4GLTA

Crystal structure of glutathione s-transferase mfla_2116 (target efi-507160) from methylobacillus flagellatus kt with gsh bound
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
208
structure length
208
Chain Sequence
NLYFQSMKLLYSNTSPYARKVRVVAAEKRIDVDMVLVVLADPECPVADHNPLGKIPVLILPDGESLYDSRVIVEYLDHRTPVAHLIPQDHTAKIAVRRWEALADGVTDAAVAAVMEGRRPEGMQDSAVIEKQLNKVERGLRRMDQDLEKRKWCVNESFSLADIAVGCMLGYLELRYQHLDWKQQYPNLARHYAAMMKRASFKDTAPVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase-like protein
publication title Crystal structure of glutathione s-transferase MFLA_2116 (target EFI-507160) from methylobacillus flagellatus kt with gsh bound
rcsb
source organism Methylobacillus flagellatus
total genus 67
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4gltA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gltA01
1X0RA 4E8HA 1QFNA 3ZIVA 2VCVA 2O7KA 1F2EA 4PUAA 5HQPA 2F3MA 4G2EA 3KGKA 5A4VA 1PN9A 4BL7A 2GZPA 4HZ2A 1URMA 2B1KA 1A2MA 1NW2A 4OD7A 2L5OA 3ZFLA 1GUKA 3UBLA 3LWAA 2VL2A 3FW2A 2B3SA 2LTKA 4XS4B 4N10A 3EE2A 1EEJA 3DVWA 2QGVA 2IMKA 5JWOB 4WKWA 1ZGNA 5B6MA 3VPTA 2DJ2A 4TR0A 3J7Yb 3N9JA 4KB3A 2LJKA 2JSZA 2PU9C 4MLYA 1GLPA 1PL2A 2GSSA 1LU4A 2NDOA 2JZTA 4AJ7A 4IS0A 3P90A 2HZFA 2WDUA 2WRTA 2ZCTA 2FA4A 3H79A 3ZLPA 1Z9HA 3R3EA 2JU5A 3A2XA 3UL3A 4ULXA 6GSSA 4L5OA 5CP1A 1I5GA 3IRAA 1CQGA 4RQRA 1K0BA 5AISA 5INYA 1R26A 1F37A 3DXBA 4QL9A 4XIHA 4DSQA 4YH2A 2LQOA 3G7JA 3GNJA 2FD3A 5EPFA 1PA3A 4OWYA 4EL1A 1Z6MA 2O8VB 3QMXA 22GSA 2HQTA 2P5QA 5DAKB 5ECQB 2I9HA 4IJ3A 4WR5A 6GSUA 4GSSA 4KDXA 1XVWA 2GSRA 1AC1A 2LV3A 1XWKA 3KTBA 4O5RA 2KLXA 4HQSA 2MMNA 2P31A 5ECSA 1Y25A 2RM6A 3LG6A 2DJKA 3IDVA 1B4QA 3FY7A 5A4WA 1MD4A 1XOAA 5ECKB 2KUCA 3F4RA 3A5WA 4GXZA 4LLRA 4KDUA 2ZNMA 1B8XA 4EDZA 3QCPA 6GSTA 3HDCA 2GTUA 4MJEA 2FNOA 3F9UA 4E8EA 3CSHA 1SJ6A 5J3RA 1U88A 1S3CA 2IIYA 2WFCA 3GIXA 1BQ7A 1AQXA 4GRFA 1NSWA 2CZ3A 3UIWA 2I3YA 1JLVA 2NTOA 2AAWA 1A0FA 5AN1A 3GH6A 5ID2A 1XXUA 3D21A 1YF1A 2WS2A 2EIRA 4PTSA 3GA4A 2V6KA 3TJJA 3HVXA 1T3BA 3EMXA 2VM2A 3NOFA 1O8XA 3TKSA 1AUCA 2GT5A 1ACVA 4JR4A 3N5OA 3CYNA 4K7IA 12GSA 1TRUA 2CAQA 5A5KA 3ZVJA 1HYUA 1YF0A 3H4KA 1K0NA 5ELAA 4BVXB 2LUSA 4NAXA 3EINA 4MJAA 3IAM2 4X0XA 1B48A 1S3DA 2LSTA 1RW1A 2E7PA 3DIEA 3IC4A 4V1Ag 4XHMA 1HNCA 1J0FA 3UAPA 1QGVA 3JCML 2NPBA 4PGTA 5DJLA 4GWRA 4OCFA 3D5JA 3EC3A 2CVDA 1Z7RA 2F9SA 5CNWA 2VCXA 5ABRA 1U87A 4XRDA 2NBSA 1GP1A 2LNTA 2DLXA 4N0ZA 4F0CA 4HZ4A 4HJMA 1V2AA 1FW1A 4MH2A 1TXXA 1O85A 4Q5NA 2MYGA 1X5CA 3FYGA 4MH3A 1OE8A 1Z3EA 3EMPA 1O8WA 3LQ7A 3TOUA 3WT1A 2LRTA 5IMZA 3F6FA 4JEDA 5JWRB 1JZWA 5B7CA 3GKKA 2PERA 3GURA 5IO2A 3KMNA 1Q98A 3LEFA 3E3EA 4EUYA 4KGIA 5EVOA 5G1KA 4N30A 3RHCA 1J08A 3SWLA 3ZMKA 1JLWA 1SL2B 2VLVA 2DIYA 1FG4A 2V6OA 1QQ2A 1SL0B 4IBPA 1TK8B 5ECIB 3HZ4A 1EOHA 1BX9A 5J9CA 17GSA 1ZMAA 3L9UA 3UVHA 3FRCA 1N2AA 2LRCA 2XBIA 1Q4JA 4ECJA 3WYWA 3TDGA 2HNLA 4YQMA 3I9V2 3HA9A 1TU8A 3HHVA 2HRKB 2CVBA 3QDNA 3C1SA 1VF3A 4GQCA 1R5PA 4F0BA 2AHEA 4ACSA 1Y6EA 4BWQA 4F03A 1AXDA 5KN1A 4MPGA 2H74A 4FQUA 4IP6A 1X9MB 2TRXA 2N5AA 3A2VA 2L4QA 1MEKA 3Q18A 3C73A 3PH9A 3UJ1A 4HEA2 4ZB6A 5IQYA 3QPMA 2H6YA 2MMOA 2LKUA 4FYCA 4KCAA 2H1DA 3F63A 2RUFA 3E0UA 4G0KA 5LNKe 3CMIA 2LS5A 1YQ1A 2O87A 3IE3A 3IOSA 14GSA 4IHUA 3ZL5A 2XC2A 4EKZA 2C3TA 3WD6A 1BG5A 5F06A 1XW9A 4NMUA 3M9KA 5G31A 1DBYA 1PKWA 2MMZA 1YJ6A 4MCUA 2VO4A 3H1NA 4K0NA 2LNSA 3TKQA 3MAKA 1AIUA 2IL3A 1EOGA 2HLSA 1XWAA 4ZBBA 1XVQA 3S9FA 1X9SB 5C04A 5DVBA 4K8MA 1EV9A 3US3A 4JBBA 2HZEA 16GSA 2VCWA 3QAGA 4I6XA 5HR0A 1UA5A 3TKPA 5D96A 1PX6A 1S3AA 2DMMA 4MJCA 4I2TA 1T4ZA 4EC0A 2YZHA 2VIMA 3LYPA 1KTEA 5IPGA 1ZYQB 3HD5A 5ECHB 1WPIA 1A23A 1VRSD 4G0LA 18GSA 5HR2A 2R37A 1F6MC 3KIJA 3C71A 2BJXA 4FYUA 4KW6A 2FHEA 2AJQB 3VFIA 2GT6A 3Q74A 3GKXA 3UARA 5L71A 4MF7A 3CRUA 3F6DA 2GQMA 1AQVA 2A2RA 2HSYA 3DKSA 3FR9A 2EIOA 4YQUA 11GSA 3W8SA 2H30A 5DALB 5KN3A 3P8WA 2C0DA 1FVJA 5A4UA 4HOJA 2HSNB 4NPBA 2VL2C 4TVEA 4ZL7A 5IMDA 1V40A 5CREA 1K0DA 4NHZA 3BCIA 2A2SA 1XOBA 1HNAA 3P2AA 2M46A 4AGSA 2VLTA 1X5DA 1V98A 4BVYA 1XFLA 4BA7A 1G6WA 3HCZA 4MF5A 1WWJA 1JZOA 4N11A 4QL7A 2GZYA 4ZL9A 1ZCPA 2H71A 1EGOA 4POLA 4J57E 1YDKA 2H19A 3CTGA 3ZZXA 2F51A 2BTOT 2VOCA 1PL1A 1XWBA 1M2BA 3L9VA 1M9BA 2X99A 1GSYA 4IW9A 3MNGA 5D9VA 2XPEA 4XRAA 2F8AA 4KA0A 4Z7XA 1ON4A 1MDIA 4X1UA 4X43A 4K9ZA 4JR6A 3I6AA 2D2ZA 20GSA 1ST9A 2H66A 3GKNA 1KBNA 2YJ7A 4KSMA 4IJIA 4PXOA 2HRNA 2F8FA 6GSVA 2JSYA 4GSNA 2OADA 3LYKA 2WCIA 1XW6A 3GYKA 3ISOA 1XW5A 5CYYA 4ML6A 4D73A 2HI7A 4TKYA 3M8NA 1F3BA 3F3RA 4FIWA 5IMAA 1JFUA 2N5FA 4H86A 2P5RA 4O7HA 2RIIA 4XTSA 3FR3A 3TJBA 4ZB8A 2IWTA 5B6NA 1SL1B 4ZBDA 2KP1A 4JRRA 4I8BA 3VWVA 3WGDA 3A2WA 2B7KA 1A8LA 3L4NA 2AV4A 2PMTA 2EC4A 1FAAA 2YANA 4WF5A 4PQ1A 1U3IA 1EWXA 2I1UA 3BD2A 3MWHA 4V1Ap 3F4SA 2YNXA 4PQHA 1SJZA 1LBKA 3HZ8A 1R4WA 4BL7B 4OO4A 3HYPA 2PVQA 1B9YC 3GX8A 4EVMA 5FHIA 1GRXA 1M2DA 5DCGA 1ML6A 1PQNA 2YV7A 4HU9A 3PGTA 2AUVA 3TRQA 1K3OA 1WOUA 5D9TA 4J56E 4IVFA 5GAPD 1GUMA 4MDCA 3TRXA 2CQ9A 1GL8A 2PVOC 1C72A 1RQMA 3CSJA 3U6VA 1JHBA 2VL3A 4BPYA 2K8SA 4I97A 5B8AA 2KHPA 2WJUA 3FR6A 3DEXA 4HDEA 5FT3A 1ERTA 4O92A 10GSA 2OJLA 1TRSA 5D9WA 2H1AA 3TKSC 2IFQA 4HQZA 2REMA 4NXIA 4MPFA 2K8VA 5AIXA 2VD1A 4HUAA 1K0MA 4ML1A 1PD21 2FWFA 3DYRA 3GMFA 3M0FA 2R5GA 1EEMA 1A8YA 3DGQA 2FUG2 4ECBA 2NVLA 1E6BA 4IQ1A 5GSTA 4FYBA 2FWEA 1K0AA 1WIKA 2L6DA 1SYXA 4KCEA 2CAIA 1G6YA 5EY6A 1GLQA 4GQFA 1ERVA 1OAZA 2M72A 3TKSE 4ZIJA 3HVVA 5FWGA 3ED3A 1WJKA 5LCZA 2CVKA 2K18A 1TK5B 3CBUA 1YKAA 1OC9A 1XWGA 1U3AA 2YP6A 3CSIA 4TXOA 1EP7A 1YZXA 4POMA 1M7TA 3VI7A 2CA8A 1FOVA 3O6TA 1FVKA 2DC5A 3L0HA 4F82A 3MSZA 4KF9A 2OE1A 5F0GA 3VWWA 3IAS2 3C8EA 2HSMA 5LD0A 2I4AA 1ILOA 1H75A 3KEBA 4OFNA 2HT9A 3ZIJA 5ECMB 1TJDA 1HQOA 1QK8A 1VGLA 3OR5A 1PX7A 5ECPB 4TR1A 5HR3A 4Q5FA 1DUGA 2LJAA 3D0ZA 2G2QA 1PRXA 4O32A 2GGTA 1UC7A 4LMWA 4HJ2A 5JCWA 2CX3A 4LA1A 1DE2A 2VLUA 4KE3A 4CW9A 5DQYA 2C0FA 1V9WA 4USSA 4QQ7A 4ZILA 1THXA 5ID2B 2TIRA 3RBTA 3DRNA 1GTAA 2YWOA 2H01A 4JE1A 2ON7A 4ISDA 1GSDA 1ZZYA 2GSQA 4RQXA 1BYEA 5ENUA 5JCGA 3J7Yk 5KEJA 1SK0A 3GHAA 1TKDB 1OC3A 2DJ1A 5G30A 5AGYA 4GCIA 1VF4A 3TOTA 4J2FA 2PBJA 2B6MA 5GAND 2CT6A 2H72A 5ECNB 1FB0A 3ZREA 1T1VA 3M1GA 3LJRA 1TW9A 1HD2A 2IMDA 3H93A 1GTBA 5IO0A 3NIVA 4Q5QA 2H0HA 