3ZMKA

Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
219
structure length
200
Chain Sequence
KLVLYTLHLSPPCRAVELTAKALGLELEQKNITIPVLDDDGTIITESHAIMIYLVTKYGKDDTLYPKDPVQQARVNAALHFESGVLFARMRFIFERIFFYGKSDIPEDRVEYVQKSYRLLEDTLKDDFVAGSKMTIADFSCISTISSIMGVVPLEQSEHPRIYEWIDRLKQLPYYEEANGGGGTDLGKFVLAKKEENAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE E2
publication title A Single Mutation in the Gste2 Gene Allows Tracking of Metabolically-Based Insecticide Resistance in a Major Malaria Vector.
pubmed doi rcsb
source organism Anopheles funestus
total genus 79
structure length 200
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3zmkA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zmkA01
1O81A 2L5OA 2HRNA 3BJ5A 2UZ8A 2HFDA 2LNTA 2JL4A 5JCGA 3PR8A 2AAWA 4TR1B 2VCVA 1KEBA 3IK7A 2N5FA 4K0NA 2RIIA 1MEKA 2C1YA 2B1KA 2L4CA 2DSAA 1GH2A 4EDYA 1A2LA 3DYRA 2MMNA 3GNJA 4I6XA 2VL3A 6GSYA 2N5AA 4GRFA 4EF0A 2P5QA 2PUKC 3C7MA 5EY6A 3ZITA 2VOCA 2C80A 1XW6A 5AIXA 1J08A 4G19A 3D6IA 5J9BA 1EP7A 3CSHA 2H19A 5AGYA 1YF1A 2H1DA 3LXTA 4MF6A 1XIYA 3HJPA 4OO5A 2MBSA 2EIRA 5J4UA 3GTUA 1UVZA 1G0TA 3TJBA 2BJXA 2GDRA 4G0KA 4XS4A 2VM1A 4ZB6A 2GLRA 2GSQA 22GSA 4MCUA 4TXOB 5D73A 1FG4A 2WGRA 1RW1A 1GRXA 3E9JB 2XBQA 5ECSA 3KP8A 3LSZA 2ON5A 4KAEA 3GUSA 2ZUPA 3ZREA 2M80A 3F4TA 3KTLA 5H5RA 2IMDA 3VI7A 4KSMA 2P0GA 5ECOB 1AIUA 3ZFLA 1EP8A 2OE3A 3H93A 1YZXA 1Z5YE 3HVSA 4KCAA 1THXA 1GP1A 1QGVA 1DE1A 3H1NA 1YDKA 5ECIB 1ERVA 5GAPD 4LL4B 5F0GA 1X9WB 2YWNA 4NHWA 5J3RA 1BX9A 4HJMA 1XBSA 1SKSB 1GUMA 5LCZA 4Z7XA 2HI7A 1G6YA 4GSSA 4GWRA 1PMTA 1A0RP 2HQTA 1TI1A 3WGXA 1M2BA 2MMOA 4O7HA 5G2ZA 1FO5A 1ZYQB 3D21A 3DEXA 2FWFA 2WULA 4X0XA 1V58A 1YJ6A 4XS4B 3GX0A 3VURA 2LRCA 1R4WA 3RHCA 1WIKA 3HA9A 1T1VA 3WT1A 3LYKA 5D9WA 1YEXA 4ZIJA 2OE0A 1DBYA 5JCWA 4K7OA 1F9MA 4IJ3A 2H71A 3C1SA 1VF1A 16GSA 1R7HA 4KUNA 4NV5A 1UC7A 1EOHA 5IM9A 1Y6EA 4KB3A 1MD4A 1WP0A 4DSQA 3BD2A 3L4NA 2L6CA 4IELA 5DAKA 5B8BA 4N0ZA 4I5QA 3R3EA 2X8CA 1OC9B 4WEYA 2KP1A 2CVDA 3US3A 3H4KA 1IYHA 1G7EA 1GTBA 1O7UA 3LQ7A 3LJRA 2BTOT 4TR3A 3ZL5A 2YN1A 4YAVA 4RUVA 1YF0A 1ABAA 4PQIA 3NZNA 5EVOA 1FB6A 3DMLA 1JLWA 5HFKA 4WKWA 3VLNA 4FYUA 3PPUA 3R2QA 5LNKe 4E8EA 12GSA 4DSRA 2JZRA 1OYJA 1N2AA 1SJIA 2V6KA 1KNGA 1S3DA 2A2RA 2C0GA 2JU5A 2MMAA 1B48A 1Z3EA 2HSHA 2QGVA 1AQWA 4POKA 3HYPA 1A23A 2C0EA 3ZMLA 1EZKA 1XOAA 1JZWA 5COHA 2OACA 1B8XA 4ZL8A 4JU5A 5D9VA 4YAPA 3KJYA 4ML6A 1U87A 2JSYA 4AF2A 1JZRA 2B5EA 1CQHA 5IMZA 5DALB 4GXZA 2WS2A 3DVXA 1VF4A 2GZZA 2FWGA 5CP1A 3ZFBA 3QPMA 2H0IA 3FR9A 1GSUA 2HRKB 3IC4A 2IMIA 3KM6A 2GT5A 4Q5NA 2NVLA 1BYEA 2MMZA 3A5WA 3TRPA 1SU9A 2YWMA 1TRWA 3O76A 4IP1A 7GSSA 3M9KA 3DXBA 4ULXA 3ERWA 2HXKA 4I8BA 3L0HA 1AC1A 3IPZA 5KN3A 1QFNA 1VGLA 4FQUA 4N11A 2V6OA 1B4PA 3WD6A 2CZ3A 1VF3A 1WJKA 4DVCA 3DWVA 1JFUA 4KDXA 2MBTA 1WWJA 2YJ7A 2FWEA 1TOFA 1PQNA 2CX3A 4KNDA 2GVPA 4HS1A 3BBYA 1PN9A 4NAXA 3APQA 4G0LA 5ENUA 3DGQA 1QXHA 2HZEB 1O85A 3ME7A 1B9XC 4JEDA 1DSBA 5CO3A 1VRSD 4WETA 1K0NA 3MDKA 4GF0A 1XOBA 3TB2A 4AJ6A 3DIEA 3VWUA 5ID2A 2V1MA 2XC2A 3F4RA 2VD1A 5JWRB 1TU8A 5G1LA 3MNGA 3QMXA 4BWQA 5A4UA 2M72A 3GMFA 2FGXA 2WB9A 3TKSE 3EURA 1EV9A 2PGTA 1EGOA 2B5XA 1GSYA 4KA0A 2XHFA 4PNFA 4G10A 5F07A 1XVQA 2O85A 2HSMA 4BL7A 4IBPA 3GHAA 3WYWA 1TU7A 3TJJA 4TR0A 2PVQA 2F51A 2EIOA 3HVVA 8GSSA 1VF2A 3N5OA 1G7OA 1HYUA 2H1AA 3E3EA 2C0FA 2YZHA 1FVKA 2HSNB 3LG6A 2V32A 1ZZYA 1T4YA 3D0ZA 3ZIVA 2I3YA 2YPMA 1OC8A 2H01A 1Z7RA 1SL2B 4HZ4A 3ZVJA 4AGSA 2L5LA 1TRVA 4XIHA 1EGRA 1V2AA 3HCZA 1I9DA 4WBRD 18GSA 3M9JA 4PURA 4IHUA 2G2QA 1MTCA 3G7YA 5KN1A 2RLIA 2PMTA 1AQVA 10GSA 1C72A 4FYCA 2CAIA 1G6WA 3D5JA 2X8HA 5J41A 1N8JA 2VD0A 2B6MA 4AJ7A 1M9BA 4KCEA 2CVKA 5J9CA 2VIMA 1KTEA 5AN1A 3IV4A 1ON4A 3SWLA 5HR0A 1S3AA 1KBNA 1GUHA 5B6MA 2CZ2A 1NW2A 1A24A 5CRDA 2A4VA 3KMNA 3U6VA 1PL1A 2FHEA 4D73B 2ZCTA 2H72A 2JADA 1K0MA 3W8JA 4GLTA 3MWHA 4NWYA 1SKWB 1XVWA 1T4ZA 2E2GA 1U3AA 4TKYA 3EC3A 1ILOA 4F2IA 5B7CA 4MA9A 4OFNA 2HYXA 5B6NA 19GSA 4ECIA 2N5BA 3Q6OA 4K7NA 2IWTA 4OCEA 5C04A 3FW2A 1U88A 4JR4A 5FHIA 2OKAA 3TRXA 2G0FA 5BMUA 2R37A 4HQSA 3TCOA 1BG5A 5IOWA 2AYTA 3QAVA 3GH9A 3IHQA 4KX4A 5IMAA 2OA7A 2B1LA 3QR6A 2WCIA 3GIXA 1HNAA 3FZ9A 3F8UA 3IR4A 3HZ4A 4AJ8A 4TW5A 3CRUA 2X64A 4EE0A 4TVEA 4G2EA 3KGKA 3L9UA 2I4AA 4MLYA 4DSSB 4J57E 4MJAA 4ZB8A 1DUGA 1HQOA 2NDOA 3M8NA 3F9UA 4I2TA 5CNWA 1SK0A 3M3MA 5GSTA 3VK9A 2H6YA 3DKSA 3ERGA 1X0RA 3G9BA 4L0WA 4HJ2A 4N30A 2VL2A 1A0FA 4MH2A 6GSSA 2V41A 4MK3A 1BQ7A 3EINA 2HNLA 3F4SA 4V1Ag 1GUKA 5HQPA 4FO5A 2PERA 4JBBA 4Q5RA 3FZ5A 3FR6A 1M99A 5IPHA 2HSYA 2QC7A 1XZOA 2DJ2A 3EU3A 4ZL9A 1BEDA 3VPTA 4L0UA 5DCHA 1QK8A 1F3AA 3CSIA 1FAAA 3FZ4A 1ZGNA 3IXRA 1TK8B 3I6AA 1OC9A 3ZRDA 2J23A 4EVMA 1FW1A 1AQXA 2E2MA 2H1BA 1GULA 2I9HA 3GRXA 2JZTA 1XFLA 3ED3A 4HZ2A 2FUG2 3IAM2 1H75A 3N9JA 4MDCA 3F6DA 1H4OA 2PVOC 4F0BA 1JZOA 4QL9A 1GSFA 5DBQA 3OR5A 4ZB9A 2LQOA 4NXIA 4IJIA 2AUVA 1Z6NA 1SK1A 4EUYA 4K7IA 3QFBC 1ERUA 4MZCA 4IN0A 4CDOA 4H86A 5IO2A 5ECLB 4EO3A 2HT9A 3HVXA 2DJ3A 2YWOA 2E0QA 2JACA 5EL8A 1M2DA 4IGJA 4HEA2 4K9ZA 2DLXA 4F9ZA 4ZBBA 1F2EA 5H5QA 1OVNA 5DALA 3DVWA 1T7PB 3AY8A 1SD8A 2F8AA 2GQLA 1OC3A 2H0HA 1Z9HA 2HRKA 1SJ6A 5IPGA 1GTUA 4HUAA 2LJAA 1SYRA 3O3TA 3FRCA 4MMMA 2LV3A 1SYXA 5CYYA 3GKNA 3UL3A 3GKMA 2LKUA 4NMUA 3I69A 4MJCA 1EEMA 1TTZA 2GZYA 3EE2A 1OKTA 1LBKA 3TRQA 1XXUA 1FB0A 1GLQA 9GSSA 3QD9A 1SK2A 5HR1A 4TOPA 3FHKA 3GA4A 5CRGA 14GSA 4IS0A 1NSWA 4FYBA 3D4TA 1UA5A 4HDEA 4XHMA 2P5RA 1WE0A 1A8LA 1YQ1A 2LEGA 1GL8A 3LEFA 6GSVA 5F06A 3GKXA 1V57A 1K3LA 2FNOA 3EWLA 4Q5FA 3NIVA 1PX6A 5E4WA 3CYNA 5IOXA 2PU9C 2RUEA 1AW9A 1SL1B 4KH7A 2HZEA 3TJGA 1ZMAA 2REMA 1FVJA 2J9HA 3A2VA 3GL3A 3GSSA 1GTIA 3Q18A 5D9XA 1T00A 4I97A 2LQQA 1T3BA 2DJJA 2O89A 4EDZA 3IE3A 4ECJA 1JZDA 3ZVJD 3KD0A 2HZFA 3UAPA 3TKRA 1OE8A 2DIZA 5INYA 2TRCP 2IL3A 2YANA 5LD0A 2VLVA 2EC4A 2IMKA 3SBCA 4USSA 2VCQA 3QAWA 2PPTA 2DMMA 1RK4A 3TJFA 1I5GA 1IYIA 2R6KA 2H75A 4JRRA 4BWSA 3GFKA 1SJZA 2R4VA 4TR4A 2K8SA 2GSRA 1E2YA 4WF4A 3QDNA 4PQ1A 4JR6A 5FWGA 1U6TA 5AIVA 3TGZA 4OD7A 3KH9A 2K9FA 1R5PA 2WZ9A 4NPBA 1K0OA 1Q98A 3APOA 4MZBA 3UJ1A 1TRSA 5IIZA 1XPVA 3KCMA 1XWCA 1WOUA 3TJKA 3S9FA 4HI7A 5DQYA 1PRXA 2WDUA 3D4MA 2LUSA 3GKKA 3RBTA 2YV7A 4PXOA 4OO4A 3J7Yb 2RM5A 5GSSA 11GSA 2AHEA 2ZNMA 2K6VA 3W8SA 5ECRB 3QCPA 1TXXA 3ME8A 5DCGA 2E7PA 3VPQA 2GS3A 3IAS2 4E8HA 2O7KA 1X5DA 3HDCA 3NOFA 2CX4A 3A3TA 2K8VA 4RQRA 3UBLA 3UBKA 1M2AA 1TI3A 2VLUA 2VUPA 2KUCA 4GTUA 4D73A 3IK9A 4XRDA 4HOJA 1CQGA 5HR3A 2F9SA 3LXZA 5IQYA 4XCSA 1YKAA 5A4VA 3V1WA 2YNXA 1UN2A 1BAYA 4KGIA 5DQSA 4ILFA 1TK0B 1X9MB 5L71A 2IFQA 3GH6A 2OBIA 1TP9A 2NPBA 2WFCA 2I81A 5CREA 2C3QA 2LNSA 3PGTA 4MJEA 3PINA 1K0BA 4K0GA 2H66A 3P7XA 3ZIJA 5DJLA 3GYKA 1PKZA 4MPGA 4POBA 3RDWA 3DD3A 5ECPB 2A2SA 2GTUA 3ISOA 4WR4A 4KF9A 3UEMA 4BVXA 2R5GA 4IQAA 5A4WA 4GSTA 3LORA 4F82A 2GSTA 3IC8A 3H8QA 4DSSA 4IKHA 1ZCPA 2R2JA 2VAFA 4XS1A 4ID0A 3Q74A 5H5SA 5IMVA 2H1GA 1Y25A 3FR3A 3HD5A 1GNWA 1XW5A 3VWVA 2D2ZA 3I43A 2R3XA 1QQ2A 4CW9A 3W6GA 3J7Yk 5DVBA 4QL7A 3ZYWA 3KEBA 3F3QA 2DJKA 3FYGA 3LWAA 1R5AA 4P3YB 2IFQB 1HNBA 4OFTA 3UVHA 4WXTA 3CTGA 2GGTA 2L57A 4K1FA 4GQCA 3ERFA 17GSA 1GSDA 3C71A 1MDIA 3TUEA 1XCCA 4X1UA 3VFIA 3RAZA 1ML6A 2IIYA 1MDKA 2GSSA 2XBIA 3UMAA 2NBSA 2LSTA 1V98A 4BA7A 2L6DA 4MF7A 1V40A 4GSNA 5HFIA 3TKPA 1M9AA 5IO0A 1O8XA 4BVXB 1K0AA 3LYPA 3TKQA 3IA1A 3EMXA 1NM3A 5DJMA 4WF5A 4TXVA 5CRHA 3RPPA 2HE3A 2MZCA 2H73A 5ELGA 1GLPA 2H74A 5D96A 5F05A 3TDGA 5AISA 5EPFA 4MP4A 6GSWA 2KP2A 4OWYA 1J0FA 1TJDA 4WR5A 4OFMA 1FHEA 2JSZA 3ZLPA 1OE7A 2DBCA 3WGEA 4ECCA 2GQMA 1XWAA 1X5CA 2FLSA 4YQUA 1YKCA 4ISDA 4L5OA 3L9SA 2WJUA 2ES7A 3FEUA 2F3MA 3BCKA 1ZL9A 2I1UA 4DEJA 3L9VA 1ACVA 1ERTA 3F0IA 4OCFA 3KMOA 4JE1A 5ECMB 4LL1B 4PQHA 2WRTA 3RHBA 1TRUA 2DC5A 5G30A 4XRAA 2PN8A 4CHSA 2JZSA 4L5LA 2H6XA 2DJ0A 4MH3A 2H70A 4PTSA 1Z6MA 4FH8A 1TKDB 1TW9A 4EXJA 4RI7A 5F8BA 1PD21 2M46A 2OBKA 2FA8A 1MD3A 3CRTA 4MABA 3KTBA 1EOGA 4G0IA 3HZ8A 1W89A 2F8FA 1SD9A 1BJXA 5JCUA 3GL5A 1Q4JA 3TKSA 2C4JA 1AXDA 1O6JA 13GSA 4IVFA 4O5RA 3F3RA 4RQXA 5ECHB 2FCHA 5IMDA 4OMVA 1T8EB 3M0FA 1U3IA 1MDJA 2RUFA 4IP6A 2O8VB 3GTUB 1PGTA 4WBJA 3G7IA 1JLVA 3A2XA 4ZL7A 1X5EA 3MSZA 5ECQB 2MYGA 4ACSA 4YQVA 1O73A 2LTKA 1URMA 5G1KA 4F03A 5G5EA 2QKEA 3FKFA 5ABRA 1EEJA 2LJKA 4MF5A 1SL0B 4TN8A 5GAND 2X99A 3P90A 5G5FA 1LJRA 2HLSA 2OE1A 3FY7A 3HXSA 3F6FA 2YWIA 4ZILA 1XW9A 5J5NA 2FA4A 2IN3A 2CAQA 4EL1A 1THOA 4HQZA 4MPFA 2H6ZA 3GN3A 4POMA 5DDLA 5IMFA 2LRNA 5G31A 2TRXA 1M7TA 3FZAA 3HJOA 1ZYEA 4G9HA 2VCTA 3EMPA 1W4VA 2V2GA 1ERWA 3D22A 3U5RE 3UVTA 2K18A 1E6BA 1GTAA 2GQKA 4I2UA 2FWHA 3CSJA 4K6XA 1WRYA 4N0VA 4V2MA 4V2LA 2VLTA 2CA8A 2OJLA 1XWBA 3CMIA 2FD3A 4GCIA 4ZXGA 1V9WA 5KN2A 3CXGA 2FY6A 3VWXA 1AAZA 5IMCA 2H0GA 3QOUA 1A8YA 2YJHA 1FOVA 3LFLA 1ST9A 4YQMA 2HRFA 2YP6A 2YZUA 3KZQA 1GSEA 4V1Ap 1USBA 2TIRA 4K8MA 1X9SB 1PL2A 2H30A 3HY2A 1NHOA 1K0CA 3KIJA 5A5KA 2VCWA 1DE2A 1GNEA 5E59A 2AJQB 3EVIA 4TRXA 3TOUA 2C3NA 2KOKA 3C73A 1HNCA 4JZQA 2GT6A 5ECKB 3VI5A 4LLRA 1M0UA 2H76A 3CTFA 4PX1A 4XTSA 4EKZA 2B7JA 4LA1A 1HD2A 1AUCA 2Z9SA 2C3TA 5DAKB 2VO4A 2CVBA 3UARA 2VCXA 4KDUA 4LMVA 5ELAA 2CT6A 2AB6A 1GWCA 3L78A 3PH9A 1B9YC 3G7JA 3ZZXA 1NHYA 3IDVA 1XWKA 1K0DA 4PGTA 3C1RA 1PX7A 1F3BA 4EC0A 3K8NA 2LS5A 3KH7A 4O32A 3IRAA 2C8UA 5JWOB 3Q19A 1R26A 2DMLA 5CAXA 2NTOA 5C00A 2P31A 4MJBA 1XWGA 3GX8A 4FIWA 4RI6A 4J56E 4PUFC 5KEJA 1EV4A 1QUWA 5FT3A 1JHBA 4X43A 1TDIA 1TK5B 1YY7A 2VM2A 1QMVA 2H8LA 4KE3A 2OADA 4IQ1A 5CRWA 3F63A 1WPIA 4BVYA 3CBUA 1GSSA 4ZBAA 1S3CA 4Q5QA 1RQMA 1A2JA 2AV4A 2RM6A 4ML1A 3UIWA 4KDYA 2XPEA 2QSIA 2B7KA 3TOTA 3FK8A 1SENA 3ZTLA 2BMXA 3GURA 2DJ1A 4NV2A 1Z7PA 5HR2A 2IJYA 2LJRA 3P8WA 1K3OA 3QAGA 3KXOA 1F37A 3HHVA 3HJMA 1SKRB 3QFAC 1LU4A 1GSQA 20GSA 2CQ9A 1B4QA 3ZMKA 1ZOFA 4YH2A 1PKWA 5ECNB 3VWWA 1K3YA 4NHZA 2B3SA 4BPYA 3H79A 3EU4A 3MAKA 5D8IA 5GZZB 6GSUA 2VL2C 4ECBA 1EWXA 4TR1A 4J2FA 3WT2A 4F0CA 5D9TA 2GZPA 3GV1A 2VCZA 2IMFA 4MZWA 4GQFA 5KN0A 2CV4A 2VL9A 3M1GA 2YCDA 3IOSA 2ALBA 2PWJA 4HU7A 3GSTA 2LRTA 3BCIA 1OKDA 3LGCA 2EIQA 4N10A 3BOAA 1O8WA 4PNGA 3O6TA 6GSXA 4XS6A 6GSTA 3RPNA 1YEPA 2YV9A 3I9V2 4KW6A 4L8EA 2L4QA 2YOIA 2ON7A 2X8GA 2PBJA 1J9BA 4V2NA 3P2AA 3C8EA 4BVYB 2O87A 3A2WA 1PA3A 3IBHA 3HKRA 5ID2B 2IMEA 2B5YA 2DIYA 4HU9A 2KHPA 3WGDA 3UOMA 4LMWA 1OAZA 2IPAA 2XPDA 3DRNA 3KP9A 1A2MA 4O92A 4KSOA 3EYTA 3TKSC 3JCML 4ZBDA 4QQ7A 1PSQA 2L59A 1WMJA 3E0UA 1F6MC 3APSA 2C0DA 5B8AA 2KLXA 4TXOA 5HFGA 4PUAA 5JWQB 4POLA 2HSMB 4BL7B 5D93A 4K2DA 4IW9A 2HRAA
