3LFLA

Crystal structure of human glutathione transferase omega 1, delta 155
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
236
structure length
236
Chain Sequence
SARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase omega-1
publication title Novel folding and stability defects cause a deficiency of human glutathione transferase omega 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 236
sequence length 236
chains with identical sequence B, C
ec nomenclature ec 1.20.4.2: Methylarsonate reductase.
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3lflA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lflA01
5DALB 4ZBBA 2MMNA 3ME7A 2LSTA 3ZIJA 1QFNA 1KNGA 5D9XA 1JZRA 5GSSA 2XHFA 1PRXA 3FZAA 4MABA 2YWMA 3EURA 7GSSA 2HSMB 3M1GA 3DVXA 3W8JA 2C1YA 1EGRA 1TTZA 1I9DA 3IAS2 4ZB9A 3CMIA 4NPBA 2VM2A 1EOGA 19GSA 1VGLA 2IMEA 4F2IA 1DSBA 2WDUA 4EXJA 3M3MA 4N11A 1M9BA 1A0FA 3RHCA 2K8VA 8GSSA 1EV9A 4AJ7A 2RUEA 4K7IA 2LV3A 4BVXA 1BJXA 2WB9A 4NHWA 2FLSA 1V9WA 4MDCA 4OFMA 4HUAA 3GX8A 2IMIA 2P5RA 4TXVA 2JZRA 3ZZXA 2XPDA 3UAPA 3ISOA 2XBIA 3TRPA 4AJ8A 2TIRA 2VCVA 4XTSA 2EIRA 3LXTA 3LFLA 2DJ3A 3VI5A 13GSA 1M2BA 16GSA 3QMXA 2L5LA 2YPMA 2WS2A 5D8IA 3U5RE 3ZL5A 5KN0A 1GNEA 2YWIA 3CSJA 2JL4A 5D9TA 4L0UA 3KXOA 1QGVA 3EE2A 3QFAC 3TCOA 2CZ3A 3F3QA 4G9HA 1B9YC 3R3EA 1ZCPA 3U6VA 6GSUA 3TKRA 4MP4A 3VWWA 2L4QA 3LGCA 3WT2A 5DAKB 3UBLA 1B8XA 2CA8A 1XW9A 3K8NA 2GQLA 4DSSA 4FYUA 5ECRB 4WEYA 1IYHA 2F9SA 4G10A 2OKAA 3HVXA 3A3TA 1GULA 4WR4A 2R3XA 4E8EA 3UMAA 1EGOA 3PPUA 3VK9A 4MLYA 2ES7A 5AN1A 3HXSA 2N5AA 3H1NA 3KH9A 4WBJA 1DE1A 2VLVA 3EMPA 1F3AA 2CX3A 1BEDA 2G0FA 1AC1A 3KP9A 4Q5QA 3NZNA 3GSSA 1GP1A 1ML6A 4K7OA 3F0IA 5FT3A 4PQIA 1GUMA 4HZ4A 1WPIA 4YQMA 2WCIA 6GSYA 1V40A 3RPNA 2V1MA 1V2AA 4O92A 2HQTA 3TJKA 1TP9A 2MYGA 2E2MA 3VI7A 1XIYA 3AY8A 1OVNA 2AV4A 2V6KA 5CREA 2B1KA 4IGJA 5BMUA 2NPBA 2DJKA 1X0RA 1G6YA 5DVBA 2KOKA 5DJMA 3D4MA 5D9WA 5G5EA 3C71A 2DSAA 5ECMB 3P7XA 1JZOA 4G0LA 4CHSA 3TJFA 3MSZA 1NHYA 3IHQA 3I43A 1CQHA 4LA1A 2A4VA 1GLPA 2LRTA 3SWLA 3H93A 4HJ2A 5CO3A 3GHAA 5EVOA 2VL9A 4TXOB 2B1LA 2PU9C 5IOWA 1K0CA 1TW9A 1OKDA 4MF6A 4V2LA 3M8NA 5ID2B 5ECSA 3D21A 4X0XA 5A5KA 1GSFA 2H1BA 3C73A 4DVCA 4GLTA 2KP1A 4G19A 3C7MA 4ZL8A 3KTLA 3BJ5A 1PL1A 2PUKC 1QMVA 5AIVA 2OBKA 2YANA 4OFTA 2B7JA 1USBA 4MMMA 1TI1A 2P5QA 5FWGA 3F63A 3R2QA 1OC9B 4J57E 3WD6A 1O8XA 4X43A 1FOVA 3O76A 3D6IA 2CAQA 2C0FA 2E2GA 5IMAA 4N10A 1F3BA 5LCZA 1VF3A 3IR4A 4FYBA 2Z9SA 4RI7A 3MAKA 2GQKA 5J9CA 1XOBA 1PGTA 3KTBA 4TOPA 4EDYA 2QC7A 2H30A 2L4CA 3TKQA 2HRKA 4IHUA 5LNKe 5DDLA 4JZQA 4EO3A 4XS1A 1V57A 3DIEA 1J9BA 2RIIA 3TJBA 1WMJA 3FKFA 2YCDA 5JWQB 4IQ1A 2GSQA 2R5GA 3WGDA 2AB6A 4GQFA 5G31A 1LJRA 2VUPA 2H0HA 2HSNB 2NDOA 4FQUA 1T4YA 3M9JA 4IP1A 1MDJA 2REMA 1XWBA 4PTSA 3DVWA 2VO4A 4ZB6A 5KN3A 2VL2A 2IPAA 3ZITA 2K8SA 1NW2A 4MPFA 3WT1A 1ILOA 2YNXA 3FEUA 5A4UA 4P3YB 2H0IA 4KNDA 5F8BA 3S9FA 4I6XA 2AAWA 1JLWA 4KCAA 1SL0B 4BL7A 1THXA 2H6YA 5IIZA 4HQZA 2X8HA 2LKUA 5COHA 1B4QA 1MDKA 4NWYA 1M0UA 5IQYA 4EKZA 1SD8A 1E6BA 2LNTA 1EOHA 3EMXA 3IC8A 1F37A 2GT5A 1ERTA 1DE2A 2FA8A 3LYPA 2B5XA 1XWKA 2V41A 4KA0A 2RUFA 4V2NA 3TGZA 1YF0A 4IVFA 1GLQA 4RI6A 4O7HA 2BMXA 2G2QA 2HNLA 3HCZA 3H8QA 3HHVA 4IP6A 1OYJA 3F9UA 2V2GA 5G1LA 3QFBC 1MD4A 4MPGA 3LEFA 4DEJA 1UN2A 3QCPA 2WRTA 3KEBA 3I69A 3BCKA 4BPYA 3UOMA 3DGQA 4KW6A 1A8LA 2HYXA 4YAVA 5B7CA 1HQOA 3C8EA 3QAWA 2C80A 4GF0A 2X8CA 3CTFA 3HVVA 1BAYA 2GZYA 1PA3A 2YV9A 3ME8A 2HZEB 2GGTA 2QGVA 5DBQA 2FWFA 2HXKA 2C8UA 1ZZYA 4OCEA 5HR0A 2YP6A 1PMTA 3LWAA 2E0QA 5IO0A 2CZ2A 4MZCA 5F06A 3IK9A 4XS4B 1JZDA 1TK8B 2H70A 1ERVA 5CRWA 1WOUA 2HLSA 1WRYA 1K3LA 5CAXA 1AQVA 5ECNB 5JCUA 3L9VA 1LBKA 3P90A 3FK8A 5F07A 3CTGA 4EVMA 5ECHB 3IE3A 1Y25A 5DQYA 4ZBDA 1A0RP 4NV2A 3PGTA 5B8AA 5L71A 1TK0B 3VPQA 2N5FA 5INYA 2LJAA 3GTUA 5CRDA 1K0DA 1PL2A 2OE3A 1FHEA 2XPEA 1ABAA 2LQQA 2LEGA 4CW9A 3KH7A 3ZFBA 5HR2A 2IIYA 3DRNA 2P0GA 5GZZB 4E8HA 1A24A 4HJMA 2ZNMA 5JCGA 1YQ1A 1XPVA 3EU3A 3IRAA 3F3RA 4GQCA 3GYKA 5B8BA 5ECQB 4G0KA 4KSMA 1DBYA 4KSOA 2IWTA 2J9HA 4KCEA 4KDUA 4QQ7A 4K1FA 4XHMA 2K9FA 5FHIA 1NHOA 4MH2A 1RW1A 4HI7A 4JBBA 2MMAA 1XW5A 1WIKA 4K8MA 2C4JA 4FO5A 3KZQA 2YJHA 1A8YA 3GSTA 1ZMAA 3LJRA 1ZYQB 3ERWA 3RHBA 5DCGA 1T1VA 1SENA 4F03A 4WR5A 3FYGA 5J9BA 3TRQA 1KBNA 2PWJA 2VLUA 2L57A 4MK3A 2D2ZA 3GURA 1JZWA 1Z7PA 1TI3A 4YAPA 1TKDB 3V1WA 2CVKA 5HFGA 3HVSA 2DJ0A 2YWOA 5IMVA 4BVXB 4OO4A 4D73A 4ZIJA 2OBIA 4Q5RA 5D96A 5ENUA 2CV4A 1YKCA 1GH2A 5IMCA 2RM5A 2ALBA 1VF4A 4BA7A 3TJGA 1B4PA 3VLNA 3IC4A 4LLRA 5JWRB 4XS6A 1R5AA 1AIUA 2LS5A 22GSA 3C1RA 3WGEA 1ACVA 1X5EA 4IW9A 1Z5YE 12GSA 3FR9A 3WGXA 1QQ2A 6GSSA 2JU5A 1XXUA 1VF2A 2O8VB 4PNFA 1TXXA 5ECPB 4PNGA 4OWYA 4L5OA 4RQRA 1JFUA 2PN8A 5DAKA 3QAGA 4PQHA 5CRHA 2LRCA 2LNSA 1SL2B 3TKPA 2X99A 2YWNA 5HR3A 4LL1B 2WFCA 3TDGA 2PVQA 5DCHA 1U88A 1FVJA 2WGRA 2IFQA 4EUYA 2A2RA 4KDXA 6GSWA 6GSXA 2YZUA 4KDYA 5EPFA 3KJYA 2LUSA 1GTBA 1EZKA 4HU7A 1Z6NA 1XW6A 4XCSA 4IELA 1I5GA 3KM6A 2PERA 1SKWB 4BWQA 1OAZA 1BYEA 2DC5A 4KB3A 3KD0A 1AUCA 4ZILA 2F3MA 5CYYA 1EP8A 1T7PB 4MA9A 2R6KA 3O6TA 1Z6MA 1YKAA 4J56E 5A4WA 1A2JA 1HNAA 1U87A 2LJRA 5ECOB 3US3A 1SKSB 17GSA 2FNOA 2H6ZA 5IMDA 4KE3A 1V58A 3Q19A 2JZSA 1Z9HA 3D22A 5D93A 3D0ZA 1X9MB 1SYXA 3HJMA 4ZBAA 4KUNA 5H5QA 4KAEA 2UZ8A 4I8BA 5C04A 4YH2A 1J0FA 2VD1A 3IPZA 3KMNA 2C3NA 2HRAA 4EF0A 2ON5A 4ACSA 1B48A 4ECJA 4MJEA 2AYTA 5IMZA 4JR4A 4HEA2 1XVWA 4G2EA 4DSRA 1SKRB 3ZRDA 3IOSA 4USSA 4BVYB 1HNBA 1A2MA 1QUWA 4HS1A 3QOUA 3A2VA 2E7PA 3ZVJA 3W6GA 3UARA 2JSZA 3IAM2 1NSWA 2VCZA 5DQSA 2MBSA 4V1Ag 5JCWA 3VWUA 1GTAA 1DUGA 1MTCA 3TKSA 2GQMA 3J7Yk 4JU5A 4ECCA 2N5BA 5G2ZA 4QL9A 2K6VA 3HDCA 4QL7A 1AAZA 4ZL9A 4JE1A 4OD7A 4POMA 2L59A 5CRGA 3TJJA 2M72A 4KF9A 4JR6A 5KN2A 2OADA 2DMMA 2H1GA 4L8EA 5HFKA 3NIVA 1XWGA 1FG4A 3UIWA 2IJYA 3RAZA 1SU9A 1X5CA 3QDNA 1FVKA 4O32A 1O8WA 1PKWA 4GSNA 2CAIA 2LQOA 1TRVA 2RM6A 1TU7A 3VPTA 3KGKA 2GSRA 1XWAA 3F6DA 1CQGA 1OKTA 3SBCA 3GKXA 3PINA 1Z7RA 4ID0A 2V32A 2KP2A 1GSQA 1F6MC 3HZ4A 1X9WB 1RQMA 2JADA 4X1UA 5G30A 2VCWA 3F4TA 1TRSA 1UC7A 2PVOC 3G7IA 1PX7A 1XWCA 5EY6A 4GSTA 2AJQB 4MJBA 4ZXGA 3DXBA 4FIWA 3HYPA 1GUHA 3ZMLA 1VF1A 2X8GA 4MZBA 3GL3A 2L6CA 1O7UA 1FB0A 4I5QA 1SJIA 1TDIA 1JLVA 3N9JA 1ZGNA 3FZ5A 2IMKA 4POLA 1WWJA 4LL4B 1PKZA 2O7KA 2FWEA 2KLXA 4V2MA 2C3TA 2ZUPA 2LRNA 3F6FA 1TRUA 2VL2C 3GA4A 2JSYA 4HDEA 3PH9A 3FW2A 4JEDA 1GTIA 1R5PA 4KX4A 6GSVA 2FGXA 3LQ7A 5IO2A 3CXGA 2HSHA 3Q74A 2MMOA 2X64A 2OJLA 1O6JA 2CVBA 2VIMA 2VOCA 1TRWA 10GSA 2BTOT 3D5JA 4WXTA 3Q6OA 1AXDA 4TKYA 2TRCP 4H86A 4EC0A 4HQSA 3KIJA 4WF5A 1PQNA 3GIXA 4XRAA 1UVZA 3F8UA 3RDWA 4L0WA 4XRDA 3UVHA 2H1AA 1WP0A 3CRTA 1IYIA 4MZWA 2GT6A 1BQ7A 2PGTA 3NOFA 2YOIA 3BBYA 3IA1A 2R2JA 2HZEA 1PN9A 5J4UA 4DSQA 2I4AA 2CVDA 4RQXA 4MJCA 2FHEA 5J3RA 2J23A 3HY2A 2DMLA 2GLRA 1M2AA 3TOUA 1GSDA 1S3AA 5E4WA 3F4RA 1GNWA 4TW5A 5GAND 2JZTA 4ISDA 5AISA 1SK0A 4YQVA 2IN3A 1XCCA 2HSYA 3DWVA 4OCFA 2GSTA 1AW9A 3H79A 4K7NA 3C1SA 3UL3A 2EIOA 2R37A 2I81A 1BG5A 3TRXA 1W4VA 1XVQA 1GSYA 1E2YA 1OE8A 3D4TA 3ZREA 3Q18A 2PMTA 2M46A 1NM3A 4ZL7A 6GSTA 2C0DA 3L0HA 4TR1A 1N8JA 4ECIA 4NHZA 2F8FA 5DALA 1Q4JA 4TN8A 3UJ1A 1T8EB 1T4ZA 1K0NA 2YJ7A 3L78A 2VCXA 1SL1B 1SJ6A 4OO5A 3GTUB 4BWSA 3IBHA 1G0TA 1ST9A 2H8LA 2B5EA 4FH8A 14GSA 2VCTA 2B3SA 2HSMA 1XOAA 4GRFA 4TRXA 1SYRA 2IMFA 3LG6A 2I1UA 2H73A 2VL3A 1U6TA 2VLTA 2GSSA 3FRCA 2YN1A 3ERGA 2F8AA 3FR6A 4F0BA 1T3BA 1OC8A 1QXHA 1GUKA 1Z3EA 5H5RA 1TU8A 5EL8A 3GH9A 4PGTA 1WJKA 4OMVA 3IV4A 5D73A 2H6XA 2HZFA 4MH3A 4MF7A 3ZVJD 18GSA 2V6OA 1ZL9A 1FW1A 5D9VA 2NTOA 1X5DA 3QPMA 2ZCTA 3FR3A 3GKKA 4TVEA 2YZHA 1K0OA 3MWHA 4IKHA 2H66A 1M2DA 2DJ2A 1K0BA 2HRFA 2FY6A 5IM9A 1BX9A 4D73B 2FCHA 3MNGA 5ECKB 1AQWA 4IS0A 2QKEA 5C00A 1K0MA 2B6MA 3E9JB 4Q5NA 3CSHA 1GSSA 3IDVA 2O89A 2DJJA 4GCIA 1GWCA 1F2EA 3VURA 2AUVA 20GSA 4TR3A 2DLXA 4RUVA 3LYKA 4YQUA 4K6XA 3TB2A 2MMZA 1XBSA 2HI7A 2VCQA 4XIHA 2A2SA 3KMOA 1FAAA 4MF5A 2GS3A 2O87A 4I2UA 4ULXA 4F0CA 1YEPA 3FHKA 3G9BA 2GTUA 4K9ZA 4GWRA 1GSUA 1FB6A 5IPGA 5ELGA 1O81A 1M99A 3FY7A 2O85A 2BJXA 3BCIA 4DSSB 1FO5A 4PX1A 2GZZA 3GNJA 3M0FA 2I3YA 2PPTA 2C0GA 4PQ1A 2H76A 1W89A 2C0EA 3HA9A 2IFQB 3VFIA 1SK2A 2H74A 11GSA 5AIXA 1EEJA 5J5NA 2IL3A 4K0GA 1K3YA 3M9KA 4IN0A 2GVPA 2M80A 1PX6A 2XC2A 1YEXA 2FA4A 4WF4A 2MBTA 5ECIB 1C72A 2HFDA 2EC4A 3EU4A 4NMUA 2OE0A 2R4VA 4POKA 4AJ6A 1TK5B 1K0AA 4TR4A 4PUFC 3JCML 1UA5A 1H4OA 2OE1A 3CRUA 2RLIA 3TKSE 5LD0A 1ZYEA 3UBKA 4TXOA 4WETA 2FWHA 2DBCA 3QR6A 2KHPA 1WE0A 1ZOFA 3GH6A 4AF2A 2KUCA 5ID2A 3BOAA 4G0IA 1G7OA 2DIZA 1JHBA 4FYCA 5B6MA 1GTUA 3J7Yb 1URMA 1YDKA 3DEXA 3DKSA 2WULA 3ZLPA 4Z7XA 3A2XA 2DJ1A 2CX4A 2K18A 4O5RA 3L9SA 4CDOA 1GRXA 5KEJA 4LMVA 4BVYA 1OC9A 4IQAA 2GZPA 3E0UA 1LU4A 1N2AA 3G7YA 4ML1A 1MEKA 4EE0A 3GRXA 1TJDA 4L5LA 3EYTA 1S3CA 3EWLA 3P8WA 1TOFA 3MDKA 2C3QA 2AHEA 4J2FA 2QSIA 4I97A 2H0GA 3HD5A 1M7TA 2B7KA 5CNWA 1YJ6A 4JRRA 3GL5A 2H71A 3I9V2 3WYWA 3GN3A 1EEMA 4TR0A 1U3IA 3G7JA 2L6DA 4MCUA 1YY7A 2MZCA 5DJLA 5B6NA 1YF1A 3APQA 2CT6A 3GKNA 3FZ4A 4GSSA 1RK4A 2HRKB 3APOA 4GTUA 3FZ9A 3ZMKA 3TOTA 4LMWA 2VAFA 3HZ8A 4EL1A 4NXIA 4Q5FA 3ZYWA 2YV7A 1SK1A 3KP8A 3LXZA 3GMFA 4WBRD 1GL8A 2XBQA 1EWXA 4IJIA 5ECLB 1O85A 2HE3A 2DIYA 2H19A 1KTEA 4MJAA 3CSIA 4GXZA 4N0VA 5F05A 3ZTLA 3EC3A 3ERFA 3TKSC 5ABRA 4WKWA 5GAPD 3N5OA 4OFNA 1HNCA 5G1KA 1AQXA 2ON7A 3CYNA 5J41A 5CP1A 1J08A 1M9AA 1F9MA 5AGYA 2WZ9A 4ZB8A 4NAXA 3VWXA 5GSTA 3ZFLA 3TUEA 4I2TA 2OACA 4BL7B 4KH7A 1YZXA 4KGIA 1V98A 1A23A 2H01A 3ED3A 3A5WA 5IMFA 1ON4A 1EV4A 1U3AA 1PD21 5JWOB 5HFIA 1ERUA 3QD9A 5IPHA 9GSSA 5F0GA 4PUAA 1O73A 1SD9A 3BD2A 1T00A 3PR8A 4HU9A 3KCMA 2FD3A 2HT9A 1OC3A 2H1DA 3GUSA 3HJPA 1Q98A 3APSA 2NBSA 4V1Ap 3O3TA 1B9XC 2TRXA 2OA7A 2VM1A 1KEBA 2B5YA 5HR1A 3EVIA 3A2WA 3L9UA 1R4WA 1EP7A 3LORA 4F82A 1VRSD 2LJKA 1Y6EA 1S3DA 5HQPA 2CQ9A 3HKRA 1K3OA 3DMLA 4ILFA 1ERWA 4POBA 4EDZA 5KN1A 3VWVA 3EINA 5A4VA 4F9ZA 1MD3A 1SJZA 1XFLA 5E59A 2GDRA 3QAVA 4N0ZA 1THOA 1G6WA 4N30A 3OR5A 1G7EA 2NVLA 2FWGA 3CBUA 1MDIA 5IOXA 4XS4A 2I9HA 3GKMA 3IXRA 4K2DA 3I6AA 1HYUA 4AGSA 2HRNA 3P2AA 3HJOA 4PURA 3H4KA 1H75A 4HOJA 3UVTA 3IK7A 5H5SA 2L5OA 3ZIVA 2H75A 3DYRA 3DD3A 2IMDA 3E3EA 4K0NA 2P31A 1X9SB 2FUG2 3LSZA 3GFKA 2H72A 1QK8A 3W8SA 4PXOA 3UEMA 5G5FA 2F51A 1GSEA 1OE7A 2JACA 2VD0A 4IBPA 2EIQA 3F4SA 1XZOA 2WJUA 4ML6A 1A2LA 1R7HA 1R26A 4HZ2A 1HD2A 3RBTA 4IJ3A 4NV5A 3RPPA 2LTKA 3GV1A 3L4NA 3GX0A 4ECBA 5ELAA 1PSQA 2PBJA 4TR1B