2JZSA 4EDYA 1TRWA 3NZNA 3GTUA 4KSOA 5G2ZA 3AY8A 4JZQA 4PX1A 4ID0A 3KP9A 2H75A 1GNEA 1GSUA 4DSSA 1NHOA 4TR3A 3GSSA 2XHFA 5EL8A 4ZBAA 4V2NA 1XBSA 4WBJA 3UMAA 1WMJA 3GN3A 2HSHA 5IOXA 1B9XC 1G7EA 2B7JA 3QOUA 1OKDA 1XZOA 2FWHA 3FZ4A 1K0CA 4KX4A 1AW9A 3GX0A 3L78A 4OMVA 2C4JA 4TRXA 3MDKA 2YWIA 4G9HA 4L0UA 1SD9A 2KP2A 2L5LA 2OBKA 3FHKA 3IR4A 4EXJA 1SKSB 2LEGA 4MK3A 4IELA 4PURA 4EO3A 2CZ2A 4KNDA 5CAXA 1SYRA 4AF2A 3IV4A 1OE7A 3E9JB 3QD9A 4WBRD 2YN1A 3TRPA 3G7YA 3BBYA 5CRDA 3VPQA 2N5BA 4MF6A 3TJFA 2O85A 5HFIA 3C1RA 1J9BA 2OKAA 3DMLA 3IC8A 2E0QA 1A2JA 2J23A 4WR4A 3ME8A 2H1BA 4IN0A 5D9XA 2X64A 4XS4A 2JADA 1TU7A 3GKMA 4PQIA 5KN0A 5D8IA 5AIVA 6GSYA 1X9WB 1USBA 3QFAC 2HXKA 2PUKC 4DEJA 2H76A 1WP0A 4FH8A 3IXRA 3W8JA 1MTCA 3KJYA 4TXVA 1SENA 2H73A 2MBTA 2GS3A 2PPTA 1X5EA 4FO5A 4I5QA 2V41A 3U5RE 2K6VA 4WEYA 1GSFA 2R6KA 2XPDA 2C80A 2WULA 1FO5A 4OCEA 2IMIA 1WE0A 2X8GA 1BJXA 4DSRA 4F9ZA 2OA7A 1GTIA 3HJPA 4G19A 2R3XA 1SU9A 1V58A 3WGEA 4MP4A 3ERWA 2QSIA 4LL4B 5DJMA 2FGXA 5E4WA 2DJ3A 4MABA 1AAZA 1I9DA 1WRYA 1A0RP 3KH7A 3LORA 2DMLA 2V32A 2C0GA 2JACA 3VLNA 3PR8A 5DQSA 4TN8A 3TKRA 3BJ5A 2IJYA 3LFLA 5ECRB 3WT2A 5DAKA 3EU4A 5IOWA 5ECOB 8GSSA 5H5SA 2C3QA 5CRHA 2MMAA 1VF1A 3QAVA 4AJ6A 1TDIA 3KP8A 2H1GA 4KAEA 2BMXA 2R4VA 3G9BA 5J5NA 5ELGA 4XS1A 1ABAA 3H8QA 1K0OA 5D73A 2OACA 2IPAA 2HZEB 1B4PA 4GTUA 3K8NA 5G5FA 5IMCA 3F8UA 4MZBA 5H5QA 2JZRA 2WB9A 3ZMLA 2HFDA 3R2QA 5JCUA 1EGRA 5CRWA 1R7HA 1GSEA 4KDYA 2OBIA 3UBKA 2FCHA 4ZXGA 1O6JA 3QAWA 1A2LA 2H0GA 2H8LA 2MBSA 4HU7A 2RUEA 2ZUPA 3CTFA 2VCQA 2L59A 1OKTA 3HY2A 3UVTA 1ZL9A 3WGXA 2HE3A 3D4MA 2M80A 2ALBA 5E59A 4EF0A 5KN2A 1FHEA 3TJGA 5COHA 1EP8A 4LL1B 1G0TA 1Z6NA 1K3YA 4XCSA 2P0GA 2C0EA 1GNWA 2HYXA 3HJOA 2GQLA 3HXSA 3KCMA 3GRXA 3Q6OA 4BVYB 2H0IA 2VAFA 4YAVA 2GVPA 2YOIA 2PWJA 2C3NA 4IP1A 5DCHA 3GFKA 5IIZA 4ILFA 3QFBC 3RHBA 4OO5A 1GSQA 1T7PB 4MA9A 4L5LA 4V2MA 1XPVA 3PINA 4BVXA 1TP9A 1BEDA 4N0VA 2AB6A 3GSTA 3ZITA 1OC8A 4PNFA 2R2JA 1N8JA 4RI6A 3KXOA 4JU5A 1T8EB 2B1LA 4DVCA 2OE0A 1MDKA 1F3AA 1XWCA 4MJBA 3RDWA 3FKFA 2XBQA 4NWYA 1AQWA 3IA1A 2L4CA 4WETA 3ZRDA 2AYTA 3O3TA 5GZZB 1KEBA 1W4VA 1OYJA 1THOA 3ZYWA 2ON5A 4K0GA 1ZYEA 3GV1A 1YEXA 2VCZA 3D4TA 4GSTA 4POBA 4HS1A 4D73B 1SK1A 1PMTA 3LGCA 4Q5RA 2QKEA 1PKZA 3UOMA 2UZ8A 1Z7PA 4MMMA 2RM5A 2HRAA 3EYTA 3ZFBA 2JL4A 4V2LA 3F3QA 2GSTA 2CX4A 2WGRA 3IK7A 1NHYA 2B5XA 1FB6A 2GZZA 3TJKA 4K2DA 3F0IA 1R5AA 5ECLB 1O73A 5CO3A 1DSBA 1T00A 2KOKA 1A24A 2DJJA 2OE3A 3KZQA 3GL5A 3I43A 1QUWA 3I69A 3IHQA 1GULA 2RLIA 5F05A 3IPZA 3KH9A 3IK9A 1JZDA 4P3YB 3VWUA 2IN3A 2J9HA 3TGZA 2H6ZA 4RI7A 1TI3A 3C7MA 3A3TA 4HI7A 1SKWB 1SK2A 3TUEA 2A4VA 2Z9SA 5J41A 2B5YA 4YQVA 3IBHA 3FK8A 5J9BA 2L57A 2GDRA 1MD3A 2YCDA 5B8BA 3W6GA 3P7XA 2HRKA 5HFGA 4MZWA 2VD0A 1ERUA 2YWNA 4WXTA 2VUPA 3EU3A 3EURA 3LXZA 3DD3A 4OFTA 4K7OA 1VF2A 1O81A 4POKA 1XIYA 1YKCA 1TI1A 4YAPA 2IFQB 5D93A 6GSXA 1GWCA 3HJMA 4L8EA 3FZ9A 2X8CA 1HNBA 5IMFA 4ZB9A 2FA8A 2V1MA 4WF4A 2IMFA 1BAYA 4IQAA 1TRVA 4CHSA 2B5EA 1M99A 2X8HA 2YJHA 3VURA 3ERGA 1M0UA 3RPPA 2IMEA 4ECIA 1GTUA 1H4OA 3HKRA 4OFMA 1OC9B 3G7IA 1T4YA 2CV4A 4TXOB 4K1FA 3D6IA 1V57A 1U6TA 5C00A 5G1LA 3O76A 3SBCA 4TW5A 3KM6A 2L6CA 1O7UA 4TOPA 3CRTA 3D22A 4ZL8A 2HSMB 3VWXA 1QMVA 3QR6A 5G5EA 3ME7A 2FLSA 3RPNA 5F8BA 1GSSA 4G10A 2VCTA 5CRGA 5HR1A 3KMOA 2HRFA 4GLTA 4NV2A 1DE1A 5J4UA 4TR1B 4L0WA 2H70A 5JWQB 3RAZA 5F07A 19GSA 1LJRA 4IKHA 3VK9A 3APSA 1IYHA 3DWVA 2LJRA 3UEMA 3M3MA 3FZ5A 2YPMA 2LQQA 3M9JA 3HVSA 1PGTA 2EIQA 2GQKA 2YV9A 2V2GA 3DVXA 3BOAA 1UVZA 4KUNA 4K7NA 2VL9A 1JZRA 3GUSA 2G0FA 3FEUA 5DALA 3PPUA 2C8UA 1M9AA 5IMVA 4I2UA 2C1YA 4NHWA 1M2AA 2E2GA 3GH9A 2I81A 2E2MA 2H6XA 1YY7A 2WZ9A 1UN2A 4K6XA 2PN8A 1PSQA 1TOFA 2LRNA 2FWGA 5IM9A 1MDJA 2DSAA 3TB2A 1SKRB 3LSZA 2O89A 3FZAA 1SJIA 4NV5A 5BMUA 1XCCA 4KH7A 1Z5YE 4MZCA 1F9MA 5H5RA 3APQA 2VM1A 4TR4A 1QXHA 3EVIA 3LXTA 2TRCP 1NM3A 1TK0B 4BWSA 3GTUB 2DBCA 1GH2A 3ZVJD 3TCOA 2DIZA 3Q19A 1OVNA 2DJ0A 5HFKA 3VI5A 2QC7A 3CXGA 1ZOFA 4DSSB 5GSSA 1RK4A 2YWMA 2ES7A 4EE0A 1ERWA 1SD8A 4F2IA 5DBQA 3KTLA 3L9SA 4LMVA 1K3LA 4RUVA 1EV4A 3APOA 1KNGA 4XS6A 3ZTLA 3BCKA 4PNGA 3ERFA 2FY6A 6GSWA 4GF0A 9GSSA 1YEPA 4CDOA 3EWLA 4ECCA 3F4TA 2PGTA 4IGJA 1IYIA 1W89A 3GL3A 2YZUA 5IPHA 1GUHA 2GLRA 1CQHA 4AJ8A 1G7OA 1EZKA 4PUFC 7GSSA 2MZCA 13GSA 3KD0A 5DDLA 2K9FA 4G0IA 1TTZA 1E2YA 3V1WA
chains in the Genus database with same CATH superfamily
1X0RA 4E8HA 4K5RA 1QFNA 3ZIVA 2VCVA 2O7KA 1F2EA 4PUAA 5HQPA 2F3MA 4G2EA 3KGKA 5A4VA 1PN9A 4BL7A 2GZPA 4HZ2A 1URMA 2B1KA 1A2MA 1NW2A 2H1LA 4OD7A 2L5OA 3ZFLA 1GUKA 3UBLA 3LWAA 2VL2A 3FW2A 2B3SA 2LTKA 4XS4B 1XG8A 4N10A 3EE2A 1EEJA 3DVWA 2QGVA 2IMKA 3FMWA 5JWOB 4WKWA 1YEWC 2O36A 1ZGNA 5B6MA 3VPTA 2DJ2A 4TR0A 3J7Yb 3N9JA 4KB3A 2LJKA 2JSZA 2PU9C 4MLYA 1GLPA 1PL2A 2GSSA 1LU4A 2WVXB 2NDOA 2JZTA 4AJ7A 4IS0A 3P90A 2HZFA 2WDUA 2WRTA 2ZCTA 2FA4A 3H79A 3ZLPA 1Z9HA 3R3EA 2JU5A 3A2XA 3UL3A 4ULXA 6GSSA 4L5OA 5CP1A 1I5GA 3IRAA 1CQGA 4RQRA 1K0BA 5AISA 5INYA 1R26A 1F37A 3DXBA 4QL9A 4XIHA 5A1NB 4DSQA 4YH2A 2LQOA 3G7JA 3GNJA 2FD3A 2WZSA 5EPFA 1PA3A 4OWYA 4EL1A 1Z6MA 2O8VB 3QMXA 4ICYA 1PN0A 22GSA 2HQTA 2P5QA 5DAKB 5ECQB 2I9HA 4IJ3A 4WR5A 6GSUA 4GSSA 4KDXA 1XVWA 2GSRA 1AC1A 2LV3A 1XWKA 3KTBA 4O5RA 2KLXA 4HQSA 2MMNA 2P31A 5ECSA 1Y25A 2RM6A 3LG6A 2DJKA 2VKZG 3IDVA 1B4QA 3FY7A 5A4WA 1MD4A 1XOAA 5ECKB 2KUCA 1Y1UA 3F4RA 3A5WA 4GXZA 4LLRA 4KDUA 2ZNMA 1B8XA 4EDZA 3QCPA 6GSTA 3A5IA 3HDCA 2GTUA 4MJEA 2FNOA 3F9UA 4E8EA 3CSHA 1SJ6A 1SVLA 5J3RA 1U88A 1S3CA 2IIYA 2WFCA 3GIXA 1BQ7A 1AQXA 4GRFA 1NSWA 2CZ3A 3UIWA 2I3YA 1JLVA 2NTOA 2AAWA 1A0FA 5AN1A 3GH6A 5ID2A 4CY6A 1XXUA 3D21A 1YF1A 2WS2A 2EIRA 4O5QA 4PTSA 3GA4A 2V6KA 3TJJA 3HVXA 1T3BA 5J47A 3EMXA 2VM2A 3NOFA 1O8XA 3TKSA 1AUCA 2DKIA 2GT5A 1ACVA 4PHZC 4JR4A 3N5OA 3CYNA 4K7IA 12GSA 1TRUA 2CAQA 5A5KA 3ZVJA 1HYUA 3TU3B 1YF0A 3H4KA 1K0NA 5ELAA 4BVXB 2LUSA 4NAXA 4A5PA 3EINA 4MJAA 3IAM2 5J4VA 4X0XA 1B48A 1S3DA 2LSTA 1RW1A 2E7PA 3DIEA 3IC4A 4V1Ag 4XHMA 1HNCA 1J0FA 3UAPA 4AKHA 1QGVA 3JCML 2NPBA 4AKXB 4PGTA 5DJLA 4GWRA 4OCFA 3D5JA 3EC3A 2CVDA 1Z7RA 2F9SA 5CNWA 2VCXA 5ABRA 1U87A 4YKFA 4XRDA 2NBSA 1GP1A 2LNTA 2DLXA 4N0ZA 4F0CA 4HZ4A 4HJMA 1V2AA 1FW1A 4MH2A 1TXXA 1O85A 4Q5NA 2MYGA 1X5CA 3FYGA 4MH3A 1OE8A 1Z3EA 3EMPA 1O8WA 3LQ7A 3TOUA 3WT1A 