1EV4A

Rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
SGKPVLHYFNARGRMECIRFLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNKLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPMDAKQIEEARKIYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE A1-1
publication title Localization of the C-terminus of rat glutathione S-transferase A1-1: crystal structure of mutants W21F and W21F/F220Y.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 77
structure length 221
sequence length 221
chains with identical sequence C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1ev4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ev4A01
3MSZA 3BOAA 1OC9B 3R3EA 4TKYA 3IC8A 2F51A 1EZKA 2CX3A 5IMCA 4K1FA 1Z6NA 3W8JA 1O8WA 1V98A 3QMXA 2XPEA 3QFBC 1NSWA 1URMA 2X8GA 1BX9A 3F0IA 3E9JB 14GSA 5IQYA 2H0GA 1SYRA 4RI7A 1M2DA 1TW9A 4MZBA 2XBIA 1XCCA 5G1LA 3ISOA 2GT6A 1FW1A 2HT9A 2GZYA 1KBNA 2VCWA 4MPFA 2IMEA 1TU7A 1YDKA 2VCVA 4DEJA 17GSA 3HVXA 3UMAA 1HD2A 4KUNA 1XZOA 2JZRA 1SL1B 20GSA 2JZSA 1YQ1A 2HLSA 5DCGA 3F8UA 3ZLPA 5F05A 2FUG2 1GULA 3GKXA 4J57E 5JCGA 2C3NA 6GSXA 4V2MA 3ERGA 2LTKA 2C3TA 3KP9A 3VI5A 4IS0A 4OFNA 3HA9A 4HS1A 1F9MA 2IL3A 3RHCA 5KEJA 4BL7A 4FH8A 4HQZA 3TJKA 1M2AA 1G6YA 1IYIA 1NW2A 1PSQA 4KDUA 1XXUA 4PQ1A 2CAIA 2ALBA 4F82A 1GUKA 1T8EB 4IELA 2NDOA 2FWFA 2B5EA 2JL4A 2H74A 2IMDA 1J08A 2L6DA 3GNJA 4POKA 4ECCA 3DGQA 5C00A 3FY7A 1V40A 3C8EA 4GQCA 3FZ4A 3HJMA 3VWWA 5JCUA 1T00A 3G7JA 3ERFA 5ECHB 1A8YA 16GSA 4ML6A 4CDOA 2V1MA 5KN3A 4EXJA 3MWHA 4MK3A 2O8VB 2ES7A 2A2SA 3HDCA 2NVLA 4X43A 1W89A 1A2LA 3JCML 2AHEA 4RQXA 3TJJA 4Q5NA 2D2ZA 2VOCA 3A2WA 4O5RA 3RPNA 3QCPA 1XW9A 1EGOA 1XW6A 4PTSA 2F8AA 3KH7A 4TR3A 4OWYA 2QGVA 4WXTA 1O6JA 3BCIA 7GSSA 1O7UA 1ON4A 1SJZA 4ID0A 2YZHA 3GIXA 4OMVA 3LGCA 5GSSA 2QC7A 4IP1A 5AISA 2P0GA 4GLTA 4MJAA 1EP7A 3U6VA 3KH9A 4L5OA 2GZPA 2X8CA 3GYKA 2NPBA 3DYRA 2LQQA 1BJXA 1RW1A 4KDXA 5B7CA 4N0ZA 3PH9A 2MBSA 3L0HA 2GQLA 2C4JA 4ZXGA 1DBYA 4LLRA 4XRDA 2HXKA 4GSSA 1XOAA 5A4VA 1YJ6A 3PR8A 4JEDA 2LJAA 5J41A 2K9FA 2M72A 3DIEA 1ZL9A 3GURA 2DIZA 2HSMA 3O76A 1PGTA 4ZILA 3EWLA 4XHMA 1GNEA 3CRTA 1TRSA 4HU9A 2F9SA 3APOA 3GTUA 3ME8A 4FQUA 4ZB9A 1OKDA 2E7PA 4XRAA 2MMNA 1VF1A 5H5QA 1WMJA 1WPIA 2O89A 4WF4A 4FYUA 2V6OA 1U3IA 3IA1A 5B6MA 2HRKB 3DMLA 4K9ZA 2H66A 1U3AA 5GZZB 3K8NA 1GSUA 1R26A 1Z6MA 1TRUA 2BMXA 1Z3EA 5HQPA 4JR4A 4MP4A 5A5KA 1I9DA 5CRWA 1PL2A 3C1SA 1A0RP 4TN8A 4TR0A 2DLXA 1XWGA 3WT1A 3TRPA 1Q4JA 2WGRA 4YH2A 4BVYB 1Q98A 1R4WA 1OC3A 1ZYQB 5IPHA 1LU4A 2VAFA 2MMZA 2PGTA 1WOUA 3FZ5A 4EVMA 1YY7A 4ECBA 5IMVA 3IHQA 5EPFA 2VIMA 4ZL7A 3ERWA 1EEMA 1R7HA 1M0UA 2X8HA 1MEKA 2C0EA 2IN3A 3V1WA 1T7PB 1KEBA 2VLTA 5IMDA 1B48A 1AQXA 5CO3A 3A2VA 5DALA 1DUGA 2LSTA 3LQ7A 5DCHA 5JCWA 5DVBA 4KAEA 4Q5QA 2JADA 2B7KA 1JZDA 2FWHA 2IJYA 2WRTA 4LL1B 1XW5A 1M9BA 1EGRA 3GA4A 1WRYA 2OBKA 1JZOA 2E2MA 2DBCA 1PQNA 1IYHA 1YF1A 2YWNA 1K0NA 1T1VA 2VL2C 1YEPA 2OE1A 3IOSA 3TOUA 1OE8A 1OYJA 3UVTA 2CZ3A 1JFUA 3GTUB 4IQ1A 2DJ2A 1NHYA 1PN9A 4MJBA 3J7Yb 3QAWA 5IOWA 3QAVA 1I5GA 5CYYA 4HDEA 4I97A 2AB6A 2HZEA 3LYPA 5ECKB 3KEBA 2N5FA 3A5WA 3IRAA 3KZQA 3TB2A 3I9V2 5F06A 4N30A 4P3YB 2ZCTA 4KE3A 2IMFA 4JRRA 4N0VA 1K0CA 4KH7A 2C0FA 1GTAA 5GAPD 3TKQA 2RIIA 3FEUA 3PINA 3E3EA 5F8BA 1K3YA 1TK5B 1TI1A 1WP0A 2VUPA 5D9VA 2LUSA 4MLYA 1GSQA 3IK7A 1WJKA 4HJ2A 2H6ZA 5D73A 3SBCA 2MMAA 3CBUA 2H0HA 3GX8A 5CRDA 1PKWA 1CQHA 1AUCA 1R5PA 1F3AA 3N9JA 1A8LA 2VCQA 1LJRA 4NHWA 4GSNA 2A4VA 3LG6A 2VCZA 3MAKA 2HRAA 1DSBA 3HJPA 4DSSA 9GSSA 3FK8A 4NAXA 2LQOA 1ZGNA 1M2BA 2IFQA 4OO4A 1BG5A 5DALB 1V57A 2LRTA 4MJCA 2LS5A 1AC1A 2CX4A 1O85A 4I8BA 2WJUA 3NZNA 1X5EA 3KXOA 3UIWA 4MDCA 2YJHA 2K8SA 4F03A 3UJ1A 5CRGA 2I9HA 1ERWA 1OC8A 1VRSD 4IGJA 2XBQA 1S3AA 4ISDA 5J9BA 5EVOA 1QFNA 5B8AA 1B4QA 4GWRA 2IMKA 3KGKA 4L8EA 2QKEA 2C1YA 2L57A 5HFIA 3LWAA 3GL3A 2OACA 2KHPA 2PVOC 2L59A 4XTSA 2HRNA 3EU4A 2L6CA 1DE1A 3F6FA 2DJ0A 3C7MA 1AQVA 3HHVA 2B5XA 1GH2A 2HNLA 5A4UA 3IXRA 13GSA 1PA3A 2YV9A 1XBSA 3ZFBA 2HZEB 3EMPA 4AF2A 1A24A 1PKZA 4IBPA 4K7IA 3O6TA 1OVNA 2VL3A 2GSRA 1FB6A 1J9BA 2DJKA 1MDIA 2XHFA 1K0DA 4E8HA 3LFLA 1UVZA 2EIOA 2H75A 1JLVA 1J0FA 3UARA 1G0TA 3CSIA 4GQFA 4PNFA 3IDVA 4DVCA 1BEDA 1EV9A 1ACVA 1F3BA 4TXOB 3TUEA 4MF5A 2HYXA 1Z7PA 4TVEA 5G31A 3IAS2 1ST9A 2G0FA 1ZMAA 3P90A 2R3XA 4BVXA 2I4AA 1TP9A 2H01A 3QPMA 5DAKA 3F63A 1N8JA 1RK4A 2YP6A 1T3BA 1EV4A 3VPQA 2RLIA 5J9CA 3QR6A 3HXSA 4LMVA 6GSTA 4TXVA 3LORA 2VLVA 3TOTA 4BWQA 2B6MA 3GH9A 5AGYA 2HZFA 3KP8A 2IFQB 1AW9A 4L0WA 2JACA 1HNAA 6GSVA 2M80A 4PURA 3ZTLA 3LXTA 4MZCA 2YNXA 2HQTA 5F0GA 1THOA 1XVWA 2KOKA 4RQRA 3L4NA 2C0DA 2CVKA 3ZITA 3IR4A 5ID2B 4EDYA 1LBKA 1GNWA 2O85A 1VF3A 3M9JA 2XPDA 1R5AA 5ECPB 2N5BA 1QQ2A 5D9XA 4HEA2 2KLXA 3TJFA 3L9UA 3R2QA 3Q18A 2GSQA 2H1DA 4LA1A 4RUVA 1FHEA 5IMFA 1SKRB 1GSDA 2KUCA 4EKZA 1PMTA 2H1BA 1GWCA 2VM2A 6GSUA 1UN2A 3PPUA 1XWKA 4CW9A 5DQYA 2B1LA 4NHZA 3LJRA 3CRUA 4IKHA 3TCOA 1THXA 4HQSA 5ECIB 1N2AA 3TGZA 3D5JA 4YQUA 2FA8A 4IHUA 4JE1A 3H8QA 1OE7A 1K0OA 4MCUA 3ZZXA 2IIYA 4RI6A 1SK2A 2JU5A 4YQVA 3FYGA 1Z9HA 8GSSA 2YZUA 5IOXA 2R4VA 2HRFA 2OADA 3F3QA 2V6KA 3D6IA 5CAXA 1XVQA 4N10A 4MJEA 12GSA 4NMUA 3H79A 4JR6A 3TKSA 3ZVJA 3BBYA 5EL8A 2FY6A 4KB3A 1AAZA 2O7KA 1X9SB 3WGXA 3W8SA 3ZMKA 1TRVA 2P5RA 3DEXA 1M9AA 1E6BA 4KW6A 4BPYA 4BL7B 1F6MC 1O73A 2CVDA 4TR1A 3ZRDA 1O8XA 1SK1A 3ZYWA 1GLPA 5DJMA 5ECSA 1TJDA 2MYGA 5CRHA 2FNOA 2K8VA 3Q74A 3HZ4A 3HCZA 1Y25A 1BQ7A 3IV4A 4GCIA 1XPVA 5AIXA 4MZWA 2XC2A 3GL5A 1YKAA 1K3OA 1YF0A 2LJKA 2R6KA 5LNKe 1SD9A 3FR6A 2N5AA 4NWYA 3D4MA 1FB0A 2LNTA 2VM1A 3QD9A 5IO0A 2PUKC 3UEMA 5LCZA 11GSA 2J23A 1MDKA 1TDIA 4ECJA 3KTBA 4WETA 2YV7A 1JHBA 1GLQA 1ZCPA 2WS2A 1BYEA 5IO2A 2OBIA 1G7OA 4F0CA 4KNDA 3I6AA 3VLNA 3EVIA 1GTIA 3ZMLA 3IAM2 4MABA 5G1KA 1ERTA 2C80A 1SJ6A 2CVBA 1B9XC 1PL1A 3P7XA 2VLUA 2LKUA 2H0IA 1A23A 1GUHA 2YJ7A 2HE3A 2GQMA 4K6XA 1Z5YE 1FVJA 1TRWA 2E2GA 2FLSA 1QGVA 4QQ7A 3DVXA 3H4KA 3H93A 1WWJA 3F6DA 4G10A 3WD6A 5DQSA 4K7OA 4WKWA 5D96A 2KP1A 3CSJA 5D9WA 1JLWA 1UC7A 1KNGA 3D22A 3TKRA 2QSIA 1G7EA 3SWLA 4MF6A 1F37A 3HVSA 3GMFA 3C73A 3GN3A 2H71A 5J3RA 1B4PA 3BJ5A 5DJLA 3A3TA 3CXGA 1H4OA 3FHKA 5HFKA 4EC0A 2HSMB 4G0LA 3S9FA 2H76A 5LD0A 2PMTA 3HYPA 2H19A 2V2GA 1M99A 2VO4A 4AJ6A 2JZTA 3GUSA 3ZL5A 22GSA 2AYTA 3Q19A 1VGLA 2H30A 3DWVA 1SU9A 1SKWB 4I2UA 4PGTA 2FWGA 2ZNMA 5HR2A 1OC9A 4K8MA 3FZ9A 2AAWA 4KSOA 4V1Ag 2DMMA 1BAYA 2HSYA 3GKMA 2LRNA 1AIUA 5IMAA 5KN0A 3IC4A 5L71A 3L78A 1GTBA 2C8UA 1AXDA 2GQKA 4G2EA 1X5DA 3W6GA 4PNGA 5AIVA 2M46A 2YCDA 1DE2A 5CREA 4KA0A 1GTUA 1C72A 4GRFA 3GSTA 4GTUA 4NV2A 3KIJA 2GSTA 2CQ9A 2IPAA 4KF9A 2H8LA 3L9VA 1GUMA 4YQMA 2YN1A 3LXZA 2HSNB 5ECMB 5FHIA 2B1KA 5GSTA 2CAQA 1FVKA 4TRXA 4MF7A 2C3QA 4F0BA 4HJMA 5G5FA 1HNCA 1V58A 5HR0A 2IWTA 3GKNA 2NTOA 3RDWA 4EL1A 4ZB8A 5H5RA 1SL0B 2PN8A 5E59A 3J7Yk 2WZ9A 3P2AA 1GRXA 2PERA 3MNGA 3E0UA 3LYKA 2FA4A 4N11A 2YWMA 2PVQA 3M8NA 2BTOT 1FOVA 3UL3A 5ENUA 2HI7A 3GH6A 2MZCA 3TKSE 3KTLA 1GP1A 1Y6EA 2IMIA 4ZB6A 4XS6A 2ON5A 3QFAC 4QL9A 4YAVA 1X9WB 3NIVA 3G7IA 5BMUA 3L9SA 1EOHA 3US3A 3PGTA 2L4CA 4OCEA 1K3LA 3VWUA 2MBTA 4GSTA 5ABRA 3RPPA 1FAAA 3ME7A 2YWIA 3LSZA 2V41A 2PU9C 1E2YA 4AGSA 3KJYA 1V9WA 1NM3A 4WR4A 5ECQB 1XIYA 4I5QA 5G30A 4NV5A 1ZYEA 4CHSA 6GSSA 2LV3A 4IN0A 2VD1A 3ZREA 2WULA 3CYNA 3RBTA 5COHA 4HOJA 3DKSA 5G2ZA 1MD3A 1ABAA 6GSYA 3BD2A 1M7TA 1TXXA 3CTGA 5HFGA 4XS1A 2HSHA 2UZ8A 3GX0A 5C04A 1SK0A 4V2LA 3EU3A 2WFCA 4XS4A 3CTFA 5ECLB 3C1RA 4MH2A 1SYXA 3I69A 1ERUA 4EE0A 2RUEA 1K0AA 1A2JA 2H6YA 1S3CA 5D93A 4WR5A 4MPGA 2TRXA 3GV1A 4X0XA 3FW2A 1K0MA 5JWRB 2J9HA 4BWSA 5G5EA 1EEJA 4HZ4A 4G19A 3BCKA 1YKCA 4PUFC 1GSSA 5JWQB 6GSWA 3FRCA 3D0ZA 4I2TA 4GF0A 3F3RA 2H70A 4JZQA 2VL9A 4DSSB 2P31A 4JBBA 1HQOA 5CNWA 3TDGA 4HU7A 1SKSB 1U87A 4O32A 1WIKA 3KMNA 2H1AA 2H73A 3IPZA 4PUAA 2HFDA 4K2DA 3ED3A 1W4VA 4EDZA 3NOFA 2DJJA 1OKTA 2I3YA 4IP6A 5J4UA 2NBSA 3ZVJD 5KN1A 2FHEA 3QDNA 1XFLA 2FD3A 2R5GA 3DD3A 3VPTA 4USSA 1SD8A 4IVFA 4OD7A 4ZL8A 3UBKA 4FYBA 2HRKA 3FZAA 4K0GA 3FR9A 2GVPA 4OFTA 3Q6OA 4G9HA 3DVWA 2I81A 4E8EA 3HKRA 5ECOB 5CP1A 4POMA 3RAZA 1AQWA 1VF4A 4MH3A 3G9BA 4TOPA 5E4WA 4O92A 4MMMA 5A4WA 1QK8A 4PQHA 2V32A 4G0KA 3A2XA 18GSA 2LNSA 1UA5A 5ECRB 1H75A 2OA7A 4HI7A 4BVYA 2RUFA 4D73A 2DIYA 2I1UA 2OJLA 1TI3A 3VFIA 4HUAA 5B8BA 4KCAA 4ACSA 4XS4B 3G7YA 1A2MA 4G0IA 2GT5A 3F4TA 1YEXA 1TK0B 1TTZA 2GLRA 4WBJA 4KGIA 4F2IA 3OR5A 2WCIA 1XWCA 2GDRA 4BVXB 4LL4B 3O3TA 5DDLA 2TRCP 2YWOA 5DAKB 4O7HA 5D8IA 2DMLA 4ZBDA 3WGDA 1ML6A 5GAND 4ILFA 2VD0A 2KP2A 4X1UA 3N5OA 5HR3A 1RQMA 3KMOA 4MA9A 5J5NA 3UVHA 1V2AA 1FG4A 3KM6A 2H72A 1USBA 1PD21 2AJQB 3I43A 1G6WA 4POBA 3TRXA 1ZOFA 1SL2B 19GSA 1QMVA 5AN1A 2CZ2A 2K18A 2L4QA 2FGXA 4KSMA 4EF0A 3FR3A 3ZIJA 4DSRA 3VK9A 3QOUA 4OFMA 3UBLA 2PWJA 1WE0A 4KX4A 2H1GA 4PQIA 1O81A 1T4YA 4KDYA 3EURA 5INYA 4ZL9A 5B6NA 3F9UA 4PX1A 3UAPA 2AV4A 1KTEA 2PBJA 3APSA 3KCMA 3KD0A 2C0GA 4ML1A 3VURA 2JSZA 1SENA 2MMOA 3F4SA 1EOGA 4L5LA 1U88A 1SJIA 2F3MA 5EY6A 2VL2A 1TU8A 2LEGA 4PXOA 3EC3A 3GHAA 4WF5A 2RM6A 2VCXA 1GSFA 3CMIA 3APQA 2X99A 3HY2A 3M0FA 3WT2A 2YOIA 10GSA 1ERVA 4IJIA 2H6XA 5FWGA 4Q5FA 3VWXA 3IE3A 1PX7A 2P5QA 3WGEA 2YPMA 4D73B 1X5CA 1EWXA 3DXBA 5D9TA 2DC5A 1GSEA 2GZZA 3TKSC 2L5LA 2K6VA 5ELAA 3EE2A 2TIRA 5F07A 4FO5A 1F2EA 2Z9SA 2DJ3A 4BA7A 1MTCA 1YZXA 1TKDB 2GSSA 2OE0A 3UOMA 1HYUA 1X0RA 2WB9A 2DJ1A 4XIHA 2JSYA 3U5RE 1FO5A 1S3DA 3P8WA 5KN2A 3M9KA 2REMA 1JZWA 5HR1A 4J56E 5IM9A 3RHBA 1K0BA 2GGTA 3IK9A 1GSYA 3GRXA 1B8XA 1T4ZA 4TR1B 3QAGA 4V2NA 3TJGA 4XCSA 1HNBA 4YAPA 1MD4A 3VWVA 1EP8A 3M1GA 4ZBBA 2EIRA 4K0NA 3F4RA 1U6TA 3D21A 4H86A 3GSSA 3MDKA 3GKKA 3TKPA 4Q5RA 4DSQA 5H5SA 1B9YC 4POLA 4NXIA 4AJ7A 1VF2A 4IQAA 4ZIJA 4FYCA 3HZ8A 1X9MB 1TOFA 1Z7RA 2A2RA 4OO5A 3AY8A 2VCTA 4FIWA 2R37A 2CT6A 4TR4A 5ELGA 3LEFA 4TW5A 4LMWA 2CA8A 2GTUA 1PRXA 1QXHA 2ZUPA 3HVVA 1MDJA 4WEYA 3ZFLA 4F9ZA 2E0QA 2YANA 4WBRD 3FKFA 5IIZA 3ZIVA 4L0UA 3HJOA 2DSAA 5ECNB 2FWEA 3DRNA 3VI7A 3TJBA 3M3MA 4I6XA 1XOBA 4EUYA 2GS3A 1XWBA 4JU5A 4Z7XA 4V1Ap 1TK8B 3C71A 2ON7A 4J2FA 2RM5A 3EMXA 4TXOA 5JWOB 2EC4A 4K7NA 5IMZA 2OKAA 2O87A 2LRCA 5FT3A 4AJ8A 5DBQA 3GFKA 2G2QA 1ILOA 4EO3A 4KCEA 1GL8A 2L5OA 4ZBAA 2B5YA 3D4TA 1PX6A 2AUVA 2R2JA 1OAZA 3EINA 2B3SA 2B7JA 1CQGA 1A0FA 4GXZA 2F8FA 3CSHA 4ECIA 5IPGA 4QL7A 3HD5A 3H1NA 2EIQA 2LJRA 3TRQA 3IBHA 2WDUA 1QUWA 2OE3A 4NPBA 2PPTA 5ID2A 2X64A 3WYWA 4HZ2A 4OCFA 4ULXA 1ZZYA 1JZRA 4IJ3A 2CV4A 2FCHA 3EYTA 2BJXA 4IW9A 1NHOA 1XWAA
