3ZMKA

Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
219
structure length
200
Chain Sequence
KLVLYTLHLSPPCRAVELTAKALGLELEQKNITIPVLDDDGTIITESHAIMIYLVTKYGKDDTLYPKDPVQQARVNAALHFESGVLFARMRFIFERIFFYGKSDIPEDRVEYVQKSYRLLEDTLKDDFVAGSKMTIADFSCISTISSIMGVVPLEQSEHPRIYEWIDRLKQLPYYEEANGGGGTDLGKFVLAKKEENAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE E2
publication title A Single Mutation in the Gste2 Gene Allows Tracking of Metabolically-Based Insecticide Resistance in a Major Malaria Vector.
pubmed doi rcsb
source organism Anopheles funestus
molecule tags Transferase
total genus 79
structure length 200
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3zmkA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zmkA01
3KJYA 2DIZA 3M0FA 3F4SA 3CTGA 1EZKA 2WFCA 4PUAA 1GH2A 5KN3A 3KMNA 1YEXA 4ZBDA 2CVDA 1GUKA 3GURA 5HR0A 3TKSA 2RUEA 3CSIA 1NHYA 4G10A 16GSA 6GSTA 2VL3A 4QL9A 3D5JA 3VURA 5ABRA 2DJKA 3EINA 2IIYA 1MDKA 2C3QA 2O87A 2YV7A 3LEFA 2GSQA 2JADA 2VLUA 2HSYA 5ECMB 2WB9A 3GMFA 1I9DA 4ZL7A 1SYRA 3ZIJA 4JE1A 2VCXA 4MH2A 2M46A 1GSEA 2WRTA 1K0BA 4JRRA 4JU5A 1SL1B 4POMA 4KSOA 1XIYA 3WGDA 2VM1A 5GSSA 1TU8A 1R7HA 2MBTA 1YKAA 1SJ6A 3FEUA 2WULA 3PPUA 1GSSA 1MD3A 4WBRD 17GSA 1W4VA 3KH7A 2K9FA 3HVVA 5DDLA 3A2XA 1C72A 4KCEA 3ZLPA 4PUFC 1TI3A 4I8BA 2REMA 3H1NA 4GSNA 1DSBA 2BTOT 4WETA 1VF3A 4PQ1A 5HR2A 2IMKA 1B4QA 2TRXA 4NMUA 2GSRA 1QMVA 2XBIA 2F8FA 2ZNMA 5DJMA 1OKTA 3VWUA 3W8JA 2DMMA 1VGLA 1WOUA 4ML6A 3NIVA 2F9SA 4HQSA 2VL9A 2DC5A 3TJBA 5FHIA 2DBCA 2N5FA 4Q5FA 2GQLA 4XIHA 3ZFLA 3UBLA 3IDVA 1K0CA 1FOVA 1H4OA 4MF6A 4CW9A 5B7CA 1S3CA 4LLRA 3ME7A 2AHEA 3GIXA 1TRVA 4LMWA 4EVMA 3DVWA 1XOBA 2C0DA 1XVWA 2WZ9A 2DSAA 3TKSC 3FR9A 1O7UA 5IO2A 3FY7A 1ERTA 2M80A 1USBA 5G31A 1V58A 2CT6A 3LYKA 2ZCTA 2YZHA 5D9XA 5ECLB 2O7KA 2QC7A 5ECRB 1XZOA 5EL8A 3TKPA 2EIQA 1PX6A 4BL7A 3GKKA 2QKEA 3L9SA 6GSUA 5BMUA 3PR8A 5D9TA 1FO5A 3TJGA 2FLSA 3H93A 1BG5A 2NBSA 3IXRA 3I6AA 3LQ7A 1PKZA 4G19A 1G6WA 2YPMA 5ENUA 1JZRA 2Z9SA 4V1Ap 1PA3A 5JCWA 5CRWA 1RK4A 1X9SB 2ON5A 1FG4A 2V1MA 3TKRA 3QDNA 4DSQA 4FQUA 3KTLA 4N11A 5GAND 3EYTA 5ECSA 5ECQB 5CP1A 1A2MA 1ON4A 3HYPA 3LORA 2H72A 3ZRDA 4L0WA 4BL7B 1KBNA 1Z5YE 8GSSA 3HZ4A 2H6ZA 1WIKA 1SL0B 2YANA 2XC2A 4GLTA 2HQTA 1EEMA 4ACSA 3IV4A 5IMDA 4CHSA 1FHEA 4X0XA 3O76A 2RM5A 1WRYA 2I4AA 2WDUA 1M7TA 1M99A 2CZ2A 3UVHA 2GLRA 2YJ7A 3N9JA 1O8XA 3M1GA 1TK8B 1A8YA 2JACA 3GX8A 5CO3A 1GSQA 3TOUA 1Z6MA 3ZZXA 4F03A 3HA9A 1JZDA 3HJOA 1ILOA 3HD5A 5F05A 1X5EA 1KEBA 5IIZA 2O85A 4IN0A 4LL1B 2V41A 3S9FA 5G5FA 2R5GA 5AISA 2R2JA 5D8IA 4HS1A 2GSSA 4H86A 3BD2A 5HR1A 1XWCA 3TJKA 2H74A 2X8HA 3CSJA 3ZTLA 2GQKA 1F3BA 1DUGA 1RQMA 4MA9A 3CTFA 4RUVA 5DCHA 3LFLA 5HFKA 3J7Yk 2H1AA 1K0OA 3GN3A 1JHBA 4ZB8A 2CQ9A 4JR6A 3BOAA 3UBKA 1BAYA 3I43A 4WBJA 4IS0A 4IQ1A 4HQZA 2I81A 2J9HA 2AJQB 4KF9A 1JZOA 1PGTA 1NM3A 4TR1A 4D73A 2GT5A 2JZSA 5JCUA 3E3EA 3FK8A 3W6GA 2K8VA 2RM6A 4N10A 2VCQA 2JU5A 1LU4A 1U87A 3F4RA 5F07A 4BPYA 2O89A 1EOGA 2R3XA 3GH9A 3E0UA 2N5AA 4LMVA 1ZYQB 1NSWA 4MF7A 3VI5A 4HDEA 2LRTA 2B3SA 4TN8A 2L5OA 1ZL9A 2ON7A 2LRCA 2LV3A 1GUMA 1QFNA 1SJZA 1OC8A 4HU7A 2VCTA 2DJ2A 1B8XA 2DJ0A 2MMZA 2HRFA 3TKQA 3Q19A 1VF2A 2VLVA 5B6NA 2FUG2 1VF1A 1EV4A 2GTUA 3MNGA 1F3AA 2GZPA 2V6OA 2C1YA 2GGTA 4G9HA 3F3QA 1OKDA 3VWVA 5JWRB 2C3TA 4TR0A 5H5SA 1X9MB 6GSWA 4JZQA 2K6VA 4PNFA 1T8EB 6GSSA 1MEKA 1M2BA 3TRXA 2YNXA 1ERUA 2HSNB 3IR4A 1OC9A 2X8GA 4F0BA 1ZGNA 1ERVA 2H1GA 3U6VA 3GSTA 4ECCA 1LBKA 3SWLA 1CQHA 1KTEA 1PRXA 1B9YC 5CRDA 1E6BA 2LEGA 2R4VA 1OVNA 1UVZA 5DALA 4ZILA 3H79A 3APSA 3FKFA 1SK0A 2H6XA 2IJYA 1AAZA 5EVOA 5KN2A 3K8NA 4G0LA 3HKRA 1V98A 2XPEA 2AB6A 1O8WA 5J41A 19GSA 2HSMA 1JLVA 3VPTA 3TB2A 2FWEA 5F8BA 1HNAA 1GNWA 5LCZA 3ZREA 2WCIA 4DSRA 3UARA 4EDYA 1UC7A 4GXZA 5DVBA 4EKZA 2E2MA 2JL4A 2H0GA 4MPFA 1EEJA 1K3OA 1PMTA 3P7XA 5DALB 1WWJA 1U3AA 1THXA 3MDKA 3L0HA 2FWGA 2B5XA 5IQYA 4HJMA 2MMAA 3GUSA 1V2AA 1N8JA 1XWAA 2YV9A 1XCCA 5C04A 2VD1A 2O8VB 1DE1A 5G30A 4O32A 4FYUA 1YJ6A 4RQXA 2HSMB 1ST9A 2FA4A 1OE8A 1BJXA 4IJ3A 2A4VA 2C0EA 1GSDA 4NHZA 1BEDA 4EC0A 1A8LA 2YWNA 1ML6A 2PU9C 5DQYA 2IMIA 3KZQA 3DIEA 2HZFA 3Q18A 5D96A 4L8EA 3UMAA 1B4PA 1ZOFA 3VPQA 1ZMAA 2RUFA 4POBA 4NV5A 5G2ZA 3QAVA 4Q5NA 1TRSA 3LJRA 5F06A 3QAWA 4MJCA 1SKRB 1V9WA 3ZFBA 1GP1A 3RPPA 1AQVA 1U3IA 2DLXA 4HU9A 4ECJA 1GWCA 5DCGA 5E59A 10GSA 3NZNA 4G2EA 2VL2A 5D93A 3O6TA 1FVKA 3PH9A 4ZXGA 2KUCA 3APOA 3TRQA 2C80A 4AF2A 2HT9A 4KX4A 4XHMA 2RLIA 2CX3A 4XS1A 3WD6A 1WJKA 1GRXA 1TRUA 4AJ6A 1XW5A 2DJJA 3M3MA 3G7IA 4ZBBA 2LRNA 4XCSA 9GSSA 2V6KA 1GL8A 3I69A 3C7MA 4OD7A 1GUHA 3AY8A 1YEPA 4JEDA 1XFLA 3CSHA 4MLYA 4L5OA 1GSUA 1M2AA 4KE3A 4XRDA 3WT1A 1URMA 2KP2A 4N30A 4XTSA 6GSXA 3GYKA 4TRXA 1GTUA 2C0GA 2C3NA 1A0FA 2P31A 2LUSA 4X1UA 4GTUA 2B6MA 5LD0A 1Z6NA 2YZUA 3D4TA 4AJ7A 3JCML 3UJ1A 2LKUA 2OACA 3KGKA 2D2ZA 4MJAA 1MDIA 2V32A 3A3TA 4P3YB 3ZIVA 5AN1A 2H1BA 1MD4A 5IPGA 1HNCA 4ZIJA 2X64A 1A23A 1T1VA 3IAM2 5AGYA 5IMCA 3DWVA 3FR6A 3ED3A 3R3EA 5DJLA 1A24A 4J56E 4PX1A 1QUWA 1BYEA 2VIMA 2EC4A 1AQWA 4GSTA 3FYGA 3IAS2 3GKXA 4KAEA 2IMEA 1HNBA 5H5QA 2VL2C 1BX9A 4EL1A 5ECOB 4QQ7A 2OADA 1QXHA 2FCHA 1YQ1A 1PL2A 2DMLA 3IA1A 3GTUA 4MJEA 3DVXA 3D0ZA 1SJIA 4FO5A 1XW6A 3KTBA 1TK5B 4EF0A 2OE0A 3C1RA 5HFIA 2EIOA 3J7Yb 2AAWA 2H01A 4K7NA 3EURA 3G7JA 2HNLA 3RHBA 1MDJA 1F37A 2L4CA 3US3A 2IMFA 5ECKB 1E2YA 4Q5RA 2KHPA 4J2FA 2G2QA 3GX0A 3KCMA 2LJAA 1UN2A 2WS2A 3UAPA 3ZYWA 1YZXA 3CXGA 3GTUB 1GULA 2P5QA 1FAAA 2VOCA 4KW6A 1AUCA 3KXOA 4KNDA 1T4YA 2H66A 1TI1A 4KDUA 1Q98A 5C00A 2LSTA 5B6MA 4TR3A 1SK2A 2B1KA 1XW9A 1U6TA 1K0NA 3GL3A 3TRPA 2PN8A 3MAKA 1RW1A 1ZYEA 4GWRA 1J0FA 4ML1A 1ACVA 3H8QA 5A4UA 3IK9A 1PD21 2GZZA 5GSTA 1B48A 3H4KA 5D9VA 2XBQA 1I5GA 4ZL8A 5KEJA 4YH2A 1TU7A 2OKAA 1YF0A 3IPZA 3IBHA 5IPHA 2H19A 4K7OA 3FZAA 4GSSA 1ERWA 5CRGA 3HY2A 1A0RP 4KSMA 2VM2A 2LS5A 1AIUA 3EU4A 4F9ZA 3F6DA 4KGIA 3ISOA 1X5CA 4RI6A 4IJIA 4LA1A 4PGTA 2V2GA 3IE3A 2L6CA 4L0UA 4OCEA 4PTSA 4GRFA 2G0FA 4WEYA 5JWOB 4IVFA 4ULXA 2KOKA 3GSSA 1V57A 1XWBA 2E0QA 1X9WB 2C8UA 1Y6EA 4KH7A 1J9BA 2HSHA 2MBSA 3LSZA 1PN9A 3CMIA 3D4MA 1G6YA 4OO5A 1PL1A 2A2RA 2GS3A 3OR5A 4K0GA 4FIWA 1CQGA 3RHCA 4V1Ag 4MF5A 4CDOA 5EY6A 5DQSA 2ES7A 3QR6A 2IMDA 1XOAA 4YQMA 3U5RE 3GKMA 3QOUA 4YQUA 5GZZB 1QK8A 2DJ1A 2H0IA 5IMZA 3HJMA 2N5BA 3A2WA 4MDCA 3D21A 5DBQA 3ZMKA 2FD3A 1J08A 2A2SA 4K0NA 4PXOA 4MZBA 2L57A 3DRNA 3FZ5A 4IBPA 1O81A 1OC3A 4PURA 3L9VA 2ZUPA 1K0AA 1YDKA 3C73A 4QL7A 1AC1A 2PBJA 3CBUA 3QAGA 2KP1A 3HHVA 2VD0A 4I97A 4EUYA 3CYNA 4I2TA 4KA0A 3TUEA 5FWGA 1K3YA 1SU9A 5HFGA 3C71A 11GSA 2VCZA 4K7IA 4V2LA 3GV1A 2FHEA 2F8AA 1UA5A 3PINA 4V2MA 3KH9A 3DXBA 3F0IA 1GSFA 1T7PB 2I3YA 3APQA 6GSYA 2L59A 3BCIA 1O73A 5ECPB 2P5RA 2HFDA 1SKSB 4KUNA 4MZCA 1HYUA 1W89A 1YY7A 1HD2A 2IN3A 5KN1A 2M72A 3KEBA 3G7YA 1GTAA 2JSZA 4JR4A 3LYPA 2AV4A 1PKWA 3FZ9A 4OCFA 4OWYA 2B5YA 3KP8A 5ID2A 1X5DA 1K0MA 4J57E 3LXZA 1JFUA 3D22A 4IGJA 2L4QA 1F9MA 2YOIA 4EO3A 2H76A 1EWXA 4I5QA 5HR3A 3RBTA 2LJKA 3FR3A 1ABAA 2H75A 3WT2A 1Q4JA 1Y25A 5B8AA 1S3AA 1V40A 3TKSE 1AQXA 2B7KA 4K1FA 2JZRA 5EPFA 3LGCA 1GNEA 4HEA2 1XWKA 3ERGA 3RDWA 4E8HA 2GQMA 2FWHA 4USSA 1XXUA 3L78A 3P8WA 4L5LA 3MWHA 3VLNA 4TKYA 2EIRA 4HZ2A 5J9BA 2B5EA 2L5LA 1O85A 4BA7A 4OFNA 3C1SA 5G1KA 3EC3A 5ID2B 4HOJA 4JBBA 4YAVA 1G0TA 3QPMA 2IFQA 1BQ7A 2X99A 3GNJA 3Q74A 2FNOA 2GT6A 4XRAA 3F8UA 1R26A 2CVBA 5IM9A 2GZYA 2TRCP 4RI7A 4ZB6A 4G0IA 2GDRA 4TW5A 1TOFA 2E7PA 3O3TA 4OFTA 2LNTA 1XPVA 1R5AA 4DEJA 4MJBA 3VWWA 2HYXA 2LTKA 3DKSA 4K6XA 4OFMA 2QSIA 2NTOA 1SENA 5CNWA 2F51A 1K3LA 4F2IA 3HDCA 1X0RA 1ZCPA 2K8SA 2X8CA 1XBSA 2YWOA 2IFQB 2MMOA 1TKDB 3L4NA 1T3BA 2IPAA 2FY6A 5IMVA 1IYIA 3QMXA 3TGZA 5IO0A 18GSA 3W8SA 4NXIA 1VRSD 1Z3EA 1SD9A 2VLTA 2PWJA 4HI7A 2GSTA 4ECIA 3EWLA 3FZ4A 4Z7XA 1K0DA 5A4VA 3KP9A 4NHWA 3IK7A 4X43A 4E8EA 3FHKA 5IMAA 5ELGA 3R2QA 3LG6A 4TOPA 2C0FA 1HQOA 4NAXA 4ISDA 3IC8A 4WF4A 4Q5QA 5HQPA 3Q6OA 4EXJA 2PPTA 4OO4A 4KDYA 4WR4A 2YP6A 2MYGA 1JZWA 2VUPA 4BWSA 5LNKe 1S3DA 3CRUA 4POLA 2PUKC 1THOA 3QFAC 1A2LA 3L9UA 4KB3A 1TDIA 3WYWA 4N0VA 6GSVA 2PERA 1M9AA 2PVQA 4N0ZA 1WMJA 3F63A 3LWAA 3E9JB 3LXTA 3EU3A 4MABA 1WP0A 3IC4A 2JSYA 1IYHA 3UL3A 2PVOC 3EMPA 1JLWA 2F3MA 4FYCA 2HRKA 2H73A 3ZL5A 1G7EA 2YWIA 4BVYA 4YAPA 12GSA 1N2AA 3QCPA 2CVKA 2NVLA 2H71A 4DSSA 4I2UA 1Z7PA 1KNGA 4XS6A 4ZB9A 3RPNA 2HZEA 2FA8A 1GSYA 2BMXA 1TP9A 2H0HA 5G5EA 4IELA 2CZ3A 3ZITA 2DJ3A 1GTBA 2I1UA 4POKA 2OJLA 4IKHA 2OE1A 4MCUA 1FW1A 2LJRA 5G1LA 1SD8A 4HZ4A 1WPIA 1M9BA 4IHUA 4TVEA 4FH8A 5D73A 4KDXA 4EE0A 4KCAA 3RAZA 2HRKB 4GCIA 4ID0A 3GHAA 4BVYB 22GSA 2FGXA 2J23A 4MPGA 1PQNA 1B9XC 1TTZA 4O92A 4IP1A 1R5PA 1ZZYA 4DSSB 1MTCA 2LQOA 3MSZA 1SYXA 2HZEB 2CX4A 2AYTA 2AUVA 1SL2B 2H30A 1M0UA 3ERWA 3HCZA 5GAPD 2CAQA 5CAXA 1Z9HA 2LQQA 2YCDA 3G9BA 1PX7A 5F0GA 2QGVA 2WGRA 5IOXA 4TR4A 4MP4A 3P2AA 1OYJA 4DVCA 1XVQA 4WF5A 2P0GA 2IWTA 1OE7A 1NW2A 3M8NA 4MZWA 3SBCA 3F6FA 5COHA 1EOHA 2YN1A 3A5WA 3QD9A 4GF0A 20GSA 1QQ2A 2TIRA 4FYBA 3IRAA 5J5NA 2NPBA 3UOMA 3GA4A 1TJDA 5KN0A 3HVXA 3PGTA 4HJ2A 4AJ8A 4PNGA 4F82A 1SKWB 1EP8A 4AGSA 5L71A 1TXXA 1H75A 4O5RA 2I9HA 3VFIA 4ZL9A 3CRTA 2HRAA 3BCKA 2LNSA 4IQAA 4ZBAA 5JWQB 2R6KA 3TJFA 3DYRA 1TW9A 2BJXA 3GH6A 2CAIA 1A2JA 1Z7RA 4IW9A 1T4ZA 3FRCA 1F2EA 1TRWA 2UZ8A 1YF1A 2DIYA 2HXKA 2MMNA 1AXDA 5E4WA 4NWYA 2XPDA 1LJRA 2L6DA 2RIIA 3P90A 2NDOA 4TXOA 5CREA 2VCVA 1EGOA 3DMLA 1XWGA 4NPBA 4GQFA 3GFKA 5DAKA 2VCWA 3M9KA 2FWFA 3BBYA 3KMOA 4K9ZA 3EMXA 4BWQA 1EV9A 1WE0A 5J4UA 4V2NA 3F4TA 1TK0B 3ZVJD 4WXTA 1U88A 2H6YA 5CRHA 5A5KA 2OBKA 5ECNB 3UIWA 5IOWA 5H5RA 3FW2A 1DBYA 3KD0A 2YWMA 3EE2A 3UEMA 3KIJA 5ECHB 1VF4A 4TXOB 1DE2A 4TR1B 4D73B 7GSSA 4GQCA 2C4JA 5D9WA 3TDGA 5DAKB 1G7OA 2H8LA 3DEXA 3VWXA 4PQHA 2KLXA 4XS4A 3IHQA 1PSQA 3WGEA 4WR5A 3WGXA 4YQVA 3ZMLA 3A2VA 5CYYA 1R4WA 1YKCA 3TJJA 4TXVA 4I6XA 3F3RA 2OE3A 2HI7A 3VI7A 5ECIB 3HXSA 1M2DA 2IL3A 4K8MA 2R37A 3ERFA 1F6MC 5J3RA 3EVIA 4OMVA 2OBIA 5B8BA 1T00A 1SK1A 2B7JA 4XS4B 4ILFA 2VAFA 2ALBA 3KM6A 3GRXA 1GTIA 2PGTA 3N5OA 2E2GA 4MH3A 3QFBC 4O7HA 3VK9A 3HJPA 2H1DA 2WJUA 4K2DA 1OC9B 3HZ8A 4BVXA 3ME8A 2CA8A 4MK3A 4F0CA 2HLSA 3UVTA 3TCOA 1OAZA 2OA7A 5AIXA 5INYA 2JZTA 3M9JA 1AW9A 2HE3A 3NOFA 4WKWA 3BJ5A 14GSA 2GVPA 5J9CA 3GL5A 4HUAA 5A4WA 4G0KA 4LL4B 2CV4A 2MZCA 2H70A 1EP7A 5FT3A 4EDZA 2XHFA 2K18A 3DD3A 5ELAA 1NHOA 2YJHA 4MMMA 13GSA 3I9V2 4ECBA 3DGQA 3HVSA 3C8EA 5AIVA 1O6JA 2HRNA 3D6IA 3GKNA 5JCGA 1FVJA 1EGRA 3TOTA 1QGVA 3F9UA 3V1WA 4BVXB 2PMTA 4NV2A 2B1LA 3IOSA 1GLQA 5IMFA 4PQIA 1GLPA 1FB0A 3ZVJA 2VO4A 4RQRA 4IP6A 1FB6A