2LRTA 5IMZA 3F6FA 4JEDA 5JWRB 1JZWA 5B7CA 3GKKA 2PERA 3GURA 5IO2A 3KMNA 1Q98A 3LEFA 3E3EA 4EUYA 4KGIA 5EVOA 5G1KA 4N30A 3RHCA 5A34B 1J08A 3SWLA 3ZMKA 1JLWA 1SL2B 2VLVA 2DIYA 1FG4A 2V6OA 1QQ2A 1SL0B 4IBPA 1TK8B 3HMJG 5ECIB 3HZ4A 1EOHA 1BX9A 5J9CA 17GSA 1ZMAA 3L9UA 3UVHA 3FRCA 1N2AA 2LRCA 2XBIA 1Q4JA 4ECJA 3WYWA 3TDGA 2HNLA 4YQMA 3I9V2 3CWGA 5A5HB 3HA9A 1TU8A 3HHVA 2HRKB 2CVBA 3QDNA 3C1SA 1VF3A 4FXYP 4GQCA 1R5PA 4F0BA 2AHEA 4ACSA 1Y6EA 4BWQA 4F03A 1AXDA 1S4BP 5KN1A 4MPGA 2H74A 4FQUA 4IP6A 1X9MB 2TRXA 2N5AA 3A2VA 2L4QA 1MEKA 3Q18A 3C73A 3PH9A 3UJ1A 4HEA2 4ZB6A 2EFEA 5IQYA 2UV8G 3QPMA 2H6YA 2MMOA 2LKUA 4FYCA 4KCAA 2H1DA 3F63A 2RUFA 3E0UA 5KOWA 4G0KA 5LNKe 3CMIA 2LS5A 1YQ1A 2O87A 3IE3A 3IOSA 14GSA 4IHUA 3ZL5A 2XC2A 4EKZA 2C3TA 3WD6A 1BG5A 5F06A 1XW9A 4NMUA 3M9KA 5G31A 1DBYA 1PKWA 2MMZA 1YJ6A 4MCUA 2VO4A 3H1NA 4K0NA 2LNSA 3TKQA 3MAKA 1AIUA 5J4YA 2IL3A 1EOGA 2HLSA 1XWAA 4ZBBA 1XVQA 3S9FA 1X9SB 5C04A 5DVBA 4K8MA 1EV9A 3US3A 4JBBA 2HZEA 16GSA 2VCWA 3QAGA 4I6XA 5HR0A 1UA5A 3TKPA 5D96A 1PX6A 1S3AA 2DMMA 4MJCA 4I2TA 1TXUA 1T4ZA 4EC0A 2YZHA 2VIMA 4GDFA 3LYPA 1KTEA 5IPGA 1ZYQB 3HD5A 5ECHB 1WPIA 1A23A 1VRSD 4G0LA 18GSA 5HR2A 2R37A 1F6MC 3KIJA 3C71A 2BJXA 2DKHA 4FYUA 4KW6A 2FHEA 2AJQB 3VFIA 2GT6A 3Q74A 3GKXA 3UARA 5L71A 4MF7A 3CRUA 3F6DA 2GQMA 1AQVA 2A2RA 2HSYA 3DKSA 3FR9A 2EIOA 4YQUA 11GSA 3W8SA 2H30A 5DALB 5KN3A 3P8WA 2C0DA 1FVJA 5A4UA 4HOJA 2HSNB 4NPBA 2VL2C 4TVEA 4ZL7A 5IMDA 1V40A 5CREA 1K0DA 4NHZA 3BCIA 2A2SA 1XOBA 1HNAA 3P2AA 1N25A 2M46A 4AGSA 2VLTA 5BMUB 1X5DA 1V98A 4BVYA 1XFLA 4BA7A 1G6WA 3HCZA 4MF5A 1WWJA 1JZOA 4N11A 4QL7A 2GZYA 4ZL9A 1ZCPA 2H71A 1EGOA 4POLA 4J57E 1YDKA 2H19A 3CTGA 4K5SA 3ZZXA 2F51A 2BTOT 2VOCA 1PL1A 1XWBA 1M2BA 3L9VA 1M9BA 2X99A 1GSYA 4IW9A 3MNGA 5D9VA 3LW9A 2XPEA 4XRAA 2F8AA 4KA0A 4Z7XA 1ON4A 1MDIA 4X1UA 4X43A 4K9ZA 4JR6A 4E68A 3I6AA 2D2ZA 20GSA 4AKIA 1ST9A 2H66A 3GKNA 3RGBC 1KBNA 2YJ7A 4KSMA 4IJIA 4PXOA 2HRNA 2F8FA 6GSVA 2JSYA 4GSNA 2OADA 3LYKA 2WCIA 1XW6A 3GYKA 3ISOA 1XW5A 5CYYA 4ML6A 4D73A 2HI7A 4TKYA 3M8NA 1F3BA 3F3RA 4FIWA 5IMAA 1JFUA 2N5FA 4H86A 2P5RA 4O7HA 2RIIA 4XTSA 1S3RA 3FR3A 3TJBA 4ZB8A 2IWTA 5B6NA 1SL1B 4G01A 4ZBDA 2KP1A 4JRRA 4I8BA 3VWVA 3WGDA 3A2WA 2B7KA 1A8LA 3L4NA 4PI0C 2AV4A 2PMTA 2EC4A 1FAAA 2YANA 4WF5A 4PQ1A 1U3IA 1EWXA 2I1UA 3BD2A 3MWHA 4V1Ap 3F4SA 2YNXA 4PQHA 1SJZA 1LBKA 3HZ8A 2R0PA 1R4WA 4BL7B 4OO4A 1I1IP 3HYPA 2PVQA 1B9YC 3GX8A 4EVMA 5FHIA 1GRXA 1M2DA 5DCGA 1ML6A 1PQNA 2YV7A 4HU9A 3PGTA 2AUVA 3TRQA 1K3OA 1WOUA 5D9TA 4J56E 4IVFA 5GAPD 1GUMA 4MDCA 3TRXA 2CQ9A 1GL8A 2WW2A 2PVOC 1C72A 1RQMA 3CSJA 3U6VA 1JHBA 2VL3A 4BPYA 2K8SA 4I97A 5B8AA 2KHPA 2WJUA 3FR6A 3DEXA 4HDEA 5FT3A 1ERTA 4O92A 10GSA 2OJLA 1TRSA 5D9WA 2H1AA 3TKSC 2IFQA 4HQZA 2REMA 4Z2TA 4NXIA 4MPFA 2K8VA 5AIXA 2VD1A 4HUAA 1K0MA 4ML1A 1PD21 2FWFA 3DYRA 3IHGA 3GMFA 3M0FA 2R5GA 1EEMA 1A8YA 3DGQA 2FUG2 4ECBA 2NVLA 1E6BA 4IQ1A 5GSTA 4FYBA 2FWEA 1K0AA 1WIKA 2L6DA 1SYXA 4KCEA 2CAIA 1G6YA 4QMKA 5EY6A 1GLQA 4GQFA 1ERVA 1OAZA 2M72A 3TKSE 4ZIJA 3HVVA 5FWGA 3ED3A 1WJKA 1SVOA 5LCZA 2CVKA 2K18A 1TK5B 3CBUA 1YKAA 1OC9A 1XWGA 1U3AA 2YP6A 3CSIA 4TXOA 1EP7A 1YZXA 4HSCX 4POMA 1M7TA 3VI7A 2CA8A 1FOVA 3O6TA 1FVKA 2DC5A 3L0HA 4F82A 3MSZA 4KF9A 2OE1A 5F0GA 3VWWA 3IAS2 3C8EA 2HSMA 5LD0A 3CHXC 2I4AA 1ILOA 1H75A 3KEBA 4OFNA 2HT9A 3ZIJA 5ECMB 1TJDA 1PFOA 1HQOA 1QK8A 1VGLA 3OR5A 1PX7A 5ECPB 4TR1A 5HR3A 1YVLA 4Q5FA 1DUGA 2LJAA 3D0ZA 2G2QA 1PRXA 4O32A 2GGTA 1UC7A 4LMWA 4HJ2A 5JCWA 2CX3A 4LA1A 1DE2A 2VLUA 3RFRC 4KE3A 4CW9A 5DQYA 2C0FA 1V9WA 4USSA 4QQ7A 4BIKA 4ZILA 1THXA 5ID2B 2TIRA 3RBTA 2EFCA 3DRNA 1GTAA 2YWOA 2H01A 4JE1A 2ON7A 4ISDA 1GSDA 1ZZYA 4O5UA 2GSQA 4RQXA 1BYEA 4AKGA 3HVNA 5ENUA 5JCGA 3J7Yk 5KEJA 2WVYA 1SK0A 3GHAA 1TKDB 1OC3A 4Z2RA 2DJ1A 5G30A 5AGYA 4GCIA 1VF4A 3TOTA 4J2FA 2PBJA 2B6MA 5GAND 2CT6A 2H72A 5ECNB 1FB0A 3ZREA 1T1VA 3M1GA 3LJRA 1TW9A 1HD2A 2IMDA 3H93A 1GTBA 5IO0A 3NIVA 4Q5QA 2H0HA 2JZSA 4EDYA 1TRWA 3NZNA 3GTUA 4KSOA 5G2ZA 3AY8A 4JZQA 4PX1A 5J40A 4Z2UA 4ID0A 2O5VA 3KP9A 2H75A 1GNEA 1GSUA 4DSSA 2R0CA 1NHOA 4TR3A 3GSSA 2XHFA 5EL8A 2WVZA 4ZBAA 4V2NA 2O3EA 1XBSA 4WBJA 3UMAA 1WMJA 3GN3A 2HSHA 5IOXA 1B9XC 1G7EA 2B7JA 3QOUA 1OKDA 1XZOA 2FWHA 3FZ4A 1K0CA 4KX4A 1AW9A 3GX0A 3L78A 4OMVA 2C4JA 4TRXA 3MDKA 2YWIA 4G9HA 4L0UA 3MIXA 1SD9A 2KP2A 2L5LA 2OBKA 3FHKA 3IR4A 4EXJA 1SKSB 2LEGA 4MK3A 4IELA 4PURA 4EO3A 2CZ2A 4KNDA 5CAXA 1SYRA 4AF2A 2X4AA 3IV4A 1OE7A 3E9JB 3QD9A 4WBRD 2YN1A 3TRPA 3G7YA 3BBYA 5CRDA 3VPQA 2N5BA 4MF6A 3TJFA 2O85A 5HFIA 3C1RA 1J9BA 2OKAA 3DMLA 3IC8A 2E0QA 1A2JA 2J23A 4WR4A 3ME8A 1M3JA 2H1BA 4IN0A 5D9XA 2X64A 4XS4A 2JADA 1TU7A 3GKMA 4PQIA 5KN0A 5D8IA 5AIVA 6GSYA 2WW1A 1X9WB 1USBA 3QFAC 2HXKA 2PUKC 4DEJA 2H76A 1WP0A 4FH8A 3IXRA 3W8JA 1MTCA 3KJYA 4TXVA 4K2XA 1SENA 2H73A 2MBTA 2GS3A 2PPTA 1X5EA 4FO5A 4I5QA 2WVXA 2V41A 3U5RE 2K6VA 4WEYA 1GSFA 2R6KA 2XPDA 2C80A 2WULA 1FO5A 4OCEA 2IMIA 1WE0A 2X8GA 1BJXA 4DSRA 4F9ZA 2OA7A 2WW3A 4CY8A 1GTIA 3HJPA 4G19A 2R3XA 1SU9A 1V58A 3WGEA 4MP4A 3ERWA 2A4HA 5A1NA 2QSIA 4LL4B 5DJMA 2FGXA 5E4WA 2DJ3A 4MABA 1AAZA 1I9DA 1WRYA 1A0RP 3KH7A 3LORA 2DMLA 2V32A 2C0GA 2JACA 3VLNA 3PR8A 5DQSA 4TN8A 3TKRA 3BJ5A 2IJYA 1ZYNA 3LFLA 5ECRB 3WT2A 5DAKA 3EU4A 5IOWA 5ECOB 8GSSA 4YKGA 5H5SA 1BF5A 2C3QA 5CRHA 2MMAA 1VF1A 3QAVA 4AJ6A 1TDIA 3KP8A 2H1GA 4KAEA 2BMXA 2R4VA 3G9BA 5J5NA 5ELGA 4XS1A 1ABAA 3H8QA 1K0OA 5D73A 2OACA 2IPAA 2HZEB 1B4PA 4GTUA 3K8NA 5G5FA 5IMCA 3F8UA 4MZBA 5H5QA 2JZRA 2WB9A 3ZMLA 2HFDA 3R2QA 5JCUA 1EGRA 5CRWA 1R7HA 1GSEA 4KDYA 2OBIA 3UBKA 2FCHA 4ZXGA 4W66A 1O6JA 3QAWA 4AI6A 1A2LA 2H0GA 2H8LA 2MBSA 4HU7A 2RUEA 2ZUPA 3CTFA 2VCQA 2L59A 1OKTA 3HY2A 4EIPA 4X4JA 3UVTA 1ZL9A 3WGXA 2HE3A 3D4MA 2M80A 2ALBA 5E59A 4EF0A 5KN2A 1FHEA 3TJGA 5COHA 1EP8A 4LL1B 1G0TA 1Z6NA 1K3YA 4XCSA 2P0GA 2C0EA 1GNWA 2HYXA 3HJOA 2GQLA 3HXSA 3KCMA 3GRXA 3Q6OA 4BVYB 2H0IA 2VAFA 4YAVA 2GVPA 2YOIA 2EFDA 2PWJA 2C3NA 4IP1A 5DCHA 3CQFA 3GFKA 5IIZA 4ILFA 3QFBC 3RHBA 4OO5A 1GSQA 1T7PB 4MA9A 4L5LA 4V2MA 1XPVA 3PINA 4BVXA 1TP9A 1BEDA 4N0VA 2AB6A 3GSTA 3ZITA 1OC8A 4PNFA 4MNNA 2R2JA 1N8JA 4RI6A 3KXOA 4JU5A 1T8EB 2B1LA 4DVCA 2OE0A 1MDKA 1F3AA 1XWCA 4MJBA 3RDWA 3FKFA 2XBQA 4NWYA 1AQWA 3IA1A 2L4CA 4WETA 3ZRDA 1FOHA 2AYTA 3O3TA 5GZZB 1KEBA 1W4VA 1OYJA 1THOA 