3ZMKA

Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
219
structure length
200
Chain Sequence
KLVLYTLHLSPPCRAVELTAKALGLELEQKNITIPVLDDDGTIITESHAIMIYLVTKYGKDDTLYPKDPVQQARVNAALHFESGVLFARMRFIFERIFFYGKSDIPEDRVEYVQKSYRLLEDTLKDDFVAGSKMTIADFSCISTISSIMGVVPLEQSEHPRIYEWIDRLKQLPYYEEANGGGGTDLGKFVLAKKEENAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE E2
publication title A Single Mutation in the Gste2 Gene Allows Tracking of Metabolically-Based Insecticide Resistance in a Major Malaria Vector.
pubmed doi rcsb
source organism Anopheles funestus
molecule tags Transferase
total genus 79
structure length 200
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3zmkA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zmkA01
1X9MB 2LSTA 4HJ2A 2GQMA 1ST9A 3GX0A 4F03A 3D22A 4ZL8A 4WR4A 5D96A 4EO3A 4BVYA 4WKWA 1SD9A 3F8UA 2HT9A 4POKA 2DJ1A 4ISDA 5F06A 1JZOA 2YWNA 3APOA 5D9VA 2CVKA 3GL5A 3I9V2 1K0BA 2M80A 1X5CA 5JCGA 1XWCA 3E3EA 3ZYWA 3KM6A 4OFMA 1UVZA 4K2DA 5CRDA 4O7HA 2BJXA 1MEKA 2MMAA 1XVQA 1DE1A 3L0HA 2PPTA 1VF1A 2O7KA 4OFTA 1ON4A 3LYKA 3KTLA 2HE3A 4N10A 3FY7A 3QMXA 5F0GA 2WZ9A 1GUHA 2YV7A 4JZQA 1GLPA 4G10A 2H1DA 2H1BA 1TU7A 2PVOC 5D73A 2L59A 1JZDA 4GCIA 1A2LA 1QXHA 1RQMA 1WE0A 4GSSA 3TGZA 2ZUPA 5G2ZA 3LORA 2N5AA 1BJXA 2GSSA 5KN0A 4I5QA 1G7OA 3VPQA 1U87A 2CV4A 4K7IA 2HZEA 4OD7A 3TKSA 3FZ9A 1EOGA 2H01A 1X9WB 1F3AA 2HSHA 5H5RA 1FAAA 2A4VA 1MTCA 3QDNA 4DSSB 2H30A 1ACVA 2FUG2 20GSA 4ZBBA 1EOHA 4F0BA 5IOXA 2C4JA 1H75A 5DDLA 4HZ2A 5F8BA 4BVXB 5E4WA 2H70A 4NAXA 4MF5A 4G0LA 1FG4A 3FYGA 2OJLA 4K0GA 2FY6A 5CO3A 4GRFA 6GSSA 1AUCA 2D2ZA 4FYCA 2B7KA 1X0RA 4MCUA 3UEMA 4N0ZA 2L57A 3F6FA 2VL2A 1XWAA 4EUYA 4AJ6A 1AW9A 1SL2B 5GSTA 1XZOA 1KNGA 2LQQA 4EKZA 1WJKA 3EWLA 2LEGA 3LYPA 2I3YA 5A4WA 3UBKA 1JHBA 2WCIA 4EDYA 4TKYA 1NW2A 4I97A 4NPBA 5C00A 3GL3A 1BAYA 3GRXA 3QCPA 2H0IA 5KN2A 1XWBA 2FHEA 3DMLA 1G6WA 4NV2A 1N2AA 1PA3A 1JLWA 3CBUA 2H1GA 3D0ZA 2F9SA 3LXZA 3A3TA 3QFAC 1ZZYA 1J9BA 2VO4A 3HZ8A 5AN1A 1SENA 2GT6A 2LJRA 2O85A 3TJGA 2XPDA 5CRWA 3GTUB 1SKSB 3O6TA 2X8CA 2N5FA 1GUKA 4L5OA 4EVMA 2JL4A 4IELA 2PVQA 2B5EA 2C0EA 3VI7A 1S3DA 2O8VB 1Q98A 1XW5A 4DVCA 1DUGA 2FWEA 2FLSA 1B4PA 2OE3A 5GSSA 2L6DA 1C72A 1T7PB 4MPGA 2H74A 1Y25A 2FD3A 4LLRA 1HQOA 2C0FA 3HA9A 3EU4A 3Q74A 2DC5A 1J08A 2XBIA 3WD6A 1Z5YE 1R5PA 5ECRB 2XPEA 3PINA 4HEA2 17GSA 2ES7A 3IDVA 2C1YA 4XS4B 1T4YA 5J41A 6GSVA 3F4TA 1TRSA 2VCQA 3LXTA 2HRFA 3KZQA 4EC0A 2I9HA 4TW5A 3EVIA 2MBSA 2L4QA 1BYEA 2GSQA 4F0CA 2GTUA 3W8SA 1EP8A 4GF0A 1HNAA 4GQCA 3UARA 2IMKA 2JZSA 1DSBA 3UIWA 3V1WA 1U3AA 3JCML 2FWGA 4OFNA 4KNDA 1CQGA 4MABA 1GSQA 5J5NA 3ZITA 2C3QA 3ZLPA 5ECPB 1PN9A 4V2MA 1USBA 5A4UA 5JCUA 2WFCA 1RK4A 1A23A 1PKZA 3I69A 2TRCP 2P5RA 2IMFA 3HKRA 1M0UA 2HSYA 3KP8A 1R5AA 3QAVA 3M3MA 2V6KA 4WXTA 2J23A 1JZWA 4CDOA 1AXDA 2I81A 5DALB 3QD9A 3FRCA 1FVJA 6GSWA 3BJ5A 1OVNA 1A8YA 4KSMA 4V2NA 1Y6EA 4XIHA 2YJHA 4LMVA 3EMPA 1NM3A 3NOFA 4BL7A 3ZFLA 3ERFA 3UJ1A 1FHEA 2GDRA 2DBCA 4G0KA 3H79A 3GX8A 2NVLA 5GAND 1GWCA 2MMNA 4EDZA 4K9ZA 3ZIJA 2AUVA 1O8WA 4ZL9A 3DWVA 4Q5FA 3KD0A 1ZYQB 1B9YC 2MZCA 3KH7A 4PQIA 3IA1A 4Q5QA 3KJYA 3AY8A 2FA8A 3EYTA 4ECJA 1F2EA 4LL4B 1PSQA 1WPIA 1ZYEA 2AHEA 5FHIA 1IYHA 2LV3A 4OO4A 3TDGA 3UBLA 2DJ0A 2IMDA 2HNLA 2HLSA 1SK2A 5HR0A 1XVWA 3ME8A 3ZTLA 6GSUA 5BMUA 3F4RA 5B8AA 3CSHA 3P8WA 1X5EA 1V2AA 3L9VA 4POLA 1SJZA 2E2MA 5HFKA 4EE0A 4RI6A 2I1UA 5D9TA 2H19A 3U5RE 4O32A 2C3TA 4LL1B 2CX3A 2V41A 1TK5B 4MJEA 2A2SA 3L78A 4PUAA 3IAS2 1XW6A 1OE8A 4I2UA 4HOJA 3R2QA 2PMTA 2EIQA 2CA8A 1TU8A 1E6BA 2AV4A 1UC7A 2GQKA 3LFLA 2FWFA 5HFIA 3EURA 2OACA 3F63A 2ZCTA 3HJOA 4ML1A 3QPMA 2LNSA 4K0NA 5CREA 2HFDA 4QL7A 4TOPA 1OAZA 2R4VA 3BD2A 4QL9A 4X1UA 2XC2A 4TR3A 2C3NA 4MZBA 3TCOA 3NZNA 3CRTA 7GSSA 4FYUA 6GSYA 4JBBA 3OR5A 2VD1A 4J56E 4PQ1A 5HR2A 1HD2A 2VLTA 3HY2A 2HRKA 1NSWA 1TP9A 1UA5A 2IN3A 1XWGA 4TXVA 1K3LA 1M99A 3GURA 1WWJA 3IAM2 3IK9A 1AC1A 2REMA 1GSYA 3K8NA 5JWOB 3HVVA 2VCTA 5CAXA 4BWSA 4E8EA 3ZMKA 4L8EA 4MK3A 1GSFA 1K0CA 1VGLA 3MAKA 3RHBA 2DJKA 2XBQA 4MA9A 5ECHB 4J2FA 4ZB9A 2CQ9A 4WF5A 5ECKB 3LQ7A 1X5DA 2PBJA 4TXOA 4ZL7A 3TKSC 1XIYA 2IFQB 3APSA 1WRYA 4RI7A 2H75A 3GKMA 1PD21 2MYGA 3VURA 4WETA 3GKXA 2HSMA 2HQTA 2H6ZA 3FZAA 4XRDA 4ECBA 2WRTA 4PTSA 3F9UA 3VPTA 4G2EA 6GSTA 3GYKA 3GNJA 1SK0A 4HDEA 5J9CA 4USSA 3L4NA 2R5GA 1GSEA 1MDIA 1X9SB 2V32A 1NHYA 1F9MA 2FWHA 1V98A 4KB3A 1TRVA 5ECQB 1T4ZA 2LJKA 1Q4JA 3C8EA 4TVEA 3TOUA 2VL2C 4MJAA 4ML6A 1FVKA 3TRPA 1SL1B 3US3A 1A24A 2B5YA 1LJRA 3UOMA 3D21A 3IE3A 2E2GA 1G0TA 3TKPA 4D73B 2LNTA 5IPHA 1PKWA 5DJLA 3BCIA 1THXA 5B6NA 3RHCA 2TIRA 2DJ2A 2P0GA 1M7TA 2C8UA 5B7CA 2VUPA 3O76A 5IPGA 3A2XA 3IV4A 2L6CA 5EPFA 3HDCA 2H66A 4Q5NA 2TRXA 4K1FA 3W8JA 2IL3A 4MH2A 1TJDA 3GKNA 2DMMA 3TB2A 3GIXA 3TOTA 2X8GA 4KW6A 1E2YA 2IMEA 3R3EA 4E8HA 3HD5A 4GQFA 11GSA 3IK7A 1GRXA 1FB0A 1OC9B 3KCMA 5G1KA 2DIZA 4OCFA 4DSSA 2B1KA 1EV9A 3PPUA 4V1Ag 2B6MA 4HU9A 3RBTA 4MDCA 1YF0A 2G0FA 4IQ1A 4BVXA 5IMAA 2NTOA 4I8BA 1G7EA 1FB6A 4X0XA 22GSA 1HNBA 1GULA 1XOBA 3P2AA 4PUFC 2CVDA 4JEDA 1BG5A 2ON5A 2N5BA 1QGVA 2E7PA 4TRXA 5CP1A 1SK1A 4KDXA 1VF3A 5EL8A 4GSTA 4RUVA 3VK9A 1A0RP 1XWKA 2EIRA 1YEPA 3M9KA 2J9HA 1GH2A 1XXUA 1YEXA 3EMXA 4WBJA 4BWQA 4L5LA 1EV4A 5DAKB 2B7JA 3CXGA 3UMAA 1AQVA 3FR3A 2OBIA 4IQAA 4K7NA 1EP7A 9GSSA 5IMFA 4Q5RA 1J0FA 3VI5A 1M9BA 4NMUA 5ID2B 3HJPA 4YQMA 5LCZA 2HXKA 1GL8A 2LJAA 1RW1A 2HZFA 4KA0A 4F82A 1S3CA 5ECNB 3ED3A 3DGQA 4JR4A 3ZVJA 4BPYA 4GLTA 3CRUA 2VL3A 1TK8B 1XW9A 3EU3A 1K0OA 1Z9HA 3GTUA 4ZB6A 2YANA 1URMA 4ULXA 2VD0A 2GSTA 2V6OA 3IXRA 1DE2A 1OKDA 1QMVA 3QAWA 3C71A 1SJIA 1EEMA 1KEBA 4PGTA 1JZRA 5D9XA 5CRHA 5CYYA 4WEYA 3CTGA 5H5SA 4G0IA 3C1RA 1B8XA 3LG6A 3FZ5A 1W4VA 1I9DA 4WBRD 1R26A 4MH3A 1Z6MA 5ENUA 3IBHA 3EC3A 1YDKA 3LWAA 3SBCA 5IMDA 2JSZA 1T1VA 2VCXA 2VLUA 4MJCA 1K0AA 4JE1A 2L4CA 2CX4A 19GSA 2YJ7A 1K3YA 4I2TA 2RUEA 4BA7A 3FW2A 2FGXA 1TKDB 1WP0A 2AYTA 3KTBA 4AGSA 2NPBA 3WGDA 3A2WA 1B4QA 1TI3A 2V2GA 2WGRA 3GSSA 1YZXA 3DYRA 3P7XA 4XS4A 2L5OA 2FNOA 3GKKA 1ZOFA 2R37A 2F8AA 2WS2A 1XBSA 2HYXA 2ON7A 2KUCA 2WJUA 3VLNA 2MBTA 2R6KA 2RUFA 3N5OA 2C80A 2WB9A 3HYPA 3ZIVA 3UVTA 3Q6OA 1AQWA 3WT1A 1TOFA 3C7MA 2IMIA 3UVHA 4FH8A 3KP9A 4V1Ap 10GSA 4LMWA 4IP6A 1TXXA 2LRCA 5DJMA 4OMVA 3ZL5A 2GSRA 1ZGNA 4DSQA 4PXOA 4MZCA 16GSA 1OC8A 1M2DA 1ERVA 3APQA 5ABRA 4KCAA 1DBYA 3GMFA 2JU5A 3VFIA 2NDOA 5D93A 3TJJA 1PGTA 4MF7A 2FCHA 4K7OA 2FA4A 3H8QA 3ZVJD 4KDYA 1GTUA 3IC4A 1TTZA 3CYNA 2HRNA 2DSAA 5ECOB 2MMZA 2R2JA 2H6XA 5GZZB 3HXSA 2GZPA 4NV5A 1O73A 4HUAA 2H6YA 5DALA 5AIXA 1ILOA 8GSSA 3BCKA 3M8NA 2GLRA 1V40A 4FIWA 3QR6A 4NWYA 1QFNA 1JFUA 5CNWA 3WGXA 2XHFA 4RQRA 4GWRA 1WIKA 5DBQA 5J3RA 2F8FA 5ELAA 2AB6A 1A2JA 2BTOT 3H1NA 5DVBA 1TRUA 3FKFA 4TR1B 4TR0A 2KHPA 2PN8A 1JLVA 4IGJA 3GH6A 4HU7A 5HQPA 3M0FA 1ERWA 2I4AA 1S3AA 5JCWA 1V57A 1PMTA 5G5EA 3DVXA 2B3SA 4OCEA 2L5LA 3G9BA 4I6XA 4KF9A 4KDUA 5IIZA 3C1SA 4DSRA 3ZRDA 5HR1A 4O5RA 1AQXA 4IVFA 2QKEA 4GTUA 3HHVA 3EE2A 1EEJA 1ABAA 1O7UA 3GH9A 2VAFA 5DQYA 4YAVA 2B1LA 1GSSA 2H72A 3IHQA 4MMMA 1EGRA 1CQHA 3ERWA 1VRSD 3KIJA 4EF0A 3TJKA 2GQLA 2KOKA 2LTKA 2YOIA 4FQUA 4MJBA 4IS0A 3RDWA 3KMOA 1GNEA 1TDIA 4XS1A 2LQOA 4BVYB 2YZUA 4IN0A 2R3XA 1O85A 2OADA 2CT6A 4L0UA 4KE3A 4K6XA 3GA4A 4LA1A 1O81A 2CAIA 2M72A 1Z7RA 3RPPA 4YQUA 1HYUA 1F3BA 2M46A 5EY6A 2CVBA 3L9SA 2A2RA 5JWRB 3U6VA 4IW9A 2DIYA 2JACA 4EXJA 2HSMB 3H93A 5DQSA 3PGTA 4KUNA 1ZMAA 1TRWA 4MF6A 3Q19A 4AF2A 2C0GA 2HRAA 3RPNA 1XFLA 5INYA 1O6JA 12GSA 4MPFA 1Z6NA 1GLQA 2YN1A 2GVPA 3HJMA 3S9FA 2H76A 2P5QA 6GSXA 1SD8A 4QQ7A 4PX1A 3N9JA 4GXZA 3QFBC 2LKUA 3TKSE 1XCCA 2HZEB 2CZ2A 1ZCPA 3HVXA 1M2BA 1U88A 4HI7A 3GSTA 1H4OA 2IFQA 4YAPA 3TUEA 4PNFA 4V2LA 2KLXA 3GFKA 1OKTA 1B48A 2K9FA 3HCZA 5F07A 3FK8A 2PUKC 1F6MC 2P31A 3FR9A 2K8SA 4POMA 1SYXA 3TJBA 1LBKA 1PL2A 3ISOA 1KTEA 1XOAA 3G7IA 3UAPA 4G9HA 2H71A 3MWHA 4KAEA 1GTBA 3P90A 5DCHA 2CAQA 2G2QA 2VM2A 2IJYA 1GSUA 4HJMA 4G19A 2VLVA 1BQ7A 3BBYA 2LRTA 1Z7PA 4D73A 1TI1A 3WGEA 2RIIA 3W6GA 5ECMB 5AGYA 3TRXA 5E59A 4FYBA 4WR5A 3D6IA 1NHOA 3EINA 2NBSA 1YY7A 1YKAA 4F9ZA 2K6VA 2H0GA 3Q18A 4P3YB 5LD0A 4HS1A 5G30A 1GP1A 3DXBA 3FHKA 4OWYA 2RM6A 1SYRA 5J9BA 5D9WA 5KN3A 1QK8A 4N0VA 1GNWA 3KXOA 1EGOA 3GHAA 1OC9A 4KX4A 5B8BA 3TJFA 1VF2A 5B6MA 4XCSA 4ZILA 1FOVA 1V58A 1M9AA 2GS3A 1K3OA 5HFGA 2DLXA 1N8JA 2DMLA 3VWVA 1LU4A 5H5QA 2IPAA 1YQ1A 4XHMA 2WULA 1HNCA 3FEUA 1PRXA 4CHSA 4KGIA 1PX7A 2JSYA 1I5GA 4TN8A 1O8XA 3PR8A 2YPMA 2VOCA 1UN2A 3MNGA 4IHUA 1B9XC 2QGVA 4AJ7A 4YH2A 1XPVA 1ERTA 3D4MA 18GSA 2GZYA 5EVOA 1W89A 4POBA 3M9JA 5J4UA 1THOA 1FW1A 4N11A 5IM9A 5CRGA 3C73A 3WYWA 4K8MA 3DD3A 4ECCA 5DAKA 3I6AA 4KCEA 3LSZA 4WF4A 3SWLA 3J7Yb 1YJ6A 5FT3A 3CSJA 1BX9A 1MDKA 1U6TA 3IRAA 3A2VA 3TKRA 2O87A 5C04A 4FO5A 4IJIA 3ERGA 4ECIA 5ID2A 2HSNB 2ZNMA 1MD4A 4DEJA 4ZIJA 1GTIA 1BEDA 2OE1A 2GZZA 4KSOA 2MMOA 3ME7A 3GV1A 2H8LA 2H1AA 2OE0A 1TK0B 4AJ8A 2X8HA 2YNXA 2OBKA 4CW9A 2PGTA 2O89A 1SL0B 5COHA 1SKRB 2VCZA 4XRAA 1SJ6A 2IWTA 4X43A 2X99A 2F51A 4KH7A 3FZ4A 1WMJA 3ZREA 4PQHA 4PNGA 1GTAA 3VWXA 3D5JA 2YV9A 4H86A 3ZFBA 1A8LA 2BMXA 2UZ8A 4HQSA 4NXIA 5IMZA 1TW9A 2GGTA 3J7Yk 1A2MA 2VCVA 3F3RA 1GUMA 5KN1A 1U3IA 4BL7B 2RM5A 1PQNA 3L9UA 1KBNA 1SKWB 3IC8A 2LRNA 2ALBA 3PH9A 2OA7A 2E0QA 5L71A 1V9WA 2OKAA 3FR6A 3GUSA 3G7YA 4PURA 5JWQB 2PWJA 3D4TA 4N30A 1IYIA 3HVSA 1R4WA 1ML6A 3F4SA 2JADA 1MD3A 2VCWA 2KP2A 3E9JB 3E0UA 1YKCA 1QUWA 5AISA 2B5XA 2IIYA 1K0MA 2YWMA 4MZWA 4ZB8A 4JR6A 1WOUA 1K0NA 5F05A 4JU5A 5G31A 3MDKA 2K8VA 5G1LA 2EC4A 2DJJA 2AAWA 2K18A 5IO0A 2DJ3A 5A4VA 4JRRA 2PERA 4XS6A 1OE7A 1OC3A 5ELGA 3M1GA 5G5FA 1OYJA 2HI7A 5D8IA 1T8EB 1Z3EA 1T3BA 3H4KA 5IMVA 5DCGA 5ECLB 1VF4A 2VL9A 4IBPA 2VM1A 4ID0A 4Z7XA 1EZKA 5A5KA 4J57E 1ZL9A 2KP1A 1G6YA 3QOUA 3WT2A 4IJ3A 1F37A 3DVWA 2VIMA 1QQ2A 3DRNA 3CSIA 2YP6A 4GSNA 1R7HA 1PX6A 4MP4A 2RLIA 3ZZXA 2YZHA 4MLYA 2AJQB 1ERUA 3QAGA 3DIEA 3GN3A 2C0DA 4NHZA 3VWWA 5GAPD 4NHWA 3LJRA 2EIOA 2WDUA 3DEXA 4YQVA 4O92A 1EWXA 4F2IA 4EL1A 5IO2A 3KGKA 4TR1A 3RAZA 1K0DA 3IR4A 3ZMLA 2H0HA 1YF1A 5ECIB 1AIUA 3I43A 3F0IA 2HRKB 3VWUA 2CZ3A 1SU9A 5IMCA 3TKQA 4ILFA 3UL3A 2H73A 3F6DA 5LNKe 2V1MA 2QSIA 1FO5A 3KMNA 3LEFA 3BOAA 1A0FA 2JZTA 4ZXGA 2GT5A 4L0WA 2X64A 4HQZA 13GSA 4OO5A 3NIVA 2YCDA 4ZBDA 3DKSA 1MDJA 4XTSA 1AAZA 3TRQA 4IKHA 4ZBAA 1GSDA 5IQYA 4RQXA 1M2AA 3LGCA 2JZRA 5FWGA 3F3QA 3KH9A 5ECSA 3CMIA 2YWOA 2PU9C 3IPZA 4ACSA 3HZ4A 5HR3A 4HZ4A 2LUSA 3IOSA 3G7JA 4TXOB 3CTFA 5AIVA 3A5WA 4TR4A 3MSZA 2F3MA 4IP1A 3KEBA 2LS5A 2YWIA 14GSA 2Z9SA 3O3TA 2QC7A 5KEJA 1PL1A 5IOWA 1T00A