chains in the Genus database with same CATH superfamily
3KJYA 2DIZA 3M0FA 3F4SA 3CTGA 1EZKA 2WFCA 1S4BP 4PUAA 1GH2A 2WVYA 5KN3A 3KMNA 1YEXA 4ZBDA 2CVDA 1GUKA 3GURA 5HR0A 3TKSA 1M3IA 2VKZG 2RUEA 3CSIA 1NHYA 4G10A 16GSA 6GSTA 2VL3A 4QL9A 3D5JA 3VURA 5ABRA 2DJKA 4MNNA 3EINA 2IIYA 1MDKA 2C3QA 2O87A 2YV7A 3LEFA 2GSQA 2JADA 2VLUA 2HSYA 5ECMB 2WB9A 3GMFA 1I9DA 4ZL7A 1SYRA 3ZIJA 5A5HA 4JE1A 2VCXA 4MH2A 2M46A 1GSEA 2WRTA 1K0BA 4JRRA 4JU5A 1SL1B 4POMA 4KSOA 1XIYA 1BF5A 3WGDA 2VM1A 5GSSA 1TU8A 1R7HA 2MBTA 1YKAA 1SJ6A 3FEUA 2WULA 3PPUA 1GSSA 1MD3A 4WBRD 17GSA 1W4VA 3KH7A 2K9FA 3HVVA 5DDLA 3A2XA 2O36A 1C72A 4KCEA 3ZLPA 4PUFC 1TI3A 4I8BA 2REMA 3H1NA 4GSNA 1DSBA 2BTOT 4WETA 2WVXA 1VF3A 4PQ1A 5HR2A 2IMKA 1B4QA 2TRXA 4NMUA 2GSRA 1QMVA 2XBIA 2F8FA 2ZNMA 5DJMA 1OKTA 3VWUA 3W8JA 2DMMA 1VGLA 1WOUA 4ML6A 3NIVA 2F9SA 4HQSA 2VL9A 3CHXC 3A5IA 2DC5A 3TJBA 5FHIA 2DBCA 2N5FA 4Q5FA 2GQLA 4XIHA 3ZFLA 3UBLA 3IDVA 1K0CA 1FOVA 1H4OA 4MF6A 5A1NA 1M3JA 4CW9A 5B7CA 1S3CA 4LLRA 3ME7A 2AHEA 3GIXA 1I1IP 1TRVA 4LMWA 4EVMA 3DVWA 1XOBA 2C0DA 1XVWA 2WZ9A 2DSAA 3TKSC 3FR9A 1O7UA 5IO2A 3FY7A 1ERTA 2M80A 1USBA 4AKHA 5G31A 1V58A 2CT6A 3LYKA 5J47A 2ZCTA 2YZHA 5D9XA 5ECLB 2O7KA 2QC7A 5ECRB 1XZOA 5EL8A 5KOWA 3TKPA 2EIQA 1PX6A 4BL7A 3GKKA 2QKEA 3L9SA 6GSUA 5BMUA 3PR8A 5D9TA 5A1NB 1FO5A 1TXUA 3TJGA 2FLSA 3H93A 1BG5A 2NBSA 3IXRA 4W66A 3I6AA 3LQ7A 1PKZA 4G19A 1G6WA 2YPMA 5ENUA 1JZRA 2Z9SA 4V1Ap 1PA3A 5JCWA 5CRWA 1RK4A 1X9SB 2ON5A 1FG4A 2V1MA 3TKRA 3QDNA 4DSQA 4FQUA 3KTLA 4N11A 5GAND 3EYTA 5ECSA 5ECQB 5CP1A 1A2MA 1ON4A 3HYPA 3LORA 2H72A 3ZRDA 4L0WA 4BL7B 1KBNA 1Z5YE 8GSSA 3HZ4A 2H6ZA 1WIKA 1SL0B 2YANA 5J4YA 3HVNA 2XC2A 4GLTA 2HQTA 1EEMA 4ACSA 3IV4A 5IMDA 4CHSA 1FHEA 4X0XA 3O76A 2RM5A 1WRYA 2I4AA 2WDUA 1M7TA 1M99A 2CZ2A 3UVHA 2GLRA 2YJ7A 3N9JA 1O8XA 3M1GA 1TK8B 1A8YA 2JACA 3GX8A 5CO3A 1GSQA 3TOUA 1Z6MA 3ZZXA 4F03A 3HA9A 1JZDA 3HJOA 1ILOA 3HD5A 5F05A 1X5EA 1KEBA 3RGBC 3FMWA 2O85A 5IIZA 4IN0A 4LL1B 2V41A 3S9FA 5G5FA 2R5GA 5AISA 2R2JA 5D8IA 4HS1A 2GSSA 3BD2A 4H86A 5HR1A 1XWCA 3TJKA 2H74A 2X8HA 3CSJA 3ZTLA 2GQKA 1F3BA 1DUGA 1RQMA 4MA9A 3CTFA 4RUVA 5DCHA 3LFLA 5HFKA 3J7Yk 2H1AA 1K0OA 3GN3A 1JHBA 4ZB8A 2CQ9A 4JR6A 3BOAA 3UBKA 1BAYA 3I43A 4WBJA 4IS0A 4IQ1A 4HQZA 2I81A 2J9HA 2AJQB 4KF9A 1JZOA 1PGTA 1NM3A 4TR1A 2R0CA 4D73A 2GT5A 2JZSA 5JCUA 3E3EA 3FK8A 3W6GA 2K8VA 2RM6A 4QMKA 4N10A 2VCQA 2JU5A 4E68A 1LU4A 1U87A 3F4RA 5F07A 4BPYA 2O89A 1EOGA 2R3XA 3GH9A 3E0UA 2N5AA 4LMVA 1ZYQB 1NSWA 4MF7A 3VI5A 4HDEA 2LRTA 2B3SA 4TN8A 2L5OA 2HSNA 1ZL9A 2ON7A 2LRCA 2LV3A 1GUMA 1QFNA 1SJZA 1OC8A 4HU7A 2VCTA 2DJ2A 5A34A 1B8XA 2DJ0A 4ICYA 2MMZA 2HRFA 3TKQA 3Q19A 1VF2A 2VLVA 5B6NA 2FUG2 2O5VA 1VF1A 1EV4A 2GTUA 3MNGA 1F3AA 2GZPA 2V6OA 2C1YA 2GGTA 4G9HA 3F3QA 1OKDA 3CWGA 3VWVA 5JWRB 2C3TA 4TR0A 5H5SA 1X9MB 6GSWA 4JZQA 2K6VA 4PNFA 1T8EB 6GSSA 1MEKA 1M2BA 3TRXA 2YNXA 1ERUA 2HSNB 3IR4A 1OC9A 2X8GA 4F0BA 1ZGNA 1ERVA 2H1GA 3U6VA 3GSTA 4ECCA 1LBKA 2X49A 3SWLA 1CQHA 5A34B 1KTEA 1PRXA 1B9YC 5CRDA 1E6BA 1PFOA 2H1LA 4AI6A 2LEGA 2QA1A 2R4VA 1OVNA 1UVZA 5DALA 4ZILA 3H79A 3APSA 3FKFA 1SK0A 2H6XA 2IJYA 1AAZA 5EVOA 5KN2A 3K8NA 4G0LA 3HKRA 1V98A 4PI2C 2XPEA 2AB6A 1O8WA 5J41A 19GSA 2HSMA 1JLVA 3VPTA 3TB2A 2FWEA 5F8BA 1HNAA 1GNWA 5LCZA 3ZREA 2WCIA 4DSRA 4PHZC 3UARA 4EDYA 1UC7A 4GXZA 5DVBA 4EKZA 2E2MA 2JL4A 2H0GA 1BG1A 4MPFA 1EEJA 1K3OA 1PMTA 3P7XA 5DALB 1WWJA 1U3AA 1THXA 3MDKA 3L0HA 2FWGA 2B5XA 5IQYA 4HJMA 2MMAA 4Z2UA 3GUSA 1V2AA 1N8JA 1XWAA 2YV9A 1XCCA 5C04A 2VD1A 2O8VB 1DE1A 5G30A 4O32A 4FYUA 1YJ6A 4RQXA 2HSMB 1ST9A 2FA4A 2A2PA 1OE8A 1BJXA 4IJ3A 2A4VA 2C0EA 1GSDA 4NHZA 1BEDA 4CY6A 4EC0A 1A8LA 4HSCX 2YWNA 1ML6A 2PU9C 5DQYA 2IMIA 3KZQA 3DIEA 2HZFA 3Q18A 5D96A 4L8EA 3UMAA 1B4PA 1ZOFA 3VPQA 1ZMAA 2RUFA 4POBA 4NV5A 5G2ZA 3QAVA 4Q5NA 1TRSA 3LJRA 5F06A 3QAWA 4MJCA 1S3RA 1V9WA 1SKRB 3ZFBA 1YVLA 1GP1A 3RPPA 1AQVA 1U3IA 2DLXA 4HU9A 4ECJA 1GWCA 4YKGA 5DCGA 5E59A 10GSA 3NZNA 4G2EA 2VL2A 5D93A 3O6TA 1FVKA 3PH9A 4ZXGA 2KUCA 3APOA 3TRQA 2C80A 4AF2A 2HT9A 4KX4A 4XHMA 2RLIA 2DKHA 2CX3A 4XS1A 3WD6A 1WJKA 1GRXA 1TRUA 4AJ6A 1XW5A 2DJJA 3M3MA 4O5UA 3G7IA 4ZBBA 2LRNA 4XCSA 9GSSA 4AKGA 2V6KA 1GL8A 3I69A 3C7MA 4OD7A 1GUHA 3AY8A 1YEPA 4JEDA 1XFLA 3CSHA 4MLYA 4N3ZA 4L5OA 1GSUA 1M2AA 4KE3A 4XRDA 3WT1A 1URMA 2KP2A 4N30A 4XTSA 6GSXA 3GYKA 4TRXA 1GTUA 2C0GA 3RFRC 2C3NA 1A0FA 2P31A 2LUSA 4X1UA 5KOXA 4GTUA 2B6MA 5LD0A 1Z6NA 2YZUA 3D4TA 4AJ7A 3JCML 3UJ1A 2LKUA 2OACA 3KGKA 2D2ZA 2EFDA 4MJAA 1MDIA 1SVOA 2V32A 3A3TA 4P3YB 3ZIVA 4O5QA 2EFHA 5BRTA 5AN1A 2H1BA 1MD4A 5IPGA 1HNCA 4ZIJA 2X64A 1A23A 1T1VA 3IAM2 5AGYA 5IMCA 3DWVA 3FR6A 3ED3A 3R3EA 5DJLA 1A24A 4J56E 4PX1A 1QUWA 1BYEA 2VIMA 2EC4A 1AQWA 4GSTA 3FYGA 3IAS2 3GKXA 4KAEA 2IMEA 1HNBA 5H5QA 2VL2C 1BX9A 4EL1A 5ECOB 4QQ7A 2OADA 1QXHA 2FCHA 1YQ1A 1PL2A 2DMLA 3IA1A 3GTUA 4MJEA 3DVXA 3D0ZA 1SJIA 4FO5A 1XW6A 3KTBA 1TK5B 4EF0A 2OE0A 3C1RA 5HFIA 2EIOA 3J7Yb 2AAWA 2H01A 4K7NA 3EURA 3G7JA 2O3EA 2HNLA 3RHBA 1MDJA 1F37A 2L4CA 3US3A 2IMFA 5ECKB 1E2YA 4Q5RA 2KHPA 1Y1UA 2R0GA 4J2FA 2G2QA 3GX0A 3KCMA 2LJAA 1UN2A 2WS2A 3UAPA 3ZYWA 1YZXA 3CXGA 3GTUB 1XG8A 1GULA 2P5QA 1FAAA 2VOCA 4Z2TA 4KW6A 1AUCA 3KXOA 4KNDA 1T4YA 2H66A 1TI1A 4KDUA 1Q98A 5C00A 2LSTA 5B6MA 4TR3A 1SK2A 2B1KA 1XW9A 1U6TA 1K0NA 3GL3A 3TRPA 2PN8A 3MAKA 1RW1A 1ZYEA 4GWRA 1J0FA 4ML1A 1ACVA 3H8QA 5A4UA 3IK9A 1PD21 5J40A 2GZZA 5GSTA 1B48A 3H4KA 5D9VA 4Z2RA 2XBQA 1I5GA 4ZL8A 5KEJA 4YH2A 1TU7A 2OKAA 1YF0A 3IPZA 3IBHA 5IPHA 2H19A 4K7OA 3FZAA 4GSSA 1ERWA 5CRGA 4G01A 3HY2A 1A0RP 4KSMA 2VM2A 2LS5A 1AIUA 3EU4A 4F9ZA 3F6DA 4KGIA 3ISOA 1X5CA 4AKIA 4RI6A 4IJIA 4LA1A 4PGTA 2V2GA 3IE3A 2L6CA 4L0UA 4OCEA 4PTSA 4GRFA 4EIQA 2G0FA 2DKIA 4WEYA 2WW0A 5JWOB 4IVFA 4ULXA 2KOKA 3GSSA 1V57A 1XWBA 2E0QA 1X9WB 2C8UA 1Y6EA 4KH7A 1J9BA 2HSHA 3LW9A 2MBSA 3LSZA 1PN9A 4PI0C 3CMIA 3D4MA 1G6YA 4OO5A 1PL1A 2A2RA 2GS3A 3OR5A 4K0GA 4FIWA 1CQGA 3RHCA 4V1Ag 4MF5A 4CDOA 5EY6A 5DQSA 2ES7A 3QR6A 2IMDA 1XOAA 4YQMA 3U5RE 4EIPA 2WVZA 3GKMA 3QOUA 4YQUA 5GZZB 1QK8A 2DJ1A 2H0IA 5IMZA 3HJMA 2N5BA 3A2WA 4MDCA 3D21A 5DBQA 3ZMKA 2FD3A 1J08A 2A2SA 4K0NA 4PXOA 4MZBA 2L57A 3DRNA 3FZ5A 4IBPA 1O81A 1OC3A 4PURA 3L9VA 2ZUPA 1K0AA 1YDKA 3C73A 4QL7A 1AC1A 2PBJA 3CBUA 3QAGA 2KP1A 3TU3B 3HHVA 2VD0A 4I97A 4K5RA 4EUYA 3CYNA 4I2TA 4KA0A 3TUEA 5FWGA 1K3YA 1SU9A 5HFGA 3C71A 11GSA 2VCZA 4K7IA 4V2LA 3GV1A 2FHEA 2F8AA 1UA5A 3PINA 4V2MA 3KH9A 3DXBA 3F0IA 1GSFA 4ZB7A 1SVLA 1T7PB 2I3YA 3APQA 6GSYA 2L59A 3BCIA 1O73A 5ECPB 2P5RA 2HFDA 1SKSB 4KUNA 4MZCA 1HYUA 1W89A 1YY7A 1HD2A 2IN3A 5KN1A 2M72A 3KEBA 3G7YA 1GTAA 2JSZA 4JR4A 3LYPA 2AV4A 1PKWA 3FZ9A 1ZYNA 4OCFA 4OWYA 4A5PA 2B5YA 3KP8A 5ID2A 1X5DA 1K0MA 4J57E 3LXZA 1JFUA 3D22A 4IGJA 4YKFA 2L4QA 1F9MA 2YOIA 4EO3A 2H76A 1EWXA 4I5QA 5HR3A 3RBTA 2LJKA 3FR3A 1ABAA 2H75A 3WT2A 4GDFA 1Q4JA 1Y25A 5B8AA 1S3AA 1V40A 3TKSE 3IHGA 1AQXA 2B7KA 4K1FA 2JZRA 5EPFA 3LGCA 1GNEA 4HEA2 1XWKA 3ERGA 3RDWA 4E8HA 2GQMA 2FWHA 4USSA 1XXUA 3L78A 3P8WA 4L5LA 3MWHA 3VLNA 4TKYA 2EIRA 4HZ2A 5J9BA 2B5EA 2L5LA 2UV8G 1O85A 4BA7A 4OFNA 3C1SA 5G1KA 3EC3A 5ID2B 4HOJA 5J4VA 4JBBA 4YAVA 1G0TA 3QPMA 2IFQA 1BQ7A 2X99A 3GNJA 3Q74A 2FNOA 2GT6A 4XRAA 2X4AA 3F8UA 1R26A 2CVBA 5IM9A 2GZYA 2TRCP 4RI7A 4ZB6A 4G0IA 2GDRA 4TW5A 1TOFA 2E7PA 3O3TA 4OFTA 2LNTA 1XPVA 1R5AA 4DEJA 4MJBA 3VWWA 2HYXA 2LTKA 3DKSA 4K6XA 4OFMA 2QSIA 2NTOA 2WW2A 1SENA 5CNWA 3EPTA 2F51A 1K3LA 4F2IA 3HDCA 1X0RA 1ZCPA 2K8SA 2X8CA 1XBSA 2YWOA 2IFQB 2MMOA 1TKDB 3L4NA 1T3BA 2IPAA 2FY6A 5IMVA 1IYIA 3QMXA 3TGZA 5IO0A 18GSA 3W8SA 4NXIA 1VRSD 1Z3EA 1SD9A 2VLTA 2PWJA 4HI7A 2GSTA 4ECIA 3EWLA 3FZ4A 4Z7XA 1K0DA 5A4VA 3KP9A 4NHWA 3IK7A 4X43A 4E8EA 3FHKA 5IMAA 5ELGA 3R2QA 3LG6A 4TOPA 2C0FA 1HQOA 4NAXA 4ISDA 3IC8A 4WF4A 4Q5QA 5HQPA 3Q6OA 4FXYP 4EXJA 2PPTA 4OO4A 4KDYA 4WR4A 2YP6A 2MYGA 1JZWA 2VUPA 4BWSA 5LNKe 1S3DA 3CRUA 4POLA 2PUKC 1THOA 3QFAC 1A2LA 3L9UA 4KB3A 1TDIA 3WYWA 4N0VA 6GSVA 2PERA 1M9AA 5A5HB 2PVQA 4N0ZA 1WMJA 3F63A 3LWAA 3E9JB 3LXTA 3EU3A 4MABA 3HMJG 1WP0A 3IC4A 2JSYA 1IYHA 3UL3A 4BIKA 2PVOC 3EMPA 1JLWA 2F3MA 4FYCA 2HRKA 2H73A 3ZL5A 1G7EA 2YWIA 4BVYA 4YAPA 12GSA 1N2AA 2WVXB 3QCPA 2WZSA 2CVKA 2NVLA 2H71A 4DSSA 4I2UA 1Z7PA 1KNGA 4XS6A 4ZB9A 3RPNA 2HZEA 2FA8A 1GSYA 2BMXA 1TP9A 2H0HA 5G5EA 4IELA 2CZ3A 3ZITA 2DJ3A 1GTBA 2I1UA 4POKA 2OJLA 4IKHA 2OE1A 4MCUA 1FW1A 2LJRA 5G1LA 1SD8A 4HZ4A 1WPIA 1M9BA 4IHUA 4TVEA 4FH8A 5D73A 4KDXA 4EE0A 4KCAA 3RAZA 2HRKB 4GCIA 4ID0A 3GHAA 4BVYB 22GSA 2FGXA 2J23A 4MPGA 1PQNA 1B9XC 1TTZA 4O92A 4IP1A 1R5PA 1ZZYA 4DSSB 1MTCA 2LQOA 3MSZA 1SYXA 2HZEB 2CX4A 2AYTA 1FOHA 2AUVA 1SL2B 2H30A 1M0UA 3ERWA 3HCZA 5GAPD 2CAQA 5BMUB 5CAXA 1Z9HA 2LQQA 2YCDA 3G9BA 1PX7A 5F0GA 2QGVA 4AKXB 2WGRA 5IOXA 4TR4A 4MP4A 3P2AA 1OYJA 4DVCA 1XVQA 2R0PA 4WF5A 2P0GA 2IWTA 1OE7A 1NW2A 3M8NA 4MZWA 3SBCA 3F6FA 5COHA 1EOHA 2EFEA 2YN1A 3A5WA 3QD9A 4CY8A 