chains in the Genus database with same CATH superfamily
4N3ZA 1O81A 2L5OA 2HRNA 3BJ5A 2UZ8A 2HFDA 2LNTA 2JL4A 5JCGA 3PR8A 2AAWA 4TR1B 2VCVA 1KEBA 3IK7A 2N5FA 4K0NA 2RIIA 1MEKA 2C1YA 2B1KA 2L4CA 2DSAA 1GH2A 3LW9A 4EDYA 1A2LA 2VKZG 1PN0A 3DYRA 2MMNA 3GNJA 4I6XA 4PI0C 2VL3A 6GSYA 4K5RA 2N5AA 4GRFA 4EF0A 2P5QA 2X49A 2PUKC 3C7MA 5EY6A 3ZITA 2VOCA 2C80A 1XW6A 5AIXA 1J08A 4G19A 3D6IA 5J9BA 1EP7A 3CSHA 2H19A 5AGYA 1YF1A 2H1DA 3LXTA 4MF6A 1XIYA 3HJPA 4OO5A 2MBSA 2EIRA 5J4UA 3GTUA 1UVZA 1G0TA 3TJBA 2BJXA 2GDRA 4G0KA 4XS4A 2VM1A 4ZB6A 2GLRA 2GSQA 22GSA 4MCUA 4TXOB 5D73A 1FG4A 2WGRA 1RW1A 1GRXA 3E9JB 2XBQA 5ECSA 3KP8A 3A5IA 3LSZA 2ON5A 4KAEA 3GUSA 2ZUPA 3ZREA 2M80A 3F4TA 3KTLA 5H5RA 2IMDA 3VI7A 4KSMA 2P0GA 5ECOB 1AIUA 3ZFLA 1EP8A 2OE3A 3H93A 1YZXA 1Z5YE 3HVSA 4KCAA 1THXA 1GP1A 1QGVA 1DE1A 3H1NA 1YDKA 5ECIB 1ERVA 5GAPD 4LL4B 5F0GA 5BMUB 1X9WB 2YWNA 4NHWA 5J3RA 1BX9A 4HJMA 4AKXB 1XBSA 1SKSB 1GUMA 5LCZA 4Z7XA 2HI7A 1G6YA 4GSSA 4GWRA 1PMTA 1A0RP 2HQTA 1TI1A 3WGXA 1M2BA 2MMOA 4O7HA 4ZB7A 5G2ZA 1FO5A 1ZYQB 3D21A 3DEXA 2FWFA 2WULA 4X0XA 1V58A 1YJ6A 4XS4B 3GX0A 3TU3B 3VURA 2LRCA 1R4WA 3RHCA 1WIKA 3HA9A 1T1VA 3WT1A 3LYKA 5D9WA 1YEXA 4ZIJA 2OE0A 4HSCX 1DBYA 5JCWA 4K7OA 1F9MA 4IJ3A 2H71A 3C1SA 1VF1A 16GSA 1R7HA 5A1NB 4KUNA 4NV5A 1UC7A 1EOHA 4YKGA 5IM9A 1Y6EA 4KB3A 1MD4A 1WP0A 4DSQA 3BD2A 3L4NA 2L6CA 4IELA 5DAKA 5B8BA 4N0ZA 4I5QA 3R3EA 2X8CA 1OC9B 4WEYA 4QMKA 2KP1A 2CVDA 3US3A 3H4KA 1IYHA 1G7EA 1GTBA 1O7UA 3LQ7A 3LJRA 2BTOT 4TR3A 3ZL5A 2YN1A 4YAVA 4RUVA 1YF0A 1SVOA 1ABAA 4PQIA 3NZNA 5EVOA 1FB6A 3DMLA 1JLWA 5HFKA 4WKWA 3VLNA 4FYUA 3PPUA 3R2QA 5LNKe 4E8EA 12GSA 4DSRA 2JZRA 1OYJA 1N2AA 1SJIA 2V6KA 2JU5A 1KNGA 2A2RA 1S3DA 2C0GA 2MMAA 1B48A 1Z3EA 2HSHA 2QGVA 1AQWA 4POKA 3HYPA 1A23A 2C0EA 3ZMLA 1EZKA 1XOAA 1JZWA 5COHA 2OACA 1B8XA 3IHGA 4ZL8A 4JU5A 5D9VA 4YAPA 3KJYA 4ML6A 1U87A 2JSYA 4AF2A 1JZRA 2B5EA 1CQHA 5IMZA 5DALB 3DVXA 2WS2A 4GXZA 1VF4A 2GZZA 1Y1UA 2FWGA 5CP1A 3ZFBA 3QPMA 2H0IA 3FR9A 1GSUA 2HRKB 3IC4A 2IMIA 3KM6A 2GT5A 4Q5NA 2NVLA 1BYEA 2MMZA 3A5WA 3TRPA 2YWMA 1SU9A 1TRWA 3O76A 4IP1A 2WVXA 7GSSA 3M9KA 3DXBA 4ULXA 2WW2A 3ERWA 2HXKA 4I8BA 3L0HA 1AC1A 1N25A 3IPZA 5KN3A 1QFNA 2O3EA 1VGLA 4FQUA 4N11A 2WVYA 2V6OA 1B4PA 3WD6A 2QA2A 2CZ3A 1VF3A 1WJKA 4DVCA 3DWVA 1JFUA 4KDXA 2MBTA 1WWJA 2YJ7A 2FWEA 1TOFA 1PQNA 2CX3A 4KNDA 2GVPA 4HS1A 3BBYA 1PN9A 4NAXA 3APQA 4G0LA 5ENUA 3DGQA 2UV8G 1QXHA 2HZEB 1O85A 3ME7A 1B9XC 4JEDA 1DSBA 5CO3A 1VRSD 4WETA 1K0NA 3MDKA 4GF0A 1XOBA 3TB2A 4AJ6A 4G01A 3DIEA 3VWUA 5ID2A 3CHXC 2V1MA 2XC2A 3F4RA 2VD1A 5JWRB 1TU8A 5G1LA 3MNGA 3QMXA 4BWQA 5A4UA 2M72A 3GMFA 2FGXA 2WB9A 3TKSE 3EURA 1EV9A 2PGTA 1EGOA 2EFDA 2B5XA 1GSYA 4KA0A 2XHFA 4PNFA 4G10A 1TXUA 5F07A 4AKGA 1XVQA 2O85A 2HSMA 4BL7A 4IBPA 3GHAA 3WYWA 1TU7A 3TJJA 4TR0A 4AKIA 2PVQA 2F51A 2EIOA 3HVVA 1S3RA 8GSSA 1VF2A 3N5OA 1G7OA 1HYUA 2H1AA 3RGBC 3E3EA 2C0FA 2YZHA 1FVKA 2HSNB 3LG6A 2V32A 1ZZYA 1T4YA 3D0ZA 3ZIVA 2I3YA 2YPMA 1OC8A 2H01A 1Z7RA 2WZSA 1SL2B 4HZ4A 3ZVJA 4AGSA 2L5LA 1TRVA 4XIHA 1EGRA 1V2AA 3HCZA 1I9DA 4WBRD 18GSA 3M9JA 4PURA 4IHUA 2G2QA 1MTCA 4Z2RA 3G7YA 5KN1A 2RLIA 2PMTA 1AQVA 10GSA 1C72A 4FYCA 2CAIA 1G6WA 3MIXA 3D5JA 2X8HA 5J41A 1N8JA 2VD0A 2B6MA 4AJ7A 3EPTA 1M9BA 4KCEA 2WVZA 2CVKA 5J9CA 2VIMA 2DKHA 1KTEA 5AN1A 3IV4A 1ON4A 3SWLA 5HR0A 1S3AA 1KBNA 1GUHA 5B6MA 2CZ2A 1NW2A 1A24A 5CRDA 2A4VA 3KMNA 3U6VA 1PL1A 2FHEA 4D73B 2ZCTA 2H72A 2JADA 1K0MA 3W8JA 4GLTA 3MWHA 4NWYA 1SKWB 1XVWA 1T4ZA 2E2GA 1U3AA 4TKYA 3EC3A 1ILOA 1I1IP 5B7CA 4F2IA 4MA9A 4OFNA 2HYXA 5B6NA 19GSA 1M3IA 4ECIA 2N5BA 3Q6OA 4K7NA 2IWTA 4OCEA 5C04A 3FW2A 1U88A 4JR4A 5FHIA 2OKAA 3TRXA 2G0FA 5BMUA 2R37A 4HQSA 3TCOA 1BG5A 5IOWA 2AYTA 3QAVA 3GH9A 3IHQA 4KX4A 5IMAA 2OA7A 2B1LA 3QR6A 2WCIA 3GIXA 1HNAA 3FZ9A 3F8UA 3IR4A 3HZ4A 4YKFA 4AJ8A 4TW5A 3CRUA 4FXYP 2X64A 4EE0A 4TVEA 4G2EA 3KGKA 3L9UA 2I4AA 4MLYA 4DSSB 4J57E 4MJAA 4ZB8A 1DUGA 4ICYA 1HQOA 2NDOA 3M8NA 3F9UA 1ZYNA 4I2TA 5CNWA 1SK0A 3M3MA 5GSTA 3VK9A 2H6YA 2H1LA 4AI6A 3DKSA 3ERGA 1X0RA 3G9BA 4L0WA 4HJ2A 4N30A 2VL2A 1A0FA 4MH2A 6GSSA 2V41A 4MK3A 1BQ7A 3EINA 3CWGA 2HNLA 3F4SA 4V1Ag 5A1NA 2A2PA 1GUKA 5HQPA 4FO5A 2PERA 4JBBA 4Q5RA 3CQFA 3FR6A 3FZ5A 4MNNA 1M99A 5IPHA 2HSYA 2QC7A 1XZOA 2DJ2A 3EU3A 4ZL9A 1BEDA 3VPTA 4L0UA 5DCHA 1QK8A 1F3AA 3CSIA 1FAAA 3FZ4A 1ZGNA 3IXRA 2O5VA 1TK8B 3I6AA 1OC9A 3ZRDA 2J23A 4EVMA 1FW1A 1AQXA 2E2MA 2H1BA 1GULA 2I9HA 3GRXA 5KOXA 2JZTA 1XFLA 3ED3A 4HZ2A 2FUG2 3IAM2 1H75A 3N9JA 4MDCA 3F6DA 1H4OA 2PVOC 4F0BA 1JZOA 4QL9A 1GSFA 5DBQA 3OR5A 4ZB9A 2LQOA 4NXIA 4IJIA 2AUVA 1Z6NA 1SK1A 4EUYA 4K7IA 3QFBC 1ERUA 4MZCA 4IN0A 4CDOA 4H86A 2OT3A 5IO2A 5ECLB 4EO3A 2HT9A 3HVXA 2DJ3A 2YWOA 2E0QA 2JACA 5EL8A 1M2DA 4IGJA 4HEA2 4K9ZA 2DLXA 4F9ZA 4ZBBA 1F2EA 5H5QA 1FOHA 1OVNA 5DALA 3DVWA 1T7PB 3AY8A 1SD8A 5A34A 2F8AA 2GQLA 1OC3A 2H0HA 1Z9HA 2HRKA 1SJ6A 5IPGA 1GTUA 2R0GA 4HUAA 2LJAA 1SYRA 3O3TA 3FRCA 4MMMA 2LV3A 1SYXA 5CYYA 3GKNA 3UL3A 3GKMA 2LKUA 4NMUA 3I69A 4MJCA 1EEMA 1TTZA 2GZYA 3EE2A 1OKTA 1LBKA 3TRQA 1XXUA 1FB0A 1GLQA 9GSSA 3QD9A 1SK2A 5HR1A 4TOPA 3FHKA 3GA4A 5CRGA 14GSA 4IS0A 1NSWA 4FYBA 3D4TA 1UA5A 4HDEA 4XHMA 2P5RA 1WE0A 1A8LA 1YQ1A 2LEGA 1GL8A 3LEFA 6GSVA 5F06A 3GKXA 1V57A 4W66A 1K3LA 2FNOA 3EWLA 4Q5FA 3NIVA 1PX6A 5E4WA 3CYNA 5IOXA 2PU9C 2RUEA 1AW9A 1SL1B 4KH7A 2HZEA 3TJGA 1ZMAA 2REMA 1FVJA 2J9HA 3A2VA 3GL3A 3GSSA 1GTIA 3Q18A 5D9XA 1T00A 4I97A 2LQQA 1T3BA 2DJJA 2O89A 4EDZA 3IE3A 4ECJA 5A34B 1JZDA 3ZVJD 3KD0A 2HZFA 3UAPA 5BRTA 3TKRA 1OE8A 2DIZA 5INYA 2TRCP 2IL3A 2YANA 5LD0A 2VLVA 2EC4A 2IMKA 3SBCA 4USSA 2VCQA 3QAWA 2PPTA 2DMMA 1RK4A 3TJFA 1I5GA 1IYIA 2R6KA 2H75A 4JRRA 4BWSA 3GFKA 1SJZA 3MYDA 2R4VA 4TR4A 2K8SA 2GSRA 1E2YA 4WF4A 3QDNA 4PQ1A 4JR6A 5FWGA 1U6TA 5AIVA 2HSNA 3TGZA 4OD7A 3KH9A 2K9FA 1R5PA 2WZ9A 4NPBA 1K0OA 1Q98A 3APOA 4MZBA 3UJ1A 1TRSA 5IIZA 1XPVA 3KCMA 1XWCA 1WOUA 2WW1A 3TJKA 3S9FA 4HI7A 5DQYA 1PRXA 2WDUA 3D4MA 2LUSA 3GKKA 4EIQA 3RBTA 2YV7A 4PXOA 4OO4A 3J7Yb 2RM5A 5GSSA 11GSA 2WW3A 2AHEA 2ZNMA 2K6VA 3W8SA 5ECRB 3QCPA 1TXXA 4GDFA 3ME8A 5DCGA 2E7PA 3VPQA 2GS3A 3IAS2 4E8HA 2O7KA 1X5DA 3HDCA 3NOFA 2CX4A 3A3TA 2K8VA 2R0CA 4RQRA 3UBLA 3UBKA 4AKHA 1M2AA 1TI3A 2VLUA 2VUPA 1YEWC 2KUCA 4GTUA 4D73A 3IK9A 4XRDA 4HOJA 1CQGA 5HR3A 2F9SA 3LXZA 5IQYA 4XCSA 1YKAA 5A4VA 3V1WA 2YNXA 1UN2A 1BAYA 4KGIA 5DQSA 4ILFA 1TK0B 1X9MB 5L71A 2IFQA 3GH6A 2OBIA 1TP9A 2NPBA 2WFCA 2I81A 5CREA 2C3QA 2LNSA 3PGTA 4MJEA 3PINA 1K0BA 4K0GA 2H66A 3P7XA 3ZIJA 5DJLA 3GYKA 1PKZA 4MPGA 4POBA 1M3JA 5J40A 4PHZC 3RDWA 3DD3A 5ECPB 2A2SA 2GTUA 3ISOA 4Z2TA 4WR4A 4KF9A 3UEMA 4BVXA 2R5GA 4IQAA 5A4WA 4GSTA 3LORA 4F82A 2GSTA 3IC8A 2EFEA 3H8QA 4DSSA 4IKHA 1ZCPA 2R2JA 2VAFA 4XS1A 4ID0A 3Q74A 5H5SA 5IMVA 2H1GA 1Y25A 3FR3A 3HD5A 1GNWA 1XW5A 4A5PA 3VWVA 2D2ZA 3I43A 2R3XA 1QQ2A 5J47A 4CW9A 3W6GA 3J7Yk 5DVBA 4QL7A 3HMJG 3ZYWA 3KEBA 3F3QA 2DJKA 3FYGA 3LWAA 1R5AA 4P3YB 2IFQB 1HNBA 4OFTA 3UVHA 4WXTA 3CTGA 2GGTA 3FMWA 2L57A 4K1FA 4GQCA 3ERFA 17GSA 1GSDA 3C71A 1MDIA 3TUEA 1XCCA 4X1UA 2DKIA 3VFIA 3RAZA 1ML6A 2IIYA 1MDKA 2GSSA 2XBIA 3UMAA 2NBSA 2LSTA 1V98A 4BA7A 2L6DA 4MF7A 1V40A 4GSNA 5HFIA 3TKPA 1M9AA 5IO0A 1O8XA 4BVXB 1K0AA 3LYPA 3TKQA 3IA1A 3EMXA 1NM3A 5DJMA 4WF5A 4TXVA 5CRHA 3RPPA 2HE3A 2MZCA 2H73A 5ELGA 1GLPA 2H74A 5D96A 5F05A 4Z2UA 3TDGA 5AISA 5EPFA 4MP4A 6GSWA 2KP2A 4OWYA 1J0FA 1TJDA 4WR5A 4OFMA 1FHEA 2JSZA 3ZLPA 1OE7A 2DBCA 3WGEA 4ECCA 2GQMA 1XWAA 1X5CA 2FLSA 4YQUA 1YKCA 4ISDA 4L5OA 3L9SA 1PFOA 2WJUA 2ES7A 3FEUA 2F3MA 3BCKA 1ZL9A 2I1UA 4DEJA 3L9VA 4PI2C 4K5SA 1ACVA 1ERTA 3F0IA 4OCFA 3KMOA 4JE1A 5ECMB 4LL1B 4PQHA 1XG8A 5A5HA 2WRTA 3RHBA 1TRUA 2DC5A 5G30A 4XRAA 2A4HA 2PN8A 4CHSA 2JZSA 4L5LA 2X4AA 2H6XA 2DJ0A 4MH3A 5J4YA 2H70A 4PTSA 1Z6MA 4FH8A 1TKDB 1TW9A 4EXJA 2EFHA 4RI7A 5F8BA 1PD21 2M46A 2OBKA 2FA8A 1MD3A 3CRTA 4MABA 3KTBA 1EOGA 4G0IA 3HZ8A 1W89A 2F8FA 1SD9A 1BJXA 5JCUA 3GL5A 1Q4JA 5KOWA 3TKSA 2O36A 2C4JA 1AXDA 1O6JA 13GSA 4IVFA 4O5RA 3F3RA 4RQXA 5ECHB 2FCHA 5IMDA 4OMVA 1T8EB 3M0FA 1U3IA 1MDJA 2RUFA 4IP6A 2O8VB 3GTUB 1PGTA 4WBJA 3G7IA 1JLVA 3A2XA 4ZL7A 1X5EA 3MSZA 5ECQB 2MYGA 4ACSA 1ZYPA 4YQVA 1O73A 2LTKA 1URMA 5G1KA 4F03A 1YVLA 5G5EA 5A5HB 2QKEA 3FKFA 5ABRA 1EEJA 2LJKA 4MF5A 1SL0B 4TN8A 5GAND 4K2XA 2X99A 3P90A 5G5FA 1LJRA 2HLSA 2OE1A 3FY7A 3HXSA 3F6FA 2YWIA 4ZILA 3HVNA 1XW9A 5J5NA 2FA4A 2IN3A 2CAQA 4EL1A 1THOA 4HQZA 4MPFA 2H6ZA 3GN3A 4POMA 5DDLA 5IMFA 2LRNA 5G31A 2TRXA 4CY8A 1M7TA 3FZAA 3HJOA 1ZYEA 4G9HA 2VCTA 3EMPA 1W4VA 2V2GA 1ERWA 3D22A 3U5RE 3UVTA 2K18A 1E6BA 1GTAA 2GQKA 4I2UA 2FWHA 3CSJA 4K6XA 1WRYA 4N0VA 4V2MA 4V2LA 2VLTA 2CA8A 2OJLA 1XWBA 3CMIA 2FD3A 4GCIA 1BF5A 4ZXGA 1V9WA 5KN2A 3CXGA 2FY6A 3VWXA 1AAZA 5IMCA 2H0GA 3QOUA 1A8YA 2YJHA 1FOVA 3LFLA 1ST9A 4YQMA 2HRFA 2YP6A 2YZUA 4CY6A 3KZQA 1GSEA 4V1Ap 1USBA 2TIRA 4K8MA 1X9SB 1PL2A 2H30A 3HY2A 1NHOA 1K0CA 3KIJA 5A5KA 2VCWA 1DE2A 1GNEA 