chains in the Genus database with same CATH superfamily
1X9MB 2LSTA 4HJ2A 2GQMA 1ST9A 3GX0A 4F03A 3D22A 4ZL8A 4WR4A 5D96A 4EO3A 4BVYA 4WKWA 1SD9A 3F8UA 2HT9A 4POKA 4HSCX 2DJ1A 4ISDA 5F06A 1JZOA 2OT3A 2YWNA 3APOA 5D9VA 2CVKA 3GL5A 3I9V2 1K0BA 2M80A 1X5CA 5JCGA 1XWCA 3E3EA 3ZYWA 3KM6A 2O5VA 4OFMA 1UVZA 4K2DA 5CRDA 4O7HA 2BJXA 1MEKA 2MMAA 1XVQA 1DE1A 3L0HA 2PPTA 1VF1A 2O7KA 4OFTA 1ON4A 3LYKA 3KTLA 2HE3A 4N10A 3FY7A 3LW9A 3QMXA 4CY8A 5F0GA 2WZ9A 1GUHA 2YV7A 4JZQA 1GLPA 4G10A 2H1DA 2H1BA 1TU7A 2PVOC 5D73A 2L59A 1JZDA 4GCIA 1A2LA 1QXHA 1RQMA 1WE0A 4GSSA 3TGZA 2ZUPA 5G2ZA 3LORA 2N5AA 1BJXA 2GSSA 5KN0A 4I5QA 1G7OA 3VPQA 1U87A 2CV4A 4K7IA 2HZEA 4OD7A 3TKSA 3FZ9A 1EOGA 2H01A 1X9WB 1F3AA 2HSHA 5H5RA 1FAAA 2A4VA 1MTCA 4AKHA 3QDNA 4DSSB 2H30A 1ACVA 2FUG2 20GSA 4ZBBA 1EOHA 4F0BA 1PFOA 5IOXA 2C4JA 1I1IP 1H75A 5DDLA 4HZ2A 5F8BA 5BRTA 4BVXB 5E4WA 2H70A 4NAXA 4MF5A 4G0LA 1FG4A 3FYGA 2OJLA 4K0GA 2FY6A 5CO3A 4GRFA 6GSSA 1AUCA 4G01A 2D2ZA 4FYCA 2B7KA 2X49A 1X0RA 4MCUA 3UEMA 4N0ZA 2L57A 3F6FA 2VL2A 1XWAA 4EUYA 4AJ6A 1AW9A 1SL2B 5GSTA 1XZOA 1KNGA 2LQQA 4EKZA 1WJKA 3EWLA 2LEGA 3LYPA 2I3YA 5A4WA 3UBKA 1JHBA 3RGBC 2WCIA 4EDYA 4TKYA 3CHXC 1NW2A 4I97A 4NPBA 5C00A 3GL3A 1BAYA 3GRXA 3QCPA 2H0IA 5KN2A 1XWBA 2FHEA 3DMLA 1G6WA 4NV2A 1N2AA 1PA3A 1JLWA 2X4AA 3CBUA 2H1GA 3D0ZA 2F9SA 3LXZA 3A3TA 3QFAC 1ZZYA 1J9BA 2VO4A 3HZ8A 5AN1A 1SENA 2GT6A 2LJRA 2O85A 3TJGA 2XPDA 5CRWA 3GTUB 1SKSB 3O6TA 2X8CA 2N5FA 1GUKA 4L5OA 4EVMA 2JL4A 4IELA 2PVQA 2B5EA 2C0EA 3VI7A 1S3DA 2O8VB 1Q98A 1XW5A 4DVCA 1DUGA 2FWEA 2FLSA 1B4PA 2OE3A 5GSSA 4PI0C 2L6DA 1C72A 1T7PB 4MPGA 2H74A 1Y25A 2FD3A 4LLRA 1HQOA 2C0FA 3HA9A 2O36A 3EU4A 3Q74A 2DC5A 1J08A 2XBIA 3WD6A 1Z5YE 1R5PA 5ECRB 2XPEA 3PINA 4HEA2 17GSA 2ES7A 3IDVA 2C1YA 4XS4B 2A4HA 1T4YA 5J41A 6GSVA 3F4TA 1TRSA 2VCQA 3LXTA 2HRFA 3KZQA 4EC0A 2HSNA 2I9HA 4TW5A 3EVIA 2MBSA 2L4QA 1BYEA 2GSQA 4F0CA 2GTUA 3W8SA 1EP8A 4GF0A 1HNAA 4GQCA 3UARA 2IMKA 2JZSA 1DSBA 3UIWA 3V1WA 1U3AA 3JCML 2FWGA 4OFNA 4KNDA 1CQGA 4MABA 1GSQA 5J5NA 3ZITA 2C3QA 3ZLPA 5ECPB 1PN9A 4V2MA 1USBA 5A4UA 5JCUA 2WFCA 1RK4A 1A23A 1PKZA 3I69A 2TRCP 2UV8G 2P5RA 2IMFA 3HKRA 1M0UA 2HSYA 3KP8A 1R5AA 2WW1A 3QAVA 3M3MA 2V6KA 4WXTA 2J23A 1JZWA 4CDOA 1AXDA 2I81A 5DALB 3QD9A 3FRCA 1FVJA 4AKIA 6GSWA 3BJ5A 1OVNA 1A8YA 4KSMA 4ZB7A 4V2NA 2R0PA 1Y6EA 4XIHA 2YJHA 4LMVA 3EMPA 1NM3A 3NOFA 4BL7A 3ZFLA 3ERFA 3UJ1A 1FHEA 5KOXA 2GDRA 2DBCA 4G0KA 3H79A 3GX8A 2NVLA 5GAND 1GWCA 2MMNA 4EDZA 4K9ZA 3ZIJA 2AUVA 1O8WA 4ZL9A 3DWVA 4Q5FA 5J47A 3KD0A 1ZYQB 1B9YC 2MZCA 3KH7A 4PQIA 3IA1A 4Q5QA 3KJYA 3AY8A 2FA8A 3EYTA 4ECJA 1F2EA 4LL4B 1PSQA 1WPIA 1ZYEA 2AHEA 5FHIA 1IYHA 2LV3A 4OO4A 3TDGA 3UBLA 2DJ0A 2IMDA 2HNLA 2HLSA 1SK2A 5HR0A 1XVWA 3ME8A 3ZTLA 6GSUA 5BMUA 3F4RA 5B8AA 3CSHA 3P8WA 1X5EA 1V2AA 3L9VA 4POLA 1SJZA 2E2MA 5HFKA 4EE0A 4RI6A 2I1UA 5D9TA 2H19A 3U5RE 4O32A 2C3TA 4LL1B 2CX3A 1S4BP 2V41A 1TK5B 4MJEA 2A2SA 3L78A 4PUAA 3IAS2 1XW6A 1OE8A 4I2UA 4HOJA 3R2QA 2PMTA 2EIQA 2CA8A 1TU8A 1E6BA 2AV4A 3CWGA 1UC7A 2GQKA 3LFLA 2FWFA 5HFIA 3EURA 2OACA 5A5HB 3F63A 2ZCTA 3HJOA 4ML1A 4EIPA 3QPMA 2LNSA 4K0NA 5CREA 2HFDA 4QL7A 4TOPA 1OAZA 2R4VA 3BD2A 4QL9A 4X1UA 2XC2A 4TR3A 2C3NA 4MZBA 3TCOA 3NZNA 3CRTA 7GSSA 4FYUA 5A1NB 6GSYA 4JBBA 3OR5A 2VD1A 4J56E 4MNNA 4PQ1A 5HR2A 1HD2A 2VLTA 3HY2A 2HRKA 1NSWA 1TP9A 1UA5A 2IN3A 1XWGA 4TXVA 2WVXA 1K3LA 4Z2UA 1M99A 3GURA 1WWJA 3IAM2 3IK9A 1AC1A 2REMA 1GSYA 3K8NA 5JWOB 3HVVA 4Z2TA 2VCTA 5CAXA 4BWSA 4E8EA 3ZMKA 4L8EA 4MK3A 1GSFA 1K0CA 1VGLA 3MAKA 5KOWA 2DKIA 3RHBA 2DJKA 2XBQA 4MA9A 5ECHB 4J2FA 4ZB9A 2CQ9A 4WF5A 5ECKB 3LQ7A 1X5DA 2PBJA 4TXOA 4ZL7A 3TKSC 1XIYA 2IFQB 3APSA 1WRYA 4RI7A 2H75A 3GKMA 1PD21 2MYGA 3VURA 4WETA 3GKXA 2HSMA 2HQTA 2H6ZA 3FZAA 4XRDA 2EFDA 5J4VA 4ECBA 2WRTA 4PTSA 3F9UA 3VPTA 2A2PA 4G2EA 6GSTA 3GYKA 3GNJA 1SK0A 4HDEA 5J9CA 4USSA 3L4NA 2R5GA 1GSEA 1MDIA 1X9SB 2V32A 1NHYA 1F9MA 2FWHA 1V98A 4KB3A 1TRVA 5ECQB 1T4ZA 2LJKA 1Q4JA 3C8EA 4TVEA 3TOUA 2VL2C 4MJAA 4ML6A 1FVKA 3TRPA 1SL1B 3US3A 1A24A 2B5YA 1LJRA 4EIQA 3UOMA 4E68A 1FOHA 2R0GA 3D21A 3IE3A 4QMKA 2E2GA 1G0TA 3TKPA 1SVLA 4D73B 2LNTA 5IPHA 1PKWA 5DJLA 3BCIA 1THXA 5B6NA 3MYDA 3RHCA 2TIRA 2DJ2A 2P0GA 1M7TA 2C8UA 5B7CA 2VUPA 3O76A 5IPGA 3A2XA 3IV4A 2L6CA 5EPFA 3HDCA 2H66A 4Q5NA 2TRXA 4K1FA 3W8JA 2IL3A 4MH2A 1TJDA 3GKNA 2DMMA 3TB2A 2WVYA 3GIXA 3TOTA 2X8GA 4KW6A 1E2YA 2IMEA 3R3EA 4E8HA 3HD5A 4GQFA 11GSA 3IK7A 1GRXA 4BIKA 1FB0A 1OC9B 3KCMA 5G1KA 4AKXB 2DIZA 3MIXA 4OCFA 4DSSA 2B1KA 1EV9A 3PPUA 4V1Ag 2B6MA 4HU9A 3RBTA 4MDCA 1YF0A 2G0FA 4IQ1A 4BVXA 5IMAA 2NTOA 4I8BA 1G7EA 1FB6A 4X0XA 22GSA 5A34B 1HNBA 1GULA 1XOBA 3P2AA 4PUFC 2CVDA 4JEDA 1BG5A 2ON5A 2N5BA 4O5QA 1QGVA 2E7PA 4TRXA 5CP1A 1SK1A 4KDXA 1VF3A 5EL8A 4GSTA 4RUVA 3VK9A 1A0RP 1XWKA 2EIRA 1YEPA 3M9KA 2J9HA 1GH2A 1XXUA 1YEXA 3EMXA 4WBJA 4BWQA 4L5LA 4X4JA 1EV4A 5DAKB 2B7JA 3CXGA 3UMAA 1AQVA 3FR3A 2OBIA 4IQAA 4K7NA 1EP7A 9GSSA 5IMFA 4Q5RA 1J0FA 3VI5A 1M9BA 2WW3A 4NMUA 5ID2B 4ICYA 3HJPA 4YQMA 5LCZA 2HXKA 1GL8A 2LJAA 1RW1A 2HZFA 4KA0A 4F82A 1S3CA 5ECNB 3ED3A 3DGQA 4JR4A 3ZVJA 4BPYA 4GLTA 3CRUA 2VL3A 1TK8B 1XW9A 3EU3A 1K0OA 1Z9HA 3GTUA 4ZB6A 2YANA 1URMA 4ULXA 2VD0A 2GSTA 2V6OA 3IXRA 1DE2A 1OKDA 4K5RA 1QMVA 3QAWA 3C71A 1SJIA 1EEMA 1KEBA 4PGTA 1JZRA 5D9XA 5CRHA 5CYYA 4WEYA 3CTGA 5H5SA 4G0IA 3C1RA 1B8XA 3LG6A 3FZ5A 1W4VA 1I9DA 4WBRD 1R26A 4MH3A 1Z6MA 5ENUA 3IBHA 3EC3A 1YDKA 3LWAA 3SBCA 5IMDA 2JSZA 1T1VA 2VCXA 2VLUA 4MJCA 1K0AA 4JE1A 2L4CA 2CX4A 19GSA 2YJ7A 1K3YA 4I2TA 2RUEA 4BA7A 3FW2A 2FGXA 1TKDB 1WP0A 2AYTA 3KTBA 4AGSA 2NPBA 3WGDA 3A2WA 1B4QA 1TI3A 2V2GA 2WGRA 3GSSA 1YZXA 3DYRA 3P7XA 4XS4A 2L5OA 2FNOA 3GKKA 1ZOFA 2R37A 2F8AA 2WS2A 1XBSA 2HYXA 2ON7A 2KUCA 2WJUA 3VLNA 2MBTA 2R6KA 2RUFA 3N5OA 2C80A 2WB9A 3HYPA 3ZIVA 3UVTA 3Q6OA 1AQWA 3WT1A 1TOFA 3A5IA 1SVMA 1YVLA 3C7MA 2IMIA 3UVHA 4FH8A 3KP9A 3TU3B 4V1Ap 10GSA 4LMWA 4IP6A 1TXXA 2LRCA 5DJMA 4OMVA 3ZL5A 2GSRA 1ZGNA 4DSQA 4PXOA 4MZCA 16GSA 1OC8A 1M2DA 2WZSA 2QA2A 1ERVA 3APQA 4K2XA 5ABRA 4KCAA 1DBYA 3GMFA 2JU5A 3VFIA 2NDOA 5D93A 3TJJA 1PGTA 4MF7A 2FCHA 4K7OA 2FA4A 3H8QA 3ZVJD 4KDYA 1GTUA 3IC4A 1TTZA 3CYNA 2HRNA 2DSAA 5ECOB 2MMZA 2R2JA 2H6XA 5GZZB 1Y1UA 3HXSA 2GZPA 4NV5A 1O73A 4HUAA 2H6YA 2WVZA 5DALA 5AIXA 1ILOA 8GSSA 3BCKA 3M8NA 2GLRA 1V40A 2EFEA 4O5UA 4FIWA 3QR6A 4NWYA 1QFNA 1JFUA 5CNWA 3WGXA 2XHFA 4GDFA 4RQRA 4GWRA 1WIKA 5DBQA 5J3RA 2F8FA 5ELAA 2AB6A 1A2JA 2BTOT 3H1NA 5DVBA 1TRUA 3FKFA 4TR1B 4TR0A 2KHPA 2PN8A 1JLVA 4IGJA 3GH6A 4YKFA 4HU7A 5HQPA 3M0FA 1ERWA 2I4AA 1S3AA 5JCWA 1V57A 1PMTA 5G5EA 3DVXA 4YKGA 2B3SA 4OCEA 2L5LA 3G9BA 4I6XA 4KF9A 4KDUA 5IIZA 3C1SA 4DSRA 3ZRDA 5HR1A 4O5RA 1SVOA 1AQXA 4IVFA 2QKEA 4GTUA 3HHVA 3EE2A 1EEJA 1ABAA 1O7UA 1PN0A 3GH9A 2VAFA 5DQYA 4PI2C 4YAVA 2B1LA 1GSSA 2H72A 3IHQA 4MMMA 1EGRA 1CQHA 3ERWA 1VRSD 3KIJA 4EF0A 3TJKA 2GQLA 2KOKA 2LTKA 2YOIA 4FQUA 4MJBA 4IS0A 3EPTA 3RDWA 3KMOA 1GNEA 1TDIA 4XS1A 2LQOA 4BVYB 2YZUA 4IN0A 2R3XA 1ZYPA 1O85A 3IHGA 5A5HA 1M3JA 2OADA 2CT6A 4L0UA 4KE3A 4K6XA 3GA4A 4LA1A 1O81A 2CAIA 2M72A 4FXYP 1Z7RA 3RPPA 4YQUA 1HYUA 1F3BA 2M46A 5EY6A 2CVBA 3L9SA 2A2RA 5JWRB 3U6VA 2WW0A 4IW9A 2DIYA 2JACA 4EXJA 2HSMB 3H93A 5DQSA 3PGTA 5A1NA 1ZMAA 4KUNA 1TRWA 4MF6A 3Q19A 4AF2A 4A5PA 1M3IA 2C0GA 2HRAA 3RPNA 1XFLA 5INYA 1O6JA 12GSA 4MPFA 1Z6NA 1GLQA 2YN1A 5J4YA 2GVPA 3HJMA 3S9FA 2H76A 2P5QA 6GSXA 1SD8A 4QQ7A 2WW2A 4PX1A 3N9JA 4GXZA 3QFBC 2LKUA 3TKSE 1XCCA 2HZEB 2CZ2A 1ZCPA 3HVXA 1M2BA 1U88A 4HI7A 3GSTA 1H4OA 2IFQA 4YAPA 3TUEA 4PNFA 4V2LA 2KLXA 3GFKA 1OKTA 1B48A 2K9FA 3HCZA 5F07A 3FK8A 2PUKC 1F6MC 2P31A 3FR9A 2K8SA 4POMA 2VKZG 1SYXA 3TJBA 2QA1A 1LBKA 1PL2A 3ISOA 1KTEA 1XOAA 3G7IA 3UAPA 4G9HA 2H71A 3MWHA 4KAEA 1GTBA 3P90A 2R0CA 4PHZC 5DCHA 2CAQA 2G2QA 2VM2A 2IJYA 1GSUA 4HJMA 4G19A 2EFHA 4W66A 2VLVA 1BQ7A 3BBYA 2LRTA 1Z7PA 4D73A 1TI1A 3WGEA 2RIIA 3W6GA 5ECMB 5AGYA 3TRXA 5E59A 4FYBA 4WR5A 3D6IA 1NHOA 3EINA 2NBSA 1YY7A 1YKAA 3HVNA 4F9ZA 2K6VA 2H0GA 3Q18A 4P3YB 5LD0A 4HS1A 5G30A 1GP1A 3DXBA 3FHKA 4OWYA 2RM6A 1SYRA 5J9BA 5D9WA 5KN3A 1QK8A 4N0VA 1GNWA 3KXOA 1EGOA 3GHAA 1S3RA 1OC9A 4KX4A 5B8BA 3TJFA 1VF2A 5B6MA 4XCSA 4ZILA 1FOVA 1V58A 1M9AA 2GS3A 1K3OA 5HFGA 2DLXA 1N8JA 2DMLA 3VWVA 1LU4A 5H5QA 2IPAA 1YQ1A 4XHMA 2WULA 1HNCA 3FEUA 1PRXA 4CHSA 4KGIA 1PX7A 2JSYA 1I5GA 4TN8A 1O8XA 3PR8A 5A34A 2YPMA 2VOCA 1UN2A 3MNGA 4IHUA 1B9XC 2QGVA 4AJ7A 4YH2A 1XPVA 1ERTA 3D4MA 18GSA 2GZYA 5EVOA 1W89A 4POBA 3M9JA 5J4UA 1THOA 1FW1A 4N11A 5IM9A 5CRGA 3C73A 3WYWA 4K8MA 3DD3A 4ECCA 5DAKA 3I6AA 4KCEA 3LSZA 4WF4A 5J40A 3SWLA 3J7Yb 1YJ6A 5FT3A 3CSJA 1BX9A 1MDKA 1U6TA 3IRAA 3A2VA 3TKRA 2O87A 5C04A 4FO5A 4IJIA 3ERGA 4ECIA 5ID2A 2HSNB 2ZNMA 1MD4A 4DEJA 4ZIJA 1BF5A 1GTIA 1BEDA 2OE1A 2GZZA 4KSOA 2MMOA 3ME7A 3GV1A 2H8LA 2H1AA 2OE0A 1TK0B 4AJ8A 2X8HA 2YNXA 2OBKA 4CW9A 2PGTA 2O89A 1SL0B 5COHA 1BG1A 1SKRB 2VCZA 4XRAA 