chains in the Genus database with same CATH superfamily
3MSZA 3BOAA 1OC9B 3R3EA 4TKYA 3IC8A 2F51A 1EZKA 2CX3A 5IMCA 4K1FA 1Z6NA 3W8JA 1O8WA 1V98A 3QMXA 2XPEA 3QFBC 1NSWA 1URMA 2X8GA 1BX9A 3F0IA 3E9JB 14GSA 5IQYA 2H0GA 1SYRA 4RI7A 1M2DA 1TW9A 4MZBA 2XBIA 1XCCA 5G1LA 3HVNA 3ISOA 2GT6A 1FW1A 2HT9A 2GZYA 1KBNA 2VCWA 4MPFA 2IMEA 1TU7A 1YDKA 2VCVA 4DEJA 17GSA 3HVXA 3UMAA 1HD2A 4KUNA 1XZOA 2JZRA 1SL1B 20GSA 2JZSA 1YQ1A 2HLSA 5DCGA 3F8UA 3ZLPA 5F05A 2FUG2 1GULA 3GKXA 4J57E 5JCGA 2C3NA 6GSXA 4V2MA 4AKIA 3ERGA 2LTKA 2C3TA 3KP9A 3VI5A 4IS0A 4OFNA 3HA9A 4HS1A 1F9MA 2IL3A 3RHCA 5KEJA 4BL7A 4FH8A 5BMUB 4HQZA 3TJKA 1M2AA 1G6YA 1IYIA 1NW2A 1PSQA 4KDUA 1XXUA 4PQ1A 2EFEA 2CAIA 4W66A 2ALBA 4F82A 1GUKA 1T8EB 4IELA 2A2PA 2NDOA 2FWFA 2B5EA 2JL4A 2H74A 2IMDA 1J08A 2L6DA 4CY8A 3GNJA 4POKA 4ECCA 3DGQA 5C00A 3MYDA 3FY7A 1V40A 3C8EA 4GQCA 3FZ4A 3HJMA 3VWWA 5JCUA 1T00A 3G7JA 3ERFA 5ECHB 4X4JA 1S3RA 1A8YA 4MNNA 16GSA 4ML6A 4CDOA 2V1MA 5KN3A 4EXJA 3MWHA 4MK3A 2O8VB 2ES7A 2A2SA 3HDCA 2NVLA 4X43A 1W89A 1A2LA 3JCML 2AHEA 4RQXA 3TJJA 4Q5NA 2D2ZA 2VOCA 3A2WA 4O5RA 3RPNA 3QCPA 1XW9A 1EGOA 1XW6A 4PTSA 2F8AA 3KH7A 4TR3A 4OWYA 2QGVA 4WXTA 1O6JA 3BCIA 7GSSA 1O7UA 1ON4A 1SJZA 4ID0A 2YZHA 3GIXA 4OMVA 2DKIA 3LGCA 5GSSA 2QC7A 4IP1A 5AISA 2P0GA 4GLTA 4MJAA 1EP7A 3U6VA 3FMWA 4L5OA 2GZPA 2X8CA 3GYKA 3KH9A 2NPBA 3DYRA 2LQQA 2O5VA 1BJXA 1RW1A 4KDXA 5B7CA 4N0ZA 3PH9A 2MBSA 3L0HA 2GQLA 2C4JA 4ZXGA 1DBYA 1TXUA 4LLRA 2HXKA 4XRDA 4GSSA 1XOAA 5A4VA 1YJ6A 3PR8A 4JEDA 2LJAA 2EFCA 5J41A 2K9FA 2M72A 3DIEA 1ZL9A 3GURA 2DIZA 2EFHA 2HSMA 3O76A 1PGTA 4ZILA 3EWLA 4XHMA 1GNEA 3CRTA 1TRSA 4HU9A 2F9SA 3APOA 3GTUA 3ME8A 4FQUA 4ZB9A 1OKDA 2E7PA 4XRAA 2MMNA 1VF1A 5H5QA 1WMJA 1WPIA 2O89A 4WF4A 4FYUA 2V6OA 1U3IA 3IA1A 5B6MA 2HRKB 3DMLA 4K9ZA 2H66A 1U3AA 5GZZB 3K8NA 1GSUA 1R26A 1Z6MA 1TRUA 2BMXA 1Z3EA 5HQPA 4JR4A 4MP4A 5A5KA 1I9DA 5CRWA 1PL2A 3C1SA 1A0RP 4TN8A 4TR0A 2DLXA 1XWGA 3WT1A 3TRPA 1Q4JA 2WGRA 4YH2A 4BVYB 1Q98A 1R4WA 1OC3A 1ZYQB 5IPHA 1LU4A 2VAFA 2MMZA 2PGTA 1WOUA 3FZ5A 4EVMA 1YY7A 2HSNA 4ECBA 5IMVA 3IHQA 5EPFA 2VIMA 4ZL7A 3ERWA 4PI0C 1EEMA 1I1IP 1R7HA 1M0UA 2X8HA 1MEKA 2C0EA 2IN3A 2R0CA 3V1WA 1T7PB 1KEBA 2VLTA 5IMDA 1B48A 1AQXA 5CO3A 3A2VA 5DALA 1DUGA 2LSTA 3LQ7A 1XG8A 5DCHA 5JCWA 5DVBA 4KAEA 4Q5QA 2JADA 2B7KA 1JZDA 2FWHA 2IJYA 2WRTA 4LL1B 1XW5A 1M9BA 1EGRA 3GA4A 1WRYA 2OBKA 1JZOA 2E2MA 2DBCA 1PQNA 1IYHA 1YF1A 2YWNA 1K0NA 1T1VA 1PN0A 2VL2C 2WW3A 1YEPA 2OE1A 3IOSA 3TOUA 1OE8A 1OYJA 3UVTA 2CZ3A 1JFUA 3GTUB 4IQ1A 2DJ2A 1NHYA 2R0GA 1PN9A 4Z2TA 4MJBA 3J7Yb 3QAWA 5IOWA 3QAVA 1I5GA 5CYYA 4HDEA 4I97A 2AB6A 2HZEA 3LYPA 5ECKB 3KEBA 2WZSA 2N5FA 3A5WA 3IRAA 3KZQA 3TB2A 3I9V2 5F06A 4N30A 3CWGA 4P3YB 2ZCTA 4KE3A 2IMFA 4JRRA 4N0VA 1K0CA 4KH7A 2C0FA 1GTAA 5GAPD 3TKQA 4K5SA 2RIIA 3FEUA 3PINA 3E3EA 5F8BA 4K5RA 1K3YA 1TK5B 1TI1A 1WP0A 2VUPA 5D9VA 2LUSA 4MLYA 1GSQA 3IK7A 1WJKA 1M3JA 2WVYA 4HJ2A 2H6ZA 5D73A 3SBCA 2MMAA 3CBUA 2H0HA 3GX8A 5CRDA 1PKWA 1CQHA 1AUCA 1R5PA 1F3AA 3N9JA 1A8LA 2VCQA 1LJRA 4NHWA 2R0PA 4GSNA 2A4VA 3LG6A 2VCZA 3MAKA 2HRAA 1DSBA 3HJPA 4DSSA 9GSSA 3FK8A 4NAXA 2LQOA 1ZGNA 1M2BA 2IFQA 4OO4A 1BG5A 5DALB 1V57A 1M3IA 2LRTA 4MJCA 2LS5A 1AC1A 4EIPA 2CX4A 1FOHA 4AKXB 1O85A 4I8BA 4O5UA 2WJUA 3NZNA 1X5EA 3KXOA 3UIWA 4MDCA 2YJHA 2K8SA 4F03A 3UJ1A 5CRGA 2I9HA 1ERWA 1OC8A 1VRSD 4IGJA 1YVLA 2XBQA 1S3AA 4ISDA 5J9BA 5EVOA 1QFNA 5B8AA 1B4QA 4GWRA 2IMKA 3KGKA 4L8EA 2QKEA 2C1YA 2L57A 5HFIA 3LWAA 3GL3A 2OACA 2KHPA 2PVOC 2L59A 4XTSA 2HRNA 3EU4A 2L6CA 1DE1A 3F6FA 2DJ0A 3C7MA 1AQVA 3HHVA 2B5XA 1GH2A 2HNLA 5A4UA 3IXRA 13GSA 1PA3A 2YV9A 1XBSA 3ZFBA 2HZEB 3EMPA 4AF2A 1A24A 2WW2A 1PKZA 4IBPA 4K7IA 3O6TA 1OVNA 2VL3A 2GSRA 1FB6A 1J9BA 2DJKA 1MDIA 2XHFA 4K2XA 1K0DA 4E8HA 3LFLA 1UVZA 2EIOA 2H75A 1JLVA 1J0FA 3UARA 1G0TA 3CSIA 4GQFA 4PNFA 3IDVA 4DVCA 1BEDA 1EV9A 1ACVA 1F3BA 4TXOB 3TUEA 4MF5A 2HYXA 1Z7PA 4TVEA 5G31A 3IAS2 1ST9A 2G0FA 1ZMAA 3P90A 2R3XA 4BVXA 2I4AA 1TP9A 2H01A 3QPMA 5DAKA 3F63A 1N8JA 1RK4A 2YP6A 1T3BA 1EV4A 3VPQA 2RLIA 2QA2A 5J9CA 3QR6A 4BIKA 3HXSA 4LMVA 6GSTA 4TXVA 3LORA 2VLVA 3TOTA 4AKGA 4BWQA 2B6MA 3GH9A 5AGYA 2HZFA 3KP8A 2IFQB 1AW9A 4L0WA 4QMKA 2JACA 1HNAA 6GSVA 2M80A 4PURA 3ZTLA 3LXTA 4MZCA 2YNXA 2HQTA 5F0GA 1THOA 1XVWA 2KOKA 4RQRA 3L4NA 2C0DA 2CVKA 3ZITA 3IR4A 5ID2B 4EDYA 1LBKA 1GNWA 5A5HA 2O85A 1VF3A 3M9JA 2XPDA 1R5AA 5ECPB 2N5BA 1QQ2A 5D9XA 4HEA2 2KLXA 3TJFA 3L9UA 3R2QA 3Q18A 2GSQA 2H1DA 4LA1A 4RUVA 1FHEA 5IMFA 1SKRB 1GSDA 2KUCA 4EKZA 1PMTA 2H1BA 4CY6A 1GWCA 2VM2A 6GSUA 1UN2A 3PPUA 1XWKA 4CW9A 5DQYA 2VKZG 2B1LA 4NHZA 3LJRA 3CRUA 4IKHA 3TCOA 1SVOA 1THXA 4HQSA 5ECIB 1N2AA 3TGZA 3D5JA 4YQUA 2FA8A 4IHUA 4JE1A 3H8QA 1OE7A 1K0OA 1ZYNA 4MCUA 3ZZXA 2IIYA 4RI6A 1SK2A 2JU5A 4YQVA 3FYGA 1Z9HA 8GSSA 2YZUA 5IOXA 2R4VA 2HRFA 2OADA 3F3QA 2V6KA 3D6IA 5CAXA 1XVQA 4YKGA 4N10A 4MJEA 12GSA 4NMUA 3H79A 4JR6A 3TKSA 3ZVJA 3BBYA 5EL8A 2FY6A 4KB3A 1AAZA 2O7KA 1X9SB 3WGXA 3W8SA 3ZMKA 1TRVA 3RFRC 2H1LA 2P5RA 3DEXA 1M9AA 1E6BA 4KW6A 4ICYA 4BPYA 4BL7B 1F6MC 1O73A 2CVDA 1SVLA 4TR1A 3ZRDA 1O8XA 1SK1A 3ZYWA 4YKFA 1GLPA 5DJMA 5ECSA 1TJDA 2MYGA 5CRHA 2FNOA 2K8VA 3Q74A 3HZ4A 3HCZA 1Y25A 1BQ7A 3IV4A 4GCIA 1XPVA 5AIXA 4MZWA 2XC2A 3GL5A 1YKAA 1K3OA 1YF0A 2LJKA 2R6KA 5A5HB 5LNKe 1SD9A 3FR6A 2N5AA 4NWYA 3D4MA 1FB0A 2LNTA 2VM1A 3QD9A 5IO0A 2PUKC 3UEMA 5J47A 5LCZA 11GSA 2J23A 1MDKA 1TDIA 4ECJA 3KTBA 4WETA 2YV7A 1JHBA 1GLQA 1ZCPA 2WS2A 4ZB7A 1BYEA 5IO2A 2OBIA 1G7OA 4F0CA 4KNDA 5A1NA 3I6AA 3VLNA 5A34A 3EVIA 1GTIA 3ZMLA 3IAM2 4MABA 5G1KA 1ERTA 2C80A 1SJ6A 2CVBA 1B9XC 1PL1A 3P7XA 2VLUA 2LKUA 2H0IA 1A23A 1GUHA 2YJ7A 2HE3A 2GQMA 4K6XA 1Z5YE 1FVJA 1TRWA 4O5QA 2E2GA 2FLSA 1QGVA 2X49A 4QQ7A 3DVXA 3H4KA 4G01A 3H93A 1WWJA 3F6DA 4G10A 3WD6A 5DQSA 4K7OA 4WKWA 5D96A 4Z2RA 2KP1A 3CSJA 5D9WA 1JLWA 1S4BP 1UC7A 1KNGA 3D22A 3TKRA 2QSIA 1G7EA 3SWLA 4MF6A 1F37A 3HVSA 3GMFA 3C73A 3GN3A 2H71A 5J3RA 5KOXA 1B4PA 3BJ5A 5DJLA 3A3TA 3CXGA 1H4OA 5BRTA 3FHKA 5HFKA 4EC0A 2HSMB 4G0LA 3S9FA 2H76A 5LD0A 2PMTA 3HYPA 2H19A 2V2GA 1M99A 2VO4A 4AJ6A 2JZTA 3GUSA 3ZL5A 22GSA 2AYTA 3Q19A 1VGLA 2H30A 3DWVA 1SU9A 1ZYPA 1SKWB 3A5IA 4PGTA 2FWGA 2ZNMA 4I2UA 5HR2A 1OC9A 4K8MA 3FZ9A 2AAWA 4KSOA 4V1Ag 2DMMA 1BAYA 2HSYA 3GKMA 2LRNA 1AIUA 5IMAA 5KN0A 3IC4A 5L71A 3L78A 1GTBA 2C8UA 1AXDA 2GQKA 4G2EA 1X5DA 3W6GA 4PNGA 5AIVA 2M46A 4N3ZA 2YCDA 1DE2A 5CREA 4KA0A 1GTUA 1C72A 4GRFA 2WW1A 3GSTA 4GTUA 4NV2A 3KIJA 2GSTA 2CQ9A 2IPAA 4KF9A 2H8LA 5A34B 3L9VA 1GUMA 4YQMA 2YN1A 3LXZA 2HSNB 5ECMB 5FHIA 2B1KA 5GSTA 5J4VA 2CAQA 1FVKA 4TRXA 4MF7A 2C3QA 4F0BA 4HJMA 5G5FA 1HNCA 1V58A 5HR0A 2IWTA 3GKNA 2NTOA 3RDWA 4EL1A 4ZB8A 5H5RA 1SL0B 2PN8A 5E59A 2WW0A 3J7Yk 2WZ9A 3P2AA 1GRXA 2PERA 3MNGA 3E0UA 3LYKA 2FA4A 4N11A 2YWMA 2O3EA 2PVQA 3M8NA 2BTOT 1FOVA 3UL3A 5ENUA 2HI7A 3GH6A 2MZCA 3TKSE 3KTLA 1GP1A 1Y6EA 2IMIA 4ZB6A 3CQFA 4XS6A 2ON5A 3QFAC 4QL9A 4YAVA 1X9WB 3NIVA 3G7IA 5BMUA 3L9SA 1EOHA 3US3A 3PGTA 2L4CA 4OCEA 1K3LA 3VWUA 2MBTA 4GSTA 5ABRA 3RPPA 1FAAA 3ME7A 2YWIA 3LSZA 2V41A 2PU9C 1E2YA 4AGSA 3KJYA 1V9WA 1NM3A 4WR4A 5ECQB 1XIYA 4I5QA 5G30A 4NV5A 1ZYEA 4CHSA 6GSSA 2LV3A 4IN0A 2VD1A 3ZREA 2WULA 3CYNA 3RBTA 5COHA 1YEWC 4HOJA 3DKSA 5G2ZA 1MD3A 4A5PA 1ABAA 6GSYA 3BD2A 1M7TA 1TXXA 3CTGA 5HFGA 4XS1A 2HSHA 2UZ8A 3GX0A 5C04A 1SK0A 4V2LA 3EU3A 2WFCA 4E68A 4XS4A 3CTFA 5ECLB 3C1RA 4MH2A 1SYXA 3I69A 1ERUA 4EE0A 2RUEA 1K0AA 1A2JA 2H6YA 1S3CA 5D93A 4WR5A 4MPGA 2TRXA 3GV1A 4EIQA 4X0XA 3FW2A 1K0MA 5JWRB 2J9HA 4BWSA 5G5EA 1EEJA 4HZ4A 4G19A 3BCKA 1YKCA 4PUFC 1GSSA 5JWQB 6GSWA 3FRCA 3D0ZA 4I2TA 4GF0A 3F3RA 2H70A 4JZQA 2VL9A 4DSSB 2P31A 4JBBA 1HQOA 5CNWA 3TDGA 4HU7A 1Y1UA 1SKSB 1U87A 4O32A 1WIKA 3KMNA 5J40A 2H1AA 2H73A 3IPZA 3LW9A 4PUAA 2HFDA 4K2DA 3ED3A 1W4VA 4EDZA 3NOFA 2DJJA 1OKTA 2I3YA 4IP6A 5J4UA 2NBSA 3ZVJD 5KN1A 2FHEA 3QDNA 1XFLA 2FD3A 2R5GA 3DD3A 3VPTA 4USSA 1SD8A 5KOWA 4IVFA 4OD7A 4ZL8A 3UBKA 4FYBA 2HRKA 3FZAA 4K0GA 3FR9A 2GVPA 4OFTA 3Q6OA 4G9HA 3DVWA 2I81A 4E8EA 3HKRA 5ECOB 5CP1A 4POMA 3RAZA 1AQWA 1VF4A 4MH3A 3G9BA 4TOPA 5E4WA 4O92A 4MMMA 5A4WA 1QK8A 4PQHA 2V32A 4G0KA 3A2XA 18GSA 2LNSA 1UA5A 5ECRB 1H75A 2OA7A 4HI7A 4BVYA 2RUFA 4AKHA 4D73A 2DIYA 4PI2C 2I1UA 2OJLA 1TI3A 3VFIA 4HUAA 5B8BA 4KCAA 4ACSA 4XS4B 2DKHA 3CHXC 3G7YA 2WVXA 1A2MA 4G0IA 2GT5A 3F4TA 1YEXA 1TK0B 1TTZA 2GLRA 4WBJA 4KGIA 4F2IA 3OR5A 2WCIA 1XWCA 2GDRA 4BVXB 4LL4B 3O3TA 5DDLA 2TRCP 2YWOA 5DAKB 4O7HA 5D8IA 2DMLA 4ZBDA 3WGDA 1ML6A 5GAND 4HSCX 4ILFA 2VD0A 2KP2A 2QA1A 1N25A 4X1UA 3N5OA 5HR3A 1RQMA 3KMOA 4MA9A 1SVMA 5J5NA 3UVHA 1V2AA 5J4YA 1FG4A 3KM6A 2H72A 1USBA 1PD21 2AJQB 3I43A 1G6WA 4POBA 3TRXA 1ZOFA 1SL2B 19GSA 1QMVA 5AN1A 2CZ2A 2K18A 2L4QA 1PFOA 2FGXA 4KSMA 4EF0A 3FR3A 3ZIJA 4DSRA 3VK9A 3QOUA 4OFMA 3UBLA 2PWJA 1WE0A 4KX4A 2H1GA 4PQIA 1O81A 1T4YA 4KDYA 3EURA 5INYA 4ZL9A 5B6NA 3F9UA 4PX1A 3UAPA 2AV4A 1KTEA 2PBJA 3APSA 3KCMA 3KD0A 2C0GA 4ML1A 3VURA 2JSZA 1SENA 2MMOA 3F4SA 1EOGA 