B;  3HVV A;  5G1L A;  2H1A A;  1F2E A;  5CAX A;  1O8W A;  1V98 A;  4POK A;  4TRX A;  4KB3 A;  1G6W A;  2ON7 A;  1A23 A;  5LNK e;  2QGV A;  2GQM A;  3GN3 A;  1XXU A;  3EMP A;  5IOW A;  5COH A;  4WF5 A;  2X8G A;  5J9B A;  5FWG A;  3FZ9 A;  3TKQ A;  2VO4 A;  2HRK B;  4O5R A;  2TRC P;  4WKW A;  4MZC A;  2PU9 C;  5IMD A;  3ERG A;  4Q5Q A;  1YVL A;  2PMT A;  4AI6 A;  4MP4 A;  4RI6 A;  4JU5 A;  1H4O A;  4POM A;  5DAL A;  2PUK C;  1MDJ A;  5ABR A;  4ISD A;  3C1R A;  4MJE A;  4FYU A;  5DBQ A;  3F3R A;  5ECN B;  3N5O A;  1M2D A;  2RM5 A;  5HFI A;  4GXZ A;  3TJK A;  3ERF A;  2I9H A;  2C0D A;  1IYI A;  2AHE A;  1B9X C;  1R4W A;  2H6X A;  2R3X A;  4JR6 A;  4TW5 A;  3ZVJ D;  2R37 A;  4YAP A;  3L9V A;  3IC8 A;  4CY6 A;  4MZW A;  3BJ5 A;  4HQZ A;  3HZ4 A;  4G0K A;  3F8U A;  3GTU B;  5CP1 A;  4XS4 B;  1URM A;  2EFH A;  2CVK A;  4EDZ A;  2X99 A;  1YF1 A;  4ACS A;  2OA7 A;  4PXO A;  1XWK A;  2FGX A;  3IR4 A;  1T4Y A;  1GLQ A;  3FHK A;  1JFU A;  2KUC A;  2OBI A;  3Q18 A;  4KND A;  4Q5F A;  3ZLP A;  4D73 A;  1FO5 A;  3TCO A;  4NPB A;  4AKH A;  1PL2 A;  4ECB A;  3GL3 A;  1T4Z A;  2YN1 A;  1EP7 A;  2HI7 A;  2F8A A;  3F9U A;  4NXI A;  1FB0 A;  1ZL9 A;  3RHC A;  3D5J A;  4HJM A;  5D73 A;  5F0G A;  3FRC A;  3HMJ G;  1I9D A;  1UVZ A;  2N5A A;  3LEF A;  4MF7 A;  2F8F A;  5AGY A;  2MMZ A;  4N30 A;  5GSS A;  3CTG A;  2GT6 A;  1ERW A;  1A2M A;  1XW6 A;  1EWX A;  3MDK A;  3F0I A;  3LG6 A;  4RQX A;  5E59 A;  2C0G A;  1VF1 A;  5B8A A;  4ULX A;  2HSH A;  2BMX A;  1OC3 A;  1X0R A;  2FUG 2;  1TXX A;  1QMV A;  4MPG A;  3IDV A;  5B7C A;  2DBC A;  3UAR A;  1ZZY A;  1UC7 A;  4MMM A;  3F6D A;  3EU3 A;  3H4K A;  4QQ7 A;  2A2P A;  2GQK A;  2HZF A;  2RUE A;  4O7H A;  2XC2 A;  4NV2 A;  1GSE A;  3KXO A;  1XWA A;  3K8N A;  4X43 A;  1RK4 A;  4WBJ A;  1EOG A;  4AJ8 A;  4HZ4 A;  1NW2 A;  2LRC A;  1QFN A;  1SKR B;  3GX0 A;  4MF5 A;  1KBN A;  4WR5 A;  3BOA A;  2KHP A;  3F4R A;  4TXO A;  2KP1 A;  5CRG A;  4LLR A;  1A0F A;  3QOU A;  2YCD A;  3LYK A;  5ECS A;  2IL3 A;  2YV9 A;  2CX4 A;  