1SJ6A 2IWTA 4X43A 2X99A 2F51A 4KH7A 4AKGA 3FZ4A 1WMJA 3ZREA 4PQHA 4PNGA 1GTAA 3VWXA 3D5JA 2YV9A 4H86A 3ZFBA 1A8LA 2BMXA 2UZ8A 4HQSA 3CQFA 4NXIA 5IMZA 1TW9A 2GGTA 3J7Yk 1A2MA 4K5SA 2VCVA 3F3RA 1GUMA 5KN1A 1U3IA 4BL7B 2RM5A 1PQNA 3L9UA 1KBNA 1SKWB 3IC8A 2LRNA 2ALBA 3PH9A 2OA7A 2E0QA 5L71A 1V9WA 2OKAA 3FR6A 3GUSA 3G7YA 4PURA 5JWQB 2PWJA 3D4TA 4N30A 4CY6A 1IYIA 3HVSA 1R4WA 1ML6A 3F4SA 1YEWC 2JADA 1MD3A 2VCWA 2KP2A 3E9JB 4N3ZA 3E0UA 1YKCA 1QUWA 5AISA 2B5XA 1ZYNA 2IIYA 1K0MA 2YWMA 4MZWA 4ZB8A 2H1LA 4JR6A 1WOUA 1K0NA 5F05A 4JU5A 5G31A 3MDKA 5BMUB 2K8VA 2EFCA 5G1LA 2EC4A 2DJJA 2AAWA 2K18A 5IO0A 2DJ3A 5A4VA 4JRRA 2PERA 4XS6A 1OE7A 1OC3A 5ELGA 3M1GA 5G5FA 1OYJA 2HI7A 5D8IA 1T8EB 1Z3EA 1T3BA 3H4KA 5IMVA 5DCGA 5ECLB 1VF4A 2VL9A 4IBPA 2VM1A 4ID0A 4Z7XA 1EZKA 5A5KA 4J57E 1ZL9A 2KP1A 1G6YA 3QOUA 3WT2A 4IJ3A 1F37A 3DVWA 2VIMA 1QQ2A 3DRNA 3CSIA 1XG8A 2YP6A 4GSNA 1R7HA 1PX6A 4MP4A 2RLIA 3ZZXA 2YZHA 4MLYA 2AJQB 1ERUA 3QAGA 4Z2RA 3DIEA 3GN3A 2C0DA 1N25A 4NHZA 3VWWA 5GAPD 4NHWA 3HMJG 3LJRA 2EIOA 2WDUA 1TXUA 3DEXA 4YQVA 4O92A 1EWXA 4F2IA 4EL1A 5IO2A 2O3EA 3KGKA 4TR1A 3RAZA 1K0DA 3IR4A 3ZMLA 2H0HA 1YF1A 5ECIB 1AIUA 3I43A 3F0IA 2HRKB 3VWUA 2CZ3A 1SU9A 5IMCA 3TKQA 4ILFA 3UL3A 2H73A 3F6DA 5LNKe 2V1MA 2QSIA 1FO5A 3KMNA 3LEFA 3BOAA 1A0FA 2WVXB 2JZTA 4ZXGA 2GT5A 4L0WA 2X64A 4HQZA 13GSA 4OO5A 4AI6A 3NIVA 2YCDA 3FMWA 4ZBDA 3DKSA 1MDJA 4XTSA 1AAZA 3TRQA 4IKHA 4ZBAA 1GSDA 5IQYA 4RQXA 1M2AA 3LGCA 2DKHA 2JZRA 5FWGA 3F3QA 3KH9A 5ECSA 3CMIA 2YWOA 2PU9C 3IPZA 4ACSA 3HZ4A 5HR3A 4HZ4A 3RFRC 2LUSA 3IOSA 3G7JA 4TXOB 3CTFA 5AIVA 3A5WA 4TR4A 3MSZA 2F3MA 4IP1A 3KEBA 2LS5A 2YWIA 14GSA 2Z9SA 3O3TA 2QC7A 5KEJA 1PL1A 5IOWA 1T00A
chains in the Genus database with same CATH topology
1X9MB 2LSTA 4HJ2A 2GQMA 1ST9A 3GX0A 4F03A 3D22A 4ZL8A 4WR4A 5D96A 4EO3A 4BVYA 4WKWA 1SD9A 3F8UA 2HT9A 4POKA 2DJ1A 4ISDA 5F06A 1JZOA 2OT3A 2YWNA 3APOA 5D9VA 2CVKA 3GL5A 3I9V2 1K0BA 2M80A 1X5CA 5JCGA 1XWCA 3E3EA 3ZYWA 3KM6A 2O5VA 4OFMA 1UVZA 4K2DA 5CRDA 4O7HA 2BJXA 1MEKA 2MMAA 1XVQA 1DE1A 3L0HA 2PPTA 1VF1A 2O7KA 4OFTA 1ON4A 3LYKA 3KTLA 2HE3A 4N10A 3FY7A 3LW9A 3QMXA 4CY8A 5F0GA 2WZ9A 1GUHA 2YV7A 4JZQA 1GLPA 4G10A 2H1DA 2H1BA 1TU7A 2PVOC 5D73A 2L59A 1JZDA 4GCIA 1A2LA 1QXHA 1RQMA 1WE0A 4GSSA 3TGZA 2ZUPA 5G2ZA 3LORA 2N5AA 1BJXA 2GSSA 5KN0A 4I5QA 1G7OA 3VPQA 1U87A 2CV4A 4K7IA 2HZEA 4OD7A 3TKSA 3FZ9A 1EOGA 2H01A 1X9WB 1F3AA 2HSHA 5H5RA 1FAAA 2A4VA 1MTCA 4AKHA 3QDNA 4DSSB 2H30A 1ACVA 2FUG2 20GSA 4ZBBA 1EOHA 4F0BA 5IOXA 2C4JA 1H75A 5DDLA 4HZ2A 5F8BA 5BRTA 4BVXB 5E4WA 2H70A 4NAXA 4MF5A 4G0LA 1FG4A 3FYGA 2OJLA 4K0GA 2FY6A 5CO3A 4GRFA 6GSSA 1AUCA 4G01A 2D2ZA 4FYCA 2B7KA 2X49A 1X0RA 4MCUA 3UEMA 4N0ZA 2L57A 3F6FA 2VL2A 1XWAA 4EUYA 4AJ6A 1AW9A 1SL2B 5GSTA 1XZOA 1KNGA 2LQQA 4EKZA 1WJKA 3EWLA 2LEGA 3LYPA 2I3YA 5A4WA 3UBKA 1JHBA 2WCIA 4EDYA 4TKYA 1NW2A 4I97A 4NPBA 5C00A 3GL3A 1BAYA 3GRXA 3QCPA 2H0IA 5KN2A 1XWBA 2FHEA 3DMLA 1G6WA 4NV2A 1N2AA 1PA3A 1JLWA 2X4AA 3CBUA 2H1GA 3D0ZA 2F9SA 3LXZA 3A3TA 3QFAC 1ZZYA 1J9BA 2VO4A 3HZ8A 5AN1A 1SENA 2GT6A 2LJRA 2O85A 3TJGA 2XPDA 5CRWA 3GTUB 1SKSB 3O6TA 2X8CA 2N5FA 1GUKA 4L5OA 4EVMA 2JL4A 4IELA 2PVQA 2B5EA 2C0EA 3VI7A 1S3DA 2O8VB 1Q98A 1XW5A 4DVCA 1DUGA 2FWEA 2FLSA 1B4PA 2OE3A 5GSSA 2L6DA 1C72A 1T7PB 4MPGA 2H74A 1Y25A 2FD3A 4LLRA 1HQOA 2C0FA 3HA9A 3EU4A 3Q74A 2DC5A 1J08A 2XBIA 3WD6A 1Z5YE 1R5PA 5ECRB 2XPEA 3PINA 4HEA2 17GSA 2ES7A 3IDVA 2C1YA 4XS4B 2A4HA 1T4YA 5J41A 6GSVA 3F4TA 1TRSA 2VCQA 3LXTA 2HRFA 3KZQA 4EC0A 2HSNA 2I9HA 4TW5A 3EVIA 2MBSA 2L4QA 1BYEA 2GSQA 4F0CA 2GTUA 3W8SA 1EP8A 4GF0A 1HNAA 4GQCA 3UARA 2IMKA 2JZSA 1DSBA 3UIWA 3V1WA 1U3AA 3JCML 2FWGA 4OFNA 4KNDA 1CQGA 4MABA 1GSQA 5J5NA 3ZITA 2C3QA 3ZLPA 5ECPB 1PN9A 4V2MA 1USBA 5A4UA 5JCUA 2WFCA 1RK4A 1A23A 1PKZA 3I69A 2TRCP 2UV8G 2P5RA 2IMFA 3HKRA 1M0UA 2HSYA 3KP8A 1R5AA 3QAVA 3M3MA 2V6KA 4WXTA 2J23A 1JZWA 4CDOA 1AXDA 2I81A 5DALB 3QD9A 3FRCA 1FVJA 4AKIA 6GSWA 3BJ5A 1OVNA 1A8YA 4KSMA 4ZB7A 4V2NA 2R0PA 1Y6EA 4XIHA 2YJHA 4LMVA 3EMPA 1NM3A 3NOFA 4BL7A 3ZFLA 3ERFA 3UJ1A 1FHEA 5KOXA 2GDRA 2DBCA 4G0KA 3H79A 3GX8A 2NVLA 5GAND 1GWCA 2MMNA 4EDZA 4K9ZA 3ZIJA 2AUVA 1O8WA 4ZL9A 3DWVA 4Q5FA 5J47A 3KD0A 1ZYQB 1B9YC 2MZCA 3KH7A 4PQIA 3IA1A 4Q5QA 3KJYA 3AY8A 2FA8A 3EYTA 4ECJA 1F2EA 4LL4B 1PSQA 1WPIA 1ZYEA 2AHEA 5FHIA 1IYHA 2LV3A 4OO4A 3TDGA 3UBLA 2DJ0A 2IMDA 2HNLA 2HLSA 1SK2A 5HR0A 1XVWA 3ME8A 3ZTLA 6GSUA 5BMUA 3F4RA 5B8AA 3CSHA 3P8WA 1X5EA 1V2AA 3L9VA 4POLA 1SJZA 2E2MA 5HFKA 4EE0A 4RI6A 2I1UA 5D9TA 2H19A 3U5RE 4O32A 2C3TA 4LL1B 2CX3A 2V41A 1TK5B 4MJEA 2A2SA 3L78A 4PUAA 3IAS2 1XW6A 1OE8A 4I2UA 4HOJA 3R2QA 2PMTA 2EIQA 2CA8A 1TU8A 1E6BA 2AV4A 3CWGA 1UC7A 2GQKA 3LFLA 2FWFA 5HFIA 3EURA 2OACA 5A5HB 3F63A 2ZCTA 3HJOA 4ML1A 4EIPA 3QPMA 2LNSA 4K0NA 5CREA 2HFDA 4QL7A 4TOPA 1OAZA 2R4VA 3BD2A 4QL9A 4X1UA 2XC2A 4TR3A 2C3NA 4MZBA 3TCOA 3NZNA 3CRTA 7GSSA 4FYUA 5A1NB 6GSYA 4JBBA 3OR5A 2VD1A 4J56E 4MNNA 4PQ1A 5HR2A 1HD2A 2VLTA 3HY2A 2HRKA 1NSWA 1TP9A 1UA5A 2IN3A 1XWGA 4TXVA 1K3LA 4Z2UA 1M99A 3GURA 1WWJA 3IAM2 3IK9A 1AC1A 2REMA 1GSYA 3K8NA 5JWOB 3HVVA 4Z2TA 2VCTA 5CAXA 4BWSA 4E8EA 3ZMKA 4L8EA 4MK3A 1GSFA 1K0CA 1VGLA 3MAKA 5KOWA 2DKIA 3RHBA 2DJKA 2XBQA 4MA9A 5ECHB 4J2FA 4ZB9A 2CQ9A 4WF5A 5ECKB 3LQ7A 1X5DA 2PBJA 4TXOA 4ZL7A 3TKSC 1XIYA 2IFQB 3APSA 1WRYA 4RI7A 2H75A 3GKMA 1PD21 2MYGA 3VURA 4WETA 3GKXA 2HSMA 2HQTA 2H6ZA 3FZAA 4XRDA 2EFDA 5J4VA 4ECBA 2WRTA 4PTSA 3F9UA 3VPTA 2A2PA 4G2EA 6GSTA 3GYKA 3GNJA 1SK0A 4HDEA 5J9CA 4USSA 3L4NA 2R5GA 1GSEA 1MDIA 1X9SB 2V32A 1NHYA 1F9MA 2FWHA 1V98A 4KB3A 1TRVA 5ECQB 1T4ZA 2LJKA 1Q4JA 3C8EA 4TVEA 3TOUA 2VL2C 4MJAA 4ML6A 1FVKA 3TRPA 1SL1B 3US3A 1A24A 2B5YA 1LJRA 4EIQA 3UOMA 4E68A 1FOHA 2R0GA 3D21A 3IE3A 4QMKA 2E2GA 1G0TA 3TKPA 1SVLA 4D73B 2LNTA 5IPHA 1PKWA 5DJLA 3BCIA 1THXA 5B6NA 3MYDA 3RHCA 2TIRA 2DJ2A 2P0GA 1M7TA 2C8UA 5B7CA 2VUPA 3O76A 5IPGA 3A2XA 3IV4A 2L6CA 5EPFA 3HDCA 2H66A 4Q5NA 2TRXA 4K1FA 3W8JA 2IL3A 4MH2A 1TJDA 3GKNA 2DMMA 3TB2A 3GIXA 3TOTA 2X8GA 4KW6A 1E2YA 2IMEA 3R3EA 4E8HA 3HD5A 4GQFA 11GSA 3IK7A 1GRXA 1FB0A 1OC9B 3KCMA 5G1KA 4AKXB 2DIZA 3MIXA 4OCFA 4DSSA 2B1KA 1EV9A 3PPUA 4V1Ag 2B6MA 4HU9A 3RBTA 4MDCA 1YF0A 2G0FA 4IQ1A 4BVXA 5IMAA 2NTOA 4I8BA 1G7EA 1FB6A 4X0XA 22GSA 5A34B 1HNBA 1GULA 1XOBA 3P2AA 4PUFC 2CVDA 4JEDA 1BG5A 2ON5A 2N5BA 4O5QA 1QGVA 2E7PA 4TRXA 5CP1A 1SK1A 4KDXA 1VF3A 5EL8A 4GSTA 4RUVA 3VK9A 1A0RP 1XWKA 2EIRA 1YEPA 3M9KA 2J9HA 1GH2A 1XXUA 1YEXA 3EMXA 4WBJA 4BWQA 4L5LA 4X4JA 1EV4A 5DAKB 2B7JA 3CXGA 3UMAA 1AQVA 3FR3A 2OBIA 4IQAA 4K7NA 1EP7A 9GSSA 5IMFA 4Q5RA 1J0FA 3VI5A 1M9BA 4NMUA 5ID2B 4ICYA 3HJPA 4YQMA 5LCZA 2HXKA 1GL8A 2LJAA 1RW1A 2HZFA 4KA0A 4F82A 1S3CA 5ECNB 3ED3A 3DGQA 4JR4A 3ZVJA 4BPYA 4GLTA 3CRUA 2VL3A 1TK8B 1XW9A 3EU3A 1K0OA 1Z9HA 3GTUA 4ZB6A 2YANA 1URMA 4ULXA 2VD0A 2GSTA 2V6OA 3IXRA 1DE2A 1OKDA 4K5RA 1QMVA 3QAWA 3C71A 1SJIA 1EEMA 1KEBA 4PGTA 1JZRA 5D9XA 5CRHA 5CYYA 4WEYA 3CTGA 5H5SA 4G0IA 3C1RA 1B8XA 3LG6A 3FZ5A 1W4VA 1I9DA 4WBRD 1R26A 4MH3A 1Z6MA 5ENUA 3IBHA 3EC3A 1YDKA 3LWAA 3SBCA 5IMDA 2JSZA 1T1VA 2VCXA 2VLUA 4MJCA 1K0AA 4JE1A 2L4CA 2CX4A 19GSA 2YJ7A 1K3YA 4I2TA 2RUEA 4BA7A 3FW2A 2FGXA 1TKDB 1WP0A 2AYTA 3KTBA 4AGSA 2NPBA 3WGDA 3A2WA 1B4QA 1TI3A 2V2GA 2WGRA 3GSSA 1YZXA 3DYRA 3P7XA 4XS4A 2L5OA 2FNOA 3GKKA 1ZOFA 2R37A 2F8AA 2WS2A 1XBSA 2HYXA 2ON7A 2KUCA 2WJUA 3VLNA 2MBTA 2R6KA 2RUFA 3N5OA 2C80A 2WB9A 3HYPA 3ZIVA 3UVTA 3Q6OA 1AQWA 3WT1A 1TOFA 3A5IA 1SVMA 1YVLA 3C7MA 2IMIA 3UVHA 4FH8A 3KP9A 3TU3B 4V1Ap 10GSA 4LMWA 4IP6A 1TXXA 2LRCA 5DJMA 4OMVA 3ZL5A 2GSRA 1ZGNA 4DSQA 4PXOA 4MZCA 16GSA 1OC8A 1M2DA 2QA2A 1ERVA 3APQA 4K2XA 5ABRA 4KCAA 1DBYA 3GMFA 2JU5A 3VFIA 2NDOA 5D93A 3TJJA 1PGTA 4MF7A 2FCHA 4K7OA 2FA4A 3H8QA 3ZVJD 4KDYA 1GTUA 3IC4A 1TTZA 3CYNA 2HRNA 2DSAA 5ECOB 2MMZA 2R2JA 2H6XA 5GZZB 1Y1UA 3HXSA 2GZPA 4NV5A 1O73A 4HUAA 2H6YA 5DALA 5AIXA 1ILOA 8GSSA 3BCKA 3M8NA 2GLRA 1V40A 2EFEA 4O5UA 4FIWA 3QR6A 4NWYA 1QFNA 1JFUA 5CNWA 3WGXA 2XHFA 4GDFA 4RQRA 4GWRA 1WIKA 5DBQA 5J3RA 2F8FA 5ELAA 2AB6A 1A2JA 2BTOT 3H1NA 5DVBA 1TRUA 3FKFA 4TR1B 4TR0A 2KHPA 2PN8A 1JLVA 4IGJA 3GH6A 4YKFA 4HU7A 5HQPA 3M0FA 1ERWA 2I4AA 1S3AA 5JCWA 1V57A 1PMTA 5G5EA 3DVXA 4YKGA 2B3SA 4OCEA 2L5LA 3G9BA 4I6XA 4KF9A 4KDUA 5IIZA 3C1SA 4DSRA 3ZRDA 5HR1A 4O5RA 1SVOA 1AQXA 4IVFA 2QKEA 4GTUA 3HHVA 3EE2A 1EEJA 1ABAA 1O7UA 1PN0A 3GH9A 2VAFA 5DQYA 4YAVA 2B1LA 1GSSA 2H72A 3IHQA 4MMMA 1EGRA 1CQHA 3ERWA 1VRSD 3KIJA 4EF0A 3TJKA 2GQLA 2KOKA 2LTKA 2YOIA 4FQUA 4MJBA 4IS0A 3EPTA 3RDWA 3KMOA 1GNEA 1TDIA 4XS1A 2LQOA 4BVYB 2YZUA 4IN0A 2R3XA 1ZYPA 1O85A 3IHGA 5A5HA 2OADA 2CT6A 4L0UA 4KE3A 4K6XA 3GA4A 4LA1A 1O81A 2CAIA 2M72A 1Z7RA 3RPPA 4YQUA 1HYUA 1F3BA 2M46A 5EY6A 2CVBA 3L9SA 2A2RA 5JWRB 3U6VA 4IW9A 2DIYA 2JACA 4EXJA 2HSMB 3H93A 5DQSA 3PGTA 5A1NA 1ZMAA 4KUNA 1TRWA 4MF6A 3Q19A 4AF2A 4A5PA 2C0GA 2HRAA 3RPNA 1XFLA 5INYA 1O6JA 12GSA 4MPFA 1Z6NA 1GLQA 2YN1A 5J4YA 2GVPA 3HJMA 3S9FA 2H76A 2P5QA 6GSXA 1SD8A 4QQ7A 4PX1A 3N9JA 4GXZA 3QFBC 2LKUA 3TKSE 1XCCA 2HZEB 2CZ2A 1ZCPA 3HVXA 1M2BA 1U88A 4HI7A 3GSTA 1H4OA 2IFQA 4YAPA 3TUEA 4PNFA 4V2LA 2KLXA 3GFKA 1OKTA 1B48A 2K9FA 3HCZA 5F07A 3FK8A 2PUKC 1F6MC 2P31A 3FR9A 2K8SA 4POMA 2VKZG 1SYXA 3TJBA 2QA1A 1LBKA 1PL2A 3ISOA 1KTEA 1XOAA 3G7IA 3UAPA 4G9HA 2H71A 3MWHA 4KAEA 1GTBA 3P90A 2R0CA 5DCHA 2CAQA 2G2QA 2VM2A 2IJYA 1GSUA 4HJMA 4G19A 2EFHA 4W66A 2VLVA 1BQ7A 3BBYA 2LRTA 1Z7PA 4D73A 1TI1A 3WGEA 2RIIA 3W6GA 5ECMB 5AGYA 3TRXA 5E59A 4FYBA 4WR5A 3D6IA 1NHOA 3EINA 2NBSA 1YY7A 1YKAA 4F9ZA 2K6VA 2H0GA 3Q18A 4P3YB 5LD0A 4HS1A 5G30A 1GP1A 3DXBA 3FHKA 4OWYA 2RM6A 1SYRA 5J9BA 5D9WA 5KN3A 1QK8A 4N0VA 1GNWA 3KXOA 1EGOA 3GHAA 1OC9A 4KX4A 5B8BA 3TJFA 1VF2A 5B6MA 4XCSA 4ZILA 