5J4UA

Crystal structure of a glutathione s-transferase ptgstu30 from populus trichocarpa in complex with gsh
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
218
structure length
218
Chain Sequence
SDQVTLLDFWPSPFGMRVRLALAEKGVKYEYSEEDLRNKSALLLQMNPVNKQIPVLVHNGKPVCESLIIVQYIDEVWKDSAPLLPSDPYQRAQSRFWADFVDKKIYDLGRKIWTKKGEEQEAAKKDFIDSLKLMEGELGDKPYFGGETIGYVDIALVPFYSWFYAYETIGNFNIEAECPKMIAYCKRCLQKETVSKALEDPQKVYDFVLMLMKKFGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase family protein
publication title Functional and Structural Profiles of GST Gene Family from Three Populus Species Revealed the Sequence-function Decoupling of Orthologous Genes
rcsb
source organism Populus trichocarpa
total genus 78
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5j4uA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5j4uA01
6GSUA 3IK7A 3F3QA 5L71A 1SKSB 1USBA 3US3A 4MJAA 5CYYA 1EEMA 1PKWA 3VWXA 3VWWA 2VL9A 4X1UA 4POKA 5DQYA 3QCPA 2MBTA 4KGIA 3LJRA 5F0GA 4KAEA 2R37A 5ECSA 4HI7A 3GN3A 1F37A 2WGRA 3WGDA 4LA1A 1S3DA 2GTUA 4G0IA 5HFKA 2YWIA 2LJAA 4XS1A 3KTLA 4XHMA 3W8JA 4V2MA 2QC7A 3VLNA 4HZ4A 2X8CA 4ID0A 3HCZA 4WXTA 4BPYA 3TB2A 2O87A 2XHFA 4ML6A 2C80A 4ECJA 5ECNB 1Y6EA 2KHPA 2H71A 1X0RA 2X64A 1T7PB 2DJ2A 3ED3A 3APQA 1GSYA 1XVQA 3UOMA 3HXSA 2VL2C 2DMLA 17GSA 4ULXA 1ZMAA 5B8BA 3VK9A 4KDUA 1T4ZA 1K0BA 2B5XA 3GKNA 3CSJA 2V1MA 4P3YB 3DVWA 2IMIA 2VM2A 4WF5A 5LCZA 4YAPA 1Z9HA 4BVXB 4PQHA 3TKRA 5ELAA 2XPDA 3A2XA 3M9JA 3GRXA 3ME8A 3KMNA 3KGKA 5G31A 3F9UA 2CVKA 5DDLA 3HYPA 3ZIJA 4RI6A 1GNEA 2DIYA 1GNWA 2HT9A 5GZZB 3LYPA 4NAXA 1Y25A 5INYA 4GLTA 4F82A 2CZ2A 1ZOFA 2LRTA 2K8VA 2AHEA 3LG6A 4ECIA 1QXHA 3KH7A 2FWHA 2PWJA 5IMZA 2H70A 2HFDA 3RPPA 4JE1A 1WPIA 2RUEA 2JZTA 2RM5A 3IR4A 1TKDB 2TRXA 3N9JA 4QL7A 1Z5YE 1NSWA 2MMZA 3ZL5A 4FIWA 1FHEA 4BVYA 1EP7A 4H86A 3WYWA 4KA0A 3H93A 3QMXA 1ON4A 3Q19A 4XS4A 2CT6A 1S3AA 4L0WA 2C0EA 1SK0A 4KDXA 1MDKA 5CNWA 5IIZA 4Q5NA 3KEBA 4IS0A 2VL2A 3GSTA 6GSSA 1F2EA 3RDWA 3TJGA 5ID2B 3E3EA 5FT3A 5KN1A 5D9VA 3FEUA 3F6DA 2FLSA 3FK8A 3L0HA 4K9ZA 3F4RA 1GWCA 4KSMA 5IOWA 3GKXA 4K8MA 5COHA 4AJ6A 4DSSA 2ON5A 1DE2A 3HY2A 2VM1A 3CRUA 3WT1A 2YCDA 4N11A 1GSFA 3GYKA 3QAGA 4MH2A 1ZYQB 1BYEA 2VLVA 1A2LA 4BL7B 4ML1A 3TOUA 5FHIA 3A2VA 1R4WA 3A3TA 1TI1A 1XWKA 3HZ8A 4QL9A 5DCHA 2K8SA 4F0CA 4JRRA 3HHVA 2PBJA 3UL3A 3UAPA 2MBSA 3D22A 4Q5QA 2CX4A 2G2QA 1WIKA 5GSSA 2IPAA 4TR4A 2L57A 2YWNA 1MDIA 1ML6A 1R26A 4EE0A 5C04A 4I2TA 5H5SA 2YJ7A 1AQVA 4K6XA 4OFMA 4OO5A 3J7Yb 2WDUA 3TCOA 3GMFA 4E8EA 2VCWA 2RUFA 1TTZA 3LXTA 4G9HA 1BQ7A 2WS2A 5ENUA 3GA4A 1T8EB 3EMPA 1SENA 4WKWA 4JR4A 1SK1A 1OE8A 5EPFA 1U87A 4PGTA 3ERWA 3KJYA 2QSIA 3W8SA 4FYCA 2C0GA 3P90A 4LMWA 3GFKA 2ON7A 4G10A 5HFIA 1ABAA 2WCIA 5G1LA 3DYRA 4MABA 4EKZA 3VFIA 3P8WA 2WB9A 4WF4A 3P2AA 2MMAA 1J0FA 4PQ1A 4IQ1A 4CDOA 4HZ2A 7GSSA 1U3AA 2MYGA 4I8BA 1B9YC 2YWMA 2OE0A 4PXOA 1RQMA 1QUWA 2HRKA 3UEMA 3ZIVA 2OA7A 2BJXA 1HNCA 5G5EA 5JCUA 2VO4A 2GS3A 1WP0A 1YEPA 1TU8A 4MF5A 5CRGA 2LJKA 1IYIA 2RIIA 4DSRA 1SL2B 4F9ZA 1G6WA 1TRVA 2X8HA 3IDVA 3QFBC 2EIRA 1NHYA 2VLUA 5KN2A 4KF9A 1HNAA 2ZNMA 3TKQA 5DBQA 2HXKA 3TKSA 1KNGA 1YZXA 2YWOA 5CREA 5AIVA 1BG5A 2C1YA 2I1UA 1EOHA 2XBQA 1WWJA 2KOKA 4ECCA 2YV9A 4KSOA 5IMDA 1HD2A 1XWAA 1X9WB 2H0HA 3CRTA 4GQFA 1OAZA 2X8GA 1GLQA 3LQ7A 2DJ1A 2I81A 5KN3A 1XIYA 2GGTA 3W6GA 2H0GA 3HKRA 1QFNA 4HU9A 3C7MA 3SBCA 4MMMA 4GTUA 1URMA 4ZL8A 3G7JA 2L4CA 5D93A 1QQ2A 4V2LA 3IOSA 4BVYB 1CQGA 3RHBA 4K0NA 1BJXA 5D8IA 1A23A 4GCIA 1ST9A 2B3SA 4MDCA 4XS4B 1O81A 1FVKA 4IKHA 2IL3A 1CQHA 3M8NA 2V6KA 2H8LA 1F9MA 1XOAA 3C1RA 4IJ3A 2IMFA 2LQQA 1B4QA 4WBRD 3HD5A 5J5NA 4N10A 1Z7RA 2L5OA 4PUFC 2VL3A 2CA8A 2BTOT 4QQ7A 3KH9A 4EDZA 1AXDA 5A4VA 4EDYA 3UBLA 1I9DA 4ZILA 3O3TA 2O8VB 4DSSB 1M2BA 2V41A 2DMMA 1VF4A 3R3EA 14GSA 1AAZA 3BBYA 3VI5A 4MA9A 2GZPA 1GSSA 3FZ5A 1GULA 2B6MA 2MMOA 2LNSA 3BOAA 3LXZA 6GSYA 2DC5A 2IMKA 3D6IA 4AF2A 1SD9A 2FA4A 2HRAA 2LUSA 2M46A 1B8XA 4TRXA 4X0XA 3LORA 4O32A 4CW9A 5DJLA 5DCGA 2AUVA 1T1VA 4YQVA 6GSWA 4RQXA 1SL0B 5CRDA 1V2AA 5HR3A 1X9SB 3EE2A 1XFLA 3F4TA 1X9MB 2H72A 2L4QA 4KB3A 3TOTA 1AQWA 3IK9A 1S3CA 1V57A 2WULA 2L6DA 4TN8A 1PX7A 4MJCA 3EU4A 1PKZA 3DWVA 9GSSA 2R4VA 4IBPA 1GL8A 4GSNA 4IELA 3ZFLA 1YY7A 3M0FA 1SD8A 5DAKA 2HSYA 1YKAA 2C3NA 1ERUA 2E0QA 3IAS2 3GIXA 3FY7A 3RHCA 2V6OA 3QAWA 1FG4A 3PGTA 2DIZA 1N8JA 2JL4A 2E2GA 1LJRA 1TP9A 3APSA 1VGLA 3K8NA 2TIRA 2H76A 1FOVA 1U3IA 2HRKB 1JZRA 3UJ1A 4YQMA 1T3BA 2OBIA 1HYUA 3CMIA 1E2YA 3G9BA 3RAZA 3M1GA 3D0ZA 3ZITA 2WRTA 1SYXA 3KP9A 4OFTA 5J4UA 2HSHA 4N30A 3HVVA 1TK8B 2H1BA 4HDEA 1ZGNA 2QGVA 1GUMA 4ZXGA 1GSEA 2TRCP 1THXA 4I5QA 4LLRA 2GQKA 4NXIA 3FR9A 5CP1A 3ZTLA 2VCQA 1G6YA 1K0MA 3UMAA 2Z9SA 4FYBA 2YN1A 4PUAA 1EGRA 4GQCA 2BMXA 4Z7XA 4XRAA 4PNFA 3Q74A 4TR0A 3F63A 5AN1A 2NVLA 3EC3A 1H75A 5J9CA 2KP1A 4FQUA 1B4PA 3UIWA 4MPGA 3GHAA 5IMAA 3TDGA 4RUVA 4NPBA 3R2QA 5JCGA 1WRYA 2JZSA 2N5AA 1FW1A 3I9V2 4IVFA 1GSDA 1SJ6A 5BMUA 4G0LA 4XS6A 2NPBA 1TRWA 3APOA 1UN2A 10GSA 5ECRB 5IO2A 2REMA 4ILFA 1GTIA 20GSA 3IBHA 2GVPA 1FB0A 1Z7PA 5AIXA 1VF2A 5JCWA 2H75A 3A5WA 6GSVA 2DJKA 2YV7A 3FYGA 2JSYA 4LL4B 3LFLA 1GLPA 1AQXA 4IGJA 2R2JA 2F3MA 1XVWA 2CZ3A 1SJZA 2VOCA 1R5AA 3FR6A 1JZWA 2HZFA 3L4NA 4MJEA 3S9FA 4AGSA 2H6YA 5EY6A 2NDOA 2GZZA 2C3TA 5A4WA 1JZDA 1MEKA 2FNOA 3GV1A 4TVEA 5IPGA 1YQ1A 4J57E 2GZYA 3N5OA 2K9FA 4TR3A 5ECHB 3GL5A 3WGXA 3JCML 1OC9A 2HZEA 1J08A 1XOBA 4YAVA 3KD0A 4DSQA 1MTCA 4OFNA 3O6TA 2J9HA 3GKMA 4K7NA 3I6AA 1BX9A 2L59A 4OD7A 3U5RE 2IFQA 2YZHA 3F6FA 2PVOC 2ZCTA 3RPNA 2HRNA 2VCVA 2LEGA 3TKSC 5A5KA 1GSUA 2FWGA 5CRWA 3FW2A 3E0UA 3ERFA 1PD21 1PX6A 3OR5A 1AW9A 4WR4A 3KM6A 2I9HA 2G0FA 3ME7A 3VPQA 1XWBA 4NWYA 2FD3A 4GXZA 2VCXA 3GH9A 5ECQB 3MWHA 5DAKB 3KMOA 5ECIB 19GSA 2J23A 4GWRA 1ZYEA 3LSZA 1ILOA 1SKRB 1HQOA 1PA3A 4JZQA 4HQSA 2YJHA 1J9BA 4HEA2 4MP4A 3L9SA 1TU7A 1GSQA 4OWYA 2AJQB 5FWGA 4OO4A 3KZQA 4WR5A 3NOFA 2VAFA 2A2SA 4L5OA 1XPVA 1TXXA 2GSSA 2L6CA 1GTAA 3ISOA 1KTEA 4RI7A 3TJJA 4EF0A 1TDIA 5HFGA 3UARA 4I2UA 3TUEA 2H66A 5CRHA 3IAM2 3LGCA 2PPTA 3BCIA 1F3AA 2H30A 2GT6A 1SL1B 2LSTA 3HDCA 4GF0A 1O73A 3NZNA 1UVZA 4HJ2A 3I43A 2CVDA 2HQTA 3CSHA 1G7EA 4HUAA 4GSSA 2M72A 3F8UA 1F6MC 1YKCA 1Q4JA 1XXUA 2VUPA 4MJBA 1WE0A 4ZBBA 2CV4A 4CHSA 2B5EA 2LRCA 2MZCA 4NHZA 1YF1A 4L0UA 2H01A 2CAQA 1K3YA 1O8XA 4NHWA 2IMEA 1ERVA 2PMTA 4ZB8A 3FRCA 2EIOA 3CSIA 5ECOB 1AC1A 2P5RA 4ZIJA 2GDRA 1SU9A 5C00A 1LU4A 1M9AA 2H0IA 1SJIA 4MF6A 3FHKA 2E7PA 2DSAA 3EVIA 2X99A 4KCEA 1B48A 1NM3A 2EC4A 2LS5A 2HLSA 3DGQA 2PN8A 1X5CA 2NTOA 1K0AA 3GURA 2H74A 5GSTA 5G2ZA 5B6MA 3FZAA 1FO5A 2KUCA 1M2DA 1MDJA 1JZOA 2WZ9A 4GSTA 2YPMA 4EXJA 1EGOA 2GSQA 3WD6A 2H1DA 3EWLA 3QR6A 2HSMA 1ZL9A 2R3XA 4L8EA 4NV5A 1XZOA 2FCHA 2DJ0A 3HA9A 4KX4A 1KBNA 3ZVJA 3C8EA 5G30A 2F51A 1JHBA 3DMLA 1JFUA 5F06A 4KDYA 1QMVA 5H5QA 3C73A 2C0FA 4PTSA 5J9BA 4G19A 2H19A 1OC9B 2HZEB 3EINA 1XW6A 1B9XC 1TRSA 2VLTA 4NMUA 3GH6A 1A2MA 5HQPA 2EIQA 1XWGA 2N5FA 2JADA 3VWVA 5DJMA 4OMVA 2FWEA 3PPUA 2OKAA 4HOJA 2VCZA 2IFQB 4AJ7A 2P0GA 3Q18A 4MZCA 4OCEA 4V1Ag 2H1AA 4K7OA 5JWOB 4I97A 2HI7A 4WBJA 1U6TA 1XWCA 4FO5A 1TOFA 2WFCA 3BCKA 4TR1A 1O8WA 5ECLB 2JSZA 5JWQB 2P5QA 4J2FA 3FZ9A 1EWXA 1A8YA 4PNGA 3I69A 4ZB6A 1RK4A 1C72A 1GTUA 4ISDA 2GSTA 3KP8A 2LRNA 1K0CA 4I6XA 5CO3A 5GAPD 2FY6A 3VWUA 2B1LA 1A24A 3P7XA 5IMVA 2OE1A 5ECPB 3EMXA 2VIMA 3LEFA 3GUSA 1X5EA 3ZMKA 2K18A 3H79A 4G2EA 1QGVA 2K6VA 3HJPA 3WGEA 4N0ZA 2A4VA 1M2AA 1M7TA 1ACVA 2FWFA 1VF3A 4LMVA 1GH2A 13GSA 4KE3A 2L5LA 4F03A 5DQSA 4V1Ap 1EV4A 3IV4A 2HRFA 4XIHA 5D9TA 2OADA 5CAXA 3PR8A 1NW2A 3IXRA 1U88A 1OC3A 4TXOA 4IN0A 1Q98A 3QD9A 3ZLPA 2OACA 3ZRDA 5ECKB 2LJRA 4K7IA 2YNXA 1GUKA 5G5FA 3QFAC 1TW9A 2F8AA 5D96A 1YEXA 2C0DA 4IW9A 1EV9A 3U6VA 3GTUA 4EUYA 2YOIA 1V58A 5DALA 1N2AA 2GLRA 1K0OA 2B5YA 4D73A 3TRPA 1SYRA 4E8HA 3ZVJD 2VD1A 1QK8A 1TRUA 3DXBA 1GTBA 3F3RA 4POMA 1EP8A 5HR1A 4G0KA 5DVBA 1T4YA 1AUCA 1VF1A 5E4WA 4AJ8A 4GRFA 3QPMA 2H6XA 2B7JA 2F8FA 2RLIA 5GAND 2FHEA 3Q6OA 3LWAA 1KEBA 3H4KA 1JLWA 1LBKA 1K3OA 1WOUA 2A2RA 3HVSA 2D2ZA 2GT5A 1FVJA 4BA7A 4F0BA 5IO0A 4KNDA 4O7HA 4EO3A 2DJ3A 1WJKA 1OYJA 3DIEA 3FKFA 5ELGA 1G0TA 2CQ9A 1JLVA 2ZUPA 3E9JB 3DRNA 4JEDA 4ECBA 1PQNA 3EU3A 4ZBDA 2B1KA 2HSMB 2YANA 1W4VA 2PU9C 3HVXA 1BEDA 4PQIA 3VPTA 1ERTA 5B7CA 1OE7A 4BWQA 1Z6MA 2VCTA 2QKEA 3D4MA 2YP6A 2OBKA 3ZYWA 4FH8A 1V40A 1M0UA 4N0VA 3NIVA 4K1FA 4MLYA 3TRXA 4MZBA 2CVBA 1O6JA 3GSSA 5IMFA 2IN3A 3F0IA 2NBSA 4USSA 3TJKA 5ECMB 3MSZA 4O5RA 4MZWA 1EZKA 3IE3A 4KH7A 1BAYA 4MK3A 1RW1A 3MAKA 1DE1A 3C71A 3H8QA 3GNJA 2XC2A 1W89A 2O89A 3D5JA 3KXOA 2MMNA 1PGTA 1OVNA 1A8LA 1UA5A 4ZL7A 2LKUA 3IA1A 3IC4A 3DD3A 3L9UA 5IPHA 3SWLA 4OCFA 5G1KA 2V32A 2IMDA 1OKTA 1ZZYA 3UBKA 1PRXA 2R6KA 3CXGA 3IHQA 5D9XA 3A2WA 1O7UA 1O85A 1Z6NA 3GKKA 3RBTA 2N5BA 3KTBA 1R7HA 2P31A 4XTSA 2H1GA 4TR1B 1XBSA 4KUNA 5H5RA 4IQAA 3QDNA 5HR0A 2WJUA 2LTKA 2AB6A 4MPFA 2JU5A 1A0FA 5JWRB 2JZRA 1HNBA 3L78A 4IJIA 4ACSA 4X43A 3G7YA 1XW5A 1PL2A 2F9SA 2PVQA 2GSRA 3V1WA 3EYTA 6GSXA 3M3MA 2GQMA 1H4OA 3HZ4A 3KIJA 4IP6A 1IYHA 3AY8A 4O92A 1SK2A 3ZZXA 3TRQA 5EL8A 2LV3A 2FA8A 2ALBA 2LQOA 1TK0B 5AGYA 2HE3A 5IQYA 4BWSA 5F05A 5F07A 2C3QA 4J56E 3G7IA 2M80A 4ZL9A 3UVHA 1PMTA 1VRSD 4HS1A 3L9VA 5HR2A 5D73A 1X5DA 1UC7A 1V9WA 12GSA 3GX8A 3DKSA 1A0RP 4TXOB 2PGTA 2V2GA 4EC0A 4MCUA 2PERA 5J41A 2AYTA 2XPEA 11GSA 2DJJA 3UVTA 2PUKC 3HJOA 1NHOA 2OJLA 4NV2A 3GX0A 2KP2A 18GSA 2H73A 3QOUA 2UZ8A 3GTUB 3WT2A 4TW5A 1MD4A 2E2MA 3HJMA 6GSTA 4HJMA 5DALB 3CTGA 3CTFA 4D73B 1PN9A 3ZMLA 1E6BA 22GSA 3CYNA 3J7Yk 4YH2A 1M99A 2O7KA 1XCCA 2H6ZA 2R5GA 2IIYA 4PX1A 2AAWA 1YDKA 4HQZA 2HYXA 4DEJA 4L5LA 4BVXA 2CAIA 2DBCA 4JBBA 8GSSA 4XCSA 4EL1A 3TKSE 4JR6A 2YZUA 5LNKe 1GRXA 1K0NA 2OE3A 3M9KA 1G7OA 1I5GA 4EVMA 1THOA 4FYUA 5B8AA 1OC8A 2FUG2 2I4AA 2KLXA 5F8BA 1R5PA 2IJYA 1EOGA 1EEJA 1OKDA 3IC8A 2RM6A 3C1SA 3DEXA 4MH3A 5J3RA 5KEJA 1FAAA 1YF0A 5EVOA 4POLA 4PURA 1ZCPA 3D21A 2O85A 1TI3A 3FR3A 4WEYA 4K0GA 4HU7A 3QAVA 4Q5RA 1T00A 1GUHA 2VD0A 5A4UA 4V2NA 5E59A 2B7KA 4KW6A 4TXVA 1F3BA 3ZFBA 3TGZA 4XRDA 1PSQA 3TJBA 2FGXA 4YQUA 1DSBA 4ZBAA 2ES7A 1M9BA 1GP1A 3TKPA 4LL1B 3KCMA 2DLXA 1TJDA 3EURA 2AV4A 2CX3A 5AISA 3PH9A 1K3LA 3VI7A 3BJ5A 5IM9A 16GSA 2JACA 1MD3A 1XW9A 5KN0A 4K2DA 3TJFA 4DVCA 4RQRA 5ID2A 2C4JA 1SKWB 1K0DA 2IWTA 3GL3A 3IPZA 4POBA 3BD2A 1WMJA 4KCAA 1ERWA 3H1NA 1PL1A 4ZB9A 2LNTA 3F4SA 3IRAA 1YJ6A 4Q5FA 3DVXA 3LYKA 3FZ4A 3MDKA 4IP1A 5ABRA 4BL7A 1AIUA 3MNGA 3ERGA 3D4TA 4TKYA 4JU5A 4TOPA 2HSNB 1DBYA 2C8UA 1A2JA 4F2IA 1TK5B 3O76A 5D9WA 2XBIA 5B6NA 5IMCA 2GQLA 3CBUA 1FB6A 4IHUA 1Z3EA 3PINA 5IOXA 3ZREA 2I3YA 4WETA 4MF7A 5LD0A 2HNLA 3VURA 1V98A 1DUGA