4KUN A;  1BG1 A;  5G5E A;  2QA2 A;  3HJO A;  18GS A;  4G19 A;  5A4V A;  3ZZX A;  2GZZ A;  3KGK A;  3QAW A;  5J40 A;  3L9S A;  1VRS D;  3SBC A;  2MMA A;  1MTC A;  3BCK A;  5D93 A;  1CQH A;  2OKA A;  1Z9H A;  3ZML A;  10GS A;  2H76 A;  5D9V A;  2GVP A;  4FIW A;  4MCU A;  3MNG A;  3DEX A;  1A2L A;  4AKI A;  3CTF A;  5IMC A;  5J9C A;  1SJ6 A;  2HZE A;  3C1S A;  1BF5 A;  2DML A;  1E6B A;  3ZRD A;  2NTO A;  1SJI A;  3WYW A;  2EIQ A;  1F3B A;  3RPP A;  2PWJ A;  2EC4 A;  2V41 A;  3LXT A;  1FAA A;  1EEM A;  4K0G A;  3GIX A;  1OC8 A;  5A5K A;  4E8E A;  1M2A A;  2DMM A;  3IPZ A;  2X4A A;  2VIM A;  4ZBD A;  4OMV A;  5DCH A;  1GUM A;  3FR6 A;  3HD5 A;  2XHF A;  3L9U A;  2D2Z A;  5IO2 A;  5J4U A;  2C3N A;  4G9H A;  2WUL A;  1G7E A;  1Z3E A;  2JSZ A;  2GT5 A;  4V1A g;  3QAV A;  2YZH A;  4I6X A;  3Q19 A;  3GMF A;  3GFK A;  2IPA A;  1ERT A;  3C7M A;  2VCZ A;  3GL5 A;  3I69 A;  3GV1 A;  2XBQ A;  2YP6 A;  5H5S A;  1K0C A;  1TOF A;  1PA3 A;  2HT9 A;  3FZ5 A;  5ECI B;  3HY2 A;  4XHM A;  3L4N A;  1SVL A;  2CZ3 A;  2L6C A;  3GKM A;  2MBS A;  4ZBA A;  1SD9 A;  5JCG A;  1ZGN A;  3ERW A;  4IW9 A;  2YJH A;  3FW2 A;  1XFL A;  1B8X A;  3CRU A;  3LSZ A;  2HNL A;  1GSD A;  3TRP A;  4HQS A;  4V2M A;  3UOM A;  5ECH B;  3DD3 A;  1A8Y A;  4TKY A;  2GQL A;  5G1K A;  2RII A;  4IEL A;  4KE3 A;  4EKZ A;  1PKZ A;  3HCZ A;  3C8E A;  3H1N A;  2BJX A;  3APO A;  1X9W B;  2HFD A;  1B9Y C;  1GH2 A;  2HSM A;  1QUW A;  1K3L A;  4MA9 A;  3A2V A;  2IFQ A;  2PVO C;  1K0D A;  1M2B A;  2IMK A;  3WT1 A;  5EY6 A;  4POB A;  4GLT A;  2UV8 G;  2WDU A;  5IMA A;  4KDU A;  5A34 B;  4PUF C;  1TXU A;  1TI1 A;  3TRQ A;  7GSS A;  1QGV A;  2GZY A;  1PKW A;  2P5R A;  5CNW A;  4YAV A;  3GKK A;  4KX4 A;  3ZIV A;  2K8S A;  2TRX A;  2NVL A;  4KAE A;  2GDR A;  3HA9 A;  3U6V A;  1JLV A;  1XIY A;  4HU7 A;  3LJR A;  4EDY A;  4AKX B;  3KP9 A;  3GH6 A;  4EO3 A;  5ID2 B;  3IXR A;  1SL1 B;  5J4Y A;  4GDF A;  4ZL9 A;  3ZMK A;  1GSS A;  4X4J A;  1K0A A;  2FWH A;  2R6K A;  4KDY A;  4I5Q A;  1GTB A;  4JZQ A;  3PH9 