chains in the Genus database with same CATH superfamily
5DALB 4ZBBA 2MMNA 3ME7A 2LSTA 3ZIJA 1QFNA 1KNGA 5D9XA 1JZRA 5GSSA 2XHFA 1PRXA 3FZAA 4MABA 2YWMA 3EURA 7GSSA 2HSMB 3M1GA 3DVXA 3CQFA 3W8JA 2C1YA 1EGRA 1TTZA 1I9DA 3IAS2 4ZB9A 3CMIA 4NPBA 2VM2A 1EOGA 19GSA 1VGLA 2IMEA 4F2IA 1DSBA 2WDUA 4EXJA 3M3MA 4N11A 1M9BA 1A0FA 3RHCA 2K8VA 8GSSA 1EV9A 4AJ7A 2RUEA 4K7IA 2LV3A 4BVXA 1BJXA 2WB9A 4NHWA 2FLSA 1V9WA 4MDCA 4OFMA 4HUAA 3GX8A 2IMIA 2P5RA 4TXVA 2JZRA 3ZZXA 2XPDA 3UAPA 3ISOA 3LW9A 2XBIA 3TRPA 4AJ8A 2TIRA 2VCVA 4XTSA 2EIRA 3LXTA 3LFLA 2DJ3A 3VI5A 13GSA 1M2BA 16GSA 3QMXA 2L5LA 2YPMA 2WS2A 5D8IA 3U5RE 3ZL5A 5KN0A 1GNEA 4CY6A 2YWIA 3CSJA 2JL4A 5D9TA 4L0UA 3KXOA 1QGVA 3EE2A 3QFAC 3TCOA 2CZ3A 3F3QA 4G9HA 1B9YC 3R3EA 1ZCPA 3U6VA 6GSUA 3TKRA 4MP4A 3VWWA 2L4QA 3LGCA 3WT2A 5DAKB 3UBLA 1B8XA 2CA8A 1XW9A 3K8NA 2GQLA 4DSSA 4FYUA 5ECRB 4WEYA 1IYHA 2F9SA 4G10A 2A2PA 2OKAA 3HVXA 3A3TA 1GULA 4WR4A 2R3XA 4E8EA 3UMAA 1EGOA 3PPUA 3VK9A 4MLYA 2ES7A 5AN1A 3HXSA 2N5AA 3H1NA 3KH9A 4WBJA 1DE1A 2VLVA 3EMPA 1F3AA 2CX3A 1BEDA 2G0FA 1AC1A 3RGBC 3KP9A 4Q5QA 3NZNA 2WVYA 3GSSA 1GP1A 1ML6A 4K7OA 3F0IA 5FT3A 4PQIA 1GUMA 4HZ4A 1WPIA 4YQMA 2WCIA 6GSYA 1V40A 3RPNA 2V1MA 1V2AA 4O92A 2HQTA 3TJKA 1TP9A 2MYGA 2E2MA 3VI7A 1XIYA 3AY8A 1OVNA 2AV4A 2V6KA 5CREA 4MNNA 2B1KA 4IGJA 5BMUA 4K5SA 2NPBA 2DJKA 1X0RA 1G6YA 5DVBA 2KOKA 5DJMA 3D4MA 5D9WA 5G5EA 3C71A 2DSAA 5ECMB 3P7XA 1JZOA 4G0LA 4CHSA 3TJFA 3MSZA 1NHYA 3IHQA 3I43A 1CQHA 4LA1A 2A4VA 1GLPA 2LRTA 3SWLA 3H93A 4HJ2A 5CO3A 3GHAA 5EVOA 2VL9A 4TXOB 4Z2RA 2B1LA 2PU9C 5IOWA 4K5RA 1K0CA 1TW9A 1OKDA 4MF6A 4V2LA 3M8NA 5ID2B 5ECSA 3D21A 4X0XA 5A5KA 1GSFA 2H1BA 3C73A 4DVCA 4GLTA 2KP1A 4G19A 2WVZA 3C7MA 4ZL8A 3KTLA 3BJ5A 2O36A 1PL1A 2PUKC 1QMVA 5AIVA 2OBKA 2YANA 4OFTA 2B7JA 1USBA 2WW0A 4MMMA 4AKGA 2P5QA 5FWGA 1TI1A 3F63A 3R2QA 1OC9B 4J57E 3WD6A 1O8XA 4X43A 1FOVA 3O76A 3D6IA 2CAQA 2C0FA 2E2GA 5IMAA 4N10A 1F3BA 5LCZA 1VF3A 3IR4A 4FYBA 2Z9SA 4RI7A 2QA1A 3MAKA 2GQKA 5J9CA 1XOBA 1PGTA 3KTBA 4TOPA 4EDYA 2QC7A 2H30A 2L4CA 3TKQA 2HRKA 4IHUA 5LNKe 5DDLA 4JZQA 4EO3A 4XS1A 1V57A 3DIEA 1J9BA 2RIIA 3TJBA 1WMJA 3FKFA 2YCDA 5JWQB 4IQ1A 2GSQA 2R5GA 3WGDA 2WZSA 2AB6A 4GQFA 5G31A 1LJRA 2VUPA 2H0HA 2HSNB 2NDOA 4FQUA 1T4YA 3M9JA 4IP1A 1MDJA 2REMA 1XWBA 4PTSA 3DVWA 2VO4A 4ZB6A 5KN3A 2VL2A 2IPAA 3ZITA 2K8SA 2EFHA 1NW2A 4MPFA 1ZYPA 3WT1A 1ILOA 2YNXA 3FEUA 5A1NA 5A4UA 2UV8G 4P3YB 2H0IA 4KNDA 5F8BA 3S9FA 4I6XA 2AAWA 1JLWA 4KCAA 1SL0B 4BL7A 1THXA 2H6YA 5IIZA 4HQZA 4PI0C 2X8HA 2LKUA 5COHA 1B4QA 1MDKA 4NWYA 1M0UA 2X49A 5IQYA 2WVXB 4EKZA 1SD8A 1E6BA 2LNTA 1BG1A 1EOHA 3EMXA 3IC8A 1F37A 2GT5A 1ERTA 1DE2A 2FA8A 3LYPA 2B5XA 1XWKA 2V41A 4KA0A 2RUFA 4V2NA 3TGZA 1YF0A 4IVFA 1GLQA 4RI6A 2WW1A 4O7HA 2BMXA 2G2QA 2HNLA 3HCZA 3H8QA 1I1IP 3HHVA 4IP6A 1OYJA 3F9UA 2V2GA 5G1LA 3QFBC 1MD4A 4MPGA 3LEFA 1YVLA 4DEJA 1UN2A 4O5QA 3QCPA 2WRTA 3KEBA 3I69A 3BCKA 4BPYA 3UOMA 3DGQA 4KW6A 1A8LA 2HYXA 4YAVA 5B7CA 1HQOA 1PFOA 3C8EA 3QAWA 2C80A 4GF0A 2X8CA 3CTFA 3HVVA 1BAYA 2GZYA 1PA3A 2YV9A 3ME8A 2HZEB 2GGTA 1FOHA 2QGVA 4PI2C 5DBQA 2FWFA 2HXKA 2C8UA 1ZZYA 4OCEA 5HR0A 2YP6A 1PMTA 3LWAA 2E0QA 5IO0A 2CZ2A 4MZCA 5F06A 3IK9A 4XS4B 1JZDA 1TK8B 3CHXC 2H70A 1ERVA 5CRWA 1WOUA 2HLSA 1WRYA 1K3LA 5CAXA 1AQVA 5ECNB 5JCUA 3L9VA 1LBKA 3P90A 3FK8A 5F07A 3CTGA 4EVMA 5ECHB 3IE3A 1Y25A 5DQYA 4ZBDA 1A0RP 4NV2A 3PGTA 5B8AA 5L71A 5KOWA 1TK0B 3VPQA 2N5FA 5INYA 2LJAA 3GTUA 5CRDA 4K2XA 1K0DA 1PL2A 2OE3A 1FHEA 2XPEA 1ABAA 2LQQA 2LEGA 4CW9A 3KH7A 3ZFBA 5HR2A 2IIYA 3DRNA 2P0GA 5GZZB 4E8HA 1A24A 4HJMA 2ZNMA 5JCGA 1YQ1A 1XPVA 3EU3A 3IRAA 3F3RA 4GQCA 3GYKA 5B8BA 5ECQB 2EFDA 4G0KA 4KSMA 1DBYA 4KSOA 2IWTA 2J9HA 4KCEA 4KDUA 4QQ7A 4K1FA 4XHMA 2K9FA 5FHIA 1NHOA 4MH2A 1RW1A 4HI7A 4JBBA 2MMAA 1XW5A 1WIKA 4K8MA 2C4JA 4FO5A 3KZQA 2YJHA 1A8YA 3GSTA 1ZMAA 3LJRA 1ZYQB 3ERWA 3IHGA 3RHBA 5DCGA 1T1VA 1SENA 4F03A 4WR5A 3FYGA 5J9BA 3TRQA 4AKHA 1KBNA 2PWJA 2VLUA 2L57A 4MK3A 4EIQA 2D2ZA 3GURA 1JZWA 1Z7PA 1TI3A 5BRTA 4YAPA 1TKDB 4Z2UA 3V1WA 2CVKA 2O5VA 5HFGA 3HVSA 2DJ0A 2YWOA 5IMVA 4BVXB 4OO4A 4D73A 4ZIJA 2OBIA 4Q5RA 5D96A 5ENUA 2CV4A 1YKCA 3FMWA 1GH2A 5IMCA 2RM5A 2ALBA 1VF4A 4BA7A 3TJGA 1B4PA 3VLNA 3IC4A 4LLRA 5JWRB 4ICYA 4XS6A 1R5AA 1AIUA 4N3ZA 2LS5A 22GSA 3C1RA 3WGEA 1ACVA 1X5EA 4IW9A 4QMKA 1Z5YE 12GSA 3FR9A 3WGXA 1QQ2A 6GSSA 2JU5A 1XXUA 1VF2A 2O8VB 4PNFA 1TXXA 5ECPB 4PNGA 4OWYA 4L5OA 4RQRA 1JFUA 2PN8A 5DAKA 3QAGA 4PQHA 5CRHA 2LRCA 2LNSA 1SL2B 3TKPA 2X99A 2YWNA 5HR3A 4LL1B 2WFCA 3TDGA 2PVQA 5DCHA 1U88A 1FVJA 2WGRA 2OT3A 2IFQA 4EUYA 2A2RA 4KDXA 6GSWA 4ZB7A 6GSXA 2YZUA 4KDYA 5EPFA 3KJYA 2LUSA 1GTBA 1EZKA 4HU7A 1Z6NA 1XW6A 4XCSA 4IELA 1I5GA 3KM6A 2PERA 1SKWB 4BWQA 1OAZA 1BYEA 2DC5A 4KB3A 3KD0A 1AUCA 4ZILA 2F3MA 2QA2A 5CYYA 1EP8A 1T7PB 4MA9A 2R6KA 3O6TA 1Z6MA 1YKAA 4J56E 5A4WA 1A2JA 1HNAA 1SVMA 1U87A 2LJRA 5ECOB 3US3A 1SKSB 17GSA 2FNOA 2H6ZA 5IMDA 4KE3A 1V58A 3Q19A 2JZSA 1Z9HA 3D22A 5D93A 3D0ZA 1X9MB 2X4AA 1SYXA 3HJMA 1N25A 4ZBAA 4KUNA 5H5QA 4KAEA 2UZ8A 4I8BA 5C04A 4YH2A 1J0FA 2VD1A 3IPZA 3KMNA 2C3NA 2HRAA 4EF0A 2ON5A 4ACSA 1B48A 4ECJA 4MJEA 2AYTA 5IMZA 4G01A 4JR4A 4HEA2 1XVWA 5J4YA 4G2EA 4DSRA 1SKRB 3ZRDA 3IOSA 4USSA 4BVYB 4Z2TA 1HNBA 1A2MA 1QUWA 4HS1A 2A4HA 3QOUA 3A2VA 2E7PA 3ZVJA 3W6GA 3UARA 2JSZA 3IAM2 1NSWA 2VCZA 5DQSA 2MBSA 4V1Ag 5JCWA 3VWUA 1GTAA 1DUGA 1MTCA 4X4JA 3TKSA 2GQMA 3J7Yk 4JU5A 4ECCA 2N5BA 5G2ZA 4QL9A 2K6VA 3HDCA 4QL7A 1AAZA 4ZL9A 4JE1A 4OD7A 4POMA 2L59A 1M3JA 5CRGA 3TJJA 5A5HA 2M72A 4KF9A 4JR6A 5KN2A 2OADA 2DMMA 2H1GA 4L8EA 5HFKA 3NIVA 1XWGA 1FG4A 3UIWA 2IJYA 3RAZA 1SU9A 1X5CA 3QDNA 1FVKA 4O32A 1O8WA 1PKWA 4GSNA 2CAIA 2LQOA 1TRVA 2RM6A 1TU7A 3VPTA 3KGKA 2GSRA 1XWAA 3F6DA 1CQGA 1OKTA 3SBCA 3GKXA 3PINA 1Z7RA 4ID0A 2V32A 2KP2A 1GSQA 1F6MC 3HZ4A 1X9WB 1RQMA 2JADA 4X1UA 1XG8A 5G30A 2VCWA 3F4TA 1TRSA 1UC7A 2PVOC 3G7IA 1PX7A 1S3RA 1XWCA 5EY6A 4GSTA 2AJQB 4MJBA 4ZXGA 3DXBA 4FIWA 5A1NB 1GUHA 3ZMLA 1VF1A 2X8GA 3HYPA 4MZBA 3GL3A 2L6CA 1O7UA 2R0CA 1FB0A 4I5QA 1SJIA 1TDIA 2WW2A 1JLVA 3N9JA 1ZGNA 3FZ5A 2IMKA 4POLA 1WWJA 4LL4B 1PKZA 2O7KA 4AKIA 2FWEA 2KLXA 4V2MA 2C3TA 4AI6A 2ZUPA 5A34A 2LRNA 3F6FA 1TRUA 2VL2C 3GA4A 2JSYA 4HDEA 3PH9A 3FW2A 4JEDA 1GTIA 1R5PA 4KX4A 6GSVA 2FGXA 3LQ7A 5IO2A 3CXGA 2HSHA 3Q74A 2MMOA 2X64A 2OJLA 1O6JA 2CVBA 2VIMA 2VOCA 1TRWA 10GSA 2BTOT 3D5JA 4WXTA 3Q6OA 1AXDA 4TKYA 2TRCP 4H86A 3MYDA 4EC0A 4HQSA 3KIJA 4WF5A 1PQNA 3GIXA 4XRAA 1UVZA 3F8UA 3RDWA 4L0WA 4XRDA 3UVHA 2H1AA 1WP0A 3CRTA 1IYIA 4MZWA 2GT6A 1BQ7A 2PGTA 3NOFA 4HSCX 2YOIA 3BBYA 3IA1A 2R2JA 2HZEA 1PN9A 5J4UA 4DSQA 4YKGA 2I4AA 2CVDA 4RQXA 4A5PA 4MJCA 2FHEA 5J3RA 2J23A 3HY2A 1TXUA 2DMLA 4PHZC 2GLRA 1M2AA 3TOUA 1GSDA 3HMJG 1S3AA 5E4WA 3F4RA 1GNWA 4TW5A 5GAND 2JZTA 4ISDA 5AISA 1SK0A 4YQVA 2IN3A 1XCCA 2HSYA 3DWVA 4OCFA 2GSTA 4O5UA 1AW9A 3CWGA 3H79A 4K7NA 3C1SA 4W66A 3UL3A 2EIOA 2R37A 2I81A 1BG5A 3TRXA 1W4VA 1XVQA 1GSYA 1E2YA 1OE8A 3D4TA 3ZREA 3Q18A 2PMTA 2M46A 1NM3A 4ZL7A 6GSTA 2C0DA 3L0HA 4TR1A 1N8JA 4ECIA 4NHZA 2F8FA 5DALA 1Q4JA 4TN8A 3UJ1A 1T8EB 1T4ZA 1K0NA 2YJ7A 3L78A 2VCXA 1SL1B 1SJ6A 4OO5A 3GTUB 4BWSA 3IBHA 1G0TA 1ST9A 2H8LA 2B5EA 4FH8A 14GSA 2VCTA 2B3SA 2HSMA 1XOAA 4GRFA 4TRXA 1SYRA 2IMFA 3LG6A 2I1UA 2H73A 2VKZG 2VL3A 1U6TA 2VLTA 2GSSA 3FRCA 2YN1A 3ERGA 2F8AA 3FR6A 4F0BA 1T3BA 1OC8A 2R0PA 1QXHA 1GUKA 1Z3EA 5H5RA 1TU8A 5EL8A 3GH9A 4PGTA 1WJKA 4GDFA 2DKHA 4OMVA 3IV4A 5D73A 2H6XA 2HZFA 4MH3A 4MF7A 4FXYP 3ZVJD 18GSA 2V6OA 1ZL9A 1FW1A 5J4VA 5D9VA 2NTOA 1X5DA 3QPMA 2ZCTA 4BIKA 3FR3A 3GKKA 4TVEA 2YZHA 3RFRC 1K0OA 3MWHA 4IKHA 2H66A 1M2DA 2DJ2A 1K0BA 2HRFA 2FY6A 5IM9A 1BX9A 4D73B 2FCHA 3MNGA 5ECKB 1AQWA 4IS0A 2QKEA 3MIXA 5C00A 1K0MA 2B6MA 3E9JB 4Q5NA 3CSHA 4AKXB 1GSSA 3IDVA 2O89A 2DJJA 4GCIA 1GWCA 1F2EA 3VURA 2AUVA 20GSA 4TR3A 2DLXA 4RUVA 3LYKA 4YQUA 4K6XA 3TB2A 2MMZA 1XBSA 2HI7A 2VCQA 4XIHA 2A2SA 3KMOA 1FAAA 4MF5A 2GS3A 2O87A 4I2UA 4ULXA 4F0CA 1YEPA 3FHKA 3G9BA 2GTUA 4K9ZA 4GWRA 1GSUA 2R0GA 1FB6A 5IPGA 5ELGA 1O81A 1M99A 3FY7A 2O85A 2BJXA 3BCIA 4DSSB 1FO5A 4PX1A 2GZZA 3GNJA 3M0FA 2I3YA 2PPTA 2C0GA 4PQ1A 2H76A 1W89A 2C0EA 5KOXA 3HA9A 2IFQB 3VFIA 1SK2A 4EIPA 2H74A 11GSA 5AIXA 1EEJA 5J5NA 2IL3A 4K0GA 1K3YA 3M9KA 4IN0A 2GVPA 2M80A 1PX6A 2XC2A 1YEXA 1BF5A 2FA4A 4WF4A 2MBTA 5ECIB 1C72A 2HFDA 2EC4A 3EU4A 4NMUA 2OE0A 2R4VA 4POKA 4AJ6A 2DKIA 1TK5B 3EPTA 1K0AA 4TR4A 4PUFC 3JCML 1UA5A 1H4OA 2OE1A 3CRUA 2RLIA 3TKSE 5BMUB 5LD0A 1ZYEA 3UBKA 4TXOA 4WETA 2FWHA 2DBCA 3QR6A 1Y1UA 2KHPA 1WE0A 1ZOFA 4CY8A 3GH6A 2EFEA 4AF2A 2KUCA 5ID2A 3BOAA 4G0IA 1G7OA 2DIZA 1JHBA 4FYCA 5B6MA 1GTUA 3J7Yb 1URMA 1YDKA 3DEXA 3DKSA 2WULA 3ZLPA 4Z7XA 3A2XA 2DJ1A 2CX4A 2K18A 4O5RA 3L9SA 4CDOA 1GRXA 5KEJA 4LMVA 4BVYA 1OC9A 4IQAA 2GZPA 3E0UA 1LU4A 1N2AA 3G7YA 4ML1A 1MEKA 4EE0A 1S4BP 3GRXA 1TJDA 4L5LA 3EYTA 2H1LA 1S3CA 3EWLA 3P8WA 1TOFA 3MDKA 2C3QA 2AHEA 4J2FA 2QSIA 4I97A 2H0GA 3HD5A 1M7TA 2B7KA 5CNWA 1YJ6A 4JRRA 3GL5A 5J40A 2H71A 3I9V2 