4GF0A 20GSA 1QQ2A 2TIRA 4FYBA 1ZYPA 3IRAA 5J5NA 2NPBA 3UOMA 3GA4A 1TJDA 5KN0A 3HVXA 3PGTA 4HJ2A 4AJ8A 4PNGA 4F82A 1SKWB 1EP8A 4AGSA 5L71A 1TXXA 1H75A 4O5RA 2I9HA 3VFIA 4ZL9A 3CRTA 2HRAA 3BCKA 2LNSA 4IQAA 4ZBAA 5JWQB 2R6KA 3TJFA 3DYRA 1TW9A 2BJXA 3GH6A 2CAIA 1A2JA 1Z7RA 4IW9A 1T4ZA 3FRCA 1F2EA 1TRWA 1YEWC 2UZ8A 2WW1A 2A4HA 1YF1A 2DIYA 1PN0A 2HXKA 2MMNA 1AXDA 5E4WA 4NWYA 2XPDA 1LJRA 2L6DA 2RIIA 3P90A 2NDOA 4TXOA 5CREA 2VCVA 1EGOA 3DMLA 1XWGA 4NPBA 4GQFA 3GFKA 5DAKA 2VCWA 3M9KA 2WW3A 2FWFA 3BBYA 3KMOA 4K9ZA 3EMXA 4BWQA 1EV9A 1WE0A 5J4UA 4V2NA 3F4TA 1TK0B 3ZVJD 4WXTA 2QA2A 1U88A 2H6YA 5CRHA 5A5KA 2OBKA 5ECNB 3UIWA 5IOWA 5H5RA 3FW2A 4K2XA 1DBYA 3KD0A 2YWMA 3EE2A 3UEMA 3KIJA 5ECHB 1VF4A 4TXOB 1DE2A 4TR1B 4D73B 7GSSA 4GQCA 2C4JA 5D9WA 4K5SA 3TDGA 5DAKB 1G7OA 2H8LA 3DEXA 3VWXA 4PQHA 2KLXA 4XS4A 3IHQA 1PSQA 3WGEA 4WR5A 3WGXA 4YQVA 3ZMLA 3A2VA 2OT3A 5CYYA 1R4WA 1YKCA 3TJJA 4TXVA 4I6XA 3F3RA 2OE3A 2HI7A 3VI7A 5ECIB 3HXSA 1M2DA 2IL3A 4K8MA 2R37A 3ERFA 1F6MC 5J3RA 3EVIA 4OMVA 2OBIA 3MIXA 5B8BA 1T00A 1SK1A 2B7JA 4XS4B 4ILFA 2VAFA 2ALBA 3KM6A 1SVMA 3GRXA 1GTIA 2PGTA 3N5OA 2E2GA 4MH3A 3QFBC 4O7HA 3VK9A 3HJPA 2H1DA 2WJUA 4X4JA 1OC9B 3HZ8A 4K2DA 4BVXA 3ME8A 2CA8A 4MK3A 4F0CA 2HLSA 3UVTA 3TCOA 1OAZA 2OA7A 5AIXA 5INYA 2JZTA 3M9JA 1AW9A 2HE3A 3CQFA 3NOFA 4WKWA 3BJ5A 14GSA 2GVPA 5J9CA 3GL5A 3MYDA 4HUAA 5A4WA 4G0KA 2EFCA 4LL4B 2CV4A 2MZCA 2H70A 1N25A 1EP7A 5FT3A 4EDZA 2XHFA 2K18A 3DD3A 5ELAA 1NHOA 2YJHA 4MMMA 13GSA 3I9V2 4ECBA 3DGQA 3HVSA 3C8EA 5AIVA 1O6JA 2HRNA 3D6IA 3GKNA 5JCGA 1FVJA 1EGRA 3TOTA 1QGVA 3F9UA 3V1WA 4BVXB 2PMTA 4NV2A 2B1LA 3IOSA 1GLQA 5IMFA 4PQIA 1GLPA 1FB0A 3ZVJA 2VO4A 4RQRA 4IP6A 1FB6A
chains in the Genus database with same CATH topology
3KJYA 2DIZA 3M0FA 3F4SA 3CTGA 1EZKA 2WFCA 4PUAA 1GH2A 5KN3A 3KMNA 1YEXA 4ZBDA 2CVDA 1GUKA 3GURA 5HR0A 3TKSA 2VKZG 2RUEA 3CSIA 1NHYA 4G10A 16GSA 6GSTA 2VL3A 4QL9A 3D5JA 3VURA 5ABRA 2DJKA 4MNNA 3EINA 2IIYA 1MDKA 2C3QA 2O87A 2YV7A 3LEFA 2GSQA 2JADA 2VLUA 2HSYA 5ECMB 2WB9A 3GMFA 1I9DA 4ZL7A 1SYRA 3ZIJA 5A5HA 4JE1A 2VCXA 4MH2A 2M46A 1GSEA 2WRTA 1K0BA 4JRRA 4JU5A 1SL1B 4POMA 4KSOA 1XIYA 1BF5A 3WGDA 2VM1A 5GSSA 1TU8A 1R7HA 2MBTA 1YKAA 1SJ6A 3FEUA 2WULA 3PPUA 1GSSA 1MD3A 4WBRD 17GSA 1W4VA 3KH7A 2K9FA 3HVVA 5DDLA 3A2XA 1C72A 4KCEA 3ZLPA 4PUFC 1TI3A 4I8BA 2REMA 3H1NA 4GSNA 1DSBA 2BTOT 4WETA 1VF3A 4PQ1A 5HR2A 2IMKA 1B4QA 2TRXA 4NMUA 2GSRA 1QMVA 2XBIA 2F8FA 2ZNMA 5DJMA 1OKTA 3VWUA 3W8JA 2DMMA 1VGLA 1WOUA 4ML6A 3NIVA 2F9SA 4HQSA 2VL9A 3A5IA 2DC5A 3TJBA 5FHIA 2DBCA 2N5FA 4Q5FA 2GQLA 4XIHA 3ZFLA 3UBLA 3IDVA 1K0CA 1FOVA 1H4OA 4MF6A 5A1NA 4CW9A 5B7CA 1S3CA 4LLRA 3ME7A 2AHEA 3GIXA 1TRVA 4LMWA 4EVMA 3DVWA 1XOBA 2C0DA 1XVWA 2WZ9A 2DSAA 3TKSC 3FR9A 1O7UA 5IO2A 3FY7A 1ERTA 2M80A 1USBA 4AKHA 5G31A 1V58A 2CT6A 3LYKA 5J47A 2ZCTA 2YZHA 5D9XA 5ECLB 2O7KA 2QC7A 5ECRB 1XZOA 5EL8A 5KOWA 3TKPA 2EIQA 1PX6A 4BL7A 3GKKA 2QKEA 3L9SA 6GSUA 5BMUA 3PR8A 5D9TA 5A1NB 1FO5A 1TXUA 3TJGA 2FLSA 3H93A 1BG5A 2NBSA 3IXRA 4W66A 3I6AA 3LQ7A 1PKZA 4G19A 1G6WA 2YPMA 5ENUA 1JZRA 2Z9SA 4V1Ap 1PA3A 5JCWA 5CRWA 1RK4A 1X9SB 2ON5A 1FG4A 2V1MA 3TKRA 3QDNA 4DSQA 4FQUA 3KTLA 4N11A 5GAND 3EYTA 5ECSA 5ECQB 5CP1A 1A2MA 1ON4A 3HYPA 3LORA 2H72A 3ZRDA 4L0WA 4BL7B 1KBNA 1Z5YE 8GSSA 3HZ4A 2H6ZA 1WIKA 1SL0B 2YANA 5J4YA 2XC2A 4GLTA 2HQTA 1EEMA 4ACSA 3IV4A 5IMDA 4CHSA 1FHEA 4X0XA 3O76A 2RM5A 1WRYA 2I4AA 2WDUA 1M7TA 1M99A 2CZ2A 3UVHA 2GLRA 2YJ7A 3N9JA 1O8XA 3M1GA 1TK8B 1A8YA 2JACA 3GX8A 5CO3A 1GSQA 3TOUA 1Z6MA 3ZZXA 4F03A 3HA9A 1JZDA 3HJOA 1ILOA 3HD5A 5F05A 1X5EA 1KEBA 3FMWA 2O85A 5IIZA 4IN0A 4LL1B 2V41A 3S9FA 5G5FA 2R5GA 5AISA 2R2JA 5D8IA 4HS1A 2GSSA 3BD2A 4H86A 5HR1A 1XWCA 3TJKA 2H74A 2X8HA 3CSJA 3ZTLA 2GQKA 1F3BA 1DUGA 1RQMA 4MA9A 3CTFA 4RUVA 5DCHA 3LFLA 5HFKA 3J7Yk 2H1AA 1K0OA 3GN3A 1JHBA 4ZB8A 2CQ9A 4JR6A 3BOAA 3UBKA 1BAYA 3I43A 4WBJA 4IS0A 4IQ1A 4HQZA 2I81A 2J9HA 2AJQB 4KF9A 1JZOA 1PGTA 1NM3A 4TR1A 2R0CA 4D73A 2GT5A 2JZSA 5JCUA 3E3EA 3FK8A 3W6GA 2K8VA 2RM6A 4QMKA 4N10A 2VCQA 2JU5A 4E68A 1LU4A 1U87A 3F4RA 5F07A 4BPYA 2O89A 1EOGA 2R3XA 3GH9A 3E0UA 2N5AA 4LMVA 1ZYQB 1NSWA 4MF7A 3VI5A 4HDEA 2LRTA 2B3SA 4TN8A 2L5OA 2HSNA 1ZL9A 2ON7A 2LRCA 2LV3A 1GUMA 1QFNA 1SJZA 1OC8A 4HU7A 2VCTA 2DJ2A 5A34A 1B8XA 2DJ0A 4ICYA 2MMZA 2HRFA 3TKQA 3Q19A 1VF2A 2VLVA 5B6NA 2FUG2 2O5VA 1VF1A 1EV4A 2GTUA 3MNGA 1F3AA 2GZPA 2V6OA 2C1YA 2GGTA 4G9HA 3F3QA 1OKDA 3CWGA 3VWVA 5JWRB 2C3TA 4TR0A 5H5SA 1X9MB 6GSWA 4JZQA 2K6VA 4PNFA 1T8EB 6GSSA 1MEKA 1M2BA 3TRXA 2YNXA 1ERUA 2HSNB 3IR4A 1OC9A 2X8GA 4F0BA 1ZGNA 1ERVA 2H1GA 3U6VA 3GSTA 4ECCA 1LBKA 2X49A 3SWLA 1CQHA 5A34B 1KTEA 1PRXA 1B9YC 5CRDA 1E6BA 2H1LA 4AI6A 2LEGA 2QA1A 2R4VA 1OVNA 1UVZA 5DALA 4ZILA 3H79A 3APSA 3FKFA 1SK0A 2H6XA 2IJYA 1AAZA 5EVOA 5KN2A 3K8NA 4G0LA 3HKRA 1V98A 2XPEA 2AB6A 1O8WA 5J41A 19GSA 2HSMA 1JLVA 3VPTA 3TB2A 2FWEA 5F8BA 1HNAA 1GNWA 5LCZA 3ZREA 2WCIA 4DSRA 3UARA 4EDYA 1UC7A 4GXZA 5DVBA 4EKZA 2E2MA 2JL4A 2H0GA 1BG1A 4MPFA 1EEJA 1K3OA 1PMTA 3P7XA 5DALB 1WWJA 1U3AA 1THXA 3MDKA 3L0HA 2FWGA 2B5XA 5IQYA 4HJMA 2MMAA 4Z2UA 3GUSA 1V2AA 1N8JA 1XWAA 2YV9A 1XCCA 5C04A 2VD1A 2O8VB 1DE1A 5G30A 4O32A 4FYUA 1YJ6A 4RQXA 2HSMB 1ST9A 2FA4A 2A2PA 1OE8A 1BJXA 4IJ3A 2A4VA 2C0EA 1GSDA 4NHZA 1BEDA 4CY6A 4EC0A 1A8LA 2YWNA 1ML6A 2PU9C 5DQYA 2IMIA 3KZQA 3DIEA 2HZFA 3Q18A 5D96A 4L8EA 3UMAA 1B4PA 1ZOFA 3VPQA 1ZMAA 2RUFA 4POBA 4NV5A 5G2ZA 3QAVA 4Q5NA 1TRSA 3LJRA 5F06A 3QAWA 4MJCA 1SKRB 1V9WA 3ZFBA 1YVLA 1GP1A 3RPPA 1AQVA 1U3IA 2DLXA 4HU9A 4ECJA 1GWCA 4YKGA 5DCGA 5E59A 10GSA 3NZNA 4G2EA 2VL2A 5D93A 3O6TA 1FVKA 3PH9A 4ZXGA 2KUCA 3APOA 3TRQA 2C80A 4AF2A 2HT9A 4KX4A 4XHMA 2RLIA 2DKHA 2CX3A 4XS1A 3WD6A 1WJKA 1GRXA 1TRUA 4AJ6A 1XW5A 2DJJA 3M3MA 4O5UA 3G7IA 4ZBBA 2LRNA 4XCSA 9GSSA 4AKGA 2V6KA 1GL8A 3I69A 3C7MA 4OD7A 1GUHA 3AY8A 1YEPA 4JEDA 1XFLA 3CSHA 4MLYA 4N3ZA 4L5OA 1GSUA 1M2AA 4KE3A 4XRDA 3WT1A 1URMA 2KP2A 4N30A 4XTSA 6GSXA 3GYKA 4TRXA 1GTUA 2C0GA 2C3NA 1A0FA 2P31A 2LUSA 4X1UA 5KOXA 4GTUA 2B6MA 5LD0A 1Z6NA 2YZUA 3D4TA 4AJ7A 3JCML 3UJ1A 2LKUA 2OACA 3KGKA 2D2ZA 2EFDA 4MJAA 1MDIA 1SVOA 2V32A 3A3TA 4P3YB 3ZIVA 4O5QA 2EFHA 5BRTA 5AN1A 2H1BA 1MD4A 5IPGA 1HNCA 4ZIJA 2X64A 1A23A 1T1VA 3IAM2 5AGYA 5IMCA 3DWVA 3FR6A 3ED3A 3R3EA 5DJLA 1A24A 4J56E 4PX1A 1QUWA 1BYEA 2VIMA 2EC4A 1AQWA 4GSTA 3FYGA 3IAS2 3GKXA 4KAEA 2IMEA 1HNBA 5H5QA 2VL2C 1BX9A 4EL1A 5ECOB 4QQ7A 2OADA 1QXHA 2FCHA 1YQ1A 1PL2A 2DMLA 3IA1A 3GTUA 4MJEA 3DVXA 3D0ZA 1SJIA 4FO5A 1XW6A 3KTBA 1TK5B 4EF0A 2OE0A 3C1RA 5HFIA 2EIOA 3J7Yb 2AAWA 2H01A 4K7NA 3EURA 3G7JA 2HNLA 3RHBA 1MDJA 1F37A 2L4CA 3US3A 2IMFA 5ECKB 1E2YA 4Q5RA 2KHPA 1Y1UA 2R0GA 4J2FA 2G2QA 3GX0A 3KCMA 2LJAA 1UN2A 2WS2A 3UAPA 3ZYWA 1YZXA 3CXGA 3GTUB 1GULA 2P5QA 1FAAA 2VOCA 4Z2TA 4KW6A 1AUCA 3KXOA 4KNDA 1T4YA 2H66A 1TI1A 4KDUA 1Q98A 5C00A 2LSTA 5B6MA 4TR3A 1SK2A 2B1KA 1XW9A 1U6TA 1K0NA 3GL3A 3TRPA 2PN8A 3MAKA 1RW1A 1ZYEA 4GWRA 1J0FA 4ML1A 1ACVA 3H8QA 5A4UA 3IK9A 1PD21 5J40A 2GZZA 5GSTA 1B48A 3H4KA 5D9VA 4Z2RA 2XBQA 1I5GA 4ZL8A 5KEJA 4YH2A 1TU7A 2OKAA 1YF0A 3IPZA 3IBHA 5IPHA 2H19A 4K7OA 3FZAA 4GSSA 1ERWA 5CRGA 4G01A 3HY2A 1A0RP 4KSMA 2VM2A 2LS5A 1AIUA 3EU4A 4F9ZA 3F6DA 4KGIA 3ISOA 1X5CA 4AKIA 4RI6A 4IJIA 4LA1A 4PGTA 2V2GA 3IE3A 2L6CA 4L0UA 4OCEA 4PTSA 4GRFA 4EIQA 2G0FA 2DKIA 4WEYA 5JWOB 4IVFA 4ULXA 2KOKA 3GSSA 1V57A 1XWBA 2E0QA 1X9WB 2C8UA 1Y6EA 4KH7A 1J9BA 2HSHA 3LW9A 2MBSA 3LSZA 1PN9A 3CMIA 3D4MA 1G6YA 4OO5A 1PL1A 2A2RA 2GS3A 3OR5A 4K0GA 4FIWA 1CQGA 3RHCA 4V1Ag 4MF5A 4CDOA 5EY6A 5DQSA 2ES7A 3QR6A 2IMDA 1XOAA 4YQMA 3U5RE 4EIPA 3GKMA 3QOUA 4YQUA 5GZZB 1QK8A 2DJ1A 2H0IA 5IMZA 3HJMA 2N5BA 3A2WA 4MDCA 3D21A 5DBQA 3ZMKA 2FD3A 1J08A 2A2SA 4K0NA 4PXOA 4MZBA 2L57A 3DRNA 3FZ5A 4IBPA 1O81A 1OC3A 4PURA 3L9VA 2ZUPA 1K0AA 1YDKA 3C73A 4QL7A 1AC1A 2PBJA 3CBUA 3QAGA 2KP1A 3TU3B 3HHVA 2VD0A 4I97A 4K5RA 4EUYA 3CYNA 4I2TA 4KA0A 3TUEA 5FWGA 1K3YA 1SU9A 5HFGA 3C71A 11GSA 2VCZA 4K7IA 4V2LA 3GV1A 2FHEA 2F8AA 1UA5A 3PINA 4V2MA 3KH9A 3DXBA 3F0IA 1GSFA 4ZB7A 1SVLA 1T7PB 2I3YA 3APQA 6GSYA 2L59A 3BCIA 1O73A 5ECPB 2P5RA 2HFDA 1SKSB 4KUNA 4MZCA 1HYUA 1W89A 1YY7A 1HD2A 2IN3A 5KN1A 2M72A 3KEBA 3G7YA 1GTAA 2JSZA 4JR4A 3LYPA 2AV4A 1PKWA 3FZ9A 1ZYNA 4OCFA 4OWYA 4A5PA 2B5YA 3KP8A 5ID2A 1X5DA 1K0MA 4J57E 3LXZA 1JFUA 3D22A 4IGJA 4YKFA 2L4QA 1F9MA 2YOIA 4EO3A 2H76A 1EWXA 4I5QA 5HR3A 3RBTA 2LJKA 3FR3A 1ABAA 2H75A 3WT2A 4GDFA 1Q4JA 1Y25A 5B8AA 1S3AA 1V40A 3TKSE 3IHGA 1AQXA 2B7KA 4K1FA 2JZRA 5EPFA 3LGCA 1GNEA 4HEA2 1XWKA 3ERGA 3RDWA 4E8HA 2GQMA 2FWHA 4USSA 1XXUA 3L78A 3P8WA 4L5LA 3MWHA 3VLNA 4TKYA 2EIRA 4HZ2A 5J9BA 2B5EA 2L5LA 2UV8G 1O85A 4BA7A 4OFNA 3C1SA 5G1KA 3EC3A 5ID2B 4HOJA 5J4VA 4JBBA 4YAVA 1G0TA 3QPMA 2IFQA 1BQ7A 2X99A 3GNJA 3Q74A 2FNOA 2GT6A 4XRAA 2X4AA 3F8UA 1R26A 2CVBA 5IM9A 2GZYA 2TRCP 4RI7A 4ZB6A 4G0IA 2GDRA 4TW5A 1TOFA 2E7PA 3O3TA 4OFTA 2LNTA 1XPVA 1R5AA 4DEJA 4MJBA 3VWWA 2HYXA 2LTKA 3DKSA 4K6XA 4OFMA 2QSIA 2NTOA 1SENA 5CNWA 3EPTA 2F51A 1K3LA 4F2IA 3HDCA 1X0RA 1ZCPA 2K8SA 2X8CA 1XBSA 2YWOA 2IFQB 2MMOA 1TKDB 3L4NA 1T3BA 2IPAA 2FY6A 5IMVA 1IYIA 3QMXA 3TGZA 5IO0A 18GSA 3W8SA 4NXIA 1VRSD 1Z3EA 1SD9A 2VLTA 2PWJA 4HI7A 2GSTA 4ECIA 3EWLA 3FZ4A 4Z7XA 1K0DA 5A4VA 3KP9A 4NHWA 3IK7A 4X43A 4E8EA 3FHKA 5IMAA 5ELGA 3R2QA 3LG6A 4TOPA 2C0FA 1HQOA 4NAXA 4ISDA 3IC8A 4WF4A 4Q5QA 5HQPA 3Q6OA 4EXJA 2PPTA 4OO4A 4KDYA 4WR4A 2YP6A 2MYGA 1JZWA 2VUPA 4BWSA 5LNKe 1S3DA 3CRUA 4POLA 2PUKC 1THOA 3QFAC 1A2LA 3L9UA 4KB3A 1TDIA 3WYWA 4N0VA 6GSVA 2PERA 1M9AA 5A5HB 2PVQA 4N0ZA 1WMJA 3F63A 3LWAA 3E9JB 3LXTA 3EU3A 4MABA 3HMJG 1WP0A 3IC4A 2JSYA 1IYHA 3UL3A 2PVOC 3EMPA 1JLWA 2F3MA 4FYCA 2HRKA 2H73A 3ZL5A 1G7EA 2YWIA 4BVYA 4YAPA 12GSA 1N2AA 3QCPA 2CVKA 