3ZYWA 2ON5A 4K0GA 1ZYEA 3GV1A 1YEXA 2VCZA 3D4TA 3EPTA 4GSTA 4POBA 4HS1A 4D73B 1SK1A 1PMTA 3LGCA 4Q5RA 2QKEA 1PKZA 3UOMA 2UZ8A 1Z7PA 4MMMA 2RM5A 2HRAA 3EYTA 3ZFBA 2JL4A 4V2LA 3F3QA 2GSTA 2CX4A 2WGRA 3IK7A 1NHYA 2B5XA 1FB6A 2GZZA 3TJKA 4K2DA 3F0IA 1R5AA 5ECLB 1O73A 5CO3A 1DSBA 1T00A 2KOKA 1A24A 2DJJA 2OE3A 4ZB7A 3KZQA 3GL5A 3I43A 1QUWA 3I69A 3IHQA 1GULA 2RLIA 5F05A 3IPZA 3KH9A 3IK9A 1JZDA 4P3YB 3VWUA 5A34A 2IN3A 2J9HA 3TGZA 2H6ZA 4RI7A 1TI3A 3C7MA 3A3TA 2QA1A 4HI7A 1SKWB 1SK2A 3TUEA 2A4VA 2Z9SA 5J41A 2B5YA 4YQVA 3IBHA 3FK8A 5J9BA 4EIQA 2L57A 3MYDA 2GDRA 1MD3A 2YCDA 2QA2A 5A5HA 5B8BA 3W6GA 3P7XA 2HRKA 5HFGA 4MZWA 2VD0A 1ERUA 2YWNA 4WXTA 2VUPA 3EU3A 3EURA 3LXZA 3DD3A 4OFTA 4K7OA 1VF2A 1O81A 4POKA 1XIYA 2OT3A 1SVMA 1YKCA 1TI1A 4YAPA 2IFQB 5D93A 6GSXA 1GWCA 3HJMA 4L8EA 3FZ9A 2X8CA 1HNBA 5IMFA 4ZB9A 2FA8A 2V1MA 4WF4A 2IMFA 1BAYA 4IQAA 4N3ZA 1TRVA 4CHSA 2B5EA 1M99A 2X8HA 2YJHA 3VURA 3ERGA 1M0UA 3RPPA 2IMEA 4ECIA 1GTUA 1H4OA 3HKRA 4OFMA 1OC9B 3G7IA 1T4YA 2CV4A 4TXOB 4K1FA 3D6IA 1V57A 1U6TA 5C00A 5G1LA 3O76A 3SBCA 4TW5A 3KM6A 2L6CA 1O7UA 4TOPA 3CRTA 3D22A 4ZL8A 2HSMB 3VWXA 1QMVA 3QR6A 5G5EA 3ME7A 2FLSA 3RPNA 5F8BA 1GSSA 4G10A 2VCTA 5CRGA 5HR1A 3KMOA 2HRFA 4GLTA 4NV2A 1DE1A 5J4UA 1BG1A 4TR1B 4L0WA 2EFHA 2H70A 5JWQB 3RAZA 5F07A 19GSA 1LJRA 4IKHA 3VK9A 3APSA 1IYHA 3DWVA 2LJRA 3UEMA 3M3MA 3FZ5A 2YPMA 2LQQA 3M9JA 3HVSA 1PGTA 2EIQA 2GQKA 2YV9A 2V2GA 3DVXA 3BOAA 1UVZA 4KUNA 4K7NA 2VL9A 2X49A 1JZRA 3GUSA 2G0FA 3FEUA 5DALA 3PPUA 2C8UA 1M9AA 5IMVA 4I2UA 2C1YA 4NHWA 1M2AA 2HSNA 2E2GA 3GH9A 2I81A 2E2MA 2H6XA 1YY7A 2WZ9A 1UN2A 4K6XA 2PN8A 1PSQA 1TOFA 2LRNA 2FWGA 5IM9A 1MDJA 2DSAA 3TB2A 1SKRB 3LSZA 2O89A 3FZAA 1SJIA 5KOXA 4NV5A 5BMUA 1XCCA 4KH7A 2A2PA 1Z5YE 4MZCA 1F9MA 5H5RA 3APQA 2VM1A 4TR4A 1QXHA 3EVIA 3LXTA 2TRCP 1NM3A 1TK0B 4BWSA 3GTUB 2DBCA 1GH2A 3ZVJD 3TCOA 2DIZA 3Q19A 1OVNA 2DJ0A 5HFKA 3VI5A 2QC7A 3CXGA 1ZOFA 4DSSB 5GSSA 1RK4A 2YWMA 2ES7A 4EE0A 1ERWA 1SD8A 5BRTA 4F2IA 5DBQA 3KTLA 3L9SA 4LMVA 1K3LA 4RUVA 1EV4A 3APOA 1KNGA 2R0GA 4XS6A 3ZTLA 3BCKA 4PI2C 4PNGA 3ERFA 1ZYPA 2FY6A 6GSWA 4GF0A 9GSSA 1YEPA 4CDOA 3EWLA 4ECCA 3F4TA 2PGTA 4IGJA 1M3IA 1IYIA 1W89A 3GL3A 2YZUA 5IPHA 1GUHA 2GLRA 1CQHA 4AJ8A 1G7OA 1EZKA 2WW0A 4PUFC 7GSSA 2MZCA 13GSA 3KD0A 5DDLA 2K9FA 4G0IA 1TTZA 1E2YA 3V1WA
chains in the Genus database with same CATH topology
1X0RA 4E8HA 4K5RA 1QFNA 3ZIVA 2VCVA 2O7KA 1F2EA 4PUAA 5HQPA 2F3MA 4G2EA 3KGKA 5A4VA 1PN9A 4BL7A 2GZPA 4HZ2A 1URMA 2B1KA 1A2MA 1NW2A 2H1LA 4OD7A 2L5OA 3ZFLA 1GUKA 3UBLA 3LWAA 2VL2A 3FW2A 2B3SA 2LTKA 4XS4B 4N10A 3EE2A 1EEJA 3DVWA 2QGVA 2IMKA 3FMWA 5JWOB 4WKWA 1ZGNA 5B6MA 3VPTA 2DJ2A 4TR0A 3J7Yb 3N9JA 4KB3A 2LJKA 2JSZA 2PU9C 4MLYA 1GLPA 1PL2A 2GSSA 1LU4A 2NDOA 2JZTA 4AJ7A 4IS0A 3P90A 2HZFA 2WDUA 2WRTA 2ZCTA 2FA4A 3H79A 3ZLPA 1Z9HA 3R3EA 2JU5A 3A2XA 3UL3A 4ULXA 6GSSA 4L5OA 5CP1A 1I5GA 3IRAA 1CQGA 4RQRA 1K0BA 5AISA 5INYA 1R26A 1F37A 3DXBA 4QL9A 4XIHA 5A1NB 4DSQA 4YH2A 2LQOA 3G7JA 3GNJA 2FD3A 5EPFA 1PA3A 4OWYA 4EL1A 1Z6MA 2O8VB 3QMXA 4ICYA 1PN0A 22GSA 2HQTA 2P5QA 5DAKB 5ECQB 2I9HA 4IJ3A 4WR5A 6GSUA 4GSSA 4KDXA 1XVWA 2GSRA 1AC1A 2LV3A 1XWKA 3KTBA 4O5RA 2KLXA 4HQSA 2MMNA 2P31A 5ECSA 1Y25A 2RM6A 3LG6A 2DJKA 2VKZG 3IDVA 1B4QA 3FY7A 5A4WA 1MD4A 1XOAA 5ECKB 2KUCA 1Y1UA 3F4RA 3A5WA 4GXZA 4LLRA 4KDUA 2ZNMA 1B8XA 4EDZA 3QCPA 6GSTA 3A5IA 3HDCA 2GTUA 4MJEA 2FNOA 3F9UA 4E8EA 3CSHA 1SJ6A 1SVLA 5J3RA 1U88A 1S3CA 2IIYA 2WFCA 3GIXA 1BQ7A 1AQXA 4GRFA 1NSWA 2CZ3A 3UIWA 2I3YA 1JLVA 2NTOA 2AAWA 1A0FA 5AN1A 3GH6A 5ID2A 4CY6A 1XXUA 3D21A 1YF1A 2WS2A 2EIRA 4O5QA 4PTSA 3GA4A 2V6KA 3TJJA 3HVXA 1T3BA 5J47A 3EMXA 2VM2A 3NOFA 1O8XA 3TKSA 1AUCA 2DKIA 2GT5A 1ACVA 4JR4A 3N5OA 3CYNA 4K7IA 12GSA 1TRUA 2CAQA 5A5KA 3ZVJA 1HYUA 3TU3B 1YF0A 3H4KA 1K0NA 5ELAA 4BVXB 2LUSA 4NAXA 4A5PA 3EINA 4MJAA 3IAM2 5J4VA 4X0XA 1B48A 1S3DA 2LSTA 1RW1A 2E7PA 3DIEA 3IC4A 4V1Ag 4XHMA 1HNCA 1J0FA 3UAPA 4AKHA 1QGVA 3JCML 2NPBA 4AKXB 4PGTA 5DJLA 4GWRA 4OCFA 3D5JA 3EC3A 2CVDA 1Z7RA 2F9SA 5CNWA 2VCXA 5ABRA 1U87A 4YKFA 4XRDA 2NBSA 1GP1A 2LNTA 2DLXA 4N0ZA 4F0CA 4HZ4A 4HJMA 1V2AA 1FW1A 4MH2A 1TXXA 1O85A 4Q5NA 2MYGA 1X5CA 3FYGA 4MH3A 1OE8A 1Z3EA 3EMPA 1O8WA 3LQ7A 3TOUA 3WT1A 2LRTA 5IMZA 3F6FA 4JEDA 5JWRB 1JZWA 5B7CA 3GKKA 2PERA 3GURA 5IO2A 3KMNA 1Q98A 3LEFA 3E3EA 4EUYA 4KGIA 5EVOA 5G1KA 4N30A 3RHCA 5A34B 1J08A 3SWLA 3ZMKA 1JLWA 1SL2B 2VLVA 2DIYA 1FG4A 2V6OA 1QQ2A 1SL0B 4IBPA 1TK8B 3HMJG 5ECIB 3HZ4A 1EOHA 1BX9A 5J9CA 17GSA 1ZMAA 3L9UA 3UVHA 3FRCA 1N2AA 2LRCA 2XBIA 1Q4JA 4ECJA 3WYWA 3TDGA 2HNLA 4YQMA 3I9V2 3CWGA 5A5HB 3HA9A 1TU8A 3HHVA 2HRKB 2CVBA 3QDNA 3C1SA 1VF3A 4GQCA 1R5PA 4F0BA 2AHEA 4ACSA 1Y6EA 4BWQA 4F03A 1AXDA 5KN1A 4MPGA 2H74A 4FQUA 4IP6A 1X9MB 2TRXA 2N5AA 3A2VA 2L4QA 1MEKA 3Q18A 3C73A 3PH9A 3UJ1A 4HEA2 4ZB6A 2EFEA 5IQYA 2UV8G 3QPMA 2H6YA 2MMOA 2LKUA 4FYCA 4KCAA 2H1DA 3F63A 2RUFA 3E0UA 5KOWA 4G0KA 5LNKe 3CMIA 2LS5A 1YQ1A 2O87A 3IE3A 3IOSA 14GSA 4IHUA 3ZL5A 2XC2A 4EKZA 2C3TA 3WD6A 1BG5A 5F06A 1XW9A 4NMUA 3M9KA 5G31A 1DBYA 1PKWA 2MMZA 1YJ6A 4MCUA 2VO4A 3H1NA 4K0NA 2LNSA 3TKQA 3MAKA 1AIUA 5J4YA 2IL3A 1EOGA 2HLSA 1XWAA 4ZBBA 1XVQA 3S9FA 1X9SB 5C04A 5DVBA 4K8MA 1EV9A 3US3A 4JBBA 2HZEA 16GSA 2VCWA 3QAGA 4I6XA 5HR0A 1UA5A 3TKPA 5D96A 1PX6A 1S3AA 2DMMA 4MJCA 4I2TA 1TXUA 1T4ZA 4EC0A 2YZHA 2VIMA 4GDFA 3LYPA 1KTEA 5IPGA 1ZYQB 3HD5A 5ECHB 1WPIA 1A23A 1VRSD 4G0LA 18GSA 5HR2A 2R37A 1F6MC 3KIJA 3C71A 2BJXA 2DKHA 4FYUA 4KW6A 2FHEA 2AJQB 3VFIA 2GT6A 3Q74A 3GKXA 3UARA 5L71A 4MF7A 3CRUA 3F6DA 2GQMA 1AQVA 2A2RA 2HSYA 3DKSA 3FR9A 2EIOA 4YQUA 11GSA 3W8SA 2H30A 5DALB 5KN3A 3P8WA 2C0DA 1FVJA 5A4UA 4HOJA 2HSNB 4NPBA 2VL2C 4TVEA 4ZL7A 5IMDA 1V40A 5CREA 1K0DA 4NHZA 3BCIA 2A2SA 1XOBA 1HNAA 3P2AA 1N25A 2M46A 4AGSA 2VLTA 5BMUB 1X5DA 1V98A 4BVYA 1XFLA 4BA7A 1G6WA 3HCZA 4MF5A 1WWJA 1JZOA 4N11A 4QL7A 2GZYA 4ZL9A 1ZCPA 2H71A 1EGOA 4POLA 4J57E 1YDKA 2H19A 3CTGA 4K5SA 3ZZXA 2F51A 2BTOT 2VOCA 1PL1A 1XWBA 1M2BA 3L9VA 1M9BA 2X99A 1GSYA 4IW9A 3MNGA 5D9VA 3LW9A 2XPEA 4XRAA 2F8AA 4KA0A 4Z7XA 1ON4A 1MDIA 4X1UA 4X43A 4K9ZA 4JR6A 4E68A 3I6AA 2D2ZA 20GSA 4AKIA 1ST9A 2H66A 3GKNA 1KBNA 2YJ7A 4KSMA 4IJIA 4PXOA 2HRNA 2F8FA 6GSVA 2JSYA 4GSNA 2OADA 3LYKA 2WCIA 1XW6A 3GYKA 3ISOA 1XW5A 5CYYA 4ML6A 4D73A 2HI7A 4TKYA 