1FOVA 1V58A 1M9AA 2GS3A 1K3OA 5HFGA 2DLXA 1N8JA 2DMLA 3VWVA 1LU4A 5H5QA 2IPAA 1YQ1A 4XHMA 2WULA 1HNCA 3FEUA 1PRXA 4CHSA 4KGIA 1PX7A 2JSYA 1I5GA 4TN8A 1O8XA 3PR8A 5A34A 2YPMA 2VOCA 1UN2A 3MNGA 4IHUA 1B9XC 2QGVA 4AJ7A 4YH2A 1XPVA 1ERTA 3D4MA 18GSA 2GZYA 5EVOA 1W89A 4POBA 3M9JA 5J4UA 1THOA 1FW1A 4N11A 5IM9A 5CRGA 3C73A 3WYWA 4K8MA 3DD3A 4ECCA 5DAKA 3I6AA 4KCEA 3LSZA 4WF4A 5J40A 3SWLA 3J7Yb 1YJ6A 5FT3A 3CSJA 1BX9A 1MDKA 1U6TA 3IRAA 3A2VA 3TKRA 2O87A 5C04A 4FO5A 4IJIA 3ERGA 4ECIA 5ID2A 2HSNB 2ZNMA 1MD4A 4DEJA 4ZIJA 1BF5A 1GTIA 1BEDA 2OE1A 2GZZA 4KSOA 2MMOA 3ME7A 3GV1A 2H8LA 2H1AA 2OE0A 1TK0B 4AJ8A 2X8HA 2YNXA 2OBKA 4CW9A 2PGTA 2O89A 1SL0B 5COHA 1BG1A 1SKRB 2VCZA 4XRAA 1SJ6A 2IWTA 4X43A 2X99A 2F51A 4KH7A 4AKGA 3FZ4A 1WMJA 3ZREA 4PQHA 4PNGA 1GTAA 3VWXA 3D5JA 2YV9A 4H86A 3ZFBA 1A8LA 2BMXA 2UZ8A 4HQSA 4NXIA 5IMZA 1TW9A 2GGTA 3J7Yk 1A2MA 4K5SA 2VCVA 3F3RA 1GUMA 5KN1A 1U3IA 4BL7B 2RM5A 1PQNA 3L9UA 1KBNA 1SKWB 3IC8A 2LRNA 2ALBA 3PH9A 2OA7A 2E0QA 5L71A 1V9WA 2OKAA 3FR6A 3GUSA 3G7YA 4PURA 5JWQB 2PWJA 3D4TA 4N30A 4CY6A 1IYIA 3HVSA 1R4WA 1ML6A 3F4SA 2JADA 1MD3A 2VCWA 2KP2A 3E9JB 4N3ZA 3E0UA 1YKCA 1QUWA 5AISA 2B5XA 1ZYNA 2IIYA 1K0MA 2YWMA 4MZWA 4ZB8A 2H1LA 4JR6A 1WOUA 1K0NA 5F05A 4JU5A 5G31A 3MDKA 5BMUB 2K8VA 2EFCA 5G1LA 2EC4A 2DJJA 2AAWA 2K18A 5IO0A 2DJ3A 5A4VA 4JRRA 2PERA 4XS6A 1OE7A 1OC3A 5ELGA 3M1GA 5G5FA 1OYJA 2HI7A 5D8IA 1T8EB 1Z3EA 1T3BA 3H4KA 5IMVA 5DCGA 5ECLB 1VF4A 2VL9A 4IBPA 2VM1A 4ID0A 4Z7XA 1EZKA 5A5KA 4J57E 1ZL9A 2KP1A 1G6YA 3QOUA 3WT2A 4IJ3A 1F37A 3DVWA 2VIMA 1QQ2A 3DRNA 3CSIA 2YP6A 4GSNA 1R7HA 1PX6A 4MP4A 2RLIA 3ZZXA 2YZHA 4MLYA 2AJQB 1ERUA 3QAGA 4Z2RA 3DIEA 3GN3A 2C0DA 1N25A 4NHZA 3VWWA 5GAPD 4NHWA 3HMJG 3LJRA 2EIOA 2WDUA 1TXUA 3DEXA 4YQVA 4O92A 1EWXA 4F2IA 4EL1A 5IO2A 3KGKA 4TR1A 3RAZA 1K0DA 3IR4A 3ZMLA 2H0HA 1YF1A 5ECIB 1AIUA 3I43A 3F0IA 2HRKB 3VWUA 2CZ3A 1SU9A 5IMCA 3TKQA 4ILFA 3UL3A 2H73A 3F6DA 5LNKe 2V1MA 2QSIA 1FO5A 3KMNA 3LEFA 3BOAA 1A0FA 2JZTA 4ZXGA 2GT5A 4L0WA 2X64A 4HQZA 13GSA 4OO5A 4AI6A 3NIVA 2YCDA 3FMWA 4ZBDA 3DKSA 1MDJA 4XTSA 1AAZA 3TRQA 4IKHA 4ZBAA 1GSDA 5IQYA 4RQXA 1M2AA 3LGCA 2DKHA 2JZRA 5FWGA 3F3QA 3KH9A 5ECSA 3CMIA 2YWOA 2PU9C 3IPZA 4ACSA 3HZ4A 5HR3A 4HZ4A 2LUSA 3IOSA 3G7JA 4TXOB 3CTFA 5AIVA 3A5WA 4TR4A 3MSZA 2F3MA 4IP1A 3KEBA 2LS5A 2YWIA 14GSA 2Z9SA 3O3TA 2QC7A 5KEJA 1PL1A 5IOWA 1T00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9M B;  2LST A;  4HJ2 A;  2GQM A;  1ST9 A;  3GX0 A;  4F03 A;  3D22 A;  4ZL8 A;  4WR4 A;  5D96 A;  4EO3 A;  4BVY A;  4WKW A;  1SD9 A;  3F8U A;  2HT9 A;  4POK A;  2DJ1 A;  4ISD A;  5F06 A;  1JZO A;  2YWN A;  3APO A;  5D9V A;  2CVK A;  3GL5 A;  3I9V 2;  1K0B A;  2M80 A;  1X5C A;  5JCG A;  1XWC A;  3E3E A;  3ZYW A;  3KM6 A;  4OFM A;  1UVZ A;  4K2D A;  5CRD A;  4O7H A;  2BJX A;  1MEK A;  2MMA A;  1XVQ A;  1DE1 A;  3L0H A;  2PPT A;  1VF1 A;  2O7K A;  4OFT A;  1ON4 A;  3LYK A;  3KTL A;  2HE3 A;  4N10 A;  3FY7 A;  3QMX A;  5F0G A;  2WZ9 A;  1GUH A;  2YV7 A;  4JZQ A;  1GLP A;  4G10 A;  2H1D A;  2H1B A;  1TU7 A;  2PVO C;  5D73 A;  2L59 A;  1JZD A;  4GCI A;  1A2L A;  1QXH A;  1RQM A;  1WE0 A;  4GSS A;  3TGZ A;  2ZUP A;  5G2Z A;  3LOR A;  2N5A A;  1BJX A;  2GSS A;  5KN0 A;  4I5Q A;  1G7O A;  3VPQ A;  1U87 A;  2CV4 A;  4K7I A;  2HZE A;  4OD7 A;  3TKS A;  3FZ9 A;  1EOG A;  2H01 A;  1X9W B;  1F3A A;  2HSH A;  5H5R A;  1FAA A;  2A4V A;  1MTC A;  3QDN A;  4DSS B;  2H30 A;  1ACV A;  2FUG 2;  20GS A;  4ZBB A;  1EOH A;  4F0B A;  5IOX A;  2C4J A;  1H75 A;  5DDL A;  4HZ2 A;  5F8B A;  4BVX B;  5E4W A;  2H70 A;  4NAX A;  4MF5 A;  4G0L A;  1FG4 A;  3FYG A;  2OJL A;  4K0G A;  2FY6 A;  5CO3 A;  4GRF A;  6GSS A;  1AUC A;  2D2Z A;  4FYC A;  2B7K A;  1X0R A;  4MCU A;  3UEM A;  4N0Z A;  2L57 A;  3F6F A;  2VL2 A;  1XWA A;  4EUY A;  4AJ6 A;  1AW9 A;  1SL2 B;  5GST A;  1XZO A;  1KNG A;  2LQQ A;  4EKZ A;  1WJK A;  3EWL A;  2LEG A;  3LYP A;  2I3Y A;  5A4W A;  3UBK A;  1JHB A;  2WCI A;  4EDY A;  4TKY A;  1NW2 A;  4I97 A;  4NPB A;  5C00 A;  3GL3 A;  1BAY A;  3GRX A;  3QCP A;  2H0I A;  5KN2 A;  1XWB A;  2FHE A;  3DML A;  1G6W A;  4NV2 A;  1N2A A;  1PA3 A;  1JLW A;  3CBU A;  2H1G A;  3D0Z A;  2F9S A;  3LXZ A;  3A3T A;  3QFA C;  1ZZY A;  1J9B A;  2VO4 A;  3HZ8 A;  5AN1 A;  1SEN A;  2GT6 A;  2LJR A;  2O85 A;  3TJG A;  2XPD A;  5CRW A;  3GTU B;  1SKS B;  3O6T A;  2X8C A;  2N5F A;  1GUK A;  4L5O A;  4EVM A;  2JL4 A;  4IEL A;  2PVQ A;  2B5E A;  2C0E A;  3VI7 A;  1S3D A;  2O8V B;  1Q98 A;  1XW5 A;  4DVC A;  1DUG A;  2FWE A;  2FLS A;  1B4P A;  2OE3 A;  5GSS A;  2L6D A;  1C72 A;  1T7P B;  4MPG A;  2H74 A;  1Y25 A;  2FD3 A;  4LLR A;  1HQO A;  2C0F A;  3HA9 A;  3EU4 A;  3Q74 A;  2DC5 A;  1J08 A;  2XBI A;  3WD6 A;  1Z5Y E;  1R5P A;  5ECR B;  2XPE A;  3PIN A;  4HEA 2;  17GS A;  2ES7 A;  3IDV A;  2C1Y A;  4XS4 B;  1T4Y A;  5J41 A;  6GSV A;  3F4T A;  1TRS A;  2VCQ A;  3LXT A;  2HRF A;  3KZQ A;  4EC0 A;  2I9H A;  4TW5 A;  3EVI A;  2MBS A;  2L4Q A;  1BYE A;  2GSQ A;  4F0C A;  2GTU A;  3W8S A;  1EP8 A;  4GF0 A;  1HNA A;  4GQC A;  3UAR A;  2IMK A;  2JZS A;  1DSB A;  3UIW A;  3V1W A;  1U3A A;  3JCM L;  2FWG A;  4OFN A;  4KND A;  1CQG A;  4MAB A;  1GSQ A;  5J5N A;  3ZIT A;  2C3Q A;  3ZLP A;  5ECP B;  1PN9 A;  4V2M A;  1USB A;  5A4U A;  5JCU A;  2WFC A;  1RK4 A;  1A23 A;  1PKZ A;  3I69 A;  2TRC P;  2P5R A;  2IMF A;  3HKR A;  1M0U A;  2HSY A;  3KP8 A;  1R5A A;  3QAV A;  3M3M A;  2V6K A;  4WXT A;  2J23 A;  1JZW A;  4CDO A;  1AXD A;  2I81 A;  5DAL B;  3QD9 A;  3FRC A;  1FVJ A;  6GSW A;  3BJ5 A;  1OVN A;  1A8Y A;  4KSM A;  4V2N A;  1Y6E A;  4XIH A;  2YJH A;  4LMV A;  3EMP A;  1NM3 A;  3NOF A;  4BL7 A;  3ZFL A;  3ERF A;  3UJ1 A;  1FHE A;  2GDR A;  2DBC A;  4G0K A;  3H79 A;  3GX8 A;  2NVL A;  5GAN D;  1GWC A;  2MMN A;  4EDZ A;  4K9Z A;  3ZIJ A;  2AUV A;  1O8W A;  4ZL9 A;  3DWV A;  4Q5F A;  3KD0 A;  1ZYQ B;  1B9Y C;  2MZC A;  3KH7 A;  4PQI A;  3IA1 A;  4Q5Q A;  3KJY A;  3AY8 A;  2FA8 A;  3EYT A;  4ECJ A;  1F2E A;  4LL4 B;  1PSQ A;  1WPI A;  1ZYE A;  2AHE A;  5FHI A;  1IYH A;  2LV3 A;  4OO4 A;  3TDG A;  3UBL A;  2DJ0 A;  2IMD A;  2HNL A;  2HLS A;  1SK2 A;  5HR0 A;  1XVW A;  3ME8 A;  3ZTL A;  6GSU A;  5BMU A;  3F4R A;  5B8A A;  3CSH A;  3P8W A;  1X5E A;  1V2A A;  3L9V A;  4POL A;  1SJZ A;  2E2M A;  5HFK A;  4EE0 A;  4RI6 A;  2I1U A;  5D9T A;  2H19 A;  3U5R E;  4O32 A;  2C3T A;  4LL1 B;  2CX3 A;  2V41 A;  1TK5 B;  4MJE A;  2A2S A;  3L78 A;  4PUA A;  3IAS 2;  1XW6 A;  1OE8 A;  4I2U A;  4HOJ A;  3R2Q A;  2PMT A;  2EIQ A;  2CA8 A;  1TU8 A;  1E6B A;  2AV4 A;  1UC7 A;  2GQK A;  3LFL A;  2FWF A;  5HFI A;  3EUR A;  2OAC A;  3F63 A;  2ZCT A;  3HJO A;  4ML1 A;  3QPM A;  2LNS A;  4K0N A;  5CRE A;  2HFD A;  4QL7 A;  4TOP A;  1OAZ A;  2R4V A;  3BD2 A;  4QL9 A;  4X1U A;  2XC2 A;  4TR3 A;  2C3N A;  4MZB A;  3TCO A;  3NZN A;  3CRT A;  7GSS A;  4FYU A;  6GSY A;  4JBB A;  3OR5 A;  2VD1 A;  4J56 E;  4PQ1 A;  5HR2 A;  1HD2 A;  2VLT A;  3HY2 A;  2HRK A;  1NSW A;  1TP9 A;  1UA5 A;  2IN3 A;  1XWG A;  4TXV A;  1K3L A;  1M99 A;  3GUR A;  1WWJ A;  3IAM 2;  3IK9 A;  1AC1 A;  2REM A;  1GSY A;  3K8N A;  5JWO B;  3HVV A;  2VCT A;  5CAX A;  4BWS A;  4E8E A;  3ZMK A;  4L8E A;  4MK3 A;  1GSF A;  1K0C A;  1VGL A;  3MAK A;  3RHB A;  2DJK A;  2XBQ A;  4MA9 A;  5ECH B;  4J2F A;  4ZB9 A;  2CQ9 A;  4WF5 A;  5ECK B;  3LQ7 A;  1X5D A;  2PBJ A;  4TXO A;  4ZL7 A;  3TKS C;  1XIY A;  2IFQ B;  3APS A;  1WRY A;  4RI7 A;  2H75 A;  3GKM A;  1PD2 1;  2MYG A;  3VUR A;  4WET A;  3GKX A;  2HSM A;  2HQT A;  2H6Z A;  3FZA A;  4XRD A;  4ECB A;  2WRT A;  4PTS A;  3F9U A;  3VPT A;  4G2E A;  6GST A;  3GYK A;  3GNJ A;  1SK0 A;  4HDE A;  5J9C A;  4USS A;  3L4N A;  2R5G A;  1GSE A;  1MDI A;  1X9S B;  2V32 A;  1NHY A;  1F9M A;  2FWH A;  1V98 A;  4KB3 A;  1TRV A;  5ECQ B;  1T4Z A;  2LJK A;  1Q4J A;  3C8E A;  4TVE A;  3TOU A;  2VL2 C;  4MJA A;  4ML6 A;  1FVK A;  3TRP A;  1SL1 B;  3US3 A;  1A24 A;  2B5Y A;  1LJR A;  3UOM A;  3D21 A;  3IE3 A;  2E2G A;  1G0T A;  3TKP A;  4D73 B;  2LNT A;  5IPH A;  1PKW A;  5DJL A;  3BCI A;  1THX A;  5B6N A;  3RHC A;  2TIR A;  2DJ2 A;  2P0G A;  1M7T A;  2C8U A;  5B7C A;  2VUP A;  3O76 A;  5IPG A;  3A2X A;  3IV4 A;  2L6C A;  5EPF A;  3HDC A;  2H66 A;  4Q5N A;  2TRX A;  4K1F A;  3W8J A;  2IL3 A;  4MH2 A;  1TJD A;  3GKN A;  2DMM A;  3TB2 A;  3GIX A;  3TOT A;  2X8G A;  4KW6 A;  1E2Y A;  2IME A;  3R3E A;  4E8H A;  3HD5 A;  4GQF A;  11GS A;  3IK7 A;  1GRX A;  1FB0 A;  1OC9 B;  3KCM A;  5G1K A;  2DIZ A;  4OCF A;  4DSS A;  2B1K A;  1EV9 A;  3PPU A;  4V1A g;  2B6M A;  4HU9 A;  3RBT A;  4MDC A;  1YF0 A;  2G0F A;  4IQ1 A;  4BVX A;  5IMA A;  2NTO A;  4I8B A;  1G7E A;  1FB6 A;  4X0X A;  22GS A;  1HNB A;  1GUL A;  1XOB A;  3P2A A;  4PUF C;  2CVD A;  4JED A;  1BG5 A;  2ON5 A;  2N5B A;  1QGV A;  2E7P A;  4TRX A;  5CP1 A;  1SK1 A;  4KDX A;  1VF3 A;  5EL8 A;  4GST A;  4RUV A;  3VK9 A;  1A0R P;  1XWK A;  2EIR A;  1YEP A;  3M9K A;  2J9H A;  1GH2 A;  1XXU A;  1YEX A;  3EMX A;  4WBJ A;  4BWQ A;  4L5L A;  1EV4 A;  5DAK B;  2B7J A;  3CXG A;  3UMA A;  1AQV A;  3FR3 A;  2OBI A;  4IQA A;  4K7N A;  1EP7 A;  9GSS A;  5IMF A;  4Q5R A;  1J0F A;  3VI5 A;  1M9B A;  4NMU A;  5ID2 B;  3HJP A;  4YQM A;  5LCZ A;  2HXK A;  1GL8 A;  2LJA A;  1RW1 A;  2HZF A;  4KA0 A;  4F82 A;  1S3C A;  5ECN B;  3ED3 A;  3DGQ A;  4JR4 A;  3ZVJ A;  4BPY A;  4GLT A;  3CRU A;  2VL3 A;  1TK8 B;  1XW9 A;  3EU3 A;  1K0O A;  1Z9H A;  3GTU A;  4ZB6 A;  2YAN A;  1URM A;  4ULX A;  2VD0 A;  2GST A;  2V6O A;  3IXR A;  1DE2 A;  1OKD A;  1QMV A;  3QAW A;  3C71 A;  1SJI A;  