5E59A 4EIPA 2AJQB 3EVIA 4TRXA 3TOUA 2C3NA 2KOKA 3C73A 1HNCA 4JZQA 2GT6A 5ECKB 3VI5A 4LLRA 1M0UA 2H76A 3CTFA 4PX1A 4XTSA 4EKZA 2B7JA 4LA1A 1HD2A 1AUCA 2Z9SA 2C3TA 5DAKB 2VO4A 2CVBA 1S4BP 3UARA 4O5UA 2VCXA 4KDUA 4LMVA 5ELAA 2CT6A 2AB6A 1GWCA 3L78A 3PH9A 1B9YC 3G7JA 4E68A 3ZZXA 3IDVA 1NHYA 1XWKA 4BIKA 1K0DA 2WW0A 4PGTA 3C1RA 1PX7A 1F3BA 4EC0A 3K8NA 2LS5A 3KH7A 4O32A 3IRAA 2C8UA 5JWOB 3Q19A 1R26A 2DMLA 5CAXA 2NTOA 5C00A 2P31A 4MJBA 5J4VA 1XWGA 3GX8A 4FIWA 2EFCA 4RI6A 4J56E 4PUFC 5KEJA 1EV4A 1QUWA 1SVMA 5FT3A 1JHBA 4X43A 1TDIA 1TK5B 1YY7A 2VM2A 1QMVA 2H8LA 4KE3A 2OADA 4IQ1A 5CRWA 3F63A 1WPIA 4BVYA 3CBUA 1GSSA 4ZBAA 1S3CA 4Q5QA 1RQMA 1A2JA 2AV4A 2RM6A 4ML1A 3UIWA 4KDYA 2XPEA 2QSIA 3RFRC 3TOTA 2B7KA 3FK8A 4X4JA 1SENA 3ZTLA 2BMXA 3GURA 2DJ1A 4NV2A 1Z7PA 5HR2A 2IJYA 2LJRA 3P8WA 1K3OA 3QAGA 3KXOA 1F37A 3HHVA 3HJMA 2WVXB 1SKRB 3QFAC 1LU4A 1GSQA 20GSA 2CQ9A 4O5QA 1B4QA 3ZMKA 1ZOFA 4YH2A 1PKWA 5ECNB 3VWWA 1K3YA 4NHZA 2B3SA 4BPYA 3H79A 3EU4A 3MAKA 5D8IA 5GZZB 6GSUA 2VL2C 4ECBA 1EWXA 4TR1A 4J2FA 3WT2A 4F0CA 5D9TA 2GZPA 3GV1A 2VCZA 2IMFA 4MZWA 2QA1A 4GQFA 5KN0A 2CV4A 2VL9A 3M1GA 2YCDA 3IOSA 2ALBA 2PWJA 4HU7A 3GSTA 2LRTA 3BCIA 1OKDA 3LGCA 2EIQA 4N10A 3BOAA 1O8WA 4PNGA 3O6TA 6GSXA 4XS6A 6GSTA 3RPNA 1YEPA 2YV9A 1SVLA 3I9V2 4KW6A 4L8EA 2L4QA 2YOIA 2ON7A 2X8GA 2PBJA 1J9BA 4V2NA 3P2AA 3C8EA 4BVYB 2O87A 3A2WA 1PA3A 3IBHA 3HKRA 5ID2B 2IMEA 2B5YA 2DIYA 4HU9A 2KHPA 3WGDA 3UOMA 4LMWA 1OAZA 2IPAA 2XPDA 1BG1A 3DRNA 3KP9A 1A2MA 2R0PA 4O92A 4KSOA 3EYTA 3TKSC 3JCML 4ZBDA 4QQ7A 1PSQA 2L59A 1WMJA 3E0UA 1F6MC 3APSA 2C0DA 5B8AA 2KLXA 4TXOA 5HFGA 4PUAA 5JWQB 4POLA 2HSMB 4BL7B 5D93A 4K2DA 4IW9A 2HRAA
chains in the Genus database with same CATH topology
4N3ZA 1O81A 2L5OA 2HRNA 3BJ5A 2UZ8A 2HFDA 2LNTA 2JL4A 5JCGA 3PR8A 2AAWA 4TR1B 2VCVA 1KEBA 3IK7A 2N5FA 4K0NA 2RIIA 1MEKA 2C1YA 2B1KA 2L4CA 2DSAA 1GH2A 3LW9A 4EDYA 1A2LA 2VKZG 1PN0A 3DYRA 2MMNA 3GNJA 4I6XA 2VL3A 6GSYA 4K5RA 2N5AA 4GRFA 4EF0A 2P5QA 2X49A 2PUKC 3C7MA 5EY6A 3ZITA 2VOCA 2C80A 1XW6A 5AIXA 1J08A 4G19A 3D6IA 5J9BA 1EP7A 3CSHA 2H19A 5AGYA 1YF1A 2H1DA 3LXTA 4MF6A 1XIYA 3HJPA 4OO5A 2MBSA 2EIRA 5J4UA 3GTUA 1UVZA 1G0TA 3TJBA 2BJXA 2GDRA 4G0KA 4XS4A 2VM1A 4ZB6A 2GLRA 2GSQA 22GSA 4MCUA 4TXOB 5D73A 1FG4A 2WGRA 1RW1A 1GRXA 3E9JB 2XBQA 5ECSA 3KP8A 3A5IA 3LSZA 2ON5A 4KAEA 3GUSA 2ZUPA 3ZREA 2M80A 3F4TA 3KTLA 5H5RA 2IMDA 3VI7A 4KSMA 2P0GA 5ECOB 1AIUA 3ZFLA 1EP8A 2OE3A 3H93A 1YZXA 1Z5YE 3HVSA 4KCAA 1THXA 1GP1A 1QGVA 1DE1A 3H1NA 1YDKA 5ECIB 1ERVA 5GAPD 4LL4B 5F0GA 5BMUB 1X9WB 2YWNA 4NHWA 5J3RA 1BX9A 4HJMA 4AKXB 1XBSA 1SKSB 1GUMA 5LCZA 4Z7XA 2HI7A 1G6YA 4GSSA 4GWRA 1PMTA 1A0RP 2HQTA 1TI1A 3WGXA 1M2BA 2MMOA 4O7HA 4ZB7A 5G2ZA 1FO5A 1ZYQB 3D21A 3DEXA 2FWFA 2WULA 4X0XA 1V58A 1YJ6A 4XS4B 3GX0A 3TU3B 3VURA 2LRCA 1R4WA 3RHCA 1WIKA 3HA9A 1T1VA 3WT1A 3LYKA 5D9WA 1YEXA 4ZIJA 2OE0A 1DBYA 5JCWA 4K7OA 1F9MA 4IJ3A 2H71A 3C1SA 1VF1A 16GSA 1R7HA 5A1NB 4KUNA 4NV5A 1UC7A 1EOHA 4YKGA 5IM9A 1Y6EA 4KB3A 1MD4A 1WP0A 4DSQA 3BD2A 3L4NA 2L6CA 4IELA 5DAKA 5B8BA 4N0ZA 4I5QA 3R3EA 2X8CA 1OC9B 4WEYA 4QMKA 2KP1A 2CVDA 3US3A 3H4KA 1IYHA 1G7EA 1GTBA 1O7UA 3LQ7A 3LJRA 2BTOT 4TR3A 3ZL5A 2YN1A 4YAVA 4RUVA 1YF0A 1SVOA 1ABAA 4PQIA 3NZNA 5EVOA 1FB6A 3DMLA 1JLWA 5HFKA 4WKWA 3VLNA 4FYUA 3PPUA 3R2QA 5LNKe 4E8EA 12GSA 4DSRA 2JZRA 1OYJA 1N2AA 1SJIA 2V6KA 2JU5A 1KNGA 2A2RA 1S3DA 2C0GA 2MMAA 1B48A 1Z3EA 2HSHA 2QGVA 1AQWA 4POKA 3HYPA 1A23A 2C0EA 3ZMLA 1EZKA 1XOAA 1JZWA 5COHA 2OACA 1B8XA 3IHGA 4ZL8A 4JU5A 5D9VA 4YAPA 3KJYA 4ML6A 1U87A 2JSYA 4AF2A 1JZRA 2B5EA 1CQHA 5IMZA 5DALB 3DVXA 2WS2A 4GXZA 1VF4A 2GZZA 1Y1UA 2FWGA 5CP1A 3ZFBA 3QPMA 2H0IA 3FR9A 1GSUA 2HRKB 3IC4A 2IMIA 3KM6A 2GT5A 4Q5NA 2NVLA 1BYEA 2MMZA 3A5WA 3TRPA 1SU9A 2YWMA 1TRWA 3O76A 4IP1A 7GSSA 3M9KA 3DXBA 4ULXA 3ERWA 2HXKA 4I8BA 3L0HA 1AC1A 1N25A 3IPZA 5KN3A 1QFNA 1VGLA 4FQUA 4N11A 2V6OA 1B4PA 3WD6A 2QA2A 2CZ3A 1VF3A 1WJKA 4DVCA 3DWVA 1JFUA 4KDXA 2MBTA 1WWJA 2YJ7A 2FWEA 1TOFA 1PQNA 2CX3A 4KNDA 2GVPA 4HS1A 3BBYA 1PN9A 4NAXA 3APQA 4G0LA 5ENUA 3DGQA 2UV8G 1QXHA 2HZEB 1O85A 3ME7A 1B9XC 4JEDA 1DSBA 5CO3A 1VRSD 4WETA 1K0NA 3MDKA 4GF0A 1XOBA 3TB2A 4AJ6A 4G01A 3DIEA 3VWUA 5ID2A 2V1MA 2XC2A 3F4RA 2VD1A 5JWRB 1TU8A 5G1LA 3MNGA 3QMXA 4BWQA 5A4UA 2M72A 3GMFA 2FGXA 2WB9A 3TKSE 3EURA 1EV9A 2PGTA 1EGOA 2EFDA 2B5XA 1GSYA 4KA0A 2XHFA 4PNFA 4G10A 1TXUA 5F07A 4AKGA 1XVQA 2O85A 2HSMA 4BL7A 4IBPA 3GHAA 3WYWA 1TU7A 3TJJA 4TR0A 4AKIA 2PVQA 2F51A 2EIOA 3HVVA 8GSSA 1VF2A 3N5OA 1G7OA 1HYUA 2H1AA 3E3EA 2C0FA 2YZHA 1FVKA 2HSNB 3LG6A 2V32A 1ZZYA 1T4YA 3D0ZA 3ZIVA 2I3YA 2YPMA 1OC8A 2H01A 1Z7RA 1SL2B 4HZ4A 3ZVJA 4AGSA 2L5LA 1TRVA 4XIHA 1EGRA 1V2AA 3HCZA 1I9DA 4WBRD 18GSA 3M9JA 4PURA 4IHUA 2G2QA 1MTCA 4Z2RA 3G7YA 5KN1A 2RLIA 2PMTA 1AQVA 10GSA 1C72A 4FYCA 2CAIA 1G6WA 3MIXA 3D5JA 2X8HA 5J41A 1N8JA 2VD0A 2B6MA 4AJ7A 3EPTA 1M9BA 4KCEA 2CVKA 5J9CA 2VIMA 2DKHA 1KTEA 5AN1A 3IV4A 1ON4A 3SWLA 5HR0A 1S3AA 1KBNA 1GUHA 5B6MA 2CZ2A 1NW2A 1A24A 5CRDA 2A4VA 3KMNA 3U6VA 1PL1A 2FHEA 4D73B 2ZCTA 2H72A 2JADA 1K0MA 3W8JA 4GLTA 3MWHA 4NWYA 1SKWB 1XVWA 1T4ZA 2E2GA 1U3AA 4TKYA 3EC3A 1ILOA 4F2IA 5B7CA 4MA9A 4OFNA 2HYXA 5B6NA 19GSA 4ECIA 2N5BA 3Q6OA 4K7NA 2IWTA 4OCEA 5C04A 3FW2A 1U88A 4JR4A 5FHIA 2OKAA 3TRXA 2G0FA 5BMUA 2R37A 4HQSA 3TCOA 1BG5A 5IOWA 2AYTA 3QAVA 3GH9A 3IHQA 4KX4A 5IMAA 2OA7A 2B1LA 3QR6A 2WCIA 3GIXA 1HNAA 3FZ9A 3F8UA 3IR4A 3HZ4A 4YKFA 4AJ8A 4TW5A 3CRUA 2X64A 4EE0A 4TVEA 4G2EA 3KGKA 3L9UA 2I4AA 4MLYA 4DSSB 4J57E 4MJAA 4ZB8A 1DUGA 4ICYA 1HQOA 2NDOA 3M8NA 3F9UA 1ZYNA 4I2TA 5CNWA 1SK0A 3M3MA 5GSTA 3VK9A 2H6YA 2H1LA 4AI6A 3DKSA 3ERGA 1X0RA 3G9BA 4L0WA 4HJ2A 4N30A 2VL2A 1A0FA 4MH2A 6GSSA 2V41A 4MK3A 1BQ7A 3EINA 3CWGA 2HNLA 3F4SA 4V1Ag 5A1NA 2A2PA 1GUKA 5HQPA 4FO5A 2PERA 4JBBA 4Q5RA 3FZ5A 3FR6A 4MNNA 1M99A 5IPHA 2HSYA 2QC7A 1XZOA 2DJ2A 3EU3A 4ZL9A 1BEDA 3VPTA 4L0UA 5DCHA 1QK8A 1F3AA 3CSIA 1FAAA 3FZ4A 1ZGNA 3IXRA 2O5VA 1TK8B 3I6AA 1OC9A 3ZRDA 2J23A 4EVMA 1FW1A 1AQXA 2E2MA 2H1BA 1GULA 2I9HA 3GRXA 5KOXA 2JZTA 1XFLA 3ED3A 4HZ2A 2FUG2 3IAM2 1H75A 3N9JA 4MDCA 3F6DA 1H4OA 2PVOC 4F0BA 1JZOA 4QL9A 1GSFA 5DBQA 3OR5A 4ZB9A 2LQOA 4NXIA 4IJIA 2AUVA 1Z6NA 1SK1A 4EUYA 4K7IA 3QFBC 1ERUA 4MZCA 4IN0A 4CDOA 4H86A 2OT3A 5IO2A 5ECLB 4EO3A 2HT9A 3HVXA 2DJ3A 2YWOA 2E0QA 2JACA 5EL8A 1M2DA 4IGJA 4HEA2 4K9ZA 2DLXA 4F9ZA 4ZBBA 1F2EA 5H5QA 1FOHA 1OVNA 5DALA 3DVWA 1T7PB 3AY8A 1SD8A 5A34A 2F8AA 2GQLA 1OC3A 2H0HA 1Z9HA 2HRKA 1SJ6A 5IPGA 1GTUA 2R0GA 4HUAA 2LJAA 1SYRA 3O3TA 3FRCA 4MMMA 2LV3A 1SYXA 5CYYA 3GKNA 3UL3A 3GKMA 2LKUA 4NMUA 3I69A 4MJCA 1EEMA 1TTZA 2GZYA 3EE2A 1OKTA 1LBKA 3TRQA 1XXUA 1FB0A 1GLQA 9GSSA 3QD9A 1SK2A 5HR1A 4TOPA 3FHKA 3GA4A 5CRGA 14GSA 4IS0A 1NSWA 4FYBA 3D4TA 1UA5A 4HDEA 4XHMA 2P5RA 1WE0A 1A8LA 1YQ1A 2LEGA 1GL8A 3LEFA 6GSVA 5F06A 3GKXA 1V57A 4W66A 1K3LA 2FNOA 3EWLA 4Q5FA 3NIVA 1PX6A 5E4WA 3CYNA 5IOXA 2PU9C 2RUEA 1AW9A 1SL1B 4KH7A 2HZEA 3TJGA 1ZMAA 2REMA 1FVJA 2J9HA 3A2VA 3GL3A 3GSSA 1GTIA 3Q18A 5D9XA 1T00A 4I97A 2LQQA 1T3BA 2DJJA 2O89A 4EDZA 3IE3A 4ECJA 5A34B 1JZDA 3ZVJD 3KD0A 2HZFA 3UAPA 5BRTA 3TKRA 1OE8A 2DIZA 5INYA 2TRCP 2IL3A 2YANA 5LD0A 2VLVA 2EC4A 2IMKA 3SBCA 4USSA 2VCQA 3QAWA 2PPTA 2DMMA 1RK4A 3TJFA 1I5GA 1IYIA 2R6KA 2H75A 4JRRA 4BWSA 3GFKA 1SJZA 3MYDA 2R4VA 4TR4A 2K8SA 2GSRA 1E2YA 4WF4A 3QDNA 4PQ1A 4JR6A 5FWGA 1U6TA 5AIVA 2HSNA 3TGZA 4OD7A 3KH9A 2K9FA 1R5PA 2WZ9A 4NPBA 1K0OA 1Q98A 3APOA 4MZBA 3UJ1A 1TRSA 5IIZA 1XPVA 3KCMA 1XWCA 1WOUA 3TJKA 3S9FA 4HI7A 5DQYA 1PRXA 2WDUA 3D4MA 2LUSA 3GKKA 4EIQA 3RBTA 2YV7A 4PXOA 4OO4A 3J7Yb 2RM5A 5GSSA 11GSA 2AHEA 2ZNMA 2K6VA 3W8SA 5ECRB 3QCPA 1TXXA 4GDFA 3ME8A 5DCGA 2E7PA 3VPQA 2GS3A 3IAS2 4E8HA 2O7KA 1X5DA 3HDCA 3NOFA 2CX4A 3A3TA 2K8VA 2R0CA 4RQRA 3UBLA 3UBKA 4AKHA 1M2AA 1TI3A 2VLUA 2VUPA 2KUCA 4GTUA 4D73A 3IK9A 4XRDA 4HOJA 1CQGA 5HR3A 2F9SA 3LXZA 5IQYA 4XCSA 1YKAA 5A4VA 3V1WA 2YNXA 1UN2A 1BAYA 4KGIA 5DQSA 4ILFA 1TK0B 1X9MB 5L71A 2IFQA 3GH6A 2OBIA 1TP9A 2NPBA 2WFCA 2I81A 5CREA 2C3QA 2LNSA 3PGTA 4MJEA 3PINA 1K0BA 4K0GA 2H66A 3P7XA 3ZIJA 5DJLA 3GYKA 1PKZA 4MPGA 4POBA 5J40A 3RDWA 3DD3A 5ECPB 2A2SA 2GTUA 3ISOA 4Z2TA 4WR4A 4KF9A 3UEMA 4BVXA 2R5GA 4IQAA 5A4WA 4GSTA 3LORA 4F82A 2GSTA 3IC8A 2EFEA 3H8QA 4DSSA 4IKHA 1ZCPA 2R2JA 2VAFA 4XS1A 4ID0A 3Q74A 5H5SA 5IMVA 2H1GA 1Y25A 3FR3A 3HD5A 1GNWA 1XW5A 4A5PA 3VWVA 2D2ZA 3I43A 2R3XA 1QQ2A 5J47A 4CW9A 3W6GA 3J7Yk 5DVBA 4QL7A 3HMJG 3ZYWA 3KEBA 3F3QA 2DJKA 3FYGA 3LWAA 1R5AA 4P3YB 2IFQB 1HNBA 4OFTA 3UVHA 4WXTA 3CTGA 2GGTA 3FMWA 2L57A 4K1FA 4GQCA 3ERFA 17GSA 1GSDA 3C71A 1MDIA 3TUEA 1XCCA 4X1UA 2DKIA 3VFIA 3RAZA 1ML6A 2IIYA 1MDKA 2GSSA 2XBIA 3UMAA 2NBSA 2LSTA 1V98A 4BA7A 2L6DA 4MF7A 1V40A 4GSNA 5HFIA 3TKPA 1M9AA 5IO0A 1O8XA 4BVXB 1K0AA 3LYPA 3TKQA 3IA1A 3EMXA 1NM3A 5DJMA 4WF5A 4TXVA 5CRHA 3RPPA 2HE3A 2MZCA 2H73A 5ELGA 1GLPA 2H74A 5D96A 5F05A 4Z2UA 3TDGA 5AISA 5EPFA 4MP4A 6GSWA 2KP2A 4OWYA 1J0FA 1TJDA 4WR5A 4OFMA 1FHEA 2JSZA 3ZLPA 1OE7A 2DBCA 3WGEA 4ECCA 2GQMA 1XWAA 1X5CA 2FLSA 4YQUA 1YKCA 4ISDA 4L5OA 3L9SA 2WJUA 2ES7A 3FEUA 2F3MA 3BCKA 1ZL9A 2I1UA 4DEJA 3L9VA 4K5SA 1ACVA 1ERTA 3F0IA 4OCFA 3KMOA 4JE1A 5ECMB 4LL1B 4PQHA 5A5HA 2WRTA 3RHBA 1TRUA 2DC5A 5G30A 4XRAA 2A4HA 2PN8A 4CHSA 2JZSA 4L5LA 2X4AA 2H6XA 2DJ0A 4MH3A 5J4YA 2H70A 4PTSA 1Z6MA 4FH8A 1TKDB 1TW9A 4EXJA 2EFHA 4RI7A 5F8BA 1PD21 2M46A 2OBKA 2FA8A 1MD3A 3CRTA 4MABA 3KTBA 1EOGA 4G0IA 3HZ8A 1W89A 2F8FA 1SD9A 1BJXA 5JCUA 3GL5A 1Q4JA 5KOWA 3TKSA 2C4JA 1AXDA 1O6JA 13GSA 4IVFA 4O5RA 3F3RA 4RQXA 5ECHB 2FCHA 5IMDA 4OMVA 1T8EB 3M0FA 1U3IA 1MDJA 2RUFA 4IP6A 2O8VB 3GTUB 1PGTA 4WBJA 3G7IA 1JLVA 3A2XA 4ZL7A 1X5EA 3MSZA 5ECQB 2MYGA 4ACSA 1ZYPA 4YQVA 1O73A 2LTKA 1URMA 5G1KA 4F03A 1YVLA 5G5EA 5A5HB 2QKEA 3FKFA 5ABRA 1EEJA 2LJKA 4MF5A 1SL0B 4TN8A 5GAND 4K2XA 2X99A 3P90A 5G5FA 1LJRA 2HLSA 2OE1A 3FY7A 3HXSA 3F6FA 2YWIA 4ZILA 1XW9A 5J5NA 2FA4A 2IN3A 2CAQA 4EL1A 1THOA 4HQZA 4MPFA 2H6ZA 3GN3A 4POMA 5DDLA 5IMFA 2LRNA 5G31A 2TRXA 4CY8A 1M7TA 3FZAA 3HJOA 1ZYEA 4G9HA 2VCTA 3EMPA 1W4VA 2V2GA 1ERWA 3D22A 3U5RE 3UVTA 2K18A 1E6BA 1GTAA 2GQKA 4I2UA 2FWHA 3CSJA 4K6XA 1WRYA 4N0VA 4V2MA 4V2LA 2VLTA 2CA8A 2OJLA 1XWBA 3CMIA 2FD3A 4GCIA 1BF5A 4ZXGA 1V9WA 5KN2A 3CXGA 2FY6A 3VWXA 1AAZA 5IMCA 2H0GA 3QOUA 1A8YA 2YJHA 1FOVA 3LFLA 1ST9A 4YQMA 2HRFA 2YP6A 2YZUA 4CY6A 3KZQA 1GSEA 4V1Ap 1USBA 2TIRA 4K8MA 1X9SB 1PL2A 2H30A 3HY2A 1NHOA 1K0CA 3KIJA 5A5KA 2VCWA 1DE2A 1GNEA 5E59A 4EIPA 2AJQB 3EVIA 4TRXA 3TOUA 2C3NA 2KOKA 3C73A 1HNCA 4JZQA 2GT6A 5ECKB 3VI5A 4LLRA 1M0UA 2H76A 3CTFA 4PX1A 4XTSA 4EKZA 2B7JA 4LA1A 1HD2A 1AUCA 2Z9SA 2C3TA 5DAKB 2VO4A 2CVBA 3UARA 4O5UA 2VCXA 4KDUA 4LMVA 5ELAA 2CT6A 2AB6A 1GWCA 3L78A 3PH9A 1B9YC 3G7JA 4E68A 3ZZXA 3IDVA 1NHYA 1XWKA 1K0DA 4PGTA 3C1RA 1PX7A 1F3BA 4EC0A 3K8NA 2LS5A 3KH7A 4O32A 3IRAA 2C8UA 5JWOB 3Q19A 1R26A 2DMLA 5CAXA 2NTOA 5C00A 2P31A 4MJBA 5J4VA 1XWGA 3GX8A 4FIWA 2EFCA 4RI6A 4J56E 4PUFC 5KEJA 1EV4A 1QUWA 1SVMA 5FT3A 1JHBA 4X43A 1TDIA 1TK5B 1YY7A 2VM2A 1QMVA 2H8LA 4KE3A 2OADA 4IQ1A 5CRWA 3F63A 1WPIA 4BVYA 3CBUA 1GSSA 4ZBAA 1S3CA 4Q5QA 1RQMA 1A2JA 2AV4A 2RM6A 4ML1A 3UIWA 4KDYA 2XPEA 2QSIA 2B7KA 3TOTA 3FK8A 4X4JA 1SENA 3ZTLA 2BMXA 3GURA 2DJ1A 4NV2A 1Z7PA 5HR2A 2IJYA 2LJRA 3P8WA 1K3OA 3QAGA 3KXOA 1F37A 3HHVA 3HJMA 1SKRB 3QFAC 1LU4A 1GSQA 20GSA 2CQ9A 4O5QA 1B4QA 3ZMKA 1ZOFA 4YH2A 1PKWA 5ECNB 3VWWA 1K3YA 4NHZA 2B3SA 4BPYA 3H79A 3EU4A 3MAKA 5D8IA 5GZZB 6GSUA 2VL2C 4ECBA 1EWXA 4TR1A 4J2FA 3WT2A 4F0CA 5D9TA 2GZPA 3GV1A 2VCZA 2IMFA 4MZWA 2QA1A 4GQFA 5KN0A 2CV4A 2VL9A 3M1GA 2YCDA 3IOSA 2ALBA 2PWJA 4HU7A 3GSTA 2LRTA 3BCIA 1OKDA 3LGCA 2EIQA 4N10A 3BOAA 1O8WA 4PNGA 3O6TA 6GSXA 4XS6A 6GSTA 3RPNA 1YEPA 2YV9A 1SVLA 3I9V2 4KW6A 4L8EA 2L4QA 2YOIA 2ON7A 2X8GA 2PBJA 1J9BA 4V2NA 3P2AA 3C8EA 4BVYB 2O87A 3A2WA 1PA3A 3IBHA 3HKRA 5ID2B 2IMEA 2B5YA 2DIYA 4HU9A 2KHPA 3WGDA 3UOMA 4LMWA 1OAZA 2IPAA 2XPDA 1BG1A 3DRNA 3KP9A 1A2MA 2R0PA 4O92A 4KSOA 3EYTA 3TKSC 3JCML 4ZBDA 4QQ7A 1PSQA 2L59A 1WMJA 3E0UA 1F6MC 3APSA 2C0DA 5B8AA 2KLXA 4TXOA 5HFGA 4PUAA 5JWQB 4POLA 2HSMB 4BL7B 5D93A 4K2DA 4IW9A 2HRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O81 A;  2L5O A;  2HRN A;  3BJ5 A;  2UZ8 A;  2HFD A;  2LNT A;  2JL4 A;  5JCG A;  3PR8 A;  2AAW A;  4TR1 B;  2VCV A;  1KEB A;  3IK7 A;  2N5F A;  4K0N A;  2RII A;  1MEK A;  2C1Y A;  2B1K A;  2L4C A;  2DSA A;  1GH2 A;  4EDY A;  1A2L A;  3DYR A;  2MMN A;  3GNJ A;  4I6X A;  2VL3 A;  6GSY A;  2N5A A;  4GRF A;  4EF0 A;  2P5Q A;  2PUK C;  3C7M A;  5EY6 A;  3ZIT A;  2VOC A;  2C80 A;  1XW6 A;  5AIX A;  1J08 A;  4G19 A;  3D6I A;  5J9B A;  1EP7 A;  3CSH A;  2H19 A;  5AGY A;  1YF1 A;  2H1D A;  3LXT A;  4MF6 A;  1XIY A;  3HJP A;  4OO5 A;  2MBS A;  2EIR A;  5J4U A;  3GTU A;  1UVZ A;  1G0T A;  3TJB A;  2BJX A;  2GDR A;  4G0K A;  4XS4 A;  2VM1 A;  4ZB6 A;  2GLR A;  2GSQ A;  22GS A;  4MCU A;  4TXO B;  5D73 A;  1FG4 A;  2WGR A;  1RW1 A;  1GRX A;  3E9J B;  2XBQ A;  5ECS A;  3KP8 A;  3LSZ A;  2ON5 A;  4KAE A;  3GUS A;  2ZUP A;  3ZRE A;  2M80 A;  3F4T A;  3KTL A;  5H5R A;  2IMD A;  3VI7 A;  4KSM A;  2P0G A;  5ECO B;  1AIU A;  3ZFL A;  1EP8 A;  2OE3 A;  3H93 A;  1YZX A;  1Z5Y E;  3HVS A;  4KCA A;  1THX A;  1GP1 A;  1QGV A;  1DE1 A;  3H1N A;  1YDK A;  5ECI B;  1ERV A;  5GAP D;  4LL4 B;  5F0G A;  1X9W B;  2YWN A;  4NHW A;  5J3R A;  1BX9 A;  4HJM A;  1XBS A;  1SKS B;  1GUM A;  5LCZ A;  4Z7X A;  2HI7 A;  1G6Y A;  4GSS A;  4GWR A;  1PMT A;  1A0R P;  2HQT A;  1TI1 A;  3WGX A;  1M2B A;  2MMO A;  4O7H A;  5G2Z A;  1FO5 A;  1ZYQ B;  3D21 A;  3DEX A;  2FWF A;  2WUL A;  4X0X A;  1V58 A;  1YJ6 A;  4XS4 B;  3GX0 A;  3VUR A;  2LRC A;  1R4W A;  3RHC A;  1WIK A;  3HA9 A;  1T1V A;  3WT1 A;  3LYK A;  5D9W A;  1YEX A;  4ZIJ A;  2OE0 A;  1DBY A;  5JCW A;  4K7O A;  1F9M A;  4IJ3 A;  2H71 A;  3C1S A;  1VF1 A;  16GS A;  1R7H A;  4KUN A;  4NV5 A;  1UC7 A;  1EOH A;  5IM9 A;  1Y6E A;  4KB3 A;  1MD4 A;  1WP0 A;  4DSQ A;  3BD2 A;  3L4N A;  2L6C A;  4IEL A;  5DAK A;  5B8B A;  4N0Z A;  4I5Q A;  3R3E A;  2X8C A;  1OC9 B;  4WEY A;  2KP1 A;  2CVD A;  3US3 A;  3H4K A;  1IYH A;  1G7E A;  1GTB A;  1O7U A;  3LQ7 A;  3LJR A;  2BTO T;  4TR3 A;  3ZL5 A;  2YN1 A;  4YAV A;  4RUV A;  1YF0 A;  1ABA A;  4PQI A;  3NZN A;  5EVO A;  1FB6 A;  3DML A;  1JLW A;  5HFK A;  4WKW A;  3VLN A;  4FYU A;  3PPU A;  3R2Q A;  5LNK e;  4E8E A;  12GS A;  4DSR A;  2JZR A;  1OYJ A;  1N2A A;  1SJI A;  2V6K A;  1KNG A;  1S3D A;  2A2R A;  2C0G A;  2JU5 A;  2MMA A;  1B48 A;  1Z3E A;  2HSH A;  2QGV A;  1AQW A;  4POK A;  3HYP A;  1A23 A;  2C0E A;  3ZML A;  1EZK A;  1XOA A;  1JZW A;  5COH A;  2OAC A;  1B8X A;  4ZL8 A;  4JU5 A;  5D9V A;  4YAP A;  3KJY A;  4ML6 A;  1U87 A;  2JSY A;  4AF2 A;  1JZR A;  2B5E A;  1CQH A;  5IMZ A;  5DAL B;  4GXZ A;  2WS2 A;  3DVX A;  1VF4 A;  2GZZ A;  2FWG A;  5CP1 A;  3ZFB A;  3QPM A;  2H0I A;  3FR9 A;  1GSU A;  2HRK B;  3IC4 A;  2IMI A;  3KM6 A;  2GT5 A;  4Q5N A;  2NVL A;  1BYE A;  2MMZ A;  3A5W A;  3TRP A;  1SU9 A;  2YWM A;  1TRW A;  3O76 A;  4IP1 A;  7GSS A;  3M9K A;  3DXB A;  4ULX A;  3ERW A;  2HXK A;  4I8B A;  3L0H A;  1AC1 A;  3IPZ A;  5KN3 A;  1QFN A;  1VGL A;  4FQU A;  4N11 A;  2V6O A;  1B4P A;  3WD6 A;  2CZ3 A;  1VF3 A;  1WJK A;  4DVC A;  3DWV A;  1JFU A;  4KDX A;  2MBT A;  1WWJ A;  2YJ7 A;  2FWE A;  1TOF A;  1PQN A;  2CX3 A;  4KND A;  2GVP A;  4HS1 A;  3BBY A;  1PN9 A;  4NAX A;  3APQ A;  4G0L A;  5ENU A;  3DGQ A;  1QXH A;  2HZE B;  1O85 A;  3ME7 A;  1B9X C;  4JED A;  1DSB A;  5CO3 A;  1VRS D;  4WET A;  1K0N A;  3MDK A;  4GF0 A;  1XOB A;  3TB2 A;  4AJ6 A;  3DIE A;  3VWU A;  5ID2 A;  2V1M A;  2XC2 A;  3F4R A;  2VD1 A;  5JWR B;  1TU8 A;  5G1L A;  3MNG A;  3QMX A;  4BWQ A;  5A4U A;  2M72 A;  3GMF A;  2FGX A;  2WB9 A;  3TKS E;  3EUR A;  1EV9 A;  2PGT A;  1EGO A;  2B5X A;  1GSY A;  4KA0 A;  2XHF A;  4PNF A;  4G10 A;  5F07 A;  1XVQ A;  2O85 A;  2HSM A;  4BL7 A;  4IBP A;  3GHA A;  3WYW A;  1TU7 A;  3TJJ A;  4TR0 A;  2PVQ A;  2F51 A;  2EIO A;  3HVV A;  8GSS A;  1VF2 A;  3N5O A;  1G7O A;  1HYU A;  2H1A A;  3E3E A;  2C0F A;  2YZH A;  1FVK A;  2HSN B;  3LG6 A;  2V32 A;  1ZZY A;  1T4Y A;  3D0Z A;  3ZIV A;  2I3Y A;  2YPM A;  1OC8 A;  2H01 A;  1Z7R A;  1SL2 B;  4HZ4 A;  3ZVJ A;  4AGS A;  2L5L A;  1TRV A;  4XIH A;  1EGR A;  1V2A A;  3HCZ A;  1I9D A;  4WBR D;  18GS A;  3M9J A;  4PUR A;  4IHU A;  2G2Q A;  1MTC A;  3G7Y A;  5KN1 A;  2RLI A;  2PMT A;  1AQV A;  10GS A;  1C72 A;  4FYC A;  2CAI A;  1G6W A;  3D5J A;  2X8H A;  5J41 A;  1N8J A;  2VD0 A;  2B6M A;  4AJ7 A;  1M9B A;  4KCE A;  2CVK A;  5J9C A;  2VIM A;  1KTE A;  5AN1 A;  3IV4 A;  1ON4 A;  3SWL A;  5HR0 A;  1S3A A;  1KBN A;  1GUH A;  5B6M A;  2CZ2 A;  1NW2 A;  1A24 A;  5CRD A;  2A4V A;  3KMN A;  3U6V A;  1PL1 A;  2FHE A;  4D73 B;  2ZCT A;  2H72 A;  2JAD A;  1K0M A;  3W8J A;  4GLT A;  3MWH A;  4NWY A;  1SKW B;  1XVW A;  1T4Z A;  2E2G A;  1U3A A;  4TKY A;  3EC3 A;  1ILO A;  4F2I A;  5B7C A;  4MA9 A;  4OFN A;  2HYX A;  5B6N A;  19GS A;  4ECI A;  2N5B A;  3Q6O A;  4K7N A;  2IWT A;  4OCE A;  5C04 A;  3FW2 A;  1U88 A;  4JR4 A;  5FHI A;  2OKA A;  3TRX A;  2G0F A;  5BMU A;  2R37 A;  4HQS A;  3TCO A;  1BG5 A;  5IOW A;  2AYT A;  3QAV A;  3GH9 A;  3IHQ A;  4KX4 A;  5IMA A;  2OA7 A;  2B1L A;  3QR6 A;  2WCI A;  3GIX A;  1HNA A;  3FZ9 A;  3F8U A;  3IR4 A;  3HZ4 A;  4AJ8 A;  4TW5 A;  3CRU A;  2X64 A;  4EE0 A;  4TVE A;  4G2E A;  3KGK A;  3L9U A;  2I4A A;  4MLY A;  4DSS B;  4J57 E;  4MJA A;  4ZB8 A;  1DUG A;  1HQO A;  2NDO A;  3M8N A;  3F9U A;  4I2T A;  5CNW A;  1SK0 A;  3M3M A;  5GST A;  3VK9 A;  2H6Y A;  3DKS A;  3ERG A;  1X0R A;  3G9B A;  4L0W A;  4HJ2 A;  4N30 A;  2VL2 A;  1A0F A;  4MH2 A;  6GSS A;  2V41 A;  4MK3 A;  1BQ7 A;  3EIN A;  2HNL A;  3F4S A;  4V1A g;  1GUK A;  5HQP A;  4FO5 A;  2PER A;  4JBB A;  4Q5R A;  3FZ5 A;  3FR6 A;  1M99 A;  5IPH A;  2HSY A;  2QC7 A;  1XZO A;  2DJ2 A;  3EU3 A;  4ZL9 A;  1BED A;  3VPT A;  4L0U A;  5DCH A;  1QK8 A;  1F3A A;  3CSI A;  1FAA A;  3FZ4 A;  1ZGN A;  3IXR A;  1TK8 B;  3I6A A;  1OC9 A;  3ZRD A;  2J23 A;  4EVM A;  1FW1 A;  1AQX A;  2E2M A;  2H1B A;  1GUL A;  2I9H A;  3GRX A;  2JZT A;  1XFL A;  3ED3 A;  4HZ2 A;  2FUG 2;  3IAM 2;  1H75 A;  3N9J A;  4MDC A;  3F6D A;  1H4O A;  2PVO C;  4F0B A;  1JZO A;  4QL9 A;  1GSF A;  5DBQ A;  3OR5 A;  4ZB9 A;  2LQO A;  4NXI A;  4IJI A;  2AUV A;  1Z6N A;  1SK1 A;  4EUY A;  4K7I A;  3QFB C;  1ERU A;  4MZC A;  4IN0 A;  4CDO A;  4H86 A;  5IO2 A;  5ECL B;  4EO3 A;  2HT9 A;  3HVX A;  2DJ3 A;  2YWO A;  2E0Q A;  2JAC A;  5EL8 A;  1M2D A;  4IGJ A;  4HEA 2;  4K9Z A;  2DLX A;  4F9Z A;  4ZBB A;  1F2E A;  5H5Q A;  1OVN A;  5DAL A;  3DVW A;  1T7P B;  3AY8 A;  1SD8 A;  2F8A A;  2GQL A;  1OC3 A;  2H0H A;  1Z9H A;  2HRK A;  1SJ6 A;  5IPG A;  1GTU A;  4HUA A;  2LJA A;  1SYR A;  3O3T A;  3FRC A;  4MMM A;  2LV3 A;  1SYX A;  5CYY A;  3GKN A;  3UL3 A;  3GKM A;  2LKU A;  4NMU A;  3I69 A;  4MJC A;  1EEM A;  1TTZ A;  2GZY A;  3EE2 A;  1OKT A;  1LBK A;  3TRQ A;  1XXU A;  1FB0 A;  1GLQ A;  9GSS A;  3QD9 A;  1SK2 A;  5HR1 A;  4TOP A;  3FHK A;  3GA4 A;  5CRG A;  14GS A;  4IS0 A;  1NSW A;  4FYB A;  3D4T A;  1UA5 A;  4HDE A;  4XHM A;  2P5R A;  1WE0 A;  1A8L A;  1YQ1 A;  2LEG A;  1GL8 A;  3LEF A;  6GSV A;  5F06 A;  3GKX A;  1V57 A;  1K3L A;  2FNO A;  3EWL A;  4Q5F A;  3NIV A;  1PX6 A;  5E4W A;  3CYN A;  