2NVLA 2H71A 4DSSA 4I2UA 1Z7PA 1KNGA 4XS6A 4ZB9A 3RPNA 2HZEA 2FA8A 1GSYA 2BMXA 1TP9A 2H0HA 5G5EA 4IELA 2CZ3A 3ZITA 2DJ3A 1GTBA 2I1UA 4POKA 2OJLA 4IKHA 2OE1A 4MCUA 1FW1A 2LJRA 5G1LA 1SD8A 4HZ4A 1WPIA 1M9BA 4IHUA 4TVEA 4FH8A 5D73A 4KDXA 4EE0A 4KCAA 3RAZA 2HRKB 4GCIA 4ID0A 3GHAA 4BVYB 22GSA 2FGXA 2J23A 4MPGA 1PQNA 1B9XC 1TTZA 4O92A 4IP1A 1R5PA 1ZZYA 4DSSB 1MTCA 3MSZA 2LQOA 1SYXA 2HZEB 2CX4A 2AYTA 1FOHA 2AUVA 1SL2B 2H30A 1M0UA 3ERWA 3HCZA 5GAPD 2CAQA 5BMUB 5CAXA 1Z9HA 2LQQA 2YCDA 3G9BA 1PX7A 5F0GA 2QGVA 4AKXB 2WGRA 5IOXA 4TR4A 4MP4A 3P2AA 1OYJA 4DVCA 1XVQA 2R0PA 4WF5A 2P0GA 2IWTA 1OE7A 1NW2A 3M8NA 4MZWA 3SBCA 3F6FA 5COHA 1EOHA 2EFEA 2YN1A 3A5WA 3QD9A 4CY8A 4GF0A 20GSA 1QQ2A 2TIRA 4FYBA 1ZYPA 3IRAA 5J5NA 2NPBA 3UOMA 3GA4A 1TJDA 5KN0A 3HVXA 3PGTA 4HJ2A 4AJ8A 4PNGA 4F82A 1SKWB 1EP8A 4AGSA 5L71A 1TXXA 1H75A 4O5RA 2I9HA 3VFIA 4ZL9A 3CRTA 2HRAA 3BCKA 2LNSA 4IQAA 4ZBAA 5JWQB 2R6KA 3TJFA 3DYRA 1TW9A 2BJXA 3GH6A 2CAIA 1A2JA 1Z7RA 4IW9A 1T4ZA 3FRCA 1F2EA 1TRWA 2UZ8A 2A4HA 1YF1A 2DIYA 1PN0A 2HXKA 2MMNA 1AXDA 5E4WA 4NWYA 2XPDA 1LJRA 2L6DA 2RIIA 3P90A 2NDOA 4TXOA 5CREA 2VCVA 1EGOA 3DMLA 1XWGA 4NPBA 4GQFA 3GFKA 5DAKA 2VCWA 3M9KA 2FWFA 3BBYA 3KMOA 4K9ZA 3EMXA 4BWQA 1EV9A 1WE0A 5J4UA 4V2NA 3F4TA 1TK0B 3ZVJD 4WXTA 2QA2A 1U88A 2H6YA 5CRHA 5A5KA 2OBKA 5ECNB 3UIWA 5IOWA 5H5RA 3FW2A 4K2XA 1DBYA 3KD0A 2YWMA 3EE2A 3UEMA 3KIJA 5ECHB 1VF4A 4TXOB 1DE2A 4TR1B 4D73B 7GSSA 4GQCA 2C4JA 5D9WA 4K5SA 3TDGA 5DAKB 1G7OA 2H8LA 3DEXA 3VWXA 4PQHA 2KLXA 4XS4A 3IHQA 1PSQA 3WGEA 4WR5A 3WGXA 4YQVA 3ZMLA 3A2VA 2OT3A 5CYYA 1R4WA 1YKCA 3TJJA 4TXVA 4I6XA 3F3RA 2OE3A 2HI7A 3VI7A 5ECIB 3HXSA 1M2DA 2IL3A 4K8MA 2R37A 3ERFA 1F6MC 5J3RA 3EVIA 4OMVA 2OBIA 3MIXA 5B8BA 1T00A 1SK1A 2B7JA 4XS4B 4ILFA 2VAFA 2ALBA 3KM6A 1SVMA 3GRXA 1GTIA 2PGTA 3N5OA 2E2GA 4MH3A 3QFBC 4O7HA 3VK9A 3HJPA 2H1DA 2WJUA 4X4JA 1OC9B 3HZ8A 4K2DA 4BVXA 3ME8A 2CA8A 4MK3A 4F0CA 2HLSA 3UVTA 3TCOA 1OAZA 2OA7A 5AIXA 5INYA 2JZTA 3M9JA 1AW9A 2HE3A 3NOFA 4WKWA 3BJ5A 14GSA 2GVPA 5J9CA 3GL5A 3MYDA 4HUAA 5A4WA 4G0KA 2EFCA 4LL4B 2CV4A 2MZCA 2H70A 1N25A 1EP7A 5FT3A 4EDZA 2XHFA 2K18A 3DD3A 5ELAA 1NHOA 2YJHA 4MMMA 13GSA 3I9V2 4ECBA 3DGQA 3HVSA 3C8EA 5AIVA 1O6JA 2HRNA 3D6IA 3GKNA 5JCGA 1FVJA 1EGRA 3TOTA 1QGVA 3F9UA 3V1WA 4BVXB 2PMTA 4NV2A 2B1LA 3IOSA 1GLQA 5IMFA 4PQIA 1GLPA 1FB0A 3ZVJA 2VO4A 4RQRA 4IP6A 1FB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJY A;  2DIZ A;  3M0F A;  3F4S A;  3CTG A;  1EZK A;  2WFC A;  4PUA A;  1GH2 A;  5KN3 A;  3KMN A;  1YEX A;  4ZBD A;  2CVD A;  1GUK A;  3GUR A;  5HR0 A;  3TKS A;  2RUE A;  3CSI A;  1NHY A;  4G10 A;  16GS A;  6GST A;  2VL3 A;  4QL9 A;  3D5J A;  3VUR A;  5ABR A;  2DJK A;  3EIN A;  2IIY A;  1MDK A;  2C3Q A;  2O87 A;  2YV7 A;  3LEF A;  2GSQ A;  2JAD A;  2VLU A;  2HSY A;  5ECM B;  2WB9 A;  3GMF A;  1I9D A;  4ZL7 A;  1SYR A;  3ZIJ A;  4JE1 A;  2VCX A;  4MH2 A;  2M46 A;  1GSE A;  2WRT A;  1K0B A;  4JRR A;  4JU5 A;  1SL1 B;  4POM A;  4KSO A;  1XIY A;  3WGD A;  2VM1 A;  5GSS A;  1TU8 A;  1R7H A;  2MBT A;  1YKA A;  1SJ6 A;  3FEU A;  2WUL A;  3PPU A;  1GSS A;  1MD3 A;  4WBR D;  17GS A;  1W4V A;  3KH7 A;  2K9F A;  3HVV A;  5DDL A;  3A2X A;  1C72 A;  4KCE A;  3ZLP A;  4PUF C;  1TI3 A;  4I8B A;  2REM A;  3H1N A;  4GSN A;  1DSB A;  2BTO T;  4WET A;  1VF3 A;  4PQ1 A;  5HR2 A;  2IMK A;  1B4Q A;  2TRX A;  4NMU A;  2GSR A;  1QMV A;  2XBI A;  2F8F A;  2ZNM A;  5DJM A;  1OKT A;  3VWU A;  3W8J A;  2DMM A;  1VGL A;  1WOU A;  4ML6 A;  3NIV A;  2F9S A;  4HQS A;  2VL9 A;  2DC5 A;  3TJB A;  5FHI A;  2DBC A;  2N5F A;  4Q5F A;  2GQL A;  4XIH A;  3ZFL A;  3UBL A;  3IDV A;  1K0C A;  1FOV A;  1H4O A;  4MF6 A;  4CW9 A;  5B7C A;  1S3C A;  4LLR A;  3ME7 A;  2AHE A;  3GIX A;  1TRV A;  4LMW A;  4EVM A;  3DVW A;  1XOB A;  2C0D A;  1XVW A;  2WZ9 A;  2DSA A;  3TKS C;  3FR9 A;  1O7U A;  5IO2 A;  3FY7 A;  1ERT A;  2M80 A;  1USB A;  5G31 A;  1V58 A;  2CT6 A;  3LYK A;  2ZCT A;  2YZH A;  5D9X A;  5ECL B;  2O7K A;  2QC7 A;  5ECR B;  1XZO A;  5EL8 A;  3TKP A;  2EIQ A;  1PX6 A;  4BL7 A;  3GKK A;  2QKE A;  3L9S A;  6GSU A;  5BMU A;  3PR8 A;  5D9T A;  1FO5 A;  3TJG A;  2FLS A;  3H93 A;  1BG5 A;  2NBS A;  3IXR A;  3I6A A;  3LQ7 A;  1PKZ A;  4G19 A;  1G6W A;  2YPM A;  5ENU A;  1JZR A;  2Z9S A;  4V1A p;  1PA3 A;  5JCW A;  5CRW A;  1RK4 A;  1X9S B;  2ON5 A;  1FG4 A;  2V1M A;  3TKR A;  3QDN A;  4DSQ A;  4FQU A;  3KTL A;  4N11 A;  5GAN D;  3EYT A;  5ECS A;  5ECQ B;  5CP1 A;  1A2M A;  1ON4 A;  3HYP A;  3LOR A;  2H72 A;  3ZRD A;  4L0W A;  4BL7 B;  1KBN A;  1Z5Y E;  8GSS A;  3HZ4 A;  2H6Z A;  1WIK A;  1SL0 B;  2YAN A;  2XC2 A;  4GLT A;  2HQT A;  1EEM A;  4ACS A;  3IV4 A;  5IMD A;  4CHS A;  1FHE A;  4X0X A;  3O76 A;  2RM5 A;  1WRY A;  2I4A A;  2WDU A;  1M7T A;  1M99 A;  2CZ2 A;  3UVH A;  2GLR A;  2YJ7 A;  3N9J A;  1O8X A;  3M1G A;  1TK8 B;  1A8Y A;  2JAC A;  3GX8 A;  5CO3 A;  1GSQ A;  3TOU A;  1Z6M A;  3ZZX A;  4F03 A;  3HA9 A;  1JZD A;  3HJO A;  1ILO A;  3HD5 A;  5F05 A;  1X5E A;  1KEB A;  5IIZ A;  2O85 A;  4IN0 A;  4LL1 B;  2V41 A;  3S9F A;  5G5F A;  2R5G A;  5AIS A;  2R2J A;  5D8I A;  4HS1 A;  2GSS A;  4H86 A;  3BD2 A;  5HR1 A;  1XWC A;  3TJK A;  2H74 A;  2X8H A;  3CSJ A;  3ZTL A;  2GQK A;  1F3B A;  1DUG A;  1RQM A;  4MA9 A;  3CTF A;  4RUV A;  5DCH A;  3LFL A;  5HFK A;  3J7Y k;  2H1A A;  1K0O A;  3GN3 A;  1JHB A;  4ZB8 A;  2CQ9 A;  4JR6 A;  3BOA A;  3UBK A;  1BAY A;  3I43 A;  4WBJ A;  4IS0 A;  4IQ1 A;  4HQZ A;  2I81 A;  2J9H A;  2AJQ B;  4KF9 A;  1JZO A;  1PGT A;  1NM3 A;  4TR1 A;  4D73 A;  2GT5 A;  2JZS A;  5JCU A;  3E3E A;  3FK8 A;  3W6G A;  2K8V A;  2RM6 A;  4N10 A;  2VCQ A;  2JU5 A;  1LU4 A;  1U87 A;  3F4R A;  5F07 A;  4BPY A;  2O89 A;  1EOG A;  2R3X A;  3GH9 A;  3E0U A;  2N5A A;  4LMV A;  1ZYQ B;  1NSW A;  4MF7 A;  3VI5 A;  4HDE A;  2LRT A;  2B3S A;  4TN8 A;  2L5O A;  1ZL9 A;  2ON7 A;  2LRC A;  2LV3 A;  1GUM A;  1QFN A;  1SJZ A;  1OC8 A;  4HU7 A;  2VCT A;  2DJ2 A;  1B8X A;  2DJ0 A;  2MMZ A;  2HRF A;  3TKQ A;  3Q19 A;  1VF2 A;  2VLV A;  5B6N A;  2FUG 2;  1VF1 A;  1EV4 A;  2GTU A;  3MNG A;  1F3A A;  2GZP A;  2V6O A;  2C1Y A;  2GGT A;  4G9H A;  3F3Q A;  1OKD A;  3VWV A;  5JWR B;  2C3T A;  4TR0 A;  5H5S A;  1X9M B;  6GSW A;  4JZQ A;  2K6V A;  4PNF A;  1T8E B;  6GSS A;  1MEK A;  1M2B A;  3TRX A;  2YNX A;  1ERU A;  2HSN B;  3IR4 A;  1OC9 A;  2X8G A;  4F0B A;  1ZGN A;  1ERV A;  2H1G A;  3U6V A;  3GST A;  4ECC A;  1LBK A;  3SWL A;  1CQH A;  1KTE A;  1PRX A;  1B9Y C;  5CRD A;  1E6B A;  2LEG A;  2R4V A;  1OVN A;  1UVZ A;  5DAL A;  4ZIL A;  3H79 A;  3APS A;  3FKF A;  1SK0 A;  2H6X A;  2IJY A;  1AAZ A;  5EVO A;  5KN2 A;  3K8N A;  4G0L A;  3HKR A;  1V98 A;  2XPE A;  2AB6 A;  1O8W A;  5J41 A;  19GS A;  2HSM A;  1JLV A;  3VPT A;  3TB2 A;  2FWE A;  5F8B A;  1HNA A;  1GNW A;  5LCZ A;  3ZRE A;  2WCI A;  4DSR A;  3UAR A;  4EDY A;  1UC7 A;  4GXZ A;  5DVB A;  4EKZ A;  2E2M A;  2JL4 A;  2H0G A;  4MPF A;  1EEJ A;  1K3O A;  1PMT A;  3P7X A;  5DAL B;  1WWJ A;  1U3A A;  1THX A;  3MDK A;  3L0H A;  2FWG A;  2B5X A;  5IQY A;  4HJM A;  2MMA A;  3GUS A;  1V2A A;  1N8J A;  1XWA A;  2YV9 A;  1XCC A;  5C04 A;  2VD1 A;  2O8V B;  1DE1 A;  5G30 A;  4O32 A;  4FYU A;  1YJ6 A;  4RQX A;  2HSM B;  1ST9 A;  2FA4 A;  1OE8 A;  1BJX A;  4IJ3 A;  2A4V A;  2C0E A;  1GSD A;  4NHZ A;  1BED A;  4EC0 A;  1A8L A;  2YWN A;  1ML6 A;  2PU9 C;  5DQY A;  2IMI A;  3KZQ A;  3DIE A;  2HZF A;  3Q18 A;  5D96 A;  4L8E A;  3UMA A;  1B4P A;  1ZOF A;  3VPQ A;  1ZMA A;  2RUF A;  4POB A;  4NV5 A;  5G2Z A;  3QAV A;  4Q5N A;  1TRS A;  3LJR A;  5F06 A;  3QAW A;  4MJC A;  1SKR B;  1V9W A;  3ZFB A;  1GP1 A;  3RPP A;  1AQV A;  1U3I A;  2DLX A;  4HU9 A;  4ECJ A;  1GWC A;  5DCG A;  5E59 A;  10GS A;  3NZN A;  4G2E A;  2VL2 A;  5D93 A;  3O6T A;  1FVK A;  3PH9 A;  4ZXG A;  2KUC A;  3APO A;  3TRQ A;  2C80 A;  4AF2 A;  2HT9 A;  4KX4 A;  4XHM A;  2RLI A;  2CX3 A;  4XS1 A;  3WD6 A;  1WJK A;  1GRX A;  1TRU A;  4AJ6 A;  1XW5 A;  2DJJ A;  3M3M A;  3G7I A;  4ZBB A;  2LRN A;  4XCS A;  9GSS A;  2V6K A;  1GL8 A;  3I69 A;  3C7M A;  4OD7 A;  1GUH A;  3AY8 A;  1YEP A;  4JED A;  1XFL A;  3CSH A;  4MLY A;  4L5O A;  1GSU A;  1M2A A;  4KE3 A;  4XRD A;  3WT1 A;  1URM A;  2KP2 A;  4N30 A;  4XTS A;  6GSX A;  3GYK A;  4TRX A;  1GTU A;  2C0G A;  2C3N A;  1A0F A;  2P31 A;  2LUS A;  4X1U A;  4GTU A;  2B6M A;  5LD0 A;  1Z6N A;  2YZU A;  3D4T A;  4AJ7 A;  3JCM L;  3UJ1 A;  2LKU A;  2OAC A;  3KGK A;  2D2Z A;  4MJA A;  1MDI A;  2V32 A;  3A3T A;  4P3Y B;  3ZIV A;  5AN1 A;  2H1B A;  1MD4 A;  5IPG A;  1HNC A;  4ZIJ A;  2X64 A;  1A23 A;  1T1V A;  3IAM 2;  5AGY A;  5IMC A;  3DWV A;  3FR6 A;  3ED3 A;  3R3E A;  5DJL A;  1A24 A;  4J56 E;  4PX1 A;  1QUW A;  1BYE A;  2VIM A;  2EC4 A;  1AQW A;  4GST A;  3FYG A;  3IAS 2;  3GKX A;  4KAE A;  2IME A;  1HNB A;  5H5Q A;  2VL2 C;  1BX9 A;  4EL1 A;  5ECO B;  4QQ7 A;  2OAD A;  1QXH A;  2FCH A;  1YQ1 A;  1PL2 A;  2DML A;  3IA1 A;  3GTU A;  4MJE A;  3DVX A;  3D0Z A;  1SJI A;  4FO5 A;  1XW6 A;  3KTB A;  1TK5 B;  4EF0 A;  2OE0 A;  3C1R A;  5HFI A;  2EIO A;  3J7Y b;  2AAW A;  2H01 A;  4K7N A;  3EUR A;  3G7J A;  2HNL A;  3RHB A;  1MDJ A;  1F37 A;  2L4C A;  3US3 A;  2IMF A;  5ECK B;  1E2Y A;  4Q5R A;  2KHP A;  4J2F A;  2G2Q A;  3GX0 A;  3KCM A;  2LJA A;  1UN2 A;  2WS2 A;  3UAP A;  3ZYW A;  1YZX A;  3CXG A;  3GTU B;  1GUL A;  2P5Q A;  1FAA A;  2VOC A;  4KW6 A;  1AUC A;  3KXO A;  4KND A;  1T4Y A;  2H66 A;  1TI1 A;  4KDU A;  1Q98 A;  5C00 A;  2LST A;  5B6M A;  4TR3 A;  1SK2 A;  2B1K A;  1XW9 A;  1U6T A;  1K0N A;  3GL3 A;  3TRP A;  2PN8 A;  