chains in the Genus database with same CATH superfamily
6GSUA 2WW3A 3IK7A 3F3QA 5L71A 1SKSB 1USBA 3US3A 4MJAA 4AKIA 5CYYA 1EEMA 1PKWA 3VWXA 3VWWA 2VL9A 4X1UA 4POKA 5DQYA 3QCPA 2MBTA 4KGIA 3LJRA 5F0GA 4KAEA 2R37A 5ECSA 4HI7A 3GN3A 1F37A 2WGRA 3WGDA 4LA1A 1S3DA 2GTUA 4G0IA 5HFKA 2YWIA 2LJAA 4XS1A 3KTLA 4XHMA 3W8JA 4V2MA 2QC7A 5A34B 1M3IA 3VLNA 4MNNA 4HZ4A 2X8CA 4ID0A 3HCZA 4WXTA 4BPYA 3TB2A 2O87A 2XHFA 4ML6A 2C80A 4ECJA 5ECNB 1Y6EA 2KHPA 1XG8A 2H71A 1X0RA 2X64A 1T7PB 2DJ2A 3ED3A 3APQA 1GSYA 1XVQA 3UOMA 3HXSA 2VL2C 2DMLA 17GSA 4ULXA 1ZMAA 5B8BA 3VK9A 4KDUA 1T4ZA 1K0BA 2B5XA 3MIXA 4K2XA 3GKNA 3CSJA 2V1MA 4P3YB 3DVWA 2IMIA 2VM2A 4WF5A 5LCZA 4YAPA 1Z9HA 4BVXB 4PQHA 3TKRA 5ELAA 4G01A 2XPDA 3A2XA 3M9JA 3GRXA 3ME8A 3KMNA 3KGKA 5G31A 3F9UA 2CVKA 5DDLA 3HYPA 3ZIJA 4RI6A 1GNEA 4ICYA 2DIYA 1GNWA 2HT9A 5GZZB 3LYPA 2R0PA 4NAXA 1Y25A 5INYA 4GLTA 4F82A 2CZ2A 1ZOFA 2LRTA 2K8VA 2AHEA 3LG6A 4ECIA 1QXHA 3KH7A 2FWHA 2PWJA 5IMZA 2H70A 2HFDA 3RPPA 4JE1A 1WPIA 2RUEA 2JZTA 1N25A 2RM5A 3IR4A 1TKDB 2TRXA 3N9JA 4QL7A 1Z5YE 1NSWA 2MMZA 3ZL5A 4FIWA 1FHEA 4BVYA 1EP7A 4H86A 3WYWA 4KA0A 3H93A 3QMXA 1ON4A 3Q19A 4XS4A 2CT6A 1S3AA 4L0WA 2C0EA 2WVXB 1SK0A 4KDXA 1MDKA 5CNWA 5IIZA 4Q5NA 3KEBA 4IS0A 2VL2A 3GSTA 6GSSA 1F2EA 3RDWA 3TJGA 5ID2B 3E3EA 5FT3A 5KN1A 2WZSA 5D9VA 3FEUA 3F6DA 2FLSA 3FK8A 3L0HA 4K9ZA 3F4RA 1GWCA 4KSMA 5IOWA 3GKXA 4K8MA 5COHA 4AJ6A 4DSSA 2ON5A 1DE2A 3HY2A 2VM1A 3CRUA 3WT1A 2YCDA 4N11A 1GSFA 5J47A 3GYKA 3QAGA 4MH2A 1ZYQB 1BYEA 2VLVA 1A2LA 4BL7B 4ML1A 3TOUA 5FHIA 3A2VA 1R4WA 3A3TA 1TI1A 1XWKA 3HZ8A 4QL9A 5DCHA 2K8SA 4F0CA 4JRRA 3HHVA 2PBJA 3UL3A 3UAPA 2MBSA 3D22A 4Q5QA 2CX4A 2G2QA 1WIKA 5GSSA 2IPAA 4TR4A 2L57A 2YWNA 1MDIA 1ML6A 1R26A 4EE0A 5C04A 4I2TA 5H5SA 2YJ7A 1AQVA 4K6XA 4OFMA 4OO5A 3J7Yb 2WDUA 3TCOA 3GMFA 4E8EA 2VCWA 2RUFA 1TTZA 3LXTA 4G9HA 1BQ7A 2WS2A 5ENUA 4PI0C 3GA4A 1T8EB 3EMPA 1SENA 4WKWA 2QA1A 4JR4A 4PHZC 1SK1A 1OE8A 5EPFA 1U87A 4PGTA 3ERWA 3KJYA 2QSIA 3W8SA 4FYCA 2C0GA 3P90A 4LMWA 4QMKA 3GFKA 2ON7A 4G10A 5HFIA 1ABAA 2WCIA 5G1LA 3DYRA 4MABA 4EKZA 3VFIA 2WB9A 3P8WA 4WF4A 3P2AA 2MMAA 1J0FA 4PQ1A 4IQ1A 4CDOA 4HZ2A 7GSSA 1U3AA 2MYGA 4I8BA 1B9YC 2YWMA 2OE0A 4PXOA 1RQMA 1QUWA 2HRKA 3UEMA 3ZIVA 2OA7A 2BJXA 1HNCA 1BF5A 5G5EA 5JCUA 2VO4A 2GS3A 1WP0A 1YEPA 1TU8A 4MF5A 5CRGA 2LJKA 1IYIA 2RIIA 4DSRA 4A5PA 1SL2B 4F9ZA 1G6WA 1TRVA 2X8HA 3IDVA 3QFBC 2EIRA 1NHYA 2VLUA 5KN2A 4KF9A 1HNAA 2ZNMA 3TKQA 5DBQA 2HXKA 3TKSA 1KNGA 1YZXA 2YWOA 5CREA 5AIVA 3EPTA 1BG5A 2C1YA 2I1UA 1EOHA 2XBQA 1BG1A 1WWJA 2KOKA 4ECCA 2YV9A 4KSOA 5IMDA 1HD2A 1XWAA 1X9WB 2H0HA 3CRTA 4GQFA 1OAZA 2X8GA 5A5HA 1GLQA 3LQ7A 2DJ1A 2I81A 5KN3A 1XIYA 2GGTA 3W6GA 2H0GA 3HKRA 1QFNA 4HU9A 3C7MA 1FOHA 3SBCA 4MMMA 1TXUA 4GTUA 1URMA 4ZL8A 3G7JA 2L4CA 5D93A 1QQ2A 4V2LA 3IOSA 4BVYB 1CQGA 3RHBA 4K0NA 3CWGA 1BJXA 5D8IA 1A23A 4GCIA 1ST9A 2B3SA 4MDCA 4XS4B 1O81A 1FVKA 4IKHA 2IL3A 1CQHA 4FXYP 3M8NA 2V6KA 2H8LA 1F9MA 1XOAA 3C1RA 4IJ3A 2IMFA 2LQQA 1B4QA 4WBRD 3HD5A 5J5NA 4N10A 1Z7RA 2L5OA 4PUFC 2VL3A 2CA8A 2BTOT 4QQ7A 3KH9A 4EDZA 1AXDA 5A4VA 4EDYA 3UBLA 1I9DA 4ZILA 3O3TA 2O8VB 4DSSB 1M2BA 2V41A 2DMMA 1VF4A 3R3EA 14GSA 1AAZA 3BBYA 3VI5A 4MA9A 2GZPA 1GSSA 3FZ5A 1GULA 2B6MA 2MMOA 1YEWC 2LNSA 3BOAA 3LXZA 6GSYA 2DC5A 2IMKA 3D6IA 4AF2A 1SD9A 2FA4A 2HRAA 2LUSA 2M46A 1B8XA 4TRXA 4X0XA 3LORA 4O32A 4CW9A 5DJLA 5DCGA 2AUVA 1T1VA 4YQVA 6GSWA 4RQXA 1ZYPA 1SL0B 5CRDA 1V2AA 5HR3A 1X9SB 3EE2A 1XFLA 3F4TA 1X9MB 2H72A 2L4QA 4KB3A 3TOTA 1AQWA 3IK9A 1S3CA 1V57A 2WULA 2L6DA 4TN8A 1PX7A 4AKGA 4MJCA 3EU4A 4YKFA 4EIPA 1M3JA 1PKZA 3DWVA 9GSSA 2R4VA 4IBPA 1GL8A 4GSNA 4IELA 3ZFLA 1YY7A 3M0FA 1SD8A 5DAKA 2HSYA 1YKAA 2C3NA 1ERUA 2E0QA 3IAS2 3GIXA 3FY7A 3RHCA 2V6OA 3QAWA 1FG4A 3PGTA 2DIZA 1N8JA 2JL4A 2E2GA 1LJRA 1TP9A 3APSA 1VGLA 3K8NA 2TIRA 2H76A 1FOVA 1U3IA 2HRKB 1JZRA 3UJ1A 4YQMA 2OT3A 1T3BA 2OBIA 1HYUA 3CMIA 3G9BA 2EFHA 1E2YA 3RAZA 3M1GA 3D0ZA 3ZITA 5A1NA 2WRTA 1SYXA 3KP9A 4OFTA 5J4UA 2HSHA 4N30A 3HVVA 1TK8B 3CHXC 2H1BA 4HDEA 1ZGNA 2QGVA 1GUMA 4ZXGA 1GSEA 2TRCP 1THXA 4I5QA 4LLRA 2GQKA 4NXIA 3FR9A 5CP1A 3HVNA 3ZTLA 2VCQA 1G6YA 2O3EA 1K0MA 3UMAA 2Z9SA 4FYBA 2YN1A 4PUAA 1EGRA 4GQCA 1SVLA 2BMXA 4Z7XA 4XRAA 4PNFA 3Q74A 4TR0A 3F63A 5AN1A 2NVLA 3EC3A 1H75A 5A5HB 5J9CA 2KP1A 4FQUA 1B4PA 3UIWA 3CQFA 4MPGA 3GHAA 5IMAA 3TDGA 4RUVA 4NPBA 3R2QA 5JCGA 1WRYA 2A2PA 2JZSA 2N5AA 1FW1A 3I9V2 4IVFA 1GSDA 1SJ6A 5BMUA 4G0LA 4XS6A 2NPBA 1TRWA 3APOA 1UN2A 10GSA 5ECRB 5IO2A 2REMA 4ILFA 1GTIA 20GSA 3IBHA 2GVPA 1FB0A 1Z7PA 5AIXA 1VF2A 5JCWA 2H75A 3A5WA 6GSVA 2DJKA 2YV7A 3FYGA 2JSYA 4LL4B 3LFLA 1GLPA 1AQXA 4IGJA 2R2JA 2F3MA 1XVWA 2CZ3A 3TU3B 1SJZA 2VOCA 1R5AA 3FR6A 1JZWA 2HZFA 3L4NA 4MJEA 3S9FA 4AGSA 2H6YA 5EY6A 2NDOA 2GZZA 2WW2A 2C3TA 5A4WA 1JZDA 1MEKA 2FNOA 1ZYNA 3GV1A 2A4HA 4TVEA 5IPGA 1YQ1A 4J57E 2GZYA 3N5OA 2K9FA 4TR3A 5ECHB 3GL5A 3WGXA 3JCML 1OC9A 2HZEA 1J08A 1XOBA 4YAVA 3KD0A 4DSQA 1MTCA 4OFNA 3O6TA 2J9HA 2WVZA 3GKMA 4K7NA 3I6AA 1BX9A 2L59A 2O36A 4OD7A 3MYDA 3U5RE 5J40A 2IFQA 2YZHA 3F6FA 2PVOC 2ZCTA 3A5IA 3RPNA 2HRNA 2VCVA 2LEGA 3TKSC 5A5KA 5BRTA 1GSUA 2FWGA 5CRWA 3FW2A 3E0UA 3ERFA 2H1LA 1PD21 1PX6A 3OR5A 1AW9A 4WR4A 3KM6A 2QA2A 2I9HA 2G0FA 3ME7A 3VPQA 1XWBA 4NWYA 2FD3A 4GXZA 2X4AA 2VCXA 5J4VA 3GH9A 5ECQB 3MWHA 5DAKB 3KMOA 5ECIB 19GSA 2J23A 2WW0A 1ZYEA 2EFCA 4GWRA 3LSZA 1ILOA 3IHGA 1SKRB 1HQOA 1PA3A 1PN0A 4JZQA 4HQSA 2YJHA 1J9BA 4HEA2 4MP4A 3L9SA 1TU7A 1GSQA 4OWYA 2AJQB 5FWGA 4OO4A 3KZQA 4WR5A 3NOFA 4YKGA 2VAFA 2A2SA 4L5OA 1XPVA 1TXXA 2GSSA 2WW1A 4AKHA 2L6CA 1GTAA 3ISOA 1KTEA 4RI7A 3TJJA 4EF0A 1TDIA 5HFGA 3UARA 4I2UA 3TUEA 2H66A 4GDFA 5CRHA 3IAM2 5A1NB 3LGCA 2PPTA 3BCIA 1F3AA 2H30A 2GT6A 1SL1B 2LSTA 3HDCA 4CY6A 4GF0A 1O73A 3NZNA 1UVZA 4HJ2A 3I43A 2CVDA 2HQTA 3CSHA 1G7EA 4HUAA 4GSSA 2M72A 3F8UA 1F6MC 1YKCA 1Q4JA 2R0GA 1XXUA 2VUPA 4MJBA 1WE0A 4ZBBA 2CV4A 4CHSA 2B5EA 2LRCA 2MZCA 4NHZA 1YF1A 4L0UA 2H01A 2EFDA 2CAQA 1K3YA 1O8XA 4NHWA 2IMEA 1ERVA 2PMTA 4ZB8A 3FRCA 2EIOA 3CSIA 5ECOB 1AC1A 2P5RA 4ZIJA 2GDRA 1SU9A 5C00A 1LU4A 1M9AA 2H0IA 1SVOA 1SJIA 4MF6A 3FHKA 2E7PA 2DSAA 3EVIA 2X99A 4KCEA 5BMUB 1B48A 1NM3A 2EC4A 2LS5A 2HLSA 3DGQA 2PN8A 1X5CA 2NTOA 1K0AA 3GURA 2H74A 5GSTA 5G2ZA 3RFRC 5B6MA 3FZAA 1FO5A 2KUCA 1M2DA 1MDJA 1JZOA 2WZ9A 4GSTA 2YPMA 4EXJA 1EGOA 2GSQA 3WD6A 2H1DA 3EWLA 3QR6A 2HSMA 1ZL9A 2R3XA 5KOWA 4L8EA 4NV5A 1XZOA 2FCHA 4PI2C 2DJ0A 3HA9A 4KX4A 1KBNA 3ZVJA 3C8EA 5G30A 2F51A 1JHBA 3DMLA 1JFUA 5F06A 4KDYA 1QMVA 5H5QA 3C73A 2C0FA 4PTSA 5J9BA 4G19A 2H19A 1OC9B 2HZEB 3EINA 1XW6A 1B9XC 1TRSA 2VLTA 4NMUA 5J4YA 3GH6A 1A2MA 5HQPA 2EIQA 1XWGA 2N5FA 2JADA 3VWVA 5DJMA 4EIQA 4OMVA 2FWEA 3PPUA 2OKAA 4HOJA 2VCZA 2IFQB 4AJ7A 2P0GA 3Q18A 4MZCA 4OCEA 4V1Ag 2H1AA 4K7OA 5JWOB 4I97A 2HI7A 1YVLA 4WBJA 1U6TA 1XWCA 4FO5A 1TOFA 2WFCA 3BCKA 4TR1A 1O8WA 5ECLB 2JSZA 5JWQB 2P5QA 4J2FA 3FZ9A 1EWXA 1A8YA 4PNGA 3I69A 4ZB6A 1RK4A 4AKXB 1I1IP 1C72A 1GTUA 4ISDA 2GSTA 3KP8A 2LRNA 1K0CA 4I6XA 5CO3A 5GAPD 2FY6A 3VWUA 2B1LA 1A24A 3P7XA 5IMVA 2OE1A 5ECPB 3EMXA 2VIMA 3LEFA 3GUSA 1X5EA 3ZMKA 2K18A 3H79A 4G2EA 1QGVA 2K6VA 3HJPA 3WGEA 4N0ZA 2A4VA 1M2AA 1M7TA 1ACVA 2FWFA 1VF3A 4LMVA 1GH2A 13GSA 4KE3A 2L5LA 4F03A 5DQSA 4V1Ap 1EV4A 3IV4A 5KOXA 2HRFA 4XIHA 5D9TA 2OADA 5CAXA 3PR8A 1NW2A 3IXRA 1U88A 1OC3A 4TXOA 4IN0A 1Q98A 3QD9A 3ZLPA 2OACA 3ZRDA 5ECKB 2LJRA 4K7IA 2YNXA 1GUKA 5G5FA 4E68A 3QFAC 4K5SA 1TW9A 1S3RA 2F8AA 5D96A 1YEXA 2C0DA 4IW9A 1EV9A 3U6VA 1S4BP 4O5UA 3GTUA 4X4JA 4EUYA 4ZB7A 2YOIA 1V58A 4AI6A 5DALA 1N2AA 2GLRA 1K0OA 2B5YA 4D73A 3TRPA 1SYRA 4E8HA 3ZVJD 3HMJG 2VD1A 1QK8A 1TRUA 3DXBA 1GTBA 3F3RA 4POMA 1EP8A 5HR1A 4G0KA 5DVBA 1T4YA 4N3ZA 1AUCA 1VF1A 5E4WA 4AJ8A 4GRFA 3QPMA 2H6XA 2B7JA 2F8FA 2RLIA 5GAND 2FHEA 3Q6OA 3LWAA 1KEBA 3H4KA 1JLWA 1LBKA 1K3OA 1WOUA 2A2RA 2DKIA 3HVSA 2D2ZA 2GT5A 1FVJA 4BA7A 4F0BA 5IO0A 4KNDA 4O7HA 4EO3A 1WJKA 2DJ3A 1OYJA 3DIEA 3FKFA 5ELGA 2O5VA 1G0TA 2CQ9A 1JLVA 2ZUPA 3E9JB 3DRNA 4JEDA 4ECBA 1PQNA 3EU3A 4ZBDA 2B1KA 2HSMB 2YANA 1W4VA 2PU9C 3HVXA 1BEDA 4PQIA 3VPTA 1ERTA 5B7CA 1OE7A 4BWQA 1Z6MA 2VCTA 2QKEA 3D4MA 2YP6A 2OBKA 3ZYWA 4FH8A 1V40A 1M0UA 4N0VA 3NIVA 4K1FA 4MLYA 3TRXA 4MZBA 2X49A 2CVBA 1O6JA 3GSSA 5IMFA 2IN3A 3F0IA 2NBSA 4USSA 3TJKA 5ECMB 3MSZA 4O5RA 4MZWA 1EZKA 2DKHA 3IE3A 4KH7A 1BAYA 4MK3A 1RW1A 3MAKA 1DE1A 4Z2RA 3C71A 3H8QA 3GNJA 2XC2A 1W89A 2O89A 3D5JA 3KXOA 2MMNA 1PGTA 1OVNA 1A8LA 1UA5A 4ZL7A 2LKUA 3IA1A 3IC4A 3DD3A 3L9UA 5IPHA 3SWLA 4OCFA 5G1KA 2V32A 2IMDA 1OKTA 1ZZYA 3UBKA 1PRXA 2R6KA 3CXGA 3IHQA 5D9XA 3A2WA 1O7UA 1O85A 1Z6NA 3GKKA 3RBTA 2N5BA 3KTBA 4Z2UA 1R7HA 2P31A 4XTSA 2H1GA 4TR1B 1Y1UA 1XBSA 4KUNA 5H5RA 4IQAA 3QDNA 5HR0A 2WJUA 2HSNA 2LTKA 2AB6A 4MPFA 2JU5A 1A0FA 5JWRB 2JZRA 4CY8A 1HNBA 3L78A 4IJIA 4ACSA 4X43A 3G7YA 1XW5A 1PL2A 2F9SA 