1EEM A;  1KEB A;  4PGT A;  1JZR A;  5D9X A;  5CRH A;  5CYY A;  4WEY A;  3CTG A;  5H5S A;  4G0I A;  3C1R A;  1B8X A;  3LG6 A;  3FZ5 A;  1W4V A;  1I9D A;  4WBR D;  1R26 A;  4MH3 A;  1Z6M A;  5ENU A;  3IBH A;  3EC3 A;  1YDK A;  3LWA A;  3SBC A;  5IMD A;  2JSZ A;  1T1V A;  2VCX A;  2VLU A;  4MJC A;  1K0A A;  4JE1 A;  2L4C A;  2CX4 A;  19GS A;  2YJ7 A;  1K3Y A;  4I2T A;  2RUE A;  4BA7 A;  3FW2 A;  2FGX A;  1TKD B;  1WP0 A;  2AYT A;  3KTB A;  4AGS A;  2NPB A;  3WGD A;  3A2W A;  1B4Q A;  1TI3 A;  2V2G A;  2WGR A;  3GSS A;  1YZX A;  3DYR A;  3P7X A;  4XS4 A;  2L5O A;  2FNO A;  3GKK A;  1ZOF A;  2R37 A;  2F8A A;  2WS2 A;  1XBS A;  2HYX A;  2ON7 A;  2KUC A;  2WJU A;  3VLN A;  2MBT A;  2R6K A;  2RUF A;  3N5O A;  2C80 A;  2WB9 A;  3HYP A;  3ZIV A;  3UVT A;  3Q6O A;  1AQW A;  3WT1 A;  1TOF A;  3C7M A;  2IMI A;  3UVH A;  4FH8 A;  3KP9 A;  4V1A p;  10GS A;  4LMW A;  4IP6 A;  1TXX A;  2LRC A;  5DJM A;  4OMV A;  3ZL5 A;  2GSR A;  1ZGN A;  4DSQ A;  4PXO A;  4MZC A;  16GS A;  1OC8 A;  1M2D A;  1ERV A;  3APQ A;  5ABR A;  4KCA A;  1DBY A;  3GMF A;  2JU5 A;  3VFI A;  2NDO A;  5D93 A;  3TJJ A;  1PGT A;  4MF7 A;  2FCH A;  4K7O A;  2FA4 A;  3H8Q A;  3ZVJ D;  4KDY A;  1GTU A;  3IC4 A;  1TTZ A;  3CYN A;  2HRN A;  2DSA A;  5ECO B;  2MMZ A;  2R2J A;  2H6X A;  5GZZ B;  3HXS A;  2GZP A;  4NV5 A;  1O73 A;  4HUA A;  2H6Y A;  5DAL A;  5AIX A;  1ILO A;  8GSS A;  3BCK A;  3M8N A;  2GLR A;  1V40 A;  4FIW A;  3QR6 A;  4NWY A;  1QFN A;  1JFU A;  5CNW A;  3WGX A;  2XHF A;  4RQR A;  4GWR A;  1WIK A;  5DBQ A;  5J3R A;  2F8F A;  5ELA A;  2AB6 A;  1A2J A;  2BTO T;  3H1N A;  5DVB A;  1TRU A;  3FKF A;  4TR1 B;  4TR0 A;  2KHP A;  2PN8 A;  1JLV A;  4IGJ A;  3GH6 A;  4HU7 A;  5HQP A;  3M0F A;  1ERW A;  2I4A A;  1S3A A;  5JCW A;  1V57 A;  1PMT A;  5G5E A;  3DVX A;  2B3S A;  4OCE A;  2L5L A;  3G9B A;  4I6X A;  4KF9 A;  4KDU A;  5IIZ A;  3C1S A;  4DSR A;  3ZRD A;  5HR1 A;  4O5R A;  1AQX A;  4IVF A;  2QKE A;  4GTU A;  3HHV A;  3EE2 A;  1EEJ A;  1ABA A;  1O7U A;  3GH9 A;  2VAF A;  5DQY A;  4YAV A;  2B1L A;  1GSS A;  2H72 A;  3IHQ A;  4MMM A;  1EGR A;  1CQH A;  3ERW A;  1VRS D;  3KIJ A;  4EF0 A;  3TJK A;  2GQL A;  2KOK A;  2LTK A;  2YOI A;  4FQU A;  4MJB A;  4IS0 A;  3RDW A;  3KMO A;  1GNE A;  1TDI A;  4XS1 A;  2LQO A;  4BVY B;  2YZU A;  4IN0 A;  2R3X A;  1O85 A;  2OAD A;  2CT6 A;  4L0U A;  4KE3 A;  4K6X A;  3GA4 A;  4LA1 A;  1O81 A;  2CAI A;  2M72 A;  1Z7R A;  3RPP A;  4YQU A;  1HYU A;  1F3B A;  2M46 A;  5EY6 A;  2CVB A;  3L9S A;  2A2R A;  5JWR B;  3U6V A;  4IW9 A;  2DIY A;  2JAC A;  4EXJ A;  2HSM B;  3H93 A;  5DQS A;  3PGT A;  4KUN A;  1ZMA A;  1TRW A;  4MF6 A;  3Q19 A;  4AF2 A;  2C0G A;  2HRA A;  3RPN A;  1XFL A;  5INY A;  1O6J A;  12GS A;  4MPF A;  1Z6N A;  1GLQ A;  2YN1 A;  2GVP A;  3HJM A;  3S9F A;  2H76 A;  2P5Q A;  6GSX A;  1SD8 A;  4QQ7 A;  4PX1 A;  3N9J A;  4GXZ A;  3QFB C;  2LKU A;  3TKS E;  1XCC A;  2HZE B;  2CZ2 A;  1ZCP A;  3HVX A;  1M2B A;  1U88 A;  4HI7 A;  3GST A;  1H4O A;  2IFQ A;  4YAP A;  3TUE A;  4PNF A;  4V2L A;  2KLX A;  3GFK A;  1OKT A;  1B48 A;  2K9F A;  3HCZ A;  5F07 A;  3FK8 A;  2PUK C;  1F6M C;  2P31 A;  3FR9 A;  2K8S A;  4POM A;  1SYX A;  3TJB A;  1LBK A;  1PL2 A;  3ISO A;  1KTE A;  1XOA A;  3G7I A;  3UAP A;  4G9H A;  2H71 A;  3MWH A;  4KAE A;  1GTB A;  3P90 A;  5DCH A;  2CAQ A;  2G2Q A;  2VM2 A;  2IJY A;  1GSU A;  4HJM A;  4G19 A;  2VLV A;  1BQ7 A;  3BBY A;  2LRT A;  1Z7P A;  4D73 A;  1TI1 A;  3WGE A;  2RII A;  3W6G A;  5ECM B;  5AGY A;  3TRX A;  5E59 A;  4FYB A;  4WR5 A;  3D6I A;  1NHO A;  3EIN A;  2NBS A;  1YY7 A;  1YKA A;  4F9Z A;  2K6V A;  2H0G A;  3Q18 A;  4P3Y B;  5LD0 A;  4HS1 A;  5G30 A;  1GP1 A;  3DXB A;  3FHK A;  4OWY A;  2RM6 A;  1SYR A;  5J9B A;  5D9W A;  5KN3 A;  1QK8 A;  4N0V A;  1GNW A;  3KXO A;  1EGO A;  3GHA A;  1OC9 A;  4KX4 A;  5B8B A;  3TJF A;  1VF2 A;  5B6M A;  4XCS A;  4ZIL A;  1FOV A;  1V58 A;  1M9A A;  2GS3 A;  1K3O A;  5HFG A;  2DLX A;  1N8J A;  2DML A;  3VWV A;  1LU4 A;  5H5Q A;  2IPA A;  1YQ1 A;  4XHM A;  2WUL A;  1HNC A;  3FEU A;  1PRX A;  4CHS A;  4KGI A;  1PX7 A;  2JSY A;  1I5G A;  4TN8 A;  1O8X A;  3PR8 A;  2YPM A;  2VOC A;  1UN2 A;  3MNG A;  4IHU A;  1B9X C;  2QGV A;  4AJ7 A;  4YH2 A;  1XPV A;  1ERT A;  3D4M A;  18GS A;  2GZY A;  5EVO A;  1W89 A;  4POB A;  3M9J A;  5J4U A;  1THO A;  1FW1 A;  4N11 A;  5IM9 A;  5CRG A;  3C73 A;  3WYW A;  4K8M A;  3DD3 A;  4ECC A;  5DAK A;  3I6A A;  4KCE A;  3LSZ A;  4WF4 A;  3SWL A;  3J7Y b;  1YJ6 A;  5FT3 A;  3CSJ A;  1BX9 A;  1MDK A;  1U6T A;  3IRA A;  3A2V A;  3TKR A;  2O87 A;  5C04 A;  4FO5 A;  4IJI A;  3ERG A;  4ECI A;  5ID2 A;  2HSN B;  2ZNM A;  1MD4 A;  4DEJ A;  4ZIJ A;  1GTI A;  1BED A;  2OE1 A;  2GZZ A;  4KSO A;  2MMO A;  3ME7 A;  3GV1 A;  2H8L A;  2H1A A;  2OE0 A;  1TK0 B;  4AJ8 A;  2X8H A;  2YNX A;  2OBK A;  4CW9 A;  2PGT A;  2O89 A;  1SL0 B;  5COH A;  1SKR B;  2VCZ A;  4XRA A;  1SJ6 A;  2IWT A;  4X43 A;  2X99 A;  2F51 A;  4KH7 A;  3FZ4 A;  1WMJ A;  3ZRE A;  4PQH A;  4PNG A;  1GTA A;  3VWX A;  3D5J A;  2YV9 A;  4H86 A;  3ZFB A;  1A8L A;  2BMX A;  2UZ8 A;  4HQS A;  4NXI A;  5IMZ A;  1TW9 A;  2GGT A;  3J7Y k;  1A2M A;  2VCV A;  3F3R A;  1GUM A;  5KN1 A;  1U3I A;  4BL7 B;  2RM5 A;  1PQN A;  3L9U A;  1KBN A;  1SKW B;  3IC8 A;  2LRN A;  2ALB A;  3PH9 A;  2OA7 A;  2E0Q A;  5L71 A;  1V9W A;  2OKA A;  3FR6 A;  3GUS A;  3G7Y A;  4PUR A;  5JWQ B;  2PWJ A;  3D4T A;  4N30 A;  1IYI A;  3HVS A;  1R4W A;  1ML6 A;  3F4S A;  2JAD A;  1MD3 A;  2VCW A;  2KP2 A;  3E9J B;  3E0U A;  1YKC A;  1QUW A;  5AIS A;  2B5X A;  2IIY A;  1K0M A;  2YWM A;  4MZW A;  4ZB8 A;  4JR6 A;  1WOU A;  1K0N A;  5F05 A;  4JU5 A;  5G31 A;  3MDK A;  2K8V A;  5G1L A;  2EC4 A;  2DJJ A;  2AAW A;  2K18 A;  5IO0 A;  2DJ3 A;  5A4V A;  4JRR A;  2PER A;  4XS6 A;  1OE7 A;  1OC3 A;  5ELG A;  3M1G A;  5G5F A;  1OYJ A;  2HI7 A;  5D8I A;  1T8E B;  1Z3E A;  1T3B A;  3H4K A;  5IMV A;  5DCG A;  5ECL B;  1VF4 A;  2VL9 A;  4IBP A;  2VM1 A;  4ID0 A;  4Z7X A;  1EZK A;  5A5K A;  4J57 E;  1ZL9 A;  2KP1 A;  1G6Y A;  3QOU A;  3WT2 A;  4IJ3 A;  1F37 A;  3DVW A;  2VIM A;  1QQ2 A;  3DRN A;  3CSI A;  2YP6 A;  4GSN A;  1R7H A;  1PX6 A;  4MP4 A;  2RLI A;  3ZZX A;  2YZH A;  4MLY A;  2AJQ B;  1ERU A;  3QAG A;  3DIE A;  3GN3 A;  2C0D A;  4NHZ A;  3VWW A;  5GAP D;  4NHW A;  3LJR A;  2EIO A;  2WDU A;  3DEX A;  4YQV A;  4O92 A;  1EWX A;  4F2I A;  4EL1 A;  5IO2 A;  3KGK A;  4TR1 A;  3RAZ A;  1K0D A;  3IR4 A;  3ZML A;  2H0H A;  1YF1 A;  5ECI B;  1AIU A;  3I43 A;  3F0I A;  2HRK B;  3VWU A;  2CZ3 A;  1SU9 A;  5IMC A;  3TKQ A;  4ILF A;  3UL3 A;  2H73 A;  3F6D A;  5LNK e;  2V1M A;  2QSI A;  1FO5 A;  3KMN A;  3LEF A;  3BOA A;  1A0F A;  2JZT A;  4ZXG A;  2GT5 A;  4L0W A;  2X64 A;  4HQZ A;  13GS A;  4OO5 A;  3NIV A;  2YCD A;  4ZBD A;  3DKS A;  1MDJ A;  4XTS A;  1AAZ A;  3TRQ A;  4IKH A;  4ZBA A;  1GSD A;  5IQY A;  4RQX A;  1M2A A;  3LGC A;  2JZR A;  5FWG A;  3F3Q A;  3KH9 A;  5ECS A;  3CMI A;  2YWO A;  2PU9 C;  3IPZ A;  4ACS A;  3HZ4 A;  5HR3 A;  4HZ4 A;  2LUS A;  3IOS A;  3G7J A;  4TXO B;  3CTF A;  5AIV A;  3A5W A;  4TR4 A;  3MSZ A;  2F3M A;  4IP1 A;  3KEB A;  2LS5 A;  2YWI A;  14GS A;  2Z9S A;  3O3T A;  2QC7 A;  5KEJ A;  1PL1 A;  5IOW A;  1T00 A; 
#chains in the Genus database with same CATH topology
 1X9M B;  2LST A;  4HJ2 A;  2GQM A;  1ST9 A;  3GX0 A;  4F03 A;  3D22 A;  4ZL8 A;  4WR4 A;  5D96 A;  4EO3 A;  4BVY A;  4WKW A;  1SD9 A;  3F8U A;  2HT9 A;  4POK A;  4HSC X;  2DJ1 A;  4ISD A;  5F06 A;  1JZO A;  2OT3 A;  2YWN A;  3APO A;  5D9V A;  2CVK A;  3GL5 A;  3I9V 2;  1K0B A;  2M80 A;  1X5C A;  5JCG A;  1XWC A;  3E3E A;  3ZYW A;  3KM6 A;  2O5V A;  4OFM A;  1UVZ A;  4K2D A;  5CRD A;  4O7H A;  2BJX A;  1MEK A;  2MMA A;  1XVQ A;  1DE1 A;  3L0H A;  2PPT A;  1VF1 A;  2O7K A;  4OFT A;  1ON4 A;  3LYK A;  3KTL A;  2HE3 A;  4N10 A;  3FY7 A;  3LW9 A;  3QMX A;  4CY8 A;  5F0G A;  2WZ9 A;  1GUH A;  2YV7 A;  4JZQ A;  1GLP A;  4G10 A;  2H1D A;  2H1B A;  1TU7 A;  2PVO C;  5D73 A;  2L59 A;  1JZD A;  4GCI A;  1A2L A;  1QXH A;  1RQM A;  1WE0 A;  4GSS A;  3TGZ A;  2ZUP A;  5G2Z A;  3LOR A;  2N5A A;  1BJX A;  2GSS A;  5KN0 A;  4I5Q A;  1G7O A;  3VPQ A;  1U87 A;  2CV4 A;  4K7I A;  2HZE A;  4OD7 A;  3TKS A;  3FZ9 A;  1EOG A;  2H01 A;  1X9W B;  1F3A A;  2HSH A;  5H5R A;  1FAA A;  2A4V A;  1MTC A;  4AKH A;  3QDN A;  4DSS B;  2H30 A;  1ACV A;  2FUG 2;  20GS A;  4ZBB A;  1EOH A;  4F0B A;  1PFO A;  5IOX A;  2C4J A;  1I1I P;  1H75 A;  5DDL A;  4HZ2 A;  5F8B A;  5BRT A;  4BVX B;  5E4W A;  2H70 A;  4NAX A;  4MF5 A;  4G0L A;  1FG4 A;  3FYG A;  2OJL A;  4K0G A;  2FY6 A;  5CO3 A;  4GRF A;  6GSS A;  1AUC A;  4G01 A;  2D2Z A;  4FYC A;  2B7K A;  2X49 A;  1X0R A;  4MCU A;  3UEM A;  4N0Z A;  2L57 A;  3F6F A;  2VL2 A;  1XWA A;  4EUY A;  4AJ6 A;  1AW9 A;  1SL2 B;  5GST A;  1XZO A;  1KNG A;  2LQQ A;  4EKZ A;  1WJK A;  3EWL A;  2LEG A;  3LYP A;  2I3Y A;  5A4W A;  3UBK A;  1JHB A;  3RGB C;  2WCI A;  4EDY A;  4TKY A;  3CHX C;  1NW2 A;  4I97 A;  4NPB A;  5C00 A;  3GL3 A;  1BAY A;  3GRX A;  3QCP A;  2H0I A;  5KN2 A;  1XWB A;  2FHE A;  3DML A;  1G6W A;  4NV2 A;  1N2A A;  1PA3 A;  1JLW A;  2X4A A;  3CBU A;  2H1G A;  3D0Z A;  2F9S A;  3LXZ A;  3A3T A;  3QFA C;  1ZZY A;  1J9B A;  2VO4 A;  3HZ8 A;  5AN1 A;  1SEN A;  2GT6 A;  2LJR A;  2O85 A;  3TJG A;  2XPD A;  5CRW A;  3GTU B;  1SKS B;  3O6T A;  2X8C A;  2N5F A;  1GUK A;  4L5O A;  4EVM A;  2JL4 A;  4IEL A;  2PVQ A;  2B5E A;  2C0E A;  3VI7 A;  1S3D A;  2O8V B;  1Q98 A;  1XW5 A;  4DVC A;  1DUG