5IOX A;  2PU9 C;  2RUE A;  1AW9 A;  1SL1 B;  4KH7 A;  2HZE A;  3TJG A;  1ZMA A;  2REM A;  1FVJ A;  2J9H A;  3A2V A;  3GL3 A;  3GSS A;  1GTI A;  3Q18 A;  5D9X A;  1T00 A;  4I97 A;  2LQQ A;  1T3B A;  2DJJ A;  2O89 A;  4EDZ A;  3IE3 A;  4ECJ A;  1JZD A;  3ZVJ D;  3KD0 A;  2HZF A;  3UAP A;  3TKR A;  1OE8 A;  2DIZ A;  5INY A;  2TRC P;  2IL3 A;  2YAN A;  5LD0 A;  2VLV A;  2EC4 A;  2IMK A;  3SBC A;  4USS A;  2VCQ A;  3QAW A;  2PPT A;  2DMM A;  1RK4 A;  3TJF A;  1I5G A;  1IYI A;  2R6K A;  2H75 A;  4JRR A;  4BWS A;  3GFK A;  1SJZ A;  2R4V A;  4TR4 A;  2K8S A;  2GSR A;  1E2Y A;  4WF4 A;  3QDN A;  4PQ1 A;  4JR6 A;  5FWG A;  1U6T A;  5AIV A;  3TGZ A;  4OD7 A;  3KH9 A;  2K9F A;  1R5P A;  2WZ9 A;  4NPB A;  1K0O A;  1Q98 A;  3APO A;  4MZB A;  3UJ1 A;  1TRS A;  5IIZ A;  1XPV A;  3KCM A;  1XWC A;  1WOU A;  3TJK A;  3S9F A;  4HI7 A;  5DQY A;  1PRX A;  2WDU A;  3D4M A;  2LUS A;  3GKK A;  3RBT A;  2YV7 A;  4PXO A;  4OO4 A;  3J7Y b;  2RM5 A;  5GSS A;  11GS A;  2AHE A;  2ZNM A;  2K6V A;  3W8S A;  5ECR B;  3QCP A;  1TXX A;  3ME8 A;  5DCG A;  2E7P A;  3VPQ A;  2GS3 A;  3IAS 2;  4E8H A;  2O7K A;  1X5D A;  3HDC A;  3NOF A;  2CX4 A;  3A3T A;  2K8V A;  4RQR A;  3UBL A;  3UBK A;  1M2A A;  1TI3 A;  2VLU A;  2VUP A;  2KUC A;  4GTU A;  4D73 A;  3IK9 A;  4XRD A;  4HOJ A;  1CQG A;  5HR3 A;  2F9S A;  3LXZ A;  5IQY A;  4XCS A;  1YKA A;  5A4V A;  3V1W A;  2YNX A;  1UN2 A;  1BAY A;  4KGI A;  5DQS A;  4ILF A;  1TK0 B;  1X9M B;  5L71 A;  2IFQ A;  3GH6 A;  2OBI A;  1TP9 A;  2NPB A;  2WFC A;  2I81 A;  5CRE A;  2C3Q A;  2LNS A;  3PGT A;  4MJE A;  3PIN A;  1K0B A;  4K0G A;  2H66 A;  3P7X A;  3ZIJ A;  5DJL A;  3GYK A;  1PKZ A;  4MPG A;  4POB A;  3RDW A;  3DD3 A;  5ECP B;  2A2S A;  2GTU A;  3ISO A;  4WR4 A;  4KF9 A;  3UEM A;  4BVX A;  2R5G A;  4IQA A;  5A4W A;  4GST A;  3LOR A;  4F82 A;  2GST A;  3IC8 A;  3H8Q A;  4DSS A;  4IKH A;  1ZCP A;  2R2J A;  2VAF A;  4XS1 A;  4ID0 A;  3Q74 A;  5H5S A;  5IMV A;  2H1G A;  1Y25 A;  3FR3 A;  3HD5 A;  1GNW A;  1XW5 A;  3VWV A;  2D2Z A;  3I43 A;  2R3X A;  1QQ2 A;  4CW9 A;  3W6G A;  3J7Y k;  5DVB A;  4QL7 A;  3ZYW A;  3KEB A;  3F3Q A;  2DJK A;  3FYG A;  3LWA A;  1R5A A;  4P3Y B;  2IFQ B;  1HNB A;  4OFT A;  3UVH A;  4WXT A;  3CTG A;  2GGT A;  2L57 A;  4K1F A;  4GQC A;  3ERF A;  17GS A;  1GSD A;  3C71 A;  1MDI A;  3TUE A;  1XCC A;  4X1U A;  3VFI A;  3RAZ A;  1ML6 A;  2IIY A;  1MDK A;  2GSS A;  2XBI A;  3UMA A;  2NBS A;  2LST A;  1V98 A;  4BA7 A;  2L6D A;  4MF7 A;  1V40 A;  4GSN A;  5HFI A;  3TKP A;  1M9A A;  5IO0 A;  1O8X A;  4BVX B;  1K0A A;  3LYP A;  3TKQ A;  3IA1 A;  3EMX A;  1NM3 A;  5DJM A;  4WF5 A;  4TXV A;  5CRH A;  3RPP A;  2HE3 A;  2MZC A;  2H73 A;  5ELG A;  1GLP A;  2H74 A;  5D96 A;  5F05 A;  3TDG A;  5AIS A;  5EPF A;  4MP4 A;  6GSW A;  2KP2 A;  4OWY A;  1J0F A;  1TJD A;  4WR5 A;  4OFM A;  1FHE A;  2JSZ A;  3ZLP A;  1OE7 A;  2DBC A;  3WGE A;  4ECC A;  2GQM A;  1XWA A;  1X5C A;  2FLS A;  4YQU A;  1YKC A;  4ISD A;  4L5O A;  3L9S A;  2WJU A;  2ES7 A;  3FEU A;  2F3M A;  3BCK A;  1ZL9 A;  2I1U A;  4DEJ A;  3L9V A;  1ACV A;  1ERT A;  3F0I A;  4OCF A;  3KMO A;  4JE1 A;  5ECM B;  4LL1 B;  4PQH A;  2WRT A;  3RHB A;  1TRU A;  2DC5 A;  5G30 A;  4XRA A;  2PN8 A;  4CHS A;  2JZS A;  4L5L A;  2H6X A;  2DJ0 A;  4MH3 A;  2H70 A;  4PTS A;  1Z6M A;  4FH8 A;  1TKD B;  1TW9 A;  4EXJ A;  4RI7 A;  5F8B A;  1PD2 1;  2M46 A;  2OBK A;  2FA8 A;  1MD3 A;  3CRT A;  4MAB A;  3KTB A;  1EOG A;  4G0I A;  3HZ8 A;  1W89 A;  2F8F A;  1SD9 A;  1BJX A;  5JCU A;  3GL5 A;  1Q4J A;  3TKS A;  2C4J A;  1AXD A;  1O6J A;  13GS A;  4IVF A;  4O5R A;  3F3R A;  4RQX A;  5ECH B;  2FCH A;  5IMD A;  4OMV A;  1T8E B;  3M0F A;  1U3I A;  1MDJ A;  2RUF A;  4IP6 A;  2O8V B;  3GTU B;  1PGT A;  4WBJ A;  3G7I A;  1JLV A;  3A2X A;  4ZL7 A;  1X5E A;  3MSZ A;  5ECQ B;  2MYG A;  4ACS A;  4YQV A;  1O73 A;  2LTK A;  1URM A;  5G1K A;  4F03 A;  5G5E A;  2QKE A;  3FKF A;  5ABR A;  1EEJ A;  2LJK A;  4MF5 A;  1SL0 B;  4TN8 A;  5GAN D;  2X99 A;  3P90 A;  5G5F A;  1LJR A;  2HLS A;  2OE1 A;  3FY7 A;  3HXS A;  3F6F A;  2YWI A;  4ZIL A;  1XW9 A;  5J5N A;  2FA4 A;  2IN3 A;  2CAQ A;  4EL1 A;  1THO A;  4HQZ A;  4MPF A;  2H6Z A;  3GN3 A;  4POM A;  5DDL A;  5IMF A;  2LRN A;  5G31 A;  2TRX A;  1M7T A;  3FZA A;  3HJO A;  1ZYE A;  4G9H A;  2VCT A;  3EMP A;  1W4V A;  2V2G A;  1ERW A;  3D22 A;  3U5R E;  3UVT A;  2K18 A;  1E6B A;  1GTA A;  2GQK A;  4I2U A;  2FWH A;  3CSJ A;  4K6X A;  1WRY A;  4N0V A;  4V2M A;  4V2L A;  2VLT A;  2CA8 A;  2OJL A;  1XWB A;  3CMI A;  2FD3 A;  4GCI A;  4ZXG A;  1V9W A;  5KN2 A;  3CXG A;  2FY6 A;  3VWX A;  1AAZ A;  5IMC A;  2H0G A;  3QOU A;  1A8Y A;  2YJH A;  1FOV A;  3LFL A;  1ST9 A;  4YQM A;  2HRF A;  2YP6 A;  2YZU A;  3KZQ A;  1GSE A;  4V1A p;  1USB A;  2TIR A;  4K8M A;  1X9S B;  1PL2 A;  2H30 A;  3HY2 A;  1NHO A;  1K0C A;  3KIJ A;  5A5K A;  2VCW A;  1DE2 A;  1GNE A;  5E59 A;  2AJQ B;  3EVI A;  4TRX A;  3TOU A;  2C3N A;  2KOK A;  3C73 A;  1HNC A;  4JZQ A;  2GT6 A;  5ECK B;  3VI5 A;  4LLR A;  1M0U A;  2H76 A;  3CTF A;  4PX1 A;  4XTS A;  4EKZ A;  2B7J A;  4LA1 A;  1HD2 A;  1AUC A;  2Z9S A;  2C3T A;  5DAK B;  2VO4 A;  2CVB A;  3UAR A;  2VCX A;  4KDU A;  4LMV A;  5ELA A;  2CT6 A;  2AB6 A;  1GWC A;  3L78 A;  3PH9 A;  1B9Y C;  3G7J A;  3ZZX A;  1NHY A;  3IDV A;  1XWK A;  1K0D A;  4PGT A;  3C1R A;  1PX7 A;  1F3B A;  4EC0 A;  3K8N A;  2LS5 A;  3KH7 A;  4O32 A;  3IRA A;  2C8U A;  5JWO B;  3Q19 A;  1R26 A;  2DML A;  5CAX A;  2NTO A;  5C00 A;  2P31 A;  4MJB A;  1XWG A;  3GX8 A;  4FIW A;  4RI6 A;  4J56 E;  4PUF C;  5KEJ A;  1EV4 A;  1QUW A;  5FT3 A;  1JHB A;  4X43 A;  1TDI A;  1TK5 B;  1YY7 A;  2VM2 A;  1QMV A;  2H8L A;  4KE3 A;  2OAD A;  4IQ1 A;  5CRW A;  3F63 A;  1WPI A;  4BVY A;  3CBU A;  1GSS A;  4ZBA A;  1S3C A;  4Q5Q A;  1RQM A;  1A2J A;  2AV4 A;  2RM6 A;  4ML1 A;  3UIW A;  4KDY A;  2XPE A;  2QSI A;  2B7K A;  3TOT A;  3FK8 A;  1SEN A;  3ZTL A;  2BMX A;  3GUR A;  2DJ1 A;  4NV2 A;  1Z7P A;  5HR2 A;  2IJY A;  2LJR A;  3P8W A;  1K3O A;  3QAG A;  3KXO A;  1F37 A;  3HHV A;  3HJM A;  1SKR B;  3QFA C;  1LU4 A;  1GSQ A;  20GS A;  2CQ9 A;  1B4Q A;  3ZMK A;  1ZOF A;  4YH2 A;  1PKW A;  5ECN B;  3VWW A;  1K3Y A;  4NHZ A;  2B3S A;  4BPY A;  3H79 A;  3EU4 A;  3MAK A;  5D8I A;  5GZZ B;  6GSU A;  2VL2 C;  4ECB A;  1EWX A;  4TR1 A;  4J2F A;  3WT2 A;  4F0C A;  5D9T A;  2GZP A;  3GV1 A;  2VCZ A;  2IMF A;  4MZW A;  4GQF A;  5KN0 A;  2CV4 A;  2VL9 A;  3M1G A;  2YCD A;  3IOS A;  2ALB A;  2PWJ A;  4HU7 A;  3GST A;  2LRT A;  3BCI A;  1OKD A;  3LGC A;  2EIQ A;  4N10 A;  3BOA A;  1O8W A;  4PNG A;  3O6T A;  6GSX A;  4XS6 A;  6GST A;  3RPN A;  1YEP A;  2YV9 A;  3I9V 2;  4KW6 A;  4L8E A;  2L4Q A;  2YOI A;  2ON7 A;  2X8G A;  2PBJ A;  1J9B A;  4V2N A;  3P2A A;  3C8E A;  4BVY B;  2O87 A;  3A2W A;  1PA3 A;  3IBH A;  3HKR A;  5ID2 B;  2IME A;  2B5Y A;  2DIY A;  4HU9 A;  2KHP A;  3WGD A;  3UOM A;  4LMW A;  1OAZ A;  2IPA A;  2XPD A;  3DRN A;  3KP9 A;  1A2M A;  4O92 A;  4KSO A;  3EYT A;  3TKS C;  3JCM L;  4ZBD A;  4QQ7 A;  1PSQ A;  2L59 A;  1WMJ A;  3E0U A;  1F6M C;  3APS A;  2C0D A;  5B8A A;  2KLX A;  4TXO A;  5HFG A;  4PUA A;  5JWQ B;  4POL A;  2HSM B;  4BL7 B;  5D93 A;  4K2D A;  4IW9 A;  2HRA A; 
#chains in the Genus database with same CATH topology
 4N3Z A;  1O81 A;  2L5O A;  2HRN A;  3BJ5 A;  2UZ8 A;  2HFD A;  2LNT A;  2JL4 A;  5JCG A;  3PR8 A;  2AAW A;  4TR1 B;  2VCV A;  1KEB A;  3IK7 A;  2N5F A;  4K0N A;  2RII A;  1MEK A;  2C1Y A;  2B1K A;  2L4C A;  2DSA A;  1GH2 A;  3LW9 A;  4EDY A;  1A2L A;  2VKZ G;  1PN0 A;  3DYR A;  2MMN A;  3GNJ A;  4I6X A;  4PI0 C;  2VL3 A;  6GSY A;  4K5R A;  2N5A A;  4GRF A;  4EF0 A;  2P5Q A;  2X49 A;  2PUK C;  3C7M A;  5EY6 A;  3ZIT A;  2VOC A;  2C80 A;  1XW6 A;  5AIX A;  1J08 A;  4G19 A;  3D6I A;  5J9B A;  1EP7 A;  3CSH A;  2H19 A;  5AGY A;  1YF1 A;  2H1D A;  3LXT A;  4MF6 A;  1XIY A;  3HJP A;  4OO5 A;  2MBS A;  2EIR A;  5J4U A;  3GTU A;  1UVZ A;  1G0T A;  3TJB A;  2BJX A;  2GDR A;  4G0K A;  4XS4 A;  2VM1 A;  4ZB6 A;  2GLR A;  2GSQ A;  22GS A;  4MCU A;  4TXO B;  5D73 A;  1FG4 A;  2WGR A;  1RW1 A;  1GRX A;  3E9J B;  2XBQ A;  5ECS A;  3KP8 A;  3A5I A;  3LSZ A;  2ON5 A;  4KAE A;  3GUS A;  2ZUP A;  3ZRE A;  2M80 A;  3F4T A;  3KTL A;  5H5R A;  2IMD A;  3VI7 A;  4KSM A;  2P0G A;  5ECO B;  1AIU A;  3ZFL A;  1EP8 A;  2OE3 A;  3H93 A;  1YZX A;  1Z5Y E;  3HVS A;  4KCA A;  1THX A;  1GP1 A;  1QGV A;  1DE1 A;  3H1N A;  1YDK A;  5ECI B;  1ERV A;  5GAP D;  4LL4 B;  5F0G A;  5BMU B;  1X9W B;  2YWN A;  4NHW A;  5J3R A;  1BX9 A;  4HJM A;  4AKX B;  1XBS A;  1SKS B;  1GUM A;  5LCZ A;  4Z7X A;  2HI7 A;  1G6Y A;  4GSS A;  4GWR A;  1PMT A;  1A0R P;  2HQT A;  1TI1 A;  3WGX A;  1M2B A;  2MMO A;  4O7H A;  4ZB7 A;  5G2Z A;  1FO5 A;  1ZYQ B;  3D21 A;  3DEX A;  2FWF A;  2WUL A;  4X0X A;  1V58 A;  1YJ6 A;  4XS4 B;  3GX0 A;  3TU3 B;  3VUR A;  2LRC A;  1R4W A;  3RHC A;  1WIK A;  3HA9 A;  1T1V A;  3WT1 A;  3LYK A;  5D9W A;  1YEX A;  4ZIJ A;  2OE0 A;  4HSC X;  1DBY A;  5JCW A;  4K7O A;  1F9M A;  4IJ3 A;  2H71 A;  3C1S A;  1VF1 A;  16GS A;  1R7H A;  5A1N B;  4KUN A;  4NV5 A;  1UC7 A;  1EOH A;  4YKG A;  5IM9 A;  1Y6E A;  4KB3 A;  1MD4 A;  1WP0 A;  4DSQ A;  3BD2 A;  3L4N A;  2L6C A;  4IEL A;  5DAK A;  5B8B A;  4N0Z A;  4I5Q A;  3R3E A;  2X8C A;  1OC9 B;  4WEY A;  4QMK A;  2KP1 A;  2CVD A;  3US3 A;  3H4K A;  1IYH A;  1G7E A;  1GTB A;  1O7U A;  3LQ7 A;  3LJR A;  2BTO T;  4TR3 A;  3ZL5 A;  2YN1 A;  4YAV A;  4RUV A;  1YF0 A;  1SVO A;  1ABA A;  4PQI A;  3NZN