4L5LA 1U88A 1SJIA 2F3MA 5EY6A 2VL2A 1TU8A 2LEGA 4PXOA 3EC3A 3GHAA 4WF5A 2RM6A 2VCXA 1GSFA 3CMIA 3APQA 1BG1A 2X99A 3HY2A 3M0FA 3WT2A 2O36A 2YOIA 10GSA 1ERVA 4IJIA 2H6XA 5FWGA 4Q5FA 3VWXA 3IE3A 1PX7A 2P5QA 3WGEA 2YPMA 4D73B 1X5CA 3RGBC 1EWXA 3DXBA 5D9TA 2DC5A 1GSEA 2GZZA 3TKSC 2L5LA 2K6VA 5ELAA 3EE2A 2TIRA 5F07A 4FO5A 2WVXB 1F2EA 2Z9SA 2DJ3A 4BA7A 1MTCA 1YZXA 1TKDB 2GSSA 2OE0A 3UOMA 4FXYP 1HYUA 1X0RA 2WB9A 2DJ1A 4XIHA 2JSYA 3U5RE 1FO5A 1S3DA 3P8WA 5KN2A 3M9KA 2REMA 1JZWA 5HR1A 4J56E 5IM9A 3RHBA 1K0BA 2GGTA 3IK9A 1GSYA 3HMJG 3GRXA 1B8XA 1T4ZA 4TR1B 3QAGA 2UV8G 4V2NA 3TJGA 4XCSA 1HNBA 4YAPA 1MD4A 3VWVA 1EP8A 3TU3B 3M1GA 4ZBBA 2EIRA 4K0NA 3F4RA 1U6TA 4AI6A 3D21A 4H86A 3GSSA 3MDKA 3GKKA 2EFDA 3TKPA 4Q5RA 4DSQA 5H5SA 1B9YC 4POLA 4NXIA 4AJ7A 1VF2A 4IQAA 4ZIJA 4FYCA 3HZ8A 1X9MB 1TOFA 3EPTA 1Z7RA 2A2RA 2OT3A 4OO5A 3AY8A 2VCTA 4FIWA 2R37A 2CT6A 4TR4A 5ELGA 3LEFA 4TW5A 4LMWA 2CA8A 2GTUA 1PRXA 2X4AA 1QXHA 2ZUPA 3HVVA 1MDJA 4WEYA 3ZFLA 5A1NB 4F9ZA 2E0QA 2YANA 4WBRD 3FKFA 5IIZA 3ZIVA 4L0UA 3HJOA 2DSAA 5ECNB 2FWEA 3DRNA 3VI7A 3TJBA 3M3MA 4I6XA 1XOBA 4EUYA 2GS3A 3MIXA 1XWBA 4JU5A 4Z7XA 4V1Ap 1TK8B 3C71A 2ON7A 4J2FA 2RM5A 3EMXA 4TXOA 5JWOB 2EC4A 4K7NA 5IMZA 2OKAA 2O87A 2LRCA 1BF5A 5FT3A 4AJ8A 5DBQA 4GDFA 3GFKA 2G2QA 4Z2UA 1ILOA 4EO3A 2A4HA 2WVZA 4KCEA 1GL8A 2L5OA 4ZBAA 2B5YA 3D4TA 1PX6A 2AUVA 2R2JA 1OAZA 3EINA 2B3SA 2B7JA 1CQGA 1A0FA 4GXZA 2F8FA 3CSHA 4ECIA 5IPGA 4QL7A 3HD5A 3H1NA 2EIQA 2LJRA 3TRQA 3IBHA 4PHZC 2WDUA 1QUWA 2OE3A 4NPBA 2PPTA 3IHGA 5ID2A 2X64A 3WYWA 4HZ2A 4OCFA 4ULXA 1ZZYA 1JZRA 4IJ3A 2CV4A 2FCHA 3EYTA 2BJXA 4IW9A 1NHOA 1XWAA
chains in the Genus database with same CATH topology
3MSZA 3BOAA 1OC9B 3R3EA 4TKYA 3IC8A 2F51A 1EZKA 2CX3A 5IMCA 4K1FA 1Z6NA 3W8JA 1O8WA 1V98A 3QMXA 2XPEA 3QFBC 1NSWA 1URMA 2X8GA 1BX9A 3F0IA 3E9JB 14GSA 5IQYA 2H0GA 1SYRA 4RI7A 1M2DA 1TW9A 4MZBA 2XBIA 1XCCA 5G1LA 3ISOA 2GT6A 1FW1A 2HT9A 2GZYA 1KBNA 2VCWA 4MPFA 2IMEA 1TU7A 1YDKA 2VCVA 4DEJA 17GSA 3HVXA 3UMAA 1HD2A 4KUNA 1XZOA 2JZRA 1SL1B 20GSA 2JZSA 1YQ1A 2HLSA 5DCGA 3F8UA 3ZLPA 5F05A 2FUG2 1GULA 3GKXA 4J57E 5JCGA 2C3NA 6GSXA 4V2MA 4AKIA 3ERGA 2LTKA 2C3TA 3KP9A 3VI5A 4IS0A 4OFNA 3HA9A 4HS1A 1F9MA 2IL3A 3RHCA 5KEJA 4BL7A 4FH8A 5BMUB 4HQZA 3TJKA 1M2AA 1G6YA 1IYIA 1NW2A 1PSQA 4KDUA 1XXUA 4PQ1A 2EFEA 2CAIA 4W66A 2ALBA 4F82A 1GUKA 1T8EB 4IELA 2A2PA 2NDOA 2FWFA 2B5EA 2JL4A 2H74A 2IMDA 1J08A 2L6DA 4CY8A 3GNJA 4POKA 4ECCA 3DGQA 5C00A 3MYDA 3FY7A 1V40A 3C8EA 4GQCA 3FZ4A 3HJMA 3VWWA 5JCUA 1T00A 3G7JA 3ERFA 5ECHB 4X4JA 1A8YA 4MNNA 16GSA 4ML6A 4CDOA 2V1MA 5KN3A 4EXJA 3MWHA 4MK3A 2O8VB 2ES7A 2A2SA 3HDCA 2NVLA 4X43A 1W89A 1A2LA 3JCML 2AHEA 4RQXA 3TJJA 4Q5NA 2D2ZA 2VOCA 3A2WA 4O5RA 3RPNA 3QCPA 1XW9A 1EGOA 1XW6A 4PTSA 2F8AA 3KH7A 4TR3A 4OWYA 2QGVA 4WXTA 1O6JA 3BCIA 7GSSA 1O7UA 1ON4A 1SJZA 4ID0A 2YZHA 3GIXA 4OMVA 2DKIA 3LGCA 5GSSA 2QC7A 4IP1A 5AISA 2P0GA 4GLTA 4MJAA 1EP7A 3U6VA 3FMWA 4L5OA 2GZPA 2X8CA 3GYKA 3KH9A 2NPBA 3DYRA 2LQQA 2O5VA 1BJXA 1RW1A 4KDXA 5B7CA 4N0ZA 3PH9A 2MBSA 3L0HA 2GQLA 2C4JA 4ZXGA 1DBYA 1TXUA 4LLRA 2HXKA 4XRDA 4GSSA 1XOAA 5A4VA 1YJ6A 3PR8A 4JEDA 2LJAA 2EFCA 5J41A 2K9FA 2M72A 3DIEA 1ZL9A 3GURA 2DIZA 2EFHA 2HSMA 3O76A 1PGTA 4ZILA 3EWLA 4XHMA 1GNEA 3CRTA 1TRSA 4HU9A 2F9SA 3APOA 3GTUA 3ME8A 4FQUA 4ZB9A 1OKDA 2E7PA 4XRAA 2MMNA 1VF1A 5H5QA 1WMJA 1WPIA 2O89A 4WF4A 4FYUA 2V6OA 1U3IA 3IA1A 5B6MA 2HRKB 3DMLA 4K9ZA 2H66A 1U3AA 5GZZB 3K8NA 1GSUA 1R26A 1Z6MA 1TRUA 2BMXA 1Z3EA 5HQPA 4JR4A 4MP4A 5A5KA 1I9DA 5CRWA 1PL2A 3C1SA 1A0RP 4TN8A 4TR0A 2DLXA 1XWGA 3WT1A 3TRPA 1Q4JA 2WGRA 4YH2A 4BVYB 1Q98A 1R4WA 1OC3A 1ZYQB 5IPHA 1LU4A 2VAFA 2MMZA 2PGTA 1WOUA 3FZ5A 4EVMA 1YY7A 2HSNA 4ECBA 5IMVA 3IHQA 5EPFA 2VIMA 4ZL7A 3ERWA 1EEMA 1R7HA 1M0UA 2X8HA 1MEKA 2C0EA 2IN3A 2R0CA 3V1WA 1T7PB 1KEBA 2VLTA 5IMDA 1B48A 1AQXA 5CO3A 3A2VA 5DALA 1DUGA 2LSTA 3LQ7A 5DCHA 5JCWA 5DVBA 4KAEA 4Q5QA 2JADA 2B7KA 1JZDA 2FWHA 2IJYA 2WRTA 4LL1B 1XW5A 1M9BA 1EGRA 3GA4A 1WRYA 2OBKA 1JZOA 2E2MA 2DBCA 1PQNA 1IYHA 1YF1A 2YWNA 1K0NA 1T1VA 1PN0A 2VL2C 1YEPA 2OE1A 3IOSA 3TOUA 1OE8A 1OYJA 3UVTA 2CZ3A 1JFUA 3GTUB 4IQ1A 2DJ2A 1NHYA 2R0GA 1PN9A 4Z2TA 4MJBA 3J7Yb 3QAWA 5IOWA 3QAVA 1I5GA 5CYYA 4HDEA 4I97A 2AB6A 2HZEA 3LYPA 5ECKB 3KEBA 2N5FA 3A5WA 3IRAA 3KZQA 3TB2A 3I9V2 5F06A 4N30A 3CWGA 4P3YB 2ZCTA 4KE3A 2IMFA 4JRRA 4N0VA 1K0CA 4KH7A 2C0FA 1GTAA 5GAPD 3TKQA 4K5SA 2RIIA 3FEUA 3PINA 3E3EA 5F8BA 4K5RA 1K3YA 1TK5B 1TI1A 1WP0A 2VUPA 5D9VA 2LUSA 4MLYA 1GSQA 3IK7A 1WJKA 4HJ2A 2H6ZA 5D73A 3SBCA 2MMAA 3CBUA 2H0HA 3GX8A 5CRDA 1PKWA 1CQHA 1AUCA 1R5PA 1F3AA 3N9JA 1A8LA 2VCQA 1LJRA 4NHWA 2R0PA 4GSNA 2A4VA 3LG6A 2VCZA 3MAKA 2HRAA 1DSBA 3HJPA 4DSSA 9GSSA 3FK8A 4NAXA 2LQOA 1ZGNA 1M2BA 2IFQA 4OO4A 1BG5A 5DALB 1V57A 2LRTA 4MJCA 2LS5A 1AC1A 4EIPA 2CX4A 1FOHA 4AKXB 1O85A 4I8BA 4O5UA 2WJUA 3NZNA 1X5EA 3KXOA 3UIWA 4MDCA 2YJHA 2K8SA 4F03A 3UJ1A 5CRGA 2I9HA 1ERWA 1OC8A 1VRSD 4IGJA 1YVLA 2XBQA 1S3AA 4ISDA 5J9BA 5EVOA 1QFNA 5B8AA 1B4QA 4GWRA 2IMKA 3KGKA 4L8EA 2QKEA 2C1YA 2L57A 5HFIA 3LWAA 3GL3A 2OACA 2KHPA 2PVOC 2L59A 4XTSA 2HRNA 3EU4A 2L6CA 1DE1A 3F6FA 2DJ0A 3C7MA 1AQVA 3HHVA 2B5XA 1GH2A 2HNLA 5A4UA 3IXRA 13GSA 1PA3A 2YV9A 1XBSA 3ZFBA 2HZEB 3EMPA 4AF2A 1A24A 1PKZA 4IBPA 4K7IA 3O6TA 1OVNA 2VL3A 2GSRA 1FB6A 1J9BA 2DJKA 1MDIA 2XHFA 4K2XA 1K0DA 4E8HA 3LFLA 1UVZA 2EIOA 2H75A 1JLVA 1J0FA 3UARA 1G0TA 3CSIA 4GQFA 4PNFA 3IDVA 4DVCA 1BEDA 1EV9A 1ACVA 1F3BA 4TXOB 3TUEA 4MF5A 2HYXA 1Z7PA 4TVEA 5G31A 3IAS2 1ST9A 2G0FA 1ZMAA 3P90A 2R3XA 4BVXA 2I4AA 1TP9A 2H01A 3QPMA 5DAKA 3F63A 1N8JA 1RK4A 2YP6A 1T3BA 1EV4A 3VPQA 2RLIA 2QA2A 5J9CA 3QR6A 3HXSA 4LMVA 6GSTA 4TXVA 3LORA 2VLVA 3TOTA 4AKGA 4BWQA 2B6MA 3GH9A 5AGYA 2HZFA 3KP8A 2IFQB 1AW9A 4L0WA 4QMKA 2JACA 1HNAA 6GSVA 2M80A 4PURA 3ZTLA 3LXTA 4MZCA 2YNXA 2HQTA 5F0GA 1THOA 1XVWA 2KOKA 4RQRA 3L4NA 2C0DA 2CVKA 3ZITA 3IR4A 5ID2B 4EDYA 1LBKA 1GNWA 5A5HA 2O85A 1VF3A 3M9JA 2XPDA 1R5AA 5ECPB 2N5BA 1QQ2A 5D9XA 4HEA2 2KLXA 3TJFA 3L9UA 3R2QA 3Q18A 2GSQA 2H1DA 4LA1A 4RUVA 1FHEA 5IMFA 1SKRB 1GSDA 2KUCA 4EKZA 1PMTA 2H1BA 4CY6A 1GWCA 2VM2A 6GSUA 1UN2A 3PPUA 1XWKA 4CW9A 5DQYA 2VKZG 2B1LA 4NHZA 3LJRA 3CRUA 4IKHA 3TCOA 1SVOA 1THXA 4HQSA 5ECIB 1N2AA 3TGZA 3D5JA 4YQUA 2FA8A 4IHUA 4JE1A 3H8QA 1OE7A 1K0OA 1ZYNA 4MCUA 3ZZXA 2IIYA 4RI6A 1SK2A 2JU5A 4YQVA 3FYGA 1Z9HA 8GSSA 2YZUA 5IOXA 2R4VA 2HRFA 2OADA 3F3QA 2V6KA 3D6IA 5CAXA 1XVQA 4YKGA 4N10A 4MJEA 12GSA 4NMUA 3H79A 4JR6A 3TKSA 3ZVJA 3BBYA 5EL8A 2FY6A 4KB3A 1AAZA 2O7KA 1X9SB 3WGXA 3W8SA 3ZMKA 1TRVA 2H1LA 2P5RA 3DEXA 1M9AA 1E6BA 4KW6A 4ICYA 4BPYA 4BL7B 1F6MC 1O73A 2CVDA 1SVLA 4TR1A 3ZRDA 1O8XA 1SK1A 3ZYWA 4YKFA 1GLPA 5DJMA 5ECSA 1TJDA 2MYGA 5CRHA 2FNOA 2K8VA 3Q74A 3HZ4A 3HCZA 1Y25A 1BQ7A 3IV4A 4GCIA 1XPVA 5AIXA 4MZWA 2XC2A 3GL5A 1YKAA 1K3OA 1YF0A 2LJKA 2R6KA 5A5HB 5LNKe 1SD9A 3FR6A 2N5AA 4NWYA 3D4MA 1FB0A 2LNTA 2VM1A 3QD9A 5IO0A 2PUKC 3UEMA 5J47A 5LCZA 11GSA 2J23A 1MDKA 1TDIA 4ECJA 3KTBA 4WETA 2YV7A 1JHBA 1GLQA 1ZCPA 2WS2A 4ZB7A 1BYEA 5IO2A 2OBIA 1G7OA 4F0CA 4KNDA 5A1NA 3I6AA 3VLNA 5A34A 3EVIA 1GTIA 3ZMLA 3IAM2 4MABA 5G1KA 1ERTA 2C80A 1SJ6A 2CVBA 1B9XC 1PL1A 3P7XA 2VLUA 2LKUA 2H0IA 1A23A 1GUHA 2YJ7A 2HE3A 2GQMA 4K6XA 1Z5YE 1FVJA 1TRWA 4O5QA 2E2GA 2FLSA 1QGVA 2X49A 4QQ7A 3DVXA 3H4KA 4G01A 3H93A 1WWJA 3F6DA 4G10A 3WD6A 5DQSA 4K7OA 4WKWA 5D96A 4Z2RA 2KP1A 3CSJA 5D9WA 1JLWA 1UC7A 1KNGA 3D22A 3TKRA 2QSIA 1G7EA 3SWLA 4MF6A 1F37A 3HVSA 3GMFA 3C73A 3GN3A 2H71A 5J3RA 5KOXA 1B4PA 3BJ5A 5DJLA 3A3TA 3CXGA 1H4OA 5BRTA 3FHKA 5HFKA 4EC0A 2HSMB 4G0LA 3S9FA 2H76A 5LD0A 2PMTA 3HYPA 2H19A 2V2GA 1M99A 2VO4A 4AJ6A 2JZTA 3GUSA 3ZL5A 22GSA 2AYTA 3Q19A 1VGLA 2H30A 3DWVA 1SU9A 1ZYPA 1SKWB 3A5IA 4PGTA 2FWGA 2ZNMA 4I2UA 5HR2A 1OC9A 4K8MA 3FZ9A 2AAWA 4KSOA 4V1Ag 2DMMA 1BAYA 2HSYA 3GKMA 2LRNA 1AIUA 5IMAA 5KN0A 3IC4A 5L71A 3L78A 1GTBA 2C8UA 1AXDA 2GQKA 4G2EA 1X5DA 3W6GA 4PNGA 5AIVA 2M46A 4N3ZA 2YCDA 1DE2A 5CREA 4KA0A 1GTUA 1C72A 4GRFA 3GSTA 4GTUA 4NV2A 3KIJA 2GSTA 2CQ9A 2IPAA 4KF9A 2H8LA 5A34B 3L9VA 1GUMA 4YQMA 2YN1A 3LXZA 2HSNB 5ECMB 5FHIA 2B1KA 5GSTA 5J4VA 2CAQA 1FVKA 4TRXA 4MF7A 2C3QA 4F0BA 4HJMA 5G5FA 1HNCA 1V58A 5HR0A 2IWTA 3GKNA 2NTOA 3RDWA 4EL1A 4ZB8A 5H5RA 1SL0B 2PN8A 5E59A 3J7Yk 2WZ9A 3P2AA 1GRXA 2PERA 3MNGA 3E0UA 3LYKA 2FA4A 4N11A 2YWMA 2PVQA 3M8NA 2BTOT 1FOVA 3UL3A 5ENUA 2HI7A 3GH6A 2MZCA 3TKSE 3KTLA 1GP1A 1Y6EA 2IMIA 4ZB6A 4XS6A 2ON5A 3QFAC 4QL9A 4YAVA 1X9WB 3NIVA 3G7IA 5BMUA 3L9SA 1EOHA 3US3A 3PGTA 2L4CA 4OCEA 1K3LA 3VWUA 2MBTA 4GSTA 5ABRA 3RPPA 1FAAA 3ME7A 2YWIA 3LSZA 2V41A 2PU9C 1E2YA 4AGSA 3KJYA 1V9WA 1NM3A 4WR4A 5ECQB 1XIYA 4I5QA 5G30A 4NV5A 1ZYEA 4CHSA 6GSSA 2LV3A 4IN0A 2VD1A 3ZREA 2WULA 3CYNA 3RBTA 5COHA 4HOJA 3DKSA 5G2ZA 1MD3A 4A5PA 1ABAA 6GSYA 3BD2A 1M7TA 1TXXA 3CTGA 5HFGA 4XS1A 2HSHA 2UZ8A 3GX0A 5C04A 1SK0A 4V2LA 3EU3A 2WFCA 4E68A 4XS4A 3CTFA 5ECLB 3C1RA 4MH2A 1SYXA 3I69A 1ERUA 4EE0A 2RUEA 1K0AA 1A2JA 2H6YA 1S3CA 5D93A 4WR5A 4MPGA 2TRXA 3GV1A 4EIQA 4X0XA 3FW2A 1K0MA 5JWRB 2J9HA 4BWSA 5G5EA 1EEJA 4HZ4A 4G19A 3BCKA 1YKCA 4PUFC 1GSSA 5JWQB 6GSWA 3FRCA 3D0ZA 4I2TA 4GF0A 3F3RA 2H70A 4JZQA 2VL9A 4DSSB 2P31A 4JBBA 1HQOA 5CNWA 3TDGA 4HU7A 1Y1UA 1SKSB 1U87A 4O32A 1WIKA 3KMNA 5J40A 2H1AA 2H73A 3IPZA 3LW9A 4PUAA 2HFDA 4K2DA 3ED3A 1W4VA 4EDZA 3NOFA 2DJJA 1OKTA 2I3YA 4IP6A 5J4UA 2NBSA 3ZVJD 5KN1A 2FHEA 3QDNA 1XFLA 2FD3A 2R5GA 3DD3A 3VPTA 4USSA 1SD8A 5KOWA 4IVFA 4OD7A 4ZL8A 3UBKA 4FYBA 2HRKA 3FZAA 4K0GA 3FR9A 2GVPA 4OFTA 3Q6OA 4G9HA 3DVWA 2I81A 4E8EA 3HKRA 5ECOB 5CP1A 4POMA 3RAZA 1AQWA 1VF4A 4MH3A 3G9BA 4TOPA 5E4WA 4O92A 4MMMA 5A4WA 1QK8A 4PQHA 2V32A 4G0KA 3A2XA 18GSA 2LNSA 1UA5A 5ECRB 1H75A 2OA7A 4HI7A 4BVYA 2RUFA 4AKHA 4D73A 