3M8NA 1F3BA 3F3RA 4FIWA 5IMAA 1JFUA 2N5FA 4H86A 2P5RA 4O7HA 2RIIA 4XTSA 3FR3A 3TJBA 4ZB8A 2IWTA 5B6NA 1SL1B 4G01A 4ZBDA 2KP1A 4JRRA 4I8BA 3VWVA 3WGDA 3A2WA 2B7KA 1A8LA 3L4NA 2AV4A 2PMTA 2EC4A 1FAAA 2YANA 4WF5A 4PQ1A 1U3IA 1EWXA 2I1UA 3BD2A 3MWHA 4V1Ap 3F4SA 2YNXA 4PQHA 1SJZA 1LBKA 3HZ8A 2R0PA 1R4WA 4BL7B 4OO4A 3HYPA 2PVQA 1B9YC 3GX8A 4EVMA 5FHIA 1GRXA 1M2DA 5DCGA 1ML6A 1PQNA 2YV7A 4HU9A 3PGTA 2AUVA 3TRQA 1K3OA 1WOUA 5D9TA 4J56E 4IVFA 5GAPD 1GUMA 4MDCA 3TRXA 2CQ9A 1GL8A 2PVOC 1C72A 1RQMA 3CSJA 3U6VA 1JHBA 2VL3A 4BPYA 2K8SA 4I97A 5B8AA 2KHPA 2WJUA 3FR6A 3DEXA 4HDEA 5FT3A 1ERTA 4O92A 10GSA 2OJLA 1TRSA 5D9WA 2H1AA 3TKSC 2IFQA 4HQZA 2REMA 4Z2TA 4NXIA 4MPFA 2K8VA 5AIXA 2VD1A 4HUAA 1K0MA 4ML1A 1PD21 2FWFA 3DYRA 3IHGA 3GMFA 3M0FA 2R5GA 1EEMA 1A8YA 3DGQA 2FUG2 4ECBA 2NVLA 1E6BA 4IQ1A 5GSTA 4FYBA 2FWEA 1K0AA 1WIKA 2L6DA 1SYXA 4KCEA 2CAIA 1G6YA 4QMKA 5EY6A 1GLQA 4GQFA 1ERVA 1OAZA 2M72A 3TKSE 4ZIJA 3HVVA 5FWGA 3ED3A 1WJKA 1SVOA 5LCZA 2CVKA 2K18A 1TK5B 3CBUA 1YKAA 1OC9A 1XWGA 1U3AA 2YP6A 3CSIA 4TXOA 1EP7A 1YZXA 4POMA 1M7TA 3VI7A 2CA8A 1FOVA 3O6TA 1FVKA 2DC5A 3L0HA 4F82A 3MSZA 4KF9A 2OE1A 5F0GA 3VWWA 3IAS2 3C8EA 2HSMA 5LD0A 2I4AA 1ILOA 1H75A 3KEBA 4OFNA 2HT9A 3ZIJA 5ECMB 1TJDA 1HQOA 1QK8A 1VGLA 3OR5A 1PX7A 5ECPB 4TR1A 5HR3A 1YVLA 4Q5FA 1DUGA 2LJAA 3D0ZA 2G2QA 1PRXA 4O32A 2GGTA 1UC7A 4LMWA 4HJ2A 5JCWA 2CX3A 4LA1A 1DE2A 2VLUA 4KE3A 4CW9A 5DQYA 2C0FA 1V9WA 4USSA 4QQ7A 4ZILA 1THXA 5ID2B 2TIRA 3RBTA 2EFCA 3DRNA 1GTAA 2YWOA 2H01A 4JE1A 2ON7A 4ISDA 1GSDA 1ZZYA 4O5UA 2GSQA 4RQXA 1BYEA 4AKGA 5ENUA 5JCGA 3J7Yk 5KEJA 1SK0A 3GHAA 1TKDB 1OC3A 4Z2RA 2DJ1A 5G30A 5AGYA 4GCIA 1VF4A 3TOTA 4J2FA 2PBJA 2B6MA 5GAND 2CT6A 2H72A 5ECNB 1FB0A 3ZREA 1T1VA 3M1GA 3LJRA 1TW9A 1HD2A 2IMDA 3H93A 1GTBA 5IO0A 3NIVA 4Q5QA 2H0HA 2JZSA 4EDYA 1TRWA 3NZNA 3GTUA 4KSOA 5G2ZA 3AY8A 4JZQA 4PX1A 5J40A 4Z2UA 4ID0A 2O5VA 3KP9A 2H75A 1GNEA 1GSUA 4DSSA 2R0CA 1NHOA 4TR3A 3GSSA 2XHFA 5EL8A 4ZBAA 4V2NA 1XBSA 4WBJA 3UMAA 1WMJA 3GN3A 2HSHA 5IOXA 1B9XC 1G7EA 2B7JA 3QOUA 1OKDA 1XZOA 2FWHA 3FZ4A 1K0CA 4KX4A 1AW9A 3GX0A 3L78A 4OMVA 2C4JA 4TRXA 3MDKA 2YWIA 4G9HA 4L0UA 3MIXA 1SD9A 2KP2A 2L5LA 2OBKA 3FHKA 3IR4A 4EXJA 1SKSB 2LEGA 4MK3A 4IELA 4PURA 4EO3A 2CZ2A 4KNDA 5CAXA 1SYRA 4AF2A 2X4AA 3IV4A 1OE7A 3E9JB 3QD9A 4WBRD 2YN1A 3TRPA 3G7YA 3BBYA 5CRDA 3VPQA 2N5BA 4MF6A 3TJFA 2O85A 5HFIA 3C1RA 1J9BA 2OKAA 3DMLA 3IC8A 2E0QA 1A2JA 2J23A 4WR4A 3ME8A 2H1BA 4IN0A 5D9XA 2X64A 4XS4A 2JADA 1TU7A 3GKMA 4PQIA 5KN0A 5D8IA 5AIVA 6GSYA 1X9WB 1USBA 3QFAC 2HXKA 2PUKC 4DEJA 2H76A 1WP0A 4FH8A 3IXRA 3W8JA 1MTCA 3KJYA 4TXVA 4K2XA 1SENA 2H73A 2MBTA 2GS3A 2PPTA 1X5EA 4FO5A 4I5QA 2V41A 3U5RE 2K6VA 4WEYA 1GSFA 2R6KA 2XPDA 2C80A 2WULA 1FO5A 4OCEA 2IMIA 1WE0A 2X8GA 1BJXA 4DSRA 4F9ZA 2OA7A 4CY8A 1GTIA 3HJPA 4G19A 2R3XA 1SU9A 1V58A 3WGEA 4MP4A 3ERWA 2A4HA 5A1NA 2QSIA 4LL4B 5DJMA 2FGXA 5E4WA 2DJ3A 4MABA 1AAZA 1I9DA 1WRYA 1A0RP 3KH7A 3LORA 2DMLA 2V32A 2C0GA 2JACA 3VLNA 3PR8A 5DQSA 4TN8A 3TKRA 3BJ5A 2IJYA 1ZYNA 3LFLA 5ECRB 3WT2A 5DAKA 3EU4A 5IOWA 5ECOB 8GSSA 4YKGA 5H5SA 1BF5A 2C3QA 5CRHA 2MMAA 1VF1A 3QAVA 4AJ6A 1TDIA 3KP8A 2H1GA 4KAEA 2BMXA 2R4VA 3G9BA 5J5NA 5ELGA 4XS1A 1ABAA 3H8QA 1K0OA 5D73A 2OACA 2IPAA 2HZEB 1B4PA 4GTUA 3K8NA 5G5FA 5IMCA 3F8UA 4MZBA 5H5QA 2JZRA 2WB9A 3ZMLA 2HFDA 3R2QA 5JCUA 1EGRA 5CRWA 1R7HA 1GSEA 4KDYA 2OBIA 3UBKA 2FCHA 4ZXGA 4W66A 1O6JA 3QAWA 4AI6A 1A2LA 2H0GA 2H8LA 2MBSA 4HU7A 2RUEA 2ZUPA 3CTFA 2VCQA 2L59A 1OKTA 3HY2A 4EIPA 4X4JA 3UVTA 1ZL9A 3WGXA 2HE3A 3D4MA 2M80A 2ALBA 5E59A 4EF0A 5KN2A 1FHEA 3TJGA 5COHA 1EP8A 4LL1B 1G0TA 1Z6NA 1K3YA 4XCSA 2P0GA 2C0EA 1GNWA 2HYXA 3HJOA 2GQLA 3HXSA 3KCMA 3GRXA 3Q6OA 4BVYB 2H0IA 2VAFA 4YAVA 2GVPA 2YOIA 2EFDA 2PWJA 2C3NA 4IP1A 5DCHA 3GFKA 5IIZA 4ILFA 3QFBC 3RHBA 4OO5A 1GSQA 1T7PB 4MA9A 4L5LA 4V2MA 1XPVA 3PINA 4BVXA 1TP9A 1BEDA 4N0VA 2AB6A 3GSTA 3ZITA 1OC8A 4PNFA 4MNNA 2R2JA 1N8JA 4RI6A 3KXOA 4JU5A 1T8EB 2B1LA 4DVCA 2OE0A 1MDKA 1F3AA 1XWCA 4MJBA 3RDWA 3FKFA 2XBQA 4NWYA 1AQWA 3IA1A 2L4CA 4WETA 3ZRDA 1FOHA 2AYTA 3O3TA 5GZZB 1KEBA 1W4VA 1OYJA 1THOA 3ZYWA 2ON5A 4K0GA 1ZYEA 3GV1A 1YEXA 2VCZA 3D4TA 3EPTA 4GSTA 4POBA 4HS1A 4D73B 1SK1A 1PMTA 3LGCA 4Q5RA 2QKEA 1PKZA 3UOMA 2UZ8A 1Z7PA 4MMMA 2RM5A 2HRAA 3EYTA 3ZFBA 2JL4A 4V2LA 3F3QA 2GSTA 2CX4A 2WGRA 3IK7A 1NHYA 2B5XA 1FB6A 2GZZA 3TJKA 4K2DA 3F0IA 1R5AA 5ECLB 1O73A 5CO3A 1DSBA 1T00A 2KOKA 1A24A 2DJJA 2OE3A 4ZB7A 3KZQA 3GL5A 3I43A 1QUWA 3I69A 3IHQA 1GULA 2RLIA 5F05A 3IPZA 3KH9A 3IK9A 1JZDA 4P3YB 3VWUA 5A34A 2IN3A 2J9HA 3TGZA 2H6ZA 4RI7A 1TI3A 3C7MA 3A3TA 2QA1A 4HI7A 1SKWB 1SK2A 3TUEA 2A4VA 2Z9SA 5J41A 2B5YA 4YQVA 3IBHA 3FK8A 5J9BA 4EIQA 2L57A 3MYDA 2GDRA 1MD3A 2YCDA 2QA2A 5A5HA 5B8BA 3W6GA 3P7XA 2HRKA 5HFGA 4MZWA 2VD0A 1ERUA 2YWNA 4WXTA 2VUPA 3EU3A 3EURA 3LXZA 3DD3A 4OFTA 4K7OA 1VF2A 1O81A 4POKA 1XIYA 2OT3A 1SVMA 1YKCA 1TI1A 4YAPA 2IFQB 5D93A 6GSXA 1GWCA 3HJMA 4L8EA 3FZ9A 2X8CA 1HNBA 5IMFA 4ZB9A 2FA8A 2V1MA 4WF4A 2IMFA 1BAYA 4IQAA 4N3ZA 1TRVA 4CHSA 2B5EA 1M99A 2X8HA 2YJHA 3VURA 3ERGA 1M0UA 3RPPA 2IMEA 4ECIA 1GTUA 1H4OA 3HKRA 4OFMA 1OC9B 3G7IA 1T4YA 2CV4A 4TXOB 4K1FA 3D6IA 1V57A 1U6TA 5C00A 5G1LA 3O76A 3SBCA 4TW5A 3KM6A 2L6CA 1O7UA 4TOPA 3CRTA 3D22A 4ZL8A 2HSMB 3VWXA 1QMVA 3QR6A 5G5EA 3ME7A 2FLSA 3RPNA 5F8BA 1GSSA 4G10A 2VCTA 5CRGA 5HR1A 3KMOA 2HRFA 4GLTA 4NV2A 1DE1A 5J4UA 1BG1A 4TR1B 4L0WA 2EFHA 2H70A 5JWQB 3RAZA 5F07A 19GSA 1LJRA 4IKHA 3VK9A 3APSA 1IYHA 3DWVA 2LJRA 3UEMA 3M3MA 3FZ5A 2YPMA 2LQQA 3M9JA 3HVSA 1PGTA 2EIQA 2GQKA 2YV9A 2V2GA 3DVXA 3BOAA 1UVZA 4KUNA 4K7NA 2VL9A 2X49A 1JZRA 3GUSA 2G0FA 3FEUA 5DALA 3PPUA 2C8UA 1M9AA 5IMVA 4I2UA 2C1YA 4NHWA 1M2AA 2HSNA 2E2GA 3GH9A 2I81A 2E2MA 2H6XA 1YY7A 2WZ9A 1UN2A 4K6XA 2PN8A 1PSQA 1TOFA 2LRNA 2FWGA 5IM9A 1MDJA 2DSAA 3TB2A 1SKRB 3LSZA 2O89A 3FZAA 1SJIA 5KOXA 4NV5A 5BMUA 1XCCA 4KH7A 2A2PA 1Z5YE 4MZCA 1F9MA 5H5RA 3APQA 2VM1A 4TR4A 1QXHA 3EVIA 3LXTA 2TRCP 1NM3A 1TK0B 4BWSA 3GTUB 2DBCA 1GH2A 3ZVJD 3TCOA 2DIZA 3Q19A 1OVNA 2DJ0A 5HFKA 3VI5A 2QC7A 3CXGA 1ZOFA 4DSSB 5GSSA 1RK4A 2YWMA 2ES7A 4EE0A 1ERWA 1SD8A 5BRTA 4F2IA 5DBQA 3KTLA 3L9SA 4LMVA 1K3LA 4RUVA 1EV4A 3APOA 1KNGA 2R0GA 4XS6A 3ZTLA 3BCKA 4PNGA 3ERFA 1ZYPA 2FY6A 6GSWA 4GF0A 9GSSA 1YEPA 4CDOA 3EWLA 4ECCA 3F4TA 2PGTA 4IGJA 1IYIA 1W89A 