2PVQA 2GSRA 3V1WA 3EYTA 6GSXA 3M3MA 2GQMA 1H4OA 3HZ4A 3KIJA 4IP6A 1IYHA 3AY8A 4O92A 1SK2A 3ZZXA 3TRQA 5EL8A 2LV3A 2FA8A 2ALBA 2LQOA 1PFOA 1TK0B 5AGYA 2EFEA 2HE3A 4K5RA 5IQYA 4BWSA 5F05A 5F07A 2C3QA 4J56E 3G7IA 2UV8G 2M80A 4ZL9A 4O5QA 3UVHA 1PMTA 1VRSD 4HS1A 3L9VA 5HR2A 5D73A 1X5DA 1UC7A 4W66A 1V9WA 12GSA 3GX8A 3LW9A 3DKSA 1A0RP 4TXOB 2PGTA 2V2GA 4EC0A 5A34A 4MCUA 2PERA 2VKZG 5J41A 2AYTA 2XPEA 3FMWA 11GSA 2DJJA 3UVTA 2PUKC 3HJOA 1NHOA 2OJLA 4NV2A 3GX0A 2KP2A 18GSA 2H73A 3QOUA 2UZ8A 3GTUB 3WT2A 4TW5A 1MD4A 2E2MA 3HJMA 6GSTA 4HJMA 5DALB 3CTGA 3CTFA 4D73B 1PN9A 3ZMLA 1E6BA 22GSA 3CYNA 3J7Yk 4YH2A 1M99A 2O7KA 1XCCA 2H6ZA 2R5GA 2IIYA 4PX1A 2AAWA 1YDKA 4HQZA 2HYXA 4DEJA 4L5LA 4BVXA 2CAIA 2DBCA 4JBBA 2WVYA 8GSSA 4XCSA 4EL1A 3TKSE 4JR6A 2YZUA 5LNKe 1GRXA 1K0NA 2OE3A 3M9KA 1G7OA 1I5GA 4EVMA 1THOA 4FYUA 5B8AA 1OC8A 2FUG2 2I4AA 2KLXA 5F8BA 1R5PA 2IJYA 1EOGA 1EEJA 1OKDA 3IC8A 2RM6A 1SVMA 3C1SA 3DEXA 4MH3A 5J3RA 5KEJA 1FAAA 1YF0A 5EVOA 4POLA 4PURA 1ZCPA 3D21A 2O85A 1TI3A 3FR3A 4WEYA 4K0GA 4HU7A 3QAVA 4Q5RA 1T00A 1GUHA 2VD0A 5A4UA 4V2NA 5E59A 2B7KA 4KW6A 4Z2TA 4TXVA 1F3BA 3ZFBA 3TGZA 4XRDA 3RGBC 1PSQA 3TJBA 2FGXA 4YQUA 1DSBA 4ZBAA 2ES7A 1M9BA 1GP1A 3TKPA 4LL1B 3KCMA 2DLXA 1TJDA 2WVXA 3EURA 2AV4A 2CX3A 5AISA 1K3LA 3VI7A 3PH9A 3BJ5A 5IM9A 16GSA 2JACA 1MD3A 1XW9A 5KN0A 4K2DA 3TJFA 4DVCA 4RQRA 5ID2A 2C4JA 1SKWB 1K0DA 2IWTA 3GL3A 3IPZA 4POBA 3BD2A 1WMJA 4KCAA 1ERWA 3H1NA 1PL1A 4ZB9A 4HSCX 2LNTA 3F4SA 3IRAA 1YJ6A 4Q5FA 3DVXA 3LYKA 3FZ4A 3MDKA 4IP1A 5ABRA 4BL7A 1AIUA 3MNGA 3ERGA 3D4TA 4TKYA 4JU5A 4TOPA 2HSNB 2R0CA 1DBYA 2C8UA 1A2JA 4F2IA 1TK5B 4BIKA 3O76A 5D9WA 2XBIA 5B6NA 5IMCA 2GQLA 3CBUA 1FB6A 4IHUA 1Z3EA 3PINA 5IOXA 3ZREA 2I3YA 4WETA 4MF7A 5LD0A 2HNLA 3VURA 1V98A 1DUGA
chains in the Genus database with same CATH topology
6GSUA 3IK7A 3F3QA 5L71A 1SKSB 1USBA 3US3A 4MJAA 4AKIA 5CYYA 1EEMA 1PKWA 3VWXA 3VWWA 2VL9A 4X1UA 4POKA 5DQYA 3QCPA 2MBTA 4KGIA 3LJRA 5F0GA 4KAEA 2R37A 5ECSA 4HI7A 3GN3A 1F37A 2WGRA 3WGDA 4LA1A 1S3DA 2GTUA 4G0IA 5HFKA 2YWIA 2LJAA 4XS1A 3KTLA 4XHMA 3W8JA 4V2MA 2QC7A 5A34B 3VLNA 4MNNA 4HZ4A 2X8CA 4ID0A 3HCZA 4WXTA 4BPYA 3TB2A 2O87A 2XHFA 4ML6A 2C80A 4ECJA 5ECNB 1Y6EA 2KHPA 2H71A 1X0RA 2X64A 1T7PB 2DJ2A 3ED3A 3APQA 1GSYA 1XVQA 3UOMA 3HXSA 2VL2C 2DMLA 17GSA 4ULXA 1ZMAA 5B8BA 3VK9A 4KDUA 1T4ZA 1K0BA 2B5XA 3MIXA 4K2XA 3GKNA 3CSJA 2V1MA 4P3YB 3DVWA 2IMIA 2VM2A 4WF5A 5LCZA 4YAPA 1Z9HA 4BVXB 4PQHA 3TKRA 5ELAA 4G01A 2XPDA 3A2XA 3M9JA 3GRXA 3ME8A 3KMNA 3KGKA 5G31A 3F9UA 2CVKA 5DDLA 3HYPA 3ZIJA 4RI6A 1GNEA 4ICYA 2DIYA 1GNWA 2HT9A 5GZZB 3LYPA 2R0PA 4NAXA 1Y25A 5INYA 4GLTA 4F82A 2CZ2A 1ZOFA 2LRTA 2K8VA 2AHEA 3LG6A 4ECIA 1QXHA 3KH7A 2FWHA 2PWJA 5IMZA 2H70A 2HFDA 3RPPA 4JE1A 1WPIA 2RUEA 2JZTA 1N25A 2RM5A 3IR4A 1TKDB 2TRXA 3N9JA 4QL7A 1Z5YE 1NSWA 2MMZA 3ZL5A 4FIWA 1FHEA 4BVYA 1EP7A 4H86A 3WYWA 4KA0A 3H93A 3QMXA 1ON4A 3Q19A 4XS4A 2CT6A 1S3AA 4L0WA 2C0EA 1SK0A 4KDXA 1MDKA 5CNWA 5IIZA 4Q5NA 3KEBA 4IS0A 2VL2A 3GSTA 6GSSA 1F2EA 3RDWA 3TJGA 5ID2B 3E3EA 5FT3A 5KN1A 5D9VA 3FEUA 3F6DA 2FLSA 3FK8A 3L0HA 4K9ZA 3F4RA 1GWCA 4KSMA 5IOWA 3GKXA 4K8MA 5COHA 4AJ6A 4DSSA 2ON5A 1DE2A 3HY2A 2VM1A 3CRUA 3WT1A 2YCDA 4N11A 1GSFA 5J47A 3GYKA 3QAGA 4MH2A 1ZYQB 1BYEA 2VLVA 1A2LA 4BL7B 4ML1A 3TOUA 5FHIA 3A2VA 1R4WA 3A3TA 1TI1A 1XWKA 3HZ8A 4QL9A 5DCHA 2K8SA 4F0CA 4JRRA 3HHVA 2PBJA 3UL3A 3UAPA 2MBSA 3D22A 4Q5QA 2CX4A 2G2QA 1WIKA 5GSSA 2IPAA 4TR4A 2L57A 2YWNA 1MDIA 1ML6A 1R26A 4EE0A 5C04A 4I2TA 5H5SA 2YJ7A 1AQVA 4K6XA 4OFMA 4OO5A 3J7Yb 2WDUA 3TCOA 3GMFA 4E8EA 2VCWA 2RUFA 1TTZA 3LXTA 4G9HA 1BQ7A 2WS2A 5ENUA 3GA4A 1T8EB 3EMPA 1SENA 4WKWA 2QA1A 4JR4A 1SK1A 1OE8A 5EPFA 1U87A 4PGTA 3ERWA 3KJYA 2QSIA 3W8SA 4FYCA 2C0GA 3P90A 4LMWA 4QMKA 3GFKA 2ON7A 4G10A 5HFIA 1ABAA 2WCIA 5G1LA 3DYRA 4MABA 4EKZA 3VFIA 2WB9A 3P8WA 4WF4A 3P2AA 2MMAA 1J0FA 4PQ1A 4IQ1A 4CDOA 4HZ2A 7GSSA 1U3AA 2MYGA 4I8BA 1B9YC 2YWMA 2OE0A 4PXOA 1RQMA 1QUWA 2HRKA 3UEMA 3ZIVA 2OA7A 2BJXA 1HNCA 1BF5A 5G5EA 5JCUA 2VO4A 2GS3A 1WP0A 1YEPA 1TU8A 4MF5A 5CRGA 2LJKA 1IYIA 2RIIA 4DSRA 4A5PA 1SL2B 4F9ZA 1G6WA 1TRVA 2X8HA 3IDVA 3QFBC 2EIRA 1NHYA 2VLUA 5KN2A 4KF9A 1HNAA 2ZNMA 3TKQA 5DBQA 2HXKA 3TKSA 1KNGA 1YZXA 2YWOA 5CREA 5AIVA 3EPTA 1BG5A 2C1YA 2I1UA 1EOHA 2XBQA 1BG1A 1WWJA 2KOKA 4ECCA 2YV9A 4KSOA 5IMDA 1HD2A 1XWAA 1X9WB 2H0HA 3CRTA 4GQFA 1OAZA 2X8GA 5A5HA 1GLQA 3LQ7A 2DJ1A 2I81A 5KN3A 1XIYA 2GGTA 3W6GA 2H0GA 3HKRA 1QFNA 4HU9A 3C7MA 1FOHA 3SBCA 4MMMA 1TXUA 4GTUA 1URMA 4ZL8A 3G7JA 2L4CA 5D93A 1QQ2A 4V2LA 3IOSA 4BVYB 1CQGA 3RHBA 4K0NA 3CWGA 1BJXA 5D8IA 1A23A 4GCIA 1ST9A 2B3SA 4MDCA 4XS4B 1O81A 1FVKA 4IKHA 2IL3A 1CQHA 3M8NA 2V6KA 2H8LA 1F9MA 1XOAA 3C1RA 4IJ3A 2IMFA 2LQQA 1B4QA 4WBRD 3HD5A 5J5NA 4N10A 1Z7RA 2L5OA 4PUFC 2VL3A 2CA8A 2BTOT 4QQ7A 3KH9A 4EDZA 1AXDA 5A4VA 4EDYA 3UBLA 1I9DA 4ZILA 3O3TA 2O8VB 4DSSB 1M2BA 2V41A 2DMMA 1VF4A 3R3EA 14GSA 1AAZA 3BBYA 3VI5A 4MA9A 2GZPA 1GSSA 3FZ5A 1GULA 2B6MA 2MMOA 2LNSA 3BOAA 3LXZA 6GSYA 2DC5A 2IMKA 3D6IA 4AF2A 1SD9A 2FA4A 2HRAA 2LUSA 2M46A 1B8XA 4TRXA 4X0XA 3LORA 4O32A 4CW9A 5DJLA 5DCGA 2AUVA 1T1VA 4YQVA 6GSWA 4RQXA 1ZYPA 1SL0B 5CRDA 1V2AA 5HR3A 1X9SB 3EE2A 1XFLA 3F4TA 1X9MB 2H72A 2L4QA 4KB3A 3TOTA 1AQWA 3IK9A 1S3CA 1V57A 2WULA 2L6DA 4TN8A 1PX7A 4AKGA 4MJCA 3EU4A 4YKFA 4EIPA 1PKZA 3DWVA 9GSSA 2R4VA 4IBPA 1GL8A 4GSNA 4IELA 3ZFLA 1YY7A 3M0FA 1SD8A 5DAKA 2HSYA 1YKAA 2C3NA 1ERUA 2E0QA 3IAS2 3GIXA 3FY7A 3RHCA 2V6OA 3QAWA 1FG4A 3PGTA 2DIZA 1N8JA 2JL4A 2E2GA 1LJRA 1TP9A 3APSA 1VGLA 3K8NA 2TIRA 2H76A 1FOVA 1U3IA 2HRKB 1JZRA 3UJ1A 4YQMA 2OT3A 1T3BA 2OBIA 1HYUA 3CMIA 3G9BA 2EFHA 1E2YA 3RAZA 3M1GA 3D0ZA 3ZITA 5A1NA 2WRTA 1SYXA 3KP9A 4OFTA 5J4UA 2HSHA 4N30A 3HVVA 1TK8B 2H1BA 4HDEA 1ZGNA 2QGVA 1GUMA 4ZXGA 1GSEA 2TRCP 1THXA 4I5QA 4LLRA 2GQKA 4NXIA 3FR9A 5CP1A 3ZTLA 2VCQA 1G6YA 1K0MA 3UMAA 2Z9SA 4FYBA 2YN1A 4PUAA 1EGRA 4GQCA 1SVLA 2BMXA 4Z7XA 4XRAA 4PNFA 3Q74A 4TR0A 3F63A 5AN1A 2NVLA 3EC3A 1H75A 5A5HB 5J9CA 2KP1A 4FQUA 1B4PA 3UIWA 4MPGA 3GHAA 5IMAA 3TDGA 4RUVA 4NPBA 3R2QA 5JCGA 1WRYA 2A2PA 2JZSA 2N5AA 1FW1A 3I9V2 4IVFA 1GSDA 1SJ6A 5BMUA 4G0LA 4XS6A 2NPBA 1TRWA 3APOA 1UN2A 10GSA 5ECRB 5IO2A 2REMA 4ILFA 1GTIA 20GSA 3IBHA 2GVPA 1FB0A 1Z7PA 5AIXA 1VF2A 5JCWA 2H75A 3A5WA 6GSVA 2DJKA 2YV7A 3FYGA 2JSYA 4LL4B 3LFLA 1GLPA 1AQXA 4IGJA 2R2JA 2F3MA 1XVWA 2CZ3A 3TU3B 1SJZA 2VOCA 1R5AA 3FR6A 1JZWA 2HZFA 3L4NA 4MJEA 3S9FA 4AGSA 2H6YA 5EY6A 2NDOA 2GZZA 2C3TA 5A4WA 1JZDA 1MEKA 2FNOA 1ZYNA 3GV1A 2A4HA 4TVEA 5IPGA 1YQ1A 4J57E 2GZYA 3N5OA 2K9FA 4TR3A 5ECHB 3GL5A 3WGXA 3JCML 1OC9A 2HZEA 1J08A 1XOBA 4YAVA 3KD0A 4DSQA 1MTCA 4OFNA 3O6TA 2J9HA 3GKMA 4K7NA 3I6AA 1BX9A 2L59A 4OD7A 3MYDA 3U5RE 5J40A 2IFQA 2YZHA 3F6FA 2PVOC 2ZCTA 3A5IA 3RPNA 2HRNA 2VCVA 2LEGA 3TKSC 5A5KA 5BRTA 1GSUA 2FWGA 5CRWA 3FW2A 3E0UA 3ERFA 2H1LA 1PD21 1PX6A 3OR5A 1AW9A 4WR4A 3KM6A 2QA2A 2I9HA 2G0FA 3ME7A 3VPQA 1XWBA 4NWYA 2FD3A 4GXZA 2X4AA 2VCXA 5J4VA 3GH9A 5ECQB 3MWHA 5DAKB 3KMOA 5ECIB 19GSA 2J23A 4GWRA 1ZYEA 2EFCA 3LSZA 1ILOA 3IHGA 1SKRB 1HQOA 1PA3A 1PN0A 4JZQA 4HQSA 2YJHA 1J9BA 4HEA2 4MP4A 3L9SA 1TU7A 1GSQA 4OWYA 2AJQB 5FWGA 4OO4A 3KZQA 4WR5A 3NOFA 4YKGA 2VAFA 2A2SA 4L5OA 1XPVA 1TXXA 2GSSA 4AKHA 2L6CA 1GTAA 3ISOA 1KTEA 4RI7A 3TJJA 4EF0A 1TDIA 5HFGA 3UARA 4I2UA 3TUEA 2H66A 4GDFA 5CRHA 3IAM2 5A1NB 3LGCA 2PPTA 3BCIA 1F3AA 2H30A 2GT6A 1SL1B 2LSTA 3HDCA 4CY6A 4GF0A 1O73A 3NZNA 1UVZA 4HJ2A 3I43A 2CVDA 2HQTA 3CSHA 1G7EA 4HUAA 4GSSA 2M72A 3F8UA 1F6MC 1YKCA 1Q4JA 2R0GA 1XXUA 2VUPA 4MJBA 1WE0A 4ZBBA 2CV4A 4CHSA 2B5EA 2LRCA 2MZCA 4NHZA 1YF1A 4L0UA 2H01A 2EFDA 2CAQA 1K3YA 1O8XA 4NHWA 2IMEA 1ERVA 2PMTA 4ZB8A 3FRCA 2EIOA 3CSIA 5ECOB 1AC1A 2P5RA 4ZIJA 2GDRA 1SU9A 5C00A 1LU4A 1M9AA 2H0IA 1SVOA 1SJIA 4MF6A 3FHKA 2E7PA 2DSAA 3EVIA 2X99A 4KCEA 5BMUB 1B48A 1NM3A 2EC4A 2LS5A 2HLSA 3DGQA 2PN8A 1X5CA 2NTOA 1K0AA 3GURA 2H74A 5GSTA 5G2ZA 5B6MA 3FZAA 1FO5A 2KUCA 1M2DA 1MDJA 1JZOA 2WZ9A 4GSTA 2YPMA 4EXJA 1EGOA 2GSQA 3WD6A 2H1DA 3EWLA 3QR6A 2HSMA 1ZL9A 2R3XA 5KOWA 4L8EA 4NV5A 1XZOA 2FCHA 2DJ0A 3HA9A 4KX4A 1KBNA 3ZVJA 3C8EA 5G30A 2F51A 1JHBA 3DMLA 1JFUA 5F06A 4KDYA 1QMVA 5H5QA 3C73A 2C0FA 4PTSA 5J9BA 4G19A 2H19A 1OC9B 2HZEB 3EINA 1XW6A 1B9XC 1TRSA 2VLTA 4NMUA 5J4YA 3GH6A 1A2MA 5HQPA 2EIQA 1XWGA 2N5FA 2JADA 3VWVA 5DJMA 4EIQA 4OMVA 2FWEA 3PPUA 2OKAA 4HOJA 2VCZA 2IFQB 4AJ7A 2P0GA 3Q18A 4MZCA 4OCEA 4V1Ag 2H1AA 4K7OA 5JWOB 4I97A 2HI7A 1YVLA 4WBJA 1U6TA 1XWCA 4FO5A 1TOFA 2WFCA 3BCKA 4TR1A 1O8WA 5ECLB 2JSZA 5JWQB 2P5QA 4J2FA 3FZ9A 1EWXA 1A8YA 4PNGA 3I69A 4ZB6A 1RK4A 4AKXB 1C72A 1GTUA 4ISDA 2GSTA 3KP8A 2LRNA 1K0CA 4I6XA 5CO3A 5GAPD 2FY6A 3VWUA 2B1LA 1A24A 3P7XA 5IMVA 2OE1A 5ECPB 3EMXA 2VIMA 3LEFA 3GUSA 1X5EA 3ZMKA 2K18A 3H79A 4G2EA 1QGVA 2K6VA 3HJPA 3WGEA 4N0ZA 2A4VA 1M2AA 1M7TA 1ACVA 2FWFA 1VF3A 4LMVA 1GH2A 13GSA 4KE3A 2L5LA 4F03A 5DQSA 4V1Ap 1EV4A 3IV4A 5KOXA 2HRFA 4XIHA 5D9TA 2OADA 5CAXA 3PR8A 1NW2A 3IXRA 1U88A 1OC3A 4TXOA 4IN0A 1Q98A 3QD9A 3ZLPA 2OACA 3ZRDA 5ECKB 2LJRA 4K7IA 2YNXA 1GUKA 5G5FA 4E68A 3QFAC 4K5SA 1TW9A 2F8AA 5D96A 1YEXA 2C0DA 4IW9A 1EV9A 3U6VA 4O5UA 3GTUA 4X4JA 4EUYA 4ZB7A 2YOIA 1V58A 4AI6A 5DALA 1N2AA 2GLRA 1K0OA 2B5YA 4D73A 3TRPA 1SYRA 4E8HA 3ZVJD 3HMJG 2VD1A 1QK8A 1TRUA 3DXBA 1GTBA 3F3RA 4POMA 1EP8A 5HR1A 4G0KA 5DVBA 1T4YA 4N3ZA 1AUCA 1VF1A 5E4WA 4AJ8A 4GRFA 3QPMA 2H6XA 2B7JA 2F8FA 2RLIA 5GAND 2FHEA 3Q6OA 3LWAA 1KEBA 3H4KA 1JLWA 1LBKA 1K3OA 1WOUA 2A2RA 2DKIA 3HVSA 2D2ZA 2GT5A 1FVJA 4BA7A 4F0BA 5IO0A 4KNDA 4O7HA 4EO3A 1WJKA 2DJ3A 1OYJA 3DIEA 3FKFA 5ELGA 2O5VA 1G0TA 2CQ9A 1JLVA 2ZUPA 3E9JB 3DRNA 4JEDA 4ECBA 1PQNA 3EU3A 4ZBDA 2B1KA 2HSMB 2YANA 1W4VA 2PU9C 3HVXA 1BEDA 4PQIA 3VPTA 1ERTA 5B7CA 1OE7A 4BWQA 1Z6MA 2VCTA 2QKEA 