3WYWA 3GN3A 1EEMA 4TR0A 1U3IA 3G7JA 5J47A 2L6DA 4MCUA 1YY7A 2MZCA 5DJLA 5B6NA 1YF1A 3APQA 2CT6A 3GKNA 2HSNA 3HVNA 3FZ4A 4GSSA 1RK4A 2HRKB 3TU3B 3APOA 4GTUA 3FZ9A 3ZMKA 3TOTA 4LMWA 2VAFA 3HZ8A 4EL1A 4NXIA 4Q5FA 5A5HB 3ZYWA 2YV7A 1SK1A 3KP8A 3LXZA 3GMFA 4WBRD 1GL8A 2XBQA 1EWXA 4IJIA 5ECLB 1O85A 2HE3A 2DIYA 2H19A 1KTEA 4MJAA 3CSIA 4GXZA 4N0VA 5F05A 3ZTLA 3EC3A 3ERFA 3TKSC 5ABRA 4WKWA 5GAPD 3N5OA 2EFCA 4OFNA 2O3EA 1HNCA 5G1KA 1AQXA 2ON7A 3CYNA 5J41A 5CP1A 1J08A 1M9AA 1F9MA 5AGYA 2WZ9A 4ZB8A 4NAXA 3VWXA 5GSTA 2WVXA 3ZFLA 3TUEA 4I2TA 2OACA 4BL7B 4KH7A 1YZXA 4KGIA 1V98A 1A23A 2H01A 3ED3A 3A5WA 5IMFA 1SVLA 1ON4A 1EV4A 1U3AA 1PD21 5JWOB 5HFIA 1ERUA 3QD9A 5IPHA 9GSSA 5F0GA 4PUAA 1O73A 1SD9A 3BD2A 1T00A 3PR8A 4HU9A 1M3IA 3KCMA 2FD3A 2HT9A 5A34B 1OC3A 2H1DA 3GUSA 3HJPA 1Q98A 3APSA 2NBSA 4V1Ap 3O3TA 1B9XC 2TRXA 2OA7A 2VM1A 1KEBA 2B5YA 5HR1A 3EVIA 3A2WA 3L9UA 1R4WA 1EP7A 3LORA 4F82A 1VRSD 2LJKA 1Y6EA 1S3DA 5HQPA 2CQ9A 3HKRA 1K3OA 3DMLA 4ILFA 1ERWA 4POBA 4EDZA 5KN1A 3VWVA 3EINA 5A4VA 4F9ZA 1MD3A 1SJZA 1XFLA 5E59A 2GDRA 3QAVA 4N0ZA 1THOA 1G6WA 4N30A 3OR5A 1G7EA 2NVLA 2FWGA 1ZYNA 3CBUA 1MDIA 5IOXA 4XS4A 2I9HA 3GKMA 3IXRA 4K2DA 3I6AA 1HYUA 4AGSA 2HRNA 3P2AA 3HJOA 4PURA 3H4KA 1H75A 4HOJA 3UVTA 3IK7A 5H5SA 2L5OA 3ZIVA 2H75A 3DYRA 3DD3A 2WW3A 2IMDA 3E3EA 4K0NA 2P31A 1X9SB 2FUG2 3A5IA 3LSZA 3GFKA 2H72A 1QK8A 3W8SA 4PXOA 3UEMA 5G5FA 2F51A 1GSEA 1OE7A 2JACA 2VD0A 4IBPA 2EIQA 3F4SA 1XZOA 1PN0A 2WJUA 4E68A 4ML6A 1A2LA 1R7HA 1R26A 4HZ2A 1HD2A 3RBTA 4IJ3A 4NV5A 3RPPA 1SVOA 1YEWC 2LTKA 3GV1A 3L4NA 3GX0A 4ECBA 4YKFA 5ELAA 1PSQA 2PBJA 4TR1B
chains in the Genus database with same CATH topology
5DALB 4ZBBA 2MMNA 3ME7A 2LSTA 3ZIJA 1QFNA 1KNGA 5D9XA 1JZRA 5GSSA 2XHFA 1PRXA 3FZAA 4MABA 2YWMA 3EURA 7GSSA 2HSMB 3M1GA 3DVXA 3W8JA 2C1YA 1EGRA 1TTZA 1I9DA 3IAS2 4ZB9A 3CMIA 4NPBA 2VM2A 1EOGA 19GSA 1VGLA 2IMEA 4F2IA 1DSBA 2WDUA 4EXJA 3M3MA 4N11A 1M9BA 1A0FA 3RHCA 2K8VA 8GSSA 1EV9A 4AJ7A 2RUEA 4K7IA 2LV3A 4BVXA 1BJXA 2WB9A 4NHWA 2FLSA 1V9WA 4MDCA 4OFMA 4HUAA 3GX8A 2IMIA 2P5RA 4TXVA 2JZRA 3ZZXA 2XPDA 3UAPA 3ISOA 3LW9A 2XBIA 3TRPA 4AJ8A 2TIRA 2VCVA 4XTSA 2EIRA 3LXTA 3LFLA 2DJ3A 3VI5A 13GSA 1M2BA 16GSA 3QMXA 2L5LA 2YPMA 2WS2A 5D8IA 3U5RE 3ZL5A 5KN0A 1GNEA 4CY6A 2YWIA 3CSJA 2JL4A 5D9TA 4L0UA 3KXOA 1QGVA 3EE2A 3QFAC 3TCOA 2CZ3A 3F3QA 4G9HA 1B9YC 3R3EA 1ZCPA 3U6VA 6GSUA 3TKRA 4MP4A 3VWWA 2L4QA 3LGCA 3WT2A 5DAKB 3UBLA 1B8XA 2CA8A 1XW9A 3K8NA 2GQLA 4DSSA 4FYUA 5ECRB 4WEYA 1IYHA 2F9SA 4G10A 2A2PA 2OKAA 3HVXA 3A3TA 1GULA 4WR4A 2R3XA 4E8EA 3UMAA 1EGOA 3PPUA 3VK9A 4MLYA 2ES7A 5AN1A 3HXSA 2N5AA 3H1NA 3KH9A 4WBJA 1DE1A 2VLVA 3EMPA 1F3AA 2CX3A 1BEDA 2G0FA 1AC1A 3KP9A 4Q5QA 3NZNA 3GSSA 1GP1A 1ML6A 4K7OA 3F0IA 5FT3A 4PQIA 1GUMA 4HZ4A 1WPIA 4YQMA 2WCIA 6GSYA 1V40A 3RPNA 2V1MA 1V2AA 4O92A 2HQTA 3TJKA 1TP9A 2MYGA 2E2MA 3VI7A 1XIYA 3AY8A 1OVNA 2AV4A 2V6KA 5CREA 4MNNA 2B1KA 4IGJA 5BMUA 4K5SA 2NPBA 2DJKA 1X0RA 1G6YA 5DVBA 2KOKA 5DJMA 3D4MA 5D9WA 5G5EA 3C71A 2DSAA 5ECMB 3P7XA 1JZOA 4G0LA 4CHSA 3TJFA 3MSZA 1NHYA 3IHQA 3I43A 1CQHA 4LA1A 2A4VA 1GLPA 2LRTA 3SWLA 3H93A 4HJ2A 5CO3A 3GHAA 5EVOA 2VL9A 4TXOB 4Z2RA 2B1LA 2PU9C 5IOWA 4K5RA 1K0CA 1TW9A 1OKDA 4MF6A 4V2LA 3M8NA 5ID2B 5ECSA 3D21A 4X0XA 5A5KA 1GSFA 2H1BA 3C73A 4DVCA 4GLTA 2KP1A 4G19A 3C7MA 4ZL8A 3KTLA 3BJ5A 1PL1A 2PUKC 1QMVA 5AIVA 2OBKA 2YANA 4OFTA 2B7JA 1USBA 4MMMA 4AKGA 2P5QA 5FWGA 1TI1A 3F63A 3R2QA 1OC9B 4J57E 3WD6A 1O8XA 4X43A 1FOVA 3O76A 3D6IA 2CAQA 2C0FA 2E2GA 5IMAA 4N10A 1F3BA 5LCZA 1VF3A 3IR4A 4FYBA 2Z9SA 4RI7A 2QA1A 3MAKA 2GQKA 5J9CA 1XOBA 1PGTA 3KTBA 4TOPA 4EDYA 2QC7A 2H30A 2L4CA 3TKQA 2HRKA 4IHUA 5LNKe 5DDLA 4JZQA 4EO3A 4XS1A 1V57A 3DIEA 1J9BA 2RIIA 3TJBA 1WMJA 3FKFA 2YCDA 5JWQB 4IQ1A 2GSQA 2R5GA 3WGDA 2AB6A 4GQFA 5G31A 1LJRA 2VUPA 2H0HA 2HSNB 2NDOA 4FQUA 1T4YA 3M9JA 4IP1A 1MDJA 2REMA 1XWBA 4PTSA 3DVWA 2VO4A 4ZB6A 5KN3A 2VL2A 2IPAA 3ZITA 2K8SA 2EFHA 1NW2A 4MPFA 1ZYPA 3WT1A 1ILOA 2YNXA 3FEUA 5A1NA 5A4UA 2UV8G 4P3YB 2H0IA 4KNDA 5F8BA 3S9FA 4I6XA 2AAWA 1JLWA 4KCAA 1SL0B 4BL7A 1THXA 2H6YA 5IIZA 4HQZA 2X8HA 2LKUA 5COHA 1B4QA 1MDKA 4NWYA 1M0UA 2X49A 5IQYA 4EKZA 1SD8A 1E6BA 2LNTA 1BG1A 1EOHA 3EMXA 3IC8A 1F37A 2GT5A 1ERTA 1DE2A 2FA8A 3LYPA 2B5XA 1XWKA 2V41A 4KA0A 2RUFA 4V2NA 3TGZA 1YF0A 4IVFA 1GLQA 4RI6A 4O7HA 2BMXA 2G2QA 2HNLA 3HCZA 3H8QA 3HHVA 4IP6A 1OYJA 3F9UA 2V2GA 5G1LA 3QFBC 1MD4A 4MPGA 3LEFA 1YVLA 4DEJA 1UN2A 4O5QA 3QCPA 2WRTA 3KEBA 3I69A 3BCKA 4BPYA 3UOMA 3DGQA 4KW6A 1A8LA 2HYXA 4YAVA 5B7CA 1HQOA 3C8EA 3QAWA 2C80A 4GF0A 2X8CA 3CTFA 3HVVA 1BAYA 2GZYA 1PA3A 2YV9A 3ME8A 2HZEB 2GGTA 1FOHA 2QGVA 5DBQA 2FWFA 2HXKA 2C8UA 1ZZYA 4OCEA 5HR0A 2YP6A 1PMTA 3LWAA 2E0QA 5IO0A 2CZ2A 4MZCA 5F06A 3IK9A 4XS4B 1JZDA 1TK8B 2H70A 1ERVA 5CRWA 1WOUA 2HLSA 1WRYA 1K3LA 5CAXA 1AQVA 5ECNB 5JCUA 3L9VA 1LBKA 3P90A 3FK8A 5F07A 3CTGA 4EVMA 5ECHB 3IE3A 1Y25A 5DQYA 4ZBDA 1A0RP 4NV2A 3PGTA 5B8AA 5L71A 5KOWA 1TK0B 3VPQA 2N5FA 5INYA 2LJAA 3GTUA 5CRDA 4K2XA 1K0DA 1PL2A 2OE3A 1FHEA 2XPEA 1ABAA 2LQQA 2LEGA 4CW9A 3KH7A 3ZFBA 5HR2A 2IIYA 3DRNA 2P0GA 5GZZB 4E8HA 1A24A 4HJMA 2ZNMA 5JCGA 1YQ1A 1XPVA 3EU3A 3IRAA 3F3RA 4GQCA 3GYKA 5B8BA 5ECQB 2EFDA 4G0KA 4KSMA 1DBYA 4KSOA 2IWTA 2J9HA 4KCEA 4KDUA 4QQ7A 4K1FA 4XHMA 2K9FA 5FHIA 1NHOA 4MH2A 1RW1A 4HI7A 4JBBA 2MMAA 1XW5A 1WIKA 4K8MA 2C4JA 4FO5A 3KZQA 2YJHA 1A8YA 3GSTA 1ZMAA 3LJRA 1ZYQB 3ERWA 3IHGA 3RHBA 5DCGA 1T1VA 1SENA 4F03A 4WR5A 3FYGA 5J9BA 3TRQA 4AKHA 1KBNA 2PWJA 2VLUA 2L57A 4MK3A 4EIQA 2D2ZA 3GURA 1JZWA 1Z7PA 1TI3A 5BRTA 4YAPA 1TKDB 4Z2UA 3V1WA 2CVKA 2O5VA 5HFGA 3HVSA 2DJ0A 2YWOA 5IMVA 4BVXB 4OO4A 4D73A 4ZIJA 2OBIA 4Q5RA 5D96A 5ENUA 2CV4A 1YKCA 3FMWA 1GH2A 5IMCA 2RM5A 2ALBA 1VF4A 4BA7A 3TJGA 1B4PA 3VLNA 3IC4A 4LLRA 5JWRB 4ICYA 4XS6A 1R5AA 1AIUA 4N3ZA 2LS5A 22GSA 3C1RA 3WGEA 1ACVA 1X5EA 4IW9A 4QMKA 1Z5YE 12GSA 3FR9A 3WGXA 1QQ2A 6GSSA 2JU5A 1XXUA 1VF2A 2O8VB 4PNFA 1TXXA 5ECPB 4PNGA 4OWYA 4L5OA 4RQRA 1JFUA 2PN8A 5DAKA 3QAGA 4PQHA 5CRHA 2LRCA 2LNSA 1SL2B 3TKPA 2X99A 2YWNA 5HR3A 4LL1B 2WFCA 3TDGA 2PVQA 5DCHA 1U88A 1FVJA 2WGRA 2OT3A 2IFQA 4EUYA 2A2RA 4KDXA 6GSWA 4ZB7A 6GSXA 2YZUA 4KDYA 5EPFA 3KJYA 2LUSA 1GTBA 1EZKA 4HU7A 1Z6NA 1XW6A 4XCSA 4IELA 1I5GA 3KM6A 2PERA 1SKWB 4BWQA 1OAZA 1BYEA 2DC5A 4KB3A 3KD0A 1AUCA 4ZILA 2F3MA 2QA2A 5CYYA 1EP8A 1T7PB 4MA9A 2R6KA 3O6TA 1Z6MA 1YKAA 4J56E 5A4WA 1A2JA 1HNAA 1SVMA 1U87A 2LJRA 5ECOB 3US3A 1SKSB 17GSA 2FNOA 2H6ZA 5IMDA 4KE3A 1V58A 3Q19A 2JZSA 1Z9HA 3D22A 5D93A 3D0ZA 1X9MB 2X4AA 1SYXA 3HJMA 1N25A 4ZBAA 4KUNA 5H5QA 4KAEA 2UZ8A 4I8BA 5C04A 4YH2A 1J0FA 2VD1A 3IPZA 3KMNA 2C3NA 2HRAA 4EF0A 2ON5A 4ACSA 1B48A 4ECJA 4MJEA 2AYTA 5IMZA 4G01A 4JR4A 4HEA2 1XVWA 5J4YA 4G2EA 4DSRA 1SKRB 3ZRDA 3IOSA 4USSA 4BVYB 4Z2TA 1HNBA 1A2MA 1QUWA 4HS1A 2A4HA 3QOUA 3A2VA 2E7PA 3ZVJA 3W6GA 3UARA 2JSZA 3IAM2 1NSWA 2VCZA 5DQSA 2MBSA 4V1Ag 5JCWA 3VWUA 1GTAA 1DUGA 1MTCA 4X4JA 3TKSA 2GQMA 3J7Yk 4JU5A 4ECCA 2N5BA 5G2ZA 4QL9A 2K6VA 3HDCA 4QL7A 1AAZA 4ZL9A 4JE1A 4OD7A 4POMA 2L59A 5CRGA 3TJJA 5A5HA 2M72A 4KF9A 4JR6A 5KN2A 2OADA 2DMMA 2H1GA 4L8EA 5HFKA 3NIVA 1XWGA 1FG4A 3UIWA 2IJYA 3RAZA 1SU9A 1X5CA 3QDNA 1FVKA 4O32A 1O8WA 1PKWA 4GSNA 2CAIA 2LQOA 1TRVA 2RM6A 1TU7A 3VPTA 3KGKA 2GSRA 1XWAA 3F6DA 1CQGA 1OKTA 3SBCA 3GKXA 3PINA 1Z7RA 4ID0A 2V32A 2KP2A 1GSQA 1F6MC 3HZ4A 1X9WB 1RQMA 2JADA 4X1UA 5G30A 2VCWA 3F4TA 1TRSA 1UC7A 2PVOC 3G7IA 1PX7A 1XWCA 5EY6A 4GSTA 2AJQB 4MJBA 4ZXGA 3DXBA 4FIWA 5A1NB 1GUHA 3ZMLA 1VF1A 2X8GA 3HYPA 4MZBA 3GL3A 2L6CA 1O7UA 2R0CA 1FB0A 4I5QA 1SJIA 1TDIA 1JLVA 3N9JA 1ZGNA 3FZ5A 2IMKA 4POLA 1WWJA 4LL4B 1PKZA 2O7KA 4AKIA 2FWEA 2KLXA 4V2MA 2C3TA 4AI6A 2ZUPA 5A34A 2LRNA 3F6FA 1TRUA 2VL2C 3GA4A 2JSYA 4HDEA 3PH9A 3FW2A 4JEDA 1GTIA 1R5PA 4KX4A 6GSVA 2FGXA 3LQ7A 5IO2A 3CXGA 2HSHA 3Q74A 2MMOA 2X64A 2OJLA 1O6JA 2CVBA 2VIMA 2VOCA 1TRWA 10GSA 2BTOT 3D5JA 4WXTA 3Q6OA 1AXDA 4TKYA 2TRCP 4H86A 3MYDA 4EC0A 4HQSA 3KIJA 4WF5A 1PQNA 3GIXA 4XRAA 1UVZA 3F8UA 3RDWA 4L0WA 4XRDA 3UVHA 2H1AA 1WP0A 3CRTA 1IYIA 4MZWA 2GT6A 1BQ7A 2PGTA 3NOFA 2YOIA 3BBYA 3IA1A 2R2JA 2HZEA 1PN9A 5J4UA 4DSQA 4YKGA 2I4AA 2CVDA 4RQXA 4A5PA 4MJCA 2FHEA 5J3RA 2J23A 3HY2A 1TXUA 2DMLA 2GLRA 1M2AA 3TOUA 1GSDA 3HMJG 1S3AA 5E4WA 3F4RA 1GNWA 4TW5A 5GAND 2JZTA 4ISDA 5AISA 1SK0A 4YQVA 2IN3A 1XCCA 2HSYA 3DWVA 4OCFA 2GSTA 4O5UA 1AW9A 3CWGA 3H79A 4K7NA 3C1SA 4W66A 3UL3A 2EIOA 2R37A 2I81A 1BG5A 3TRXA 1W4VA 1XVQA 1GSYA 1E2YA 1OE8A 3D4TA 3ZREA 3Q18A 2PMTA 2M46A 1NM3A 4ZL7A 6GSTA 2C0DA 3L0HA 4TR1A 1N8JA 4ECIA 4NHZA 2F8FA 5DALA 1Q4JA 4TN8A 3UJ1A 1T8EB 1T4ZA 1K0NA 2YJ7A 3L78A 2VCXA 1SL1B 1SJ6A 4OO5A 3GTUB 4BWSA 3IBHA 1G0TA 1ST9A 2H8LA 2B5EA 4FH8A 14GSA 2VCTA 2B3SA 2HSMA 1XOAA 4GRFA 4TRXA 1SYRA 2IMFA 3LG6A 2I1UA 2H73A 2VKZG 2VL3A 1U6TA 2VLTA 2GSSA 3FRCA 2YN1A 3ERGA 2F8AA 3FR6A 4F0BA 1T3BA 1OC8A 2R0PA 1QXHA 1GUKA 1Z3EA 5H5RA 1TU8A 5EL8A 3GH9A 4PGTA 1WJKA 4GDFA 2DKHA 4OMVA 3IV4A 5D73A 2H6XA 2HZFA 4MH3A 4MF7A 3ZVJD 18GSA 2V6OA 1ZL9A 1FW1A 5J4VA 5D9VA 2NTOA 1X5DA 3QPMA 2ZCTA 3FR3A 3GKKA 4TVEA 2YZHA 1K0OA 3MWHA 4IKHA 2H66A 1M2DA 2DJ2A 1K0BA 2HRFA 2FY6A 5IM9A 1BX9A 4D73B 2FCHA 3MNGA 5ECKB 1AQWA 4IS0A 2QKEA 3MIXA 5C00A 1K0MA 2B6MA 3E9JB 4Q5NA 3CSHA 4AKXB 1GSSA 3IDVA 2O89A 2DJJA 4GCIA 1GWCA 1F2EA 3VURA 2AUVA 20GSA 4TR3A 2DLXA 4RUVA 3LYKA 4YQUA 4K6XA 3TB2A 2MMZA 1XBSA 2HI7A 2VCQA 4XIHA 2A2SA 3KMOA 1FAAA 4MF5A 2GS3A 2O87A 4I2UA 4ULXA 4F0CA 1YEPA 3FHKA 3G9BA 2GTUA 4K9ZA 4GWRA 1GSUA 2R0GA 1FB6A 5IPGA 5ELGA 1O81A 1M99A 3FY7A 2O85A 2BJXA 3BCIA 4DSSB 1FO5A 4PX1A 2GZZA 3GNJA 3M0FA 2I3YA 2PPTA 2C0GA 4PQ1A 2H76A 1W89A 2C0EA 5KOXA 3HA9A 2IFQB 3VFIA 1SK2A 4EIPA 2H74A 11GSA 5AIXA 1EEJA 5J5NA 2IL3A 4K0GA 1K3YA 3M9KA 4IN0A 