3GL3A 2YZUA 5IPHA 1GUHA 2GLRA 1CQHA 4AJ8A 1G7OA 1EZKA 4PUFC 7GSSA 2MZCA 13GSA 3KD0A 5DDLA 2K9FA 4G0IA 1TTZA 1E2YA 3V1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0R A;  4E8H A;  1QFN A;  3ZIV A;  2VCV A;  2O7K A;  1F2E A;  4PUA A;  5HQP A;  2F3M A;  4G2E A;  3KGK A;  5A4V A;  1PN9 A;  4BL7 A;  2GZP A;  4HZ2 A;  1URM A;  2B1K A;  1A2M A;  1NW2 A;  4OD7 A;  2L5O A;  3ZFL A;  1GUK A;  3UBL A;  3LWA A;  2VL2 A;  3FW2 A;  2B3S A;  2LTK A;  4XS4 B;  4N10 A;  3EE2 A;  1EEJ A;  3DVW A;  2QGV A;  2IMK A;  5JWO B;  4WKW A;  1ZGN A;  5B6M A;  3VPT A;  2DJ2 A;  4TR0 A;  3J7Y b;  3N9J A;  4KB3 A;  2LJK A;  2JSZ A;  2PU9 C;  4MLY A;  1GLP A;  1PL2 A;  2GSS A;  1LU4 A;  2NDO A;  2JZT A;  4AJ7 A;  4IS0 A;  3P90 A;  2HZF A;  2WDU A;  2WRT A;  2ZCT A;  2FA4 A;  3H79 A;  3ZLP A;  1Z9H A;  3R3E A;  2JU5 A;  3A2X A;  3UL3 A;  4ULX A;  6GSS A;  4L5O A;  5CP1 A;  1I5G A;  3IRA A;  1CQG A;  4RQR A;  1K0B A;  5AIS A;  5INY A;  1R26 A;  1F37 A;  3DXB A;  4QL9 A;  4XIH A;  4DSQ A;  4YH2 A;  2LQO A;  3G7J A;  3GNJ A;  2FD3 A;  5EPF A;  1PA3 A;  4OWY A;  4EL1 A;  1Z6M A;  2O8V B;  3QMX A;  22GS A;  2HQT A;  2P5Q A;  5DAK B;  5ECQ B;  2I9H A;  4IJ3 A;  4WR5 A;  6GSU A;  4GSS A;  4KDX A;  1XVW A;  2GSR A;  1AC1 A;  2LV3 A;  1XWK A;  3KTB A;  4O5R A;  2KLX A;  4HQS A;  2MMN A;  2P31 A;  5ECS A;  1Y25 A;  2RM6 A;  3LG6 A;  2DJK A;  3IDV A;  1B4Q A;  3FY7 A;  5A4W A;  1MD4 A;  1XOA A;  5ECK B;  2KUC A;  3F4R A;  3A5W A;  4GXZ A;  4LLR A;  4KDU A;  2ZNM A;  1B8X A;  4EDZ A;  3QCP A;  6GST A;  3HDC A;  2GTU A;  4MJE A;  2FNO A;  3F9U A;  4E8E A;  3CSH A;  1SJ6 A;  5J3R A;  1U88 A;  1S3C A;  2IIY A;  2WFC A;  3GIX A;  1BQ7 A;  1AQX A;  4GRF A;  1NSW A;  2CZ3 A;  3UIW A;  2I3Y A;  1JLV A;  2NTO A;  2AAW A;  1A0F A;  5AN1 A;  3GH6 A;  5ID2 A;  1XXU A;  3D21 A;  1YF1 A;  2WS2 A;  2EIR A;  4PTS A;  3GA4 A;  2V6K A;  3TJJ A;  3HVX A;  1T3B A;  3EMX A;  2VM2 A;  3NOF A;  1O8X A;  3TKS A;  1AUC A;  2GT5 A;  1ACV A;  4JR4 A;  3N5O A;  3CYN A;  4K7I A;  12GS A;  1TRU A;  2CAQ A;  5A5K A;  3ZVJ A;  1HYU A;  1YF0 A;  3H4K A;  1K0N A;  5ELA A;  4BVX B;  2LUS A;  4NAX A;  3EIN A;  4MJA A;  3IAM 2;  4X0X A;  1B48 A;  1S3D A;  2LST A;  1RW1 A;  2E7P A;  3DIE A;  3IC4 A;  4V1A g;  4XHM A;  1HNC A;  1J0F A;  3UAP A;  1QGV A;  3JCM L;  2NPB A;  4PGT A;  5DJL A;  4GWR A;  4OCF A;  3D5J A;  3EC3 A;  2CVD A;  1Z7R A;  2F9S A;  5CNW A;  2VCX A;  5ABR A;  1U87 A;  4XRD A;  2NBS A;  1GP1 A;  2LNT A;  2DLX A;  4N0Z A;  4F0C A;  4HZ4 A;  4HJM A;  1V2A A;  1FW1 A;  4MH2 A;  1TXX A;  1O85 A;  4Q5N A;  2MYG A;  1X5C A;  3FYG A;  4MH3 A;  1OE8 A;  1Z3E A;  3EMP A;  1O8W A;  3LQ7 A;  3TOU A;  3WT1 A;  2LRT A;  5IMZ A;  3F6F A;  4JED A;  5JWR B;  1JZW A;  5B7C A;  3GKK A;  2PER A;  3GUR A;  5IO2 A;  3KMN A;  1Q98 A;  3LEF A;  3E3E A;  4EUY A;  4KGI A;  5EVO A;  5G1K A;  4N30 A;  3RHC A;  1J08 A;  3SWL A;  3ZMK A;  1JLW A;  1SL2 B;  2VLV A;  2DIY A;  1FG4 A;  2V6O A;  1QQ2 A;  1SL0 B;  4IBP A;  1TK8 B;  5ECI B;  3HZ4 A;  1EOH A;  1BX9 A;  5J9C A;  17GS A;  1ZMA A;  3L9U A;  3UVH A;  3FRC A;  1N2A A;  2LRC A;  2XBI A;  1Q4J A;  4ECJ A;  3WYW A;  3TDG A;  2HNL A;  4YQM A;  3I9V 2;  3HA9 A;  1TU8 A;  3HHV A;  2HRK B;  2CVB A;  3QDN A;  3C1S A;  1VF3 A;  4GQC A;  1R5P A;  4F0B A;  2AHE A;  4ACS A;  1Y6E A;  4BWQ A;  4F03 A;  1AXD A;  5KN1 A;  4MPG A;  2H74 A;  4FQU A;  4IP6 A;  1X9M B;  2TRX A;  2N5A A;  3A2V A;  2L4Q A;  1MEK A;  3Q18 A;  3C73 A;  3PH9 A;  3UJ1 A;  4HEA 2;  4ZB6 A;  5IQY A;  3QPM A;  2H6Y A;  2MMO A;  2LKU A;  4FYC A;  4KCA A;  2H1D A;  3F63 A;  2RUF A;  3E0U A;  4G0K A;  5LNK e;  3CMI A;  2LS5 A;  1YQ1 A;  2O87 A;  3IE3 A;  3IOS A;  14GS A;  4IHU A;  3ZL5 A;  2XC2 A;  4EKZ A;  2C3T A;  3WD6 A;  1BG5 A;  5F06 A;  1XW9 A;  4NMU A;  3M9K A;  5G31 A;  1DBY A;  1PKW A;  2MMZ A;  1YJ6 A;  4MCU A;  2VO4 A;  3H1N A;  4K0N A;  2LNS A;  3TKQ A;  3MAK A;  1AIU A;  2IL3 A;  1EOG A;  2HLS A;  1XWA A;  4ZBB A;  1XVQ A;  3S9F A;  1X9S B;  5C04 A;  5DVB A;  4K8M A;  1EV9 A;  3US3 A;  4JBB A;  2HZE A;  16GS A;  2VCW A;  3QAG A;  4I6X A;  5HR0 A;  1UA5 A;  3TKP A;  5D96 A;  1PX6 A;  1S3A A;  2DMM A;  4MJC A;  4I2T A;  1T4Z A;  4EC0 A;  2YZH A;  2VIM A;  3LYP A;  1KTE A;  5IPG A;  1ZYQ B;  3HD5 A;  5ECH B;  1WPI A;  1A23 A;  1VRS D;  4G0L A;  18GS A;  5HR2 A;  2R37 A;  1F6M C;  3KIJ A;  3C71 A;  2BJX A;  4FYU A;  4KW6 A;  2FHE A;  2AJQ B;  3VFI A;  2GT6 A;  3Q74 A;  3GKX A;  3UAR A;  5L71 A;  4MF7 A;  3CRU A;  3F6D A;  2GQM A;  1AQV A;  2A2R A;  2HSY A;  3DKS A;  3FR9 A;  2EIO A;  4YQU A;  11GS A;  3W8S A;  2H30 A;  5DAL B;  5KN3 A;  3P8W A;  2C0D A;  1FVJ A;  5A4U A;  4HOJ A;  2HSN B;  4NPB A;  2VL2 C;  4TVE A;  4ZL7 A;  5IMD A;  1V40 A;  5CRE A;  1K0D A;  4NHZ A;  3BCI A;  2A2S A;  1XOB A;  1HNA A;  3P2A A;  2M46 A;  4AGS A;  2VLT A;  1X5D A;  1V98 A;  4BVY A;  1XFL A;  4BA7 A;  1G6W A;  3HCZ A;  4MF5 A;  1WWJ A;  1JZO A;  4N11 A;  4QL7 A;  2GZY A;  4ZL9 A;  1ZCP A;  2H71 A;  1EGO A;  4POL A;  4J57 E;  1YDK A;  2H19 A;  3CTG A;  3ZZX A;  2F51 A;  2BTO T;  2VOC A;  1PL1 A;  1XWB A;  1M2B A;  3L9V A;  1M9B A;  2X99 A;  1GSY A;  4IW9 A;  3MNG A;  5D9V A;  2XPE A;  4XRA A;  2F8A A;  4KA0 A;  4Z7X A;  1ON4 A;  1MDI A;  4X1U A;  4X43 A;  4K9Z A;  4JR6 A;  3I6A A;  2D2Z A;  20GS A;  1ST9 A;  2H66 A;  3GKN A;  1KBN A;  2YJ7 A;  4KSM A;  4IJI A;  4PXO A;  2HRN A;  2F8F A;  6GSV A;  2JSY A;  4GSN A;  2OAD A;  3LYK A;  2WCI A;  1XW6 A;  3GYK A;  3ISO A;  1XW5 A;  5CYY A;  4ML6 A;  4D73 A;  2HI7 A;  4TKY A;  3M8N A;  1F3B A;  3F3R A;  4FIW A;  5IMA A;  1JFU A;  2N5F A;  4H86 A;  2P5R A;  4O7H A;  2RII A;  4XTS A;  3FR3 A;  3TJB A;  4ZB8 A;  2IWT A;  5B6N A;  1SL1 B;  4ZBD A;  2KP1 A;  4JRR A;  4I8B A;  3VWV A;  3WGD A;  3A2W A;  2B7K A;  1A8L A;  3L4N A;  2AV4 A;  2PMT A;  2EC4 A;  1FAA A;  2YAN A;  4WF5 A;  4PQ1 A;  1U3I A;  1EWX A;  2I1U A;  3BD2 A;  3MWH A;  4V1A p;  3F4S A;  2YNX A;  4PQH A;  1SJZ A;  1LBK A;  3HZ8 A;  1R4W A;  4BL7 B;  4OO4 A;  3HYP A;  2PVQ A;  1B9Y C;  3GX8 A;  4EVM A;  5FHI A;  1GRX A;  1M2D A;  5DCG A;  1ML6 A;  1PQN A;  2YV7 A;  4HU9 A;  3PGT A;  2AUV A;  