3D4MA 2YP6A 2OBKA 3ZYWA 4FH8A 1V40A 1M0UA 4N0VA 3NIVA 4K1FA 4MLYA 3TRXA 4MZBA 2X49A 2CVBA 1O6JA 3GSSA 5IMFA 2IN3A 3F0IA 2NBSA 4USSA 3TJKA 5ECMB 3MSZA 4O5RA 4MZWA 1EZKA 2DKHA 3IE3A 4KH7A 1BAYA 4MK3A 1RW1A 3MAKA 1DE1A 4Z2RA 3C71A 3H8QA 3GNJA 2XC2A 1W89A 2O89A 3D5JA 3KXOA 2MMNA 1PGTA 1OVNA 1A8LA 1UA5A 4ZL7A 2LKUA 3IA1A 3IC4A 3DD3A 3L9UA 5IPHA 3SWLA 4OCFA 5G1KA 2V32A 2IMDA 1OKTA 1ZZYA 3UBKA 1PRXA 2R6KA 3CXGA 3IHQA 5D9XA 3A2WA 1O7UA 1O85A 1Z6NA 3GKKA 3RBTA 2N5BA 3KTBA 4Z2UA 1R7HA 2P31A 4XTSA 2H1GA 4TR1B 1Y1UA 1XBSA 4KUNA 5H5RA 4IQAA 3QDNA 5HR0A 2WJUA 2HSNA 2LTKA 2AB6A 4MPFA 2JU5A 1A0FA 5JWRB 2JZRA 4CY8A 1HNBA 3L78A 4IJIA 4ACSA 4X43A 3G7YA 1XW5A 1PL2A 2F9SA 2PVQA 2GSRA 3V1WA 3EYTA 6GSXA 3M3MA 2GQMA 1H4OA 3HZ4A 3KIJA 4IP6A 1IYHA 3AY8A 4O92A 1SK2A 3ZZXA 3TRQA 5EL8A 2LV3A 2FA8A 2ALBA 2LQOA 1TK0B 5AGYA 2EFEA 2HE3A 4K5RA 5IQYA 4BWSA 5F05A 5F07A 2C3QA 4J56E 3G7IA 2UV8G 2M80A 4ZL9A 4O5QA 3UVHA 1PMTA 1VRSD 4HS1A 3L9VA 5HR2A 5D73A 1X5DA 1UC7A 4W66A 1V9WA 12GSA 3GX8A 3LW9A 3DKSA 1A0RP 4TXOB 2PGTA 2V2GA 4EC0A 5A34A 4MCUA 2PERA 2VKZG 5J41A 2AYTA 2XPEA 3FMWA 11GSA 2DJJA 3UVTA 2PUKC 3HJOA 1NHOA 2OJLA 4NV2A 3GX0A 2KP2A 18GSA 2H73A 3QOUA 2UZ8A 3GTUB 3WT2A 4TW5A 1MD4A 2E2MA 3HJMA 6GSTA 4HJMA 5DALB 3CTGA 3CTFA 4D73B 1PN9A 3ZMLA 1E6BA 22GSA 3CYNA 3J7Yk 4YH2A 1M99A 2O7KA 1XCCA 2H6ZA 2R5GA 2IIYA 4PX1A 2AAWA 1YDKA 4HQZA 2HYXA 4DEJA 4L5LA 4BVXA 2CAIA 2DBCA 4JBBA 8GSSA 4XCSA 4EL1A 3TKSE 4JR6A 2YZUA 5LNKe 1GRXA 1K0NA 2OE3A 3M9KA 1G7OA 1I5GA 4EVMA 1THOA 4FYUA 5B8AA 1OC8A 2FUG2 2I4AA 2KLXA 5F8BA 1R5PA 2IJYA 1EOGA 1EEJA 1OKDA 3IC8A 2RM6A 1SVMA 3C1SA 3DEXA 4MH3A 5J3RA 5KEJA 1FAAA 1YF0A 5EVOA 4POLA 4PURA 1ZCPA 3D21A 2O85A 1TI3A 3FR3A 4WEYA 4K0GA 4HU7A 3QAVA 4Q5RA 1T00A 1GUHA 2VD0A 5A4UA 4V2NA 5E59A 2B7KA 4KW6A 4Z2TA 4TXVA 1F3BA 3ZFBA 3TGZA 4XRDA 1PSQA 3TJBA 2FGXA 4YQUA 1DSBA 4ZBAA 2ES7A 1M9BA 1GP1A 3TKPA 4LL1B 3KCMA 2DLXA 1TJDA 3EURA 2AV4A 2CX3A 5AISA 1K3LA 3VI7A 3PH9A 3BJ5A 5IM9A 16GSA 2JACA 1MD3A 1XW9A 5KN0A 4K2DA 3TJFA 4DVCA 4RQRA 5ID2A 2C4JA 1SKWB 1K0DA 2IWTA 3GL3A 3IPZA 4POBA 3BD2A 1WMJA 4KCAA 1ERWA 3H1NA 1PL1A 4ZB9A 2LNTA 3F4SA 3IRAA 1YJ6A 4Q5FA 3DVXA 3LYKA 3FZ4A 3MDKA 4IP1A 5ABRA 4BL7A 1AIUA 3MNGA 3ERGA 3D4TA 4TKYA 4JU5A 4TOPA 2HSNB 2R0CA 1DBYA 2C8UA 1A2JA 4F2IA 1TK5B 3O76A 5D9WA 2XBIA 5B6NA 5IMCA 2GQLA 3CBUA 1FB6A 4IHUA 1Z3EA 3PINA 5IOXA 3ZREA 2I3YA 4WETA 4MF7A 5LD0A 2HNLA 3VURA 1V98A 1DUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSU A;  3IK7 A;  3F3Q A;  5L71 A;  1SKS B;  1USB A;  3US3 A;  4MJA A;  5CYY A;  1EEM A;  1PKW A;  3VWX A;  3VWW A;  2VL9 A;  4X1U A;  4POK A;  5DQY A;  3QCP A;  2MBT A;  4KGI A;  3LJR A;  5F0G A;  4KAE A;  2R37 A;  5ECS A;  4HI7 A;  3GN3 A;  1F37 A;  2WGR A;  3WGD A;  4LA1 A;  1S3D A;  2GTU A;  4G0I A;  5HFK A;  2YWI A;  2LJA A;  4XS1 A;  3KTL A;  4XHM A;  3W8J A;  4V2M A;  2QC7 A;  3VLN A;  4HZ4 A;  2X8C A;  4ID0 A;  3HCZ A;  4WXT A;  4BPY A;  3TB2 A;  2O87 A;  2XHF A;  4ML6 A;  2C80 A;  4ECJ A;  5ECN B;  1Y6E A;  2KHP A;  2H71 A;  1X0R A;  2X64 A;  1T7P B;  2DJ2 A;  3ED3 A;  3APQ A;  1GSY A;  1XVQ A;  3UOM A;  3HXS A;  2VL2 C;  2DML A;  17GS A;  4ULX A;  1ZMA A;  5B8B A;  3VK9 A;  4KDU A;  1T4Z A;  1K0B A;  2B5X A;  3GKN A;  3CSJ A;  2V1M A;  4P3Y B;  3DVW A;  2IMI A;  2VM2 A;  4WF5 A;  5LCZ A;  4YAP A;  1Z9H A;  4BVX B;  4PQH A;  3TKR A;  5ELA A;  2XPD A;  3A2X A;  3M9J A;  3GRX A;  3ME8 A;  3KMN A;  3KGK A;  5G31 A;  3F9U A;  2CVK A;  5DDL A;  3HYP A;  3ZIJ A;  4RI6 A;  1GNE A;  2DIY A;  1GNW A;  2HT9 A;  5GZZ B;  3LYP A;  4NAX A;  1Y25 A;  5INY A;  4GLT A;  4F82 A;  2CZ2 A;  1ZOF A;  2LRT A;  2K8V A;  2AHE A;  3LG6 A;  4ECI A;  1QXH A;  3KH7 A;  2FWH A;  2PWJ A;  5IMZ A;  2H70 A;  2HFD A;  3RPP A;  4JE1 A;  1WPI A;  2RUE A;  2JZT A;  2RM5 A;  3IR4 A;  1TKD B;  2TRX A;  3N9J A;  4QL7 A;  1Z5Y E;  1NSW A;  2MMZ A;  3ZL5 A;  4FIW A;  1FHE A;  4BVY A;  1EP7 A;  4H86 A;  3WYW A;  4KA0 A;  3H93 A;  3QMX A;  1ON4 A;  3Q19 A;  4XS4 A;  2CT6 A;  1S3A A;  4L0W A;  2C0E A;  1SK0 A;  4KDX A;  1MDK A;  5CNW A;  5IIZ A;  4Q5N A;  3KEB A;  4IS0 A;  2VL2 A;  3GST A;  6GSS A;  1F2E A;  3RDW A;  3TJG A;  5ID2 B;  3E3E A;  5FT3 A;  5KN1 A;  5D9V A;  3FEU A;  3F6D A;  2FLS A;  3FK8 A;  3L0H A;  4K9Z A;  3F4R A;  1GWC A;  4KSM A;  5IOW A;  3GKX A;  4K8M A;  5COH A;  4AJ6 A;  4DSS A;  2ON5 A;  1DE2 A;  3HY2 A;  2VM1 A;  3CRU A;  3WT1 A;  2YCD A;  4N11 A;  1GSF A;  3GYK A;  3QAG A;  4MH2 A;  1ZYQ B;  1BYE A;  2VLV A;  1A2L A;  4BL7 B;  4ML1 A;  3TOU A;  5FHI A;  3A2V A;  1R4W A;  3A3T A;  1TI1 A;  1XWK A;  3HZ8 A;  4QL9 A;  5DCH A;  2K8S A;  4F0C A;  4JRR A;  3HHV A;  2PBJ A;  3UL3 A;  3UAP A;  2MBS A;  3D22 A;  4Q5Q A;  2CX4 A;  2G2Q A;  1WIK A;  5GSS A;  2IPA A;  4TR4 A;  2L57 A;  2YWN A;  1MDI A;  1ML6 A;  1R26 A;  4EE0 A;  5C04 A;  4I2T A;  5H5S A;  2YJ7 A;  1AQV A;  4K6X A;  4OFM A;  4OO5 A;  3J7Y b;  2WDU A;  3TCO A;  3GMF A;  4E8E A;  2VCW A;  2RUF A;  1TTZ A;  3LXT A;  4G9H A;  1BQ7 A;  2WS2 A;  5ENU A;  3GA4 A;  1T8E B;  3EMP A;  1SEN A;  4WKW A;  4JR4 A;  1SK1 A;  1OE8 A;  5EPF A;  1U87 A;  4PGT A;  3ERW A;  3KJY A;  2QSI A;  3W8S A;  4FYC A;  2C0G A;  3P90 A;  4LMW A;  3GFK A;  2ON7 A;  4G10 A;  5HFI A;  1ABA A;  2WCI A;  5G1L A;  3DYR A;  4MAB A;  4EKZ A;  3VFI A;  3P8W A;  2WB9 A;  4WF4 A;  3P2A A;  2MMA A;  1J0F A;  4PQ1 A;  4IQ1 A;  4CDO A;  4HZ2 A;  7GSS A;  1U3A A;  2MYG A;  4I8B A;  1B9Y C;  2YWM A;  2OE0 A;  4PXO A;  1RQM A;  1QUW A;  2HRK A;  3UEM A;  3ZIV A;  2OA7 A;  2BJX A;  1HNC A;  5G5E A;  5JCU A;  2VO4 A;  2GS3 A;  1WP0 A;  1YEP A;  1TU8 A;  4MF5 A;  5CRG A;  2LJK A;  1IYI A;  2RII A;  4DSR A;  1SL2 B;  4F9Z A;  1G6W A;  1TRV A;  2X8H A;  3IDV A;  3QFB C;  2EIR A;  1NHY A;  2VLU A;  5KN2 A;  4KF9 A;  1HNA A;  2ZNM A;  3TKQ A;  5DBQ A;  2HXK A;  3TKS A;  1KNG A;  1YZX A;  2YWO A;  5CRE A;  5AIV A;  1BG5 A;  2C1Y A;  2I1U A;  1EOH A;  2XBQ A;  1WWJ A;  2KOK A;  4ECC A;  2YV9 A;  4KSO A;  5IMD A;  1HD2 A;  1XWA A;  1X9W B;  2H0H A;  3CRT A;  4GQF A;  1OAZ A;  2X8G A;  1GLQ A;  3LQ7 A;  2DJ1 A;  2I81 A;  5KN3 A;  1XIY A;  2GGT A;  3W6G A;  2H0G A;  3HKR A;  1QFN A;  4HU9 A;  3C7M A;  3SBC A;  4MMM A;  4GTU A;  1URM A;  4ZL8 A;  3G7J A;  2L4C A;  5D93 A;  1QQ2 A;  4V2L A;  3IOS A;  4BVY B;  1CQG A;  3RHB A;  4K0N A;  1BJX A;  5D8I A;  1A23 A;  4GCI A;  1ST9 A;  2B3S A;  4MDC A;  4XS4 B;  1O81 A;  1FVK A;  4IKH A;  2IL3 A;  1CQH A;  3M8N A;  2V6K A;  2H8L A;  1F9M A;  1XOA A;  3C1R A;  4IJ3 A;  2IMF A;  2LQQ A;  1B4Q A;  4WBR D;  3HD5 A;  5J5N A;  4N10 A;  1Z7R A;  2L5O A;  4PUF C;  2VL3 A;  2CA8 A;  2BTO T;  4QQ7 A;  3KH9 A;  4EDZ A;  1AXD A;  5A4V A;  4EDY A;  3UBL A;  1I9D A;  4ZIL A;  3O3T A;  2O8V B;  4DSS B;  1M2B A;  2V41 A;  2DMM A;  1VF4 A;  3R3E A;  14GS A;  1AAZ A;  3BBY A;  3VI5 A;  4MA9 A;  2GZP A;  1GSS A;  3FZ5 A;  1GUL A;  2B6M A;  2MMO A;  2LNS A;  3BOA A;  3LXZ A;  6GSY A;  2DC5 A;  2IMK A;  3D6I A;  4AF2 A;  1SD9 A;  2FA4 A;  2HRA A;  2LUS A;  2M46 A;  1B8X A;  4TRX A;  4X0X A;  3LOR A;  4O32 A;  4CW9 A;  5DJL A;  5DCG A;  2AUV A;  1T1V A;  4YQV A;  6GSW A;  4RQX A;  1SL0 B;  5CRD A;  1V2A A;  5HR3 A;  1X9S B;  3EE2 A;  1XFL A;  3F4T A;  1X9M B;  2H72 A;  2L4Q A;  4KB3 A;  3TOT A;  1AQW A;  3IK9 A;  1S3C A;  1V57 A;  2WUL A;  2L6D A;  4TN8 A;  1PX7 A;  4MJC A;  3EU4 A;  1PKZ A;  3DWV A;  9GSS A;  2R4V A;  4IBP A;  1GL8 A;  4GSN A;  4IEL A;  3ZFL A;  1YY7 A;  3M0F A;  1SD8 A;  5DAK A;  2HSY A;  1YKA A;  2C3N A;  1ERU A;  2E0Q A;  3IAS 2;  3GIX A;  3FY7 A;  3RHC A;  2V6O A;  3QAW A;  1FG4 A;  3PGT A;  2DIZ A;  1N8J A;  2JL4 A;  2E2G A;  1LJR A;  1TP9 A;  3APS A;  1VGL A;  3K8N A;  2TIR A;  2H76 A;  1FOV A;  1U3I A;  2HRK B;  1JZR A;  3UJ1 A;  4YQM A;  1T3B A;  2OBI A;  1HYU A;  3CMI A;  1E2Y A;  3G9B A;  3RAZ A;  3M1G A;  3D0Z A;  3ZIT A;  2WRT A;  1SYX A;  3KP9 A;  4OFT A;  5J4U A;  2HSH A;  4N30 A;  3HVV A;  1TK8 B;  2H1B A;  4HDE A;  1ZGN A;  2QGV A;  1GUM A;  4ZXG A;  1GSE A;  2TRC P;  1THX A;  4I5Q A;  4LLR A;  2GQK A;  4NXI A;  3FR9 A;  5CP1 A;  3ZTL A;  2VCQ A;  1G6Y A;  1K0M A;  3UMA A;  2Z9S A;  4FYB A;  2YN1 A;  4PUA A;  1EGR A;  4GQC A;  2BMX A;  4Z7X A;  4XRA A;  4PNF A;  3Q74 A;  4TR0 A;  3F63 A;  5AN1 A;  2NVL A;  3EC3 A;  1H75 A;  5J9C A;  2KP1 A;  4FQU A;  1B4P A;  3UIW A;  4MPG A;  3GHA A;  5IMA A;  3TDG A;  4RUV A;  4NPB A;  3R2Q A;  5JCG A;  1WRY A;  2JZS A;  2N5A A;  1FW1 A;  3I9V 2;  4IVF A;  1GSD A;  1SJ6 A;  5BMU A;  4G0L A;  4XS6 A;  2NPB A;  1TRW A;  3APO A;  1UN2 A;  10GS A;  5ECR B;  5IO2 A;  2REM A;  4ILF A;  1GTI A;  20GS A;  3IBH A;  2GVP A;  1FB0 A;  1Z7P A;  5AIX A;  1VF2 A;  5JCW A;  2H75 A;  3A5W A;  6GSV A;  2DJK A;  2YV7 A;  3FYG A;  2JSY A;  4LL4 B;  3LFL A;  1GLP A;  1AQX A;  4IGJ A;  2R2J A;  2F3M A;  1XVW A;  2CZ3 A;  1SJZ A;  2VOC A;  1R5A A;  3FR6 A;  1JZW A;  2HZF A;  3L4N A;  4MJE A;  3S9F A;  4AGS A;  2H6Y A;  5EY6 A;  2NDO A;  2GZZ A;  2C3T A;  5A4W A;  1JZD A;  1MEK A;  2FNO A;  3GV1 A;  4TVE A;  5IPG A;  1YQ1 A;  4J57 E;  2GZY A;  3N5O A;  2K9F A;  4TR3 A;  5ECH B;  3GL5 A;  3WGX A;  3JCM L;  1OC9 A;  2HZE A;  1J08 A;  1XOB A;  4YAV A;  3KD0 A;  4DSQ A;  1MTC A;  4OFN A;  3O6T A;  2J9H A;  3GKM A;  4K7N A;  3I6A A;  1BX9 A;  2L59 A;  4OD7 A;  3U5R E;  2IFQ A;  2YZH A;  3F6F A;  2PVO C;  2ZCT A;  3RPN A;  2HRN A;  2VCV A;  2LEG A;  3TKS C;  5A5K A;  1GSU A;  2FWG A;  5CRW A;  3FW2 A;  3E0U A;  3ERF A;  1PD2 1;  1PX6 A;  3OR5 A;  1AW9 A;  4WR4 A;  3KM6 A;  2I9H A;  2G0F A;  3ME7 A;  3VPQ A;  1XWB A;  4NWY A;  2FD3 A;  4GXZ A;  2VCX A;  3GH9 A;  5ECQ B;  3MWH A;  5DAK B;  3KMO A;  5ECI B;  19GS A;  2J23 A;  4GWR A;  1ZYE A;  3LSZ A;  1ILO A;  1SKR B;  1HQO A;  1PA3 A;  4JZQ A;  4HQS A;  2YJH A;  1J9B A;  4HEA 2;  4MP4 A;  3L9S A;  1TU7 A;  1GSQ A;  4OWY A;  2AJQ B;  5FWG A;  4OO4 A;  3KZQ A;  4WR5 A;  3NOF A;  2VAF A;  2A2S A;  4L5O A;  1XPV A;  1TXX A;  2GSS A;  2L6C A;  1GTA A;  3ISO A;  1KTE A;  4RI7 A;  3TJJ A;  4EF0 A;  1TDI A;  5HFG A;  3UAR A;  4I2U A;  3TUE A;  2H66 A;  5CRH A;  3IAM 2;  3LGC A;  2PPT A;  3BCI A;  1F3A A;  2H30 A;  2GT6 A;  1SL1 B;  2LST A;  3HDC A;  4GF0 A;  1O73 A;  3NZN A;  1UVZ A;  4HJ2 A;  3I43 A;  2CVD A;  2HQT A;  3CSH A;  1G7E A;  4HUA A;  4GSS A;  2M72 A;  3F8U A;  1F6M C;  1YKC A;  1Q4J A;  1XXU A;  2VUP A;  4MJB A;  1WE0 A;  4ZBB A;  2CV4 A;  4CHS A;  2B5E A;  2LRC A;  2MZC A;  4NHZ A;  1YF1 A;  4L0U A;  2H01 A;  2CAQ A;  1K3Y A;  1O8X A;  4NHW A;  2IME A;  1ERV A;  2PMT A;  4ZB8 A;  3FRC A;  2EIO A;  3CSI A;  5ECO B;  1AC1 A;  2P5R A;  4ZIJ A;  2GDR A;  1SU9 A;  5C00 A;  1LU4 A;  1M9A A;  2H0I A;  1SJI A;  4MF6 A;  3FHK A;  2E7P A;  2DSA A;  3EVI A;  2X99 A;  4KCE A;  1B48 A;  1NM3 A;  2EC4 A;  2LS5 A;  2HLS A;  3DGQ A;  2PN8 A;  1X5C A;  2NTO A;  1K0A A;  3GUR A;  2H74 A;  5GST A;  5G2Z A;  5B6M A;  3FZA A;  1FO5 A;  2KUC A;  1M2D A;  1MDJ A;  1JZO A;  2WZ9 A;  4GST A;  2YPM A;  4EXJ A;  1EGO A;  2GSQ A;  3WD6 A;  2H1D A;  3EWL A;  3QR6 A;  2HSM A;  1ZL9 A;  2R3X A;  4L8E A;  4NV5 A;  1XZO A;  2FCH A;  2DJ0 A;  3HA9 A;  4KX4 A;  1KBN A;  3ZVJ A;  3C8E A;  5G30 A;  2F51 A;  1JHB A;  3DML A;  1JFU A;  5F06 A;  4KDY A;  1QMV A;  5H5Q A;  3C73 A;  2C0F A;  4PTS A;  5J9B A;  4G19 A;  2H19 A;  1OC9 B;  2HZE B;  3EIN A;  1XW6 A;  1B9X C;  1TRS A;  2VLT A;  4NMU A;  3GH6 A;  1A2M A;  5HQP A;  2EIQ A;  1XWG A;  2N5F A;  2JAD A;  3VWV A;  5DJM A;  4OMV A;  2FWE A;  3PPU A;  2OKA A;  4HOJ A;  2VCZ A;  2IFQ B;  4AJ7 A;  2P0G A;  3Q18 A;  4MZC A;  4OCE A;  4V1A g;  2H1A A;  4K7O A;  5JWO B;  4I97 A;  2HI7 A;  4WBJ A;  1U6T A;  1XWC A;  4FO5 A;  1TOF A;  2WFC A;  3BCK A;  4TR1 A;  1O8W A;  5ECL B;  2JSZ A;  5JWQ B;  2P5Q A;  4J2F A;  3FZ9 A;  1EWX A;  1A8Y A;  4PNG A;  3I69 A;  4ZB6 A;  1RK4 A;  1C72 A;  1GTU A;  4ISD A;  2GST A;  3KP8 A;  2LRN A;  1K0C A;  4I6X A;  5CO3 A;  5GAP D;  2FY6 A;  3VWU A;  2B1L A;  1A24 A;  3P7X A;  5IMV A;  2OE1 A;  5ECP B;  3EMX A;  2VIM A;  3LEF A;  3GUS A;  1X5E A;  3ZMK A;  2K18 A;  3H79 A;  4G2E A;  1QGV A;  2K6V A;  3HJP A;  3WGE A;  4N0Z A;  2A4V A;  1M2A A;  1M7T A;  1ACV A;  2FWF A;  1VF3 A;  4LMV A;  1GH2 A;  13GS A;  4KE3 A;  2L5L A;  4F03 A;  5DQS A;  4V1A p;  1EV4 A;  3IV4 A;  2HRF A;  4XIH A;  5D9T A;  2OAD A;  5CAX A;  3PR8 A;  1NW2 A;  3IXR A;  1U88 A;  1OC3 A;  4TXO A;  4IN0 A;  1Q98 A;  3QD9 A;  3ZLP A;  2OAC A;  3ZRD A;  5ECK B;  2LJR A;  4K7I A;  2YNX A;  1GUK A;  5G5F A;  3QFA C;  1TW9 A;  2F8A A;  5D96 A;  1YEX A;  2C0D A;  4IW9 A;  1EV9 A;  3U6V A;  3GTU A;  4EUY A;  2YOI A;  1V58 A;  5DAL A;  1N2A A;  2GLR A;  1K0O A;  2B5Y A;  4D73 A;  3TRP A;  1SYR A;  4E8H A;  3ZVJ D;  2VD1 A;  1QK8 A;  1TRU A;  3DXB A;  1GTB A;  3F3R A;  4POM A;  1EP8 A;  5HR1 A;  4G0K A;  5DVB A;  1T4Y A;  1AUC A;  1VF1 A;  5E4W A;  4AJ8 A;  4GRF A;  3QPM A;  2H6X A;  2B7J A;  2F8F A;  2RLI A;  5GAN D;  2FHE A;  3Q6O A;  3LWA A;  1KEB A;  3H4K A;  1JLW A;  1LBK A;  1K3O A;  1WOU A;  2A2R A;  3HVS A;  2D2Z A;  2GT5 A;  1FVJ A;  4BA7 A;  4F0B A;  5IO0 A;  4KND A;  4O7H A;  4EO3 A;  2DJ3 A;  1WJK A;  1OYJ A;  3DIE A;  3FKF A;  5ELG A;  1G0T A;  2CQ9 A;  1JLV A;  2ZUP A;  3E9J B;  3DRN A;  4JED A;  4ECB A;  1PQN A;  3EU3 A;  4ZBD A;  2B1K A;  2HSM B;  2YAN A;  1W4V A;  2PU9 C;  3HVX A;  1BED A;  4PQI A;  3VPT A;  1ERT A;  5B7C A;  1OE7 A;  4BWQ A;  1Z6M A;  2VCT A;  2QKE A;  3D4M A;  2YP6 A;  2OBK A;  3ZYW A;  4FH8 A;  1V40 A;  1M0U A;  4N0V A;  3NIV A;  4K1F A;  4MLY A;  3TRX A;  4MZB A;  2CVB A;  1O6J A;  3GSS A;  5IMF A;  2IN3 A;  3F0I A;  2NBS A;  4USS A;  3TJK A;  5ECM B;  3MSZ A;  4O5R A;  4MZW A;  1EZK A;  3IE3 A;  4KH7 A;  1BAY A;  4MK3 A;  1RW1 A;  3MAK A;  1DE1 A;  3C71 A;  3H8Q A;  3GNJ A;  2XC2 A;  1W89 A;  2O89 A;  3D5J A;  3KXO A;  2MMN A;  1PGT A;  1OVN A;  1A8L A;  1UA5 A;  4ZL7 A;  2LKU A;  3IA1 A;  3IC4 A;  3DD3 A;  3L9U A;  5IPH A;  3SWL A;  4OCF A;  5G1K A;  2V32 A;  2IMD A;  1OKT A;  1ZZY A;  3UBK A;  1PRX A;  2R6K A;  3CXG A;  3IHQ A;  5D9X A;  3A2W A;  1O7U A;  1O85 A;  1Z6N A;  3GKK A;  3RBT A;  2N5B A;  3KTB A;  1R7H A;  2P31 A;  4XTS A;  2H1G A;  4TR1 B;  1XBS A;  4KUN A;  5H5R A;  4IQA A;  3QDN A;  5HR0 A;  2WJU A;  2LTK A;  2AB6 A;  4MPF A;  2JU5 A;  1A0F A;  5JWR B;  2JZR A;  1HNB A;  3L78 A;  4IJI A;  4ACS A;  4X43 A;  3G7Y A;  1XW5 A;  1PL2 A;  2F9S A;  2PVQ A;  2GSR A;  3V1W A;  3EYT A;  6GSX A;  3M3M A;  2GQM A;  1H4O A;  3HZ4 A;  3KIJ A;  4IP6 A;  1IYH A;  3AY8 A;  4O92 A;  1SK2 A;  3ZZX A;  3TRQ A;  5EL8 A;  2LV3 A;  2FA8 A;  2ALB A;  2LQO A;  1TK0 B;  5AGY A;  2HE3 A;  5IQY A;  4BWS A;  5F05 A;  5F07 A;  2C3Q A;  4J56 E;  3G7I A;  2M80 A;  4ZL9 A;  3UVH A;  1PMT A;  1VRS D;  4HS1 A;  3L9V A;  5HR2 A;  5D73 A;  1X5D A;  1UC7 A;  1V9W A;  12GS A;  3GX8 A;  3DKS A;  1A0R P;  4TXO B;  2PGT A;  2V2G A;  4EC0 A;  4MCU A;  2PER A;  5J41 A;  2AYT A;  2XPE A;  11GS A;  2DJJ A;  3UVT A;  2PUK C;  3HJO A;  1NHO A;  2OJL A;  4NV2 A;  3GX0 A;  2KP2 A;  18GS A;  2H73 A;  3QOU A;  2UZ8 A;  3GTU B;  3WT2 A;  4TW5 A;  1MD4 A;  2E2M A;  3HJM A;  6GST A;  4HJM A;  5DAL B;  3CTG A;  3CTF A;  4D73 B;  1PN9 A;  3ZML A;  1E6B A;  22GS A;  3CYN A;  3J7Y k;  4YH2 A;  1M99 A;  2O7K A;  1XCC A;  2H6Z A;  2R5G A;  2IIY A;  4PX1 A;  2AAW A;  1YDK A;  4HQZ A;  2HYX A;  4DEJ A;  4L5L A;  4BVX A;  2CAI A;  2DBC A;  4JBB A;  8GSS A;  4XCS A;  4EL1 A;  3TKS E;  4JR6 A;  2YZU A;  5LNK e;  1GRX A;  1K0N A;  2OE3 A;  3M9K A;  1G7O A;  1I5G A;  4EVM A;  1THO A;  4FYU A;  5B8A A;  1OC8 A;  2FUG 2;  2I4A A;  2KLX A;  5F8B A;  1R5P A;  2IJY A;  1EOG A;  1EEJ A;  1OKD A;  3IC8 A;  2RM6 A;  3C1S A;  3DEX A;  4MH3 A;  5J3R A;  5KEJ A;  1FAA A;  1YF0 A;  5EVO A;  4POL A;  4PUR A;  1ZCP A;  3D21 A;  2O85 A;  1TI3 A;  3FR3 A;  4WEY A;  4K0G A;  4HU7 A;  3QAV A;  4Q5R A;  1T00 A;  1GUH A;  2VD0 A;  5A4U A;  4V2N A;  5E59 A;  2B7K A;  4KW6 A;  4TXV A;  1F3B A;  3ZFB A;  3TGZ A;  4XRD A;  1PSQ A;  3TJB A;  2FGX A;  4YQU A;  1DSB A;  4ZBA A;  2ES7 A;  1M9B A;  1GP1 A;  3TKP A;  4LL1 B;  3KCM A;  2DLX A;  1TJD A;  3EUR A;  2AV4 A;  2CX3 A;  5AIS A;  3PH9 A;  1K3L A;  3VI7 A;  3BJ5 A;  5IM9 A;  16GS A;  2JAC A;  1MD3 A;  1XW9 A;  5KN0 A;  4K2D A;  3TJF A;  4DVC A;  4RQR A;  5ID2 A;  2C4J A;  1SKW B;  1K0D A;  2IWT A;  3GL3 A;  3IPZ A;  4POB A;  3BD2 A;  1WMJ A;  4KCA A;  1ERW A;  3H1N A;  1PL1 A;  4ZB9 A;  2LNT A;  3F4S A;  3IRA A;  1YJ6 A;  4Q5F A;  3DVX A;  3LYK A;  3FZ4 A;  3MDK A;  4IP1 A;  5ABR A;  4BL7 A;  1AIU A;  3MNG A;  3ERG A;  3D4T A;  4TKY A;  4JU5 A;  4TOP A;  2HSN B;  1DBY A;  2C8U A;  1A2J A;  4F2I A;  1TK5 B;  3O76 A;  5D9W A;  2XBI A;  5B6N A;  5IMC A;  2GQL A;  3CBU A;  1FB6 A;  4IHU A;  1Z3E A;  3PIN A;  5IOX A;  3ZRE A;  2I3Y A;  4WET A;  4MF7 A;  5LD0 A;  2HNL A;  3VUR A;  1V98 A;  1DUG A; 
#chains in the Genus database with same CATH topology
 6GSU A;  2WW3 A;  3IK7 A;  3F3Q A;  5L71 A;  1SKS B;  1USB A;  3US3 A;  4MJA A;  4AKI A;  5CYY A;  1EEM A;  1PKW A;  3VWX A;  3VWW A;  2VL9 A;  4X1U A;  4POK A;  5DQY A;  3QCP A;  2MBT A;  4KGI A;  3LJR A;  5F0G A;  4KAE A;  2R37 A;  5ECS A;  4HI7 A;  3GN3 A;  1F37 A;  2WGR A;  3WGD A;  4LA1 A;  1S3D A;  2GTU A;  4G0I A;  5HFK A;  2YWI A;  2LJA A;  4XS1 A;  3KTL A;  4XHM A;  3W8J A;  4V2M A;  2QC7 A;  5A34 B;  1M3I A;  3VLN A;  4MNN A;  4HZ4 A;  2X8C A;  4ID0 A;  3HCZ A;  4WXT A;  4BPY A;  3TB2 A;  2O87 A;  2XHF A;  4ML6 A;  2C80 A;  4ECJ A;  5ECN B;  1Y6E A;  2KHP A;  1XG8 A;  2H71 A;  1X0R A;  2X64 A;  1T7P B;  2DJ2 A;  3ED3 A;  3APQ A;  1GSY A;  1XVQ A;  3UOM A;  3HXS A;  2VL2 C;  2DML A;  17GS A;  4ULX A;  1ZMA A;  5B8B A;  3VK9 A;  4KDU A;  1T4Z A;  1K0B A;  2B5X A;  3MIX A;  4K2X A;  3GKN A;  3CSJ A;  2V1M A;  4P3Y B;  3DVW A;  2IMI A;  2VM2 A;  4WF5 A;  5LCZ A;  4YAP A;  1Z9H A;  4BVX B;  4PQH A;  3TKR A;  5ELA A;  4G01 A;  2XPD A;  3A2X A;  3M9J A;  3GRX A;  3ME8 A;  3KMN A;  3KGK A;  5G31 A;  3F9U A;  2CVK A;  5DDL A;  3HYP A;  3ZIJ A;  4RI6 A;  1GNE A;  4ICY A;  2DIY A;  1GNW A;  2HT9 A;  5GZZ B;  3LYP A;  2R0P A;  4NAX A;  1Y25 A;  5INY A;  4GLT A;  4F82 A;  2CZ2 A;  1ZOF A;  2LRT A;  2K8V A;  2AHE A;  3LG6 A;  4ECI A;  1QXH A;  3KH7 A;  2FWH A;  2PWJ A;  5IMZ A;  2H70 A;  2HFD A;  3RPP A;  4JE1 A;  1WPI A;  2RUE A;  2JZT A;  1N25 A;  2RM5 A;  3IR4 A;  1TKD B;  2TRX A;  3N9J A;  4QL7 A;  1Z5Y E;  1NSW A;  2MMZ A;  3ZL5 A;  4FIW A;  1FHE A;  4BVY A;  1EP7 A;  4H86 A;  3WYW A;  4KA0 A;  3H93 A;  3QMX A;  1ON4 A;  3Q19 A;  4XS4 A;  2CT6 A;  1S3A A;  4L0W A;  2C0E A;  2WVX B;  1SK0 A;  4KDX A;  1MDK A;  5CNW A;  5IIZ A;  4Q5N A;  3KEB A;  4IS0 A;  2VL2 A;  3GST A;  6GSS A;  1F2E A;  3RDW A;  3TJG A;  5ID2 B;  3E3E A;  5FT3 A;  5KN1 A;  2WZS A;  5D9V A;  3FEU A;  3F6D A;  2FLS A;  3FK8 A;  3L0H A;  4K9Z A;  3F4R A;  1GWC A;  4KSM A;  5IOW A;  3GKX A;  4K8M A;  5COH A;  4AJ6 A;  4DSS A;  2ON5 A;  1DE2 A;  3HY2 A;  2VM1 A;  3CRU A;  3WT1 A;  2YCD A;  4N11 A;  1GSF A;  5J47 A;  3GYK A;  3QAG A;  4MH2 A;  1ZYQ B;  1BYE A;  2VLV A;  1A2L A;  4BL7 B;  4ML1 