2DIYA 2I1UA 2OJLA 1TI3A 3VFIA 4HUAA 5B8BA 4KCAA 4ACSA 4XS4B 2DKHA 3G7YA 1A2MA 4G0IA 2GT5A 3F4TA 1YEXA 1TK0B 1TTZA 2GLRA 4WBJA 4KGIA 4F2IA 3OR5A 2WCIA 1XWCA 2GDRA 4BVXB 4LL4B 3O3TA 5DDLA 2TRCP 2YWOA 5DAKB 4O7HA 5D8IA 2DMLA 4ZBDA 3WGDA 1ML6A 5GAND 4ILFA 2VD0A 2KP2A 2QA1A 1N25A 4X1UA 3N5OA 5HR3A 1RQMA 3KMOA 4MA9A 1SVMA 5J5NA 3UVHA 1V2AA 5J4YA 1FG4A 3KM6A 2H72A 1USBA 1PD21 2AJQB 3I43A 1G6WA 4POBA 3TRXA 1ZOFA 1SL2B 19GSA 1QMVA 5AN1A 2CZ2A 2K18A 2L4QA 2FGXA 4KSMA 4EF0A 3FR3A 3ZIJA 4DSRA 3VK9A 3QOUA 4OFMA 3UBLA 2PWJA 1WE0A 4KX4A 2H1GA 4PQIA 1O81A 1T4YA 4KDYA 3EURA 5INYA 4ZL9A 5B6NA 3F9UA 4PX1A 3UAPA 2AV4A 1KTEA 2PBJA 3APSA 3KCMA 3KD0A 2C0GA 4ML1A 3VURA 2JSZA 1SENA 2MMOA 3F4SA 1EOGA 4L5LA 1U88A 1SJIA 2F3MA 5EY6A 2VL2A 1TU8A 2LEGA 4PXOA 3EC3A 3GHAA 4WF5A 2RM6A 2VCXA 1GSFA 3CMIA 3APQA 1BG1A 2X99A 3HY2A 3M0FA 3WT2A 2YOIA 10GSA 1ERVA 4IJIA 2H6XA 5FWGA 4Q5FA 3VWXA 3IE3A 1PX7A 2P5QA 3WGEA 2YPMA 4D73B 1X5CA 1EWXA 3DXBA 5D9TA 2DC5A 1GSEA 2GZZA 3TKSC 2L5LA 2K6VA 5ELAA 3EE2A 2TIRA 5F07A 4FO5A 1F2EA 2Z9SA 2DJ3A 4BA7A 1MTCA 1YZXA 1TKDB 2GSSA 2OE0A 3UOMA 1HYUA 1X0RA 2WB9A 2DJ1A 4XIHA 2JSYA 3U5RE 1FO5A 1S3DA 3P8WA 5KN2A 3M9KA 2REMA 1JZWA 5HR1A 4J56E 5IM9A 3RHBA 1K0BA 2GGTA 3IK9A 1GSYA 3HMJG 3GRXA 1B8XA 1T4ZA 4TR1B 3QAGA 2UV8G 4V2NA 3TJGA 4XCSA 1HNBA 4YAPA 1MD4A 3VWVA 1EP8A 3TU3B 3M1GA 4ZBBA 2EIRA 4K0NA 3F4RA 1U6TA 4AI6A 3D21A 4H86A 3GSSA 3MDKA 3GKKA 2EFDA 3TKPA 4Q5RA 4DSQA 5H5SA 1B9YC 4POLA 4NXIA 4AJ7A 1VF2A 4IQAA 4ZIJA 4FYCA 3HZ8A 1X9MB 1TOFA 3EPTA 1Z7RA 2A2RA 2OT3A 4OO5A 3AY8A 2VCTA 4FIWA 2R37A 2CT6A 4TR4A 5ELGA 3LEFA 4TW5A 4LMWA 2CA8A 2GTUA 1PRXA 2X4AA 1QXHA 2ZUPA 3HVVA 1MDJA 4WEYA 3ZFLA 5A1NB 4F9ZA 2E0QA 2YANA 4WBRD 3FKFA 5IIZA 3ZIVA 4L0UA 3HJOA 2DSAA 5ECNB 2FWEA 3DRNA 3VI7A 3TJBA 3M3MA 4I6XA 1XOBA 4EUYA 2GS3A 3MIXA 1XWBA 4JU5A 4Z7XA 4V1Ap 1TK8B 3C71A 2ON7A 4J2FA 2RM5A 3EMXA 4TXOA 5JWOB 2EC4A 4K7NA 5IMZA 2OKAA 2O87A 2LRCA 1BF5A 5FT3A 4AJ8A 5DBQA 4GDFA 3GFKA 2G2QA 4Z2UA 1ILOA 4EO3A 2A4HA 4KCEA 1GL8A 2L5OA 4ZBAA 2B5YA 3D4TA 1PX6A 2AUVA 2R2JA 1OAZA 3EINA 2B3SA 2B7JA 1CQGA 1A0FA 4GXZA 2F8FA 3CSHA 4ECIA 5IPGA 4QL7A 3HD5A 3H1NA 2EIQA 2LJRA 3TRQA 3IBHA 2WDUA 1QUWA 2OE3A 4NPBA 2PPTA 3IHGA 5ID2A 2X64A 3WYWA 4HZ2A 4OCFA 4ULXA 1ZZYA 1JZRA 4IJ3A 2CV4A 2FCHA 3EYTA 2BJXA 4IW9A 1NHOA 1XWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSZ A;  3BOA A;  1OC9 B;  3R3E A;  4TKY A;  3IC8 A;  2F51 A;  1EZK A;  2CX3 A;  5IMC A;  4K1F A;  1Z6N A;  3W8J A;  1O8W A;  1V98 A;  3QMX A;  2XPE A;  3QFB C;  1NSW A;  1URM A;  2X8G A;  1BX9 A;  3F0I A;  3E9J B;  14GS A;  5IQY A;  2H0G A;  1SYR A;  4RI7 A;  1M2D A;  1TW9 A;  4MZB A;  2XBI A;  1XCC A;  5G1L A;  3ISO A;  2GT6 A;  1FW1 A;  2HT9 A;  2GZY A;  1KBN A;  2VCW A;  4MPF A;  2IME A;  1TU7 A;  1YDK A;  2VCV A;  4DEJ A;  17GS A;  3HVX A;  3UMA A;  1HD2 A;  4KUN A;  1XZO A;  2JZR A;  1SL1 B;  20GS A;  2JZS A;  1YQ1 A;  2HLS A;  5DCG A;  3F8U A;  3ZLP A;  5F05 A;  2FUG 2;  1GUL A;  3GKX A;  4J57 E;  5JCG A;  2C3N A;  6GSX A;  4V2M A;  3ERG A;  2LTK A;  2C3T A;  3KP9 A;  3VI5 A;  4IS0 A;  4OFN A;  3HA9 A;  4HS1 A;  1F9M A;  2IL3 A;  3RHC A;  5KEJ A;  4BL7 A;  4FH8 A;  4HQZ A;  3TJK A;  1M2A A;  1G6Y A;  1IYI A;  1NW2 A;  1PSQ A;  4KDU A;  1XXU A;  4PQ1 A;  2CAI A;  2ALB A;  4F82 A;  1GUK A;  1T8E B;  4IEL A;  2NDO A;  2FWF A;  2B5E A;  2JL4 A;  2H74 A;  2IMD A;  1J08 A;  2L6D A;  3GNJ A;  4POK A;  4ECC A;  3DGQ A;  5C00 A;  3FY7 A;  1V40 A;  3C8E A;  4GQC A;  3FZ4 A;  3HJM A;  3VWW A;  5JCU A;  1T00 A;  3G7J A;  3ERF A;  5ECH B;  1A8Y A;  16GS A;  4ML6 A;  4CDO A;  2V1M A;  5KN3 A;  4EXJ A;  3MWH A;  4MK3 A;  2O8V B;  2ES7 A;  2A2S A;  3HDC A;  2NVL A;  4X43 A;  1W89 A;  1A2L A;  3JCM L;  2AHE A;  4RQX A;  3TJJ A;  4Q5N A;  2D2Z A;  2VOC A;  3A2W A;  4O5R A;  3RPN A;  3QCP A;  1XW9 A;  1EGO A;  1XW6 A;  4PTS A;  2F8A A;  3KH7 A;  4TR3 A;  4OWY A;  2QGV A;  4WXT A;  1O6J A;  3BCI A;  7GSS A;  1O7U A;  1ON4 A;  1SJZ A;  4ID0 A;  2YZH A;  3GIX A;  4OMV A;  3LGC A;  5GSS A;  2QC7 A;  4IP1 A;  5AIS A;  2P0G A;  4GLT A;  4MJA A;  1EP7 A;  3U6V A;  3KH9 A;  4L5O A;  2GZP A;  2X8C A;  3GYK A;  2NPB A;  3DYR A;  2LQQ A;  1BJX A;  1RW1 A;  4KDX A;  5B7C A;  4N0Z A;  3PH9 A;  2MBS A;  3L0H A;  2GQL A;  2C4J A;  4ZXG A;  1DBY A;  4LLR A;  4XRD A;  2HXK A;  4GSS A;  1XOA A;  5A4V A;  1YJ6 A;  3PR8 A;  4JED A;  2LJA A;  5J41 A;  2K9F A;  2M72 A;  3DIE A;  1ZL9 A;  3GUR A;  2DIZ A;  2HSM A;  3O76 A;  1PGT A;  4ZIL A;  3EWL A;  4XHM A;  1GNE A;  3CRT A;  1TRS A;  4HU9 A;  2F9S A;  3APO A;  3GTU A;  3ME8 A;  4FQU A;  4ZB9 A;  1OKD A;  2E7P A;  4XRA A;  2MMN A;  1VF1 A;  5H5Q A;  1WMJ A;  1WPI A;  2O89 A;  4WF4 A;  4FYU A;  2V6O A;  1U3I A;  3IA1 A;  5B6M A;  2HRK B;  3DML A;  4K9Z A;  2H66 A;  1U3A A;  5GZZ B;  3K8N A;  1GSU A;  1R26 A;  1Z6M A;  1TRU A;  2BMX A;  1Z3E A;  5HQP A;  4JR4 A;  4MP4 A;  5A5K A;  1I9D A;  5CRW A;  1PL2 A;  3C1S A;  1A0R P;  4TN8 A;  4TR0 A;  2DLX A;  1XWG A;  3WT1 A;  3TRP A;  1Q4J A;  2WGR A;  4YH2 A;  4BVY B;  1Q98 A;  1R4W A;  1OC3 A;  1ZYQ B;  5IPH A;  1LU4 A;  2VAF A;  2MMZ A;  2PGT A;  1WOU A;  3FZ5 A;  4EVM A;  1YY7 A;  4ECB A;  5IMV A;  3IHQ A;  5EPF A;  2VIM A;  4ZL7 A;  3ERW A;  1EEM A;  1R7H A;  1M0U A;  2X8H A;  1MEK A;  2C0E A;  2IN3 A;  3V1W A;  1T7P B;  1KEB A;  2VLT A;  5IMD A;  1B48 A;  1AQX A;  5CO3 A;  3A2V A;  5DAL A;  1DUG A;  2LST A;  3LQ7 A;  5DCH A;  5JCW A;  5DVB A;  4KAE A;  4Q5Q A;  2JAD A;  2B7K A;  1JZD A;  2FWH A;  2IJY A;  2WRT A;  4LL1 B;  1XW5 A;  1M9B A;  1EGR A;  3GA4 A;  1WRY A;  2OBK A;  1JZO A;  2E2M A;  2DBC A;  1PQN A;  1IYH A;  1YF1 A;  2YWN A;  1K0N A;  1T1V A;  2VL2 C;  1YEP A;  2OE1 A;  3IOS A;  3TOU A;  1OE8 A;  1OYJ A;  3UVT A;  2CZ3 A;  1JFU A;  3GTU B;  4IQ1 A;  2DJ2 A;  1NHY A;  1PN9 A;  4MJB A;  3J7Y b;  3QAW A;  5IOW A;  3QAV A;  1I5G A;  5CYY A;  4HDE A;  4I97 A;  2AB6 A;  2HZE A;  3LYP A;  5ECK B;  3KEB A;  2N5F A;  3A5W A;  3IRA A;  3KZQ A;  3TB2 A;  3I9V 2;  5F06 A;  4N30 A;  4P3Y B;  2ZCT A;  4KE3 A;  2IMF A;  4JRR A;  4N0V A;  1K0C A;  4KH7 A;  2C0F A;  1GTA A;  5GAP D;  3TKQ A;  2RII A;  3FEU A;  3PIN A;  3E3E A;  5F8B A;  1K3Y A;  1TK5 B;  1TI1 A;  1WP0 A;  2VUP A;  5D9V A;  2LUS A;  4MLY A;  1GSQ A;  3IK7 A;  1WJK A;  4HJ2 A;  2H6Z A;  5D73 A;  3SBC A;  2MMA A;  3CBU A;  2H0H A;  3GX8 A;  5CRD A;  1PKW A;  1CQH A;  1AUC A;  1R5P A;  1F3A A;  3N9J A;  1A8L A;  2VCQ A;  1LJR A;  4NHW A;  4GSN A;  2A4V A;  3LG6 A;  2VCZ A;  3MAK A;  2HRA A;  1DSB A;  3HJP A;  4DSS A;  9GSS A;  3FK8 A;  4NAX A;  2LQO A;  1ZGN A;  1M2B A;  2IFQ A;  4OO4 A;  1BG5 A;  5DAL B;  1V57 A;  2LRT A;  4MJC A;  2LS5 A;  1AC1 A;  2CX4 A;  1O85 A;  4I8B A;  2WJU A;  3NZN A;  1X5E A;  3KXO A;  3UIW A;  4MDC A;  2YJH A;  2K8S A;  4F03 A;  3UJ1 A;  5CRG A;  2I9H A;  1ERW A;  1OC8 A;  1VRS D;  4IGJ A;  2XBQ A;  1S3A A;  4ISD A;  5J9B A;  5EVO A;  1QFN A;  5B8A A;  1B4Q A;  4GWR A;  2IMK A;  3KGK A;  4L8E A;  2QKE A;  2C1Y A;  2L57 A;  5HFI A;  3LWA A;  3GL3 A;  2OAC A;  2KHP A;  2PVO C;  2L59 A;  4XTS A;  2HRN A;  3EU4 A;  2L6C A;  1DE1 A;  3F6F A;  2DJ0 A;  3C7M A;  1AQV A;  3HHV A;  2B5X A;  1GH2 A;  2HNL A;  5A4U A;  3IXR A;  13GS A;  1PA3 A;  2YV9 A;  1XBS A;  3ZFB A;  2HZE B;  3EMP A;  4AF2 A;  1A24 A;  1PKZ A;  4IBP A;  4K7I A;  3O6T A;  1OVN A;  2VL3 A;  2GSR A;  1FB6 A;  1J9B A;  2DJK A;  1MDI A;  2XHF A;  1K0D A;  4E8H A;  3LFL A;  1UVZ A;  2EIO A;  2H75 A;  1JLV A;  1J0F A;  3UAR A;  1G0T A;  3CSI A;  4GQF A;  4PNF A;  3IDV A;  4DVC A;  1BED A;  1EV9 A;  1ACV A;  1F3B A;  4TXO B;  3TUE A;  4MF5 A;  2HYX A;  1Z7P A;  4TVE A;  5G31 A;  3IAS 2;  1ST9 A;  2G0F A;  1ZMA A;  3P90 A;  2R3X A;  4BVX A;  2I4A A;  1TP9 A;  2H01 A;  3QPM A;  5DAK A;  3F63 A;  1N8J A;  1RK4 A;  2YP6 A;  1T3B A;  1EV4 A;  3VPQ A;  2RLI A;  5J9C A;  3QR6 A;  3HXS A;  4LMV A;  6GST A;  4TXV A;  3LOR A;  2VLV A;  3TOT A;  4BWQ A;  2B6M A;  3GH9 A;  5AGY A;  2HZF A;  3KP8 A;  2IFQ B;  1AW9 A;  4L0W A;  2JAC A;  1HNA A;  6GSV A;  2M80 A;  4PUR A;  3ZTL A;  3LXT A;  4MZC A;  2YNX A;  2HQT A;  5F0G A;  1THO A;  1XVW A;  2KOK A;  4RQR A;  3L4N A;  2C0D A;  2CVK A;  3ZIT A;  3IR4 A;  5ID2 B;  4EDY A;  1LBK A;  1GNW A;  2O85 A;  1VF3 A;  3M9J A;  2XPD A;  1R5A A;  5ECP B;  2N5B A;  1QQ2 A;  5D9X A;  4HEA 2;  2KLX A;  3TJF A;  3L9U A;  3R2Q A;  3Q18 A;  2GSQ A;  2H1D A;  4LA1 A;  4RUV A;  1FHE A;  5IMF A;  1SKR B;  1GSD A;  2KUC A;  4EKZ A;  1PMT A;  2H1B A;  1GWC A;  2VM2 A;  6GSU A;  1UN2 A;  3PPU A;  1XWK A;  4CW9 A;  5DQY A;  2B1L A;  4NHZ A;  3LJR A;  3CRU A;  4IKH A;  3TCO A;  1THX A;  4HQS A;  5ECI B;  1N2A A;  3TGZ A;  3D5J A;  4YQU A;  2FA8 A;  4IHU A;  4JE1 A;  3H8Q A;  1OE7 A;  1K0O A;  4MCU A;  3ZZX A;  2IIY A;  4RI6 A;  1SK2 A;  2JU5 A;  4YQV A;  3FYG A;  1Z9H A;  8GSS A;  2YZU A;  5IOX A;  2R4V A;  2HRF A;  2OAD A;  3F3Q A;  2V6K A;  3D6I A;  5CAX A;  1XVQ A;  4N10 A;  4MJE A;  12GS A;  4NMU A;  3H79 A;  4JR6 A;  3TKS A;  3ZVJ A;  3BBY A;  5EL8 A;  2FY6 A;  4KB3 A;  1AAZ A;  2O7K A;  1X9S B;  3WGX A;  3W8S A;  3ZMK A;  1TRV A;  2P5R A;  3DEX A;  1M9A A;  1E6B A;  4KW6 A;  4BPY A;  4BL7 B;  1F6M C;  1O73 A;  2CVD A;  4TR1 A;  3ZRD A;  1O8X A;  1SK1 A;  3ZYW A;  1GLP A;  5DJM A;  5ECS A;  1TJD A;  2MYG A;  5CRH A;  2FNO A;  2K8V A;  3Q74 A;  3HZ4 A;  3HCZ A;  1Y25 A;  1BQ7 A;  3IV4 A;  4GCI A;  1XPV A;  5AIX A;  4MZW A;  2XC2 A;  3GL5 A;  1YKA A;  1K3O A;  1YF0 A;  2LJK A;  2R6K A;  5LNK e;  1SD9 A;  3FR6 A;  2N5A A;  4NWY