3MAK A;  1RW1 A;  1ZYE A;  4GWR A;  1J0F A;  4ML1 A;  1ACV A;  3H8Q A;  5A4U A;  3IK9 A;  1PD2 1;  2GZZ A;  5GST A;  1B48 A;  3H4K A;  5D9V A;  2XBQ A;  1I5G A;  4ZL8 A;  5KEJ A;  4YH2 A;  1TU7 A;  2OKA A;  1YF0 A;  3IPZ A;  3IBH A;  5IPH A;  2H19 A;  4K7O A;  3FZA A;  4GSS A;  1ERW A;  5CRG A;  3HY2 A;  1A0R P;  4KSM A;  2VM2 A;  2LS5 A;  1AIU A;  3EU4 A;  4F9Z A;  3F6D A;  4KGI A;  3ISO A;  1X5C A;  4RI6 A;  4IJI A;  4LA1 A;  4PGT A;  2V2G A;  3IE3 A;  2L6C A;  4L0U A;  4OCE A;  4PTS A;  4GRF A;  2G0F A;  4WEY A;  5JWO B;  4IVF A;  4ULX A;  2KOK A;  3GSS A;  1V57 A;  1XWB A;  2E0Q A;  1X9W B;  2C8U A;  1Y6E A;  4KH7 A;  1J9B A;  2HSH A;  2MBS A;  3LSZ A;  1PN9 A;  3CMI A;  3D4M A;  1G6Y A;  4OO5 A;  1PL1 A;  2A2R A;  2GS3 A;  3OR5 A;  4K0G A;  4FIW A;  1CQG A;  3RHC A;  4V1A g;  4MF5 A;  4CDO A;  5EY6 A;  5DQS A;  2ES7 A;  3QR6 A;  2IMD A;  1XOA A;  4YQM A;  3U5R E;  3GKM A;  3QOU A;  4YQU A;  5GZZ B;  1QK8 A;  2DJ1 A;  2H0I A;  5IMZ A;  3HJM A;  2N5B A;  3A2W A;  4MDC A;  3D21 A;  5DBQ A;  3ZMK A;  2FD3 A;  1J08 A;  2A2S A;  4K0N A;  4PXO A;  4MZB A;  2L57 A;  3DRN A;  3FZ5 A;  4IBP A;  1O81 A;  1OC3 A;  4PUR A;  3L9V A;  2ZUP A;  1K0A A;  1YDK A;  3C73 A;  4QL7 A;  1AC1 A;  2PBJ A;  3CBU A;  3QAG A;  2KP1 A;  3HHV A;  2VD0 A;  4I97 A;  4EUY A;  3CYN A;  4I2T A;  4KA0 A;  3TUE A;  5FWG A;  1K3Y A;  1SU9 A;  5HFG A;  3C71 A;  11GS A;  2VCZ A;  4K7I A;  4V2L A;  3GV1 A;  2FHE A;  2F8A A;  1UA5 A;  3PIN A;  4V2M A;  3KH9 A;  3DXB A;  3F0I A;  1GSF A;  1T7P B;  2I3Y A;  3APQ A;  6GSY A;  2L59 A;  3BCI A;  1O73 A;  5ECP B;  2P5R A;  2HFD A;  1SKS B;  4KUN A;  4MZC A;  1HYU A;  1W89 A;  1YY7 A;  1HD2 A;  2IN3 A;  5KN1 A;  2M72 A;  3KEB A;  3G7Y A;  1GTA A;  2JSZ A;  4JR4 A;  3LYP A;  2AV4 A;  1PKW A;  3FZ9 A;  4OCF A;  4OWY A;  2B5Y A;  3KP8 A;  5ID2 A;  1X5D A;  1K0M A;  4J57 E;  3LXZ A;  1JFU A;  3D22 A;  4IGJ A;  2L4Q A;  1F9M A;  2YOI A;  4EO3 A;  2H76 A;  1EWX A;  4I5Q A;  5HR3 A;  3RBT A;  2LJK A;  3FR3 A;  1ABA A;  2H75 A;  3WT2 A;  1Q4J A;  1Y25 A;  5B8A A;  1S3A A;  1V40 A;  3TKS E;  1AQX A;  2B7K A;  4K1F A;  2JZR A;  5EPF A;  3LGC A;  1GNE A;  4HEA 2;  1XWK A;  3ERG A;  3RDW A;  4E8H A;  2GQM A;  2FWH A;  4USS A;  1XXU A;  3L78 A;  3P8W A;  4L5L A;  3MWH A;  3VLN A;  4TKY A;  2EIR A;  4HZ2 A;  5J9B A;  2B5E A;  2L5L A;  1O85 A;  4BA7 A;  4OFN A;  3C1S A;  5G1K A;  3EC3 A;  5ID2 B;  4HOJ A;  4JBB A;  4YAV A;  1G0T A;  3QPM A;  2IFQ A;  1BQ7 A;  2X99 A;  3GNJ A;  3Q74 A;  2FNO A;  2GT6 A;  4XRA A;  3F8U A;  1R26 A;  2CVB A;  5IM9 A;  2GZY A;  2TRC P;  4RI7 A;  4ZB6 A;  4G0I A;  2GDR A;  4TW5 A;  1TOF A;  2E7P A;  3O3T A;  4OFT A;  2LNT A;  1XPV A;  1R5A A;  4DEJ A;  4MJB A;  3VWW A;  2HYX A;  2LTK A;  3DKS A;  4K6X A;  4OFM A;  2QSI A;  2NTO A;  1SEN A;  5CNW A;  2F51 A;  1K3L A;  4F2I A;  3HDC A;  1X0R A;  1ZCP A;  2K8S A;  2X8C A;  1XBS A;  2YWO A;  2IFQ B;  2MMO A;  1TKD B;  3L4N A;  1T3B A;  2IPA A;  2FY6 A;  5IMV A;  1IYI A;  3QMX A;  3TGZ A;  5IO0 A;  18GS A;  3W8S A;  4NXI A;  1VRS D;  1Z3E A;  1SD9 A;  2VLT A;  2PWJ A;  4HI7 A;  2GST A;  4ECI A;  3EWL A;  3FZ4 A;  4Z7X A;  1K0D A;  5A4V A;  3KP9 A;  4NHW A;  3IK7 A;  4X43 A;  4E8E A;  3FHK A;  5IMA A;  5ELG A;  3R2Q A;  3LG6 A;  4TOP A;  2C0F A;  1HQO A;  4NAX A;  4ISD A;  3IC8 A;  4WF4 A;  4Q5Q A;  5HQP A;  3Q6O A;  4EXJ A;  2PPT A;  4OO4 A;  4KDY A;  4WR4 A;  2YP6 A;  2MYG A;  1JZW A;  2VUP A;  4BWS A;  5LNK e;  1S3D A;  3CRU A;  4POL A;  2PUK C;  1THO A;  3QFA C;  1A2L A;  3L9U A;  4KB3 A;  1TDI A;  3WYW A;  4N0V A;  6GSV A;  2PER A;  1M9A A;  2PVQ A;  4N0Z A;  1WMJ A;  3F63 A;  3LWA A;  3E9J B;  3LXT A;  3EU3 A;  4MAB A;  1WP0 A;  3IC4 A;  2JSY A;  1IYH A;  3UL3 A;  2PVO C;  3EMP A;  1JLW A;  2F3M A;  4FYC A;  2HRK A;  2H73 A;  3ZL5 A;  1G7E A;  2YWI A;  4BVY A;  4YAP A;  12GS A;  1N2A A;  3QCP A;  2CVK A;  2NVL A;  2H71 A;  4DSS A;  4I2U A;  1Z7P A;  1KNG A;  4XS6 A;  4ZB9 A;  3RPN A;  2HZE A;  2FA8 A;  1GSY A;  2BMX A;  1TP9 A;  2H0H A;  5G5E A;  4IEL A;  2CZ3 A;  3ZIT A;  2DJ3 A;  1GTB A;  2I1U A;  4POK A;  2OJL A;  4IKH A;  2OE1 A;  4MCU A;  1FW1 A;  2LJR A;  5G1L A;  1SD8 A;  4HZ4 A;  1WPI A;  1M9B A;  4IHU A;  4TVE A;  4FH8 A;  5D73 A;  4KDX A;  4EE0 A;  4KCA A;  3RAZ A;  2HRK B;  4GCI A;  4ID0 A;  3GHA A;  4BVY B;  22GS A;  2FGX A;  2J23 A;  4MPG A;  1PQN A;  1B9X C;  1TTZ A;  4O92 A;  4IP1 A;  1R5P A;  1ZZY A;  4DSS B;  1MTC A;  2LQO A;  3MSZ A;  1SYX A;  2HZE B;  2CX4 A;  2AYT A;  2AUV A;  1SL2 B;  2H30 A;  1M0U A;  3ERW A;  3HCZ A;  5GAP D;  2CAQ A;  5CAX A;  1Z9H A;  2LQQ A;  2YCD A;  3G9B A;  1PX7 A;  5F0G A;  2QGV A;  2WGR A;  5IOX A;  4TR4 A;  4MP4 A;  3P2A A;  1OYJ A;  4DVC A;  1XVQ A;  4WF5 A;  2P0G A;  2IWT A;  1OE7 A;  1NW2 A;  3M8N A;  4MZW A;  3SBC A;  3F6F A;  5COH A;  1EOH A;  2YN1 A;  3A5W A;  3QD9 A;  4GF0 A;  20GS A;  1QQ2 A;  2TIR A;  4FYB A;  3IRA A;  5J5N A;  2NPB A;  3UOM A;  3GA4 A;  1TJD A;  5KN0 A;  3HVX A;  3PGT A;  4HJ2 A;  4AJ8 A;  4PNG A;  4F82 A;  1SKW B;  1EP8 A;  4AGS A;  5L71 A;  1TXX A;  1H75 A;  4O5R A;  2I9H A;  3VFI A;  4ZL9 A;  3CRT A;  2HRA A;  3BCK A;  2LNS A;  4IQA A;  4ZBA A;  5JWQ B;  2R6K A;  3TJF A;  3DYR A;  1TW9 A;  2BJX A;  3GH6 A;  2CAI A;  1A2J A;  1Z7R A;  4IW9 A;  1T4Z A;  3FRC A;  1F2E A;  1TRW A;  2UZ8 A;  1YF1 A;  2DIY A;  2HXK A;  2MMN A;  1AXD A;  5E4W A;  4NWY A;  2XPD A;  1LJR A;  2L6D A;  2RII A;  3P90 A;  2NDO A;  4TXO A;  5CRE A;  2VCV A;  1EGO A;  3DML A;  1XWG A;  4NPB A;  4GQF A;  3GFK A;  5DAK A;  2VCW A;  3M9K A;  2FWF A;  3BBY A;  3KMO A;  4K9Z A;  3EMX A;  4BWQ A;  1EV9 A;  1WE0 A;  5J4U A;  4V2N A;  3F4T A;  1TK0 B;  3ZVJ D;  4WXT A;  1U88 A;  2H6Y A;  5CRH A;  5A5K A;  2OBK A;  5ECN B;  3UIW A;  5IOW A;  5H5R A;  3FW2 A;  1DBY A;  3KD0 A;  2YWM A;  3EE2 A;  3UEM A;  3KIJ A;  5ECH B;  1VF4 A;  4TXO B;  1DE2 A;  4TR1 B;  4D73 B;  7GSS A;  4GQC A;  2C4J A;  5D9W A;  3TDG A;  5DAK B;  1G7O A;  2H8L A;  3DEX A;  3VWX A;  4PQH A;  2KLX A;  4XS4 A;  3IHQ A;  1PSQ A;  3WGE A;  4WR5 A;  3WGX A;  4YQV A;  3ZML A;  3A2V A;  5CYY A;  1R4W A;  1YKC A;  3TJJ A;  4TXV A;  4I6X A;  3F3R A;  2OE3 A;  2HI7 A;  3VI7 A;  5ECI B;  3HXS A;  1M2D A;  2IL3 A;  4K8M A;  2R37 A;  3ERF A;  1F6M C;  5J3R A;  3EVI A;  4OMV A;  2OBI A;  5B8B A;  1T00 A;  1SK1 A;  2B7J A;  4XS4 B;  4ILF A;  2VAF A;  2ALB A;  3KM6 A;  3GRX A;  1GTI A;  2PGT A;  3N5O A;  2E2G A;  4MH3 A;  3QFB C;  4O7H A;  3VK9 A;  3HJP A;  2H1D A;  2WJU A;  4K2D A;  1OC9 B;  3HZ8 A;  4BVX A;  3ME8 A;  2CA8 A;  4MK3 A;  4F0C A;  2HLS A;  3UVT A;  3TCO A;  1OAZ A;  2OA7 A;  5AIX A;  5INY A;  2JZT A;  3M9J A;  1AW9 A;  2HE3 A;  3NOF A;  4WKW A;  3BJ5 A;  14GS A;  2GVP A;  5J9C A;  3GL5 A;  4HUA A;  5A4W A;  4G0K A;  4LL4 B;  2CV4 A;  2MZC A;  2H70 A;  1EP7 A;  5FT3 A;  4EDZ A;  2XHF A;  2K18 A;  3DD3 A;  5ELA A;  1NHO A;  2YJH A;  4MMM A;  13GS A;  3I9V 2;  4ECB A;  3DGQ A;  3HVS A;  3C8E A;  5AIV A;  1O6J A;  2HRN A;  3D6I A;  3GKN A;  5JCG A;  1FVJ A;  1EGR A;  3TOT A;  1QGV A;  3F9U A;  3V1W A;  4BVX B;  2PMT A;  4NV2 A;  2B1L A;  3IOS A;  1GLQ A;  5IMF A;  4PQI A;  1GLP A;  1FB0 A;  3ZVJ A;  2VO4 A;  4RQR A;  4IP6 A;  1FB6 A; 
#chains in the Genus database with same CATH topology
 3KJY A;  2DIZ A;  3M0F A;  3F4S A;  3CTG A;  1EZK A;  2WFC A;  1S4B P;  4PUA A;  1GH2 A;  2WVY A;  5KN3 A;  3KMN A;  1YEX A;  4ZBD A;  2CVD A;  1GUK A;  3GUR A;  5HR0 A;  3TKS A;  1M3I A;  2VKZ G;  2RUE A;  3CSI A;  1NHY A;  4G10 A;  16GS A;  6GST A;  2VL3 A;  4QL9 A;  3D5J A;  3VUR A;  5ABR A;  2DJK A;  4MNN A;  3EIN A;  2IIY A;  1MDK A;  2C3Q A;  2O87 A;  2YV7 A;  3LEF A;  2GSQ A;  2JAD A;  2VLU A;  2HSY A;  5ECM B;  2WB9 A;  3GMF A;  1I9D A;  4ZL7 A;  1SYR A;  3ZIJ A;  5A5H A;  4JE1 A;  2VCX A;  4MH2 A;  2M46 A;  1GSE A;  2WRT A;  1K0B A;  4JRR A;  4JU5 A;  1SL1 B;  4POM A;  4KSO A;  1XIY A;  1BF5 A;  3WGD A;  2VM1 A;  5GSS A;  1TU8 A;  1R7H A;  2MBT A;  1YKA A;  1SJ6 A;  3FEU A;  2WUL A;  3PPU A;  1GSS A;  1MD3 A;  4WBR D;  17GS A;  1W4V A;  3KH7 A;  2K9F A;  3HVV A;  5DDL A;  3A2X A;  2O36 A;  1C72 A;  4KCE A;  3ZLP A;  4PUF C;  1TI3 A;  4I8B A;  2REM A;  3H1N A;  4GSN A;  1DSB A;  2BTO T;  4WET A;  2WVX A;  1VF3 A;  4PQ1 A;  5HR2 A;  2IMK A;  1B4Q A;  2TRX A;  4NMU A;  2GSR A;  1QMV A;  2XBI A;  2F8F A;  2ZNM A;  5DJM A;  1OKT A;  3VWU A;  3W8J A;  2DMM A;  1VGL A;  1WOU A;  4ML6 A;  3NIV A;  2F9S A;  4HQS A;  2VL9 A;  3CHX C;  3A5I A;  2DC5 A;  3TJB A;  5FHI A;  2DBC A;  2N5F A;  4Q5F A;  2GQL A;  4XIH A;  3ZFL A;  3UBL A;  3IDV A;  1K0C A;  1FOV A;  1H4O A;  4MF6 A;  5A1N A;  1M3J A;  4CW9 A;  5B7C A;  1S3C A;  4LLR A;  3ME7 A;  2AHE A;  3GIX A;  1I1I P;  1TRV A;  4LMW A;  4EVM A;  3DVW A;  1XOB A;  2C0D A;  1XVW A;  2WZ9 A;  2DSA A;  3TKS C;  3FR9 A;  1O7U A;  5IO2 A;  3FY7 A;  1ERT A;  2M80 A;  1USB A;  4AKH A;  5G31 A;  1V58 A;  2CT6 A;  3LYK A;  5J47 A;  2ZCT A;  2YZH A;  5D9X A;  5ECL B;  2O7K A;  2QC7 A;  5ECR B;  1XZO A;  5EL8 A;  5KOW A;  3TKP A;  2EIQ A;  1PX6 A;  4BL7 A;  3GKK A;  2QKE A;  3L9S A;  6GSU A;  5BMU A;  3PR8 A;  5D9T A;  5A1N B;  1FO5 A;  1TXU A;  3TJG A;  2FLS A;  3H93 A;  1BG5 A;  2NBS A;  3IXR A;  4W66 A;  3I6A A;  3LQ7 A;  1PKZ A;  4G19 A;  1G6W A;  2YPM A;  5ENU A;  1JZR A;  2Z9S A;  4V1A p;  1PA3 A;  5JCW A;  5CRW A;  1RK4 A;  1X9S B;  2ON5 A;  1FG4 A;  2V1M A;  3TKR A;  3QDN A;  4DSQ A;  4FQU A;  3KTL A;  4N11 A;  5GAN D;  3EYT A;  5ECS A;  5ECQ B;  5CP1 