3TRQ A;  1K3O A;  1WOU A;  5D9T A;  4J56 E;  4IVF A;  5GAP D;  1GUM A;  4MDC A;  3TRX A;  2CQ9 A;  1GL8 A;  2PVO C;  1C72 A;  1RQM A;  3CSJ A;  3U6V A;  1JHB A;  2VL3 A;  4BPY A;  2K8S A;  4I97 A;  5B8A A;  2KHP A;  2WJU A;  3FR6 A;  3DEX A;  4HDE A;  5FT3 A;  1ERT A;  4O92 A;  10GS A;  2OJL A;  1TRS A;  5D9W A;  2H1A A;  3TKS C;  2IFQ A;  4HQZ A;  2REM A;  4NXI A;  4MPF A;  2K8V A;  5AIX A;  2VD1 A;  4HUA A;  1K0M A;  4ML1 A;  1PD2 1;  2FWF A;  3DYR A;  3GMF A;  3M0F A;  2R5G A;  1EEM A;  1A8Y A;  3DGQ A;  2FUG 2;  4ECB A;  2NVL A;  1E6B A;  4IQ1 A;  5GST A;  4FYB A;  2FWE A;  1K0A A;  1WIK A;  2L6D A;  1SYX A;  4KCE A;  2CAI A;  1G6Y A;  5EY6 A;  1GLQ A;  4GQF A;  1ERV A;  1OAZ A;  2M72 A;  3TKS E;  4ZIJ A;  3HVV A;  5FWG A;  3ED3 A;  1WJK A;  5LCZ A;  2CVK A;  2K18 A;  1TK5 B;  3CBU A;  1YKA A;  1OC9 A;  1XWG A;  1U3A A;  2YP6 A;  3CSI A;  4TXO A;  1EP7 A;  1YZX A;  4POM A;  1M7T A;  3VI7 A;  2CA8 A;  1FOV A;  3O6T A;  1FVK A;  2DC5 A;  3L0H A;  4F82 A;  3MSZ A;  4KF9 A;  2OE1 A;  5F0G A;  3VWW A;  3IAS 2;  3C8E A;  2HSM A;  5LD0 A;  2I4A A;  1ILO A;  1H75 A;  3KEB A;  4OFN A;  2HT9 A;  3ZIJ A;  5ECM B;  1TJD A;  1HQO A;  1QK8 A;  1VGL A;  3OR5 A;  1PX7 A;  5ECP B;  4TR1 A;  5HR3 A;  4Q5F A;  1DUG A;  2LJA A;  3D0Z A;  2G2Q A;  1PRX A;  4O32 A;  2GGT A;  1UC7 A;  4LMW A;  4HJ2 A;  5JCW A;  2CX3 A;  4LA1 A;  1DE2 A;  2VLU A;  4KE3 A;  4CW9 A;  5DQY A;  2C0F A;  1V9W A;  4USS A;  4QQ7 A;  4ZIL A;  1THX A;  5ID2 B;  2TIR A;  3RBT A;  3DRN A;  1GTA A;  2YWO A;  2H01 A;  4JE1 A;  2ON7 A;  4ISD A;  1GSD A;  1ZZY A;  2GSQ A;  4RQX A;  1BYE A;  5ENU A;  5JCG A;  3J7Y k;  5KEJ A;  1SK0 A;  3GHA A;  1TKD B;  1OC3 A;  2DJ1 A;  5G30 A;  5AGY A;  4GCI A;  1VF4 A;  3TOT A;  4J2F A;  2PBJ A;  2B6M A;  5GAN D;  2CT6 A;  2H72 A;  5ECN B;  1FB0 A;  3ZRE A;  1T1V A;  3M1G A;  3LJR A;  1TW9 A;  1HD2 A;  2IMD A;  3H93 A;  1GTB A;  5IO0 A;  3NIV A;  4Q5Q A;  2H0H A;  2JZS A;  4EDY A;  1TRW A;  3NZN A;  3GTU A;  4KSO A;  5G2Z A;  3AY8 A;  4JZQ A;  4PX1 A;  4ID0 A;  3KP9 A;  2H75 A;  1GNE A;  1GSU A;  4DSS A;  1NHO A;  4TR3 A;  3GSS A;  2XHF A;  5EL8 A;  4ZBA A;  4V2N A;  1XBS A;  4WBJ A;  3UMA A;  1WMJ A;  3GN3 A;  2HSH A;  5IOX A;  1B9X C;  1G7E A;  2B7J A;  3QOU A;  1OKD A;  1XZO A;  2FWH A;  3FZ4 A;  1K0C A;  4KX4 A;  1AW9 A;  3GX0 A;  3L78 A;  4OMV A;  2C4J A;  4TRX A;  3MDK A;  2YWI A;  4G9H A;  4L0U A;  1SD9 A;  2KP2 A;  2L5L A;  2OBK A;  3FHK A;  3IR4 A;  4EXJ A;  1SKS B;  2LEG A;  4MK3 A;  4IEL A;  4PUR A;  4EO3 A;  2CZ2 A;  4KND A;  5CAX A;  1SYR A;  4AF2 A;  3IV4 A;  1OE7 A;  3E9J B;  3QD9 A;  4WBR D;  2YN1 A;  3TRP A;  3G7Y A;  3BBY A;  5CRD A;  3VPQ A;  2N5B A;  4MF6 A;  3TJF A;  2O85 A;  5HFI A;  3C1R A;  1J9B A;  2OKA A;  3DML A;  3IC8 A;  2E0Q A;  1A2J A;  2J23 A;  4WR4 A;  3ME8 A;  2H1B A;  4IN0 A;  5D9X A;  2X64 A;  4XS4 A;  2JAD A;  1TU7 A;  3GKM A;  4PQI A;  5KN0 A;  5D8I A;  5AIV A;  6GSY A;  1X9W B;  1USB A;  3QFA C;  2HXK A;  2PUK C;  4DEJ A;  2H76 A;  1WP0 A;  4FH8 A;  3IXR A;  3W8J A;  1MTC A;  3KJY A;  4TXV A;  1SEN A;  2H73 A;  2MBT A;  2GS3 A;  2PPT A;  1X5E A;  4FO5 A;  4I5Q A;  2V41 A;  3U5R E;  2K6V A;  4WEY A;  1GSF A;  2R6K A;  2XPD A;  2C80 A;  2WUL A;  1FO5 A;  4OCE A;  2IMI A;  1WE0 A;  2X8G A;  1BJX A;  4DSR A;  4F9Z A;  2OA7 A;  1GTI A;  3HJP A;  4G19 A;  2R3X A;  1SU9 A;  1V58 A;  3WGE A;  4MP4 A;  3ERW A;  2QSI A;  4LL4 B;  5DJM A;  2FGX A;  5E4W A;  2DJ3 A;  4MAB A;  1AAZ A;  1I9D A;  1WRY A;  1A0R P;  3KH7 A;  3LOR A;  2DML A;  2V32 A;  2C0G A;  2JAC A;  3VLN A;  3PR8 A;  5DQS A;  4TN8 A;  3TKR A;  3BJ5 A;  2IJY A;  3LFL A;  5ECR B;  3WT2 A;  5DAK A;  3EU4 A;  5IOW A;  5ECO B;  8GSS A;  5H5S A;  2C3Q A;  5CRH A;  2MMA A;  1VF1 A;  3QAV A;  4AJ6 A;  1TDI A;  3KP8 A;  2H1G A;  4KAE A;  2BMX A;  2R4V A;  3G9B A;  5J5N A;  5ELG A;  4XS1 A;  1ABA A;  3H8Q A;  1K0O A;  5D73 A;  2OAC A;  2IPA A;  2HZE B;  1B4P A;  4GTU A;  3K8N A;  5G5F A;  5IMC A;  3F8U A;  4MZB A;  5H5Q A;  2JZR A;  2WB9 A;  3ZML A;  2HFD A;  3R2Q A;  5JCU A;  1EGR A;  5CRW A;  1R7H A;  1GSE A;  4KDY A;  2OBI A;  3UBK A;  2FCH A;  4ZXG A;  1O6J A;  3QAW A;  1A2L A;  2H0G A;  2H8L A;  2MBS A;  4HU7 A;  2RUE A;  2ZUP A;  3CTF A;  2VCQ A;  2L59 A;  1OKT A;  3HY2 A;  3UVT A;  1ZL9 A;  3WGX A;  2HE3 A;  3D4M A;  2M80 A;  2ALB A;  5E59 A;  4EF0 A;  5KN2 A;  1FHE A;  3TJG A;  5COH A;  1EP8 A;  4LL1 B;  1G0T A;  1Z6N A;  1K3Y A;  4XCS A;  2P0G A;  2C0E A;  1GNW A;  2HYX A;  3HJO A;  2GQL A;  3HXS A;  3KCM A;  3GRX A;  3Q6O A;  4BVY B;  2H0I A;  2VAF A;  4YAV A;  2GVP A;  2YOI A;  2PWJ A;  2C3N A;  4IP1 A;  5DCH A;  3GFK A;  5IIZ A;  4ILF A;  3QFB C;  3RHB A;  4OO5 A;  1GSQ A;  1T7P B;  4MA9 A;  4L5L A;  4V2M A;  1XPV A;  3PIN A;  4BVX A;  1TP9 A;  1BED A;  4N0V A;  2AB6 A;  3GST A;  3ZIT A;  1OC8 A;  4PNF A;  2R2J A;  1N8J A;  4RI6 A;  3KXO A;  4JU5 A;  1T8E B;  2B1L A;  4DVC A;  2OE0 A;  1MDK A;  1F3A A;  1XWC A;  4MJB A;  3RDW A;  3FKF A;  2XBQ A;  4NWY A;  1AQW A;  3IA1 A;  2L4C A;  4WET A;  3ZRD A;  2AYT A;  3O3T A;  5GZZ B;  1KEB A;  1W4V A;  1OYJ A;  1THO A;  3ZYW A;  2ON5 A;  4K0G A;  1ZYE A;  3GV1 A;  1YEX A;  2VCZ A;  3D4T A;  4GST A;  4POB A;  4HS1 A;  4D73 B;  1SK1 A;  1PMT A;  3LGC A;  4Q5R A;  2QKE A;  1PKZ A;  3UOM A;  2UZ8 A;  1Z7P A;  4MMM A;  2RM5 A;  2HRA A;  3EYT A;  3ZFB A;  2JL4 A;  4V2L A;  3F3Q A;  2GST A;  2CX4 A;  2WGR A;  3IK7 A;  1NHY A;  2B5X A;  1FB6 A;  2GZZ A;  3TJK A;  4K2D A;  3F0I A;  1R5A A;  5ECL B;  1O73 A;  5CO3 A;  1DSB A;  1T00 A;  2KOK A;  1A24 A;  2DJJ A;  2OE3 A;  3KZQ A;  3GL5 A;  3I43 A;  1QUW A;  3I69 A;  3IHQ A;  1GUL A;  2RLI A;  5F05 A;  3IPZ A;  3KH9 A;  3IK9 A;  1JZD A;  4P3Y B;  3VWU A;  2IN3 A;  2J9H A;  3TGZ A;  2H6Z A;  4RI7 A;  1TI3 A;  3C7M A;  3A3T A;  4HI7 A;  1SKW B;  1SK2 A;  3TUE A;  2A4V A;  2Z9S A;  5J41 A;  2B5Y A;  4YQV A;  3IBH A;  3FK8 A;  5J9B A;  2L57 A;  2GDR A;  1MD3 A;  2YCD A;  5B8B A;  3W6G A;  3P7X A;  2HRK A;  5HFG A;  4MZW A;  2VD0 A;  1ERU A;  2YWN A;  4WXT A;  2VUP A;  3EU3 A;  3EUR A;  3LXZ A;  3DD3 A;  4OFT A;  4K7O A;  1VF2 A;  1O81 A;  4POK A;  1XIY A;  