A;  3D4M A;  1FB0 A;  2LNT A;  2VM1 A;  3QD9 A;  5IO0 A;  2PUK C;  3UEM A;  5LCZ A;  11GS A;  2J23 A;  1MDK A;  1TDI A;  4ECJ A;  3KTB A;  4WET A;  2YV7 A;  1JHB A;  1GLQ A;  1ZCP A;  2WS2 A;  1BYE A;  5IO2 A;  2OBI A;  1G7O A;  4F0C A;  4KND A;  3I6A A;  3VLN A;  3EVI A;  1GTI A;  3ZML A;  3IAM 2;  4MAB A;  5G1K A;  1ERT A;  2C80 A;  1SJ6 A;  2CVB A;  1B9X C;  1PL1 A;  3P7X A;  2VLU A;  2LKU A;  2H0I A;  1A23 A;  1GUH A;  2YJ7 A;  2HE3 A;  2GQM A;  4K6X A;  1Z5Y E;  1FVJ A;  1TRW A;  2E2G A;  2FLS A;  1QGV A;  4QQ7 A;  3DVX A;  3H4K A;  3H93 A;  1WWJ A;  3F6D A;  4G10 A;  3WD6 A;  5DQS A;  4K7O A;  4WKW A;  5D96 A;  2KP1 A;  3CSJ A;  5D9W A;  1JLW A;  1UC7 A;  1KNG A;  3D22 A;  3TKR A;  2QSI A;  1G7E A;  3SWL A;  4MF6 A;  1F37 A;  3HVS A;  3GMF A;  3C73 A;  3GN3 A;  2H71 A;  5J3R A;  1B4P A;  3BJ5 A;  5DJL A;  3A3T A;  3CXG A;  1H4O A;  3FHK A;  5HFK A;  4EC0 A;  2HSM B;  4G0L A;  3S9F A;  2H76 A;  5LD0 A;  2PMT A;  3HYP A;  2H19 A;  2V2G A;  1M99 A;  2VO4 A;  4AJ6 A;  2JZT A;  3GUS A;  3ZL5 A;  22GS A;  2AYT A;  3Q19 A;  1VGL A;  2H30 A;  3DWV A;  1SU9 A;  1SKW B;  4I2U A;  4PGT A;  2FWG A;  2ZNM A;  5HR2 A;  1OC9 A;  4K8M A;  3FZ9 A;  2AAW A;  4KSO A;  4V1A g;  2DMM A;  1BAY A;  2HSY A;  3GKM A;  2LRN A;  1AIU A;  5IMA A;  5KN0 A;  3IC4 A;  5L71 A;  3L78 A;  1GTB A;  2C8U A;  1AXD A;  2GQK A;  4G2E A;  1X5D A;  3W6G A;  4PNG A;  5AIV A;  2M46 A;  2YCD A;  1DE2 A;  5CRE A;  4KA0 A;  1GTU A;  1C72 A;  4GRF A;  3GST A;  4GTU A;  4NV2 A;  3KIJ A;  2GST A;  2CQ9 A;  2IPA A;  4KF9 A;  2H8L A;  3L9V A;  1GUM A;  4YQM A;  2YN1 A;  3LXZ A;  2HSN B;  5ECM B;  5FHI A;  2B1K A;  5GST A;  2CAQ A;  1FVK A;  4TRX A;  4MF7 A;  2C3Q A;  4F0B A;  4HJM A;  5G5F A;  1HNC A;  1V58 A;  5HR0 A;  2IWT A;  3GKN A;  2NTO A;  3RDW A;  4EL1 A;  4ZB8 A;  5H5R A;  1SL0 B;  2PN8 A;  5E59 A;  3J7Y k;  2WZ9 A;  3P2A A;  1GRX A;  2PER A;  3MNG A;  3E0U A;  3LYK A;  2FA4 A;  4N11 A;  2YWM A;  2PVQ A;  3M8N A;  2BTO T;  1FOV A;  3UL3 A;  5ENU A;  2HI7 A;  3GH6 A;  2MZC A;  3TKS E;  3KTL A;  1GP1 A;  1Y6E A;  2IMI A;  4ZB6 A;  4XS6 A;  2ON5 A;  3QFA C;  4QL9 A;  4YAV A;  1X9W B;  3NIV A;  3G7I A;  5BMU A;  3L9S A;  1EOH A;  3US3 A;  3PGT A;  2L4C A;  4OCE A;  1K3L A;  3VWU A;  2MBT A;  4GST A;  5ABR A;  3RPP A;  1FAA A;  3ME7 A;  2YWI A;  3LSZ A;  2V41 A;  2PU9 C;  1E2Y A;  4AGS A;  3KJY A;  1V9W A;  1NM3 A;  4WR4 A;  5ECQ B;  1XIY A;  4I5Q A;  5G30 A;  4NV5 A;  1ZYE A;  4CHS A;  6GSS A;  2LV3 A;  4IN0 A;  2VD1 A;  3ZRE A;  2WUL A;  3CYN A;  3RBT A;  5COH A;  4HOJ A;  3DKS A;  5G2Z A;  1MD3 A;  1ABA A;  6GSY A;  3BD2 A;  1M7T A;  1TXX A;  3CTG A;  5HFG A;  4XS1 A;  2HSH A;  2UZ8 A;  3GX0 A;  5C04 A;  1SK0 A;  4V2L A;  3EU3 A;  2WFC A;  4XS4 A;  3CTF A;  5ECL B;  3C1R A;  4MH2 A;  1SYX A;  3I69 A;  1ERU A;  4EE0 A;  2RUE A;  1K0A A;  1A2J A;  2H6Y A;  1S3C A;  5D93 A;  4WR5 A;  4MPG A;  2TRX A;  3GV1 A;  4X0X A;  3FW2 A;  1K0M A;  5JWR B;  2J9H A;  4BWS A;  5G5E A;  1EEJ A;  4HZ4 A;  4G19 A;  3BCK A;  1YKC A;  4PUF C;  1GSS A;  5JWQ B;  6GSW A;  3FRC A;  3D0Z A;  4I2T A;  4GF0 A;  3F3R A;  2H70 A;  4JZQ A;  2VL9 A;  4DSS B;  2P31 A;  4JBB A;  1HQO A;  5CNW A;  3TDG A;  4HU7 A;  1SKS B;  1U87 A;  4O32 A;  1WIK A;  3KMN A;  2H1A A;  2H73 A;  3IPZ A;  4PUA A;  2HFD A;  4K2D A;  3ED3 A;  1W4V A;  4EDZ A;  3NOF A;  2DJJ A;  1OKT A;  2I3Y A;  4IP6 A;  5J4U A;  2NBS A;  3ZVJ D;  5KN1 A;  2FHE A;  3QDN A;  1XFL A;  2FD3 A;  2R5G A;  3DD3 A;  3VPT A;  4USS A;  1SD8 A;  4IVF A;  4OD7 A;  4ZL8 A;  3UBK A;  4FYB A;  2HRK A;  3FZA A;  4K0G A;  3FR9 A;  2GVP A;  4OFT A;  3Q6O A;  4G9H A;  3DVW A;  2I81 A;  4E8E A;  3HKR A;  5ECO B;  5CP1 A;  4POM A;  3RAZ A;  1AQW A;  1VF4 A;  4MH3 A;  3G9B A;  4TOP A;  5E4W A;  4O92 A;  4MMM A;  5A4W A;  1QK8 A;  4PQH A;  2V32 A;  4G0K A;  3A2X A;  18GS A;  2LNS A;  1UA5 A;  5ECR B;  1H75 A;  2OA7 A;  4HI7 A;  4BVY A;  2RUF A;  4D73 A;  2DIY A;  2I1U A;  2OJL A;  1TI3 A;  3VFI A;  4HUA A;  5B8B A;  4KCA A;  4ACS A;  4XS4 B;  3G7Y A;  1A2M A;  4G0I A;  2GT5 A;  3F4T A;  1YEX A;  1TK0 B;  1TTZ A;  2GLR A;  4WBJ A;  4KGI A;  4F2I A;  3OR5 A;  2WCI A;  1XWC A;  2GDR A;  4BVX B;  4LL4 B;  3O3T A;  5DDL A;  2TRC P;  2YWO A;  5DAK B;  4O7H A;  5D8I A;  2DML A;  4ZBD A;  3WGD A;  1ML6 A;  5GAN D;  4ILF A;  2VD0 A;  2KP2 A;  4X1U A;  3N5O A;  5HR3 A;  1RQM A;  3KMO A;  4MA9 A;  5J5N A;  3UVH A;  1V2A A;  1FG4 A;  3KM6 A;  2H72 A;  1USB A;  1PD2 1;  2AJQ B;  3I43 A;  1G6W A;  4POB A;  3TRX A;  1ZOF A;  1SL2 B;  19GS A;  1QMV A;  5AN1 A;  2CZ2 A;  2K18 A;  2L4Q A;  2FGX A;  4KSM A;  4EF0 A;  3FR3 A;  3ZIJ A;  4DSR A;  3VK9 A;  3QOU A;  4OFM A;  3UBL A;  2PWJ A;  1WE0 A;  4KX4 A;  2H1G A;  4PQI A;  1O81 A;  1T4Y A;  4KDY A;  3EUR A;  5INY A;  4ZL9 A;  5B6N A;  3F9U A;  4PX1 A;  3UAP A;  2AV4 A;  1KTE A;  2PBJ A;  3APS A;  3KCM A;  3KD0 A;  2C0G A;  4ML1 A;  3VUR A;  2JSZ A;  1SEN A;  2MMO A;  3F4S A;  1EOG A;  4L5L A;  1U88 A;  1SJI A;  2F3M A;  5EY6 A;  2VL2 A;  1TU8 A;  2LEG A;  4PXO A;  3EC3 A;  3GHA A;  4WF5 A;  2RM6 A;  2VCX A;  1GSF A;  3CMI A;  3APQ A;  2X99 A;  3HY2 A;  3M0F A;  3WT2 A;  2YOI A;  10GS A;  1ERV A;  4IJI A;  2H6X A;  5FWG A;  4Q5F A;  3VWX A;  3IE3 A;  1PX7 A;  2P5Q A;  3WGE A;  2YPM A;  4D73 B;  1X5C A;  1EWX A;  3DXB A;  5D9T A;  2DC5 A;  1GSE A;  2GZZ A;  3TKS C;  2L5L A;  2K6V A;  5ELA A;  3EE2 A;  2TIR A;  5F07 A;  4FO5 A;  1F2E A;  2Z9S A;  2DJ3 A;  4BA7 A;  1MTC A;  1YZX A;  1TKD B;  2GSS A;  2OE0 A;  3UOM A;  1HYU A;  1X0R A;  2WB9 A;  2DJ1 A;  4XIH A;  2JSY A;  3U5R E;  1FO5 A;  1S3D A;  3P8W A;  5KN2 A;  3M9K A;  2REM A;  1JZW A;  5HR1 A;  4J56 E;  5IM9 A;  3RHB A;  1K0B A;  2GGT A;  3IK9 A;  1GSY A;  3GRX A;  1B8X A;  1T4Z A;  4TR1 B;  3QAG A;  4V2N A;  3TJG A;  4XCS A;  1HNB A;  4YAP A;  1MD4 A;  3VWV A;  1EP8 A;  3M1G A;  4ZBB A;  2EIR A;  4K0N A;  3F4R A;  1U6T A;  3D21 A;  4H86 A;  3GSS A;  3MDK A;  3GKK A;  3TKP A;  4Q5R A;  4DSQ A;  5H5S A;  1B9Y C;  4POL A;  4NXI A;  4AJ7 A;  1VF2 A;  4IQA A;  4ZIJ A;  4FYC A;  3HZ8 A;  1X9M B;  1TOF A;  1Z7R A;  2A2R A;  4OO5 A;  3AY8 A;  2VCT A;  4FIW A;  2R37 A;  2CT6 A;  4TR4 A;  5ELG A;  3LEF A;  4TW5 A;  4LMW A;  2CA8 A;  2GTU A;  1PRX A;  1QXH A;  2ZUP A;  3HVV A;  1MDJ A;  4WEY A;  3ZFL A;  4F9Z A;  2E0Q A;  2YAN A;  4WBR D;  3FKF A;  5IIZ A;  3ZIV A;  4L0U A;  3HJO A;  2DSA A;  5ECN B;  2FWE A;  3DRN A;  3VI7 A;  3TJB A;  3M3M A;  4I6X A;  1XOB A;  4EUY A;  2GS3 A;  1XWB A;  4JU5 A;  4Z7X A;  4V1A p;  1TK8 B;  3C71 A;  2ON7 A;  4J2F A;  2RM5 A;  3EMX A;  4TXO A;  5JWO B;  2EC4 A;  4K7N A;  5IMZ A;  2OKA A;  2O87 A;  2LRC A;  5FT3 A;  4AJ8 A;  5DBQ A;  3GFK A;  2G2Q A;  1ILO A;  4EO3 A;  4KCE A;  1GL8 A;  2L5O A;  4ZBA A;  2B5Y A;  3D4T A;  1PX6 A;  2AUV A;  2R2J A;  1OAZ A;  3EIN A;  2B3S A;  2B7J A;  1CQG A;  1A0F A;  4GXZ A;  2F8F A;  3CSH A;  4ECI A;  5IPG A;  4QL7 A;  3HD5 A;  3H1N A;  2EIQ A;  2LJR A;  3TRQ A;  3IBH A;  2WDU A;  1QUW A;  2OE3 A;  4NPB A;  2PPT A;  5ID2 A;  2X64 A;  3WYW A;  4HZ2 A;  4OCF A;  4ULX A;  1ZZY A;  1JZR A;  4IJ3 A;  2CV4 A;  2FCH A;  3EYT A;  2BJX A;  4IW9 A;  1NHO A;  1XWA A; 
#chains in the Genus database with same CATH topology
 3MSZ A;  3BOA A;  1OC9 B;  3R3E A;  4TKY A;  3IC8 A;  2F51 A;  1EZK A;  2CX3 A;  5IMC A;  4K1F A;  1Z6N A;  3W8J A;  1O8W A;  1V98 A;  3QMX A;  2XPE A;  3QFB C;  1NSW A;  1URM A;  2X8G A;  1BX9 A;  3F0I A;  3E9J B;  14GS A;  5IQY A;  2H0G A;  1SYR A;  4RI7 A;  1M2D A;  1TW9 A;  4MZB A;  2XBI A;  1XCC A;  5G1L A;  3HVN A;  3ISO A;  2GT6 A;  1FW1 A;  2HT9 A;  2GZY A;  1KBN A;  2VCW A;  4MPF A;  2IME A;  1TU7 A;  1YDK A;  2VCV A;  4DEJ A;  17GS A;  3HVX A;  3UMA A;  1HD2 A;  4KUN A;  1XZO A;  2JZR A;  1SL1 B;  20GS A;  2JZS A;  1YQ1 A;  2HLS A;  5DCG A;  3F8U A;  3ZLP A;  5F05 A;  2FUG 2;  1GUL A;  3GKX A;  4J57 E;  5JCG A;  2C3N A;  6GSX A;  4V2M A;  4AKI A;  3ERG A;  2LTK A;  2C3T A;  3KP9 A;  3VI5 A;  4IS0 A;  4OFN A;  3HA9 A;  4HS1 A;  1F9M A;  2IL3 A;  3RHC A;  5KEJ A;  4BL7 A;  4FH8 A;  5BMU B;  4HQZ A;  3TJK A;  1M2A A;  1G6Y A;  1IYI A;  1NW2 A;  1PSQ A;  4KDU A;  1XXU A;  4PQ1 A;  2EFE A;  2CAI A;  4W66 A;  2ALB A;  4F82 A;  1GUK A;  1T8E B;  4IEL A;  2A2P A;  2NDO A;  2FWF A;  2B5E A;  2JL4 A;  2H74 A;  2IMD A;  1J08 A;  2L6D A;  4CY8 A;  3GNJ A;  4POK A;  4ECC A;  3DGQ A;  5C00 A;  3MYD A;  3FY7 A;  1V40 A;  3C8E A;  4GQC A;  3FZ4 A;  3HJM A;  3VWW A;  5JCU A;  1T00 A;  3G7J A;  3ERF A;  5ECH B;  4X4J A;  1S3R A;  1A8Y A;  4MNN A;  16GS A;  4ML6 A;  4CDO A;  2V1M A;  5KN3 A;  4EXJ A;  3MWH A;  4MK3 A;  2O8V B;  2ES7 A;  2A2S A;  3HDC A;  2NVL A;  4X43 A;  1W89 A;  1A2L A;  3JCM L;  2AHE A;  4RQX A;  3TJJ A;  4Q5N A;  2D2Z A;  2VOC A;  3A2W A;  4O5R A;  3RPN A;  3QCP A;  1XW9 A;  1EGO A;  1XW6 A;  4PTS A;  2F8A A;  3KH7 A;  4TR3 A;  4OWY A;  2QGV A;  4WXT A;  1O6J A;  3BCI A;  7GSS A;  1O7U A;  1ON4 A;  1SJZ A;  4ID0 A;  2YZH A;  3GIX A;  4OMV A;  2DKI A;  3LGC A;  5GSS A;  2QC7 A;  4IP1 A;  5AIS A;  2P0G A;  4GLT A;  4MJA A;  1EP7 A;  3U6V A;  3FMW A;  4L5O A;  2GZP A;  2X8C A;  3GYK A;  3KH9 A;  2NPB A;  3DYR A;  2LQQ A;  2O5V A;  1BJX A;  1RW1 A;  4KDX A;  5B7C A;  4N0Z A;  3PH9 A;  2MBS A;  3L0H A;  2GQL A;  2C4J A;  4ZXG A;  1DBY A;  1TXU A;  4LLR A;  2HXK A;  4XRD A;  4GSS A;  1XOA A;  5A4V A;  1YJ6 A;  3PR8 A;  4JED A;  2LJA A;  2EFC A;  5J41 A;  2K9F A;  2M72 A;  3DIE A;  1ZL9 A;  3GUR A;  2DIZ A;  2EFH A;  