A;  1A2M A;  1ON4 A;  3HYP A;  3LOR A;  2H72 A;  3ZRD A;  4L0W A;  4BL7 B;  1KBN A;  1Z5Y E;  8GSS A;  3HZ4 A;  2H6Z A;  1WIK A;  1SL0 B;  2YAN A;  5J4Y A;  3HVN A;  2XC2 A;  4GLT A;  2HQT A;  1EEM A;  4ACS A;  3IV4 A;  5IMD A;  4CHS A;  1FHE A;  4X0X A;  3O76 A;  2RM5 A;  1WRY A;  2I4A A;  2WDU A;  1M7T A;  1M99 A;  2CZ2 A;  3UVH A;  2GLR A;  2YJ7 A;  3N9J A;  1O8X A;  3M1G A;  1TK8 B;  1A8Y A;  2JAC A;  3GX8 A;  5CO3 A;  1GSQ A;  3TOU A;  1Z6M A;  3ZZX A;  4F03 A;  3HA9 A;  1JZD A;  3HJO A;  1ILO A;  3HD5 A;  5F05 A;  1X5E A;  1KEB A;  3RGB C;  3FMW A;  2O85 A;  5IIZ A;  4IN0 A;  4LL1 B;  2V41 A;  3S9F A;  5G5F A;  2R5G A;  5AIS A;  2R2J A;  5D8I A;  4HS1 A;  2GSS A;  3BD2 A;  4H86 A;  5HR1 A;  1XWC A;  3TJK A;  2H74 A;  2X8H A;  3CSJ A;  3ZTL A;  2GQK A;  1F3B A;  1DUG A;  1RQM A;  4MA9 A;  3CTF A;  4RUV A;  5DCH A;  3LFL A;  5HFK A;  3J7Y k;  2H1A A;  1K0O A;  3GN3 A;  1JHB A;  4ZB8 A;  2CQ9 A;  4JR6 A;  3BOA A;  3UBK A;  1BAY A;  3I43 A;  4WBJ A;  4IS0 A;  4IQ1 A;  4HQZ A;  2I81 A;  2J9H A;  2AJQ B;  4KF9 A;  1JZO A;  1PGT A;  1NM3 A;  4TR1 A;  2R0C A;  4D73 A;  2GT5 A;  2JZS A;  5JCU A;  3E3E A;  3FK8 A;  3W6G A;  2K8V A;  2RM6 A;  4QMK A;  4N10 A;  2VCQ A;  2JU5 A;  4E68 A;  1LU4 A;  1U87 A;  3F4R A;  5F07 A;  4BPY A;  2O89 A;  1EOG A;  2R3X A;  3GH9 A;  3E0U A;  2N5A A;  4LMV A;  1ZYQ B;  1NSW A;  4MF7 A;  3VI5 A;  4HDE A;  2LRT A;  2B3S A;  4TN8 A;  2L5O A;  2HSN A;  1ZL9 A;  2ON7 A;  2LRC A;  2LV3 A;  1GUM A;  1QFN A;  1SJZ A;  1OC8 A;  4HU7 A;  2VCT A;  2DJ2 A;  5A34 A;  1B8X A;  2DJ0 A;  4ICY A;  2MMZ A;  2HRF A;  3TKQ A;  3Q19 A;  1VF2 A;  2VLV A;  5B6N A;  2FUG 2;  2O5V A;  1VF1 A;  1EV4 A;  2GTU A;  3MNG A;  1F3A A;  2GZP A;  2V6O A;  2C1Y A;  2GGT A;  4G9H A;  3F3Q A;  1OKD A;  3CWG A;  3VWV A;  5JWR B;  2C3T A;  4TR0 A;  5H5S A;  1X9M B;  6GSW A;  4JZQ A;  2K6V A;  4PNF A;  1T8E B;  6GSS A;  1MEK A;  1M2B A;  3TRX A;  2YNX A;  1ERU A;  2HSN B;  3IR4 A;  1OC9 A;  2X8G A;  4F0B A;  1ZGN A;  1ERV A;  2H1G A;  3U6V A;  3GST A;  4ECC A;  1LBK A;  2X49 A;  3SWL A;  1CQH A;  5A34 B;  1KTE A;  1PRX A;  1B9Y C;  5CRD A;  1E6B A;  1PFO A;  2H1L A;  4AI6 A;  2LEG A;  2QA1 A;  2R4V A;  1OVN A;  1UVZ A;  5DAL A;  4ZIL A;  3H79 A;  3APS A;  3FKF A;  1SK0 A;  2H6X A;  2IJY A;  1AAZ A;  5EVO A;  5KN2 A;  3K8N A;  4G0L A;  3HKR A;  1V98 A;  4PI2 C;  2XPE A;  2AB6 A;  1O8W A;  5J41 A;  19GS A;  2HSM A;  1JLV A;  3VPT A;  3TB2 A;  2FWE A;  5F8B A;  1HNA A;  1GNW A;  5LCZ A;  3ZRE A;  2WCI A;  4DSR A;  4PHZ C;  3UAR A;  4EDY A;  1UC7 A;  4GXZ A;  5DVB A;  4EKZ A;  2E2M A;  2JL4 A;  2H0G A;  1BG1 A;  4MPF A;  1EEJ A;  1K3O A;  1PMT A;  3P7X A;  5DAL B;  1WWJ A;  1U3A A;  1THX A;  3MDK A;  3L0H A;  2FWG A;  2B5X A;  5IQY A;  4HJM A;  2MMA A;  4Z2U A;  3GUS A;  1V2A A;  1N8J A;  1XWA A;  2YV9 A;  1XCC A;  5C04 A;  2VD1 A;  2O8V B;  1DE1 A;  5G30 A;  4O32 A;  4FYU A;  1YJ6 A;  4RQX A;  2HSM B;  1ST9 A;  2FA4 A;  2A2P A;  1OE8 A;  1BJX A;  4IJ3 A;  2A4V A;  2C0E A;  1GSD A;  4NHZ A;  1BED A;  4CY6 A;  4EC0 A;  1A8L A;  4HSC X;  2YWN A;  1ML6 A;  2PU9 C;  5DQY A;  2IMI A;  3KZQ A;  3DIE A;  2HZF A;  3Q18 A;  5D96 A;  4L8E A;  3UMA A;  1B4P A;  1ZOF A;  3VPQ A;  1ZMA A;  2RUF A;  4POB A;  4NV5 A;  5G2Z A;  3QAV A;  4Q5N A;  1TRS A;  3LJR A;  5F06 A;  3QAW A;  4MJC A;  1S3R A;  1V9W A;  1SKR B;  3ZFB A;  1YVL A;  1GP1 A;  3RPP A;  1AQV A;  1U3I A;  2DLX A;  4HU9 A;  4ECJ A;  1GWC A;  4YKG A;  5DCG A;  5E59 A;  10GS A;  3NZN A;  4G2E A;  2VL2 A;  5D93 A;  3O6T A;  1FVK A;  3PH9 A;  4ZXG A;  2KUC A;  3APO A;  3TRQ A;  2C80 A;  4AF2 A;  2HT9 A;  4KX4 A;  4XHM A;  2RLI A;  2DKH A;  2CX3 A;  4XS1 A;  3WD6 A;  1WJK A;  1GRX A;  1TRU A;  4AJ6 A;  1XW5 A;  2DJJ A;  3M3M A;  4O5U A;  3G7I A;  4ZBB A;  2LRN A;  4XCS A;  9GSS A;  4AKG A;  2V6K A;  1GL8 A;  3I69 A;  3C7M A;  4OD7 A;  1GUH A;  3AY8 A;  1YEP A;  4JED A;  1XFL A;  3CSH A;  4MLY A;  4N3Z A;  4L5O A;  1GSU A;  1M2A A;  4KE3 A;  4XRD A;  3WT1 A;  1URM A;  2KP2 A;  4N30 A;  4XTS A;  6GSX A;  3GYK A;  4TRX A;  1GTU A;  2C0G A;  3RFR C;  2C3N A;  1A0F A;  2P31 A;  2LUS A;  4X1U A;  5KOX A;  4GTU A;  2B6M A;  5LD0 A;  1Z6N A;  2YZU A;  3D4T A;  4AJ7 A;  3JCM L;  3UJ1 A;  2LKU A;  2OAC A;  3KGK A;  2D2Z A;  2EFD A;  4MJA A;  1MDI A;  1SVO A;  2V32 A;  3A3T A;  4P3Y B;  3ZIV A;  4O5Q A;  2EFH A;  5BRT A;  5AN1 A;  2H1B A;  1MD4 A;  5IPG A;  1HNC A;  4ZIJ A;  2X64 A;  1A23 A;  1T1V A;  3IAM 2;  5AGY A;  5IMC A;  3DWV A;  3FR6 A;  3ED3 A;  3R3E A;  5DJL A;  1A24 A;  4J56 E;  4PX1 A;  1QUW A;  1BYE A;  2VIM A;  2EC4 A;  1AQW A;  4GST A;  3FYG A;  3IAS 2;  3GKX A;  4KAE A;  2IME A;  1HNB A;  5H5Q A;  2VL2 C;  1BX9 A;  4EL1 A;  5ECO B;  4QQ7 A;  2OAD A;  1QXH A;  2FCH A;  1YQ1 A;  1PL2 A;  2DML A;  3IA1 A;  3GTU A;  4MJE A;  3DVX A;  3D0Z A;  1SJI A;  4FO5 A;  1XW6 A;  3KTB A;  1TK5 B;  4EF0 A;  2OE0 A;  3C1R A;  5HFI A;  2EIO A;  3J7Y b;  2AAW A;  2H01 A;  4K7N A;  3EUR A;  3G7J A;  2O3E A;  2HNL A;  3RHB A;  1MDJ A;  1F37 A;  2L4C A;  3US3 A;  2IMF A;  5ECK B;  1E2Y A;  4Q5R A;  2KHP A;  1Y1U A;  2R0G A;  4J2F A;  2G2Q A;  3GX0 A;  3KCM A;  2LJA A;  1UN2 A;  2WS2 A;  3UAP A;  3ZYW A;  1YZX A;  3CXG A;  3GTU B;  1XG8 A;  1GUL A;  2P5Q A;  1FAA A;  2VOC A;  4Z2T A;  4KW6 A;  1AUC A;  3KXO A;  4KND A;  1T4Y A;  2H66 A;  1TI1 A;  4KDU A;  1Q98 A;  5C00 A;  2LST A;  5B6M A;  4TR3 A;  1SK2 A;  2B1K A;  1XW9 A;  1U6T A;  1K0N A;  3GL3 A;  3TRP A;  2PN8 A;  3MAK A;  1RW1 A;  1ZYE A;  4GWR A;  1J0F A;  4ML1 A;  1ACV A;  3H8Q A;  5A4U A;  3IK9 A;  1PD2 1;  5J40 A;  2GZZ A;  5GST A;  1B48 A;  3H4K A;  5D9V A;  4Z2R A;  2XBQ A;  1I5G A;  4ZL8 A;  5KEJ A;  4YH2 A;  1TU7 A;  2OKA A;  1YF0 A;  3IPZ A;  3IBH A;  5IPH A;  2H19 A;  4K7O A;  3FZA A;  4GSS A;  1ERW A;  5CRG A;  4G01 A;  3HY2 A;  1A0R P;  4KSM A;  2VM2 A;  2LS5 A;  1AIU A;  3EU4 A;  4F9Z A;  3F6D A;  4KGI A;  3ISO A;  1X5C A;  4AKI A;  4RI6 A;  4IJI A;  4LA1 A;  4PGT A;  2V2G A;  3IE3 A;  2L6C A;  4L0U A;  4OCE A;  4PTS A;  4GRF A;  4EIQ A;  2G0F A;  2DKI A;  4WEY A;  2WW0 A;  5JWO B;  4IVF A;  4ULX A;  2KOK A;  3GSS A;  1V57 A;  1XWB A;  2E0Q A;  1X9W B;  2C8U A;  1Y6E A;  4KH7 A;  1J9B A;  2HSH A;  3LW9 A;  2MBS A;  3LSZ A;  1PN9 A;  4PI0 C;  3CMI A;  3D4M A;  1G6Y A;  4OO5 A;  1PL1 A;  2A2R A;  2GS3 A;  3OR5 A;  4K0G A;  4FIW A;  1CQG A;  3RHC A;  4V1A g;  4MF5 A;  4CDO A;  5EY6 A;  5DQS A;  2ES7 A;  3QR6 A;  2IMD A;  1XOA A;  4YQM A;  3U5R E;  4EIP A;  2WVZ A;  3GKM A;  3QOU A;  4YQU A;  5GZZ B;  1QK8 A;  2DJ1 A;  2H0I A;  5IMZ A;  3HJM A;  2N5B A;  3A2W A;  4MDC A;  3D21 A;  5DBQ A;  3ZMK A;  2FD3 A;  1J08 A;  2A2S A;  4K0N A;  4PXO A;  4MZB A;  2L57 A;  3DRN A;  3FZ5 A;  4IBP A;  1O81 A;  1OC3 A;  4PUR A;  3L9V A;  2ZUP A;  1K0A A;  1YDK A;  3C73 A;  4QL7 A;  1AC1 A;  2PBJ A;  3CBU A;  3QAG A;  2KP1 A;  3TU3 B;  3HHV A;  2VD0 A;  4I97 A;  4K5R A;  4EUY A;  3CYN A;  4I2T A;  4KA0 A;  3TUE A;  5FWG A;  1K3Y A;  1SU9 A;  5HFG A;  3C71 A;  11GS A;  2VCZ A;  4K7I A;  4V2L A;  3GV1 A;  2FHE A;  2F8A A;  1UA5 A;  3PIN A;  4V2M A;  3KH9 A;  3DXB A;  3F0I A;  1GSF A;  4ZB7 A;  1SVL A;  1T7P B;  2I3Y A;  3APQ A;  6GSY A;  2L59 A;  3BCI A;  1O73 A;  5ECP B;  2P5R A;  2HFD A;  1SKS B;  4KUN A;  4MZC A;  1HYU A;  1W89 A;  1YY7 A;  1HD2 A;  2IN3 A;  5KN1 A;  2M72 A;  3KEB A;  3G7Y A;  1GTA A;  2JSZ A;  4JR4 A;  3LYP A;  2AV4 A;  1PKW A;  3FZ9 A;  1ZYN A;  4OCF A;  4OWY A;  4A5P A;  2B5Y A;  3KP8 A;  5ID2 A;  1X5D A;  1K0M A;  4J57 E;  3LXZ A;  1JFU A;  3D22 A;  4IGJ A;  4YKF A;  2L4Q A;  1F9M A;  2YOI A;  4EO3 A;  2H76 A;  1EWX A;  4I5Q A;  5HR3 A;  3RBT A;  2LJK A;  3FR3 A;  1ABA A;  2H75 A;  3WT2 A;  4GDF A;  1Q4J A;  1Y25 A;  5B8A A;  1S3A A;  1V40 A;  3TKS E;  3IHG A;  1AQX A;  2B7K A;  4K1F A;  2JZR A;  5EPF A;  3LGC A;  1GNE A;  4HEA 2;  1XWK A;  3ERG A;  3RDW A;  4E8H A;  2GQM A;  2FWH A;  4USS A;  1XXU A;  3L78 A;  3P8W A;  4L5L A;  3MWH A;  3VLN A;  4TKY A;  2EIR A;  4HZ2 A;  5J9B A;  2B5E A;  2L5L A;  2UV8 G;  1O85 A;  4BA7 A;  4OFN A;  3C1S A;  5G1K A;  3EC3 A;  5ID2 B;  4HOJ A;  5J4V A;  4JBB A;  4YAV A;  1G0T A;  3QPM A;  2IFQ A;  1BQ7 A;  2X99 A;  3GNJ A;  3Q74 A;  2FNO A;  2GT6 A;  4XRA A;  2X4A A;  3F8U A;  1R26 A;  2CVB A;  5IM9 A;  2GZY A;  2TRC P;  4RI7 A;  4ZB6 A;  4G0I A;  2GDR A;  4TW5 A;  1TOF A;  2E7P A;  3O3T A;  4OFT A;  2LNT A;  1XPV A;  1R5A A;  4DEJ A;  4MJB A;  3VWW A;  2HYX A;  2LTK A;  3DKS A;  4K6X A;  4OFM A;  2QSI A;  2NTO A;  2WW2 A;  1SEN A;  5CNW A;  3EPT A;  2F51 A;  1K3L A;  4F2I A;  3HDC A;  1X0R A;  1ZCP A;  2K8S A;  2X8C A;  1XBS A;  2YWO A;  2IFQ B;  2MMO A;  1TKD B;  3L4N A;  1T3B A;  2IPA A;  2FY6 A;  5IMV A;  1IYI A;  3QMX A;  3TGZ A;  5IO0 A;  18GS A;  3W8S A;  4NXI A;  1VRS D;  1Z3E A;  1SD9 A;  2VLT A;  2PWJ A;  4HI7 A;  2GST A;  4ECI A;  3EWL A;  3FZ4 A;  4Z7X A;  1K0D A;  5A4V A;  3KP9 A;  4NHW A;  3IK7 A;  4X43 A;  4E8E A;  3FHK A;  5IMA A;  5ELG A;  3R2Q A;  3LG6 A;  4TOP A;  2C0F A;  1HQO A;  4NAX A;  4ISD A;  3IC8 A;  4WF4 A;  4Q5Q A;  5HQP A;  3Q6O A;  4FXY P;  4EXJ A;  2PPT A;  4OO4 A;  4KDY A;  4WR4 A;  2YP6 A;  2MYG A;  1JZW A;  2VUP A;  4BWS A;  5LNK e;  1S3D A;  3CRU A;  4POL A;  2PUK C;  1THO A;  3QFA C;  1A2L A;  3L9U A;  4KB3 A;  1TDI A;  3WYW A;  4N0V A;  6GSV A;  2PER A;  1M9A A;  5A5H B;  2PVQ A;  4N0Z A;  1WMJ A;  3F63 A;  3LWA A;  3E9J B;  3LXT A;  3EU3 A;  4MAB A;  3HMJ G;  1WP0 A;  3IC4 A;  2JSY A;  1IYH A;  