A;  2FWE A;  2FLS A;  1B4P A;  2OE3 A;  5GSS A;  4PI0 C;  2L6D A;  1C72 A;  1T7P B;  4MPG A;  2H74 A;  1Y25 A;  2FD3 A;  4LLR A;  1HQO A;  2C0F A;  3HA9 A;  2O36 A;  3EU4 A;  3Q74 A;  2DC5 A;  1J08 A;  2XBI A;  3WD6 A;  1Z5Y E;  1R5P A;  5ECR B;  2XPE A;  3PIN A;  4HEA 2;  17GS A;  2ES7 A;  3IDV A;  2C1Y A;  4XS4 B;  2A4H A;  1T4Y A;  5J41 A;  6GSV A;  3F4T A;  1TRS A;  2VCQ A;  3LXT A;  2HRF A;  3KZQ A;  4EC0 A;  2HSN A;  2I9H A;  4TW5 A;  3EVI A;  2MBS A;  2L4Q A;  1BYE A;  2GSQ A;  4F0C A;  2GTU A;  3W8S A;  1EP8 A;  4GF0 A;  1HNA A;  4GQC A;  3UAR A;  2IMK A;  2JZS A;  1DSB A;  3UIW A;  3V1W A;  1U3A A;  3JCM L;  2FWG A;  4OFN A;  4KND A;  1CQG A;  4MAB A;  1GSQ A;  5J5N A;  3ZIT A;  2C3Q A;  3ZLP A;  5ECP B;  1PN9 A;  4V2M A;  1USB A;  5A4U A;  5JCU A;  2WFC A;  1RK4 A;  1A23 A;  1PKZ A;  3I69 A;  2TRC P;  2UV8 G;  2P5R A;  2IMF A;  3HKR A;  1M0U A;  2HSY A;  3KP8 A;  1R5A A;  2WW1 A;  3QAV A;  3M3M A;  2V6K A;  4WXT A;  2J23 A;  1JZW A;  4CDO A;  1AXD A;  2I81 A;  5DAL B;  3QD9 A;  3FRC A;  1FVJ A;  4AKI A;  6GSW A;  3BJ5 A;  1OVN A;  1A8Y A;  4KSM A;  4ZB7 A;  4V2N A;  2R0P A;  1Y6E A;  4XIH A;  2YJH A;  4LMV A;  3EMP A;  1NM3 A;  3NOF A;  4BL7 A;  3ZFL A;  3ERF A;  3UJ1 A;  1FHE A;  5KOX A;  2GDR A;  2DBC A;  4G0K A;  3H79 A;  3GX8 A;  2NVL A;  5GAN D;  1GWC A;  2MMN A;  4EDZ A;  4K9Z A;  3ZIJ A;  2AUV A;  1O8W A;  4ZL9 A;  3DWV A;  4Q5F A;  5J47 A;  3KD0 A;  1ZYQ B;  1B9Y C;  2MZC A;  3KH7 A;  4PQI A;  3IA1 A;  4Q5Q A;  3KJY A;  3AY8 A;  2FA8 A;  3EYT A;  4ECJ A;  1F2E A;  4LL4 B;  1PSQ A;  1WPI A;  1ZYE A;  2AHE A;  5FHI A;  1IYH A;  2LV3 A;  4OO4 A;  3TDG A;  3UBL A;  2DJ0 A;  2IMD A;  2HNL A;  2HLS A;  1SK2 A;  5HR0 A;  1XVW A;  3ME8 A;  3ZTL A;  6GSU A;  5BMU A;  3F4R A;  5B8A A;  3CSH A;  3P8W A;  1X5E A;  1V2A A;  3L9V A;  4POL A;  1SJZ A;  2E2M A;  5HFK A;  4EE0 A;  4RI6 A;  2I1U A;  5D9T A;  2H19 A;  3U5R E;  4O32 A;  2C3T A;  4LL1 B;  2CX3 A;  1S4B P;  2V41 A;  1TK5 B;  4MJE A;  2A2S A;  3L78 A;  4PUA A;  3IAS 2;  1XW6 A;  1OE8 A;  4I2U A;  4HOJ A;  3R2Q A;  2PMT A;  2EIQ A;  2CA8 A;  1TU8 A;  1E6B A;  2AV4 A;  3CWG A;  1UC7 A;  2GQK A;  3LFL A;  2FWF A;  5HFI A;  3EUR A;  2OAC A;  5A5H B;  3F63 A;  2ZCT A;  3HJO A;  4ML1 A;  4EIP A;  3QPM A;  2LNS A;  4K0N A;  5CRE A;  2HFD A;  4QL7 A;  4TOP A;  1OAZ A;  2R4V A;  3BD2 A;  4QL9 A;  4X1U A;  2XC2 A;  4TR3 A;  2C3N A;  4MZB A;  3TCO A;  3NZN A;  3CRT A;  7GSS A;  4FYU A;  5A1N B;  6GSY A;  4JBB A;  3OR5 A;  2VD1 A;  4J56 E;  4MNN A;  4PQ1 A;  5HR2 A;  1HD2 A;  2VLT A;  3HY2 A;  2HRK A;  1NSW A;  1TP9 A;  1UA5 A;  2IN3 A;  1XWG A;  4TXV A;  2WVX A;  1K3L A;  4Z2U A;  1M99 A;  3GUR A;  1WWJ A;  3IAM 2;  3IK9 A;  1AC1 A;  2REM A;  1GSY A;  3K8N A;  5JWO B;  3HVV A;  4Z2T A;  2VCT A;  5CAX A;  4BWS A;  4E8E A;  3ZMK A;  4L8E A;  4MK3 A;  1GSF A;  1K0C A;  1VGL A;  3MAK A;  5KOW A;  2DKI A;  3RHB A;  2DJK A;  2XBQ A;  4MA9 A;  5ECH B;  4J2F A;  4ZB9 A;  2CQ9 A;  4WF5 A;  5ECK B;  3LQ7 A;  1X5D A;  2PBJ A;  4TXO A;  4ZL7 A;  3TKS C;  1XIY A;  2IFQ B;  3APS A;  1WRY A;  4RI7 A;  2H75 A;  3GKM A;  1PD2 1;  2MYG A;  3VUR A;  4WET A;  3GKX A;  2HSM A;  2HQT A;  2H6Z A;  3FZA A;  4XRD A;  2EFD A;  5J4V A;  4ECB A;  2WRT A;  4PTS A;  3F9U A;  3VPT A;  2A2P A;  4G2E A;  6GST A;  3GYK A;  3GNJ A;  1SK0 A;  4HDE A;  5J9C A;  4USS A;  3L4N A;  2R5G A;  1GSE A;  1MDI A;  1X9S B;  2V32 A;  1NHY A;  1F9M A;  2FWH A;  1V98 A;  4KB3 A;  1TRV A;  5ECQ B;  1T4Z A;  2LJK A;  1Q4J A;  3C8E A;  4TVE A;  3TOU A;  2VL2 C;  4MJA A;  4ML6 A;  1FVK A;  3TRP A;  1SL1 B;  3US3 A;  1A24 A;  2B5Y A;  1LJR A;  4EIQ A;  3UOM A;  4E68 A;  1FOH A;  2R0G A;  3D21 A;  3IE3 A;  4QMK A;  2E2G A;  1G0T A;  3TKP A;  1SVL A;  4D73 B;  2LNT A;  5IPH A;  1PKW A;  5DJL A;  3BCI A;  1THX A;  5B6N A;  3MYD A;  3RHC A;  2TIR A;  2DJ2 A;  2P0G A;  1M7T A;  2C8U A;  5B7C A;  2VUP A;  3O76 A;  5IPG A;  3A2X A;  3IV4 A;  2L6C A;  5EPF A;  3HDC A;  2H66 A;  4Q5N A;  2TRX A;  4K1F A;  3W8J A;  2IL3 A;  4MH2 A;  1TJD A;  3GKN A;  2DMM A;  3TB2 A;  2WVY A;  3GIX A;  3TOT A;  2X8G A;  4KW6 A;  1E2Y A;  2IME A;  3R3E A;  4E8H A;  3HD5 A;  4GQF A;  11GS A;  3IK7 A;  1GRX A;  4BIK A;  1FB0 A;  1OC9 B;  3KCM A;  5G1K A;  4AKX B;  2DIZ A;  3MIX A;  4OCF A;  4DSS A;  2B1K A;  1EV9 A;  3PPU A;  4V1A g;  2B6M A;  4HU9 A;  3RBT A;  4MDC A;  1YF0 A;  2G0F A;  4IQ1 A;  4BVX A;  5IMA A;  2NTO A;  4I8B A;  1G7E A;  1FB6 A;  4X0X A;  22GS A;  5A34 B;  1HNB A;  1GUL A;  1XOB A;  3P2A A;  4PUF C;  2CVD A;  4JED A;  1BG5 A;  2ON5 A;  2N5B A;  4O5Q A;  1QGV A;  2E7P A;  4TRX A;  5CP1 A;  1SK1 A;  4KDX A;  1VF3 A;  5EL8 A;  4GST A;  4RUV A;  3VK9 A;  1A0R P;  1XWK A;  2EIR A;  1YEP A;  3M9K A;  2J9H A;  1GH2 A;  1XXU A;  1YEX A;  3EMX A;  4WBJ A;  4BWQ A;  4L5L A;  4X4J A;  1EV4 A;  5DAK B;  2B7J A;  3CXG A;  3UMA A;  1AQV A;  3FR3 A;  2OBI A;  4IQA A;  4K7N A;  1EP7 A;  9GSS A;  5IMF A;  4Q5R A;  1J0F A;  3VI5 A;  1M9B A;  2WW3 A;  4NMU A;  5ID2 B;  4ICY A;  3HJP A;  4YQM A;  5LCZ A;  2HXK A;  1GL8 A;  2LJA A;  1RW1 A;  2HZF A;  4KA0 A;  4F82 A;  1S3C A;  5ECN B;  3ED3 A;  3DGQ A;  4JR4 A;  3ZVJ A;  4BPY A;  4GLT A;  3CRU A;  2VL3 A;  1TK8 B;  1XW9 A;  3EU3 A;  1K0O A;  1Z9H A;  3GTU A;  4ZB6 A;  2YAN A;  1URM A;  4ULX A;  2VD0 A;  2GST A;  2V6O A;  3IXR A;  1DE2 A;  1OKD A;  4K5R A;  1QMV A;  3QAW A;  3C71 A;  1SJI A;  1EEM A;  1KEB A;  4PGT A;  1JZR A;  5D9X A;  5CRH A;  5CYY A;  4WEY A;  3CTG A;  5H5S A;  4G0I A;  3C1R A;  1B8X A;  3LG6 A;  3FZ5 A;  1W4V A;  1I9D A;  4WBR D;  1R26 A;  4MH3 A;  1Z6M A;  5ENU A;  3IBH A;  3EC3 A;  1YDK A;  3LWA A;  3SBC A;  5IMD A;  2JSZ A;  1T1V A;  2VCX A;  2VLU A;  4MJC A;  1K0A A;  4JE1 A;  2L4C A;  2CX4 A;  19GS A;  2YJ7 A;  1K3Y A;  4I2T A;  2RUE A;  4BA7 A;  3FW2 A;  2FGX A;  1TKD B;  1WP0 A;  2AYT A;  3KTB A;  4AGS A;  2NPB A;  3WGD A;  3A2W A;  1B4Q A;  1TI3 A;  2V2G A;  2WGR A;  3GSS A;  1YZX A;  3DYR A;  3P7X A;  4XS4 A;  2L5O A;  2FNO A;  3GKK A;  1ZOF A;  2R37 A;  2F8A A;  2WS2 A;  1XBS A;  2HYX A;  2ON7 A;  2KUC A;  2WJU A;  3VLN A;  2MBT A;  2R6K A;  2RUF A;  3N5O A;  2C80 A;  2WB9 A;  3HYP A;  3ZIV A;  3UVT A;  3Q6O A;  1AQW A;  3WT1 A;  1TOF A;  3A5I A;  1SVM A;  1YVL A;  3C7M A;  2IMI A;  3UVH A;  4FH8 A;  3KP9 A;  3TU3 B;  4V1A p;  10GS A;  4LMW A;  4IP6 A;  1TXX A;  2LRC A;  5DJM A;  4OMV A;  3ZL5 A;  2GSR A;  1ZGN A;  4DSQ A;  4PXO A;  4MZC A;  16GS A;  1OC8 A;  1M2D A;  2WZS A;  2QA2 A;  1ERV A;  3APQ A;  4K2X A;  5ABR A;  4KCA A;  1DBY A;  3GMF A;  2JU5 A;  3VFI A;  2NDO A;  5D93 A;  3TJJ A;  1PGT A;  4MF7 A;  2FCH A;  4K7O A;  2FA4 A;  3H8Q A;  3ZVJ D;  4KDY A;  1GTU A;  3IC4 A;  1TTZ A;  3CYN A;  2HRN A;  2DSA A;  5ECO B;  2MMZ A;  2R2J A;  2H6X A;  5GZZ B;  1Y1U A;  3HXS A;  2GZP A;  4NV5 A;  1O73 A;  4HUA A;  2H6Y A;  2WVZ A;  5DAL A;  5AIX A;  1ILO A;  8GSS A;  3BCK A;  3M8N A;  2GLR A;  1V40 A;  2EFE A;  4O5U A;  4FIW A;  3QR6 A;  4NWY A;  1QFN A;  1JFU A;  5CNW A;  3WGX A;  2XHF A;  4GDF A;  4RQR A;  4GWR A;  1WIK A;  5DBQ A;  5J3R A;  2F8F A;  5ELA A;  2AB6 A;  1A2J A;  2BTO T;  3H1N A;  5DVB A;  1TRU A;  3FKF A;  4TR1 B;  4TR0 A;  2KHP A;  2PN8 A;  1JLV A;  4IGJ A;  3GH6 A;  4YKF A;  4HU7 A;  5HQP A;  3M0F A;  1ERW A;  2I4A A;  1S3A A;  5JCW A;  1V57 A;  1PMT A;  5G5E A;  3DVX A;  4YKG A;  2B3S A;  4OCE A;  2L5L A;  3G9B A;  4I6X A;  4KF9 A;  4KDU A;  5IIZ A;  3C1S A;  4DSR A;  3ZRD A;  5HR1 A;  4O5R A;  1SVO A;  1AQX A;  4IVF A;  2QKE A;  4GTU A;  3HHV A;  3EE2 A;  1EEJ A;  1ABA A;  1O7U A;  1PN0 A;  3GH9 A;  2VAF A;  5DQY A;  4PI2 C;  4YAV A;  2B1L A;  1GSS A;  2H72 A;  3IHQ A;  4MMM A;  1EGR A;  1CQH A;  3ERW A;  1VRS D;  3KIJ A;  4EF0 A;  3TJK A;  2GQL A;  2KOK A;  2LTK A;  2YOI A;  4FQU A;  4MJB A;  4IS0 A;  3EPT A;  3RDW A;  3KMO A;  1GNE A;  1TDI A;  4XS1 A;  2LQO A;  4BVY B;  2YZU A;  4IN0 A;  2R3X A;  1ZYP A;  1O85 A;  3IHG A;  5A5H A;  1M3J A;  2OAD A;  2CT6 A;  4L0U A;  4KE3 A;  4K6X A;  3GA4 A;  4LA1 A;  1O81 A;  2CAI A;  2M72 A;  4FXY P;  1Z7R A;  3RPP A;  4YQU A;  1HYU A;  1F3B A;  2M46 A;  5EY6 A;  2CVB A;  3L9S A;  2A2R A;  5JWR B;  3U6V A;  2WW0 A;  4IW9 A;  2DIY A;  2JAC A;  4EXJ A;  2HSM B;  3H93 A;  5DQS A;  3PGT A;  5A1N A;  1ZMA A;  4KUN A;  1TRW A;  4MF6 A;  3Q19 A;  4AF2 A;  4A5P A;  1M3I A;  2C0G A;  2HRA A;  3RPN A;  1XFL A;  5INY A;  1O6J A;  12GS A;  4MPF A;  1Z6N A;  1GLQ A;  2YN1 A;  5J4Y A;  2GVP A;  3HJM A;  3S9F A;  2H76 A;  2P5Q A;  6GSX A;  1SD8 A;  4QQ7 A;  2WW2 A;  4PX1 A;  3N9J A;  4GXZ A;  3QFB C;  2LKU A;  3TKS E;  1XCC A;  2HZE B;  2CZ2 A;  1ZCP A;  3HVX A;  1M2B A;  1U88 A;  4HI7 A;  3GST A;  1H4O A;  2IFQ A;  4YAP A;  3TUE A;  4PNF A;  4V2L A;  2KLX A;  3GFK A;  1OKT A;  1B48 A;  2K9F A;  3HCZ A;  5F07 A;  3FK8 A;  2PUK C;  1F6M C;  2P31 A;  3FR9 A;  2K8S A;  4POM A;  2VKZ G;  1SYX A;  3TJB A;  2QA1 A;  1LBK A;  1PL2 A;  3ISO A;  1KTE A;  1XOA A;  3G7I A;  3UAP A;  4G9H A;  2H71 A;  3MWH A;  4KAE A;  1GTB A;  3P90 A;  2R0C A;  4PHZ C;  5DCH A;  2CAQ A;  2G2Q A;  2VM2 A;  2IJY A;  1GSU A;  4HJM A;  4G19 A;  2EFH A;  4W66 A;  2VLV A;  1BQ7 A;  3BBY A;  2LRT A;  1Z7P A;  4D73 A;  1TI1 A;  3WGE A;  2RII A;  3W6G A;  5ECM B;  5AGY A;  3TRX A;  5E59 A;  4FYB A;  4WR5 A;  3D6I A;  1NHO A;  3EIN A;  2NBS A;  1YY7 A;  1YKA A;  3HVN A;  4F9Z A;  2K6V A;  2H0G A;  3Q18 A;  4P3Y B;  5LD0 A;  4HS1 A;  5G30 A;  1GP1 A;  3DXB A;  3FHK A;  4OWY A;  2RM6 A;  1SYR A;  