2HSM A;  3O76 A;  1PGT A;  4ZIL A;  3EWL A;  4XHM A;  1GNE A;  3CRT A;  1TRS A;  4HU9 A;  2F9S A;  3APO A;  3GTU A;  3ME8 A;  4FQU A;  4ZB9 A;  1OKD A;  2E7P A;  4XRA A;  2MMN A;  1VF1 A;  5H5Q A;  1WMJ A;  1WPI A;  2O89 A;  4WF4 A;  4FYU A;  2V6O A;  1U3I A;  3IA1 A;  5B6M A;  2HRK B;  3DML A;  4K9Z A;  2H66 A;  1U3A A;  5GZZ B;  3K8N A;  1GSU A;  1R26 A;  1Z6M A;  1TRU A;  2BMX A;  1Z3E A;  5HQP A;  4JR4 A;  4MP4 A;  5A5K A;  1I9D A;  5CRW A;  1PL2 A;  3C1S A;  1A0R P;  4TN8 A;  4TR0 A;  2DLX A;  1XWG A;  3WT1 A;  3TRP A;  1Q4J A;  2WGR A;  4YH2 A;  4BVY B;  1Q98 A;  1R4W A;  1OC3 A;  1ZYQ B;  5IPH A;  1LU4 A;  2VAF A;  2MMZ A;  2PGT A;  1WOU A;  3FZ5 A;  4EVM A;  1YY7 A;  2HSN A;  4ECB A;  5IMV A;  3IHQ A;  5EPF A;  2VIM A;  4ZL7 A;  3ERW A;  4PI0 C;  1EEM A;  1I1I P;  1R7H A;  1M0U A;  2X8H A;  1MEK A;  2C0E A;  2IN3 A;  2R0C A;  3V1W A;  1T7P B;  1KEB A;  2VLT A;  5IMD A;  1B48 A;  1AQX A;  5CO3 A;  3A2V A;  5DAL A;  1DUG A;  2LST A;  3LQ7 A;  1XG8 A;  5DCH A;  5JCW A;  5DVB A;  4KAE A;  4Q5Q A;  2JAD A;  2B7K A;  1JZD A;  2FWH A;  2IJY A;  2WRT A;  4LL1 B;  1XW5 A;  1M9B A;  1EGR A;  3GA4 A;  1WRY A;  2OBK A;  1JZO A;  2E2M A;  2DBC A;  1PQN A;  1IYH A;  1YF1 A;  2YWN A;  1K0N A;  1T1V A;  1PN0 A;  2VL2 C;  2WW3 A;  1YEP A;  2OE1 A;  3IOS A;  3TOU A;  1OE8 A;  1OYJ A;  3UVT A;  2CZ3 A;  1JFU A;  3GTU B;  4IQ1 A;  2DJ2 A;  1NHY A;  2R0G A;  1PN9 A;  4Z2T A;  4MJB A;  3J7Y b;  3QAW A;  5IOW A;  3QAV A;  1I5G A;  5CYY A;  4HDE A;  4I97 A;  2AB6 A;  2HZE A;  3LYP A;  5ECK B;  3KEB A;  2WZS A;  2N5F A;  3A5W A;  3IRA A;  3KZQ A;  3TB2 A;  3I9V 2;  5F06 A;  4N30 A;  3CWG A;  4P3Y B;  2ZCT A;  4KE3 A;  2IMF A;  4JRR A;  4N0V A;  1K0C A;  4KH7 A;  2C0F A;  1GTA A;  5GAP D;  3TKQ A;  4K5S A;  2RII A;  3FEU A;  3PIN A;  3E3E A;  5F8B A;  4K5R A;  1K3Y A;  1TK5 B;  1TI1 A;  1WP0 A;  2VUP A;  5D9V A;  2LUS A;  4MLY A;  1GSQ A;  3IK7 A;  1WJK A;  1M3J A;  2WVY A;  4HJ2 A;  2H6Z A;  5D73 A;  3SBC A;  2MMA A;  3CBU A;  2H0H A;  3GX8 A;  5CRD A;  1PKW A;  1CQH A;  1AUC A;  1R5P A;  1F3A A;  3N9J A;  1A8L A;  2VCQ A;  1LJR A;  4NHW A;  2R0P A;  4GSN A;  2A4V A;  3LG6 A;  2VCZ A;  3MAK A;  2HRA A;  1DSB A;  3HJP A;  4DSS A;  9GSS A;  3FK8 A;  4NAX A;  2LQO A;  1ZGN A;  1M2B A;  2IFQ A;  4OO4 A;  1BG5 A;  5DAL B;  1V57 A;  1M3I A;  2LRT A;  4MJC A;  2LS5 A;  1AC1 A;  4EIP A;  2CX4 A;  1FOH A;  4AKX B;  1O85 A;  4I8B A;  4O5U A;  2WJU A;  3NZN A;  1X5E A;  3KXO A;  3UIW A;  4MDC A;  2YJH A;  2K8S A;  4F03 A;  3UJ1 A;  5CRG A;  2I9H A;  1ERW A;  1OC8 A;  1VRS D;  4IGJ A;  1YVL A;  2XBQ A;  1S3A A;  4ISD A;  5J9B A;  5EVO A;  1QFN A;  5B8A A;  1B4Q A;  4GWR A;  2IMK A;  3KGK A;  4L8E A;  2QKE A;  2C1Y A;  2L57 A;  5HFI A;  3LWA A;  3GL3 A;  2OAC A;  2KHP A;  2PVO C;  2L59 A;  4XTS A;  2HRN A;  3EU4 A;  2L6C A;  1DE1 A;  3F6F A;  2DJ0 A;  3C7M A;  1AQV A;  3HHV A;  2B5X A;  1GH2 A;  2HNL A;  5A4U A;  3IXR A;  13GS A;  1PA3 A;  2YV9 A;  1XBS A;  3ZFB A;  2HZE B;  3EMP A;  4AF2 A;  1A24 A;  2WW2 A;  1PKZ A;  4IBP A;  4K7I A;  3O6T A;  1OVN A;  2VL3 A;  2GSR A;  1FB6 A;  1J9B A;  2DJK A;  1MDI A;  2XHF A;  4K2X A;  1K0D A;  4E8H A;  3LFL A;  1UVZ A;  2EIO A;  2H75 A;  1JLV A;  1J0F A;  3UAR A;  1G0T A;  3CSI A;  4GQF A;  4PNF A;  3IDV A;  4DVC A;  1BED A;  1EV9 A;  1ACV A;  1F3B A;  4TXO B;  3TUE A;  4MF5 A;  2HYX A;  1Z7P A;  4TVE A;  5G31 A;  3IAS 2;  1ST9 A;  2G0F A;  1ZMA A;  3P90 A;  2R3X A;  4BVX A;  2I4A A;  1TP9 A;  2H01 A;  3QPM A;  5DAK A;  3F63 A;  1N8J A;  1RK4 A;  2YP6 A;  1T3B A;  1EV4 A;  3VPQ A;  2RLI A;  2QA2 A;  5J9C A;  3QR6 A;  4BIK A;  3HXS A;  4LMV A;  6GST A;  4TXV A;  3LOR A;  2VLV A;  3TOT A;  4AKG A;  4BWQ A;  2B6M A;  3GH9 A;  5AGY A;  2HZF A;  3KP8 A;  2IFQ B;  1AW9 A;  4L0W A;  4QMK A;  2JAC A;  1HNA A;  6GSV A;  2M80 A;  4PUR A;  3ZTL A;  3LXT A;  4MZC A;  2YNX A;  2HQT A;  5F0G A;  1THO A;  1XVW A;  2KOK A;  4RQR A;  3L4N A;  2C0D A;  2CVK A;  3ZIT A;  3IR4 A;  5ID2 B;  4EDY A;  1LBK A;  1GNW A;  5A5H A;  2O85 A;  1VF3 A;  3M9J A;  2XPD A;  1R5A A;  5ECP B;  2N5B A;  1QQ2 A;  5D9X A;  4HEA 2;  2KLX A;  3TJF A;  3L9U A;  3R2Q A;  3Q18 A;  2GSQ A;  2H1D A;  4LA1 A;  4RUV A;  1FHE A;  5IMF A;  1SKR B;  1GSD A;  2KUC A;  4EKZ A;  1PMT A;  2H1B A;  4CY6 A;  1GWC A;  2VM2 A;  6GSU A;  1UN2 A;  3PPU A;  1XWK A;  4CW9 A;  5DQY A;  2VKZ G;  2B1L A;  4NHZ A;  3LJR A;  3CRU A;  4IKH A;  3TCO A;  1SVO A;  1THX A;  4HQS A;  5ECI B;  1N2A A;  3TGZ A;  3D5J A;  4YQU A;  2FA8 A;  4IHU A;  4JE1 A;  3H8Q A;  1OE7 A;  1K0O A;  1ZYN A;  4MCU A;  3ZZX A;  2IIY A;  4RI6 A;  1SK2 A;  2JU5 A;  4YQV A;  3FYG A;  1Z9H A;  8GSS A;  2YZU A;  5IOX A;  2R4V A;  2HRF A;  2OAD A;  3F3Q A;  2V6K A;  3D6I A;  5CAX A;  1XVQ A;  4YKG A;  4N10 A;  4MJE A;  12GS A;  4NMU A;  3H79 A;  4JR6 A;  3TKS A;  3ZVJ A;  3BBY A;  5EL8 A;  2FY6 A;  4KB3 A;  1AAZ A;  2O7K A;  1X9S B;  3WGX A;  3W8S A;  3ZMK A;  1TRV A;  3RFR C;  2H1L A;  2P5R A;  3DEX A;  1M9A A;  1E6B A;  4KW6 A;  4ICY A;  4BPY A;  4BL7 B;  1F6M C;  1O73 A;  2CVD A;  1SVL A;  4TR1 A;  3ZRD A;  1O8X A;  1SK1 A;  3ZYW A;  4YKF A;  1GLP A;  5DJM A;  5ECS A;  1TJD A;  2MYG A;  5CRH A;  2FNO A;  2K8V A;  3Q74 A;  3HZ4 A;  3HCZ A;  1Y25 A;  1BQ7 A;  3IV4 A;  4GCI A;  1XPV A;  5AIX A;  4MZW A;  2XC2 A;  3GL5 A;  1YKA A;  1K3O A;  1YF0 A;  2LJK A;  2R6K A;  5A5H B;  5LNK e;  1SD9 A;  3FR6 A;  2N5A A;  4NWY A;  3D4M A;  1FB0 A;  2LNT A;  2VM1 A;  3QD9 A;  5IO0 A;  2PUK C;  3UEM A;  5J47 A;  5LCZ A;  11GS A;  2J23 A;  1MDK A;  1TDI A;  4ECJ A;  3KTB A;  4WET A;  2YV7 A;  1JHB A;  1GLQ A;  1ZCP A;  2WS2 A;  4ZB7 A;  1BYE A;  5IO2 A;  2OBI A;  1G7O A;  4F0C A;  4KND A;  5A1N A;  3I6A A;  3VLN A;  5A34 A;  3EVI A;  1GTI A;  3ZML A;  3IAM 2;  4MAB A;  5G1K A;  1ERT A;  2C80 A;  1SJ6 A;  2CVB A;  1B9X C;  1PL1 A;  3P7X A;  2VLU A;  2LKU A;  2H0I A;  1A23 A;  1GUH A;  2YJ7 A;  2HE3 A;  2GQM A;  4K6X A;  1Z5Y E;  1FVJ A;  1TRW A;  4O5Q A;  2E2G A;  2FLS A;  1QGV A;  2X49 A;  4QQ7 A;  3DVX A;  3H4K A;  4G01 A;  3H93 A;  1WWJ A;  3F6D A;  4G10 A;  3WD6 A;  5DQS A;  4K7O A;  4WKW A;  5D96 A;  4Z2R A;  2KP1 A;  3CSJ A;  5D9W A;  1JLW A;  1S4B P;  1UC7 A;  1KNG A;  3D22 A;  3TKR A;  2QSI A;  1G7E A;  3SWL A;  4MF6 A;  1F37 A;  3HVS A;  3GMF A;  3C73 A;  3GN3 A;  2H71 A;  5J3R A;  5KOX A;  1B4P A;  3BJ5 A;  5DJL A;  3A3T A;  3CXG A;  1H4O A;  5BRT A;  3FHK A;  5HFK A;  4EC0 A;  2HSM B;  4G0L A;  3S9F A;  2H76 A;  5LD0 A;  2PMT A;  3HYP A;  2H19 A;  2V2G A;  1M99 A;  2VO4 A;  4AJ6 A;  2JZT A;  3GUS A;  3ZL5 A;  22GS A;  2AYT A;  3Q19 A;  1VGL A;  2H30 A;  3DWV A;  1SU9 A;  1ZYP A;  1SKW B;  3A5I A;  4PGT A;  2FWG A;  2ZNM A;  4I2U A;  5HR2 A;  1OC9 A;  4K8M A;  3FZ9 A;  2AAW A;  4KSO A;  4V1A g;  2DMM A;  1BAY A;  2HSY A;  3GKM A;  2LRN A;  1AIU A;  5IMA A;  5KN0 A;  3IC4 A;  5L71 A;  3L78 A;  1GTB A;  2C8U A;  1AXD A;  2GQK A;  4G2E A;  1X5D A;  3W6G A;  4PNG A;  5AIV A;  2M46 A;  4N3Z A;  2YCD A;  1DE2 A;  5CRE A;  4KA0 A;  1GTU A;  1C72 A;  4GRF A;  2WW1 A;  3GST A;  4GTU A;  4NV2 A;  3KIJ A;  2GST A;  2CQ9 A;  2IPA A;  4KF9 A;  2H8L A;  5A34 B;  3L9V A;  1GUM A;  4YQM A;  2YN1 A;  3LXZ A;  2HSN B;  5ECM B;  5FHI A;  2B1K A;  5GST A;  5J4V A;  2CAQ A;  1FVK A;  4TRX A;  4MF7 A;  2C3Q A;  4F0B A;  4HJM A;  5G5F A;  1HNC A;  1V58 A;  5HR0 A;  2IWT A;  3GKN A;  2NTO A;  3RDW A;  4EL1 A;  4ZB8 A;  5H5R A;  1SL0 B;  2PN8 A;  5E59 A;  2WW0 A;  3J7Y k;  2WZ9 A;  3P2A A;  1GRX A;  2PER A;  3MNG A;  3E0U A;  3LYK A;  2FA4 A;  4N11 A;  2YWM A;  2O3E A;  2PVQ A;  3M8N A;  2BTO T;  1FOV A;  3UL3 A;  5ENU A;  2HI7 A;  3GH6 A;  2MZC A;  3TKS E;  3KTL A;  1GP1 A;  1Y6E A;  2IMI A;  4ZB6 A;  3CQF A;  4XS6 A;  2ON5 A;  3QFA C;  4QL9 A;  4YAV A;  1X9W B;  3NIV A;  3G7I A;  5BMU A;  3L9S A;  1EOH A;  3US3 A;  3PGT A;  2L4C A;  4OCE A;  1K3L A;  3VWU A;  2MBT A;  4GST A;  5ABR A;  3RPP A;  1FAA A;  3ME7 A;  2YWI A;  3LSZ A;  2V41 A;  2PU9 C;  1E2Y A;  4AGS A;  3KJY A;  1V9W A;  1NM3 A;  4WR4 A;  5ECQ B;  1XIY A;  4I5Q A;  5G30 A;  4NV5 A;  1ZYE A;  4CHS A;  6GSS A;  2LV3 A;  4IN0 A;  2VD1 A;  3ZRE A;  2WUL A;  3CYN A;  3RBT A;  5COH A;  1YEW C;  4HOJ A;  3DKS A;  5G2Z A;  1MD3 A;  4A5P A;  1ABA A;  6GSY A;  3BD2 A;  1M7T A;  1TXX A;  3CTG A;  5HFG A;  4XS1 A;  2HSH A;  2UZ8 A;  3GX0 A;  5C04 A;  1SK0 A;  4V2L A;  3EU3 A;  2WFC A;  4E68 A;  4XS4 A;  3CTF A;  5ECL B;  3C1R A;  4MH2 A;  1SYX A;  3I69 A;  1ERU A;  4EE0 A;  2RUE A;  1K0A A;  1A2J A;  2H6Y A;  1S3C A;  5D93 A;  4WR5 A;  4MPG A;  2TRX A;  3GV1 A;  4EIQ A;  4X0X A;  3FW2 A;  1K0M A;  5JWR B;  2J9H A;  4BWS A;  5G5E A;  1EEJ A;  4HZ4 A;  4G19 A;  3BCK A;  1YKC A;  4PUF C;  1GSS A;  5JWQ B;  6GSW A;  3FRC A;  3D0Z A;  4I2T A;  4GF0 A;  3F3R A;  2H70 A;  4JZQ A;  2VL9 A;  4DSS B;  2P31 A;  4JBB A;  1HQO A;  5CNW A;  3TDG A;  4HU7 A;  1Y1U A;  1SKS B;  1U87 A;  4O32 A;  1WIK A;  3KMN A;  5J40 A;  2H1A A;  2H73 A;  3IPZ A;  3LW9 A;  4PUA A;  2HFD A;  4K2D A;  3ED3 A;  1W4V A;  4EDZ A;  3NOF A;  2DJJ A;  1OKT A;  2I3Y A;  4IP6 A;  5J4U A;  2NBS A;  3ZVJ D;  5KN1 A;  2FHE A;  3QDN A;  1XFL A;  2FD3 A;  2R5G A;  3DD3 A;  3VPT A;  4USS A;  1SD8 A;  5KOW A;  4IVF A;  4OD7 A;  4ZL8 A;  3UBK A;  4FYB A;  2HRK A;  3FZA A;  4K0G A;  3FR9 A;  2GVP A;  4OFT A;  3Q6O A;  4G9H A;  3DVW A;  2I81 A;  4E8E A;  3HKR A;  5ECO B;  5CP1 A;  4POM A;  3RAZ A;  1AQW A;  1VF4 A;  4MH3 A;  3G9B A;  4TOP A;  5E4W A;  4O92 