A;  3TOU A;  5FHI A;  3A2V A;  1R4W A;  3A3T A;  1TI1 A;  1XWK A;  3HZ8 A;  4QL9 A;  5DCH A;  2K8S A;  4F0C A;  4JRR A;  3HHV A;  2PBJ A;  3UL3 A;  3UAP A;  2MBS A;  3D22 A;  4Q5Q A;  2CX4 A;  2G2Q A;  1WIK A;  5GSS A;  2IPA A;  4TR4 A;  2L57 A;  2YWN A;  1MDI A;  1ML6 A;  1R26 A;  4EE0 A;  5C04 A;  4I2T A;  5H5S A;  2YJ7 A;  1AQV A;  4K6X A;  4OFM A;  4OO5 A;  3J7Y b;  2WDU A;  3TCO A;  3GMF A;  4E8E A;  2VCW A;  2RUF A;  1TTZ A;  3LXT A;  4G9H A;  1BQ7 A;  2WS2 A;  5ENU A;  4PI0 C;  3GA4 A;  1T8E B;  3EMP A;  1SEN A;  4WKW A;  2QA1 A;  4JR4 A;  4PHZ C;  1SK1 A;  1OE8 A;  5EPF A;  1U87 A;  4PGT A;  3ERW A;  3KJY A;  2QSI A;  3W8S A;  4FYC A;  2C0G A;  3P90 A;  4LMW A;  4QMK A;  3GFK A;  2ON7 A;  4G10 A;  5HFI A;  1ABA A;  2WCI A;  5G1L A;  3DYR A;  4MAB A;  4EKZ A;  3VFI A;  2WB9 A;  3P8W A;  4WF4 A;  3P2A A;  2MMA A;  1J0F A;  4PQ1 A;  4IQ1 A;  4CDO A;  4HZ2 A;  7GSS A;  1U3A A;  2MYG A;  4I8B A;  1B9Y C;  2YWM A;  2OE0 A;  4PXO A;  1RQM A;  1QUW A;  2HRK A;  3UEM A;  3ZIV A;  2OA7 A;  2BJX A;  1HNC A;  1BF5 A;  5G5E A;  5JCU A;  2VO4 A;  2GS3 A;  1WP0 A;  1YEP A;  1TU8 A;  4MF5 A;  5CRG A;  2LJK A;  1IYI A;  2RII A;  4DSR A;  4A5P A;  1SL2 B;  4F9Z A;  1G6W A;  1TRV A;  2X8H A;  3IDV A;  3QFB C;  2EIR A;  1NHY A;  2VLU A;  5KN2 A;  4KF9 A;  1HNA A;  2ZNM A;  3TKQ A;  5DBQ A;  2HXK A;  3TKS A;  1KNG A;  1YZX A;  2YWO A;  5CRE A;  5AIV A;  3EPT A;  1BG5 A;  2C1Y A;  2I1U A;  1EOH A;  2XBQ A;  1BG1 A;  1WWJ A;  2KOK A;  4ECC A;  2YV9 A;  4KSO A;  5IMD A;  1HD2 A;  1XWA A;  1X9W B;  2H0H A;  3CRT A;  4GQF A;  1OAZ A;  2X8G A;  5A5H A;  1GLQ A;  3LQ7 A;  2DJ1 A;  2I81 A;  5KN3 A;  1XIY A;  2GGT A;  3W6G A;  2H0G A;  3HKR A;  1QFN A;  4HU9 A;  3C7M A;  1FOH A;  3SBC A;  4MMM A;  1TXU A;  4GTU A;  1URM A;  4ZL8 A;  3G7J A;  2L4C A;  5D93 A;  1QQ2 A;  4V2L A;  3IOS A;  4BVY B;  1CQG A;  3RHB A;  4K0N A;  3CWG A;  1BJX A;  5D8I A;  1A23 A;  4GCI A;  1ST9 A;  2B3S A;  4MDC A;  4XS4 B;  1O81 A;  1FVK A;  4IKH A;  2IL3 A;  1CQH A;  4FXY P;  3M8N A;  2V6K A;  2H8L A;  1F9M A;  1XOA A;  3C1R A;  4IJ3 A;  2IMF A;  2LQQ A;  1B4Q A;  4WBR D;  3HD5 A;  5J5N A;  4N10 A;  1Z7R A;  2L5O A;  4PUF C;  2VL3 A;  2CA8 A;  2BTO T;  4QQ7 A;  3KH9 A;  4EDZ A;  1AXD A;  5A4V A;  4EDY A;  3UBL A;  1I9D A;  4ZIL A;  3O3T A;  2O8V B;  4DSS B;  1M2B A;  2V41 A;  2DMM A;  1VF4 A;  3R3E A;  14GS A;  1AAZ A;  3BBY A;  3VI5 A;  4MA9 A;  2GZP A;  1GSS A;  3FZ5 A;  1GUL A;  2B6M A;  2MMO A;  1YEW C;  2LNS A;  3BOA A;  3LXZ A;  6GSY A;  2DC5 A;  2IMK A;  3D6I A;  4AF2 A;  1SD9 A;  2FA4 A;  2HRA A;  2LUS A;  2M46 A;  1B8X A;  4TRX A;  4X0X A;  3LOR A;  4O32 A;  4CW9 A;  5DJL A;  5DCG A;  2AUV A;  1T1V A;  4YQV A;  6GSW A;  4RQX A;  1ZYP A;  1SL0 B;  5CRD A;  1V2A A;  5HR3 A;  1X9S B;  3EE2 A;  1XFL A;  3F4T A;  1X9M B;  2H72 A;  2L4Q A;  4KB3 A;  3TOT A;  1AQW A;  3IK9 A;  1S3C A;  1V57 A;  2WUL A;  2L6D A;  4TN8 A;  1PX7 A;  4AKG A;  4MJC A;  3EU4 A;  4YKF A;  4EIP A;  1M3J A;  1PKZ A;  3DWV A;  9GSS A;  2R4V A;  4IBP A;  1GL8 A;  4GSN A;  4IEL A;  3ZFL A;  1YY7 A;  3M0F A;  1SD8 A;  5DAK A;  2HSY A;  1YKA A;  2C3N A;  1ERU A;  2E0Q A;  3IAS 2;  3GIX A;  3FY7 A;  3RHC A;  2V6O A;  3QAW A;  1FG4 A;  3PGT A;  2DIZ A;  1N8J A;  2JL4 A;  2E2G A;  1LJR A;  1TP9 A;  3APS A;  1VGL A;  3K8N A;  2TIR A;  2H76 A;  1FOV A;  1U3I A;  2HRK B;  1JZR A;  3UJ1 A;  4YQM A;  2OT3 A;  1T3B A;  2OBI A;  1HYU A;  3CMI A;  3G9B A;  2EFH A;  1E2Y A;  3RAZ A;  3M1G A;  3D0Z A;  3ZIT A;  5A1N A;  2WRT A;  1SYX A;  3KP9 A;  4OFT A;  5J4U A;  2HSH A;  4N30 A;  3HVV A;  1TK8 B;  3CHX C;  2H1B A;  4HDE A;  1ZGN A;  2QGV A;  1GUM A;  4ZXG A;  1GSE A;  2TRC P;  1THX A;  4I5Q A;  4LLR A;  2GQK A;  4NXI A;  3FR9 A;  5CP1 A;  3HVN A;  3ZTL A;  2VCQ A;  1G6Y A;  2O3E A;  1K0M A;  3UMA A;  2Z9S A;  4FYB A;  2YN1 A;  4PUA A;  1EGR A;  4GQC A;  1SVL A;  2BMX A;  4Z7X A;  4XRA A;  4PNF A;  3Q74 A;  4TR0 A;  3F63 A;  5AN1 A;  2NVL A;  3EC3 A;  1H75 A;  5A5H B;  5J9C A;  2KP1 A;  4FQU A;  1B4P A;  3UIW A;  3CQF A;  4MPG A;  3GHA A;  5IMA A;  3TDG A;  4RUV A;  4NPB A;  3R2Q A;  5JCG A;  1WRY A;  2A2P A;  2JZS A;  2N5A A;  1FW1 A;  3I9V 2;  4IVF A;  1GSD A;  1SJ6 A;  5BMU A;  4G0L A;  4XS6 A;  2NPB A;  1TRW A;  3APO A;  1UN2 A;  10GS A;  5ECR B;  5IO2 A;  2REM A;  4ILF A;  1GTI A;  20GS A;  3IBH A;  2GVP A;  1FB0 A;  1Z7P A;  5AIX A;  1VF2 A;  5JCW A;  2H75 A;  3A5W A;  6GSV A;  2DJK A;  2YV7 A;  3FYG A;  2JSY A;  4LL4 B;  3LFL A;  1GLP A;  1AQX A;  4IGJ A;  2R2J A;  2F3M A;  1XVW A;  2CZ3 A;  3TU3 B;  1SJZ A;  2VOC A;  1R5A A;  3FR6 A;  1JZW A;  2HZF A;  3L4N A;  4MJE A;  3S9F A;  4AGS A;  2H6Y A;  5EY6 A;  2NDO A;  2GZZ A;  2WW2 A;  2C3T A;  5A4W A;  1JZD A;  1MEK A;  2FNO A;  1ZYN A;  3GV1 A;  2A4H A;  4TVE A;  5IPG A;  1YQ1 A;  4J57 E;  2GZY A;  3N5O A;  2K9F A;  4TR3 A;  5ECH B;  3GL5 A;  3WGX A;  3JCM L;  1OC9 A;  2HZE A;  1J08 A;  1XOB A;  4YAV A;  3KD0 A;  4DSQ A;  1MTC A;  4OFN A;  3O6T A;  2J9H A;  2WVZ A;  3GKM A;  4K7N A;  3I6A A;  1BX9 A;  2L59 A;  2O36 A;  4OD7 A;  3MYD A;  3U5R E;  5J40 A;  2IFQ A;  2YZH A;  3F6F A;  2PVO C;  2ZCT A;  3A5I A;  3RPN A;  2HRN A;  2VCV A;  2LEG A;  3TKS C;  5A5K A;  5BRT A;  1GSU A;  2FWG A;  5CRW A;  3FW2 A;  3E0U A;  3ERF A;  2H1L A;  1PD2 1;  1PX6 A;  3OR5 A;  1AW9 A;  4WR4 A;  3KM6 A;  2QA2 A;  2I9H A;  2G0F A;  3ME7 A;  3VPQ A;  1XWB A;  4NWY A;  2FD3 A;  4GXZ A;  2X4A A;  2VCX A;  5J4V A;  3GH9 A;  5ECQ B;  3MWH A;  5DAK B;  3KMO A;  5ECI B;  19GS A;  2J23 A;  2WW0 A;  1ZYE A;  2EFC A;  4GWR A;  3LSZ A;  1ILO A;  3IHG A;  1SKR B;  1HQO A;  1PA3 A;  1PN0 A;  4JZQ A;  4HQS A;  2YJH A;  1J9B A;  4HEA 2;  4MP4 A;  3L9S A;  1TU7 A;  1GSQ A;  4OWY A;  2AJQ B;  5FWG A;  4OO4 A;  3KZQ A;  4WR5 A;  3NOF A;  4YKG A;  2VAF A;  2A2S A;  4L5O A;  1XPV A;  1TXX A;  2GSS A;  2WW1 A;  4AKH A;  2L6C A;  1GTA A;  3ISO A;  1KTE A;  4RI7 A;  3TJJ A;  4EF0 A;  1TDI A;  5HFG A;  3UAR A;  4I2U A;  3TUE A;  2H66 A;  4GDF A;  5CRH A;  3IAM 2;  5A1N B;  3LGC A;  2PPT A;  3BCI A;  1F3A A;  2H30 A;  2GT6 A;  1SL1 B;  2LST A;  3HDC A;  4CY6 A;  4GF0 A;  1O73 A;  3NZN A;  1UVZ A;  4HJ2 A;  3I43 A;  2CVD A;  2HQT A;  3CSH A;  1G7E A;  4HUA A;  4GSS A;  2M72 A;  3F8U A;  1F6M C;  1YKC A;  1Q4J A;  2R0G A;  1XXU A;  2VUP A;  4MJB A;  1WE0 A;  4ZBB A;  2CV4 A;  4CHS A;  2B5E A;  2LRC A;  2MZC A;  4NHZ A;  1YF1 A;  4L0U A;  2H01 A;  2EFD A;  2CAQ A;  1K3Y A;  1O8X A;  4NHW A;  2IME A;  1ERV A;  2PMT A;  4ZB8 A;  3FRC A;  2EIO A;  3CSI A;  5ECO B;  1AC1 A;  2P5R A;  4ZIJ A;  2GDR A;  1SU9 A;  5C00 A;  1LU4 A;  1M9A A;  2H0I A;  1SVO A;  1SJI A;  4MF6 A;  3FHK A;  2E7P A;  2DSA A;  3EVI A;  2X99 A;  4KCE A;  5BMU B;  1B48 A;  1NM3 A;  2EC4 A;  2LS5 A;  2HLS A;  3DGQ A;  2PN8 A;  1X5C A;  2NTO A;  1K0A A;  3GUR A;  2H74 A;  5GST A;  5G2Z A;  3RFR C;  5B6M A;  3FZA A;  1FO5 A;  2KUC A;  1M2D A;  1MDJ A;  1JZO A;  2WZ9 A;  4GST A;  2YPM A;  4EXJ A;  1EGO A;  2GSQ A;  3WD6 A;  2H1D A;  3EWL A;  3QR6 A;  2HSM A;  1ZL9 A;  2R3X A;  5KOW A;  4L8E A;  4NV5 A;  1XZO A;  2FCH A;  4PI2 C;  2DJ0 A;  3HA9 A;  4KX4 A;  1KBN A;  3ZVJ A;  3C8E A;  5G30 A;  2F51 A;  1JHB A;  3DML A;  1JFU A;  5F06 A;  4KDY A;  1QMV A;  5H5Q A;  3C73 A;  2C0F A;  4PTS A;  5J9B A;  4G19 A;  2H19 A;  1OC9 B;  2HZE B;  3EIN A;  1XW6 A;  1B9X C;  1TRS A;  2VLT A;  4NMU A;  5J4Y A;  3GH6 A;  1A2M A;  5HQP A;  2EIQ A;  1XWG A;  2N5F A;  2JAD A;  3VWV A;  5DJM A;  4EIQ A;  4OMV A;  2FWE A;  3PPU A;  2OKA A;  4HOJ A;  2VCZ A;  2IFQ B;  4AJ7 A;  2P0G A;  3Q18 A;  4MZC A;  4OCE A;  4V1A g;  2H1A A;  4K7O A;  5JWO B;  4I97 A;  2HI7 A;  1YVL A;  4WBJ A;  1U6T A;  1XWC A;  4FO5 A;  1TOF A;  2WFC A;  3BCK A;  4TR1 A;  1O8W A;  5ECL B;  2JSZ A;  5JWQ B;  2P5Q A;  4J2F A;  3FZ9 A;  1EWX A;  1A8Y A;  4PNG A;  3I69 A;  4ZB6 A;  1RK4 A;  4AKX B;  1I1I P;  1C72 A;  1GTU A;  4ISD A;  2GST A;  3KP8 A;  2LRN A;  1K0C A;  4I6X A;  5CO3 A;  5GAP D;  2FY6 A;  3VWU A;  2B1L A;  1A24 A;  3P7X A;  5IMV A;  2OE1 A;  5ECP B;  3EMX A;  2VIM A;  3LEF A;  3GUS A;  1X5E A;  3ZMK A;  2K18 A;  3H79 A;  4G2E A;  1QGV A;  2K6V A;  3HJP A;  3WGE A;  4N0Z A;  2A4V A;  1M2A A;  1M7T A;  1ACV A;  2FWF A;  1VF3 A;  4LMV A;  1GH2 A;  13GS A;  4KE3 A;  2L5L A;  4F03 A;  5DQS A;  4V1A p;  1EV4 A;  3IV4 A;  5KOX A;  2HRF A;  4XIH A;  5D9T A;  2OAD A;  5CAX A;  3PR8 A;  1NW2 A;  3IXR A;  1U88 A;  1OC3 A;  4TXO A;  4IN0 A;  1Q98 A;  3QD9 A;  3ZLP A;  2OAC A;  3ZRD A;  5ECK B;  2LJR A;  4K7I A;  2YNX A;  1GUK A;  5G5F A;  4E68 A;  3QFA C;  4K5S A;  1TW9 A;  1S3R A;  2F8A A;  5D96 A;  1YEX A;  2C0D A;  4IW9 A;  1EV9 A;  3U6V A;  1S4B P;  4O5U A;  3GTU A;  4X4J A;  4EUY A;  4ZB7 A;  2YOI A;  1V58 A;  4AI6 A;  5DAL A;  1N2A A;  2GLR A;  1K0O A;  2B5Y A;  4D73 A;  3TRP A;  1SYR A;  4E8H A;  3ZVJ D;  3HMJ G;  2VD1 A;  1QK8 A;  1TRU A;  3DXB A;  1GTB A;  3F3R A;  4POM A;  1EP8 A;  5HR1 A;  4G0K A;  5DVB A;  1T4Y A;  4N3Z A;  1AUC A;  1VF1 A;  5E4W A;  4AJ8 A;  4GRF A;  3QPM A;  2H6X A;  2B7J A;  2F8F A;  2RLI A;  5GAN D;  2FHE A;  3Q6O A;  3LWA A;  1KEB A;  3H4K A;  1JLW A;  1LBK A;  1K3O A;  1WOU A;  2A2R A;  2DKI A;  3HVS A;  2D2Z A;  2GT5 A;  1FVJ A;  4BA7 A;  4F0B A;  5IO0 A;  4KND A;  4O7H A;  4EO3 A;  1WJK A;  2DJ3 A;  1OYJ A;  3DIE A;  3FKF A;  5ELG A;  2O5V A;  1G0T A;  2CQ9 A;  1JLV A;  2ZUP A;  3E9J B;  3DRN A;  4JED A;  4ECB A;  1PQN A;  3EU3 A;  4ZBD A;  2B1K A;  2HSM B;  2YAN A;  1W4V A;  2PU9 C;  3HVX