5J9B A;  5D9W A;  5KN3 A;  1QK8 A;  4N0V A;  1GNW A;  3KXO A;  1EGO A;  3GHA A;  1S3R A;  1OC9 A;  4KX4 A;  5B8B A;  3TJF A;  1VF2 A;  5B6M A;  4XCS A;  4ZIL A;  1FOV A;  1V58 A;  1M9A A;  2GS3 A;  1K3O A;  5HFG A;  2DLX A;  1N8J A;  2DML A;  3VWV A;  1LU4 A;  5H5Q A;  2IPA A;  1YQ1 A;  4XHM A;  2WUL A;  1HNC A;  3FEU A;  1PRX A;  4CHS A;  4KGI A;  1PX7 A;  2JSY A;  1I5G A;  4TN8 A;  1O8X A;  3PR8 A;  5A34 A;  2YPM A;  2VOC A;  1UN2 A;  3MNG A;  4IHU A;  1B9X C;  2QGV A;  4AJ7 A;  4YH2 A;  1XPV A;  1ERT A;  3D4M A;  18GS A;  2GZY A;  5EVO A;  1W89 A;  4POB A;  3M9J A;  5J4U A;  1THO A;  1FW1 A;  4N11 A;  5IM9 A;  5CRG A;  3C73 A;  3WYW A;  4K8M A;  3DD3 A;  4ECC A;  5DAK A;  3I6A A;  4KCE A;  3LSZ A;  4WF4 A;  5J40 A;  3SWL A;  3J7Y b;  1YJ6 A;  5FT3 A;  3CSJ A;  1BX9 A;  1MDK A;  1U6T A;  3IRA A;  3A2V A;  3TKR A;  2O87 A;  5C04 A;  4FO5 A;  4IJI A;  3ERG A;  4ECI A;  5ID2 A;  2HSN B;  2ZNM A;  1MD4 A;  4DEJ A;  4ZIJ A;  1BF5 A;  1GTI A;  1BED A;  2OE1 A;  2GZZ A;  4KSO A;  2MMO A;  3ME7 A;  3GV1 A;  2H8L A;  2H1A A;  2OE0 A;  1TK0 B;  4AJ8 A;  2X8H A;  2YNX A;  2OBK A;  4CW9 A;  2PGT A;  2O89 A;  1SL0 B;  5COH A;  1BG1 A;  1SKR B;  2VCZ A;  4XRA A;  1SJ6 A;  2IWT A;  4X43 A;  2X99 A;  2F51 A;  4KH7 A;  4AKG A;  3FZ4 A;  1WMJ A;  3ZRE A;  4PQH A;  4PNG A;  1GTA A;  3VWX A;  3D5J A;  2YV9 A;  4H86 A;  3ZFB A;  1A8L A;  2BMX A;  2UZ8 A;  4HQS A;  3CQF A;  4NXI A;  5IMZ A;  1TW9 A;  2GGT A;  3J7Y k;  1A2M A;  4K5S A;  2VCV A;  3F3R A;  1GUM A;  5KN1 A;  1U3I A;  4BL7 B;  2RM5 A;  1PQN A;  3L9U A;  1KBN A;  1SKW B;  3IC8 A;  2LRN A;  2ALB A;  3PH9 A;  2OA7 A;  2E0Q A;  5L71 A;  1V9W A;  2OKA A;  3FR6 A;  3GUS A;  3G7Y A;  4PUR A;  5JWQ B;  2PWJ A;  3D4T A;  4N30 A;  4CY6 A;  1IYI A;  3HVS A;  1R4W A;  1ML6 A;  3F4S A;  1YEW C;  2JAD A;  1MD3 A;  2VCW A;  2KP2 A;  3E9J B;  4N3Z A;  3E0U A;  1YKC A;  1QUW A;  5AIS A;  2B5X A;  1ZYN A;  2IIY A;  1K0M A;  2YWM A;  4MZW A;  4ZB8 A;  2H1L A;  4JR6 A;  1WOU A;  1K0N A;  5F05 A;  4JU5 A;  5G31 A;  3MDK A;  5BMU B;  2K8V A;  2EFC A;  5G1L A;  2EC4 A;  2DJJ A;  2AAW A;  2K18 A;  5IO0 A;  2DJ3 A;  5A4V A;  4JRR A;  2PER A;  4XS6 A;  1OE7 A;  1OC3 A;  5ELG A;  3M1G A;  5G5F A;  1OYJ A;  2HI7 A;  5D8I A;  1T8E B;  1Z3E A;  1T3B A;  3H4K A;  5IMV A;  5DCG A;  5ECL B;  1VF4 A;  2VL9 A;  4IBP A;  2VM1 A;  4ID0 A;  4Z7X A;  1EZK A;  5A5K A;  4J57 E;  1ZL9 A;  2KP1 A;  1G6Y A;  3QOU A;  3WT2 A;  4IJ3 A;  1F37 A;  3DVW A;  2VIM A;  1QQ2 A;  3DRN A;  3CSI A;  1XG8 A;  2YP6 A;  4GSN A;  1R7H A;  1PX6 A;  4MP4 A;  2RLI A;  3ZZX A;  2YZH A;  4MLY A;  2AJQ B;  1ERU A;  3QAG A;  4Z2R A;  3DIE A;  3GN3 A;  2C0D A;  1N25 A;  4NHZ A;  3VWW A;  5GAP D;  4NHW A;  3HMJ G;  3LJR A;  2EIO A;  2WDU A;  1TXU A;  3DEX A;  4YQV A;  4O92 A;  1EWX A;  4F2I A;  4EL1 A;  5IO2 A;  2O3E A;  3KGK A;  4TR1 A;  3RAZ A;  1K0D A;  3IR4 A;  3ZML A;  2H0H A;  1YF1 A;  5ECI B;  1AIU A;  3I43 A;  3F0I A;  2HRK B;  3VWU A;  2CZ3 A;  1SU9 A;  5IMC A;  3TKQ A;  4ILF A;  3UL3 A;  2H73 A;  3F6D A;  5LNK e;  2V1M A;  2QSI A;  1FO5 A;  3KMN A;  3LEF A;  3BOA A;  1A0F A;  2WVX B;  2JZT A;  4ZXG A;  2GT5 A;  4L0W A;  2X64 A;  4HQZ A;  13GS A;  4OO5 A;  4AI6 A;  3NIV A;  2YCD A;  3FMW A;  4ZBD A;  3DKS A;  1MDJ A;  4XTS A;  1AAZ A;  3TRQ A;  4IKH A;  4ZBA A;  1GSD A;  5IQY A;  4RQX A;  1M2A A;  3LGC A;  2DKH A;  2JZR A;  5FWG A;  3F3Q A;  3KH9 A;  5ECS A;  3CMI A;  2YWO A;  2PU9 C;  3IPZ A;  4ACS A;  3HZ4 A;  5HR3 A;  4HZ4 A;  3RFR C;  2LUS A;  3IOS A;  3G7J A;  4TXO B;  3CTF A;  5AIV A;  3A5W A;  4TR4 A;  3MSZ A;  2F3M A;  4IP1 A;  3KEB A;  2LS5 A;  2YWI A;  14GS A;  2Z9S A;  3O3T A;  2QC7 A;  5KEJ A;  1PL1 A;  5IOW A;  1T00 A; 
#chains in the Genus database with same CATH homology
 1X9M B;  2LST A;  4HJ2 A;  2GQM A;  1ST9 A;  3GX0 A;  4F03 A;  3D22 A;  4ZL8 A;  4WR4 A;  5D96 A;  4EO3 A;  4BVY A;  4WKW A;  1SD9 A;  3F8U A;  2HT9 A;  4POK A;  2DJ1 A;  4ISD A;  5F06 A;  1JZO A;  2OT3 A;  2YWN A;  3APO A;  5D9V A;  2CVK A;  3GL5 A;  3I9V 2;  1K0B A;  2M80 A;  1X5C A;  5JCG A;  1XWC A;  3E3E A;  3ZYW A;  3KM6 A;  2O5V A;  4OFM A;  1UVZ A;  4K2D A;  5CRD A;  4O7H A;  2BJX A;  1MEK A;  2MMA A;  1XVQ A;  1DE1 A;  3L0H A;  2PPT A;  1VF1 A;  2O7K A;  4OFT A;  1ON4 A;  3LYK A;  3KTL A;  2HE3 A;  4N10 A;  3FY7 A;  3LW9 A;  3QMX A;  4CY8 A;  5F0G A;  2WZ9 A;  1GUH A;  2YV7 A;  4JZQ A;  1GLP A;  4G10 A;  2H1D A;  2H1B A;  1TU7 A;  2PVO C;  5D73 A;  2L59 A;  1JZD A;  4GCI A;  1A2L A;  1QXH A;  1RQM A;  1WE0 A;  4GSS A;  3TGZ A;  2ZUP A;  5G2Z A;  3LOR A;  2N5A A;  1BJX A;  2GSS A;  5KN0 A;  4I5Q A;  1G7O A;  3VPQ A;  1U87 A;  2CV4 A;  4K7I A;  2HZE A;  4OD7 A;  3TKS A;  3FZ9 A;  1EOG A;  2H01 A;  1X9W B;  1F3A A;  2HSH A;  5H5R A;  1FAA A;  2A4V A;  1MTC A;  4AKH A;  3QDN A;  4DSS B;  2H30 A;  1ACV A;  2FUG 2;  20GS A;  4ZBB A;  1EOH A;  4F0B A;  5IOX A;  2C4J A;  1H75 A;  5DDL A;  4HZ2 A;  5F8B A;  5BRT A;  4BVX B;  5E4W A;  2H70 A;  4NAX A;  4MF5 A;  4G0L A;  1FG4 A;  3FYG A;  2OJL A;  4K0G A;  2FY6 A;  5CO3 A;  4GRF A;  6GSS A;  1AUC A;  4G01 A;  2D2Z A;  4FYC A;  2B7K A;  2X49 A;  1X0R A;  4MCU A;  3UEM A;  4N0Z A;  2L57 A;  3F6F A;  2VL2 A;  1XWA A;  4EUY A;  4AJ6 A;  1AW9 A;  1SL2 B;  5GST A;  1XZO A;  1KNG A;  2LQQ A;  4EKZ A;  1WJK A;  3EWL A;  2LEG A;  3LYP A;  2I3Y A;  5A4W A;  3UBK A;  1JHB A;  2WCI A;  4EDY A;  4TKY A;  1NW2 A;  4I97 A;  4NPB A;  5C00 A;  3GL3 A;  1BAY A;  3GRX A;  3QCP A;  2H0I A;  5KN2 A;  1XWB A;  2FHE A;  3DML A;  1G6W A;  4NV2 A;  1N2A A;  1PA3 A;  1JLW A;  2X4A A;  3CBU A;  2H1G A;  3D0Z A;  2F9S A;  3LXZ A;  3A3T A;  3QFA C;  1ZZY A;  1J9B A;  2VO4 A;  3HZ8 A;  5AN1 A;  1SEN A;  2GT6 A;  2LJR A;  2O85 A;  3TJG A;  2XPD A;  5CRW A;  3GTU B;  1SKS B;  3O6T A;  2X8C A;  2N5F A;  1GUK A;  4L5O A;  4EVM A;  2JL4 A;  4IEL A;  2PVQ A;  2B5E A;  2C0E A;  3VI7 A;  1S3D A;  2O8V B;  1Q98 A;  1XW5 A;  4DVC A;  1DUG A;  2FWE A;  2FLS A;  1B4P A;  2OE3 A;  5GSS A;  2L6D A;  1C72 A;  1T7P B;  4MPG A;  2H74 A;  1Y25 A;  2FD3 A;  4LLR A;  1HQO A;  2C0F A;  3HA9 A;  3EU4 A;  3Q74 A;  2DC5 A;  1J08 A;  2XBI A;  3WD6 A;  1Z5Y E;  1R5P A;  5ECR B;  2XPE A;  3PIN A;  4HEA 2;  17GS A;  2ES7 A;  3IDV A;  2C1Y A;  4XS4 B;  2A4H A;  1T4Y A;  5J41 A;  6GSV A;  3F4T A;  1TRS A;  2VCQ A;  3LXT A;  2HRF A;  3KZQ A;  4EC0 A;  2HSN A;  2I9H A;  4TW5 A;  3EVI A;  2MBS A;  2L4Q A;  1BYE A;  2GSQ A;  4F0C A;  2GTU A;  3W8S A;  1EP8 A;  4GF0 A;  1HNA A;  4GQC A;  3UAR A;  2IMK A;  2JZS A;  1DSB A;  3UIW A;  3V1W A;  1U3A A;  3JCM L;  2FWG A;  4OFN A;  4KND A;  1CQG A;  4MAB A;  1GSQ A;  5J5N A;  3ZIT A;  2C3Q A;  3ZLP A;  5ECP B;  1PN9 A;  4V2M A;  1USB A;  5A4U A;  5JCU A;  2WFC A;  1RK4 A;  1A23 A;  1PKZ A;  3I69 A;  2TRC P;  2UV8 G;  2P5R A;  2IMF A;  3HKR A;  1M0U A;  2HSY A;  3KP8 A;  1R5A A;  3QAV A;  3M3M A;  2V6K A;  4WXT A;  2J23 A;  1JZW A;  4CDO A;  1AXD A;  2I81 A;  5DAL B;  3QD9 A;  3FRC A;  1FVJ A;  4AKI A;  6GSW A;  3BJ5 A;  1OVN A;  1A8Y A;  4KSM A;  4ZB7 A;  4V2N A;  2R0P A;  1Y6E A;  4XIH A;  2YJH A;  4LMV A;  3EMP A;  1NM3 A;  3NOF A;  4BL7 A;  3ZFL A;  3ERF A;  3UJ1 A;  1FHE A;  5KOX A;  2GDR A;  2DBC A;  4G0K A;  3H79 A;  3GX8 A;  2NVL A;  5GAN D;  1GWC A;  2MMN A;  4EDZ A;  4K9Z A;  3ZIJ A;  2AUV A;  1O8W A;  4ZL9 A;  3DWV A;  4Q5F A;  5J47 A;  3KD0 A;  1ZYQ B;  1B9Y C;  2MZC A;  3KH7 A;  4PQI A;  3IA1 A;  4Q5Q A;  3KJY A;  3AY8 A;  2FA8 A;  3EYT A;  4ECJ A;  1F2E A;  4LL4 B;  1PSQ A;  1WPI A;  1ZYE A;  2AHE A;  5FHI A;  1IYH A;  2LV3 A;  4OO4 A;  3TDG A;  3UBL A;  2DJ0 A;  2IMD A;  2HNL A;  2HLS A;  1SK2 A;  5HR0 A;  1XVW A;  3ME8 A;  3ZTL A;  6GSU A;  5BMU A;  3F4R A;  5B8A A;  3CSH A;  3P8W A;  1X5E A;  1V2A A;  3L9V A;  4POL A;  1SJZ A;  2E2M A;  5HFK A;  4EE0 A;  4RI6 A;  2I1U A;  5D9T A;  2H19 A;  3U5R E;  4O32 A;  2C3T A;  4LL1 B;  2CX3 A;  2V41 A;  1TK5 B;  4MJE A;  2A2S A;  3L78 A;  4PUA A;  3IAS 2;  1XW6 A;  1OE8 A;  4I2U A;  4HOJ A;  3R2Q A;  2PMT A;  2EIQ A;  2CA8 A;  1TU8 A;  1E6B A;  2AV4 A;  3CWG A;  1UC7 A;  2GQK A;  3LFL A;  2FWF A;  5HFI A;  3EUR A;  2OAC A;  5A5H B;  3F63 A;  2ZCT A;  3HJO A;  4ML1 A;  4EIP A;  3QPM A;  2LNS A;  4K0N A;  5CRE A;  2HFD A;  4QL7 A;  4TOP A;  1OAZ A;  2R4V A;  3BD2 A;  4QL9 A;  4X1U A;  2XC2 A;  4TR3 A;  2C3N A;  4MZB A;  3TCO A;  3NZN A;  3CRT A;  7GSS A;  4FYU A;  5A1N B;  6GSY A;  4JBB A;  3OR5 A;  2VD1 A;  4J56 E;  4MNN A;  4PQ1 A;  5HR2 A;  1HD2 A;  2VLT A;  3HY2 A;  2HRK A;  1NSW A;  1TP9 A;  1UA5 A;  2IN3 A;  1XWG A;  4TXV A;  1K3L A;  4Z2U A;  1M99 A;  3GUR A;  1WWJ A;  3IAM 2;  3IK9 A;  1AC1 A;  2REM A;  1GSY A;  3K8N A;  5JWO B;  3HVV A;  4Z2T A;  2VCT A;  5CAX A;  4BWS A;  4E8E A;  3ZMK A;  4L8E A;  4MK3 A;  1GSF A;  1K0C A;  1VGL A;  3MAK A;  5KOW A;  2DKI A;  3RHB A;  2DJK A;  2XBQ A;  4MA9 A;  5ECH B;  4J2F A;  4ZB9 A;  2CQ9 A;  4WF5 A;  5ECK B;  3LQ7 A;  1X5D A;  2PBJ A;  4TXO A;  4ZL7 A;  3TKS C;  1XIY A;  2IFQ B;  3APS A;  1WRY A;  4RI7 A;  2H75 A;  3GKM A;  1PD2 1;  2MYG A;  3VUR A;  4WET A;  3GKX A;  2HSM A;  2HQT A;  2H6Z A;  3FZA A;  4XRD A;  2EFD A;  5J4V A;  4ECB A;  2WRT A;  4PTS A;  3F9U A;  3VPT A;  2A2P A;  4G2E A;  6GST A;  3GYK A;  3GNJ A;  1SK0 A;  4HDE A;  5J9C A;  4USS A;  3L4N A;  2R5G A;  1GSE A;  1MDI A;  1X9S B;  2V32 A;  1NHY A;  1F9M A;  2FWH A;  1V98 A;  4KB3 A;  1TRV A;  5ECQ B;  1T4Z A;  2LJK A;  1Q4J A;  3C8E A;  4TVE A;  3TOU A;  2VL2 C;  4MJA A;  4ML6 A;  1FVK A;  