A;  5EVO A;  1FB6 A;  3DML A;  1JLW A;  5HFK A;  4WKW A;  3VLN A;  4FYU A;  3PPU A;  3R2Q A;  5LNK e;  4E8E A;  12GS A;  4DSR A;  2JZR A;  1OYJ A;  1N2A A;  1SJI A;  2V6K A;  2JU5 A;  1KNG A;  2A2R A;  1S3D A;  2C0G A;  2MMA A;  1B48 A;  1Z3E A;  2HSH A;  2QGV A;  1AQW A;  4POK A;  3HYP A;  1A23 A;  2C0E A;  3ZML A;  1EZK A;  1XOA A;  1JZW A;  5COH A;  2OAC A;  1B8X A;  3IHG A;  4ZL8 A;  4JU5 A;  5D9V A;  4YAP A;  3KJY A;  4ML6 A;  1U87 A;  2JSY A;  4AF2 A;  1JZR A;  2B5E A;  1CQH A;  5IMZ A;  5DAL B;  3DVX A;  2WS2 A;  4GXZ A;  1VF4 A;  2GZZ A;  1Y1U A;  2FWG A;  5CP1 A;  3ZFB A;  3QPM A;  2H0I A;  3FR9 A;  1GSU A;  2HRK B;  3IC4 A;  2IMI A;  3KM6 A;  2GT5 A;  4Q5N A;  2NVL A;  1BYE A;  2MMZ A;  3A5W A;  3TRP A;  2YWM A;  1SU9 A;  1TRW A;  3O76 A;  4IP1 A;  2WVX A;  7GSS A;  3M9K A;  3DXB A;  4ULX A;  2WW2 A;  3ERW A;  2HXK A;  4I8B A;  3L0H A;  1AC1 A;  1N25 A;  3IPZ A;  5KN3 A;  1QFN A;  2O3E A;  1VGL A;  4FQU A;  4N11 A;  2WVY A;  2V6O A;  1B4P A;  3WD6 A;  2QA2 A;  2CZ3 A;  1VF3 A;  1WJK A;  4DVC A;  3DWV A;  1JFU A;  4KDX A;  2MBT A;  1WWJ A;  2YJ7 A;  2FWE A;  1TOF A;  1PQN A;  2CX3 A;  4KND A;  2GVP A;  4HS1 A;  3BBY A;  1PN9 A;  4NAX A;  3APQ A;  4G0L A;  5ENU A;  3DGQ A;  2UV8 G;  1QXH A;  2HZE B;  1O85 A;  3ME7 A;  1B9X C;  4JED A;  1DSB A;  5CO3 A;  1VRS D;  4WET A;  1K0N A;  3MDK A;  4GF0 A;  1XOB A;  3TB2 A;  4AJ6 A;  4G01 A;  3DIE A;  3VWU A;  5ID2 A;  3CHX C;  2V1M A;  2XC2 A;  3F4R A;  2VD1 A;  5JWR B;  1TU8 A;  5G1L A;  3MNG A;  3QMX A;  4BWQ A;  5A4U A;  2M72 A;  3GMF A;  2FGX A;  2WB9 A;  3TKS E;  3EUR A;  1EV9 A;  2PGT A;  1EGO A;  2EFD A;  2B5X A;  1GSY A;  4KA0 A;  2XHF A;  4PNF A;  4G10 A;  1TXU A;  5F07 A;  4AKG A;  1XVQ A;  2O85 A;  2HSM A;  4BL7 A;  4IBP A;  3GHA A;  3WYW A;  1TU7 A;  3TJJ A;  4TR0 A;  4AKI A;  2PVQ A;  2F51 A;  2EIO A;  3HVV A;  1S3R A;  8GSS A;  1VF2 A;  3N5O A;  1G7O A;  1HYU A;  2H1A A;  3RGB C;  3E3E A;  2C0F A;  2YZH A;  1FVK A;  2HSN B;  3LG6 A;  2V32 A;  1ZZY A;  1T4Y A;  3D0Z A;  3ZIV A;  2I3Y A;  2YPM A;  1OC8 A;  2H01 A;  1Z7R A;  2WZS A;  1SL2 B;  4HZ4 A;  3ZVJ A;  4AGS A;  2L5L A;  1TRV A;  4XIH A;  1EGR A;  1V2A A;  3HCZ A;  1I9D A;  4WBR D;  18GS A;  3M9J A;  4PUR A;  4IHU A;  2G2Q A;  1MTC A;  4Z2R A;  3G7Y A;  5KN1 A;  2RLI A;  2PMT A;  1AQV A;  10GS A;  1C72 A;  4FYC A;  2CAI A;  1G6W A;  3MIX A;  3D5J A;  2X8H A;  5J41 A;  1N8J A;  2VD0 A;  2B6M A;  4AJ7 A;  3EPT A;  1M9B A;  4KCE A;  2WVZ A;  2CVK A;  5J9C A;  2VIM A;  2DKH A;  1KTE A;  5AN1 A;  3IV4 A;  1ON4 A;  3SWL A;  5HR0 A;  1S3A A;  1KBN A;  1GUH A;  5B6M A;  2CZ2 A;  1NW2 A;  1A24 A;  5CRD A;  2A4V A;  3KMN A;  3U6V A;  1PL1 A;  2FHE A;  4D73 B;  2ZCT A;  2H72 A;  2JAD A;  1K0M A;  3W8J A;  4GLT A;  3MWH A;  4NWY A;  1SKW B;  1XVW A;  1T4Z A;  2E2G A;  1U3A A;  4TKY A;  3EC3 A;  1ILO A;  1I1I P;  5B7C A;  4F2I A;  4MA9 A;  4OFN A;  2HYX A;  5B6N A;  19GS A;  1M3I A;  4ECI A;  2N5B A;  3Q6O A;  4K7N A;  2IWT A;  4OCE A;  5C04 A;  3FW2 A;  1U88 A;  4JR4 A;  5FHI A;  2OKA A;  3TRX A;  2G0F A;  5BMU A;  2R37 A;  4HQS A;  3TCO A;  1BG5 A;  5IOW A;  2AYT A;  3QAV A;  3GH9 A;  3IHQ A;  4KX4 A;  5IMA A;  2OA7 A;  2B1L A;  3QR6 A;  2WCI A;  3GIX A;  1HNA A;  3FZ9 A;  3F8U A;  3IR4 A;  3HZ4 A;  4YKF A;  4AJ8 A;  4TW5 A;  3CRU A;  4FXY P;  2X64 A;  4EE0 A;  4TVE A;  4G2E A;  3KGK A;  3L9U A;  2I4A A;  4MLY A;  4DSS B;  4J57 E;  4MJA A;  4ZB8 A;  1DUG A;  4ICY A;  1HQO A;  2NDO A;  3M8N A;  3F9U A;  1ZYN A;  4I2T A;  5CNW A;  1SK0 A;  3M3M A;  5GST A;  3VK9 A;  2H6Y A;  2H1L A;  4AI6 A;  3DKS A;  3ERG A;  1X0R A;  3G9B A;  4L0W A;  4HJ2 A;  4N30 A;  2VL2 A;  1A0F A;  4MH2 A;  6GSS A;  2V41 A;  4MK3 A;  1BQ7 A;  3EIN A;  3CWG A;  2HNL A;  3F4S A;  4V1A g;  5A1N A;  2A2P A;  1GUK A;  5HQP A;  4FO5 A;  2PER A;  4JBB A;  4Q5R A;  3CQF A;  3FR6 A;  3FZ5 A;  4MNN A;  1M99 A;  5IPH A;  2HSY A;  2QC7 A;  1XZO A;  2DJ2 A;  3EU3 A;  4ZL9 A;  1BED A;  3VPT A;  4L0U A;  5DCH A;  1QK8 A;  1F3A A;  3CSI A;  1FAA A;  3FZ4 A;  1ZGN A;  3IXR A;  2O5V A;  1TK8 B;  3I6A A;  1OC9 A;  3ZRD A;  2J23 A;  4EVM A;  1FW1 A;  1AQX A;  2E2M A;  2H1B A;  1GUL A;  2I9H A;  3GRX A;  5KOX A;  2JZT A;  1XFL A;  3ED3 A;  4HZ2 A;  2FUG 2;  3IAM 2;  1H75 A;  3N9J A;  4MDC A;  3F6D A;  1H4O A;  2PVO C;  4F0B A;  1JZO A;  4QL9 A;  1GSF A;  5DBQ A;  3OR5 A;  4ZB9 A;  2LQO A;  4NXI A;  4IJI A;  2AUV A;  1Z6N A;  1SK1 A;  4EUY A;  4K7I A;  3QFB C;  1ERU A;  4MZC A;  4IN0 A;  4CDO A;  4H86 A;  2OT3 A;  5IO2 A;  5ECL B;  4EO3 A;  2HT9 A;  3HVX A;  2DJ3 A;  2YWO A;  2E0Q A;  2JAC A;  5EL8 A;  1M2D A;  4IGJ A;  4HEA 2;  4K9Z A;  2DLX A;  4F9Z A;  4ZBB A;  1F2E A;  5H5Q A;  1FOH A;  1OVN A;  5DAL A;  3DVW A;  1T7P B;  3AY8 A;  1SD8 A;  5A34 A;  2F8A A;  2GQL A;  1OC3 A;  2H0H A;  1Z9H A;  2HRK A;  1SJ6 A;  5IPG A;  1GTU A;  2R0G A;  4HUA A;  2LJA A;  1SYR A;  3O3T A;  3FRC A;  4MMM A;  2LV3 A;  1SYX A;  5CYY A;  3GKN A;  3UL3 A;  3GKM A;  2LKU A;  4NMU A;  3I69 A;  4MJC A;  1EEM A;  1TTZ A;  2GZY A;  3EE2 A;  1OKT A;  1LBK A;  3TRQ A;  1XXU A;  1FB0 A;  1GLQ A;  9GSS A;  3QD9 A;  1SK2 A;  5HR1 A;  4TOP A;  3FHK A;  3GA4 A;  5CRG A;  14GS A;  4IS0 A;  1NSW A;  4FYB A;  3D4T A;  1UA5 A;  4HDE A;  4XHM A;  2P5R A;  1WE0 A;  1A8L A;  1YQ1 A;  2LEG A;  1GL8 A;  3LEF A;  6GSV A;  5F06 A;  3GKX A;  1V57 A;  4W66 A;  1K3L A;  2FNO A;  3EWL A;  4Q5F A;  3NIV A;  1PX6 A;  5E4W A;  3CYN A;  5IOX A;  2PU9 C;  2RUE A;  1AW9 A;  1SL1 B;  4KH7 A;  2HZE A;  3TJG A;  1ZMA A;  2REM A;  1FVJ A;  2J9H A;  3A2V A;  3GL3 A;  3GSS A;  1GTI A;  3Q18 A;  5D9X A;  1T00 A;  4I97 A;  2LQQ A;  1T3B A;  2DJJ A;  2O89 A;  4EDZ A;  3IE3 A;  4ECJ A;  5A34 B;  1JZD A;  3ZVJ D;  3KD0 A;  2HZF A;  3UAP A;  5BRT A;  3TKR A;  1OE8 A;  2DIZ A;  5INY A;  2TRC P;  2IL3 A;  2YAN A;  5LD0 A;  2VLV A;  2EC4 A;  2IMK A;  3SBC A;  4USS A;  2VCQ A;  3QAW A;  2PPT A;  2DMM A;  1RK4 A;  3TJF A;  1I5G A;  1IYI A;  2R6K A;  2H75 A;  4JRR A;  4BWS A;  3GFK A;  1SJZ A;  3MYD A;  2R4V A;  4TR4 A;  2K8S A;  2GSR A;  1E2Y A;  4WF4 A;  3QDN A;  4PQ1 A;  4JR6 A;  5FWG A;  1U6T A;  5AIV A;  2HSN A;  3TGZ A;  4OD7 A;  3KH9 A;  2K9F A;  1R5P A;  2WZ9 A;  4NPB A;  1K0O A;  1Q98 A;  3APO A;  4MZB A;  3UJ1 A;  1TRS A;  5IIZ A;  1XPV A;  3KCM A;  1XWC A;  1WOU A;  2WW1 A;  3TJK A;  3S9F A;  4HI7 A;  5DQY A;  1PRX A;  2WDU A;  3D4M A;  2LUS A;  3GKK A;  4EIQ A;  3RBT A;  2YV7 A;  4PXO A;  4OO4 A;  3J7Y b;  2RM5 A;  5GSS A;  11GS A;  2WW3 A;  2AHE A;  2ZNM A;  2K6V A;  3W8S A;  5ECR B;  3QCP A;  1TXX A;  4GDF A;  3ME8 A;  5DCG A;  2E7P A;  3VPQ A;  2GS3 A;  3IAS 2;  4E8H A;  2O7K A;  1X5D A;  3HDC A;  3NOF A;  2CX4 A;  3A3T A;  2K8V A;  2R0C A;  4RQR A;  3UBL A;  3UBK A;  4AKH A;  1M2A A;  1TI3 A;  2VLU A;  2VUP A;  1YEW C;  2KUC A;  4GTU A;  4D73 A;  3IK9 A;  4XRD A;  4HOJ A;  1CQG A;  5HR3 A;  2F9S A;  3LXZ A;  5IQY A;  4XCS A;  1YKA A;  5A4V A;  3V1W A;  2YNX A;  1UN2 A;  1BAY A;  4KGI A;  5DQS A;  4ILF A;  1TK0 B;  1X9M B;  5L71 A;  2IFQ A;  3GH6 A;  2OBI A;  1TP9 A;  2NPB A;  2WFC A;  2I81 A;  5CRE A;  2C3Q A;  2LNS A;  3PGT A;  4MJE A;  3PIN A;  1K0B A;  4K0G A;  2H66 A;  3P7X A;  3ZIJ A;  5DJL A;  3GYK A;  1PKZ A;  4MPG A;  4POB A;  1M3J A;  5J40 A;  4PHZ C;  3RDW A;  3DD3 A;  5ECP B;  2A2S A;  2GTU A;  3ISO A;  4Z2T A;  4WR4 A;  4KF9 A;  3UEM A;  4BVX A;  2R5G A;  4IQA A;  5A4W A;  4GST A;  3LOR A;  4F82 A;  2GST A;  3IC8 A;  2EFE A;  3H8Q A;  4DSS A;  4IKH A;  1ZCP A;  2R2J A;  2VAF A;  4XS1 A;  4ID0 A;  3Q74 A;  5H5S A;  5IMV A;  2H1G A;  1Y25 A;  3FR3 A;  3HD5 A;  1GNW A;  1XW5 A;  4A5P A;  3VWV A;  2D2Z A;  3I43 A;  2R3X A;  1QQ2 A;  5J47 A;  4CW9 A;  3W6G A;  3J7Y k;  5DVB A;  4QL7 A;  3HMJ G;  3ZYW A;  3KEB A;  3F3Q A;  2DJK A;  3FYG A;  3LWA A;  1R5A A;  4P3Y B;  2IFQ B;  1HNB A;  4OFT A;  3UVH A;  4WXT A;  3CTG A;  2GGT A;  3FMW A;  2L57 A;  4K1F A;  4GQC A;  3ERF A;  17GS A;  1GSD A;  3C71 A;  1MDI A;  3TUE A;  1XCC A;  4X1U A;  2DKI A;  3VFI A;  3RAZ A;  1ML6 A;  2IIY A;  1MDK A;  2GSS A;  2XBI A;  3UMA A;  2NBS A;  2LST A;  1V98 A;  4BA7 A;  2L6D A;  4MF7 A;  1V40 A;  4GSN A;  5HFI A;  3TKP A;  1M9A A;  5IO0 A;  1O8X A;  4BVX B;  1K0A A;  3LYP A;  3TKQ A;  3IA1 A;  3EMX A;  1NM3 A;  5DJM A;  4WF5 A;  4TXV A;  5CRH A;  3RPP A;  2HE3 A;  2MZC A;  2H73 A;  5ELG A;  1GLP A;  2H74 A;  5D96 A;  5F05 A;  4Z2U A;  3TDG A;  5AIS A;  5EPF A;  4MP4 A;  6GSW A;  2KP2 A;  4OWY A;  1J0F A;  1TJD A;  4WR5 A;  4OFM A;  1FHE A;  2JSZ A;  3ZLP A;  1OE7 A;  2DBC A;  3WGE A;  4ECC A;  2GQM A;  1XWA A;  1X5C A;  2FLS A;  4YQU A;  1YKC A;  4ISD A;  4L5O A;  3L9S A;  1PFO A;  2WJU A;  2ES7 A;  3FEU A;  2F3M A;  3BCK A;  1ZL9 A;  2I1U A;  4DEJ A;  3L9V A;  4PI2 C;  4K5S A;  1ACV A;  1ERT A;  3F0I A;  4OCF A;  3KMO A;  4JE1 A;  5ECM B;  4LL1 B;  4PQH A;  1XG8 A;  5A5H A;  2WRT A;  3RHB A;  1TRU A;  2DC5 A;  5G30 A;  4XRA A;  2A4H A;  2PN8 A;  4CHS A;  2JZS A;  4L5L A;  2X4A A;  2H6X A;  2DJ0 A;  4MH3 A;  5J4Y A;  2H70 A;  4PTS A;  1Z6M A;  4FH8 A;  1TKD B;  1TW9 A;  4EXJ A;  2EFH A;  4RI7 A;  5F8B A;  1PD2 1;  2M46 A;  2OBK A;  2FA8 A;  1MD3 A;  3CRT A;  4MAB A;  3KTB A;  1EOG A;  4G0I A;  3HZ8 A;  1W89 A;  2F8F A;  1SD9 A;  1BJX A;  5JCU A;  3GL5 A;  1Q4J A;  5KOW A;  3TKS A;  2O36 A;  2C4J A;  1AXD A;  1O6J A;  13GS A;  4IVF A;  4O5R A;  3F3R A;  4RQX A;  5ECH B;  2FCH A;  5IMD A;  4OMV A;  1T8E B;  3M0F A;  1U3I A;  1MDJ A;  2RUF A;  4IP6 A;  2O8V B;  