3UL3 A;  4BIK A;  2PVO C;  3EMP A;  1JLW A;  2F3M A;  4FYC A;  2HRK A;  2H73 A;  3ZL5 A;  1G7E A;  2YWI A;  4BVY A;  4YAP A;  12GS A;  1N2A A;  2WVX B;  3QCP A;  2WZS A;  2CVK A;  2NVL A;  2H71 A;  4DSS A;  4I2U A;  1Z7P A;  1KNG A;  4XS6 A;  4ZB9 A;  3RPN A;  2HZE A;  2FA8 A;  1GSY A;  2BMX A;  1TP9 A;  2H0H A;  5G5E A;  4IEL A;  2CZ3 A;  3ZIT A;  2DJ3 A;  1GTB A;  2I1U A;  4POK A;  2OJL A;  4IKH A;  2OE1 A;  4MCU A;  1FW1 A;  2LJR A;  5G1L A;  1SD8 A;  4HZ4 A;  1WPI A;  1M9B A;  4IHU A;  4TVE A;  4FH8 A;  5D73 A;  4KDX A;  4EE0 A;  4KCA A;  3RAZ A;  2HRK B;  4GCI A;  4ID0 A;  3GHA A;  4BVY B;  22GS A;  2FGX A;  2J23 A;  4MPG A;  1PQN A;  1B9X C;  1TTZ A;  4O92 A;  4IP1 A;  1R5P A;  1ZZY A;  4DSS B;  1MTC A;  2LQO A;  3MSZ A;  1SYX A;  2HZE B;  2CX4 A;  2AYT A;  1FOH A;  2AUV A;  1SL2 B;  2H30 A;  1M0U A;  3ERW A;  3HCZ A;  5GAP D;  2CAQ A;  5BMU B;  5CAX A;  1Z9H A;  2LQQ A;  2YCD A;  3G9B A;  1PX7 A;  5F0G A;  2QGV A;  4AKX B;  2WGR A;  5IOX A;  4TR4 A;  4MP4 A;  3P2A A;  1OYJ A;  4DVC A;  1XVQ A;  2R0P A;  4WF5 A;  2P0G A;  2IWT A;  1OE7 A;  1NW2 A;  3M8N A;  4MZW A;  3SBC A;  3F6F A;  5COH A;  1EOH A;  2EFE A;  2YN1 A;  3A5W A;  3QD9 A;  4CY8 A;  4GF0 A;  20GS A;  1QQ2 A;  2TIR A;  4FYB A;  1ZYP A;  3IRA A;  5J5N A;  2NPB A;  3UOM A;  3GA4 A;  1TJD A;  5KN0 A;  3HVX A;  3PGT A;  4HJ2 A;  4AJ8 A;  4PNG A;  4F82 A;  1SKW B;  1EP8 A;  4AGS A;  5L71 A;  1TXX A;  1H75 A;  4O5R A;  2I9H A;  3VFI A;  4ZL9 A;  3CRT A;  2HRA A;  3BCK A;  2LNS A;  4IQA A;  4ZBA A;  5JWQ B;  2R6K A;  3TJF A;  3DYR A;  1TW9 A;  2BJX A;  3GH6 A;  2CAI A;  1A2J A;  1Z7R A;  4IW9 A;  1T4Z A;  3FRC A;  1F2E A;  1TRW A;  1YEW C;  2UZ8 A;  2WW1 A;  2A4H A;  1YF1 A;  2DIY A;  1PN0 A;  2HXK A;  2MMN A;  1AXD A;  5E4W A;  4NWY A;  2XPD A;  1LJR A;  2L6D A;  2RII A;  3P90 A;  2NDO A;  4TXO A;  5CRE A;  2VCV A;  1EGO A;  3DML A;  1XWG A;  4NPB A;  4GQF A;  3GFK A;  5DAK A;  2VCW A;  3M9K A;  2WW3 A;  2FWF A;  3BBY A;  3KMO A;  4K9Z A;  3EMX A;  4BWQ A;  1EV9 A;  1WE0 A;  5J4U A;  4V2N A;  3F4T A;  1TK0 B;  3ZVJ D;  4WXT A;  2QA2 A;  1U88 A;  2H6Y A;  5CRH A;  5A5K A;  2OBK A;  5ECN B;  3UIW A;  5IOW A;  5H5R A;  3FW2 A;  4K2X A;  1DBY A;  3KD0 A;  2YWM A;  3EE2 A;  3UEM A;  3KIJ A;  5ECH B;  1VF4 A;  4TXO B;  1DE2 A;  4TR1 B;  4D73 B;  7GSS A;  4GQC A;  2C4J A;  5D9W A;  4K5S A;  3TDG A;  5DAK B;  1G7O A;  2H8L A;  3DEX A;  3VWX A;  4PQH A;  2KLX A;  4XS4 A;  3IHQ A;  1PSQ A;  3WGE A;  4WR5 A;  3WGX A;  4YQV A;  3ZML A;  3A2V A;  2OT3 A;  5CYY A;  1R4W A;  1YKC A;  3TJJ A;  4TXV A;  4I6X A;  3F3R A;  2OE3 A;  2HI7 A;  3VI7 A;  5ECI B;  3HXS A;  1M2D A;  2IL3 A;  4K8M A;  2R37 A;  3ERF A;  1F6M C;  5J3R A;  3EVI A;  4OMV A;  2OBI A;  3MIX A;  5B8B A;  1T00 A;  1SK1 A;  2B7J A;  4XS4 B;  4ILF A;  2VAF A;  2ALB A;  3KM6 A;  1SVM A;  3GRX A;  1GTI A;  2PGT A;  3N5O A;  2E2G A;  4MH3 A;  3QFB C;  4O7H A;  3VK9 A;  3HJP A;  2H1D A;  2WJU A;  4X4J A;  1OC9 B;  3HZ8 A;  4K2D A;  4BVX A;  3ME8 A;  2CA8 A;  4MK3 A;  4F0C A;  2HLS A;  3UVT A;  3TCO A;  1OAZ A;  2OA7 A;  5AIX A;  5INY A;  2JZT A;  3M9J A;  1AW9 A;  2HE3 A;  3CQF A;  3NOF A;  4WKW A;  3BJ5 A;  14GS A;  2GVP A;  5J9C A;  3GL5 A;  3MYD A;  4HUA A;  5A4W A;  4G0K A;  2EFC A;  4LL4 B;  2CV4 A;  2MZC A;  2H70 A;  1N25 A;  1EP7 A;  5FT3 A;  4EDZ A;  2XHF A;  2K18 A;  3DD3 A;  5ELA A;  1NHO A;  2YJH A;  4MMM A;  13GS A;  3I9V 2;  4ECB A;  3DGQ A;  3HVS A;  3C8E A;  5AIV A;  1O6J A;  2HRN A;  3D6I A;  3GKN A;  5JCG A;  1FVJ A;  1EGR A;  3TOT A;  1QGV A;  3F9U A;  3V1W A;  4BVX B;  2PMT A;  4NV2 A;  2B1L A;  3IOS A;  1GLQ A;  5IMF A;  4PQI A;  1GLP A;  1FB0 A;  3ZVJ A;  2VO4 A;  4RQR A;  4IP6 A;  1FB6 A; 
#chains in the Genus database with same CATH homology
 3KJY A;  2DIZ A;  3M0F A;  3F4S A;  3CTG A;  1EZK A;  2WFC A;  4PUA A;  1GH2 A;  5KN3 A;  3KMN A;  1YEX A;  4ZBD A;  2CVD A;  1GUK A;  3GUR A;  5HR0 A;  3TKS A;  2VKZ G;  2RUE A;  3CSI A;  1NHY A;  4G10 A;  16GS A;  6GST A;  2VL3 A;  4QL9 A;  3D5J A;  3VUR A;  5ABR A;  2DJK A;  4MNN A;  3EIN A;  2IIY A;  1MDK A;  2C3Q A;  2O87 A;  2YV7 A;  3LEF A;  2GSQ A;  2JAD A;  2VLU A;  2HSY A;  5ECM B;  2WB9 A;  3GMF A;  1I9D A;  4ZL7 A;  1SYR A;  3ZIJ A;  5A5H A;  4JE1 A;  2VCX A;  4MH2 A;  2M46 A;  1GSE A;  2WRT A;  1K0B A;  4JRR A;  4JU5 A;  1SL1 B;  4POM A;  4KSO A;  1XIY A;  1BF5 A;  3WGD A;  2VM1 A;  5GSS A;  1TU8 A;  1R7H A;  2MBT A;  1YKA A;  1SJ6 A;  3FEU A;  2WUL A;  3PPU A;  1GSS A;  1MD3 A;  4WBR D;  17GS A;  1W4V A;  3KH7 A;  2K9F A;  3HVV A;  5DDL A;  3A2X A;  1C72 A;  4KCE A;  3ZLP A;  4PUF C;  1TI3 A;  4I8B A;  2REM A;  3H1N A;  4GSN A;  1DSB A;  2BTO T;  4WET A;  1VF3 A;  4PQ1 A;  5HR2 A;  2IMK A;  1B4Q A;  2TRX A;  4NMU A;  2GSR A;  1QMV A;  2XBI A;  2F8F A;  2ZNM A;  5DJM A;  1OKT A;  3VWU A;  3W8J A;  2DMM A;  1VGL A;  1WOU A;  4ML6 A;  3NIV A;  2F9S A;  4HQS A;  2VL9 A;  3A5I A;  2DC5 A;  3TJB A;  5FHI A;  2DBC A;  2N5F A;  4Q5F A;  2GQL A;  4XIH A;  3ZFL A;  3UBL A;  3IDV A;  1K0C A;  1FOV A;  1H4O A;  4MF6 A;  5A1N A;  4CW9 A;  5B7C A;  1S3C A;  4LLR A;  3ME7 A;  2AHE A;  3GIX A;  1TRV A;  4LMW A;  4EVM A;  3DVW A;  1XOB A;  2C0D A;  1XVW A;  2WZ9 A;  2DSA A;  3TKS C;  3FR9 A;  1O7U A;  5IO2 A;  3FY7 A;  1ERT A;  2M80 A;  1USB A;  4AKH A;  5G31 A;  1V58 A;  2CT6 A;  3LYK A;  5J47 A;  2ZCT A;  2YZH A;  5D9X A;  5ECL B;  2O7K A;  2QC7 A;  5ECR B;  1XZO A;  5EL8 A;  5KOW A;  3TKP A;  2EIQ A;  1PX6 A;  4BL7 A;  3GKK A;  2QKE A;  3L9S A;  6GSU A;  5BMU A;  3PR8 A;  5D9T A;  5A1N B;  1FO5 A;  1TXU A;  3TJG A;  2FLS A;  3H93 A;  1BG5 A;  2NBS A;  3IXR A;  4W66 A;  3I6A A;  3LQ7 A;  1PKZ A;  4G19 A;  1G6W A;  2YPM A;  5ENU A;  1JZR A;  2Z9S A;  4V1A p;  1PA3 A;  5JCW A;  5CRW A;  1RK4 A;  1X9S B;  2ON5 A;  1FG4 A;  2V1M A;  3TKR A;  3QDN A;  4DSQ A;  4FQU A;  3KTL A;  4N11 A;  5GAN D;  3EYT A;  5ECS A;  5ECQ B;  5CP1 A;  1A2M A;  1ON4 A;  3HYP A;  3LOR A;  2H72 A;  3ZRD A;  4L0W A;  4BL7 B;  1KBN A;  1Z5Y E;  8GSS A;  3HZ4 A;  2H6Z A;  1WIK A;  1SL0 B;  2YAN A;  5J4Y A;  2XC2 A;  4GLT A;  2HQT A;  1EEM A;  4ACS A;  3IV4 A;  5IMD A;  4CHS A;  1FHE A;  4X0X A;  3O76 A;  2RM5 A;  1WRY A;  2I4A A;  2WDU A;  1M7T A;  1M99 A;  2CZ2 A;  3UVH A;  2GLR A;  2YJ7 A;  3N9J A;  1O8X A;  3M1G A;  1TK8 B;  1A8Y A;  2JAC A;  3GX8 A;  5CO3 A;  1GSQ A;  3TOU A;  1Z6M A;  3ZZX A;  4F03 A;  3HA9 A;  1JZD A;  3HJO A;  1ILO A;  3HD5 A;  5F05 A;  1X5E A;  1KEB A;  3FMW A;  2O85 A;  5IIZ A;  4IN0 A;  4LL1 B;  2V41 A;  3S9F A;  5G5F A;  2R5G A;  5AIS A;  2R2J A;  5D8I A;  4HS1 A;  2GSS A;  3BD2 A;  4H86 A;  5HR1 A;  1XWC A;  3TJK A;  2H74 A;  2X8H A;  3CSJ A;  3ZTL A;  2GQK A;  1F3B A;  1DUG A;  1RQM A;  4MA9 A;  3CTF A;  4RUV A;  5DCH A;  3LFL A;  5HFK A;  3J7Y k;  2H1A A;  1K0O A;  3GN3 A;  1JHB A;  4ZB8 A;  2CQ9 A;  4JR6 A;  3BOA A;  3UBK A;  1BAY A;  3I43 A;  4WBJ A;  4IS0 A;  4IQ1 A;  4HQZ A;  2I81 A;  2J9H A;  2AJQ B;  4KF9 A;  1JZO A;  1PGT A;  1NM3 A;  4TR1 A;  2R0C A;  4D73 A;  2GT5 A;  2JZS A;  5JCU A;  3E3E A;  3FK8 A;  3W6G A;  2K8V A;  2RM6 A;  4QMK A;  4N10 A;  2VCQ A;  2JU5 A;  4E68 A;  1LU4 A;  1U87 A;  3F4R A;  5F07 A;  4BPY A;  2O89 A;  1EOG A;  2R3X A;  3GH9 A;  3E0U A;  2N5A A;  4LMV A;  1ZYQ B;  1NSW A;  4MF7 A;  3VI5 A;  4HDE A;  2LRT A;  2B3S A;  4TN8 A;  2L5O A;  2HSN A;  1ZL9 A;  2ON7 A;  2LRC A;  2LV3 A;  1GUM A;  1QFN A;  1SJZ A;  1OC8 A;  4HU7 A;  2VCT A;  2DJ2 A;  5A34 A;  1B8X A;  2DJ0 A;  4ICY A;  2MMZ A;  2HRF A;  3TKQ A;  3Q19 A;  1VF2 A;  2VLV A;  5B6N A;  2FUG 2;  2O5V A;  1VF1 A;  1EV4 A;  2GTU A;  3MNG A;  1F3A A;  2GZP A;  2V6O A;  2C1Y A;  2GGT A;  4G9H A;  3F3Q A;  1OKD A;  3CWG A;  3VWV A;  5JWR B;  2C3T A;  4TR0 A;  5H5S A;  1X9M B;  6GSW A;  4JZQ A;  2K6V A;  4PNF A;  1T8E B;  6GSS A;  1MEK A;  1M2B A;  3TRX A;  2YNX A;  1ERU A;  2HSN B;  3IR4 A;  1OC9 A;  2X8G A;  4F0B A;  1ZGN A;  1ERV A;  2H1G A;  3U6V A;  3GST A;  4ECC A;  1LBK A;  2X49 A;  3SWL A;  1CQH A;  5A34 B;  1KTE A;  1PRX A;  1B9Y C;  5CRD A;  1E6B A;  2H1L A;  4AI6 A;  2LEG A;  2QA1 A;  2R4V A;  1OVN A;  1UVZ A;  5DAL A;  4ZIL A;  3H79 A;  3APS A;  3FKF A;  1SK0 A;  2H6X A;  2IJY A;  1AAZ A;  5EVO A;  5KN2 A;  3K8N A;  4G0L A;  3HKR A;  1V98 A;  2XPE A;  2AB6 A;  1O8W A;  5J41 A;  19GS A;  2HSM A;  1JLV A;  3VPT A;  3TB2 A;  2FWE A;  5F8B A;  1HNA A;  1GNW A;  5LCZ A;  3ZRE A;  2WCI A;  4DSR A;  3UAR A;  4EDY A;  1UC7 A;  4GXZ A;  5DVB A;  4EKZ A;  2E2M A;  2JL4 A;  2H0G A;  1BG1 A;  4MPF A;  1EEJ A;  1K3O A;  1PMT A;  3P7X A;  5DAL B;  1WWJ A;  1U3A A;  1THX A;  3MDK A;  3L0H A;  2FWG A;  2B5X A;  5IQY A;  4HJM A;  2MMA A;  4Z2U A;  3GUS A;  1V2A A;  1N8J A;  1XWA A;  2YV9 A;  1XCC A;  5C04 A;  2VD1 A;  2O8V B;  1DE1 A;  5G30 A;  4O32 A;  4FYU A;  1YJ6 A;  4RQX A;  2HSM B;  1ST9 A;  2FA4 A;  2A2P A;  1OE8 A;  1BJX A;  4IJ3 A;  2A4V A;  2C0E A;  1GSD A;  4NHZ A;  1BED A;  4CY6 A;  4EC0 A;  1A8L A;  2YWN A;  1ML6 A;  2PU9 C;  5DQY A;  2IMI A;  3KZQ A;  3DIE A;  2HZF A;  3Q18 A;  5D96 A;  4L8E A;  3UMA A;  1B4P A;  1ZOF A;  3VPQ A;  1ZMA A;  2RUF A;  4POB A;  4NV5 A;  5G2Z A;  3QAV A;  4Q5N A;  1TRS A;  3LJR A;  5F06 A;  3QAW A;  4MJC A;  1SKR B;  1V9W A;  3ZFB A;  1YVL A;  1GP1 A;  3RPP A;  1AQV A;  1U3I A;  2DLX A;  4HU9 A;  4ECJ A;  1GWC A;  4YKG A;  5DCG A;  5E59 A;  10GS A;  3NZN A;  4G2E A;  2VL2 A;  5D93 A;  3O6T A;  1FVK A;  3PH9 A;  4ZXG A;  2KUC A;  3APO A;  3TRQ A;  2C80 A;  4AF2 A;  2HT9 A;  