2GVPA 2M80A 1PX6A 2XC2A 1YEXA 1BF5A 2FA4A 4WF4A 2MBTA 5ECIB 1C72A 2HFDA 2EC4A 3EU4A 4NMUA 2OE0A 2R4VA 4POKA 4AJ6A 2DKIA 1TK5B 3EPTA 1K0AA 4TR4A 4PUFC 3JCML 1UA5A 1H4OA 2OE1A 3CRUA 2RLIA 3TKSE 5BMUB 5LD0A 1ZYEA 3UBKA 4TXOA 4WETA 2FWHA 2DBCA 3QR6A 1Y1UA 2KHPA 1WE0A 1ZOFA 4CY8A 3GH6A 2EFEA 4AF2A 2KUCA 5ID2A 3BOAA 4G0IA 1G7OA 2DIZA 1JHBA 4FYCA 5B6MA 1GTUA 3J7Yb 1URMA 1YDKA 3DEXA 3DKSA 2WULA 3ZLPA 4Z7XA 3A2XA 2DJ1A 2CX4A 2K18A 4O5RA 3L9SA 4CDOA 1GRXA 5KEJA 4LMVA 4BVYA 1OC9A 4IQAA 2GZPA 3E0UA 1LU4A 1N2AA 3G7YA 4ML1A 1MEKA 4EE0A 3GRXA 1TJDA 4L5LA 3EYTA 2H1LA 1S3CA 3EWLA 3P8WA 1TOFA 3MDKA 2C3QA 2AHEA 4J2FA 2QSIA 4I97A 2H0GA 3HD5A 1M7TA 2B7KA 5CNWA 1YJ6A 4JRRA 3GL5A 5J40A 2H71A 3I9V2 3WYWA 3GN3A 1EEMA 4TR0A 1U3IA 3G7JA 5J47A 2L6DA 4MCUA 1YY7A 2MZCA 5DJLA 5B6NA 1YF1A 3APQA 2CT6A 3GKNA 2HSNA 3FZ4A 4GSSA 1RK4A 2HRKB 3TU3B 3APOA 4GTUA 3FZ9A 3ZMKA 3TOTA 4LMWA 2VAFA 3HZ8A 4EL1A 4NXIA 4Q5FA 5A5HB 3ZYWA 2YV7A 1SK1A 3KP8A 3LXZA 3GMFA 4WBRD 1GL8A 2XBQA 1EWXA 4IJIA 5ECLB 1O85A 2HE3A 2DIYA 2H19A 1KTEA 4MJAA 3CSIA 4GXZA 4N0VA 5F05A 3ZTLA 3EC3A 3ERFA 3TKSC 5ABRA 4WKWA 5GAPD 3N5OA 2EFCA 4OFNA 1HNCA 5G1KA 1AQXA 2ON7A 3CYNA 5J41A 5CP1A 1J08A 1M9AA 1F9MA 5AGYA 2WZ9A 4ZB8A 4NAXA 3VWXA 5GSTA 3ZFLA 3TUEA 4I2TA 2OACA 4BL7B 4KH7A 1YZXA 4KGIA 1V98A 1A23A 2H01A 3ED3A 3A5WA 5IMFA 1SVLA 1ON4A 1EV4A 1U3AA 1PD21 5JWOB 5HFIA 1ERUA 3QD9A 5IPHA 9GSSA 5F0GA 4PUAA 1O73A 1SD9A 3BD2A 1T00A 3PR8A 4HU9A 3KCMA 2FD3A 2HT9A 5A34B 1OC3A 2H1DA 3GUSA 3HJPA 1Q98A 3APSA 2NBSA 4V1Ap 3O3TA 1B9XC 2TRXA 2OA7A 2VM1A 1KEBA 2B5YA 5HR1A 3EVIA 3A2WA 3L9UA 1R4WA 1EP7A 3LORA 4F82A 1VRSD 2LJKA 1Y6EA 1S3DA 5HQPA 2CQ9A 3HKRA 1K3OA 3DMLA 4ILFA 1ERWA 4POBA 4EDZA 5KN1A 3VWVA 3EINA 5A4VA 4F9ZA 1MD3A 1SJZA 1XFLA 5E59A 2GDRA 3QAVA 4N0ZA 1THOA 1G6WA 4N30A 3OR5A 1G7EA 2NVLA 2FWGA 1ZYNA 3CBUA 1MDIA 5IOXA 4XS4A 2I9HA 3GKMA 3IXRA 4K2DA 3I6AA 1HYUA 4AGSA 2HRNA 3P2AA 3HJOA 4PURA 3H4KA 1H75A 4HOJA 3UVTA 3IK7A 5H5SA 2L5OA 3ZIVA 2H75A 3DYRA 3DD3A 2IMDA 3E3EA 4K0NA 2P31A 1X9SB 2FUG2 3A5IA 3LSZA 3GFKA 2H72A 1QK8A 3W8SA 4PXOA 3UEMA 5G5FA 2F51A 1GSEA 1OE7A 2JACA 2VD0A 4IBPA 2EIQA 3F4SA 1XZOA 1PN0A 2WJUA 4E68A 4ML6A 1A2LA 1R7HA 1R26A 4HZ2A 1HD2A 3RBTA 4IJ3A 4NV5A 3RPPA 1SVOA 2LTKA 3GV1A 3L4NA 3GX0A 4ECBA 4YKFA 5ELAA 1PSQA 2PBJA 4TR1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAL B;  4ZBB A;  2MMN A;  3ME7 A;  2LST A;  3ZIJ A;  1QFN A;  1KNG A;  5D9X A;  1JZR A;  5GSS A;  2XHF A;  1PRX A;  3FZA A;  4MAB A;  2YWM A;  3EUR A;  7GSS A;  2HSM B;  3M1G A;  3DVX A;  3W8J A;  2C1Y A;  1EGR A;  1TTZ A;  1I9D A;  3IAS 2;  4ZB9 A;  3CMI A;  4NPB A;  2VM2 A;  1EOG A;  19GS A;  1VGL A;  2IME A;  4F2I A;  1DSB A;  2WDU A;  4EXJ A;  3M3M A;  4N11 A;  1M9B A;  1A0F A;  3RHC A;  2K8V A;  8GSS A;  1EV9 A;  4AJ7 A;  2RUE A;  4K7I A;  2LV3 A;  4BVX A;  1BJX A;  2WB9 A;  4NHW A;  2FLS A;  1V9W A;  4MDC A;  4OFM A;  4HUA A;  3GX8 A;  2IMI A;  2P5R A;  4TXV A;  2JZR A;  3ZZX A;  2XPD A;  3UAP A;  3ISO A;  2XBI A;  3TRP A;  4AJ8 A;  2TIR A;  2VCV A;  4XTS A;  2EIR A;  3LXT A;  3LFL A;  2DJ3 A;  3VI5 A;  13GS A;  1M2B A;  16GS A;  3QMX A;  2L5L A;  2YPM A;  2WS2 A;  5D8I A;  3U5R E;  3ZL5 A;  5KN0 A;  1GNE A;  2YWI A;  3CSJ A;  2JL4 A;  5D9T A;  4L0U A;  3KXO A;  1QGV A;  3EE2 A;  3QFA C;  3TCO A;  2CZ3 A;  3F3Q A;  4G9H A;  1B9Y C;  3R3E A;  1ZCP A;  3U6V A;  6GSU A;  3TKR A;  4MP4 A;  3VWW A;  2L4Q A;  3LGC A;  3WT2 A;  5DAK B;  3UBL A;  1B8X A;  2CA8 A;  1XW9 A;  3K8N A;  2GQL A;  4DSS A;  4FYU A;  5ECR B;  4WEY A;  1IYH A;  2F9S A;  4G10 A;  2OKA A;  3HVX A;  3A3T A;  1GUL A;  4WR4 A;  2R3X A;  4E8E A;  3UMA A;  1EGO A;  3PPU A;  3VK9 A;  4MLY A;  2ES7 A;  5AN1 A;  3HXS A;  2N5A A;  3H1N A;  3KH9 A;  4WBJ A;  1DE1 A;  2VLV A;  3EMP A;  1F3A A;  2CX3 A;  1BED A;  2G0F A;  1AC1 A;  3KP9 A;  4Q5Q A;  3NZN A;  3GSS A;  1GP1 A;  1ML6 A;  4K7O A;  3F0I A;  5FT3 A;  4PQI A;  1GUM A;  4HZ4 A;  1WPI A;  4YQM A;  2WCI A;  6GSY A;  1V40 A;  3RPN A;  2V1M A;  1V2A A;  4O92 A;  2HQT A;  3TJK A;  1TP9 A;  2MYG A;  2E2M A;  3VI7 A;  1XIY A;  3AY8 A;  1OVN A;  2AV4 A;  2V6K A;  5CRE A;  2B1K A;  4IGJ A;  5BMU A;  2NPB A;  2DJK A;  1X0R A;  1G6Y A;  5DVB A;  2KOK A;  5DJM A;  3D4M A;  5D9W A;  5G5E A;  3C71 A;  2DSA A;  5ECM B;  3P7X A;  1JZO A;  4G0L A;  4CHS A;  3TJF A;  3MSZ A;  1NHY A;  3IHQ A;  3I43 A;  1CQH A;  4LA1 A;  2A4V A;  1GLP A;  2LRT A;  3SWL A;  3H93 A;  4HJ2 A;  5CO3 A;  3GHA A;  5EVO A;  2VL9 A;  4TXO B;  2B1L A;  2PU9 C;  5IOW A;  1K0C A;  1TW9 A;  1OKD A;  4MF6 A;  4V2L A;  3M8N A;  5ID2 B;  5ECS A;  3D21 A;  4X0X A;  5A5K A;  1GSF A;  2H1B A;  3C73 A;  4DVC A;  4GLT A;  2KP1 A;  4G19 A;  3C7M A;  4ZL8 A;  3KTL A;  3BJ5 A;  1PL1 A;  2PUK C;  1QMV A;  5AIV A;  2OBK A;  2YAN A;  4OFT A;  2B7J A;  1USB A;  4MMM A;  1TI1 A;  2P5Q A;  5FWG A;  3F63 A;  3R2Q A;  1OC9 B;  4J57 E;  3WD6 A;  1O8X A;  4X43 A;  1FOV A;  3O76 A;  3D6I A;  2CAQ A;  2C0F A;  2E2G A;  5IMA A;  4N10 A;  1F3B A;  5LCZ A;  1VF3 A;  3IR4 A;  4FYB A;  2Z9S A;  4RI7 A;  3MAK A;  2GQK A;  5J9C A;  1XOB A;  1PGT A;  3KTB A;  4TOP A;  4EDY A;  2QC7 A;  2H30 A;  2L4C A;  3TKQ A;  2HRK A;  4IHU A;  5LNK e;  5DDL A;  4JZQ A;  4EO3 A;  4XS1 A;  1V57 A;  3DIE A;  1J9B A;  2RII A;  3TJB A;  1WMJ A;  3FKF A;  2YCD A;  5JWQ B;  4IQ1 A;  2GSQ A;  2R5G A;  3WGD A;  2AB6 A;  4GQF A;  5G31 A;  1LJR A;  2VUP A;  2H0H A;  2HSN B;  2NDO A;  4FQU A;  1T4Y A;  3M9J A;  4IP1 A;  1MDJ A;  2REM A;  1XWB A;  4PTS A;  3DVW A;  2VO4 A;  4ZB6 A;  5KN3 A;  2VL2 A;  2IPA A;  3ZIT A;  2K8S A;  1NW2 A;  4MPF A;  3WT1 A;  1ILO A;  2YNX A;  3FEU A;  5A4U A;  4P3Y B;  2H0I A;  4KND A;  5F8B A;  3S9F A;  4I6X A;  2AAW A;  1JLW A;  4KCA A;  1SL0 B;  4BL7 A;  1THX A;  2H6Y A;  5IIZ A;  4HQZ A;  2X8H A;  2LKU A;  5COH A;  1B4Q A;  1MDK A;  4NWY A;  1M0U A;  5IQY A;  4EKZ A;  1SD8 A;  1E6B A;  2LNT A;  1EOH A;  3EMX A;  3IC8 A;  1F37 A;  2GT5 A;  1ERT A;  1DE2 A;  2FA8 A;  3LYP A;  2B5X A;  1XWK A;  2V41 A;  4KA0 A;  2RUF A;  4V2N A;  3TGZ A;  1YF0 A;  4IVF A;  1GLQ A;  4RI6 A;  4O7H A;  2BMX A;  2G2Q A;  2HNL A;  3HCZ A;  3H8Q A;  3HHV A;  4IP6 A;  1OYJ A;  3F9U A;  2V2G A;  5G1L A;  3QFB C;  1MD4 A;  4MPG A;  3LEF A;  4DEJ A;  1UN2 A;  3QCP A;  2WRT A;  3KEB A;  3I69 A;  3BCK A;  4BPY A;  3UOM A;  3DGQ A;  4KW6 A;  1A8L A;  2HYX A;  4YAV A;  5B7C A;  1HQO A;  3C8E A;  3QAW A;  2C80 A;  4GF0 A;  2X8C A;  3CTF A;  3HVV A;  1BAY A;  2GZY A;  1PA3 A;  2YV9 A;  3ME8 A;  2HZE B;  2GGT A;  2QGV A;  5DBQ A;  2FWF A;  2HXK A;  2C8U A;  1ZZY A;  4OCE A;  5HR0 A;  2YP6 A;  1PMT A;  3LWA A;  2E0Q A;  5IO0 A;  2CZ2 A;  4MZC A;  5F06 A;  3IK9 A;  4XS4 B;  1JZD A;  1TK8 B;  2H70 A;  1ERV A;  5CRW A;  1WOU A;  2HLS A;  1WRY A;  1K3L A;  5CAX A;  1AQV A;  5ECN B;  5JCU A;  3L9V A;  1LBK A;  3P90 A;  3FK8 A;  5F07 A;  3CTG A;  4EVM A;  5ECH B;  3IE3 A;  1Y25 A;  5DQY A;  4ZBD A;  1A0R P;  4NV2 A;  3PGT A;  5B8A A;  5L71 A;  1TK0 B;  3VPQ A;  2N5F A;  5INY A;  2LJA A;  3GTU A;  5CRD A;  1K0D A;  1PL2 A;  2OE3 A;  1FHE A;  2XPE A;  1ABA A;  2LQQ A;  2LEG A;  4CW9 A;  3KH7 A;  3ZFB A;  5HR2 A;  2IIY A;  3DRN A;  2P0G A;  5GZZ B;  4E8H A;  1A24 A;  4HJM A;  2ZNM A;  5JCG A;  1YQ1 A;  1XPV A;  3EU3 A;  3IRA A;  3F3R A;  4GQC A;  3GYK A;  5B8B A;  5ECQ B;  4G0K A;  4KSM A;  1DBY A;  4KSO A;  2IWT A;  2J9H A;  4KCE A;  4KDU A;  4QQ7 A;  4K1F A;  4XHM A;  2K9F A;  5FHI A;  1NHO A;  4MH2 A;  1RW1 A;  4HI7 A;  4JBB A;  2MMA A;  1XW5 A;  1WIK A;  4K8M A;  2C4J A;  4FO5 A;  3KZQ A;  2YJH A;  1A8Y A;  3GST A;  1ZMA A;  3LJR A;  1ZYQ B;  3ERW A;  3RHB A;  5DCG A;  1T1V A;  1SEN A;  4F03 A;  4WR5 A;  3FYG A;  5J9B A;  3TRQ A;  1KBN A;  2PWJ A;  2VLU A;  2L57 A;  4MK3 A;  2D2Z A;  3GUR A;  1JZW A;  1Z7P A;  1TI3 A;  4YAP A;  1TKD B;  3V1W A;  2CVK A;  5HFG A;  3HVS A;  2DJ0 A;  2YWO A;  5IMV A;  4BVX B;  4OO4 A;  4D73 A;  4ZIJ A;  2OBI A;  4Q5R A;  5D96 A;  5ENU A;  2CV4 A;  1YKC A;  1GH2 A;  5IMC A;  2RM5 A;  2ALB A;  1VF4 A;  4BA7 A;  3TJG A;  1B4P A;  3VLN A;  3IC4 A;  4LLR A;  5JWR B;  4XS6 A;  1R5A A;  1AIU A;  2LS5 A;  22GS A;  3C1R A;  3WGE A;  1ACV A;  1X5E A;  4IW9 A;  1Z5Y E;  12GS A;  3FR9 A;  3WGX A;  1QQ2 A;  6GSS A;  2JU5 A;  1XXU A;  1VF2 A;  2O8V B;  4PNF A;  1TXX A;  5ECP B;  4PNG A;  4OWY A;  4L5O A;  4RQR A;  1JFU A;  2PN8 A;  5DAK A;  3QAG A;  4PQH A;  5CRH A;  2LRC A;  2LNS A;  1SL2 B;  3TKP A;  2X99 A;  2YWN A;  5HR3 A;  4LL1 B;  2WFC A;  3TDG A;  2PVQ A;  5DCH A;  1U88 A;  1FVJ A;  2WGR A;  2IFQ A;  4EUY A;  2A2R A;  4KDX A;  6GSW A;  6GSX A;  2YZU A;  4KDY A;  5EPF A;  3KJY A;  2LUS A;  1GTB A;  1EZK A;  4HU7 A;  1Z6N A;  1XW6 A;  4XCS A;  4IEL A;  1I5G A;  3KM6 A;  2PER A;  1SKW B;  4BWQ A;  1OAZ A;  1BYE A;  2DC5 A;  4KB3 A;  3KD0 A;  1AUC A;  4ZIL A;  2F3M A;  5CYY A;  1EP8 A;  1T7P B;  4MA9 A;  2R6K A;  3O6T A;  1Z6M A;  1YKA A;  4J56 E;  5A4W A;  1A2J A;  1HNA A;  1U87 A;  2LJR A;  5ECO B;  3US3 A;  1SKS B;  17GS A;  2FNO A;  2H6Z A;  5IMD A;  4KE3 A;  1V58 A;  3Q19 A;  2JZS A;  1Z9H A;  3D22 A;  5D93 A;  3D0Z A;  1X9M B;  1SYX A;  3HJM A;  4ZBA A;  4KUN A;  5H5Q A;  4KAE A;  2UZ8 A;  4I8B A;  5C04 A;  4YH2 A;  1J0F A;  2VD1 A;  3IPZ A;  3KMN A;  2C3N A;  2HRA A;  4EF0 A;  2ON5 A;  4ACS A;  1B48 A;  4ECJ A;  4MJE A;  2AYT A;  5IMZ A;  4JR4 A;  4HEA 2;  1XVW A;  4G2E A;  4DSR A;  1SKR B;  3ZRD A;  3IOS A;  4USS A;  4BVY B;  1HNB A;  1A2M A;  1QUW A;  4HS1 A;  3QOU A;  3A2V A;  2E7P A;  3ZVJ A;  3W6G A;  3UAR A;  