3GTU B;  1PGT A;  4WBJ A;  3G7I A;  1JLV A;  3A2X A;  4ZL7 A;  1X5E A;  3MSZ A;  5ECQ B;  2MYG A;  4ACS A;  1ZYP A;  4YQV A;  1O73 A;  2LTK A;  1URM A;  5G1K A;  4F03 A;  1YVL A;  5G5E A;  5A5H B;  2QKE A;  3FKF A;  5ABR A;  1EEJ A;  2LJK A;  4MF5 A;  1SL0 B;  4TN8 A;  5GAN D;  4K2X A;  2X99 A;  3P90 A;  5G5F A;  1LJR A;  2HLS A;  2OE1 A;  3FY7 A;  3HXS A;  3F6F A;  2YWI A;  4ZIL A;  3HVN A;  1XW9 A;  5J5N A;  2FA4 A;  2IN3 A;  2CAQ A;  4EL1 A;  1THO A;  4HQZ A;  4MPF A;  2H6Z A;  3GN3 A;  4POM A;  5DDL A;  5IMF A;  2LRN A;  5G31 A;  2TRX A;  4CY8 A;  1M7T A;  3FZA A;  3HJO A;  1ZYE A;  4G9H A;  2VCT A;  3EMP A;  1W4V A;  2V2G A;  1ERW A;  3D22 A;  3U5R E;  3UVT A;  2K18 A;  1E6B A;  1GTA A;  2GQK A;  4I2U A;  2FWH A;  3CSJ A;  4K6X A;  1WRY A;  4N0V A;  4V2M A;  4V2L A;  2VLT A;  2CA8 A;  2OJL A;  1XWB A;  3CMI A;  2FD3 A;  4GCI A;  1BF5 A;  4ZXG A;  1V9W A;  5KN2 A;  3CXG A;  2FY6 A;  3VWX A;  1AAZ A;  5IMC A;  2H0G A;  3QOU A;  1A8Y A;  2YJH A;  1FOV A;  3LFL A;  1ST9 A;  4YQM A;  2HRF A;  2YP6 A;  2YZU A;  4CY6 A;  3KZQ A;  1GSE A;  4V1A p;  1USB A;  2TIR A;  4K8M A;  1X9S B;  1PL2 A;  2H30 A;  3HY2 A;  1NHO A;  1K0C A;  3KIJ A;  5A5K A;  2VCW A;  1DE2 A;  1GNE A;  5E59 A;  4EIP A;  2AJQ B;  3EVI A;  4TRX A;  3TOU A;  2C3N A;  2KOK A;  3C73 A;  1HNC A;  4JZQ A;  2GT6 A;  5ECK B;  3VI5 A;  4LLR A;  1M0U A;  2H76 A;  3CTF A;  4PX1 A;  4XTS A;  4EKZ A;  2B7J A;  4LA1 A;  1HD2 A;  1AUC A;  2Z9S A;  2C3T A;  5DAK B;  2VO4 A;  2CVB A;  1S4B P;  3UAR A;  4O5U A;  2VCX A;  4KDU A;  4LMV A;  5ELA A;  2CT6 A;  2AB6 A;  1GWC A;  3L78 A;  3PH9 A;  1B9Y C;  3G7J A;  4E68 A;  3ZZX A;  3IDV A;  1NHY A;  1XWK A;  4BIK A;  1K0D A;  2WW0 A;  4PGT A;  3C1R A;  1PX7 A;  1F3B A;  4EC0 A;  3K8N A;  2LS5 A;  3KH7 A;  4O32 A;  3IRA A;  2C8U A;  5JWO B;  3Q19 A;  1R26 A;  2DML A;  5CAX A;  2NTO A;  5C00 A;  2P31 A;  4MJB A;  5J4V A;  1XWG A;  3GX8 A;  4FIW A;  2EFC A;  4RI6 A;  4J56 E;  4PUF C;  5KEJ A;  1EV4 A;  1QUW A;  1SVM A;  5FT3 A;  1JHB A;  4X43 A;  1TDI A;  1TK5 B;  1YY7 A;  2VM2 A;  1QMV A;  2H8L A;  4KE3 A;  2OAD A;  4IQ1 A;  5CRW A;  3F63 A;  1WPI A;  4BVY A;  3CBU A;  1GSS A;  4ZBA A;  1S3C A;  4Q5Q A;  1RQM A;  1A2J A;  2AV4 A;  2RM6 A;  4ML1 A;  3UIW A;  4KDY A;  2XPE A;  2QSI A;  3RFR C;  3TOT A;  2B7K A;  3FK8 A;  4X4J A;  1SEN A;  3ZTL A;  2BMX A;  3GUR A;  2DJ1 A;  4NV2 A;  1Z7P A;  5HR2 A;  2IJY A;  2LJR A;  3P8W A;  1K3O A;  3QAG A;  3KXO A;  1F37 A;  3HHV A;  3HJM A;  2WVX B;  1SKR B;  3QFA C;  1LU4 A;  1GSQ A;  20GS A;  2CQ9 A;  4O5Q A;  1B4Q A;  3ZMK A;  1ZOF A;  4YH2 A;  1PKW A;  5ECN B;  3VWW A;  1K3Y A;  4NHZ A;  2B3S A;  4BPY A;  3H79 A;  3EU4 A;  3MAK A;  5D8I A;  5GZZ B;  6GSU A;  2VL2 C;  4ECB A;  1EWX A;  4TR1 A;  4J2F A;  3WT2 A;  4F0C A;  5D9T A;  2GZP A;  3GV1 A;  2VCZ A;  2IMF A;  4MZW A;  2QA1 A;  4GQF A;  5KN0 A;  2CV4 A;  2VL9 A;  3M1G A;  2YCD A;  3IOS A;  2ALB A;  2PWJ A;  4HU7 A;  3GST A;  2LRT A;  3BCI A;  1OKD A;  3LGC A;  2EIQ A;  4N10 A;  3BOA A;  1O8W A;  4PNG A;  3O6T A;  6GSX A;  4XS6 A;  6GST A;  3RPN A;  1YEP A;  2YV9 A;  1SVL A;  3I9V 2;  4KW6 A;  4L8E A;  2L4Q A;  2YOI A;  2ON7 A;  2X8G A;  2PBJ A;  1J9B A;  4V2N A;  3P2A A;  3C8E A;  4BVY B;  2O87 A;  3A2W A;  1PA3 A;  3IBH A;  3HKR A;  5ID2 B;  2IME A;  2B5Y A;  2DIY A;  4HU9 A;  2KHP A;  3WGD A;  3UOM A;  4LMW A;  1OAZ A;  2IPA A;  2XPD A;  1BG1 A;  3DRN A;  3KP9 A;  1A2M A;  2R0P A;  4O92 A;  4KSO A;  3EYT A;  3TKS C;  3JCM L;  4ZBD A;  4QQ7 A;  1PSQ A;  2L59 A;  1WMJ A;  3E0U A;  1F6M C;  3APS A;  2C0D A;  5B8A A;  2KLX A;  4TXO A;  5HFG A;  4PUA A;  5JWQ B;  4POL A;  2HSM B;  4BL7 B;  5D93 A;  4K2D A;  4IW9 A;  2HRA A; 
#chains in the Genus database with same CATH homology
 4N3Z A;  1O81 A;  2L5O A;  2HRN A;  3BJ5 A;  2UZ8 A;  2HFD A;  2LNT A;  2JL4 A;  5JCG A;  3PR8 A;  2AAW A;  4TR1 B;  2VCV A;  1KEB A;  3IK7 A;  2N5F A;  4K0N A;  2RII A;  1MEK A;  2C1Y A;  2B1K A;  2L4C A;  2DSA A;  1GH2 A;  3LW9 A;  4EDY A;  1A2L A;  2VKZ G;  1PN0 A;  3DYR A;  2MMN A;  3GNJ A;  4I6X A;  2VL3 A;  6GSY A;  4K5R A;  2N5A A;  4GRF A;  4EF0 A;  2P5Q A;  2X49 A;  2PUK C;  3C7M A;  5EY6 A;  3ZIT A;  2VOC A;  2C80 A;  1XW6 A;  5AIX A;  1J08 A;  4G19 A;  3D6I A;  5J9B A;  1EP7 A;  3CSH A;  2H19 A;  5AGY A;  1YF1 A;  2H1D A;  3LXT A;  4MF6 A;  1XIY A;  3HJP A;  4OO5 A;  2MBS A;  2EIR A;  5J4U A;  3GTU A;  1UVZ A;  1G0T A;  3TJB A;  2BJX A;  2GDR A;  4G0K A;  4XS4 A;  2VM1 A;  4ZB6 A;  2GLR A;  2GSQ A;  22GS A;  4MCU A;  4TXO B;  5D73 A;  1FG4 A;  2WGR A;  1RW1 A;  1GRX A;  3E9J B;  2XBQ A;  5ECS A;  3KP8 A;  3A5I A;  3LSZ A;  2ON5 A;  4KAE A;  3GUS A;  2ZUP A;  3ZRE A;  2M80 A;  3F4T A;  3KTL A;  5H5R A;  2IMD A;  3VI7 A;  4KSM A;  2P0G A;  5ECO B;  1AIU A;  3ZFL A;  1EP8 A;  2OE3 A;  3H93 A;  1YZX A;  1Z5Y E;  3HVS A;  4KCA A;  1THX A;  1GP1 A;  1QGV A;  1DE1 A;  3H1N A;  1YDK A;  5ECI B;  1ERV A;  5GAP D;  4LL4 B;  5F0G A;  5BMU B;  1X9W B;  2YWN A;  4NHW A;  5J3R A;  1BX9 A;  4HJM A;  4AKX B;  1XBS A;  1SKS B;  1GUM A;  5LCZ A;  4Z7X A;  2HI7 A;  1G6Y A;  4GSS A;  4GWR A;  1PMT A;  1A0R P;  2HQT A;  1TI1 A;  3WGX A;  1M2B A;  2MMO A;  4O7H A;  4ZB7 A;  5G2Z A;  1FO5 A;  1ZYQ B;  3D21 A;  3DEX A;  2FWF A;  2WUL A;  4X0X A;  1V58 A;  1YJ6 A;  4XS4 B;  3GX0 A;  3TU3 B;  3VUR A;  2LRC A;  1R4W A;  3RHC A;  1WIK A;  3HA9 A;  1T1V A;  3WT1 A;  3LYK A;  5D9W A;  1YEX A;  4ZIJ A;  2OE0 A;  1DBY A;  5JCW A;  4K7O A;  1F9M A;  4IJ3 A;  2H71 A;  3C1S A;  1VF1 A;  16GS A;  1R7H A;  5A1N B;  4KUN A;  4NV5 A;  1UC7 A;  1EOH A;  4YKG A;  5IM9 A;  1Y6E A;  4KB3 A;  1MD4 A;  1WP0 A;  4DSQ A;  3BD2 A;  3L4N A;  2L6C A;  4IEL A;  5DAK A;  5B8B A;  4N0Z A;  4I5Q A;  3R3E A;  2X8C A;  1OC9 B;  4WEY A;  4QMK A;  2KP1 A;  2CVD A;  3US3 A;  3H4K A;  1IYH A;  1G7E A;  1GTB A;  1O7U A;  3LQ7 A;  3LJR A;  2BTO T;  4TR3 A;  3ZL5 A;  2YN1 A;  4YAV A;  4RUV A;  1YF0 A;  1SVO A;  1ABA A;  4PQI A;  3NZN A;  5EVO A;  1FB6 A;  3DML A;  1JLW A;  5HFK A;  4WKW A;  3VLN A;  4FYU A;  3PPU A;  3R2Q A;  5LNK e;  4E8E A;  12GS A;  4DSR A;  2JZR A;  1OYJ A;  1N2A A;  1SJI A;  2V6K A;  2JU5 A;  1KNG A;  2A2R A;  1S3D A;  2C0G A;  2MMA A;  1B48 A;  1Z3E A;  2HSH A;  2QGV A;  1AQW A;  4POK A;  3HYP A;  1A23 A;  2C0E A;  3ZML A;  1EZK A;  1XOA A;  1JZW A;  5COH A;  2OAC A;  1B8X A;  3IHG A;  4ZL8 A;  4JU5 A;  5D9V A;  4YAP A;  3KJY A;  4ML6 A;  1U87 A;  2JSY A;  4AF2 A;  1JZR A;  2B5E A;  1CQH A;  5IMZ A;  5DAL B;  3DVX A;  2WS2 A;  4GXZ A;  1VF4 A;  2GZZ A;  1Y1U A;  2FWG A;  5CP1 A;  3ZFB A;  3QPM A;  2H0I A;  3FR9 A;  1GSU A;  2HRK B;  3IC4 A;  2IMI A;  3KM6 A;  2GT5 A;  4Q5N A;  2NVL A;  1BYE A;  2MMZ A;  3A5W A;  3TRP A;  1SU9 A;  2YWM A;  1TRW A;  3O76 A;  4IP1 A;  7GSS A;  3M9K A;  3DXB A;  4ULX A;  3ERW A;  2HXK A;  4I8B A;  3L0H A;  1AC1 A;  1N25 A;  3IPZ A;  5KN3 A;  1QFN A;  1VGL A;  4FQU A;  4N11 A;  2V6O A;  1B4P A;  3WD6 A;  2QA2 A;  2CZ3 A;  1VF3 A;  1WJK A;  4DVC A;  3DWV A;  1JFU A;  4KDX A;  2MBT A;  1WWJ A;  2YJ7 A;  2FWE A;  1TOF A;  1PQN A;  2CX3 A;  4KND A;  2GVP A;  4HS1 A;  3BBY A;  1PN9 A;  4NAX A;  3APQ A;  4G0L A;  5ENU A;  3DGQ A;  2UV8 G;  1QXH A;  2HZE B;  1O85 A;  3ME7 A;  1B9X C;  4JED A;  1DSB A;  5CO3 A;  1VRS D;  4WET A;  1K0N A;  3MDK A;  4GF0 A;  1XOB A;  3TB2 A;  4AJ6 A;  4G01 A;  3DIE A;  3VWU A;  5ID2 A;  2V1M A;  2XC2 A;  3F4R A;  2VD1 A;  5JWR B;  1TU8 A;  5G1L A;  3MNG A;  3QMX A;  4BWQ A;  5A4U A;  2M72 A;  3GMF A;  2FGX A;  2WB9 A;  3TKS E;  3EUR A;  1EV9 A;  2PGT A;  1EGO A;  2EFD A;  2B5X A;  1GSY A;  4KA0 A;  2XHF A;  4PNF A;  4G10 A;  1TXU A;  5F07 A;  4AKG A;  1XVQ A;  2O85 A;  2HSM A;  4BL7 A;  4IBP A;  3GHA A;  3WYW A;  1TU7 A;  3TJJ A;  4TR0 A;  4AKI A;  2PVQ A;  2F51 A;  2EIO A;  3HVV A;  8GSS A;  1VF2 A;  3N5O A;  1G7O A;  1HYU A;  2H1A A;  3E3E A;  2C0F A;  2YZH A;  1FVK A;  2HSN B;  3LG6 A;  2V32 A;  1ZZY A;  1T4Y A;  3D0Z A;  3ZIV A;  2I3Y A;  2YPM A;  1OC8 A;  2H01 A;  1Z7R A;  1SL2 B;  4HZ4 A;  3ZVJ A;  4AGS A;  2L5L A;  1TRV A;  4XIH A;  1EGR A;  1V2A A;  3HCZ A;  1I9D A;  4WBR D;  18GS A;  3M9J A;  4PUR A;  4IHU A;  2G2Q A;  1MTC A;  4Z2R A;  3G7Y A;  5KN1 A;  2RLI A;  2PMT A;  1AQV A;  10GS A;  1C72 A;  4FYC A;  2CAI A;  1G6W A;  3MIX A;  3D5J A;  2X8H A;  5J41 A;  1N8J A;  2VD0 A;  2B6M A;  4AJ7 A;  3EPT A;  1M9B A;  4KCE A;  2CVK A;  5J9C A;  2VIM A;  2DKH A;  1KTE A;  5AN1 A;  3IV4 A;  1ON4 A;  3SWL A;  5HR0 A;  1S3A A;  1KBN A;  1GUH A;  5B6M A;  2CZ2 A;  1NW2 A;  1A24 A;  5CRD A;  2A4V A;  3KMN A;  3U6V A;  1PL1 A;  2FHE A;  4D73 B;  2ZCT A;  2H72 A;  2JAD A;  1K0M A;  3W8J A;  4GLT A;  3MWH A;  4NWY A;  1SKW B;  1XVW A;  1T4Z A;  2E2G A;  1U3A A;  4TKY A;  3EC3 A;  1ILO A;  4F2I A;  5B7C A;  4MA9 A;  4OFN A;  2HYX A;  5B6N A;  19GS A;  4ECI A;  2N5B A;  3Q6O A;  4K7N A;  2IWT A;  4OCE A;  5C04 A;  3FW2 A;  1U88 A;  4JR4 A;  5FHI A;  2OKA A;  3TRX A;  2G0F A;  5BMU A;  2R37 A;  4HQS A;  3TCO A;  1BG5 A;  5IOW A;  2AYT A;  3QAV A;  3GH9 A;  3IHQ A;  4KX4 A;  5IMA A;  2OA7 A;  2B1L A;  3QR6 A;  2WCI A;  3GIX A;  1HNA A;  3FZ9 A;  3F8U A;  3IR4 A;  3HZ4 A;  4YKF A;  4AJ8 A;  4TW5 A;  3CRU A;  2X64 A;  4EE0 A;  4TVE A;  4G2E A;  3KGK A;  3L9U A;  2I4A A;  4MLY A;  4DSS B;  4J57 E;  4MJA A;  4ZB8 A;  1DUG A;  4ICY A;  1HQO A;  2NDO A;  3M8N A;  3F9U A;  1ZYN A;  4I2T A;  5CNW A;  1SK0 A;  3M3M A;  5GST A;  3VK9 A;  2H6Y A;  2H1L A;  4AI6 A;  3DKS A;  3ERG A;  