A;  1BED A;  4PQI A;  3VPT A;  1ERT A;  5B7C A;  1OE7 A;  4BWQ A;  1Z6M A;  2VCT A;  2QKE A;  3D4M A;  2YP6 A;  2OBK A;  3ZYW A;  4FH8 A;  1V40 A;  1M0U A;  4N0V A;  3NIV A;  4K1F A;  4MLY A;  3TRX A;  4MZB A;  2X49 A;  2CVB A;  1O6J A;  3GSS A;  5IMF A;  2IN3 A;  3F0I A;  2NBS A;  4USS A;  3TJK A;  5ECM B;  3MSZ A;  4O5R A;  4MZW A;  1EZK A;  2DKH A;  3IE3 A;  4KH7 A;  1BAY A;  4MK3 A;  1RW1 A;  3MAK A;  1DE1 A;  4Z2R A;  3C71 A;  3H8Q A;  3GNJ A;  2XC2 A;  1W89 A;  2O89 A;  3D5J A;  3KXO A;  2MMN A;  1PGT A;  1OVN A;  1A8L A;  1UA5 A;  4ZL7 A;  2LKU A;  3IA1 A;  3IC4 A;  3DD3 A;  3L9U A;  5IPH A;  3SWL A;  4OCF A;  5G1K A;  2V32 A;  2IMD A;  1OKT A;  1ZZY A;  3UBK A;  1PRX A;  2R6K A;  3CXG A;  3IHQ A;  5D9X A;  3A2W A;  1O7U A;  1O85 A;  1Z6N A;  3GKK A;  3RBT A;  2N5B A;  3KTB A;  4Z2U A;  1R7H A;  2P31 A;  4XTS A;  2H1G A;  4TR1 B;  1Y1U A;  1XBS A;  4KUN A;  5H5R A;  4IQA A;  3QDN A;  5HR0 A;  2WJU A;  2HSN A;  2LTK A;  2AB6 A;  4MPF A;  2JU5 A;  1A0F A;  5JWR B;  2JZR A;  4CY8 A;  1HNB A;  3L78 A;  4IJI A;  4ACS A;  4X43 A;  3G7Y A;  1XW5 A;  1PL2 A;  2F9S A;  2PVQ A;  2GSR A;  3V1W A;  3EYT A;  6GSX A;  3M3M A;  2GQM A;  1H4O A;  3HZ4 A;  3KIJ A;  4IP6 A;  1IYH A;  3AY8 A;  4O92 A;  1SK2 A;  3ZZX A;  3TRQ A;  5EL8 A;  2LV3 A;  2FA8 A;  2ALB A;  2LQO A;  1PFO A;  1TK0 B;  5AGY A;  2EFE A;  2HE3 A;  4K5R A;  5IQY A;  4BWS A;  5F05 A;  5F07 A;  2C3Q A;  4J56 E;  3G7I A;  2UV8 G;  2M80 A;  4ZL9 A;  4O5Q A;  3UVH A;  1PMT A;  1VRS D;  4HS1 A;  3L9V A;  5HR2 A;  5D73 A;  1X5D A;  1UC7 A;  4W66 A;  1V9W A;  12GS A;  3GX8 A;  3LW9 A;  3DKS A;  1A0R P;  4TXO B;  2PGT A;  2V2G A;  4EC0 A;  5A34 A;  4MCU A;  2PER A;  2VKZ G;  5J41 A;  2AYT A;  2XPE A;  3FMW A;  11GS A;  2DJJ A;  3UVT A;  2PUK C;  3HJO A;  1NHO A;  2OJL A;  4NV2 A;  3GX0 A;  2KP2 A;  18GS A;  2H73 A;  3QOU A;  2UZ8 A;  3GTU B;  3WT2 A;  4TW5 A;  1MD4 A;  2E2M A;  3HJM A;  6GST A;  4HJM A;  5DAL B;  3CTG A;  3CTF A;  4D73 B;  1PN9 A;  3ZML A;  1E6B A;  22GS A;  3CYN A;  3J7Y k;  4YH2 A;  1M99 A;  2O7K A;  1XCC A;  2H6Z A;  2R5G A;  2IIY A;  4PX1 A;  2AAW A;  1YDK A;  4HQZ A;  2HYX A;  4DEJ A;  4L5L A;  4BVX A;  2CAI A;  2DBC A;  4JBB A;  2WVY A;  8GSS A;  4XCS A;  4EL1 A;  3TKS E;  4JR6 A;  2YZU A;  5LNK e;  1GRX A;  1K0N A;  2OE3 A;  3M9K A;  1G7O A;  1I5G A;  4EVM A;  1THO A;  4FYU A;  5B8A A;  1OC8 A;  2FUG 2;  2I4A A;  2KLX A;  5F8B A;  1R5P A;  2IJY A;  1EOG A;  1EEJ A;  1OKD A;  3IC8 A;  2RM6 A;  1SVM A;  3C1S A;  3DEX A;  4MH3 A;  5J3R A;  5KEJ A;  1FAA A;  1YF0 A;  5EVO A;  4POL A;  4PUR A;  1ZCP A;  3D21 A;  2O85 A;  1TI3 A;  3FR3 A;  4WEY A;  4K0G A;  4HU7 A;  3QAV A;  4Q5R A;  1T00 A;  1GUH A;  2VD0 A;  5A4U A;  4V2N A;  5E59 A;  2B7K A;  4KW6 A;  4Z2T A;  4TXV A;  1F3B A;  3ZFB A;  3TGZ A;  4XRD A;  3RGB C;  1PSQ A;  3TJB A;  2FGX A;  4YQU A;  1DSB A;  4ZBA A;  2ES7 A;  1M9B A;  1GP1 A;  3TKP A;  4LL1 B;  3KCM A;  2DLX A;  1TJD A;  2WVX A;  3EUR A;  2AV4 A;  2CX3 A;  5AIS A;  1K3L A;  3VI7 A;  3PH9 A;  3BJ5 A;  5IM9 A;  16GS A;  2JAC A;  1MD3 A;  1XW9 A;  5KN0 A;  4K2D A;  3TJF A;  4DVC A;  4RQR A;  5ID2 A;  2C4J A;  1SKW B;  1K0D A;  2IWT A;  3GL3 A;  3IPZ A;  4POB A;  3BD2 A;  1WMJ A;  4KCA A;  1ERW A;  3H1N A;  1PL1 A;  4ZB9 A;  4HSC X;  2LNT A;  3F4S A;  3IRA A;  1YJ6 A;  4Q5F A;  3DVX A;  3LYK A;  3FZ4 A;  3MDK A;  4IP1 A;  5ABR A;  4BL7 A;  1AIU A;  3MNG A;  3ERG A;  3D4T A;  4TKY A;  4JU5 A;  4TOP A;  2HSN B;  2R0C A;  1DBY A;  2C8U A;  1A2J A;  4F2I A;  1TK5 B;  4BIK A;  3O76 A;  5D9W A;  2XBI A;  5B6N A;  5IMC A;  2GQL A;  3CBU A;  1FB6 A;  4IHU A;  1Z3E A;  3PIN A;  5IOX A;  3ZRE A;  2I3Y A;  4WET A;  4MF7 A;  5LD0 A;  2HNL A;  3VUR A;  1V98 A;  1DUG A; 
#chains in the Genus database with same CATH homology
 6GSU A;  3IK7 A;  3F3Q A;  5L71 A;  1SKS B;  1USB A;  3US3 A;  4MJA A;  4AKI A;  5CYY A;  1EEM A;  1PKW A;  3VWX A;  3VWW A;  2VL9 A;  4X1U A;  4POK A;  5DQY A;  3QCP A;  2MBT A;  4KGI A;  3LJR A;  5F0G A;  4KAE A;  2R37 A;  5ECS A;  4HI7 A;  3GN3 A;  1F37 A;  2WGR A;  3WGD A;  4LA1 A;  1S3D A;  2GTU A;  4G0I A;  5HFK A;  2YWI A;  2LJA A;  4XS1 A;  3KTL A;  4XHM A;  3W8J A;  4V2M A;  2QC7 A;  5A34 B;  3VLN A;  4MNN A;  4HZ4 A;  2X8C A;  4ID0 A;  3HCZ A;  4WXT A;  4BPY A;  3TB2 A;  2O87 A;  2XHF A;  4ML6 A;  2C80 A;  4ECJ A;  5ECN B;  1Y6E A;  2KHP A;  2H71 A;  1X0R A;  2X64 A;  1T7P B;  2DJ2 A;  3ED3 A;  3APQ A;  1GSY A;  1XVQ A;  3UOM A;  3HXS A;  2VL2 C;  2DML A;  17GS A;  4ULX A;  1ZMA A;  5B8B A;  3VK9 A;  4KDU A;  1T4Z A;  1K0B A;  2B5X A;  3MIX A;  4K2X A;  3GKN A;  3CSJ A;  2V1M A;  4P3Y B;  3DVW A;  2IMI A;  2VM2 A;  4WF5 A;  5LCZ A;  4YAP A;  1Z9H A;  4BVX B;  4PQH A;  3TKR A;  5ELA A;  4G01 A;  2XPD A;  3A2X A;  3M9J A;  3GRX A;  3ME8 A;  3KMN A;  3KGK A;  5G31 A;  3F9U A;  2CVK A;  5DDL A;  3HYP A;  3ZIJ A;  4RI6 A;  1GNE A;  4ICY A;  2DIY A;  1GNW A;  2HT9 A;  5GZZ B;  3LYP A;  2R0P A;  4NAX A;  1Y25 A;  5INY A;  4GLT A;  4F82 A;  2CZ2 A;  1ZOF A;  2LRT A;  2K8V A;  2AHE A;  3LG6 A;  4ECI A;  1QXH A;  3KH7 A;  2FWH A;  2PWJ A;  5IMZ A;  2H70 A;  2HFD A;  3RPP A;  4JE1 A;  1WPI A;  2RUE A;  2JZT A;  1N25 A;  2RM5 A;  3IR4 A;  1TKD B;  2TRX A;  3N9J A;  4QL7 A;  1Z5Y E;  1NSW A;  2MMZ A;  3ZL5 A;  4FIW A;  1FHE A;  4BVY A;  1EP7 A;  4H86 A;  3WYW A;  4KA0 A;  3H93 A;  3QMX A;  1ON4 A;  3Q19 A;  4XS4 A;  2CT6 A;  1S3A A;  4L0W A;  2C0E A;  1SK0 A;  4KDX A;  1MDK A;  5CNW A;  5IIZ A;  4Q5N A;  3KEB A;  4IS0 A;  2VL2 A;  3GST A;  6GSS A;  1F2E A;  3RDW A;  3TJG A;  5ID2 B;  3E3E A;  5FT3 A;  5KN1 A;  5D9V A;  3FEU A;  3F6D A;  2FLS A;  3FK8 A;  3L0H A;  4K9Z A;  3F4R A;  1GWC A;  4KSM A;  5IOW A;  3GKX A;  4K8M A;  5COH A;  4AJ6 A;  4DSS A;  2ON5 A;  1DE2 A;  3HY2 A;  2VM1 A;  3CRU A;  3WT1 A;  2YCD A;  4N11 A;  1GSF A;  5J47 A;  3GYK A;  3QAG A;  4MH2 A;  1ZYQ B;  1BYE A;  2VLV A;  1A2L A;  4BL7 B;  4ML1 A;  3TOU A;  5FHI A;  3A2V A;  1R4W A;  3A3T A;  1TI1 A;  1XWK A;  3HZ8 A;  4QL9 A;  5DCH A;  2K8S A;  4F0C A;  4JRR A;  3HHV A;  2PBJ A;  3UL3 A;  3UAP A;  2MBS A;  3D22 A;  4Q5Q A;  2CX4 A;  2G2Q A;  1WIK A;  5GSS A;  2IPA A;  4TR4 A;  2L57 A;  2YWN A;  1MDI A;  1ML6 A;  1R26 A;  4EE0 A;  5C04 A;  4I2T A;  5H5S A;  2YJ7 A;  1AQV A;  4K6X A;  4OFM A;  4OO5 A;  3J7Y b;  2WDU A;  3TCO A;  3GMF A;  4E8E A;  2VCW A;  2RUF A;  1TTZ A;  3LXT A;  4G9H A;  1BQ7 A;  2WS2 A;  5ENU A;  3GA4 A;  1T8E B;  3EMP A;  1SEN A;  4WKW A;  2QA1 A;  4JR4 A;  1SK1 A;  1OE8 A;  5EPF A;  1U87 A;  4PGT A;  3ERW A;  3KJY A;  2QSI A;  3W8S A;  4FYC A;  2C0G A;  3P90 A;  4LMW A;  4QMK A;  3GFK A;  2ON7 A;  4G10 A;  5HFI A;  1ABA A;  2WCI A;  5G1L A;  3DYR A;  4MAB A;  4EKZ A;  3VFI A;  2WB9 A;  3P8W A;  4WF4 A;  3P2A A;  2MMA A;  1J0F A;  4PQ1 A;  4IQ1 A;  4CDO A;  4HZ2 A;  7GSS A;  1U3A A;  2MYG A;  4I8B A;  1B9Y C;  2YWM A;  2OE0 A;  4PXO A;  1RQM A;  1QUW A;  2HRK A;  3UEM A;  3ZIV A;  2OA7 A;  2BJX A;  1HNC A;  1BF5 A;  5G5E A;  5JCU A;  2VO4 A;  2GS3 A;  1WP0 A;  1YEP A;  1TU8 A;  4MF5 A;  5CRG A;  2LJK A;  1IYI A;  2RII A;  4DSR A;  4A5P A;  1SL2 B;  4F9Z A;  1G6W A;  1TRV A;  2X8H A;  3IDV A;  3QFB C;  2EIR A;  1NHY A;  2VLU A;  5KN2 A;  4KF9 A;  1HNA A;  2ZNM A;  3TKQ A;  5DBQ A;  2HXK A;  3TKS A;  1KNG A;  1YZX A;  2YWO A;  5CRE A;  5AIV A;  3EPT A;  1BG5 A;  2C1Y A;  2I1U A;  1EOH A;  2XBQ A;  1BG1 A;  1WWJ A;  2KOK A;  4ECC A;  2YV9 A;  4KSO A;  5IMD A;  1HD2 A;  1XWA A;  1X9W B;  2H0H A;  3CRT A;  4GQF A;  1OAZ A;  2X8G A;  5A5H A;  1GLQ A;  3LQ7 A;  2DJ1 A;  2I81 A;  5KN3 A;  1XIY A;  2GGT A;  3W6G A;  2H0G A;  3HKR A;  1QFN A;  4HU9 A;  3C7M A;  1FOH A;  3SBC A;  4MMM A;  1TXU A;  4GTU A;  1URM A;  4ZL8 A;  3G7J A;  2L4C A;  5D93 A;  1QQ2 A;  4V2L A;  3IOS A;  4BVY B;  1CQG A;  3RHB A;  4K0N A;  3CWG A;  1BJX A;  5D8I A;  1A23 A;  4GCI A;  1ST9 A;  2B3S A;  4MDC A;  4XS4 B;  1O81 A;  1FVK A;  4IKH A;  2IL3 A;  1CQH A;  3M8N A;  2V6K A;  2H8L A;  1F9M A;  1XOA A;  3C1R A;  4IJ3 A;  2IMF A;  2LQQ A;  1B4Q A;  4WBR D;  3HD5 A;  5J5N A;  4N10 A;  1Z7R A;  2L5O A;  4PUF C;  2VL3 A;  2CA8 A;  2BTO T;  4QQ7 A;  3KH9 A;  4EDZ A;  1AXD A;  5A4V A;  4EDY A;  3UBL A;  1I9D A;  4ZIL A;  3O3T A;  2O8V B;  4DSS B;  1M2B A;  2V41 A;  2DMM A;  1VF4 A;  3R3E A;  14GS A;  1AAZ A;  3BBY A;  3VI5 A;  4MA9 A;  2GZP A;  1GSS A;  3FZ5 A;  1GUL A;  2B6M A;  2MMO A;  2LNS A;  3BOA A;  3LXZ A;  6GSY A;  2DC5 A;  2IMK A;  3D6I A;  4AF2 A;  1SD9 A;  2FA4 A;  2HRA A;  2LUS A;  2M46 A;  1B8X A;  4TRX A;  4X0X A;  3LOR A;  4O32 A;  4CW9 A;  5DJL A;  5DCG A;  2AUV A;  1T1V A;  4YQV A;  6GSW A;  4RQX A;  1ZYP A;  1SL0 B;  5CRD A;  1V2A A;  5HR3 A;  1X9S B;  3EE2 A;  1XFL A;  3F4T A;  1X9M B;  2H72 A;  2L4Q A;  4KB3 A;  3TOT A;  1AQW A;  3IK9 A;  1S3C A;  1V57 A;  2WUL A;  2L6D A;  4TN8 A;  1PX7 A;  4AKG A;  4MJC A;  3EU4 A;  4YKF A;  4EIP A;  1PKZ A;  3DWV A;  9GSS A;  2R4V A;  4IBP A;  1GL8 A;  4GSN A;  4IEL A;  3ZFL A;  1YY7 A;  3M0F A;  1SD8 A;  5DAK A;  2HSY A;  1YKA A;  2C3N A;  1ERU A;  2E0Q A;  3IAS 2;  3GIX A;  3FY7 A;  3RHC A;  2V6O A;  3QAW A;  1FG4 A;  3PGT A;  2DIZ A;  1N8J A;  2JL4 A;  2E2G A;  1LJR A;  1TP9 A;  3APS A;  1VGL A;  3K8N A;  2TIR A;  2H76 A;  1FOV A;  1U3I A;  2HRK B;  1JZR A;  3UJ1 A;  4YQM A;  2OT3 A;  1T3B A;  2OBI A;  1HYU A;  3CMI A;  3G9B A;  2EFH A;  1E2Y A;  3RAZ A;  3M1G A;  3D0Z A;  3ZIT A;  5A1N A;  2WRT A;  1SYX A;  3KP9 A;  4OFT A;  5J4U A;  2HSH A;  4N30 A;  3HVV A;  1TK8 