2JSZ A;  3IAM 2;  1NSW A;  2VCZ A;  5DQS A;  2MBS A;  4V1A g;  5JCW A;  3VWU A;  1GTA A;  1DUG A;  1MTC A;  3TKS A;  2GQM A;  3J7Y k;  4JU5 A;  4ECC A;  2N5B A;  5G2Z A;  4QL9 A;  2K6V A;  3HDC A;  4QL7 A;  1AAZ A;  4ZL9 A;  4JE1 A;  4OD7 A;  4POM A;  2L59 A;  5CRG A;  3TJJ A;  2M72 A;  4KF9 A;  4JR6 A;  5KN2 A;  2OAD A;  2DMM A;  2H1G A;  4L8E A;  5HFK A;  3NIV A;  1XWG A;  1FG4 A;  3UIW A;  2IJY A;  3RAZ A;  1SU9 A;  1X5C A;  3QDN A;  1FVK A;  4O32 A;  1O8W A;  1PKW A;  4GSN A;  2CAI A;  2LQO A;  1TRV A;  2RM6 A;  1TU7 A;  3VPT A;  3KGK A;  2GSR A;  1XWA A;  3F6D A;  1CQG A;  1OKT A;  3SBC A;  3GKX A;  3PIN A;  1Z7R A;  4ID0 A;  2V32 A;  2KP2 A;  1GSQ A;  1F6M C;  3HZ4 A;  1X9W B;  1RQM A;  2JAD A;  4X1U A;  5G30 A;  2VCW A;  3F4T A;  1TRS A;  1UC7 A;  2PVO C;  3G7I A;  1PX7 A;  1XWC A;  5EY6 A;  4GST A;  2AJQ B;  4MJB A;  4ZXG A;  3DXB A;  4FIW A;  3HYP A;  1GUH A;  3ZML A;  1VF1 A;  2X8G A;  4MZB A;  3GL3 A;  2L6C A;  1O7U A;  1FB0 A;  4I5Q A;  1SJI A;  1TDI A;  1JLV A;  3N9J A;  1ZGN A;  3FZ5 A;  2IMK A;  4POL A;  1WWJ A;  4LL4 B;  1PKZ A;  2O7K A;  2FWE A;  2KLX A;  4V2M A;  2C3T A;  2ZUP A;  2LRN A;  3F6F A;  1TRU A;  2VL2 C;  3GA4 A;  2JSY A;  4HDE A;  3PH9 A;  3FW2 A;  4JED A;  1GTI A;  1R5P A;  4KX4 A;  6GSV A;  2FGX A;  3LQ7 A;  5IO2 A;  3CXG A;  2HSH A;  3Q74 A;  2MMO A;  2X64 A;  2OJL A;  1O6J A;  2CVB A;  2VIM A;  2VOC A;  1TRW A;  10GS A;  2BTO T;  3D5J A;  4WXT A;  3Q6O A;  1AXD A;  4TKY A;  2TRC P;  4H86 A;  4EC0 A;  4HQS A;  3KIJ A;  4WF5 A;  1PQN A;  3GIX A;  4XRA A;  1UVZ A;  3F8U A;  3RDW A;  4L0W A;  4XRD A;  3UVH A;  2H1A A;  1WP0 A;  3CRT A;  1IYI A;  4MZW A;  2GT6 A;  1BQ7 A;  2PGT A;  3NOF A;  2YOI A;  3BBY A;  3IA1 A;  2R2J A;  2HZE A;  1PN9 A;  5J4U A;  4DSQ A;  2I4A A;  2CVD A;  4RQX A;  4MJC A;  2FHE A;  5J3R A;  2J23 A;  3HY2 A;  2DML A;  2GLR A;  1M2A A;  3TOU A;  1GSD A;  1S3A A;  5E4W A;  3F4R A;  1GNW A;  4TW5 A;  5GAN D;  2JZT A;  4ISD A;  5AIS A;  1SK0 A;  4YQV A;  2IN3 A;  1XCC A;  2HSY A;  3DWV A;  4OCF A;  2GST A;  1AW9 A;  3H79 A;  4K7N A;  3C1S A;  3UL3 A;  2EIO A;  2R37 A;  2I81 A;  1BG5 A;  3TRX A;  1W4V A;  1XVQ A;  1GSY A;  1E2Y A;  1OE8 A;  3D4T A;  3ZRE A;  3Q18 A;  2PMT A;  2M46 A;  1NM3 A;  4ZL7 A;  6GST A;  2C0D A;  3L0H A;  4TR1 A;  1N8J A;  4ECI A;  4NHZ A;  2F8F A;  5DAL A;  1Q4J A;  4TN8 A;  3UJ1 A;  1T8E B;  1T4Z A;  1K0N A;  2YJ7 A;  3L78 A;  2VCX A;  1SL1 B;  1SJ6 A;  4OO5 A;  3GTU B;  4BWS A;  3IBH A;  1G0T A;  1ST9 A;  2H8L A;  2B5E A;  4FH8 A;  14GS A;  2VCT A;  2B3S A;  2HSM A;  1XOA A;  4GRF A;  4TRX A;  1SYR A;  2IMF A;  3LG6 A;  2I1U A;  2H73 A;  2VL3 A;  1U6T A;  2VLT A;  2GSS A;  3FRC A;  2YN1 A;  3ERG A;  2F8A A;  3FR6 A;  4F0B A;  1T3B A;  1OC8 A;  1QXH A;  1GUK A;  1Z3E A;  5H5R A;  1TU8 A;  5EL8 A;  3GH9 A;  4PGT A;  1WJK A;  4OMV A;  3IV4 A;  5D73 A;  2H6X A;  2HZF A;  4MH3 A;  4MF7 A;  3ZVJ D;  18GS A;  2V6O A;  1ZL9 A;  1FW1 A;  5D9V A;  2NTO A;  1X5D A;  3QPM A;  2ZCT A;  3FR3 A;  3GKK A;  4TVE A;  2YZH A;  1K0O A;  3MWH A;  4IKH A;  2H66 A;  1M2D A;  2DJ2 A;  1K0B A;  2HRF A;  2FY6 A;  5IM9 A;  1BX9 A;  4D73 B;  2FCH A;  3MNG A;  5ECK B;  1AQW A;  4IS0 A;  2QKE A;  5C00 A;  1K0M A;  2B6M A;  3E9J B;  4Q5N A;  3CSH A;  1GSS A;  3IDV A;  2O89 A;  2DJJ A;  4GCI A;  1GWC A;  1F2E A;  3VUR A;  2AUV A;  20GS A;  4TR3 A;  2DLX A;  4RUV A;  3LYK A;  4YQU A;  4K6X A;  3TB2 A;  2MMZ A;  1XBS A;  2HI7 A;  2VCQ A;  4XIH A;  2A2S A;  3KMO A;  1FAA A;  4MF5 A;  2GS3 A;  2O87 A;  4I2U A;  4ULX A;  4F0C A;  1YEP A;  3FHK A;  3G9B A;  2GTU A;  4K9Z A;  4GWR A;  1GSU A;  1FB6 A;  5IPG A;  5ELG A;  1O81 A;  1M99 A;  3FY7 A;  2O85 A;  2BJX A;  3BCI A;  4DSS B;  1FO5 A;  4PX1 A;  2GZZ A;  3GNJ A;  3M0F A;  2I3Y A;  2PPT A;  2C0G A;  4PQ1 A;  2H76 A;  1W89 A;  2C0E A;  3HA9 A;  2IFQ B;  3VFI A;  1SK2 A;  2H74 A;  11GS A;  5AIX A;  1EEJ A;  5J5N A;  2IL3 A;  4K0G A;  1K3Y A;  3M9K A;  4IN0 A;  2GVP A;  2M80 A;  1PX6 A;  2XC2 A;  1YEX A;  2FA4 A;  4WF4 A;  2MBT A;  5ECI B;  1C72 A;  2HFD A;  2EC4 A;  3EU4 A;  4NMU A;  2OE0 A;  2R4V A;  4POK A;  4AJ6 A;  1TK5 B;  1K0A A;  4TR4 A;  4PUF C;  3JCM L;  1UA5 A;  1H4O A;  2OE1 A;  3CRU A;  2RLI A;  3TKS E;  5LD0 A;  1ZYE A;  3UBK A;  4TXO A;  4WET A;  2FWH A;  2DBC A;  3QR6 A;  2KHP A;  1WE0 A;  1ZOF A;  3GH6 A;  4AF2 A;  2KUC A;  5ID2 A;  3BOA A;  4G0I A;  1G7O A;  2DIZ A;  1JHB A;  4FYC A;  5B6M A;  1GTU A;  3J7Y b;  1URM A;  1YDK A;  3DEX A;  3DKS A;  2WUL A;  3ZLP A;  4Z7X A;  3A2X A;  2DJ1 A;  2CX4 A;  2K18 A;  4O5R A;  3L9S A;  4CDO A;  1GRX A;  5KEJ A;  4LMV A;  4BVY A;  1OC9 A;  4IQA A;  2GZP A;  3E0U A;  1LU4 A;  1N2A A;  3G7Y A;  4ML1 A;  1MEK A;  4EE0 A;  3GRX A;  1TJD A;  4L5L A;  3EYT A;  1S3C A;  3EWL A;  3P8W A;  1TOF A;  3MDK A;  2C3Q A;  2AHE A;  4J2F A;  2QSI A;  4I97 A;  2H0G A;  3HD5 A;  1M7T A;  2B7K A;  5CNW A;  1YJ6 A;  4JRR A;  3GL5 A;  2H71 A;  3I9V 2;  3WYW A;  3GN3 A;  1EEM A;  4TR0 A;  1U3I A;  3G7J A;  2L6D A;  4MCU A;  1YY7 A;  2MZC A;  5DJL A;  5B6N A;  1YF1 A;  3APQ A;  2CT6 A;  3GKN A;  3FZ4 A;  4GSS A;  1RK4 A;  2HRK B;  3APO A;  4GTU A;  3FZ9 A;  3ZMK A;  3TOT A;  4LMW A;  2VAF A;  3HZ8 A;  4EL1 A;  4NXI A;  4Q5F A;  3ZYW A;  2YV7 A;  1SK1 A;  3KP8 A;  3LXZ A;  3GMF A;  4WBR D;  1GL8 A;  2XBQ A;  1EWX A;  4IJI A;  5ECL B;  1O85 A;  2HE3 A;  2DIY A;  2H19 A;  1KTE A;  4MJA A;  3CSI A;  4GXZ A;  4N0V A;  5F05 A;  3ZTL A;  3EC3 A;  3ERF A;  3TKS C;  5ABR A;  4WKW A;  5GAP D;  3N5O A;  4OFN A;  1HNC A;  5G1K A;  1AQX A;  2ON7 A;  3CYN A;  5J41 A;  5CP1 A;  1J08 A;  1M9A A;  1F9M A;  5AGY A;  2WZ9 A;  4ZB8 A;  4NAX A;  3VWX A;  5GST A;  3ZFL A;  3TUE A;  4I2T A;  2OAC A;  4BL7 B;  4KH7 A;  1YZX A;  4KGI A;  1V98 A;  1A23 A;  2H01 A;  3ED3 A;  3A5W A;  5IMF A;  1ON4 A;  1EV4 A;  1U3A A;  1PD2 1;  5JWO B;  5HFI A;  1ERU A;  3QD9 A;  5IPH A;  9GSS A;  5F0G A;  4PUA A;  1O73 A;  1SD9 A;  3BD2 A;  1T00 A;  3PR8 A;  4HU9 A;  3KCM A;  2FD3 A;  2HT9 A;  1OC3 A;  2H1D A;  3GUS A;  3HJP A;  1Q98 A;  3APS A;  2NBS A;  4V1A p;  3O3T A;  1B9X C;  2TRX A;  2OA7 A;  2VM1 A;  1KEB A;  2B5Y A;  5HR1 A;  3EVI A;  3A2W A;  3L9U A;  1R4W A;  1EP7 A;  3LOR A;  4F82 A;  1VRS D;  2LJK A;  1Y6E A;  1S3D A;  5HQP A;  2CQ9 A;  3HKR A;  1K3O A;  3DML A;  4ILF A;  1ERW A;  4POB A;  4EDZ A;  5KN1 A;  3VWV A;  3EIN A;  5A4V A;  4F9Z A;  1MD3 A;  1SJZ A;  1XFL A;  5E59 A;  2GDR A;  3QAV A;  4N0Z A;  1THO A;  1G6W A;  4N30 A;  3OR5 A;  1G7E A;  2NVL A;  2FWG A;  3CBU A;  1MDI A;  5IOX A;  4XS4 A;  2I9H A;  3GKM A;  3IXR A;  4K2D A;  3I6A A;  1HYU A;  4AGS A;  2HRN A;  3P2A A;  3HJO A;  4PUR A;  3H4K A;  1H75 A;  4HOJ A;  3UVT A;  3IK7 A;  5H5S A;  2L5O A;  3ZIV A;  2H75 A;  3DYR A;  3DD3 A;  2IMD A;  3E3E A;  4K0N A;  2P31 A;  1X9S B;  2FUG 2;  3LSZ A;  3GFK A;  2H72 A;  1QK8 A;  3W8S A;  4PXO A;  3UEM A;  5G5F A;  2F51 A;  1GSE A;  1OE7 A;  2JAC A;  2VD0 A;  4IBP A;  2EIQ A;  3F4S A;  1XZO A;  2WJU A;  4ML6 A;  1A2L A;  1R7H A;  1R26 A;  4HZ2 A;  1HD2 A;  3RBT A;  4IJ3 A;  4NV5 A;  3RPP A;  2LTK A;  3GV1 A;  3L4N A;  3GX0 A;  4ECB A;  5ELA A;  1PSQ A;  2PBJ A;  4TR1 B; 
#chains in the Genus database with same CATH topology
 5DAL B;  4ZBB A;  2MMN A;  3ME7 A;  2LST A;  3ZIJ A;  1QFN A;  1KNG A;  5D9X A;  1JZR A;  5GSS A;  2XHF A;  1PRX A;  3FZA A;  4MAB A;  2YWM A;  3EUR A;  7GSS A;  2HSM B;  3M1G A;  3DVX A;  3CQF A;  3W8J A;  2C1Y A;  1EGR A;  1TTZ A;  1I9D A;  3IAS 2;  4ZB9 A;  3CMI A;  4NPB A;  2VM2 A;  1EOG A;  19GS A;  1VGL A;  2IME A;  4F2I A;  1DSB A;  2WDU A;  4EXJ A;  3M3M A;  4N11 A;  1M9B A;  1A0F A;  3RHC A;  2K8V A;  8GSS A;  1EV9 A;  4AJ7 A;  2RUE A;  4K7I A;  2LV3 A;  4BVX A;  1BJX A;  2WB9 A;  4NHW A;  2FLS A;  1V9W A;  4MDC A;  4OFM A;  4HUA A;  3GX8 A;  2IMI A;  2P5R A;  4TXV A;  2JZR A;  3ZZX A;  2XPD A;  3UAP A;  3ISO A;  3LW9 A;  2XBI A;  3TRP A;  4AJ8 A;  2TIR A;  2VCV A;  4XTS A;  2EIR A;  3LXT A;  3LFL A;  2DJ3 A;  3VI5 A;  13GS A;  1M2B A;  16GS A;  3QMX A;  2L5L A;  2YPM A;  2WS2 A;  5D8I A;  3U5R E;  3ZL5 A;  5KN0 A;  1GNE A;  4CY6 A;  2YWI A;  3CSJ A;  2JL4 A;  5D9T A;  4L0U A;  3KXO A;  1QGV A;  3EE2 A;  3QFA C;  3TCO A;  2CZ3 A;  3F3Q A;  4G9H A;  1B9Y C;  3R3E A;  1ZCP A;  3U6V A;  6GSU A;  3TKR A;  4MP4 A;  3VWW A;  2L4Q A;  3LGC A;  3WT2 A;  5DAK B;  3UBL A;  1B8X A;  2CA8 A;  1XW9 A;  3K8N A;  2GQL A;  4DSS A;  4FYU A;  5ECR B;  4WEY A;  1IYH A;  2F9S A;  4G10 A;  2A2P A;  2OKA A;  3HVX A;  3A3T A;  1GUL A;  4WR4 A;  2R3X A;  4E8E A;  3UMA A;  1EGO A;  3PPU A;  3VK9 A;  4MLY A;  2ES7 A;  5AN1 A;  3HXS A;  2N5A A;  3H1N A;  3KH9 A;  4WBJ A;  1DE1 A;  2VLV A;  3EMP A;  1F3A A;  2CX3 A;  1BED A;  2G0F A;  1AC1 A;  3RGB C;  3KP9 A;  4Q5Q A;  3NZN A;  2WVY A;  3GSS A;  1GP1 A;  1ML6 A;  4K7O A;  3F0I A;  5FT3 A;  4PQI A;  1GUM A;  4HZ4 A;  1WPI A;  4YQM A;  2WCI A;  6GSY A;  1V40 A;  3RPN A;  2V1M A;  1V2A A;  4O92 A;  2HQT A;  3TJK A;  1TP9 A;  2MYG A;  2E2M A;  3VI7 A;  1XIY A;  3AY8 A;  1OVN A;  2AV4 A;  2V6K A;  5CRE A;  4MNN A;  2B1K A;  4IGJ A;  5BMU A;  4K5S A;  2NPB A;  2DJK A;  1X0R A;  1G6Y A;  5DVB A;  2KOK A;  5DJM A;  3D4M A;  5D9W A;  5G5E A;  3C71 A;  2DSA A;  5ECM B;  3P7X A;  1JZO A;  4G0L A;  4CHS A;  3TJF A;  3MSZ A;  1NHY A;  3IHQ A;  3I43 A;  1CQH A;  4LA1 A;  2A4V A;  1GLP A;  2LRT A;  3SWL A;  3H93 A;  4HJ2 A;  5CO3 A;  3GHA A;  5EVO A;  2VL9 A;  4TXO B;  4Z2R A;  2B1L A;  2PU9 C;  5IOW A;  4K5R