1X0R A;  3G9B A;  4L0W A;  4HJ2 A;  4N30 A;  2VL2 A;  1A0F A;  4MH2 A;  6GSS A;  2V41 A;  4MK3 A;  1BQ7 A;  3EIN A;  3CWG A;  2HNL A;  3F4S A;  4V1A g;  5A1N A;  2A2P A;  1GUK A;  5HQP A;  4FO5 A;  2PER A;  4JBB A;  4Q5R A;  3FZ5 A;  3FR6 A;  4MNN A;  1M99 A;  5IPH A;  2HSY A;  2QC7 A;  1XZO A;  2DJ2 A;  3EU3 A;  4ZL9 A;  1BED A;  3VPT A;  4L0U A;  5DCH A;  1QK8 A;  1F3A A;  3CSI A;  1FAA A;  3FZ4 A;  1ZGN A;  3IXR A;  2O5V A;  1TK8 B;  3I6A A;  1OC9 A;  3ZRD A;  2J23 A;  4EVM A;  1FW1 A;  1AQX A;  2E2M A;  2H1B A;  1GUL A;  2I9H A;  3GRX A;  5KOX A;  2JZT A;  1XFL A;  3ED3 A;  4HZ2 A;  2FUG 2;  3IAM 2;  1H75 A;  3N9J A;  4MDC A;  3F6D A;  1H4O A;  2PVO C;  4F0B A;  1JZO A;  4QL9 A;  1GSF A;  5DBQ A;  3OR5 A;  4ZB9 A;  2LQO A;  4NXI A;  4IJI A;  2AUV A;  1Z6N A;  1SK1 A;  4EUY A;  4K7I A;  3QFB C;  1ERU A;  4MZC A;  4IN0 A;  4CDO A;  4H86 A;  2OT3 A;  5IO2 A;  5ECL B;  4EO3 A;  2HT9 A;  3HVX A;  2DJ3 A;  2YWO A;  2E0Q A;  2JAC A;  5EL8 A;  1M2D A;  4IGJ A;  4HEA 2;  4K9Z A;  2DLX A;  4F9Z A;  4ZBB A;  1F2E A;  5H5Q A;  1FOH A;  1OVN A;  5DAL A;  3DVW A;  1T7P B;  3AY8 A;  1SD8 A;  5A34 A;  2F8A A;  2GQL A;  1OC3 A;  2H0H A;  1Z9H A;  2HRK A;  1SJ6 A;  5IPG A;  1GTU A;  2R0G A;  4HUA A;  2LJA A;  1SYR A;  3O3T A;  3FRC A;  4MMM A;  2LV3 A;  1SYX A;  5CYY A;  3GKN A;  3UL3 A;  3GKM A;  2LKU A;  4NMU A;  3I69 A;  4MJC A;  1EEM A;  1TTZ A;  2GZY A;  3EE2 A;  1OKT A;  1LBK A;  3TRQ A;  1XXU A;  1FB0 A;  1GLQ A;  9GSS A;  3QD9 A;  1SK2 A;  5HR1 A;  4TOP A;  3FHK A;  3GA4 A;  5CRG A;  14GS A;  4IS0 A;  1NSW A;  4FYB A;  3D4T A;  1UA5 A;  4HDE A;  4XHM A;  2P5R A;  1WE0 A;  1A8L A;  1YQ1 A;  2LEG A;  1GL8 A;  3LEF A;  6GSV A;  5F06 A;  3GKX A;  1V57 A;  4W66 A;  1K3L A;  2FNO A;  3EWL A;  4Q5F A;  3NIV A;  1PX6 A;  5E4W A;  3CYN A;  5IOX A;  2PU9 C;  2RUE A;  1AW9 A;  1SL1 B;  4KH7 A;  2HZE A;  3TJG A;  1ZMA A;  2REM A;  1FVJ A;  2J9H A;  3A2V A;  3GL3 A;  3GSS A;  1GTI A;  3Q18 A;  5D9X A;  1T00 A;  4I97 A;  2LQQ A;  1T3B A;  2DJJ A;  2O89 A;  4EDZ A;  3IE3 A;  4ECJ A;  5A34 B;  1JZD A;  3ZVJ D;  3KD0 A;  2HZF A;  3UAP A;  5BRT A;  3TKR A;  1OE8 A;  2DIZ A;  5INY A;  2TRC P;  2IL3 A;  2YAN A;  5LD0 A;  2VLV A;  2EC4 A;  2IMK A;  3SBC A;  4USS A;  2VCQ A;  3QAW A;  2PPT A;  2DMM A;  1RK4 A;  3TJF A;  1I5G A;  1IYI A;  2R6K A;  2H75 A;  4JRR A;  4BWS A;  3GFK A;  1SJZ A;  3MYD A;  2R4V A;  4TR4 A;  2K8S A;  2GSR A;  1E2Y A;  4WF4 A;  3QDN A;  4PQ1 A;  4JR6 A;  5FWG A;  1U6T A;  5AIV A;  2HSN A;  3TGZ A;  4OD7 A;  3KH9 A;  2K9F A;  1R5P A;  2WZ9 A;  4NPB A;  1K0O A;  1Q98 A;  3APO A;  4MZB A;  3UJ1 A;  1TRS A;  5IIZ A;  1XPV A;  3KCM A;  1XWC A;  1WOU A;  3TJK A;  3S9F A;  4HI7 A;  5DQY A;  1PRX A;  2WDU A;  3D4M A;  2LUS A;  3GKK A;  4EIQ A;  3RBT A;  2YV7 A;  4PXO A;  4OO4 A;  3J7Y b;  2RM5 A;  5GSS A;  11GS A;  2AHE A;  2ZNM A;  2K6V A;  3W8S A;  5ECR B;  3QCP A;  1TXX A;  4GDF A;  3ME8 A;  5DCG A;  2E7P A;  3VPQ A;  2GS3 A;  3IAS 2;  4E8H A;  2O7K A;  1X5D A;  3HDC A;  3NOF A;  2CX4 A;  3A3T A;  2K8V A;  2R0C A;  4RQR A;  3UBL A;  3UBK A;  4AKH A;  1M2A A;  1TI3 A;  2VLU A;  2VUP A;  2KUC A;  4GTU A;  4D73 A;  3IK9 A;  4XRD A;  4HOJ A;  1CQG A;  5HR3 A;  2F9S A;  3LXZ A;  5IQY A;  4XCS A;  1YKA A;  5A4V A;  3V1W A;  2YNX A;  1UN2 A;  1BAY A;  4KGI A;  5DQS A;  4ILF A;  1TK0 B;  1X9M B;  5L71 A;  2IFQ A;  3GH6 A;  2OBI A;  1TP9 A;  2NPB A;  2WFC A;  2I81 A;  5CRE A;  2C3Q A;  2LNS A;  3PGT A;  4MJE A;  3PIN A;  1K0B A;  4K0G A;  2H66 A;  3P7X A;  3ZIJ A;  5DJL A;  3GYK A;  1PKZ A;  4MPG A;  4POB A;  5J40 A;  3RDW A;  3DD3 A;  5ECP B;  2A2S A;  2GTU A;  3ISO A;  4Z2T A;  4WR4 A;  4KF9 A;  3UEM A;  4BVX A;  2R5G A;  4IQA A;  5A4W A;  4GST A;  3LOR A;  4F82 A;  2GST A;  3IC8 A;  2EFE A;  3H8Q A;  4DSS A;  4IKH A;  1ZCP A;  2R2J A;  2VAF A;  4XS1 A;  4ID0 A;  3Q74 A;  5H5S A;  5IMV A;  2H1G A;  1Y25 A;  3FR3 A;  3HD5 A;  1GNW A;  1XW5 A;  4A5P A;  3VWV A;  2D2Z A;  3I43 A;  2R3X A;  1QQ2 A;  5J47 A;  4CW9 A;  3W6G A;  3J7Y k;  5DVB A;  4QL7 A;  3HMJ G;  3ZYW A;  3KEB A;  3F3Q A;  2DJK A;  3FYG A;  3LWA A;  1R5A A;  4P3Y B;  2IFQ B;  1HNB A;  4OFT A;  3UVH A;  4WXT A;  3CTG A;  2GGT A;  3FMW A;  2L57 A;  4K1F A;  4GQC A;  3ERF A;  17GS A;  1GSD A;  3C71 A;  1MDI A;  3TUE A;  1XCC A;  4X1U A;  2DKI A;  3VFI A;  3RAZ A;  1ML6 A;  2IIY A;  1MDK A;  2GSS A;  2XBI A;  3UMA A;  2NBS A;  2LST A;  1V98 A;  4BA7 A;  2L6D A;  4MF7 A;  1V40 A;  4GSN A;  5HFI A;  3TKP A;  1M9A A;  5IO0 A;  1O8X A;  4BVX B;  1K0A A;  3LYP A;  3TKQ A;  3IA1 A;  3EMX A;  1NM3 A;  5DJM A;  4WF5 A;  4TXV A;  5CRH A;  3RPP A;  2HE3 A;  2MZC A;  2H73 A;  5ELG A;  1GLP A;  2H74 A;  5D96 A;  5F05 A;  4Z2U A;  3TDG A;  5AIS A;  5EPF A;  4MP4 A;  6GSW A;  2KP2 A;  4OWY A;  1J0F A;  1TJD A;  4WR5 A;  4OFM A;  1FHE A;  2JSZ A;  3ZLP A;  1OE7 A;  2DBC A;  3WGE A;  4ECC A;  2GQM A;  1XWA A;  1X5C A;  2FLS A;  4YQU A;  1YKC A;  4ISD A;  4L5O A;  3L9S A;  2WJU A;  2ES7 A;  3FEU A;  2F3M A;  3BCK A;  1ZL9 A;  2I1U A;  4DEJ A;  3L9V A;  4K5S A;  1ACV A;  1ERT A;  3F0I A;  4OCF A;  3KMO A;  4JE1 A;  5ECM B;  4LL1 B;  4PQH A;  5A5H A;  2WRT A;  3RHB A;  1TRU A;  2DC5 A;  5G30 A;  4XRA A;  2A4H A;  2PN8 A;  4CHS A;  2JZS A;  4L5L A;  2X4A A;  2H6X A;  2DJ0 A;  4MH3 A;  5J4Y A;  2H70 A;  4PTS A;  1Z6M A;  4FH8 A;  1TKD B;  1TW9 A;  4EXJ A;  2EFH A;  4RI7 A;  5F8B A;  1PD2 1;  2M46 A;  2OBK A;  2FA8 A;  1MD3 A;  3CRT A;  4MAB A;  3KTB A;  1EOG A;  4G0I A;  3HZ8 A;  1W89 A;  2F8F A;  1SD9 A;  1BJX A;  5JCU A;  3GL5 A;  1Q4J A;  5KOW A;  3TKS A;  2C4J A;  1AXD A;  1O6J A;  13GS A;  4IVF A;  4O5R A;  3F3R A;  4RQX A;  5ECH B;  2FCH A;  5IMD A;  4OMV A;  1T8E B;  3M0F A;  1U3I A;  1MDJ A;  2RUF A;  4IP6 A;  2O8V B;  3GTU B;  1PGT A;  4WBJ A;  3G7I A;  1JLV A;  3A2X A;  4ZL7 A;  1X5E A;  3MSZ A;  5ECQ B;  2MYG A;  4ACS A;  1ZYP A;  4YQV A;  1O73 A;  2LTK A;  1URM A;  5G1K A;  4F03 A;  1YVL A;  5G5E A;  5A5H B;  2QKE A;  3FKF A;  5ABR A;  1EEJ A;  2LJK A;  4MF5 A;  1SL0 B;  4TN8 A;  5GAN D;  4K2X A;  2X99 A;  3P90 A;  5G5F A;  1LJR A;  2HLS A;  2OE1 A;  3FY7 A;  3HXS A;  3F6F A;  2YWI A;  4ZIL A;  1XW9 A;  5J5N A;  2FA4 A;  2IN3 A;  2CAQ A;  4EL1 A;  1THO A;  4HQZ A;  4MPF A;  2H6Z A;  3GN3 A;  4POM A;  5DDL A;  5IMF A;  2LRN A;  5G31 A;  2TRX A;  4CY8 A;  1M7T A;  3FZA A;  3HJO A;  1ZYE A;  4G9H A;  2VCT A;  3EMP A;  1W4V A;  2V2G A;  1ERW A;  3D22 A;  3U5R E;  3UVT A;  2K18 A;  1E6B A;  1GTA A;  2GQK A;  4I2U A;  2FWH A;  3CSJ A;  4K6X A;  1WRY A;  4N0V A;  4V2M A;  4V2L A;  2VLT A;  2CA8 A;  2OJL A;  1XWB A;  3CMI A;  2FD3 A;  4GCI A;  1BF5 A;  4ZXG A;  1V9W A;  5KN2 A;  3CXG A;  2FY6 A;  3VWX A;  1AAZ A;  5IMC A;  2H0G A;  3QOU A;  1A8Y A;  2YJH A;  1FOV A;  3LFL A;  1ST9 A;  4YQM A;  2HRF A;  2YP6 A;  2YZU A;  4CY6 A;  3KZQ A;  1GSE A;  4V1A p;  1USB A;  2TIR A;  4K8M A;  1X9S B;  1PL2 A;  2H30 A;  3HY2 A;  1NHO A;  1K0C A;  3KIJ A;  5A5K A;  2VCW A;  1DE2 A;  1GNE A;  5E59 A;  4EIP A;  2AJQ B;  3EVI A;  4TRX A;  3TOU A;  2C3N A;  2KOK A;  3C73 A;  1HNC A;  4JZQ A;  2GT6 A;  5ECK B;  3VI5 A;  4LLR A;  1M0U A;  2H76 A;  3CTF A;  4PX1 A;  4XTS A;  4EKZ A;  2B7J A;  4LA1 A;  1HD2 A;  1AUC A;  2Z9S A;  2C3T A;  5DAK B;  2VO4 A;  2CVB A;  3UAR A;  4O5U A;  2VCX A;  4KDU A;  4LMV A;  5ELA A;  2CT6 A;  2AB6 A;  1GWC A;  3L78 A;  3PH9 A;  1B9Y C;  3G7J A;  4E68 A;  3ZZX A;  3IDV A;  1NHY A;  1XWK A;  1K0D A;  4PGT A;  3C1R A;  1PX7 A;  1F3B A;  4EC0 A;  3K8N A;  2LS5 A;  3KH7 A;  4O32 A;  3IRA A;  2C8U A;  5JWO B;  3Q19 A;  1R26 A;  2DML A;  5CAX A;  2NTO A;  5C00 A;  2P31 A;  4MJB A;  5J4V A;  1XWG A;  3GX8 A;  4FIW A;  2EFC A;  4RI6 A;  4J56 E;  4PUF C;  5KEJ A;  1EV4 A;  1QUW A;  1SVM A;  5FT3 A;  1JHB A;  4X43 A;  1TDI A;  1TK5 B;  1YY7 A;  2VM2 A;  1QMV A;  2H8L A;  4KE3 A;  2OAD A;  4IQ1 A;  5CRW A;  3F63 A;  1WPI A;  4BVY A;  3CBU A;  1GSS A;  4ZBA A;  1S3C A;  4Q5Q A;  1RQM A;  1A2J A;  2AV4 A;  2RM6 A;  4ML1 A;  3UIW A;  4KDY A;  2XPE A;  2QSI A;  2B7K A;  3TOT A;  3FK8 A;  4X4J A;  1SEN A;  3ZTL A;  2BMX A;  3GUR A;  2DJ1 A;  4NV2 A;  1Z7P A;  5HR2 A;  2IJY A;  2LJR A;  3P8W A;  1K3O A;  3QAG A;  3KXO A;  1F37 A;  3HHV A;  3HJM A;  1SKR B;  3QFA C;  1LU4 A;  1GSQ A;  20GS A;  2CQ9 A;  4O5Q A;  1B4Q A;  3ZMK A;  1ZOF A;  4YH2 A;  1PKW A;  5ECN B;  3VWW A;  1K3Y A;  4NHZ A;  2B3S A;  4BPY A;  3H79 A;  3EU4 A;  3MAK A;  5D8I A;  5GZZ B;  6GSU A;  2VL2 C;  4ECB A;  1EWX A;  4TR1 A;  4J2F A;  3WT2 A;  4F0C A;  5D9T A;  2GZP A;  3GV1 A;  2VCZ A;  2IMF A;  4MZW A;  2QA1 A;  4GQF A;  5KN0 A;  2CV4 A;  2VL9 A;  3M1G A;  2YCD A;  3IOS A;  2ALB A;  2PWJ A;  4HU7 A;  3GST A;  2LRT A;  3BCI A;  1OKD A;  3LGC A;  2EIQ A;  4N10 A;  3BOA A;  1O8W A;  4PNG A;  3O6T A;  6GSX A;  4XS6 A;  6GST A;  3RPN A;  1YEP A;  2YV9 A;  1SVL A;  3I9V 2;  4KW6 A;  4L8E A;  2L4Q A;  2YOI A;  2ON7 A;  2X8G A;  2PBJ A;  1J9B A;  4V2N A;  3P2A A;  3C8E A;  4BVY B;  2O87 A;  3A2W A;  1PA3 A;  3IBH A;  3HKR A;  5ID2 B;  2IME A;  2B5Y A;  2DIY A;  4HU9 A;  2KHP A;  3WGD A;  3UOM A;  4LMW A;  1OAZ A;  2IPA A;  2XPD A;  1BG1 A;  3DRN A;  3KP9 A;  1A2M A;  2R0P A;  4O92 A;  4KSO A;  3EYT A;  3TKS C;  3JCM L;  4ZBD A;  4QQ7 A;  1PSQ A;  2L59 A;  1WMJ A;  3E0U A;  1F6M C;  3APS A;  2C0D A;  5B8A A;  2KLX A;  4TXO A;  5HFG A;  4PUA A;  5JWQ B;  4POL A;  2HSM B;  4BL7 B;  5D93 A;  4K2D A;  4IW9 A;  2HRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...