B;  2H1B A;  4HDE A;  1ZGN A;  2QGV A;  1GUM A;  4ZXG A;  1GSE A;  2TRC P;  1THX A;  4I5Q A;  4LLR A;  2GQK A;  4NXI A;  3FR9 A;  5CP1 A;  3ZTL A;  2VCQ A;  1G6Y A;  1K0M A;  3UMA A;  2Z9S A;  4FYB A;  2YN1 A;  4PUA A;  1EGR A;  4GQC A;  1SVL A;  2BMX A;  4Z7X A;  4XRA A;  4PNF A;  3Q74 A;  4TR0 A;  3F63 A;  5AN1 A;  2NVL A;  3EC3 A;  1H75 A;  5A5H B;  5J9C A;  2KP1 A;  4FQU A;  1B4P A;  3UIW A;  4MPG A;  3GHA A;  5IMA A;  3TDG A;  4RUV A;  4NPB A;  3R2Q A;  5JCG A;  1WRY A;  2A2P A;  2JZS A;  2N5A A;  1FW1 A;  3I9V 2;  4IVF A;  1GSD A;  1SJ6 A;  5BMU A;  4G0L A;  4XS6 A;  2NPB A;  1TRW A;  3APO A;  1UN2 A;  10GS A;  5ECR B;  5IO2 A;  2REM A;  4ILF A;  1GTI A;  20GS A;  3IBH A;  2GVP A;  1FB0 A;  1Z7P A;  5AIX A;  1VF2 A;  5JCW A;  2H75 A;  3A5W A;  6GSV A;  2DJK A;  2YV7 A;  3FYG A;  2JSY A;  4LL4 B;  3LFL A;  1GLP A;  1AQX A;  4IGJ A;  2R2J A;  2F3M A;  1XVW A;  2CZ3 A;  3TU3 B;  1SJZ A;  2VOC A;  1R5A A;  3FR6 A;  1JZW A;  2HZF A;  3L4N A;  4MJE A;  3S9F A;  4AGS A;  2H6Y A;  5EY6 A;  2NDO A;  2GZZ A;  2C3T A;  5A4W A;  1JZD A;  1MEK A;  2FNO A;  1ZYN A;  3GV1 A;  2A4H A;  4TVE A;  5IPG A;  1YQ1 A;  4J57 E;  2GZY A;  3N5O A;  2K9F A;  4TR3 A;  5ECH B;  3GL5 A;  3WGX A;  3JCM L;  1OC9 A;  2HZE A;  1J08 A;  1XOB A;  4YAV A;  3KD0 A;  4DSQ A;  1MTC A;  4OFN A;  3O6T A;  2J9H A;  3GKM A;  4K7N A;  3I6A A;  1BX9 A;  2L59 A;  4OD7 A;  3MYD A;  3U5R E;  5J40 A;  2IFQ A;  2YZH A;  3F6F A;  2PVO C;  2ZCT A;  3A5I A;  3RPN A;  2HRN A;  2VCV A;  2LEG A;  3TKS C;  5A5K A;  5BRT A;  1GSU A;  2FWG A;  5CRW A;  3FW2 A;  3E0U A;  3ERF A;  2H1L A;  1PD2 1;  1PX6 A;  3OR5 A;  1AW9 A;  4WR4 A;  3KM6 A;  2QA2 A;  2I9H A;  2G0F A;  3ME7 A;  3VPQ A;  1XWB A;  4NWY A;  2FD3 A;  4GXZ A;  2X4A A;  2VCX A;  5J4V A;  3GH9 A;  5ECQ B;  3MWH A;  5DAK B;  3KMO A;  5ECI B;  19GS A;  2J23 A;  4GWR A;  1ZYE A;  2EFC A;  3LSZ A;  1ILO A;  3IHG A;  1SKR B;  1HQO A;  1PA3 A;  1PN0 A;  4JZQ A;  4HQS A;  2YJH A;  1J9B A;  4HEA 2;  4MP4 A;  3L9S A;  1TU7 A;  1GSQ A;  4OWY A;  2AJQ B;  5FWG A;  4OO4 A;  3KZQ A;  4WR5 A;  3NOF A;  4YKG A;  2VAF A;  2A2S A;  4L5O A;  1XPV A;  1TXX A;  2GSS A;  4AKH A;  2L6C A;  1GTA A;  3ISO A;  1KTE A;  4RI7 A;  3TJJ A;  4EF0 A;  1TDI A;  5HFG A;  3UAR A;  4I2U A;  3TUE A;  2H66 A;  4GDF A;  5CRH A;  3IAM 2;  5A1N B;  3LGC A;  2PPT A;  3BCI A;  1F3A A;  2H30 A;  2GT6 A;  1SL1 B;  2LST A;  3HDC A;  4CY6 A;  4GF0 A;  1O73 A;  3NZN A;  1UVZ A;  4HJ2 A;  3I43 A;  2CVD A;  2HQT A;  3CSH A;  1G7E A;  4HUA A;  4GSS A;  2M72 A;  3F8U A;  1F6M C;  1YKC A;  1Q4J A;  2R0G A;  1XXU A;  2VUP A;  4MJB A;  1WE0 A;  4ZBB A;  2CV4 A;  4CHS A;  2B5E A;  2LRC A;  2MZC A;  4NHZ A;  1YF1 A;  4L0U A;  2H01 A;  2EFD A;  2CAQ A;  1K3Y A;  1O8X A;  4NHW A;  2IME A;  1ERV A;  2PMT A;  4ZB8 A;  3FRC A;  2EIO A;  3CSI A;  5ECO B;  1AC1 A;  2P5R A;  4ZIJ A;  2GDR A;  1SU9 A;  5C00 A;  1LU4 A;  1M9A A;  2H0I A;  1SVO A;  1SJI A;  4MF6 A;  3FHK A;  2E7P A;  2DSA A;  3EVI A;  2X99 A;  4KCE A;  5BMU B;  1B48 A;  1NM3 A;  2EC4 A;  2LS5 A;  2HLS A;  3DGQ A;  2PN8 A;  1X5C A;  2NTO A;  1K0A A;  3GUR A;  2H74 A;  5GST A;  5G2Z A;  5B6M A;  3FZA A;  1FO5 A;  2KUC A;  1M2D A;  1MDJ A;  1JZO A;  2WZ9 A;  4GST A;  2YPM A;  4EXJ A;  1EGO A;  2GSQ A;  3WD6 A;  2H1D A;  3EWL A;  3QR6 A;  2HSM A;  1ZL9 A;  2R3X A;  5KOW A;  4L8E A;  4NV5 A;  1XZO A;  2FCH A;  2DJ0 A;  3HA9 A;  4KX4 A;  1KBN A;  3ZVJ A;  3C8E A;  5G30 A;  2F51 A;  1JHB A;  3DML A;  1JFU A;  5F06 A;  4KDY A;  1QMV A;  5H5Q A;  3C73 A;  2C0F A;  4PTS A;  5J9B A;  4G19 A;  2H19 A;  1OC9 B;  2HZE B;  3EIN A;  1XW6 A;  1B9X C;  1TRS A;  2VLT A;  4NMU A;  5J4Y A;  3GH6 A;  1A2M A;  5HQP A;  2EIQ A;  1XWG A;  2N5F A;  2JAD A;  3VWV A;  5DJM A;  4EIQ A;  4OMV A;  2FWE A;  3PPU A;  2OKA A;  4HOJ A;  2VCZ A;  2IFQ B;  4AJ7 A;  2P0G A;  3Q18 A;  4MZC A;  4OCE A;  4V1A g;  2H1A A;  4K7O A;  5JWO B;  4I97 A;  2HI7 A;  1YVL A;  4WBJ A;  1U6T A;  1XWC A;  4FO5 A;  1TOF A;  2WFC A;  3BCK A;  4TR1 A;  1O8W A;  5ECL B;  2JSZ A;  5JWQ B;  2P5Q A;  4J2F A;  3FZ9 A;  1EWX A;  1A8Y A;  4PNG A;  3I69 A;  4ZB6 A;  1RK4 A;  4AKX B;  1C72 A;  1GTU A;  4ISD A;  2GST A;  3KP8 A;  2LRN A;  1K0C A;  4I6X A;  5CO3 A;  5GAP D;  2FY6 A;  3VWU A;  2B1L A;  1A24 A;  3P7X A;  5IMV A;  2OE1 A;  5ECP B;  3EMX A;  2VIM A;  3LEF A;  3GUS A;  1X5E A;  3ZMK A;  2K18 A;  3H79 A;  4G2E A;  1QGV A;  2K6V A;  3HJP A;  3WGE A;  4N0Z A;  2A4V A;  1M2A A;  1M7T A;  1ACV A;  2FWF A;  1VF3 A;  4LMV A;  1GH2 A;  13GS A;  4KE3 A;  2L5L A;  4F03 A;  5DQS A;  4V1A p;  1EV4 A;  3IV4 A;  5KOX A;  2HRF A;  4XIH A;  5D9T A;  2OAD A;  5CAX A;  3PR8 A;  1NW2 A;  3IXR A;  1U88 A;  1OC3 A;  4TXO A;  4IN0 A;  1Q98 A;  3QD9 A;  3ZLP A;  2OAC A;  3ZRD A;  5ECK B;  2LJR A;  4K7I A;  2YNX A;  1GUK A;  5G5F A;  4E68 A;  3QFA C;  4K5S A;  1TW9 A;  2F8A A;  5D96 A;  1YEX A;  2C0D A;  4IW9 A;  1EV9 A;  3U6V A;  4O5U A;  3GTU A;  4X4J A;  4EUY A;  4ZB7 A;  2YOI A;  1V58 A;  4AI6 A;  5DAL A;  1N2A A;  2GLR A;  1K0O A;  2B5Y A;  4D73 A;  3TRP A;  1SYR A;  4E8H A;  3ZVJ D;  3HMJ G;  2VD1 A;  1QK8 A;  1TRU A;  3DXB A;  1GTB A;  3F3R A;  4POM A;  1EP8 A;  5HR1 A;  4G0K A;  5DVB A;  1T4Y A;  4N3Z A;  1AUC A;  1VF1 A;  5E4W A;  4AJ8 A;  4GRF A;  3QPM A;  2H6X A;  2B7J A;  2F8F A;  2RLI A;  5GAN D;  2FHE A;  3Q6O A;  3LWA A;  1KEB A;  3H4K A;  1JLW A;  1LBK A;  1K3O A;  1WOU A;  2A2R A;  2DKI A;  3HVS A;  2D2Z A;  2GT5 A;  1FVJ A;  4BA7 A;  4F0B A;  5IO0 A;  4KND A;  4O7H A;  4EO3 A;  1WJK A;  2DJ3 A;  1OYJ A;  3DIE A;  3FKF A;  5ELG A;  2O5V A;  1G0T A;  2CQ9 A;  1JLV A;  2ZUP A;  3E9J B;  3DRN A;  4JED A;  4ECB A;  1PQN A;  3EU3 A;  4ZBD A;  2B1K A;  2HSM B;  2YAN A;  1W4V A;  2PU9 C;  3HVX A;  1BED A;  4PQI A;  3VPT A;  1ERT A;  5B7C A;  1OE7 A;  4BWQ A;  1Z6M A;  2VCT A;  2QKE A;  3D4M A;  2YP6 A;  2OBK A;  3ZYW A;  4FH8 A;  1V40 A;  1M0U A;  4N0V A;  3NIV A;  4K1F A;  4MLY A;  3TRX A;  4MZB A;  2X49 A;  2CVB A;  1O6J A;  3GSS A;  5IMF A;  2IN3 A;  3F0I A;  2NBS A;  4USS A;  3TJK A;  5ECM B;  3MSZ A;  4O5R A;  4MZW A;  1EZK A;  2DKH A;  3IE3 A;  4KH7 A;  1BAY A;  4MK3 A;  1RW1 A;  3MAK A;  1DE1 A;  4Z2R A;  3C71 A;  3H8Q A;  3GNJ A;  2XC2 A;  1W89 A;  2O89 A;  3D5J A;  3KXO A;  2MMN A;  1PGT A;  1OVN A;  1A8L A;  1UA5 A;  4ZL7 A;  2LKU A;  3IA1 A;  3IC4 A;  3DD3 A;  3L9U A;  5IPH A;  3SWL A;  4OCF A;  5G1K A;  2V32 A;  2IMD A;  1OKT A;  1ZZY A;  3UBK A;  1PRX A;  2R6K A;  3CXG A;  3IHQ A;  5D9X A;  3A2W A;  1O7U A;  1O85 A;  1Z6N A;  3GKK A;  3RBT A;  2N5B A;  3KTB A;  4Z2U A;  1R7H A;  2P31 A;  4XTS A;  2H1G A;  4TR1 B;  1Y1U A;  1XBS A;  4KUN A;  5H5R A;  4IQA A;  3QDN A;  5HR0 A;  2WJU A;  2HSN A;  2LTK A;  2AB6 A;  4MPF A;  2JU5 A;  1A0F A;  5JWR B;  2JZR A;  4CY8 A;  1HNB A;  3L78 A;  4IJI A;  4ACS A;  4X43 A;  3G7Y A;  1XW5 A;  1PL2 A;  2F9S A;  2PVQ A;  2GSR A;  3V1W A;  3EYT A;  6GSX A;  3M3M A;  2GQM A;  1H4O A;  3HZ4 A;  3KIJ A;  4IP6 A;  1IYH A;  3AY8 A;  4O92 A;  1SK2 A;  3ZZX A;  3TRQ A;  5EL8 A;  2LV3 A;  2FA8 A;  2ALB A;  2LQO A;  1TK0 B;  5AGY A;  2EFE A;  2HE3 A;  4K5R A;  5IQY A;  4BWS A;  5F05 A;  5F07 A;  2C3Q A;  4J56 E;  3G7I A;  2UV8 G;  2M80 A;  4ZL9 A;  4O5Q A;  3UVH A;  1PMT A;  1VRS D;  4HS1 A;  3L9V A;  5HR2 A;  5D73 A;  1X5D A;  1UC7 A;  4W66 A;  1V9W A;  12GS A;  3GX8 A;  3LW9 A;  3DKS A;  1A0R P;  4TXO B;  2PGT A;  2V2G A;  4EC0 A;  5A34 A;  4MCU A;  2PER A;  2VKZ G;  5J41 A;  2AYT A;  2XPE A;  3FMW A;  11GS A;  2DJJ A;  3UVT A;  2PUK C;  3HJO A;  1NHO A;  2OJL A;  4NV2 A;  3GX0 A;  2KP2 A;  18GS A;  2H73 A;  3QOU A;  2UZ8 A;  3GTU B;  3WT2 A;  4TW5 A;  1MD4 A;  2E2M A;  3HJM A;  6GST A;  4HJM A;  5DAL B;  3CTG A;  3CTF A;  4D73 B;  1PN9 A;  3ZML A;  1E6B A;  22GS A;  3CYN A;  3J7Y k;  4YH2 A;  1M99 A;  2O7K A;  1XCC A;  2H6Z A;  2R5G A;  2IIY A;  4PX1 A;  2AAW A;  1YDK A;  4HQZ A;  2HYX A;  4DEJ A;  4L5L A;  4BVX A;  2CAI A;  2DBC A;  4JBB A;  8GSS A;  4XCS A;  4EL1 A;  3TKS E;  4JR6 A;  2YZU A;  5LNK e;  1GRX A;  1K0N A;  2OE3 A;  3M9K A;  1G7O A;  1I5G A;  4EVM A;  1THO A;  4FYU A;  5B8A A;  1OC8 A;  2FUG 2;  2I4A A;  2KLX A;  5F8B A;  1R5P A;  2IJY A;  1EOG A;  1EEJ A;  1OKD A;  3IC8 A;  2RM6 A;  1SVM A;  3C1S A;  3DEX A;  4MH3 A;  5J3R A;  5KEJ A;  1FAA A;  1YF0 A;  5EVO A;  4POL A;  4PUR A;  1ZCP A;  3D21 A;  2O85 A;  1TI3 A;  3FR3 A;  4WEY A;  4K0G A;  4HU7 A;  3QAV A;  4Q5R A;  1T00 A;  1GUH A;  2VD0 A;  5A4U A;  4V2N A;  5E59 A;  2B7K A;  4KW6 A;  4Z2T A;  4TXV A;  1F3B A;  3ZFB A;  3TGZ A;  4XRD A;  1PSQ A;  3TJB A;  2FGX A;  4YQU A;  1DSB A;  4ZBA A;  2ES7 A;  1M9B A;  1GP1 A;  3TKP A;  4LL1 B;  3KCM A;  2DLX A;  1TJD A;  3EUR A;  2AV4 A;  2CX3 A;  5AIS A;  1K3L A;  3VI7 A;  3PH9 A;  3BJ5 A;  5IM9 A;  16GS A;  2JAC A;  1MD3 A;  1XW9 A;  5KN0 A;  4K2D A;  3TJF A;  4DVC A;  4RQR A;  5ID2 A;  2C4J A;  1SKW B;  1K0D A;  2IWT A;  3GL3 A;  3IPZ A;  4POB A;  3BD2 A;  1WMJ A;  4KCA A;  1ERW A;  3H1N A;  1PL1 A;  4ZB9 A;  2LNT A;  3F4S A;  3IRA A;  1YJ6 A;  4Q5F A;  3DVX A;  3LYK A;  3FZ4 A;  3MDK A;  4IP1 A;  5ABR A;  4BL7 A;  1AIU A;  3MNG A;  3ERG A;  3D4T A;  4TKY A;  4JU5 A;  4TOP A;  2HSN B;  2R0C A;  1DBY A;  2C8U A;  1A2J A;  4F2I A;  1TK5 B;  3O76 A;  5D9W A;  2XBI A;  5B6N A;  5IMC A;  2GQL A;  3CBU A;  1FB6 A;  4IHU A;  1Z3E A;  3PIN A;  5IOX A;  3ZRE A;  2I3Y A;  4WET A;  4MF7 A;  5LD0 A;  2HNL A;  3VUR A;  1V98 A;  1DUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...