A;  1K0C A;  1TW9 A;  1OKD A;  4MF6 A;  4V2L A;  3M8N A;  5ID2 B;  5ECS A;  3D21 A;  4X0X A;  5A5K A;  1GSF A;  2H1B A;  3C73 A;  4DVC A;  4GLT A;  2KP1 A;  4G19 A;  2WVZ A;  3C7M A;  4ZL8 A;  3KTL A;  3BJ5 A;  2O36 A;  1PL1 A;  2PUK C;  1QMV A;  5AIV A;  2OBK A;  2YAN A;  4OFT A;  2B7J A;  1USB A;  2WW0 A;  4MMM A;  4AKG A;  2P5Q A;  5FWG A;  1TI1 A;  3F63 A;  3R2Q A;  1OC9 B;  4J57 E;  3WD6 A;  1O8X A;  4X43 A;  1FOV A;  3O76 A;  3D6I A;  2CAQ A;  2C0F A;  2E2G A;  5IMA A;  4N10 A;  1F3B A;  5LCZ A;  1VF3 A;  3IR4 A;  4FYB A;  2Z9S A;  4RI7 A;  2QA1 A;  3MAK A;  2GQK A;  5J9C A;  1XOB A;  1PGT A;  3KTB A;  4TOP A;  4EDY A;  2QC7 A;  2H30 A;  2L4C A;  3TKQ A;  2HRK A;  4IHU A;  5LNK e;  5DDL A;  4JZQ A;  4EO3 A;  4XS1 A;  1V57 A;  3DIE A;  1J9B A;  2RII A;  3TJB A;  1WMJ A;  3FKF A;  2YCD A;  5JWQ B;  4IQ1 A;  2GSQ A;  2R5G A;  3WGD A;  2WZS A;  2AB6 A;  4GQF A;  5G31 A;  1LJR A;  2VUP A;  2H0H A;  2HSN B;  2NDO A;  4FQU A;  1T4Y A;  3M9J A;  4IP1 A;  1MDJ A;  2REM A;  1XWB A;  4PTS A;  3DVW A;  2VO4 A;  4ZB6 A;  5KN3 A;  2VL2 A;  2IPA A;  3ZIT A;  2K8S A;  2EFH A;  1NW2 A;  4MPF A;  1ZYP A;  3WT1 A;  1ILO A;  2YNX A;  3FEU A;  5A1N A;  5A4U A;  2UV8 G;  4P3Y B;  2H0I A;  4KND A;  5F8B A;  3S9F A;  4I6X A;  2AAW A;  1JLW A;  4KCA A;  1SL0 B;  4BL7 A;  1THX A;  2H6Y A;  5IIZ A;  4HQZ A;  4PI0 C;  2X8H A;  2LKU A;  5COH A;  1B4Q A;  1MDK A;  4NWY A;  1M0U A;  2X49 A;  5IQY A;  2WVX B;  4EKZ A;  1SD8 A;  1E6B A;  2LNT A;  1BG1 A;  1EOH A;  3EMX A;  3IC8 A;  1F37 A;  2GT5 A;  1ERT A;  1DE2 A;  2FA8 A;  3LYP A;  2B5X A;  1XWK A;  2V41 A;  4KA0 A;  2RUF A;  4V2N A;  3TGZ A;  1YF0 A;  4IVF A;  1GLQ A;  4RI6 A;  2WW1 A;  4O7H A;  2BMX A;  2G2Q A;  2HNL A;  3HCZ A;  3H8Q A;  1I1I P;  3HHV A;  4IP6 A;  1OYJ A;  3F9U A;  2V2G A;  5G1L A;  3QFB C;  1MD4 A;  4MPG A;  3LEF A;  1YVL A;  4DEJ A;  1UN2 A;  4O5Q A;  3QCP A;  2WRT A;  3KEB A;  3I69 A;  3BCK A;  4BPY A;  3UOM A;  3DGQ A;  4KW6 A;  1A8L A;  2HYX A;  4YAV A;  5B7C A;  1HQO A;  1PFO A;  3C8E A;  3QAW A;  2C80 A;  4GF0 A;  2X8C A;  3CTF A;  3HVV A;  1BAY A;  2GZY A;  1PA3 A;  2YV9 A;  3ME8 A;  2HZE B;  2GGT A;  1FOH A;  2QGV A;  4PI2 C;  5DBQ A;  2FWF A;  2HXK A;  2C8U A;  1ZZY A;  4OCE A;  5HR0 A;  2YP6 A;  1PMT A;  3LWA A;  2E0Q A;  5IO0 A;  2CZ2 A;  4MZC A;  5F06 A;  3IK9 A;  4XS4 B;  1JZD A;  1TK8 B;  3CHX C;  2H70 A;  1ERV A;  5CRW A;  1WOU A;  2HLS A;  1WRY A;  1K3L A;  5CAX A;  1AQV A;  5ECN B;  5JCU A;  3L9V A;  1LBK A;  3P90 A;  3FK8 A;  5F07 A;  3CTG A;  4EVM A;  5ECH B;  3IE3 A;  1Y25 A;  5DQY A;  4ZBD A;  1A0R P;  4NV2 A;  3PGT A;  5B8A A;  5L71 A;  5KOW A;  1TK0 B;  3VPQ A;  2N5F A;  5INY A;  2LJA A;  3GTU A;  5CRD A;  4K2X A;  1K0D A;  1PL2 A;  2OE3 A;  1FHE A;  2XPE A;  1ABA A;  2LQQ A;  2LEG A;  4CW9 A;  3KH7 A;  3ZFB A;  5HR2 A;  2IIY A;  3DRN A;  2P0G A;  5GZZ B;  4E8H A;  1A24 A;  4HJM A;  2ZNM A;  5JCG A;  1YQ1 A;  1XPV A;  3EU3 A;  3IRA A;  3F3R A;  4GQC A;  3GYK A;  5B8B A;  5ECQ B;  2EFD A;  4G0K A;  4KSM A;  1DBY A;  4KSO A;  2IWT A;  2J9H A;  4KCE A;  4KDU A;  4QQ7 A;  4K1F A;  4XHM A;  2K9F A;  5FHI A;  1NHO A;  4MH2 A;  1RW1 A;  4HI7 A;  4JBB A;  2MMA A;  1XW5 A;  1WIK A;  4K8M A;  2C4J A;  4FO5 A;  3KZQ A;  2YJH A;  1A8Y A;  3GST A;  1ZMA A;  3LJR A;  1ZYQ B;  3ERW A;  3IHG A;  3RHB A;  5DCG A;  1T1V A;  1SEN A;  4F03 A;  4WR5 A;  3FYG A;  5J9B A;  3TRQ A;  4AKH A;  1KBN A;  2PWJ A;  2VLU A;  2L57 A;  4MK3 A;  4EIQ A;  2D2Z A;  3GUR A;  1JZW A;  1Z7P A;  1TI3 A;  5BRT A;  4YAP A;  1TKD B;  4Z2U A;  3V1W A;  2CVK A;  2O5V A;  5HFG A;  3HVS A;  2DJ0 A;  2YWO A;  5IMV A;  4BVX B;  4OO4 A;  4D73 A;  4ZIJ A;  2OBI A;  4Q5R A;  5D96 A;  5ENU A;  2CV4 A;  1YKC A;  3FMW A;  1GH2 A;  5IMC A;  2RM5 A;  2ALB A;  1VF4 A;  4BA7 A;  3TJG A;  1B4P A;  3VLN A;  3IC4 A;  4LLR A;  5JWR B;  4ICY A;  4XS6 A;  1R5A A;  1AIU A;  4N3Z A;  2LS5 A;  22GS A;  3C1R A;  3WGE A;  1ACV A;  1X5E A;  4IW9 A;  4QMK A;  1Z5Y E;  12GS A;  3FR9 A;  3WGX A;  1QQ2 A;  6GSS A;  2JU5 A;  1XXU A;  1VF2 A;  2O8V B;  4PNF A;  1TXX A;  5ECP B;  4PNG A;  4OWY A;  4L5O A;  4RQR A;  1JFU A;  2PN8 A;  5DAK A;  3QAG A;  4PQH A;  5CRH A;  2LRC A;  2LNS A;  1SL2 B;  3TKP A;  2X99 A;  2YWN A;  5HR3 A;  4LL1 B;  2WFC A;  3TDG A;  2PVQ A;  5DCH A;  1U88 A;  1FVJ A;  2WGR A;  2OT3 A;  2IFQ A;  4EUY A;  2A2R A;  4KDX A;  6GSW A;  4ZB7 A;  6GSX A;  2YZU A;  4KDY A;  5EPF A;  3KJY A;  2LUS A;  1GTB A;  1EZK A;  4HU7 A;  1Z6N A;  1XW6 A;  4XCS A;  4IEL A;  1I5G A;  3KM6 A;  2PER A;  1SKW B;  4BWQ A;  1OAZ A;  1BYE A;  2DC5 A;  4KB3 A;  3KD0 A;  1AUC A;  4ZIL A;  2F3M A;  2QA2 A;  5CYY A;  1EP8 A;  1T7P B;  4MA9 A;  2R6K A;  3O6T A;  1Z6M A;  1YKA A;  4J56 E;  5A4W A;  1A2J A;  1HNA A;  1SVM A;  1U87 A;  2LJR A;  5ECO B;  3US3 A;  1SKS B;  17GS A;  2FNO A;  2H6Z A;  5IMD A;  4KE3 A;  1V58 A;  3Q19 A;  2JZS A;  1Z9H A;  3D22 A;  5D93 A;  3D0Z A;  1X9M B;  2X4A A;  1SYX A;  3HJM A;  1N25 A;  4ZBA A;  4KUN A;  5H5Q A;  4KAE A;  2UZ8 A;  4I8B A;  5C04 A;  4YH2 A;  1J0F A;  2VD1 A;  3IPZ A;  3KMN A;  2C3N A;  2HRA A;  4EF0 A;  2ON5 A;  4ACS A;  1B48 A;  4ECJ A;  4MJE A;  2AYT A;  5IMZ A;  4G01 A;  4JR4 A;  4HEA 2;  1XVW A;  5J4Y A;  4G2E A;  4DSR A;  1SKR B;  3ZRD A;  3IOS A;  4USS A;  4BVY B;  4Z2T A;  1HNB A;  1A2M A;  1QUW A;  4HS1 A;  2A4H A;  3QOU A;  3A2V A;  2E7P A;  3ZVJ A;  3W6G A;  3UAR A;  2JSZ A;  3IAM 2;  1NSW A;  2VCZ A;  5DQS A;  2MBS A;  4V1A g;  5JCW A;  3VWU A;  1GTA A;  1DUG A;  1MTC A;  4X4J A;  3TKS A;  2GQM A;  3J7Y k;  4JU5 A;  4ECC A;  2N5B A;  5G2Z A;  4QL9 A;  2K6V A;  3HDC A;  4QL7 A;  1AAZ A;  4ZL9 A;  4JE1 A;  4OD7 A;  4POM A;  2L59 A;  1M3J A;  5CRG A;  3TJJ A;  5A5H A;  2M72 A;  4KF9 A;  4JR6 A;  5KN2 A;  2OAD A;  2DMM A;  2H1G A;  4L8E A;  5HFK A;  3NIV A;  1XWG A;  1FG4 A;  3UIW A;  2IJY A;  3RAZ A;  1SU9 A;  1X5C A;  3QDN A;  1FVK A;  4O32 A;  1O8W A;  1PKW A;  4GSN A;  2CAI A;  2LQO A;  1TRV A;  2RM6 A;  1TU7 A;  3VPT A;  3KGK A;  2GSR A;  1XWA A;  3F6D A;  1CQG A;  1OKT A;  3SBC A;  3GKX A;  3PIN A;  1Z7R A;  4ID0 A;  2V32 A;  2KP2 A;  1GSQ A;  1F6M C;  3HZ4 A;  1X9W B;  1RQM A;  2JAD A;  4X1U A;  1XG8 A;  5G30 A;  2VCW A;  3F4T A;  1TRS A;  1UC7 A;  2PVO C;  3G7I A;  1PX7 A;  1S3R A;  1XWC A;  5EY6 A;  4GST A;  2AJQ B;  4MJB A;  4ZXG A;  3DXB A;  4FIW A;  5A1N B;  1GUH A;  3ZML A;  1VF1 A;  2X8G A;  3HYP A;  4MZB A;  3GL3 A;  2L6C A;  1O7U A;  2R0C A;  1FB0 A;  4I5Q A;  1SJI A;  1TDI A;  2WW2 A;  1JLV A;  3N9J A;  1ZGN A;  3FZ5 A;  2IMK A;  4POL A;  1WWJ A;  4LL4 B;  1PKZ A;  2O7K A;  4AKI A;  2FWE A;  2KLX A;  4V2M A;  2C3T A;  4AI6 A;  2ZUP A;  5A34 A;  2LRN A;  3F6F A;  1TRU A;  2VL2 C;  3GA4 A;  2JSY A;  4HDE A;  3PH9 A;  3FW2 A;  4JED A;  1GTI A;  1R5P A;  4KX4 A;  6GSV A;  2FGX A;  3LQ7 A;  5IO2 A;  3CXG A;  2HSH A;  3Q74 A;  2MMO A;  2X64 A;  2OJL A;  1O6J A;  2CVB A;  2VIM A;  2VOC A;  1TRW A;  10GS A;  2BTO T;  3D5J A;  4WXT A;  3Q6O A;  1AXD A;  4TKY A;  2TRC P;  4H86 A;  3MYD A;  4EC0 A;  4HQS A;  3KIJ A;  4WF5 A;  1PQN A;  3GIX A;  4XRA A;  1UVZ A;  3F8U A;  3RDW A;  4L0W A;  4XRD A;  3UVH A;  2H1A A;  1WP0 A;  3CRT A;  1IYI A;  4MZW A;  2GT6 A;  1BQ7 A;  2PGT A;  3NOF A;  4HSC X;  2YOI A;  3BBY A;  3IA1 A;  2R2J A;  2HZE A;  1PN9 A;  5J4U A;  4DSQ A;  4YKG A;  2I4A A;  2CVD A;  4RQX A;  4A5P A;  4MJC A;  2FHE A;  5J3R A;  2J23 A;  3HY2 A;  1TXU A;  2DML A;  4PHZ C;  2GLR A;  1M2A A;  3TOU A;  1GSD A;  3HMJ G;  1S3A A;  5E4W A;  3F4R A;  1GNW A;  4TW5 A;  5GAN D;  2JZT A;  4ISD A;  5AIS A;  1SK0 A;  4YQV A;  2IN3 A;  1XCC A;  2HSY A;  3DWV A;  4OCF A;  2GST A;  4O5U A;  1AW9 A;  3CWG A;  3H79 A;  4K7N A;  3C1S A;  4W66 A;  3UL3 A;  2EIO A;  2R37 A;  2I81 A;  1BG5 A;  3TRX A;  1W4V A;  1XVQ A;  1GSY A;  1E2Y A;  1OE8 A;  3D4T A;  3ZRE A;  3Q18 A;  2PMT A;  2M46 A;  1NM3 A;  4ZL7 A;  6GST A;  2C0D A;  3L0H A;  4TR1 A;  1N8J A;  4ECI A;  4NHZ A;  2F8F A;  5DAL A;  1Q4J A;  4TN8 A;  3UJ1 A;  1T8E B;  1T4Z A;  1K0N A;  2YJ7 A;  3L78 A;  2VCX A;  1SL1 B;  1SJ6 A;  4OO5 A;  3GTU B;  4BWS A;  3IBH A;  1G0T A;  1ST9 A;  2H8L A;  2B5E A;  4FH8 A;  14GS A;  2VCT A;  2B3S A;  2HSM A;  1XOA A;  4GRF A;  4TRX A;  1SYR A;  2IMF A;  3LG6 A;  2I1U A;  2H73 A;  2VKZ G;  2VL3 A;  1U6T A;  2VLT A;  2GSS A;  3FRC A;  2YN1 A;  3ERG A;  2F8A A;  3FR6 A;  4F0B A;  1T3B A;  1OC8 A;  2R0P A;  1QXH A;  1GUK A;  1Z3E A;  5H5R A;  1TU8 A;  5EL8 A;  3GH9 A;  4PGT A;  1WJK A;  4GDF A;  2DKH A;  4OMV A;  3IV4 A;  5D73 A;  2H6X A;  2HZF A;  4MH3 A;  4MF7 A;  4FXY P;  3ZVJ D;  18GS A;  2V6O A;  1ZL9 A;  1FW1 A;  5J4V A;  5D9V A;  2NTO A;  1X5D A;  3QPM A;  2ZCT A;  4BIK A;  3FR3 A;  3GKK A;  4TVE A;  2YZH A;  3RFR C;  1K0O A;  3MWH A;  4IKH A;  2H66 A;  1M2D A;  2DJ2 A;  1K0B A;  2HRF A;  2FY6 A;  5IM9 A;  1BX9 A;  4D73 B;  2FCH A;  3MNG A;  5ECK B;  1AQW A;  4IS0 A;  2QKE A;  3MIX A;  5C00 A;  1K0M A;  2B6M A;  3E9J B;  4Q5N A;  3CSH A;  4AKX B;  1GSS A;  3IDV A;  2O89 A;  2DJJ A;  4GCI A;  1GWC A;  1F2E A;  3VUR A;  2AUV A;  20GS A;  4TR3 A;  2DLX A;  4RUV A;  3LYK A;  4YQU A;  4K6X A;  3TB2 A;  2MMZ A;  1XBS A;  2HI7 A;  2VCQ A;  4XIH A;  2A2S A;  3KMO A;  1FAA A;  4MF5 A;  2GS3 A;  2O87 A;  4I2U A;  4ULX A;  4F0C A;  1YEP A;  3FHK A;  3G9B A;  2GTU A;  4K9Z A;  4GWR A;  1GSU A;  2R0G A;  1FB6 A;  5IPG A;  5ELG A;  1O81 A;  1M99 A;  3FY7 A;  2O85 A;  2BJX A;  3BCI A;  4DSS B;  1FO5 A;  4PX1 A;  2GZZ A;  3GNJ A;  