3TRP A;  1SL1 B;  3US3 A;  1A24 A;  2B5Y A;  1LJR A;  4EIQ A;  3UOM A;  4E68 A;  1FOH A;  2R0G A;  3D21 A;  3IE3 A;  4QMK A;  2E2G A;  1G0T A;  3TKP A;  1SVL A;  4D73 B;  2LNT A;  5IPH A;  1PKW A;  5DJL A;  3BCI A;  1THX A;  5B6N A;  3MYD A;  3RHC A;  2TIR A;  2DJ2 A;  2P0G A;  1M7T A;  2C8U A;  5B7C A;  2VUP A;  3O76 A;  5IPG A;  3A2X A;  3IV4 A;  2L6C A;  5EPF A;  3HDC A;  2H66 A;  4Q5N A;  2TRX A;  4K1F A;  3W8J A;  2IL3 A;  4MH2 A;  1TJD A;  3GKN A;  2DMM A;  3TB2 A;  3GIX A;  3TOT A;  2X8G A;  4KW6 A;  1E2Y A;  2IME A;  3R3E A;  4E8H A;  3HD5 A;  4GQF A;  11GS A;  3IK7 A;  1GRX A;  1FB0 A;  1OC9 B;  3KCM A;  5G1K A;  4AKX B;  2DIZ A;  3MIX A;  4OCF A;  4DSS A;  2B1K A;  1EV9 A;  3PPU A;  4V1A g;  2B6M A;  4HU9 A;  3RBT A;  4MDC A;  1YF0 A;  2G0F A;  4IQ1 A;  4BVX A;  5IMA A;  2NTO A;  4I8B A;  1G7E A;  1FB6 A;  4X0X A;  22GS A;  5A34 B;  1HNB A;  1GUL A;  1XOB A;  3P2A A;  4PUF C;  2CVD A;  4JED A;  1BG5 A;  2ON5 A;  2N5B A;  4O5Q A;  1QGV A;  2E7P A;  4TRX A;  5CP1 A;  1SK1 A;  4KDX A;  1VF3 A;  5EL8 A;  4GST A;  4RUV A;  3VK9 A;  1A0R P;  1XWK A;  2EIR A;  1YEP A;  3M9K A;  2J9H A;  1GH2 A;  1XXU A;  1YEX A;  3EMX A;  4WBJ A;  4BWQ A;  4L5L A;  4X4J A;  1EV4 A;  5DAK B;  2B7J A;  3CXG A;  3UMA A;  1AQV A;  3FR3 A;  2OBI A;  4IQA A;  4K7N A;  1EP7 A;  9GSS A;  5IMF A;  4Q5R A;  1J0F A;  3VI5 A;  1M9B A;  4NMU A;  5ID2 B;  4ICY A;  3HJP A;  4YQM A;  5LCZ A;  2HXK A;  1GL8 A;  2LJA A;  1RW1 A;  2HZF A;  4KA0 A;  4F82 A;  1S3C A;  5ECN B;  3ED3 A;  3DGQ A;  4JR4 A;  3ZVJ A;  4BPY A;  4GLT A;  3CRU A;  2VL3 A;  1TK8 B;  1XW9 A;  3EU3 A;  1K0O A;  1Z9H A;  3GTU A;  4ZB6 A;  2YAN A;  1URM A;  4ULX A;  2VD0 A;  2GST A;  2V6O A;  3IXR A;  1DE2 A;  1OKD A;  4K5R A;  1QMV A;  3QAW A;  3C71 A;  1SJI A;  1EEM A;  1KEB A;  4PGT A;  1JZR A;  5D9X A;  5CRH A;  5CYY A;  4WEY A;  3CTG A;  5H5S A;  4G0I A;  3C1R A;  1B8X A;  3LG6 A;  3FZ5 A;  1W4V A;  1I9D A;  4WBR D;  1R26 A;  4MH3 A;  1Z6M A;  5ENU A;  3IBH A;  3EC3 A;  1YDK A;  3LWA A;  3SBC A;  5IMD A;  2JSZ A;  1T1V A;  2VCX A;  2VLU A;  4MJC A;  1K0A A;  4JE1 A;  2L4C A;  2CX4 A;  19GS A;  2YJ7 A;  1K3Y A;  4I2T A;  2RUE A;  4BA7 A;  3FW2 A;  2FGX A;  1TKD B;  1WP0 A;  2AYT A;  3KTB A;  4AGS A;  2NPB A;  3WGD A;  3A2W A;  1B4Q A;  1TI3 A;  2V2G A;  2WGR A;  3GSS A;  1YZX A;  3DYR A;  3P7X A;  4XS4 A;  2L5O A;  2FNO A;  3GKK A;  1ZOF A;  2R37 A;  2F8A A;  2WS2 A;  1XBS A;  2HYX A;  2ON7 A;  2KUC A;  2WJU A;  3VLN A;  2MBT A;  2R6K A;  2RUF A;  3N5O A;  2C80 A;  2WB9 A;  3HYP A;  3ZIV A;  3UVT A;  3Q6O A;  1AQW A;  3WT1 A;  1TOF A;  3A5I A;  1SVM A;  1YVL A;  3C7M A;  2IMI A;  3UVH A;  4FH8 A;  3KP9 A;  3TU3 B;  4V1A p;  10GS A;  4LMW A;  4IP6 A;  1TXX A;  2LRC A;  5DJM A;  4OMV A;  3ZL5 A;  2GSR A;  1ZGN A;  4DSQ A;  4PXO A;  4MZC A;  16GS A;  1OC8 A;  1M2D A;  2QA2 A;  1ERV A;  3APQ A;  4K2X A;  5ABR A;  4KCA A;  1DBY A;  3GMF A;  2JU5 A;  3VFI A;  2NDO A;  5D93 A;  3TJJ A;  1PGT A;  4MF7 A;  2FCH A;  4K7O A;  2FA4 A;  3H8Q A;  3ZVJ D;  4KDY A;  1GTU A;  3IC4 A;  1TTZ A;  3CYN A;  2HRN A;  2DSA A;  5ECO B;  2MMZ A;  2R2J A;  2H6X A;  5GZZ B;  1Y1U A;  3HXS A;  2GZP A;  4NV5 A;  1O73 A;  4HUA A;  2H6Y A;  5DAL A;  5AIX A;  1ILO A;  8GSS A;  3BCK A;  3M8N A;  2GLR A;  1V40 A;  2EFE A;  4O5U A;  4FIW A;  3QR6 A;  4NWY A;  1QFN A;  1JFU A;  5CNW A;  3WGX A;  2XHF A;  4GDF A;  4RQR A;  4GWR A;  1WIK A;  5DBQ A;  5J3R A;  2F8F A;  5ELA A;  2AB6 A;  1A2J A;  2BTO T;  3H1N A;  5DVB A;  1TRU A;  3FKF A;  4TR1 B;  4TR0 A;  2KHP A;  2PN8 A;  1JLV A;  4IGJ A;  3GH6 A;  4YKF A;  4HU7 A;  5HQP A;  3M0F A;  1ERW A;  2I4A A;  1S3A A;  5JCW A;  1V57 A;  1PMT A;  5G5E A;  3DVX A;  4YKG A;  2B3S A;  4OCE A;  2L5L A;  3G9B A;  4I6X A;  4KF9 A;  4KDU A;  5IIZ A;  3C1S A;  4DSR A;  3ZRD A;  5HR1 A;  4O5R A;  1SVO A;  1AQX A;  4IVF A;  2QKE A;  4GTU A;  3HHV A;  3EE2 A;  1EEJ A;  1ABA A;  1O7U A;  1PN0 A;  3GH9 A;  2VAF A;  5DQY A;  4YAV A;  2B1L A;  1GSS A;  2H72 A;  3IHQ A;  4MMM A;  1EGR A;  1CQH A;  3ERW A;  1VRS D;  3KIJ A;  4EF0 A;  3TJK A;  2GQL A;  2KOK A;  2LTK A;  2YOI A;  4FQU A;  4MJB A;  4IS0 A;  3EPT A;  3RDW A;  3KMO A;  1GNE A;  1TDI A;  4XS1 A;  2LQO A;  4BVY B;  2YZU A;  4IN0 A;  2R3X A;  1ZYP A;  1O85 A;  3IHG A;  5A5H A;  2OAD A;  2CT6 A;  4L0U A;  4KE3 A;  4K6X A;  3GA4 A;  4LA1 A;  1O81 A;  2CAI A;  2M72 A;  1Z7R A;  3RPP A;  4YQU A;  1HYU A;  1F3B A;  2M46 A;  5EY6 A;  2CVB A;  3L9S A;  2A2R A;  5JWR B;  3U6V A;  4IW9 A;  2DIY A;  2JAC A;  4EXJ A;  2HSM B;  3H93 A;  5DQS A;  3PGT A;  5A1N A;  1ZMA A;  4KUN A;  1TRW A;  4MF6 A;  3Q19 A;  4AF2 A;  4A5P A;  2C0G A;  2HRA A;  3RPN A;  1XFL A;  5INY A;  1O6J A;  12GS A;  4MPF A;  1Z6N A;  1GLQ A;  2YN1 A;  5J4Y A;  2GVP A;  3HJM A;  3S9F A;  2H76 A;  2P5Q A;  6GSX A;  1SD8 A;  4QQ7 A;  4PX1 A;  3N9J A;  4GXZ A;  3QFB C;  2LKU A;  3TKS E;  1XCC A;  2HZE B;  2CZ2 A;  1ZCP A;  3HVX A;  1M2B A;  1U88 A;  4HI7 A;  3GST A;  1H4O A;  2IFQ A;  4YAP A;  3TUE A;  4PNF A;  4V2L A;  2KLX A;  3GFK A;  1OKT A;  1B48 A;  2K9F A;  3HCZ A;  5F07 A;  3FK8 A;  2PUK C;  1F6M C;  2P31 A;  3FR9 A;  2K8S A;  4POM A;  2VKZ G;  1SYX A;  3TJB A;  2QA1 A;  1LBK A;  1PL2 A;  3ISO A;  1KTE A;  1XOA A;  3G7I A;  3UAP A;  4G9H A;  2H71 A;  3MWH A;  4KAE A;  1GTB A;  3P90 A;  2R0C A;  5DCH A;  2CAQ A;  2G2Q A;  2VM2 A;  2IJY A;  1GSU A;  4HJM A;  4G19 A;  2EFH A;  4W66 A;  2VLV A;  1BQ7 A;  3BBY A;  2LRT A;  1Z7P A;  4D73 A;  1TI1 A;  3WGE A;  2RII A;  3W6G A;  5ECM B;  5AGY A;  3TRX A;  5E59 A;  4FYB A;  4WR5 A;  3D6I A;  1NHO A;  3EIN A;  2NBS A;  1YY7 A;  1YKA A;  4F9Z A;  2K6V A;  2H0G A;  3Q18 A;  4P3Y B;  5LD0 A;  4HS1 A;  5G30 A;  1GP1 A;  3DXB A;  3FHK A;  4OWY A;  2RM6 A;  1SYR A;  5J9B A;  5D9W A;  5KN3 A;  1QK8 A;  4N0V A;  1GNW A;  3KXO A;  1EGO A;  3GHA A;  1OC9 A;  4KX4 A;  5B8B A;  3TJF A;  1VF2 A;  5B6M A;  4XCS A;  4ZIL A;  1FOV A;  1V58 A;  1M9A A;  2GS3 A;  1K3O A;  5HFG A;  2DLX A;  1N8J A;  2DML A;  3VWV A;  1LU4 A;  5H5Q A;  2IPA A;  1YQ1 A;  4XHM A;  2WUL A;  1HNC A;  3FEU A;  1PRX A;  4CHS A;  4KGI A;  1PX7 A;  2JSY A;  1I5G A;  4TN8 A;  1O8X A;  3PR8 A;  5A34 A;  2YPM A;  2VOC A;  1UN2 A;  3MNG A;  4IHU A;  1B9X C;  2QGV A;  4AJ7 A;  4YH2 A;  1XPV A;  1ERT A;  3D4M A;  18GS A;  2GZY A;  5EVO A;  1W89 A;  4POB A;  3M9J A;  5J4U A;  1THO A;  1FW1 A;  4N11 A;  5IM9 A;  5CRG A;  3C73 A;  3WYW A;  4K8M A;  3DD3 A;  4ECC A;  5DAK A;  3I6A A;  4KCE A;  3LSZ A;  4WF4 A;  5J40 A;  3SWL A;  3J7Y b;  1YJ6 A;  5FT3 A;  3CSJ A;  1BX9 A;  1MDK A;  1U6T A;  3IRA A;  3A2V A;  3TKR A;  2O87 A;  5C04 A;  4FO5 A;  4IJI A;  3ERG A;  4ECI A;  5ID2 A;  2HSN B;  2ZNM A;  1MD4 A;  4DEJ A;  4ZIJ A;  1BF5 A;  1GTI A;  1BED A;  2OE1 A;  2GZZ A;  4KSO A;  2MMO A;  3ME7 A;  3GV1 A;  2H8L A;  2H1A A;  2OE0 A;  1TK0 B;  4AJ8 A;  2X8H A;  2YNX A;  2OBK A;  4CW9 A;  2PGT A;  2O89 A;  1SL0 B;  5COH A;  1BG1 A;  1SKR B;  2VCZ A;  4XRA A;  1SJ6 A;  2IWT A;  4X43 A;  2X99 A;  2F51 A;  4KH7 A;  4AKG A;  3FZ4 A;  1WMJ A;  3ZRE A;  4PQH A;  4PNG A;  1GTA A;  3VWX A;  3D5J A;  2YV9 A;  4H86 A;  3ZFB A;  1A8L A;  2BMX A;  2UZ8 A;  4HQS A;  4NXI A;  5IMZ A;  1TW9 A;  2GGT A;  3J7Y k;  1A2M A;  4K5S A;  2VCV A;  3F3R A;  1GUM A;  5KN1 A;  1U3I A;  4BL7 B;  2RM5 A;  1PQN A;  3L9U A;  1KBN A;  1SKW B;  3IC8 A;  2LRN A;  2ALB A;  3PH9 A;  2OA7 A;  2E0Q A;  5L71 A;  1V9W A;  2OKA A;  3FR6 A;  3GUS A;  3G7Y A;  4PUR A;  5JWQ B;  2PWJ A;  3D4T A;  4N30 A;  4CY6 A;  1IYI A;  3HVS A;  1R4W A;  1ML6 A;  3F4S A;  2JAD A;  1MD3 A;  2VCW A;  2KP2 A;  3E9J B;  4N3Z A;  3E0U A;  1YKC A;  1QUW A;  5AIS A;  2B5X A;  1ZYN A;  2IIY A;  1K0M A;  2YWM A;  4MZW A;  4ZB8 A;  2H1L A;  4JR6 A;  1WOU A;  1K0N A;  5F05 A;  4JU5 A;  5G31 A;  3MDK A;  5BMU B;  2K8V A;  2EFC A;  5G1L A;  2EC4 A;  2DJJ A;  2AAW A;  2K18 A;  5IO0 A;  2DJ3 A;  5A4V A;  4JRR A;  2PER A;  4XS6 A;  1OE7 A;  1OC3 A;  5ELG A;  3M1G A;  5G5F A;  1OYJ A;  2HI7 A;  5D8I A;  1T8E B;  1Z3E A;  1T3B A;  3H4K A;  5IMV A;  5DCG A;  5ECL B;  1VF4 A;  2VL9 A;  4IBP A;  2VM1 A;  4ID0 A;  4Z7X A;  1EZK A;  5A5K A;  4J57 E;  1ZL9 A;  2KP1 A;  1G6Y A;  3QOU A;  3WT2 A;  4IJ3 A;  1F37 A;  3DVW A;  2VIM A;  1QQ2 A;  3DRN A;  3CSI A;  2YP6 A;  4GSN A;  1R7H A;  1PX6 A;  4MP4 A;  2RLI A;  3ZZX A;  2YZH A;  4MLY A;  2AJQ B;  1ERU A;  3QAG A;  4Z2R A;  3DIE A;  3GN3 A;  2C0D A;  1N25 A;  4NHZ A;  3VWW A;  5GAP D;  4NHW A;  3HMJ G;  3LJR A;  2EIO A;  2WDU A;  1TXU A;  3DEX A;  4YQV A;  4O92 A;  1EWX A;  4F2I A;  4EL1 A;  5IO2 A;  3KGK A;  4TR1 A;  3RAZ A;  1K0D A;  3IR4 A;  3ZML A;  2H0H A;  1YF1 A;  5ECI B;  1AIU A;  3I43 A;  3F0I A;  2HRK B;  3VWU A;  2CZ3 A;  1SU9 A;  5IMC A;  3TKQ A;  4ILF A;  3UL3 A;  2H73 A;  3F6D A;  5LNK e;  2V1M A;  2QSI A;  1FO5 A;  3KMN A;  3LEF A;  3BOA A;  1A0F A;  2JZT A;  4ZXG A;  2GT5 A;  4L0W A;  2X64 A;  4HQZ A;  13GS A;  4OO5 A;  4AI6 A;  3NIV A;  2YCD A;  3FMW A;  4ZBD A;  3DKS A;  1MDJ A;  4XTS A;  1AAZ A;  3TRQ A;  4IKH A;  4ZBA A;  1GSD A;  5IQY A;  4RQX A;  1M2A A;  3LGC A;  2DKH A;  2JZR A;  5FWG A;  3F3Q A;  3KH9 A;  5ECS A;  3CMI A;  2YWO A;  2PU9 C;  3IPZ A;  4ACS A;  3HZ4 A;  5HR3 A;  4HZ4 A;  2LUS A;  3IOS A;  3G7J A;  4TXO B;  3CTF A;  5AIV A;  3A5W A;  4TR4 A;  3MSZ A;  2F3M A;  4IP1 A;  3KEB A;  2LS5 A;  2YWI A;  14GS A;  2Z9S A;  3O3T A;  2QC7 A;  5KEJ A;  1PL1 A;  5IOW A;  1T00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...