4KX4 A;  4XHM A;  2RLI A;  2DKH A;  2CX3 A;  4XS1 A;  3WD6 A;  1WJK A;  1GRX A;  1TRU A;  4AJ6 A;  1XW5 A;  2DJJ A;  3M3M A;  4O5U A;  3G7I A;  4ZBB A;  2LRN A;  4XCS A;  9GSS A;  4AKG A;  2V6K A;  1GL8 A;  3I69 A;  3C7M A;  4OD7 A;  1GUH A;  3AY8 A;  1YEP A;  4JED A;  1XFL A;  3CSH A;  4MLY A;  4N3Z A;  4L5O A;  1GSU A;  1M2A A;  4KE3 A;  4XRD A;  3WT1 A;  1URM A;  2KP2 A;  4N30 A;  4XTS A;  6GSX A;  3GYK A;  4TRX A;  1GTU A;  2C0G A;  2C3N A;  1A0F A;  2P31 A;  2LUS A;  4X1U A;  5KOX A;  4GTU A;  2B6M A;  5LD0 A;  1Z6N A;  2YZU A;  3D4T A;  4AJ7 A;  3JCM L;  3UJ1 A;  2LKU A;  2OAC A;  3KGK A;  2D2Z A;  2EFD A;  4MJA A;  1MDI A;  1SVO A;  2V32 A;  3A3T A;  4P3Y B;  3ZIV A;  4O5Q A;  2EFH A;  5BRT A;  5AN1 A;  2H1B A;  1MD4 A;  5IPG A;  1HNC A;  4ZIJ A;  2X64 A;  1A23 A;  1T1V A;  3IAM 2;  5AGY A;  5IMC A;  3DWV A;  3FR6 A;  3ED3 A;  3R3E A;  5DJL A;  1A24 A;  4J56 E;  4PX1 A;  1QUW A;  1BYE A;  2VIM A;  2EC4 A;  1AQW A;  4GST A;  3FYG A;  3IAS 2;  3GKX A;  4KAE A;  2IME A;  1HNB A;  5H5Q A;  2VL2 C;  1BX9 A;  4EL1 A;  5ECO B;  4QQ7 A;  2OAD A;  1QXH A;  2FCH A;  1YQ1 A;  1PL2 A;  2DML A;  3IA1 A;  3GTU A;  4MJE A;  3DVX A;  3D0Z A;  1SJI A;  4FO5 A;  1XW6 A;  3KTB A;  1TK5 B;  4EF0 A;  2OE0 A;  3C1R A;  5HFI A;  2EIO A;  3J7Y b;  2AAW A;  2H01 A;  4K7N A;  3EUR A;  3G7J A;  2HNL A;  3RHB A;  1MDJ A;  1F37 A;  2L4C A;  3US3 A;  2IMF A;  5ECK B;  1E2Y A;  4Q5R A;  2KHP A;  1Y1U A;  2R0G A;  4J2F A;  2G2Q A;  3GX0 A;  3KCM A;  2LJA A;  1UN2 A;  2WS2 A;  3UAP A;  3ZYW A;  1YZX A;  3CXG A;  3GTU B;  1GUL A;  2P5Q A;  1FAA A;  2VOC A;  4Z2T A;  4KW6 A;  1AUC A;  3KXO A;  4KND A;  1T4Y A;  2H66 A;  1TI1 A;  4KDU A;  1Q98 A;  5C00 A;  2LST A;  5B6M A;  4TR3 A;  1SK2 A;  2B1K A;  1XW9 A;  1U6T A;  1K0N A;  3GL3 A;  3TRP A;  2PN8 A;  3MAK A;  1RW1 A;  1ZYE A;  4GWR A;  1J0F A;  4ML1 A;  1ACV A;  3H8Q A;  5A4U A;  3IK9 A;  1PD2 1;  5J40 A;  2GZZ A;  5GST A;  1B48 A;  3H4K A;  5D9V A;  4Z2R A;  2XBQ A;  1I5G A;  4ZL8 A;  5KEJ A;  4YH2 A;  1TU7 A;  2OKA A;  1YF0 A;  3IPZ A;  3IBH A;  5IPH A;  2H19 A;  4K7O A;  3FZA A;  4GSS A;  1ERW A;  5CRG A;  4G01 A;  3HY2 A;  1A0R P;  4KSM A;  2VM2 A;  2LS5 A;  1AIU A;  3EU4 A;  4F9Z A;  3F6D A;  4KGI A;  3ISO A;  1X5C A;  4AKI A;  4RI6 A;  4IJI A;  4LA1 A;  4PGT A;  2V2G A;  3IE3 A;  2L6C A;  4L0U A;  4OCE A;  4PTS A;  4GRF A;  4EIQ A;  2G0F A;  2DKI A;  4WEY A;  5JWO B;  4IVF A;  4ULX A;  2KOK A;  3GSS A;  1V57 A;  1XWB A;  2E0Q A;  1X9W B;  2C8U A;  1Y6E A;  4KH7 A;  1J9B A;  2HSH A;  3LW9 A;  2MBS A;  3LSZ A;  1PN9 A;  3CMI A;  3D4M A;  1G6Y A;  4OO5 A;  1PL1 A;  2A2R A;  2GS3 A;  3OR5 A;  4K0G A;  4FIW A;  1CQG A;  3RHC A;  4V1A g;  4MF5 A;  4CDO A;  5EY6 A;  5DQS A;  2ES7 A;  3QR6 A;  2IMD A;  1XOA A;  4YQM A;  3U5R E;  4EIP A;  3GKM A;  3QOU A;  4YQU A;  5GZZ B;  1QK8 A;  2DJ1 A;  2H0I A;  5IMZ A;  3HJM A;  2N5B A;  3A2W A;  4MDC A;  3D21 A;  5DBQ A;  3ZMK A;  2FD3 A;  1J08 A;  2A2S A;  4K0N A;  4PXO A;  4MZB A;  2L57 A;  3DRN A;  3FZ5 A;  4IBP A;  1O81 A;  1OC3 A;  4PUR A;  3L9V A;  2ZUP A;  1K0A A;  1YDK A;  3C73 A;  4QL7 A;  1AC1 A;  2PBJ A;  3CBU A;  3QAG A;  2KP1 A;  3TU3 B;  3HHV A;  2VD0 A;  4I97 A;  4K5R A;  4EUY A;  3CYN A;  4I2T A;  4KA0 A;  3TUE A;  5FWG A;  1K3Y A;  1SU9 A;  5HFG A;  3C71 A;  11GS A;  2VCZ A;  4K7I A;  4V2L A;  3GV1 A;  2FHE A;  2F8A A;  1UA5 A;  3PIN A;  4V2M A;  3KH9 A;  3DXB A;  3F0I A;  1GSF A;  4ZB7 A;  1SVL A;  1T7P B;  2I3Y A;  3APQ A;  6GSY A;  2L59 A;  3BCI A;  1O73 A;  5ECP B;  2P5R A;  2HFD A;  1SKS B;  4KUN A;  4MZC A;  1HYU A;  1W89 A;  1YY7 A;  1HD2 A;  2IN3 A;  5KN1 A;  2M72 A;  3KEB A;  3G7Y A;  1GTA A;  2JSZ A;  4JR4 A;  3LYP A;  2AV4 A;  1PKW A;  3FZ9 A;  1ZYN A;  4OCF A;  4OWY A;  4A5P A;  2B5Y A;  3KP8 A;  5ID2 A;  1X5D A;  1K0M A;  4J57 E;  3LXZ A;  1JFU A;  3D22 A;  4IGJ A;  4YKF A;  2L4Q A;  1F9M A;  2YOI A;  4EO3 A;  2H76 A;  1EWX A;  4I5Q A;  5HR3 A;  3RBT A;  2LJK A;  3FR3 A;  1ABA A;  2H75 A;  3WT2 A;  4GDF A;  1Q4J A;  1Y25 A;  5B8A A;  1S3A A;  1V40 A;  3TKS E;  3IHG A;  1AQX A;  2B7K A;  4K1F A;  2JZR A;  5EPF A;  3LGC A;  1GNE A;  4HEA 2;  1XWK A;  3ERG A;  3RDW A;  4E8H A;  2GQM A;  2FWH A;  4USS A;  1XXU A;  3L78 A;  3P8W A;  4L5L A;  3MWH A;  3VLN A;  4TKY A;  2EIR A;  4HZ2 A;  5J9B A;  2B5E A;  2L5L A;  2UV8 G;  1O85 A;  4BA7 A;  4OFN A;  3C1S A;  5G1K A;  3EC3 A;  5ID2 B;  4HOJ A;  5J4V A;  4JBB A;  4YAV A;  1G0T A;  3QPM A;  2IFQ A;  1BQ7 A;  2X99 A;  3GNJ A;  3Q74 A;  2FNO A;  2GT6 A;  4XRA A;  2X4A A;  3F8U A;  1R26 A;  2CVB A;  5IM9 A;  2GZY A;  2TRC P;  4RI7 A;  4ZB6 A;  4G0I A;  2GDR A;  4TW5 A;  1TOF A;  2E7P A;  3O3T A;  4OFT A;  2LNT A;  1XPV A;  1R5A A;  4DEJ A;  4MJB A;  3VWW A;  2HYX A;  2LTK A;  3DKS A;  4K6X A;  4OFM A;  2QSI A;  2NTO A;  1SEN A;  5CNW A;  3EPT A;  2F51 A;  1K3L A;  4F2I A;  3HDC A;  1X0R A;  1ZCP A;  2K8S A;  2X8C A;  1XBS A;  2YWO A;  2IFQ B;  2MMO A;  1TKD B;  3L4N A;  1T3B A;  2IPA A;  2FY6 A;  5IMV A;  1IYI A;  3QMX A;  3TGZ A;  5IO0 A;  18GS A;  3W8S A;  4NXI A;  1VRS D;  1Z3E A;  1SD9 A;  2VLT A;  2PWJ A;  4HI7 A;  2GST A;  4ECI A;  3EWL A;  3FZ4 A;  4Z7X A;  1K0D A;  5A4V A;  3KP9 A;  4NHW A;  3IK7 A;  4X43 A;  4E8E A;  3FHK A;  5IMA A;  5ELG A;  3R2Q A;  3LG6 A;  4TOP A;  2C0F A;  1HQO A;  4NAX A;  4ISD A;  3IC8 A;  4WF4 A;  4Q5Q A;  5HQP A;  3Q6O A;  4EXJ A;  2PPT A;  4OO4 A;  4KDY A;  4WR4 A;  2YP6 A;  2MYG A;  1JZW A;  2VUP A;  4BWS A;  5LNK e;  1S3D A;  3CRU A;  4POL A;  2PUK C;  1THO A;  3QFA C;  1A2L A;  3L9U A;  4KB3 A;  1TDI A;  3WYW A;  4N0V A;  6GSV A;  2PER A;  1M9A A;  5A5H B;  2PVQ A;  4N0Z A;  1WMJ A;  3F63 A;  3LWA A;  3E9J B;  3LXT A;  3EU3 A;  4MAB A;  3HMJ G;  1WP0 A;  3IC4 A;  2JSY A;  1IYH A;  3UL3 A;  2PVO C;  3EMP A;  1JLW A;  2F3M A;  4FYC A;  2HRK A;  2H73 A;  3ZL5 A;  1G7E A;  2YWI A;  4BVY A;  4YAP A;  12GS A;  1N2A A;  3QCP A;  2CVK A;  2NVL A;  2H71 A;  4DSS A;  4I2U A;  1Z7P A;  1KNG A;  4XS6 A;  4ZB9 A;  3RPN A;  2HZE A;  2FA8 A;  1GSY A;  2BMX A;  1TP9 A;  2H0H A;  5G5E A;  4IEL A;  2CZ3 A;  3ZIT A;  2DJ3 A;  1GTB A;  2I1U A;  4POK A;  2OJL A;  4IKH A;  2OE1 A;  4MCU A;  1FW1 A;  2LJR A;  5G1L A;  1SD8 A;  4HZ4 A;  1WPI A;  1M9B A;  4IHU A;  4TVE A;  4FH8 A;  5D73 A;  4KDX A;  4EE0 A;  4KCA A;  3RAZ A;  2HRK B;  4GCI A;  4ID0 A;  3GHA A;  4BVY B;  22GS A;  2FGX A;  2J23 A;  4MPG A;  1PQN A;  1B9X C;  1TTZ A;  4O92 A;  4IP1 A;  1R5P A;  1ZZY A;  4DSS B;  1MTC A;  3MSZ A;  2LQO A;  1SYX A;  2HZE B;  2CX4 A;  2AYT A;  1FOH A;  2AUV A;  1SL2 B;  2H30 A;  1M0U A;  3ERW A;  3HCZ A;  5GAP D;  2CAQ A;  5BMU B;  5CAX A;  1Z9H A;  2LQQ A;  2YCD A;  3G9B A;  1PX7 A;  5F0G A;  2QGV A;  4AKX B;  2WGR A;  5IOX A;  4TR4 A;  4MP4 A;  3P2A A;  1OYJ A;  4DVC A;  1XVQ A;  2R0P A;  4WF5 A;  2P0G A;  2IWT A;  1OE7 A;  1NW2 A;  3M8N A;  4MZW A;  3SBC A;  3F6F A;  5COH A;  1EOH A;  2EFE A;  2YN1 A;  3A5W A;  3QD9 A;  4CY8 A;  4GF0 A;  20GS A;  1QQ2 A;  2TIR A;  4FYB A;  1ZYP A;  3IRA A;  5J5N A;  2NPB A;  3UOM A;  3GA4 A;  1TJD A;  5KN0 A;  3HVX A;  3PGT A;  4HJ2 A;  4AJ8 A;  4PNG A;  4F82 A;  1SKW B;  1EP8 A;  4AGS A;  5L71 A;  1TXX A;  1H75 A;  4O5R A;  2I9H A;  3VFI A;  4ZL9 A;  3CRT A;  2HRA A;  3BCK A;  2LNS A;  4IQA A;  4ZBA A;  5JWQ B;  2R6K A;  3TJF A;  3DYR A;  1TW9 A;  2BJX A;  3GH6 A;  2CAI A;  1A2J A;  1Z7R A;  4IW9 A;  1T4Z A;  3FRC A;  1F2E A;  1TRW A;  2UZ8 A;  2A4H A;  1YF1 A;  2DIY A;  1PN0 A;  2HXK A;  2MMN A;  1AXD A;  5E4W A;  4NWY A;  2XPD A;  1LJR A;  2L6D A;  2RII A;  3P90 A;  2NDO A;  4TXO A;  5CRE A;  2VCV A;  1EGO A;  3DML A;  1XWG A;  4NPB A;  4GQF A;  3GFK A;  5DAK A;  2VCW A;  3M9K A;  2FWF A;  3BBY A;  3KMO A;  4K9Z A;  3EMX A;  4BWQ A;  1EV9 A;  1WE0 A;  5J4U A;  4V2N A;  3F4T A;  1TK0 B;  3ZVJ D;  4WXT A;  2QA2 A;  1U88 A;  2H6Y A;  5CRH A;  5A5K A;  2OBK A;  5ECN B;  3UIW A;  5IOW A;  5H5R A;  3FW2 A;  4K2X A;  1DBY A;  3KD0 A;  2YWM A;  3EE2 A;  3UEM A;  3KIJ A;  5ECH B;  1VF4 A;  4TXO B;  1DE2 A;  4TR1 B;  4D73 B;  7GSS A;  4GQC A;  2C4J A;  5D9W A;  4K5S A;  3TDG A;  5DAK B;  1G7O A;  2H8L A;  3DEX A;  3VWX A;  4PQH A;  2KLX A;  4XS4 A;  3IHQ A;  1PSQ A;  3WGE A;  4WR5 A;  3WGX A;  4YQV A;  3ZML A;  3A2V A;  2OT3 A;  5CYY A;  1R4W A;  1YKC A;  3TJJ A;  4TXV A;  4I6X A;  3F3R A;  2OE3 A;  2HI7 A;  3VI7 A;  5ECI B;  3HXS A;  1M2D A;  2IL3 A;  4K8M A;  2R37 A;  3ERF A;  1F6M C;  5J3R A;  3EVI A;  4OMV A;  2OBI A;  3MIX A;  5B8B A;  1T00 A;  1SK1 A;  2B7J A;  4XS4 B;  4ILF A;  2VAF A;  2ALB A;  3KM6 A;  1SVM A;  3GRX A;  1GTI A;  2PGT A;  3N5O A;  2E2G A;  4MH3 A;  3QFB C;  4O7H A;  3VK9 A;  3HJP A;  2H1D A;  2WJU A;  4X4J A;  1OC9 B;  3HZ8 A;  4K2D A;  4BVX A;  3ME8 A;  2CA8 A;  4MK3 A;  4F0C A;  2HLS A;  3UVT A;  3TCO A;  1OAZ A;  2OA7 A;  5AIX A;  5INY A;  2JZT A;  3M9J A;  1AW9 A;  2HE3 A;  3NOF A;  4WKW A;  3BJ5 A;  14GS A;  2GVP A;  5J9C A;  3GL5 A;  3MYD A;  4HUA A;  5A4W A;  4G0K A;  2EFC A;  4LL4 B;  2CV4 A;  2MZC A;  2H70 A;  1N25 A;  1EP7 A;  5FT3 A;  4EDZ A;  2XHF A;  2K18 A;  3DD3 A;  5ELA A;  1NHO A;  2YJH A;  4MMM A;  13GS A;  3I9V 2;  4ECB A;  3DGQ A;  3HVS A;  3C8E A;  5AIV A;  1O6J A;  2HRN A;  3D6I A;  3GKN A;  5JCG A;  1FVJ A;  1EGR A;  3TOT A;  1QGV A;  3F9U A;  3V1W A;  4BVX B;  2PMT A;  4NV2 A;  2B1L A;  3IOS A;  1GLQ A;  5IMF A;  4PQI A;  1GLP A;  1FB0 A;  3ZVJ A;  2VO4 A;  4RQR A;  4IP6 A;  1FB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...