3M0F A;  2I3Y A;  2PPT A;  2C0G A;  4PQ1 A;  2H76 A;  1W89 A;  2C0E A;  5KOX A;  3HA9 A;  2IFQ B;  3VFI A;  1SK2 A;  4EIP A;  2H74 A;  11GS A;  5AIX A;  1EEJ A;  5J5N A;  2IL3 A;  4K0G A;  1K3Y A;  3M9K A;  4IN0 A;  2GVP A;  2M80 A;  1PX6 A;  2XC2 A;  1YEX A;  1BF5 A;  2FA4 A;  4WF4 A;  2MBT A;  5ECI B;  1C72 A;  2HFD A;  2EC4 A;  3EU4 A;  4NMU A;  2OE0 A;  2R4V A;  4POK A;  4AJ6 A;  2DKI A;  1TK5 B;  3EPT A;  1K0A A;  4TR4 A;  4PUF C;  3JCM L;  1UA5 A;  1H4O A;  2OE1 A;  3CRU A;  2RLI A;  3TKS E;  5BMU B;  5LD0 A;  1ZYE A;  3UBK A;  4TXO A;  4WET A;  2FWH A;  2DBC A;  3QR6 A;  1Y1U A;  2KHP A;  1WE0 A;  1ZOF A;  4CY8 A;  3GH6 A;  2EFE A;  4AF2 A;  2KUC A;  5ID2 A;  3BOA A;  4G0I A;  1G7O A;  2DIZ A;  1JHB A;  4FYC A;  5B6M A;  1GTU A;  3J7Y b;  1URM A;  1YDK A;  3DEX A;  3DKS A;  2WUL A;  3ZLP A;  4Z7X A;  3A2X A;  2DJ1 A;  2CX4 A;  2K18 A;  4O5R A;  3L9S A;  4CDO A;  1GRX A;  5KEJ A;  4LMV A;  4BVY A;  1OC9 A;  4IQA A;  2GZP A;  3E0U A;  1LU4 A;  1N2A A;  3G7Y A;  4ML1 A;  1MEK A;  4EE0 A;  1S4B P;  3GRX A;  1TJD A;  4L5L A;  3EYT A;  2H1L A;  1S3C A;  3EWL A;  3P8W A;  1TOF A;  3MDK A;  2C3Q A;  2AHE A;  4J2F A;  2QSI A;  4I97 A;  2H0G A;  3HD5 A;  1M7T A;  2B7K A;  5CNW A;  1YJ6 A;  4JRR A;  3GL5 A;  5J40 A;  2H71 A;  3I9V 2;  3WYW A;  3GN3 A;  1EEM A;  4TR0 A;  1U3I A;  3G7J A;  5J47 A;  2L6D A;  4MCU A;  1YY7 A;  2MZC A;  5DJL A;  5B6N A;  1YF1 A;  3APQ A;  2CT6 A;  3GKN A;  2HSN A;  3HVN A;  3FZ4 A;  4GSS A;  1RK4 A;  2HRK B;  3TU3 B;  3APO A;  4GTU A;  3FZ9 A;  3ZMK A;  3TOT A;  4LMW A;  2VAF A;  3HZ8 A;  4EL1 A;  4NXI A;  4Q5F A;  5A5H B;  3ZYW A;  2YV7 A;  1SK1 A;  3KP8 A;  3LXZ A;  3GMF A;  4WBR D;  1GL8 A;  2XBQ A;  1EWX A;  4IJI A;  5ECL B;  1O85 A;  2HE3 A;  2DIY A;  2H19 A;  1KTE A;  4MJA A;  3CSI A;  4GXZ A;  4N0V A;  5F05 A;  3ZTL A;  3EC3 A;  3ERF A;  3TKS C;  5ABR A;  4WKW A;  5GAP D;  3N5O A;  2EFC A;  4OFN A;  2O3E A;  1HNC A;  5G1K A;  1AQX A;  2ON7 A;  3CYN A;  5J41 A;  5CP1 A;  1J08 A;  1M9A A;  1F9M A;  5AGY A;  2WZ9 A;  4ZB8 A;  4NAX A;  3VWX A;  5GST A;  2WVX A;  3ZFL A;  3TUE A;  4I2T A;  2OAC A;  4BL7 B;  4KH7 A;  1YZX A;  4KGI A;  1V98 A;  1A23 A;  2H01 A;  3ED3 A;  3A5W A;  5IMF A;  1SVL A;  1ON4 A;  1EV4 A;  1U3A A;  1PD2 1;  5JWO B;  5HFI A;  1ERU A;  3QD9 A;  5IPH A;  9GSS A;  5F0G A;  4PUA A;  1O73 A;  1SD9 A;  3BD2 A;  1T00 A;  3PR8 A;  4HU9 A;  1M3I A;  3KCM A;  2FD3 A;  2HT9 A;  5A34 B;  1OC3 A;  2H1D A;  3GUS A;  3HJP A;  1Q98 A;  3APS A;  2NBS A;  4V1A p;  3O3T A;  1B9X C;  2TRX A;  2OA7 A;  2VM1 A;  1KEB A;  2B5Y A;  5HR1 A;  3EVI A;  3A2W A;  3L9U A;  1R4W A;  1EP7 A;  3LOR A;  4F82 A;  1VRS D;  2LJK A;  1Y6E A;  1S3D A;  5HQP A;  2CQ9 A;  3HKR A;  1K3O A;  3DML A;  4ILF A;  1ERW A;  4POB A;  4EDZ A;  5KN1 A;  3VWV A;  3EIN A;  5A4V A;  4F9Z A;  1MD3 A;  1SJZ A;  1XFL A;  5E59 A;  2GDR A;  3QAV A;  4N0Z A;  1THO A;  1G6W A;  4N30 A;  3OR5 A;  1G7E A;  2NVL A;  2FWG A;  1ZYN A;  3CBU A;  1MDI A;  5IOX A;  4XS4 A;  2I9H A;  3GKM A;  3IXR A;  4K2D A;  3I6A A;  1HYU A;  4AGS A;  2HRN A;  3P2A A;  3HJO A;  4PUR A;  3H4K A;  1H75 A;  4HOJ A;  3UVT A;  3IK7 A;  5H5S A;  2L5O A;  3ZIV A;  2H75 A;  3DYR A;  3DD3 A;  2WW3 A;  2IMD A;  3E3E A;  4K0N A;  2P31 A;  1X9S B;  2FUG 2;  3A5I A;  3LSZ A;  3GFK A;  2H72 A;  1QK8 A;  3W8S A;  4PXO A;  3UEM A;  5G5F A;  2F51 A;  1GSE A;  1OE7 A;  2JAC A;  2VD0 A;  4IBP A;  2EIQ A;  3F4S A;  1XZO A;  1PN0 A;  2WJU A;  4E68 A;  4ML6 A;  1A2L A;  1R7H A;  1R26 A;  4HZ2 A;  1HD2 A;  3RBT A;  4IJ3 A;  4NV5 A;  3RPP A;  1SVO A;  1YEW C;  2LTK A;  3GV1 A;  3L4N A;  3GX0 A;  4ECB A;  4YKF A;  5ELA A;  1PSQ A;  2PBJ A;  4TR1 B; 
#chains in the Genus database with same CATH homology
 5DAL B;  4ZBB A;  2MMN A;  3ME7 A;  2LST A;  3ZIJ A;  1QFN A;  1KNG A;  5D9X A;  1JZR A;  5GSS A;  2XHF A;  1PRX A;  3FZA A;  4MAB A;  2YWM A;  3EUR A;  7GSS A;  2HSM B;  3M1G A;  3DVX A;  3W8J A;  2C1Y A;  1EGR A;  1TTZ A;  1I9D A;  3IAS 2;  4ZB9 A;  3CMI A;  4NPB A;  2VM2 A;  1EOG A;  19GS A;  1VGL A;  2IME A;  4F2I A;  1DSB A;  2WDU A;  4EXJ A;  3M3M A;  4N11 A;  1M9B A;  1A0F A;  3RHC A;  2K8V A;  8GSS A;  1EV9 A;  4AJ7 A;  2RUE A;  4K7I A;  2LV3 A;  4BVX A;  1BJX A;  2WB9 A;  4NHW A;  2FLS A;  1V9W A;  4MDC A;  4OFM A;  4HUA A;  3GX8 A;  2IMI A;  2P5R A;  4TXV A;  2JZR A;  3ZZX A;  2XPD A;  3UAP A;  3ISO A;  3LW9 A;  2XBI A;  3TRP A;  4AJ8 A;  2TIR A;  2VCV A;  4XTS A;  2EIR A;  3LXT A;  3LFL A;  2DJ3 A;  3VI5 A;  13GS A;  1M2B A;  16GS A;  3QMX A;  2L5L A;  2YPM A;  2WS2 A;  5D8I A;  3U5R E;  3ZL5 A;  5KN0 A;  1GNE A;  4CY6 A;  2YWI A;  3CSJ A;  2JL4 A;  5D9T A;  4L0U A;  3KXO A;  1QGV A;  3EE2 A;  3QFA C;  3TCO A;  2CZ3 A;  3F3Q A;  4G9H A;  1B9Y C;  3R3E A;  1ZCP A;  3U6V A;  6GSU A;  3TKR A;  4MP4 A;  3VWW A;  2L4Q A;  3LGC A;  3WT2 A;  5DAK B;  3UBL A;  1B8X A;  2CA8 A;  1XW9 A;  3K8N A;  2GQL A;  4DSS A;  4FYU A;  5ECR B;  4WEY A;  1IYH A;  2F9S A;  4G10 A;  2A2P A;  2OKA A;  3HVX A;  3A3T A;  1GUL A;  4WR4 A;  2R3X A;  4E8E A;  3UMA A;  1EGO A;  3PPU A;  3VK9 A;  4MLY A;  2ES7 A;  5AN1 A;  3HXS A;  2N5A A;  3H1N A;  3KH9 A;  4WBJ A;  1DE1 A;  2VLV A;  3EMP A;  1F3A A;  2CX3 A;  1BED A;  2G0F A;  1AC1 A;  3KP9 A;  4Q5Q A;  3NZN A;  3GSS A;  1GP1 A;  1ML6 A;  4K7O A;  3F0I A;  5FT3 A;  4PQI A;  1GUM A;  4HZ4 A;  1WPI A;  4YQM A;  2WCI A;  6GSY A;  1V40 A;  3RPN A;  2V1M A;  1V2A A;  4O92 A;  2HQT A;  3TJK A;  1TP9 A;  2MYG A;  2E2M A;  3VI7 A;  1XIY A;  3AY8 A;  1OVN A;  2AV4 A;  2V6K A;  5CRE A;  4MNN A;  2B1K A;  4IGJ A;  5BMU A;  4K5S A;  2NPB A;  2DJK A;  1X0R A;  1G6Y A;  5DVB A;  2KOK A;  5DJM A;  3D4M A;  5D9W A;  5G5E A;  3C71 A;  2DSA A;  5ECM B;  3P7X A;  1JZO A;  4G0L A;  4CHS A;  3TJF A;  3MSZ A;  1NHY A;  3IHQ A;  3I43 A;  1CQH A;  4LA1 A;  2A4V A;  1GLP A;  2LRT A;  3SWL A;  3H93 A;  4HJ2 A;  5CO3 A;  3GHA A;  5EVO A;  2VL9 A;  4TXO B;  4Z2R A;  2B1L A;  2PU9 C;  5IOW A;  4K5R A;  1K0C A;  1TW9 A;  1OKD A;  4MF6 A;  4V2L A;  3M8N A;  5ID2 B;  5ECS A;  3D21 A;  4X0X A;  5A5K A;  1GSF A;  2H1B A;  3C73 A;  4DVC A;  4GLT A;  2KP1 A;  4G19 A;  3C7M A;  4ZL8 A;  3KTL A;  3BJ5 A;  1PL1 A;  2PUK C;  1QMV A;  5AIV A;  2OBK A;  2YAN A;  4OFT A;  2B7J A;  1USB A;  4MMM A;  4AKG A;  2P5Q A;  5FWG A;  1TI1 A;  3F63 A;  3R2Q A;  1OC9 B;  4J57 E;  3WD6 A;  1O8X A;  4X43 A;  1FOV A;  3O76 A;  3D6I A;  2CAQ A;  2C0F A;  2E2G A;  5IMA A;  4N10 A;  1F3B A;  5LCZ A;  1VF3 A;  3IR4 A;  4FYB A;  2Z9S A;  4RI7 A;  2QA1 A;  3MAK A;  2GQK A;  5J9C A;  1XOB A;  1PGT A;  3KTB A;  4TOP A;  4EDY A;  2QC7 A;  2H30 A;  2L4C A;  3TKQ A;  2HRK A;  4IHU A;  5LNK e;  5DDL A;  4JZQ A;  4EO3 A;  4XS1 A;  1V57 A;  3DIE A;  1J9B A;  2RII A;  3TJB A;  1WMJ A;  3FKF A;  2YCD A;  5JWQ B;  4IQ1 A;  2GSQ A;  2R5G A;  3WGD A;  2AB6 A;  4GQF A;  5G31 A;  1LJR A;  2VUP A;  2H0H A;  2HSN B;  2NDO A;  4FQU A;  1T4Y A;  3M9J A;  4IP1 A;  1MDJ A;  2REM A;  1XWB A;  4PTS A;  3DVW A;  2VO4 A;  4ZB6 A;  5KN3 A;  2VL2 A;  2IPA A;  3ZIT A;  2K8S A;  2EFH A;  1NW2 A;  4MPF A;  1ZYP A;  3WT1 A;  1ILO A;  2YNX A;  3FEU A;  5A1N A;  5A4U A;  2UV8 G;  4P3Y B;  2H0I A;  4KND A;  5F8B A;  3S9F A;  4I6X A;  2AAW A;  1JLW A;  4KCA A;  1SL0 B;  4BL7 A;  1THX A;  2H6Y A;  5IIZ A;  4HQZ A;  2X8H A;  2LKU A;  5COH A;  1B4Q A;  1MDK A;  4NWY A;  1M0U A;  2X49 A;  5IQY A;  4EKZ A;  1SD8 A;  1E6B A;  2LNT A;  1BG1 A;  1EOH A;  3EMX A;  3IC8 A;  1F37 A;  2GT5 A;  1ERT A;  1DE2 A;  2FA8 A;  3LYP A;  2B5X A;  1XWK A;  2V41 A;  4KA0 A;  2RUF A;  4V2N A;  3TGZ A;  1YF0 A;  4IVF A;  1GLQ A;  4RI6 A;  4O7H A;  2BMX A;  2G2Q A;  2HNL A;  3HCZ A;  3H8Q A;  3HHV A;  4IP6 A;  1OYJ A;  3F9U A;  2V2G A;  5G1L A;  3QFB C;  1MD4 A;  4MPG A;  3LEF A;  1YVL A;  4DEJ A;  1UN2 A;  4O5Q A;  3QCP A;  2WRT A;  3KEB A;  3I69 A;  3BCK A;  4BPY A;  3UOM A;  3DGQ A;  4KW6 A;  1A8L A;  2HYX A;  4YAV A;  5B7C A;  1HQO A;  3C8E A;  3QAW A;  2C80 A;  4GF0 A;  2X8C A;  3CTF A;  3HVV A;  1BAY A;  2GZY A;  1PA3 A;  2YV9 A;  3ME8 A;  2HZE B;  2GGT A;  1FOH A;  2QGV A;  5DBQ A;  2FWF A;  2HXK A;  2C8U A;  1ZZY A;  4OCE A;  5HR0 A;  2YP6 A;  1PMT A;  3LWA A;  2E0Q A;  5IO0 A;  2CZ2 A;  4MZC A;  5F06 A;  3IK9 A;  4XS4 B;  1JZD A;  1TK8 B;  2H70 A;  1ERV A;  5CRW A;  1WOU A;  2HLS A;  1WRY A;  1K3L A;  5CAX A;  1AQV A;  5ECN B;  5JCU A;  3L9V A;  1LBK A;  3P90 A;  3FK8 A;  5F07 A;  3CTG A;  4EVM A;  5ECH B;  3IE3 A;  1Y25 A;  5DQY A;  4ZBD A;  1A0R P;  4NV2 A;  3PGT A;  5B8A A;  5L71 A;  5KOW A;  1TK0 B;  3VPQ A;  2N5F A;  5INY A;  2LJA A;  3GTU A;  5CRD A;  4K2X A;  1K0D A;  1PL2 A;  2OE3 A;  1FHE A;  2XPE A;  1ABA A;  2LQQ A;  2LEG A;  4CW9 A;  3KH7 A;  3ZFB A;  5HR2 A;  2IIY A;  3DRN A;  2P0G A;  5GZZ B;  4E8H A;  1A24 A;  4HJM A;  2ZNM A;  5JCG A;  1YQ1 A;  1XPV A;  3EU3 A;  3IRA A;  3F3R A;  4GQC A;  3GYK A;  5B8B A;  5ECQ B;  2EFD A;  4G0K A;  4KSM A;  1DBY A;  4KSO A;  2IWT A;  2J9H A;  4KCE A;  4KDU A;  4QQ7 A;  4K1F A;  4XHM A;  2K9F A;  5FHI A;  1NHO A;  4MH2 A;  1RW1 A;  4HI7 A;  4JBB A;  2MMA A;  1XW5 A;  1WIK A;  4K8M A;  2C4J A;  4FO5 A;  3KZQ A;  2YJH A;  1A8Y A;  3GST A;  1ZMA A;  3LJR A;  1ZYQ B;  3ERW A;  3IHG A;  3RHB A;  5DCG A;  1T1V A;  1SEN A;  4F03 A;  4WR5 A;  3FYG A;  5J9B A;  3TRQ A;  4AKH A;  1KBN A;  2PWJ A;  2VLU A;  2L57 A;  4MK3 A;  4EIQ A;  2D2Z A;  3GUR A;  1JZW A;  1Z7P A;  1TI3 A;  5BRT A;  4YAP A;  1TKD B;  4Z2U A;  3V1W A;  2CVK A;  2O5V A;  