A;  4JED A;  1GLP A;  4K7O A;  1TI3 A;  3FKF A;  4BVX A;  5IIZ A;  3ED3 A;  4V1A p;  2C8U A;  3KZQ A;  4I97 A;  4F9Z A;  5AIX A;  4ML6 A;  5EPF A;  2OAD A;  1DBY A;  1BED A;  3VK9 A;  1K3O A;  5EL8 A;  2H19 A;  3US3 A;  3BBY A;  2VCV A;  1SJZ A;  1WP0 A;  1GTA A;  2CVD A;  1VGL A;  3D6I A;  1M7T A;  3RAZ A;  2H74 A;  2YPM A;  1WJK A;  2V1M A;  1K3Y A;  3APS A;  2P31 A;  2R4V A;  4OD7 A;  3KH9 A;  5D8I A;  3OR5 A;  2L6D A;  2X49 A;  1PSQ A;  2J9H A;  5HFG A;  2C0F A;  4USS A;  1TRS A;  1YEX A;  1WMJ A;  4E68 A;  2LNS A;  3DVX A;  2WFC A;  2LJA A;  5IPH A;  5G30 A;  1YKC A;  4GRF A;  2M80 A;  2JAC A;  3QAG A;  1V40 A;  4OFM A;  3VWX A;  5JWR B;  2HSN B;  4EUY A;  3EC3 A;  3EYT A;  2AJQ B;  1NM3 A;  5IMF A;  2QKE A;  1FG4 A;  2WJU A;  5KN1 A;  3LWA A;  4IQ1 A;  4RQR A;  3QDN A;  5CO3 A;  2R5G A;  2MMN A;  1HNB A;  4MJA A;  1PN9 A;  1OVN A;  1SEN A;  4MZB A;  1PX6 A;  1R5A A;  1ZOF A;  5AIS A;  2M72 A;  3MIX A;  1W4V A;  4MDC A;  1GRX A;  2L57 A;  4AKG A;  1SKS B;  1EEJ A;  4TXV A;  5A5H A;  3TJG A;  5L71 A;  3APQ A;  4IJ3 A;  5HQP A;  2GSR A;  1ACV A;  1JZD A;  4JRR A;  2WRT A;  2DIZ A;  2B5X A;  2WCI A;  4GF0 A;  1SL0 B;  5ECK B;  1ZCP A;  5DJL A;  1SK1 A;  4KSO A;  3IOS A;  4EC0 A;  5HR0 A;  2YWI A;  1PD2 1;  2DKI A;  4WET A;  2IWT A;  4J57 E;  2VCX A;  5LD0 A;  1X5D A;  3CXG A;  1TU8 A;  1PRX A;  4PX1 A;  1YF0 A;  3H79 A;  4TR0 A;  2B1K A;  4PQ1 A;  12GS A;  2A4V A;  2XBI A;  1VF4 A;  2NPB A;  1SL2 B;  2DJ2 A;  3DML A;  1YDK A;  5CRD A;  4HDE A;  1U88 A;  4GST A;  3D4T A;  5CRE A;  4K2D A;  4G01 A;  1EGO A;  4FYB A;  4N3Z A;  1PN0 A;  2H1G A;  4ILF A;  2EIO A;  4DEJ A;  2MYG A;  3GUS A;  4QL9 A;  4DSR A;  2E0Q A;  2I1U A;  2YAN A;  2DJJ A;  1Z5Y E;  1ZYQ B;  2MMO A;  5KOX A;  2H30 A;  3EE2 A;  3VUR A;  3RBT A;  3DRN A;  1XW5 A;  3W8S A;  3D21 A;  2FA8 A;  3UJ1 A;  1XWB A;  2VLU A;  4ZB6 A;  2LQQ A;  1XZO A;  2OE1 A;  5HR3 A;  3RDW A;  1GUL A;  2V2G A;  5IM9 A;  2C1Y A;  1O6J A;  4V2L A;  5F8B A;  3PPU A;  1FVK A;  2DJK A;  3TJJ A;  