A;  4MMM A;  5A4W A;  1QK8 A;  4PQH A;  2V32 A;  4G0K A;  3A2X A;  18GS A;  2LNS A;  1UA5 A;  5ECR B;  1H75 A;  2OA7 A;  4HI7 A;  4BVY A;  2RUF A;  4AKH A;  4D73 A;  2DIY A;  4PI2 C;  2I1U A;  2OJL A;  1TI3 A;  3VFI A;  4HUA A;  5B8B A;  4KCA A;  4ACS A;  4XS4 B;  2DKH A;  3CHX C;  3G7Y A;  2WVX A;  1A2M A;  4G0I A;  2GT5 A;  3F4T A;  1YEX A;  1TK0 B;  1TTZ A;  2GLR A;  4WBJ A;  4KGI A;  4F2I A;  3OR5 A;  2WCI A;  1XWC A;  2GDR A;  4BVX B;  4LL4 B;  3O3T A;  5DDL A;  2TRC P;  2YWO A;  5DAK B;  4O7H A;  5D8I A;  2DML A;  4ZBD A;  3WGD A;  1ML6 A;  5GAN D;  4HSC X;  4ILF A;  2VD0 A;  2KP2 A;  2QA1 A;  1N25 A;  4X1U A;  3N5O A;  5HR3 A;  1RQM A;  3KMO A;  4MA9 A;  1SVM A;  5J5N A;  3UVH A;  1V2A A;  5J4Y A;  1FG4 A;  3KM6 A;  2H72 A;  1USB A;  1PD2 1;  2AJQ B;  3I43 A;  1G6W A;  4POB A;  3TRX A;  1ZOF A;  1SL2 B;  19GS A;  1QMV A;  5AN1 A;  2CZ2 A;  2K18 A;  2L4Q A;  1PFO A;  2FGX A;  4KSM A;  4EF0 A;  3FR3 A;  3ZIJ A;  4DSR A;  3VK9 A;  3QOU A;  4OFM A;  3UBL A;  2PWJ A;  1WE0 A;  4KX4 A;  2H1G A;  4PQI A;  1O81 A;  1T4Y A;  4KDY A;  3EUR A;  5INY A;  4ZL9 A;  5B6N A;  3F9U A;  4PX1 A;  3UAP A;  2AV4 A;  1KTE A;  2PBJ A;  3APS A;  3KCM A;  3KD0 A;  2C0G A;  4ML1 A;  3VUR A;  2JSZ A;  1SEN A;  2MMO A;  3F4S A;  1EOG A;  4L5L A;  1U88 A;  1SJI A;  2F3M A;  5EY6 A;  2VL2 A;  1TU8 A;  2LEG A;  4PXO A;  3EC3 A;  3GHA A;  4WF5 A;  2RM6 A;  2VCX A;  1GSF A;  3CMI A;  3APQ A;  1BG1 A;  2X99 A;  3HY2 A;  3M0F A;  3WT2 A;  2O36 A;  2YOI A;  10GS A;  1ERV A;  4IJI A;  2H6X A;  5FWG A;  4Q5F A;  3VWX A;  3IE3 A;  1PX7 A;  2P5Q A;  3WGE A;  2YPM A;  4D73 B;  1X5C A;  3RGB C;  1EWX A;  3DXB A;  5D9T A;  2DC5 A;  1GSE A;  2GZZ A;  3TKS C;  2L5L A;  2K6V A;  5ELA A;  3EE2 A;  2TIR A;  5F07 A;  4FO5 A;  2WVX B;  1F2E A;  2Z9S A;  2DJ3 A;  4BA7 A;  1MTC A;  1YZX A;  1TKD B;  2GSS A;  2OE0 A;  3UOM A;  4FXY P;  1HYU A;  1X0R A;  2WB9 A;  2DJ1 A;  4XIH A;  2JSY A;  3U5R E;  1FO5 A;  1S3D A;  3P8W A;  5KN2 A;  3M9K A;  2REM A;  1JZW A;  5HR1 A;  4J56 E;  5IM9 A;  3RHB A;  1K0B A;  2GGT A;  3IK9 A;  1GSY A;  3HMJ G;  3GRX A;  1B8X A;  1T4Z A;  4TR1 B;  3QAG A;  2UV8 G;  4V2N A;  3TJG A;  4XCS A;  1HNB A;  4YAP A;  1MD4 A;  3VWV A;  1EP8 A;  3TU3 B;  3M1G A;  4ZBB A;  2EIR A;  4K0N A;  3F4R A;  1U6T A;  4AI6 A;  3D21 A;  4H86 A;  3GSS A;  3MDK A;  3GKK A;  2EFD A;  3TKP A;  4Q5R A;  4DSQ A;  5H5S A;  1B9Y C;  4POL A;  4NXI A;  4AJ7 A;  1VF2 A;  4IQA A;  4ZIJ A;  4FYC A;  3HZ8 A;  1X9M B;  1TOF A;  3EPT A;  1Z7R A;  2A2R A;  2OT3 A;  4OO5 A;  3AY8 A;  2VCT A;  4FIW A;  2R37 A;  2CT6 A;  4TR4 A;  5ELG A;  3LEF A;  4TW5 A;  4LMW A;  2CA8 A;  2GTU A;  1PRX A;  2X4A A;  1QXH A;  2ZUP A;  3HVV A;  1MDJ A;  4WEY A;  3ZFL A;  5A1N B;  4F9Z A;  2E0Q A;  2YAN A;  4WBR D;  3FKF A;  5IIZ A;  3ZIV A;  4L0U A;  3HJO A;  2DSA A;  5ECN B;  2FWE A;  3DRN A;  3VI7 A;  3TJB A;  3M3M A;  4I6X A;  1XOB A;  4EUY A;  2GS3 A;  3MIX A;  1XWB A;  4JU5 A;  4Z7X A;  4V1A p;  1TK8 B;  3C71 A;  2ON7 A;  4J2F A;  2RM5 A;  3EMX A;  4TXO A;  5JWO B;  2EC4 A;  4K7N A;  5IMZ A;  2OKA A;  2O87 A;  2LRC A;  1BF5 A;  5FT3 A;  4AJ8 A;  5DBQ A;  4GDF A;  3GFK A;  2G2Q A;  4Z2U A;  1ILO A;  4EO3 A;  2A4H A;  2WVZ A;  4KCE A;  1GL8 A;  2L5O A;  4ZBA A;  2B5Y A;  3D4T A;  1PX6 A;  2AUV A;  2R2J A;  1OAZ A;  3EIN A;  2B3S A;  2B7J A;  1CQG A;  1A0F A;  4GXZ A;  2F8F A;  3CSH A;  4ECI A;  5IPG A;  4QL7 A;  3HD5 A;  3H1N A;  2EIQ A;  2LJR A;  3TRQ A;  3IBH A;  4PHZ C;  2WDU A;  1QUW A;  2OE3 A;  4NPB A;  2PPT A;  3IHG A;  5ID2 A;  2X64 A;  3WYW A;  4HZ2 A;  4OCF A;  4ULX A;  1ZZY A;  1JZR A;  4IJ3 A;  2CV4 A;  2FCH A;  3EYT A;  2BJX A;  4IW9 A;  1NHO A;  1XWA A; 
#chains in the Genus database with same CATH homology
 3MSZ A;  3BOA A;  1OC9 B;  3R3E A;  4TKY A;  3IC8 A;  2F51 A;  1EZK A;  2CX3 A;  5IMC A;  4K1F A;  1Z6N A;  3W8J A;  1O8W A;  1V98 A;  3QMX A;  2XPE A;  3QFB C;  1NSW A;  1URM A;  2X8G A;  1BX9 A;  3F0I A;  3E9J B;  14GS A;  5IQY A;  2H0G A;  1SYR A;  4RI7 A;  1M2D A;  1TW9 A;  4MZB A;  2XBI A;  1XCC A;  5G1L A;  3ISO A;  2GT6 A;  1FW1 A;  2HT9 A;  2GZY A;  1KBN A;  2VCW A;  4MPF A;  2IME A;  1TU7 A;  1YDK A;  2VCV A;  4DEJ A;  17GS A;  3HVX A;  3UMA A;  1HD2 A;  4KUN A;  1XZO A;  2JZR A;  1SL1 B;  20GS A;  2JZS A;  1YQ1 A;  2HLS A;  5DCG A;  3F8U A;  3ZLP A;  5F05 A;  2FUG 2;  1GUL A;  3GKX A;  4J57 E;  5JCG A;  2C3N A;  6GSX A;  4V2M A;  4AKI A;  3ERG A;  2LTK A;  2C3T A;  3KP9 A;  3VI5 A;  4IS0 A;  4OFN A;  3HA9 A;  4HS1 A;  1F9M A;  2IL3 A;  3RHC A;  5KEJ A;  4BL7 A;  4FH8 A;  5BMU B;  4HQZ A;  3TJK A;  1M2A A;  1G6Y A;  1IYI A;  1NW2 A;  1PSQ A;  4KDU A;  1XXU A;  4PQ1 A;  2EFE A;  2CAI A;  4W66 A;  2ALB A;  4F82 A;  1GUK A;  1T8E B;  4IEL A;  2A2P A;  2NDO A;  2FWF A;  2B5E A;  2JL4 A;  2H74 A;  2IMD A;  1J08 A;  2L6D A;  4CY8 A;  3GNJ A;  4POK A;  4ECC A;  3DGQ A;  5C00 A;  3MYD A;  3FY7 A;  1V40 A;  3C8E A;  4GQC A;  3FZ4 A;  3HJM A;  3VWW A;  5JCU A;  1T00 A;  3G7J A;  3ERF A;  5ECH B;  4X4J A;  1A8Y A;  4MNN A;  16GS A;  4ML6 A;  4CDO A;  2V1M A;  5KN3 A;  4EXJ A;  3MWH A;  4MK3 A;  2O8V B;  2ES7 A;  2A2S A;  3HDC A;  2NVL A;  4X43 A;  1W89 A;  1A2L A;  3JCM L;  2AHE A;  4RQX A;  3TJJ A;  4Q5N A;  2D2Z A;  2VOC A;  3A2W A;  4O5R A;  3RPN A;  3QCP A;  1XW9 A;  1EGO A;  1XW6 A;  4PTS A;  2F8A A;  3KH7 A;  4TR3 A;  4OWY A;  2QGV A;  4WXT A;  1O6J A;  3BCI A;  7GSS A;  1O7U A;  1ON4 A;  1SJZ A;  4ID0 A;  2YZH A;  3GIX A;  4OMV A;  2DKI A;  3LGC A;  5GSS A;  2QC7 A;  4IP1 A;  5AIS A;  2P0G A;  4GLT A;  4MJA A;  1EP7 A;  3U6V A;  3FMW A;  4L5O A;  2GZP A;  2X8C A;  3GYK A;  3KH9 A;  2NPB A;  3DYR A;  2LQQ A;  2O5V A;  1BJX A;  1RW1 A;  4KDX A;  5B7C A;  4N0Z A;  3PH9 A;  2MBS A;  3L0H A;  2GQL A;  2C4J A;  4ZXG A;  1DBY A;  1TXU A;  4LLR A;  2HXK A;  4XRD A;  4GSS A;  1XOA A;  5A4V A;  1YJ6 A;  3PR8 A;  4JED A;  2LJA A;  2EFC A;  5J41 A;  2K9F A;  2M72 A;  3DIE A;  1ZL9 A;  3GUR A;  2DIZ A;  2EFH A;  2HSM A;  3O76 A;  1PGT A;  4ZIL A;  3EWL A;  4XHM A;  1GNE A;  3CRT A;  1TRS A;  4HU9 A;  2F9S A;  3APO A;  3GTU A;  3ME8 A;  4FQU A;  4ZB9 A;  1OKD A;  2E7P A;  4XRA A;  2MMN A;  1VF1 A;  5H5Q A;  1WMJ A;  1WPI A;  2O89 A;  4WF4 A;  4FYU A;  2V6O A;  1U3I A;  3IA1 A;  5B6M A;  2HRK B;  3DML A;  4K9Z A;  2H66 A;  1U3A A;  5GZZ B;  3K8N A;  1GSU A;  1R26 A;  1Z6M A;  1TRU A;  2BMX A;  1Z3E A;  5HQP A;  4JR4 A;  4MP4 A;  5A5K A;  1I9D A;  5CRW A;  1PL2 A;  3C1S A;  1A0R P;  4TN8 A;  4TR0 A;  2DLX A;  1XWG A;  3WT1 A;  3TRP A;  1Q4J A;  2WGR A;  4YH2 A;  4BVY B;  1Q98 A;  1R4W A;  1OC3 A;  1ZYQ B;  5IPH A;  1LU4 A;  2VAF A;  2MMZ A;  2PGT A;  1WOU A;  3FZ5 A;  4EVM A;  1YY7 A;  2HSN A;  4ECB A;  5IMV A;  3IHQ A;  5EPF A;  2VIM A;  4ZL7 A;  3ERW A;  1EEM A;  1R7H A;  1M0U A;  2X8H A;  1MEK A;  2C0E A;  2IN3 A;  2R0C A;  3V1W A;  1T7P B;  1KEB A;  2VLT A;  5IMD A;  1B48 A;  1AQX A;  5CO3 A;  3A2V A;  5DAL A;  1DUG A;  2LST A;  3LQ7 A;  5DCH A;  5JCW A;  5DVB A;  4KAE A;  4Q5Q A;  2JAD A;  2B7K A;  1JZD A;  2FWH A;  2IJY A;  2WRT A;  4LL1 B;  1XW5 A;  1M9B A;  1EGR A;  3GA4 A;  1WRY A;  2OBK A;  1JZO A;  2E2M A;  2DBC A;  1PQN A;  1IYH A;  1YF1 A;  2YWN A;  1K0N A;  1T1V A;  1PN0 A;  2VL2 C;  1YEP A;  2OE1 A;  3IOS A;  3TOU A;  1OE8 A;  1OYJ A;  3UVT A;  2CZ3 A;  1JFU A;  3GTU B;  4IQ1 A;  2DJ2 A;  1NHY A;  2R0G A;  1PN9 A;  4Z2T A;  4MJB A;  3J7Y b;  3QAW A;  5IOW A;  3QAV A;  1I5G A;  5CYY A;  4HDE A;  4I97 A;  2AB6 A;  2HZE A;  3LYP A;  5ECK B;  3KEB A;  2N5F A;  3A5W A;  3IRA A;  3KZQ A;  3TB2 A;  3I9V 2;  5F06 A;  4N30 A;  3CWG A;  4P3Y B;  2ZCT A;  4KE3 A;  2IMF A;  4JRR A;  4N0V A;  1K0C A;  4KH7 A;  2C0F A;  1GTA A;  5GAP D;  3TKQ A;  4K5S A;  2RII A;  3FEU A;  3PIN A;  3E3E A;  5F8B A;  4K5R A;  1K3Y A;  1TK5 B;  1TI1 A;  1WP0 A;  2VUP A;  5D9V A;  2LUS A;  4MLY A;  1GSQ A;  3IK7 A;  1WJK A;  4HJ2 A;  2H6Z A;  5D73 A;  3SBC A;  2MMA A;  3CBU A;  2H0H A;  3GX8 A;  5CRD A;  1PKW A;  1CQH A;  1AUC A;  1R5P A;  1F3A A;  3N9J A;  1A8L A;  2VCQ A;  1LJR A;  4NHW A;  2R0P A;  4GSN A;  2A4V A;  3LG6 A;  2VCZ A;  3MAK A;  2HRA A;  1DSB A;  3HJP A;  4DSS A;  9GSS A;  3FK8 A;  4NAX A;  2LQO A;  1ZGN A;  1M2B A;  2IFQ A;  4OO4 A;  1BG5 A;  5DAL B;  1V57 A;  2LRT A;  4MJC A;  2LS5 A;  1AC1 A;  4EIP A;  2CX4 A;  1FOH A;  4AKX B;  1O85 A;  4I8B A;  4O5U A;  2WJU A;  3NZN A;  1X5E A;  3KXO A;  3UIW A;  4MDC A;  2YJH A;  2K8S A;  4F03 A;  3UJ1 A;  5CRG A;  2I9H A;  1ERW A;  1OC8 A;  1VRS D;  4IGJ A;  1YVL A;  2XBQ A;  1S3A A;  4ISD A;  5J9B A;  5EVO A;  1QFN A;  5B8A A;  1B4Q A;  4GWR A;  2IMK A;  3KGK A;  4L8E A;  2QKE A;  2C1Y A;  2L57 A;  5HFI A;  3LWA A;  3GL3 A;  2OAC A;  2KHP A;  2PVO C;  2L59 A;  4XTS A;  2HRN A;  3EU4 A;  2L6C A;  1DE1 A;  3F6F A;  2DJ0 A;  3C7M A;  1AQV A;  3HHV A;  2B5X A;  1GH2 A;  2HNL A;  5A4U A;  3IXR A;  13GS A;  1PA3 A;  2YV9 A;  1XBS A;  3ZFB A;  2HZE B;  3EMP A;  4AF2 A;  1A24 A;  1PKZ A;  4IBP A;  4K7I A;  3O6T A;  1OVN A;  2VL3 A;  2GSR A;  1FB6 A;  1J9B A;  2DJK A;  1MDI A;  2XHF A;  4K2X A;  1K0D A;  4E8H A;  3LFL A;  1UVZ A;  2EIO A;  2H75 A;  1JLV A;  1J0F A;  3UAR A;  1G0T A;  3CSI A;  4GQF A;  4PNF A;  3IDV A;  4DVC A;  1BED A;  1EV9 A;  1ACV A;  1F3B A;  4TXO B;  3TUE A;  4MF5 A;  2HYX A;  1Z7P A;  4TVE A;  5G31 A;  3IAS 2;  1ST9 A;  2G0F A;  1ZMA A;  3P90 A;  2R3X A;  4BVX A;  2I4A A;  1TP9 A;  2H01 A;  3QPM A;  5DAK A;  3F63 A;  1N8J A;  1RK4 A;  2YP6 A;  1T3B A;  