5HFG A;  3HVS A;  2DJ0 A;  2YWO A;  5IMV A;  4BVX B;  4OO4 A;  4D73 A;  4ZIJ A;  2OBI A;  4Q5R A;  5D96 A;  5ENU A;  2CV4 A;  1YKC A;  3FMW A;  1GH2 A;  5IMC A;  2RM5 A;  2ALB A;  1VF4 A;  4BA7 A;  3TJG A;  1B4P A;  3VLN A;  3IC4 A;  4LLR A;  5JWR B;  4ICY A;  4XS6 A;  1R5A A;  1AIU A;  4N3Z A;  2LS5 A;  22GS A;  3C1R A;  3WGE A;  1ACV A;  1X5E A;  4IW9 A;  4QMK A;  1Z5Y E;  12GS A;  3FR9 A;  3WGX A;  1QQ2 A;  6GSS A;  2JU5 A;  1XXU A;  1VF2 A;  2O8V B;  4PNF A;  1TXX A;  5ECP B;  4PNG A;  4OWY A;  4L5O A;  4RQR A;  1JFU A;  2PN8 A;  5DAK A;  3QAG A;  4PQH A;  5CRH A;  2LRC A;  2LNS A;  1SL2 B;  3TKP A;  2X99 A;  2YWN A;  5HR3 A;  4LL1 B;  2WFC A;  3TDG A;  2PVQ A;  5DCH A;  1U88 A;  1FVJ A;  2WGR A;  2OT3 A;  2IFQ A;  4EUY A;  2A2R A;  4KDX A;  6GSW A;  4ZB7 A;  6GSX A;  2YZU A;  4KDY A;  5EPF A;  3KJY A;  2LUS A;  1GTB A;  1EZK A;  4HU7 A;  1Z6N A;  1XW6 A;  4XCS A;  4IEL A;  1I5G A;  3KM6 A;  2PER A;  1SKW B;  4BWQ A;  1OAZ A;  1BYE A;  2DC5 A;  4KB3 A;  3KD0 A;  1AUC A;  4ZIL A;  2F3M A;  2QA2 A;  5CYY A;  1EP8 A;  1T7P B;  4MA9 A;  2R6K A;  3O6T A;  1Z6M A;  1YKA A;  4J56 E;  5A4W A;  1A2J A;  1HNA A;  1SVM A;  1U87 A;  2LJR A;  5ECO B;  3US3 A;  1SKS B;  17GS A;  2FNO A;  2H6Z A;  5IMD A;  4KE3 A;  1V58 A;  3Q19 A;  2JZS A;  1Z9H A;  3D22 A;  5D93 A;  3D0Z A;  1X9M B;  2X4A A;  1SYX A;  3HJM A;  1N25 A;  4ZBA A;  4KUN A;  5H5Q A;  4KAE A;  2UZ8 A;  4I8B A;  5C04 A;  4YH2 A;  1J0F A;  2VD1 A;  3IPZ A;  3KMN A;  2C3N A;  2HRA A;  4EF0 A;  2ON5 A;  4ACS A;  1B48 A;  4ECJ A;  4MJE A;  2AYT A;  5IMZ A;  4G01 A;  4JR4 A;  4HEA 2;  1XVW A;  5J4Y A;  4G2E A;  4DSR A;  1SKR B;  3ZRD A;  3IOS A;  4USS A;  4BVY B;  4Z2T A;  1HNB A;  1A2M A;  1QUW A;  4HS1 A;  2A4H A;  3QOU A;  3A2V A;  2E7P A;  3ZVJ A;  3W6G A;  3UAR A;  2JSZ A;  3IAM 2;  1NSW A;  2VCZ A;  5DQS A;  2MBS A;  4V1A g;  5JCW A;  3VWU A;  1GTA A;  1DUG A;  1MTC A;  4X4J A;  3TKS A;  2GQM A;  3J7Y k;  4JU5 A;  4ECC A;  2N5B A;  5G2Z A;  4QL9 A;  2K6V A;  3HDC A;  4QL7 A;  1AAZ A;  4ZL9 A;  4JE1 A;  4OD7 A;  4POM A;  2L59 A;  5CRG A;  3TJJ A;  5A5H A;  2M72 A;  4KF9 A;  4JR6 A;  5KN2 A;  2OAD A;  2DMM A;  2H1G A;  4L8E A;  5HFK A;  3NIV A;  1XWG A;  1FG4 A;  3UIW A;  2IJY A;  3RAZ A;  1SU9 A;  1X5C A;  3QDN A;  1FVK A;  4O32 A;  1O8W A;  1PKW A;  4GSN A;  2CAI A;  2LQO A;  1TRV A;  2RM6 A;  1TU7 A;  3VPT A;  3KGK A;  2GSR A;  1XWA A;  3F6D A;  1CQG A;  1OKT A;  3SBC A;  3GKX A;  3PIN A;  1Z7R A;  4ID0 A;  2V32 A;  2KP2 A;  1GSQ A;  1F6M C;  3HZ4 A;  1X9W B;  1RQM A;  2JAD A;  4X1U A;  5G30 A;  2VCW A;  3F4T A;  1TRS A;  1UC7 A;  2PVO C;  3G7I A;  1PX7 A;  1XWC A;  5EY6 A;  4GST A;  2AJQ B;  4MJB A;  4ZXG A;  3DXB A;  4FIW A;  5A1N B;  1GUH A;  3ZML A;  1VF1 A;  2X8G A;  3HYP A;  4MZB A;  3GL3 A;  2L6C A;  1O7U A;  2R0C A;  1FB0 A;  4I5Q A;  1SJI A;  1TDI A;  1JLV A;  3N9J A;  1ZGN A;  3FZ5 A;  2IMK A;  4POL A;  1WWJ A;  4LL4 B;  1PKZ A;  2O7K A;  4AKI A;  2FWE A;  2KLX A;  4V2M A;  2C3T A;  4AI6 A;  2ZUP A;  5A34 A;  2LRN A;  3F6F A;  1TRU A;  2VL2 C;  3GA4 A;  2JSY A;  4HDE A;  3PH9 A;  3FW2 A;  4JED A;  1GTI A;  1R5P A;  4KX4 A;  6GSV A;  2FGX A;  3LQ7 A;  5IO2 A;  3CXG A;  2HSH A;  3Q74 A;  2MMO A;  2X64 A;  2OJL A;  1O6J A;  2CVB A;  2VIM A;  2VOC A;  1TRW A;  10GS A;  2BTO T;  3D5J A;  4WXT A;  3Q6O A;  1AXD A;  4TKY A;  2TRC P;  4H86 A;  3MYD A;  4EC0 A;  4HQS A;  3KIJ A;  4WF5 A;  1PQN A;  3GIX A;  4XRA A;  1UVZ A;  3F8U A;  3RDW A;  4L0W A;  4XRD A;  3UVH A;  2H1A A;  1WP0 A;  3CRT A;  1IYI A;  4MZW A;  2GT6 A;  1BQ7 A;  2PGT A;  3NOF A;  2YOI A;  3BBY A;  3IA1 A;  2R2J A;  2HZE A;  1PN9 A;  5J4U A;  4DSQ A;  4YKG A;  2I4A A;  2CVD A;  4RQX A;  4A5P A;  4MJC A;  2FHE A;  5J3R A;  2J23 A;  3HY2 A;  1TXU A;  2DML A;  2GLR A;  1M2A A;  3TOU A;  1GSD A;  3HMJ G;  1S3A A;  5E4W A;  3F4R A;  1GNW A;  4TW5 A;  5GAN D;  2JZT A;  4ISD A;  5AIS A;  1SK0 A;  4YQV A;  2IN3 A;  1XCC A;  2HSY A;  3DWV A;  4OCF A;  2GST A;  4O5U A;  1AW9 A;  3CWG A;  3H79 A;  4K7N A;  3C1S A;  4W66 A;  3UL3 A;  2EIO A;  2R37 A;  2I81 A;  1BG5 A;  3TRX A;  1W4V A;  1XVQ A;  1GSY A;  1E2Y A;  1OE8 A;  3D4T A;  3ZRE A;  3Q18 A;  2PMT A;  2M46 A;  1NM3 A;  4ZL7 A;  6GST A;  2C0D A;  3L0H A;  4TR1 A;  1N8J A;  4ECI A;  4NHZ A;  2F8F A;  5DAL A;  1Q4J A;  4TN8 A;  3UJ1 A;  1T8E B;  1T4Z A;  1K0N A;  2YJ7 A;  3L78 A;  2VCX A;  1SL1 B;  1SJ6 A;  4OO5 A;  3GTU B;  4BWS A;  3IBH A;  1G0T A;  1ST9 A;  2H8L A;  2B5E A;  4FH8 A;  14GS A;  2VCT A;  2B3S A;  2HSM A;  1XOA A;  4GRF A;  4TRX A;  1SYR A;  2IMF A;  3LG6 A;  2I1U A;  2H73 A;  2VKZ G;  2VL3 A;  1U6T A;  2VLT A;  2GSS A;  3FRC A;  2YN1 A;  3ERG A;  2F8A A;  3FR6 A;  4F0B A;  1T3B A;  1OC8 A;  2R0P A;  1QXH A;  1GUK A;  1Z3E A;  5H5R A;  1TU8 A;  5EL8 A;  3GH9 A;  4PGT A;  1WJK A;  4GDF A;  2DKH A;  4OMV A;  3IV4 A;  5D73 A;  2H6X A;  2HZF A;  4MH3 A;  4MF7 A;  3ZVJ D;  18GS A;  2V6O A;  1ZL9 A;  1FW1 A;  5J4V A;  5D9V A;  2NTO A;  1X5D A;  3QPM A;  2ZCT A;  3FR3 A;  3GKK A;  4TVE A;  2YZH A;  1K0O A;  3MWH A;  4IKH A;  2H66 A;  1M2D A;  2DJ2 A;  1K0B A;  2HRF A;  2FY6 A;  5IM9 A;  1BX9 A;  4D73 B;  2FCH A;  3MNG A;  5ECK B;  1AQW A;  4IS0 A;  2QKE A;  3MIX A;  5C00 A;  1K0M A;  2B6M A;  3E9J B;  4Q5N A;  3CSH A;  4AKX B;  1GSS A;  3IDV A;  2O89 A;  2DJJ A;  4GCI A;  1GWC A;  1F2E A;  3VUR A;  2AUV A;  20GS A;  4TR3 A;  2DLX A;  4RUV A;  3LYK A;  4YQU A;  4K6X A;  3TB2 A;  2MMZ A;  1XBS A;  2HI7 A;  2VCQ A;  4XIH A;  2A2S A;  3KMO A;  1FAA A;  4MF5 A;  2GS3 A;  2O87 A;  4I2U A;  4ULX A;  4F0C A;  1YEP A;  3FHK A;  3G9B A;  2GTU A;  4K9Z A;  4GWR A;  1GSU A;  2R0G A;  1FB6 A;  5IPG A;  5ELG A;  1O81 A;  1M99 A;  3FY7 A;  2O85 A;  2BJX A;  3BCI A;  4DSS B;  1FO5 A;  4PX1 A;  2GZZ A;  3GNJ A;  3M0F A;  2I3Y A;  2PPT A;  2C0G A;  4PQ1 A;  2H76 A;  1W89 A;  2C0E A;  5KOX A;  3HA9 A;  2IFQ B;  3VFI A;  1SK2 A;  4EIP A;  2H74 A;  11GS A;  5AIX A;  1EEJ A;  5J5N A;  2IL3 A;  4K0G A;  1K3Y A;  3M9K A;  4IN0 A;  2GVP A;  2M80 A;  1PX6 A;  2XC2 A;  1YEX A;  1BF5 A;  2FA4 A;  4WF4 A;  2MBT A;  5ECI B;  1C72 A;  2HFD A;  2EC4 A;  3EU4 A;  4NMU A;  2OE0 A;  2R4V A;  4POK A;  4AJ6 A;  2DKI A;  1TK5 B;  3EPT A;  1K0A A;  4TR4 A;  4PUF C;  3JCM L;  1UA5 A;  1H4O A;  2OE1 A;  3CRU A;  2RLI A;  3TKS E;  5BMU B;  5LD0 A;  1ZYE A;  3UBK A;  4TXO A;  4WET A;  2FWH A;  2DBC A;  3QR6 A;  1Y1U A;  2KHP A;  1WE0 A;  1ZOF A;  4CY8 A;  3GH6 A;  2EFE A;  4AF2 A;  2KUC A;  5ID2 A;  3BOA A;  4G0I A;  1G7O A;  2DIZ A;  1JHB A;  4FYC A;  5B6M A;  1GTU A;  3J7Y b;  1URM A;  1YDK A;  3DEX A;  3DKS A;  2WUL A;  3ZLP A;  4Z7X A;  3A2X A;  2DJ1 A;  2CX4 A;  2K18 A;  4O5R A;  3L9S A;  4CDO A;  1GRX A;  5KEJ A;  4LMV A;  4BVY A;  1OC9 A;  4IQA A;  2GZP A;  3E0U A;  1LU4 A;  1N2A A;  3G7Y A;  4ML1 A;  1MEK A;  4EE0 A;  3GRX A;  1TJD A;  4L5L A;  3EYT A;  2H1L A;  1S3C A;  3EWL A;  3P8W A;  1TOF A;  3MDK A;  2C3Q A;  2AHE A;  4J2F A;  2QSI A;  4I97 A;  2H0G A;  3HD5 A;  1M7T A;  2B7K A;  5CNW A;  1YJ6 A;  4JRR A;  3GL5 A;  5J40 A;  2H71 A;  3I9V 2;  3WYW A;  3GN3 A;  1EEM A;  4TR0 A;  1U3I A;  3G7J A;  5J47 A;  2L6D A;  4MCU A;  1YY7 A;  2MZC A;  5DJL A;  5B6N A;  1YF1 A;  3APQ A;  2CT6 A;  3GKN A;  2HSN A;  3FZ4 A;  4GSS A;  1RK4 A;  2HRK B;  3TU3 B;  3APO A;  4GTU A;  3FZ9 A;  3ZMK A;  3TOT A;  4LMW A;  2VAF A;  3HZ8 A;  4EL1 A;  4NXI A;  4Q5F A;  5A5H B;  3ZYW A;  2YV7 A;  1SK1 A;  3KP8 A;  3LXZ A;  3GMF A;  4WBR D;  1GL8 A;  2XBQ A;  1EWX A;  4IJI A;  5ECL B;  1O85 A;  2HE3 A;  2DIY A;  2H19 A;  1KTE A;  4MJA A;  3CSI A;  4GXZ A;  4N0V A;  5F05 A;  3ZTL A;  3EC3 A;  3ERF A;  3TKS C;  5ABR A;  4WKW A;  5GAP D;  3N5O A;  2EFC A;  4OFN A;  1HNC A;  5G1K A;  1AQX A;  2ON7 A;  3CYN A;  5J41 A;  5CP1 A;  1J08 A;  1M9A A;  1F9M A;  5AGY A;  2WZ9 A;  4ZB8 A;  4NAX A;  3VWX A;  5GST A;  3ZFL A;  3TUE A;  4I2T A;  2OAC A;  4BL7 B;  4KH7 A;  1YZX A;  4KGI A;  1V98 A;  1A23 A;  2H01 A;  3ED3 A;  3A5W A;  5IMF A;  1SVL A;  1ON4 A;  1EV4 A;  1U3A A;  1PD2 1;  5JWO B;  5HFI A;  1ERU A;  3QD9 A;  5IPH A;  9GSS A;  5F0G A;  4PUA A;  1O73 A;  1SD9 A;  3BD2 A;  1T00 A;  3PR8 A;  4HU9 A;  3KCM A;  2FD3 A;  2HT9 A;  5A34 B;  1OC3 A;  2H1D A;  3GUS A;  3HJP A;  1Q98 A;  3APS A;  2NBS A;  4V1A p;  3O3T A;  1B9X C;  2TRX A;  2OA7 A;  2VM1 A;  1KEB A;  2B5Y A;  5HR1 A;  3EVI A;  3A2W A;  3L9U A;  1R4W A;  1EP7 A;  3LOR A;  4F82 A;  1VRS D;  2LJK A;  1Y6E A;  1S3D A;  5HQP A;  2CQ9 A;  3HKR A;  1K3O A;  3DML A;  4ILF A;  1ERW A;  4POB A;  4EDZ A;  5KN1 A;  3VWV A;  3EIN A;  5A4V A;  4F9Z A;  1MD3 A;  1SJZ A;  1XFL A;  5E59 A;  2GDR A;  3QAV A;  4N0Z A;  1THO A;  1G6W A;  4N30 A;  3OR5 A;  1G7E A;  2NVL A;  2FWG A;  1ZYN A;  3CBU A;  1MDI A;  5IOX A;  4XS4 A;  2I9H A;  3GKM A;  3IXR A;  4K2D A;  3I6A A;  1HYU A;  4AGS A;  2HRN A;  3P2A A;  3HJO A;  4PUR A;  3H4K A;  1H75 A;  4HOJ A;  3UVT A;  3IK7 A;  5H5S A;  2L5O A;  3ZIV A;  2H75 A;  3DYR A;  3DD3 A;  2IMD A;  3E3E A;  4K0N A;  2P31 A;  1X9S B;  2FUG 2;  3A5I A;  3LSZ A;  3GFK A;  2H72 A;  1QK8 A;  3W8S A;  4PXO A;  3UEM A;  5G5F A;  2F51 A;  1GSE A;  1OE7 A;  2JAC A;  2VD0 A;  4IBP A;  2EIQ A;  3F4S A;  1XZO A;  1PN0 A;  2WJU A;  4E68 A;  4ML6 A;  1A2L A;  1R7H A;  1R26 A;  4HZ2 A;  1HD2 A;  3RBT A;  4IJ3 A;  4NV5 A;  3RPP A;  1SVO A;  2LTK A;  3GV1 A;  3L4N A;  3GX0 A;  4ECB A;  4YKF A;  5ELA A;  1PSQ A;  2PBJ A;  4TR1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...