1SVO A;  4K0N A;  1GSU A;  5AN1 A;  3LQ7 A;  2VUP A;  4K7N A;  3HXS A;  1GTU A;  2G0F A;  3D0Z A;  2MBT A;  2HRA A;  1X5C A;  2OT3 A;  5HR2 A;  1GSQ A;  2HRK A;  1XVQ A;  3PR8 A;  5CRH A;  2O89 A;  1X9M B;  4G2E A;  1K0N A;  1FVJ A;  1ML6 A;  4K1F A;  2VLT A;  5F05 A;  3GKN A;  3G9B A;  4X0X A;  4AGS A;  4HEA 2;  4DSS B;  4PQH A;  5EVO A;  1MEK A;  3UL3 A;  2LNT A;  4K2X A;  4HJ2 A;  2JSY A;  2OE0 A;  3J7Y k;  5JCW A;  4TR3 A;  3GNJ A;  3GKX A;  1K0M A;  2P5Q A;  3TKP A;  3CMI A;  3LFL A;  1O7U A;  1XBS A;  5E4W A;  2J23 A;  4FH8 A;  1S3A A;  3GTU A;  4XS4 A;  2IMI A;  16GS A;  3TRX A;  3JCM L;  3QCP A;  4PUR A;  4K7I A;  3FR3 A;  20GS A;  3LOR A;  4ZB7 A;  2H66 A;  5DAK B;  3A5W A;  2PER A;  2H72 A;  3CYN A;  5KEJ A;  3IA1 A;  5GST A;  1XOA A;  2QC7 A;  1QXH A;  1WE0 A;  4AJ7 A;  2HXK A;  4BL7 B;  4CHS A;  4V2N A;  2DIY A;  5IQY A;  3WT2 A;  1I5G A;  3LXZ A;  2YWN A;  2H8L A;  2LJR A;  2B5E A;  1FW1 A;  3PGT A;  4IN0 A;  1N2A A;  3IE3 A;  2JU5 A;  4AJ6 A;  1KTE A;  1KEB A;  3UEM A;  2FWE A;  3GX8 A;  2XPE A;  2PPT A;  4LL1 B;  1WRY A;  1TDI A;  1AQV A;  1Z6N A;  1ST9 A;  2O5V A;  2H01 A;  2JZR A;  3CBU A;  1KNG A;  5F07 A;  4HU9 A;  2CAI A;  5JWQ B;  3R2Q A;  3J7Y b;  4OWY A;  8GSS A;  2DC5 A;  3QMX A;  4O92 A;  2LKU A;  4O5U A;  4KH7 A;  5A1N B;  2JAD A;  2OJL A;  4HUA A;  3KJY A;  4POL A;  4TR1 B;  5FHI A;  2H71 A;  1EGR A;  3R3E A;  3KD0 A;  2VCW A;  3Q74 A;  3Q6O A;  2JL4 A;  2H73 A;  3A3T A;  1BAY A;  5DQS A;  4KCA A;  2HRN A;  1ERV A;  2E2G A;  5ECR B;  2K18 A;  4N0Z A;  5KN0 A;  3IRA A;  4EVM A;  1V2A A;  4JR4 A;  3TU3 B;  2FCH A;  1MD4 A;  4ZIJ A;  2RM6 A;  3UVH A;  3P90 A;  5J5N A;  1OYJ A;  1A2J A;  1UA5 A;  2AYT A;  1SD8 A;  2CQ9 A;  2O7K A;  1F6M C;  2HSY A;  3GA4 A;  1O73 A;  1T3B A;  5ECM B;  5KN3 A;  2GS3 A;  4N11 A;  1V9W A;  4BVY B;  2R0G A;  4MH2 A;  2IJY A;  4XTS A;  22GS A;  1AAZ A;  3FZ4 A;  1AUC A;  1PQN A;  6GSV A;  1U6T A;  2LTK A;  4J56 E;  1NHY A;  3TUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...