1EV4 A;  3VPQ A;  2RLI A;  2QA2 A;  5J9C A;  3QR6 A;  3HXS A;  4LMV A;  6GST A;  4TXV A;  3LOR A;  2VLV A;  3TOT A;  4AKG A;  4BWQ A;  2B6M A;  3GH9 A;  5AGY A;  2HZF A;  3KP8 A;  2IFQ B;  1AW9 A;  4L0W A;  4QMK A;  2JAC A;  1HNA A;  6GSV A;  2M80 A;  4PUR A;  3ZTL A;  3LXT A;  4MZC A;  2YNX A;  2HQT A;  5F0G A;  1THO A;  1XVW A;  2KOK A;  4RQR A;  3L4N A;  2C0D A;  2CVK A;  3ZIT A;  3IR4 A;  5ID2 B;  4EDY A;  1LBK A;  1GNW A;  5A5H A;  2O85 A;  1VF3 A;  3M9J A;  2XPD A;  1R5A A;  5ECP B;  2N5B A;  1QQ2 A;  5D9X A;  4HEA 2;  2KLX A;  3TJF A;  3L9U A;  3R2Q A;  3Q18 A;  2GSQ A;  2H1D A;  4LA1 A;  4RUV A;  1FHE A;  5IMF A;  1SKR B;  1GSD A;  2KUC A;  4EKZ A;  1PMT A;  2H1B A;  4CY6 A;  1GWC A;  2VM2 A;  6GSU A;  1UN2 A;  3PPU A;  1XWK A;  4CW9 A;  5DQY A;  2VKZ G;  2B1L A;  4NHZ A;  3LJR A;  3CRU A;  4IKH A;  3TCO A;  1SVO A;  1THX A;  4HQS A;  5ECI B;  1N2A A;  3TGZ A;  3D5J A;  4YQU A;  2FA8 A;  4IHU A;  4JE1 A;  3H8Q A;  1OE7 A;  1K0O A;  1ZYN A;  4MCU A;  3ZZX A;  2IIY A;  4RI6 A;  1SK2 A;  2JU5 A;  4YQV A;  3FYG A;  1Z9H A;  8GSS A;  2YZU A;  5IOX A;  2R4V A;  2HRF A;  2OAD A;  3F3Q A;  2V6K A;  3D6I A;  5CAX A;  1XVQ A;  4YKG A;  4N10 A;  4MJE A;  12GS A;  4NMU A;  3H79 A;  4JR6 A;  3TKS A;  3ZVJ A;  3BBY A;  5EL8 A;  2FY6 A;  4KB3 A;  1AAZ A;  2O7K A;  1X9S B;  3WGX A;  3W8S A;  3ZMK A;  1TRV A;  2H1L A;  2P5R A;  3DEX A;  1M9A A;  1E6B A;  4KW6 A;  4ICY A;  4BPY A;  4BL7 B;  1F6M C;  1O73 A;  2CVD A;  1SVL A;  4TR1 A;  3ZRD A;  1O8X A;  1SK1 A;  3ZYW A;  4YKF A;  1GLP A;  5DJM A;  5ECS A;  1TJD A;  2MYG A;  5CRH A;  2FNO A;  2K8V A;  3Q74 A;  3HZ4 A;  3HCZ A;  1Y25 A;  1BQ7 A;  3IV4 A;  4GCI A;  1XPV A;  5AIX A;  4MZW A;  2XC2 A;  3GL5 A;  1YKA A;  1K3O A;  1YF0 A;  2LJK A;  2R6K A;  5A5H B;  5LNK e;  1SD9 A;  3FR6 A;  2N5A A;  4NWY A;  3D4M A;  1FB0 A;  2LNT A;  2VM1 A;  3QD9 A;  5IO0 A;  2PUK C;  3UEM A;  5J47 A;  5LCZ A;  11GS A;  2J23 A;  1MDK A;  1TDI A;  4ECJ A;  3KTB A;  4WET A;  2YV7 A;  1JHB A;  1GLQ A;  1ZCP A;  2WS2 A;  4ZB7 A;  1BYE A;  5IO2 A;  2OBI A;  1G7O A;  4F0C A;  4KND A;  5A1N A;  3I6A A;  3VLN A;  5A34 A;  3EVI A;  1GTI A;  3ZML A;  3IAM 2;  4MAB A;  5G1K A;  1ERT A;  2C80 A;  1SJ6 A;  2CVB A;  1B9X C;  1PL1 A;  3P7X A;  2VLU A;  2LKU A;  2H0I A;  1A23 A;  1GUH A;  2YJ7 A;  2HE3 A;  2GQM A;  4K6X A;  1Z5Y E;  1FVJ A;  1TRW A;  4O5Q A;  2E2G A;  2FLS A;  1QGV A;  2X49 A;  4QQ7 A;  3DVX A;  3H4K A;  4G01 A;  3H93 A;  1WWJ A;  3F6D A;  4G10 A;  3WD6 A;  5DQS A;  4K7O A;  4WKW A;  5D96 A;  4Z2R A;  2KP1 A;  3CSJ A;  5D9W A;  1JLW A;  1UC7 A;  1KNG A;  3D22 A;  3TKR A;  2QSI A;  1G7E A;  3SWL A;  4MF6 A;  1F37 A;  3HVS A;  3GMF A;  3C73 A;  3GN3 A;  2H71 A;  5J3R A;  5KOX A;  1B4P A;  3BJ5 A;  5DJL A;  3A3T A;  3CXG A;  1H4O A;  5BRT A;  3FHK A;  5HFK A;  4EC0 A;  2HSM B;  4G0L A;  3S9F A;  2H76 A;  5LD0 A;  2PMT A;  3HYP A;  2H19 A;  2V2G A;  1M99 A;  2VO4 A;  4AJ6 A;  2JZT A;  3GUS A;  3ZL5 A;  22GS A;  2AYT A;  3Q19 A;  1VGL A;  2H30 A;  3DWV A;  1SU9 A;  1ZYP A;  1SKW B;  3A5I A;  4PGT A;  2FWG A;  2ZNM A;  4I2U A;  5HR2 A;  1OC9 A;  4K8M A;  3FZ9 A;  2AAW A;  4KSO A;  4V1A g;  2DMM A;  1BAY A;  2HSY A;  3GKM A;  2LRN A;  1AIU A;  5IMA A;  5KN0 A;  3IC4 A;  5L71 A;  3L78 A;  1GTB A;  2C8U A;  1AXD A;  2GQK A;  4G2E A;  1X5D A;  3W6G A;  4PNG A;  5AIV A;  2M46 A;  4N3Z A;  2YCD A;  1DE2 A;  5CRE A;  4KA0 A;  1GTU A;  1C72 A;  4GRF A;  3GST A;  4GTU A;  4NV2 A;  3KIJ A;  2GST A;  2CQ9 A;  2IPA A;  4KF9 A;  2H8L A;  5A34 B;  3L9V A;  1GUM A;  4YQM A;  2YN1 A;  3LXZ A;  2HSN B;  5ECM B;  5FHI A;  2B1K A;  5GST A;  5J4V A;  2CAQ A;  1FVK A;  4TRX A;  4MF7 A;  2C3Q A;  4F0B A;  4HJM A;  5G5F A;  1HNC A;  1V58 A;  5HR0 A;  2IWT A;  3GKN A;  2NTO A;  3RDW A;  4EL1 A;  4ZB8 A;  5H5R A;  1SL0 B;  2PN8 A;  5E59 A;  3J7Y k;  2WZ9 A;  3P2A A;  1GRX A;  2PER A;  3MNG A;  3E0U A;  3LYK A;  2FA4 A;  4N11 A;  2YWM A;  2PVQ A;  3M8N A;  2BTO T;  1FOV A;  3UL3 A;  5ENU A;  2HI7 A;  3GH6 A;  2MZC A;  3TKS E;  3KTL A;  1GP1 A;  1Y6E A;  2IMI A;  4ZB6 A;  4XS6 A;  2ON5 A;  3QFA C;  4QL9 A;  4YAV A;  1X9W B;  3NIV A;  3G7I A;  5BMU A;  3L9S A;  1EOH A;  3US3 A;  3PGT A;  2L4C A;  4OCE A;  1K3L A;  3VWU A;  2MBT A;  4GST A;  5ABR A;  3RPP A;  1FAA A;  3ME7 A;  2YWI A;  3LSZ A;  2V41 A;  2PU9 C;  1E2Y A;  4AGS A;  3KJY A;  1V9W A;  1NM3 A;  4WR4 A;  5ECQ B;  1XIY A;  4I5Q A;  5G30 A;  4NV5 A;  1ZYE A;  4CHS A;  6GSS A;  2LV3 A;  4IN0 A;  2VD1 A;  3ZRE A;  2WUL A;  3CYN A;  3RBT A;  5COH A;  4HOJ A;  3DKS A;  5G2Z A;  1MD3 A;  4A5P A;  1ABA A;  6GSY A;  3BD2 A;  1M7T A;  1TXX A;  3CTG A;  5HFG A;  4XS1 A;  2HSH A;  2UZ8 A;  3GX0 A;  5C04 A;  1SK0 A;  4V2L A;  3EU3 A;  2WFC A;  4E68 A;  4XS4 A;  3CTF A;  5ECL B;  3C1R A;  4MH2 A;  1SYX A;  3I69 A;  1ERU A;  4EE0 A;  2RUE A;  1K0A A;  1A2J A;  2H6Y A;  1S3C A;  5D93 A;  4WR5 A;  4MPG A;  2TRX A;  3GV1 A;  4EIQ A;  4X0X A;  3FW2 A;  1K0M A;  5JWR B;  2J9H A;  4BWS A;  5G5E A;  1EEJ A;  4HZ4 A;  4G19 A;  3BCK A;  1YKC A;  4PUF C;  1GSS A;  5JWQ B;  6GSW A;  3FRC A;  3D0Z A;  4I2T A;  4GF0 A;  3F3R A;  2H70 A;  4JZQ A;  2VL9 A;  4DSS B;  2P31 A;  4JBB A;  1HQO A;  5CNW A;  3TDG A;  4HU7 A;  1Y1U A;  1SKS B;  1U87 A;  4O32 A;  1WIK A;  3KMN A;  5J40 A;  2H1A A;  2H73 A;  3IPZ A;  3LW9 A;  4PUA A;  2HFD A;  4K2D A;  3ED3 A;  1W4V A;  4EDZ A;  3NOF A;  2DJJ A;  1OKT A;  2I3Y A;  4IP6 A;  5J4U A;  2NBS A;  3ZVJ D;  5KN1 A;  2FHE A;  3QDN A;  1XFL A;  2FD3 A;  2R5G A;  3DD3 A;  3VPT A;  4USS A;  1SD8 A;  5KOW A;  4IVF A;  4OD7 A;  4ZL8 A;  3UBK A;  4FYB A;  2HRK A;  3FZA A;  4K0G A;  3FR9 A;  2GVP A;  4OFT A;  3Q6O A;  4G9H A;  3DVW A;  2I81 A;  4E8E A;  3HKR A;  5ECO B;  5CP1 A;  4POM A;  3RAZ A;  1AQW A;  1VF4 A;  4MH3 A;  3G9B A;  4TOP A;  5E4W A;  4O92 A;  4MMM A;  5A4W A;  1QK8 A;  4PQH A;  2V32 A;  4G0K A;  3A2X A;  18GS A;  2LNS A;  1UA5 A;  5ECR B;  1H75 A;  2OA7 A;  4HI7 A;  4BVY A;  2RUF A;  4AKH A;  4D73 A;  2DIY A;  2I1U A;  2OJL A;  1TI3 A;  3VFI A;  4HUA A;  5B8B A;  4KCA A;  4ACS A;  4XS4 B;  2DKH A;  3G7Y A;  1A2M A;  4G0I A;  2GT5 A;  3F4T A;  1YEX A;  1TK0 B;  1TTZ A;  2GLR A;  4WBJ A;  4KGI A;  4F2I A;  3OR5 A;  2WCI A;  1XWC A;  2GDR A;  4BVX B;  4LL4 B;  3O3T A;  5DDL A;  2TRC P;  2YWO A;  5DAK B;  4O7H A;  5D8I A;  2DML A;  4ZBD A;  3WGD A;  1ML6 A;  5GAN D;  4ILF A;  2VD0 A;  2KP2 A;  2QA1 A;  1N25 A;  4X1U A;  3N5O A;  5HR3 A;  1RQM A;  3KMO A;  4MA9 A;  1SVM A;  5J5N A;  3UVH A;  1V2A A;  5J4Y A;  1FG4 A;  3KM6 A;  2H72 A;  1USB A;  1PD2 1;  2AJQ B;  3I43 A;  1G6W A;  4POB A;  3TRX A;  1ZOF A;  1SL2 B;  19GS A;  1QMV A;  5AN1 A;  2CZ2 A;  2K18 A;  2L4Q A;  2FGX A;  4KSM A;  4EF0 A;  3FR3 A;  3ZIJ A;  4DSR A;  3VK9 A;  3QOU A;  4OFM A;  3UBL A;  2PWJ A;  1WE0 A;  4KX4 A;  2H1G A;  4PQI A;  1O81 A;  1T4Y A;  4KDY A;  3EUR A;  5INY A;  4ZL9 A;  5B6N A;  3F9U A;  4PX1 A;  3UAP A;  2AV4 A;  1KTE A;  2PBJ A;  3APS A;  3KCM A;  3KD0 A;  2C0G A;  4ML1 A;  3VUR A;  2JSZ A;  1SEN A;  2MMO A;  3F4S A;  1EOG A;  4L5L A;  1U88 A;  1SJI A;  2F3M A;  5EY6 A;  2VL2 A;  1TU8 A;  2LEG A;  4PXO A;  3EC3 A;  3GHA A;  4WF5 A;  2RM6 A;  2VCX A;  1GSF A;  3CMI A;  3APQ A;  1BG1 A;  2X99 A;  3HY2 A;  3M0F A;  3WT2 A;  2YOI A;  10GS A;  1ERV A;  4IJI A;  2H6X A;  5FWG A;  4Q5F A;  3VWX A;  3IE3 A;  1PX7 A;  2P5Q A;  3WGE A;  2YPM A;  4D73 B;  1X5C A;  1EWX A;  3DXB A;  5D9T A;  2DC5 A;  1GSE A;  2GZZ A;  3TKS C;  2L5L A;  2K6V A;  5ELA A;  3EE2 A;  2TIR A;  5F07 A;  4FO5 A;  1F2E A;  2Z9S A;  2DJ3 A;  4BA7 A;  1MTC A;  1YZX A;  1TKD B;  2GSS A;  2OE0 A;  3UOM A;  1HYU A;  1X0R A;  2WB9 A;  2DJ1 A;  4XIH A;  2JSY A;  3U5R E;  1FO5 A;  1S3D A;  3P8W A;  5KN2 A;  3M9K A;  2REM A;  1JZW A;  5HR1 A;  4J56 E;  5IM9 A;  3RHB A;  1K0B A;  2GGT A;  3IK9 A;  1GSY A;  3HMJ G;  3GRX A;  1B8X A;  1T4Z A;  4TR1 B;  3QAG A;  2UV8 G;  4V2N A;  3TJG A;  4XCS A;  1HNB A;  4YAP A;  1MD4 A;  3VWV A;  1EP8 A;  3TU3 B;  3M1G A;  4ZBB A;  2EIR A;  4K0N A;  3F4R A;  1U6T A;  4AI6 A;  3D21 A;  4H86 A;  3GSS A;  3MDK A;  3GKK A;  2EFD A;  3TKP A;  4Q5R A;  4DSQ A;  5H5S A;  1B9Y C;  4POL A;  4NXI A;  4AJ7 A;  1VF2 A;  4IQA A;  4ZIJ A;  4FYC A;  3HZ8 A;  1X9M B;  1TOF A;  3EPT A;  1Z7R A;  2A2R A;  2OT3 A;  4OO5 A;  3AY8 A;  2VCT A;  4FIW A;  2R37 A;  2CT6 A;  4TR4 A;  5ELG A;  3LEF A;  4TW5 A;  4LMW A;  2CA8 A;  2GTU A;  1PRX A;  2X4A A;  1QXH A;  2ZUP A;  3HVV A;  1MDJ A;  4WEY A;  3ZFL A;  5A1N B;  4F9Z A;  2E0Q A;  2YAN A;  4WBR D;  3FKF A;  5IIZ A;  3ZIV A;  4L0U A;  3HJO A;  2DSA A;  5ECN B;  2FWE A;  3DRN A;  3VI7 A;  3TJB A;  3M3M A;  4I6X A;  1XOB A;  4EUY A;  2GS3 A;  3MIX A;  1XWB A;  4JU5 A;  4Z7X A;  4V1A p;  1TK8 B;  3C71 A;  2ON7 A;  4J2F A;  2RM5 A;  3EMX A;  4TXO A;  5JWO B;  2EC4 A;  4K7N A;  5IMZ A;  2OKA A;  2O87 A;  2LRC A;  1BF5 A;  5FT3 A;  4AJ8 A;  5DBQ A;  4GDF A;  3GFK A;  2G2Q A;  4Z2U A;  1ILO A;  4EO3 A;  2A4H A;  4KCE A;  1GL8 A;  2L5O A;  4ZBA A;  2B5Y A;  3D4T A;  1PX6 A;  2AUV A;  2R2J A;  1OAZ A;  3EIN A;  2B3S A;  2B7J A;  1CQG A;  1A0F A;  4GXZ A;  2F8F A;  3CSH A;  4ECI A;  5IPG A;  4QL7 A;  3HD5 A;  3H1N A;  2EIQ A;  2LJR A;  3TRQ A;  3IBH A;  2WDU A;  1QUW A;  2OE3 A;  4NPB A;  2PPT A;  3IHG A;  5ID2 A;  2X64 A;  3WYW A;  4HZ2 A;  4OCF A;  4ULX A;  1ZZY A;  1JZR A;  4IJ3 A;  2CV4 A;  2FCH A;  3EYT A;  2BJX A;  4IW9 A;  1NHO A;  1XWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...