1YKC A;  1TI1 A;  4YAP A;  2IFQ B;  5D93 A;  6GSX A;  1GWC A;  3HJM A;  4L8E A;  3FZ9 A;  2X8C A;  1HNB A;  5IMF A;  4ZB9 A;  2FA8 A;  2V1M A;  4WF4 A;  2IMF A;  1BAY A;  4IQA A;  1TRV A;  4CHS A;  2B5E A;  1M99 A;  2X8H A;  2YJH A;  3VUR A;  3ERG A;  1M0U A;  3RPP A;  2IME A;  4ECI A;  1GTU A;  1H4O A;  3HKR A;  4OFM A;  1OC9 B;  3G7I A;  1T4Y A;  2CV4 A;  4TXO B;  4K1F A;  3D6I A;  1V57 A;  1U6T A;  5C00 A;  5G1L A;  3O76 A;  3SBC A;  4TW5 A;  3KM6 A;  2L6C A;  1O7U A;  4TOP A;  3CRT A;  3D22 A;  4ZL8 A;  2HSM B;  3VWX A;  1QMV A;  3QR6 A;  5G5E A;  3ME7 A;  2FLS A;  3RPN A;  5F8B A;  1GSS A;  4G10 A;  2VCT A;  5CRG A;  5HR1 A;  3KMO A;  2HRF A;  4GLT A;  4NV2 A;  1DE1 A;  5J4U A;  4TR1 B;  4L0W A;  2H70 A;  5JWQ B;  3RAZ A;  5F07 A;  19GS A;  1LJR A;  4IKH A;  3VK9 A;  3APS A;  1IYH A;  3DWV A;  2LJR A;  3UEM A;  3M3M A;  3FZ5 A;  2YPM A;  2LQQ A;  3M9J A;  3HVS A;  1PGT A;  2EIQ A;  2GQK A;  2YV9 A;  2V2G A;  3DVX A;  3BOA A;  1UVZ A;  4KUN A;  4K7N A;  2VL9 A;  1JZR A;  3GUS A;  2G0F A;  3FEU A;  5DAL A;  3PPU A;  2C8U A;  1M9A A;  5IMV A;  4I2U A;  2C1Y A;  4NHW A;  1M2A A;  2E2G A;  3GH9 A;  2I81 A;  2E2M A;  2H6X A;  1YY7 A;  2WZ9 A;  1UN2 A;  4K6X A;  2PN8 A;  1PSQ A;  1TOF A;  2LRN A;  2FWG A;  5IM9 A;  1MDJ A;  2DSA A;  3TB2 A;  1SKR B;  3LSZ A;  2O89 A;  3FZA A;  1SJI A;  4NV5 A;  5BMU A;  1XCC A;  4KH7 A;  1Z5Y E;  4MZC A;  1F9M A;  5H5R A;  3APQ A;  2VM1 A;  4TR4 A;  1QXH A;  3EVI A;  3LXT A;  2TRC P;  1NM3 A;  1TK0 B;  4BWS A;  3GTU B;  2DBC A;  1GH2 A;  3ZVJ D;  3TCO A;  2DIZ A;  3Q19 A;  1OVN A;  2DJ0 A;  5HFK A;  3VI5 A;  2QC7 A;  3CXG A;  1ZOF A;  4DSS B;  5GSS A;  1RK4 A;  2YWM A;  2ES7 A;  4EE0 A;  1ERW A;  1SD8 A;  4F2I A;  5DBQ A;  3KTL A;  3L9S A;  4LMV A;  1K3L A;  4RUV A;  1EV4 A;  3APO A;  1KNG A;  4XS6 A;  3ZTL A;  3BCK A;  4PNG A;  3ERF A;  2FY6 A;  6GSW A;  4GF0 A;  9GSS A;  1YEP A;  4CDO A;  3EWL A;  4ECC A;  3F4T A;  2PGT A;  4IGJ A;  1IYI A;  1W89 A;  3GL3 A;  2YZU A;  5IPH A;  1GUH A;  2GLR A;  1CQH A;  4AJ8 A;  1G7O A;  1EZK A;  4PUF C;  7GSS A;  2MZC A;  13GS A;  3KD0 A;  5DDL A;  2K9F A;  4G0I A;  1TTZ A;  1E2Y A;  3V1W A; 
#chains in the Genus database with same CATH topology
 1X0R A;  4E8H A;  4K5R A;  1QFN A;  3ZIV A;  2VCV A;  2O7K A;  1F2E A;  4PUA A;  5HQP A;  2F3M A;  4G2E A;  3KGK A;  5A4V A;  1PN9 A;  4BL7 A;  2GZP A;  4HZ2 A;  1URM A;  2B1K A;  1A2M A;  1NW2 A;  2H1L A;  4OD7 A;  2L5O A;  3ZFL A;  1GUK A;  3UBL A;  3LWA A;  2VL2 A;  3FW2 A;  2B3S A;  2LTK A;  4XS4 B;  1XG8 A;  4N10 A;  3EE2 A;  1EEJ A;  3DVW A;  2QGV A;  2IMK A;  3FMW A;  5JWO B;  4WKW A;  1YEW C;  2O36 A;  1ZGN A;  5B6M A;  3VPT A;  2DJ2 A;  4TR0 A;  3J7Y b;  3N9J A;  4KB3 A;  2LJK A;  2JSZ A;  2PU9 C;  4MLY A;  1GLP A;  1PL2 A;  2GSS A;  1LU4 A;  2WVX B;  2NDO A;  2JZT A;  4AJ7 A;  4IS0 A;  3P90 A;  2HZF A;  2WDU A;  2WRT A;  2ZCT A;  2FA4 A;  3H79 A;  3ZLP A;  1Z9H A;  3R3E A;  2JU5 A;  3A2X A;  3UL3 A;  4ULX A;  6GSS A;  4L5O A;  5CP1 A;  1I5G A;  3IRA A;  1CQG A;  4RQR A;  1K0B A;  5AIS A;  5INY A;  1R26 A;  1F37 A;  3DXB A;  4QL9 A;  4XIH A;  5A1N B;  4DSQ A;  4YH2 A;  2LQO A;  3G7J A;  3GNJ A;  2FD3 A;  2WZS A;  5EPF A;  1PA3 A;  4OWY A;  4EL1 A;  1Z6M A;  2O8V B;  3QMX A;  4ICY A;  1PN0 A;  22GS A;  2HQT A;  2P5Q A;  5DAK B;  5ECQ B;  2I9H A;  4IJ3 A;  4WR5 A;  6GSU A;  4GSS A;  4KDX A;  1XVW A;  2GSR A;  1AC1 A;  2LV3 A;  1XWK A;  3KTB A;  4O5R A;  2KLX A;  4HQS A;  2MMN A;  2P31 A;  5ECS A;  1Y25 A;  2RM6 A;  3LG6 A;  2DJK A;  2VKZ G;  3IDV A;  1B4Q A;  3FY7 A;  5A4W A;  1MD4 A;  1XOA A;  5ECK B;  2KUC A;  1Y1U A;  3F4R A;  3A5W A;  4GXZ A;  4LLR A;  4KDU A;  2ZNM A;  1B8X A;  4EDZ A;  3QCP A;  6GST A;  3A5I A;  3HDC A;  2GTU A;  4MJE A;  2FNO A;  3F9U A;  4E8E A;  3CSH A;  1SJ6 A;  1SVL A;  5J3R A;  1U88 A;  1S3C A;  2IIY A;  2WFC A;  3GIX A;  1BQ7 A;  1AQX A;  4GRF A;  1NSW A;  2CZ3 A;  3UIW A;  2I3Y A;  1JLV A;  2NTO A;  2AAW A;  1A0F A;  5AN1 A;  3GH6 A;  5ID2 A;  4CY6 A;  1XXU A;  3D21 A;  1YF1 A;  2WS2 A;  2EIR A;  4O5Q A;  4PTS A;  3GA4 A;  2V6K A;  3TJJ A;  3HVX A;  1T3B A;  5J47 A;  3EMX A;  2VM2 A;  3NOF A;  1O8X A;  3TKS A;  1AUC A;  2DKI A;  2GT5 A;  1ACV A;  4PHZ C;  4JR4 A;  3N5O A;  3CYN A;  4K7I A;  12GS A;  1TRU A;  2CAQ A;  5A5K A;  3ZVJ A;  1HYU A;  3TU3 B;  1YF0 A;  3H4K A;  1K0N A;  5ELA A;  4BVX B;  2LUS A;  4NAX A;  4A5P A;  3EIN A;  4MJA A;  3IAM 2;  5J4V A;  4X0X A;  1B48 A;  1S3D A;  2LST A;  1RW1 A;  2E7P A;  3DIE A;  3IC4 A;  4V1A g;  4XHM A;  1HNC A;  1J0F A;  3UAP A;  4AKH A;  1QGV A;  3JCM L;  2NPB A;  4AKX B;  4PGT A;  5DJL A;  4GWR A;  4OCF A;  3D5J A;  3EC3 A;  2CVD A;  1Z7R A;  2F9S A;  5CNW A;  2VCX A;  5ABR A;  1U87 A;  4YKF A;  4XRD A;  2NBS A;  1GP1 A;  2LNT A;  2DLX A;  4N0Z A;  4F0C A;  4HZ4 A;  4HJM A;  1V2A A;  1FW1 A;  4MH2 A;  1TXX A;  1O85 A;  4Q5N A;  2MYG A;  1X5C A;  3FYG A;  4MH3 A;  1OE8 A;  1Z3E A;  3EMP A;  1O8W A;  3LQ7 A;  3TOU A;  3WT1 A;  2LRT A;  5IMZ A;  3F6F A;  4JED A;  5JWR B;  1JZW A;  5B7C A;  3GKK A;  2PER A;  3GUR A;  5IO2 A;  3KMN A;  1Q98 A;  3LEF A;  3E3E A;  4EUY A;  4KGI A;  5EVO A;  5G1K A;  4N30 A;  3RHC A;  5A34 B;  1J08 A;  3SWL A;  3ZMK A;  1JLW A;  1SL2 B;  2VLV A;  2DIY A;  1FG4 A;  2V6O A;  1QQ2 A;  1SL0 B;  4IBP A;  1TK8 B;  3HMJ G;  5ECI B;  3HZ4 A;  1EOH A;  1BX9 A;  5J9C A;  17GS A;  1ZMA A;  3L9U A;  3UVH A;  3FRC A;  1N2A A;  2LRC A;  2XBI A;  1Q4J A;  4ECJ A;  3WYW A;  3TDG A;  2HNL A;  4YQM A;  3I9V 2;  3CWG A;  5A5H B;  3HA9 A;  1TU8 A;  3HHV A;  2HRK B;  2CVB A;  3QDN A;  3C1S A;  1VF3 A;  4FXY P;  4GQC A;  1R5P A;  4F0B A;  2AHE A;  4ACS A;  1Y6E A;  4BWQ A;  4F03 A;  1AXD A;  1S4B P;  5KN1 A;  4MPG A;  2H74 A;  4FQU A;  4IP6 A;  1X9M B;  2TRX A;  2N5A A;  3A2V A;  2L4Q A;  1MEK A;  3Q18 A;  3C73 A;  3PH9 A;  3UJ1 A;  4HEA 2;  4ZB6 A;  2EFE A;  5IQY A;  2UV8 G;  3QPM A;  2H6Y A;  2MMO A;  2LKU A;  4FYC A;  4KCA A;  2H1D A;  3F63 A;  2RUF A;  3E0U A;  5KOW A;  4G0K A;  5LNK e;  3CMI A;  2LS5 A;  1YQ1 A;  2O87 A;  3IE3 A;  3IOS A;  14GS A;  4IHU A;  3ZL5 A;  2XC2 A;  4EKZ A;  2C3T A;  3WD6 A;  1BG5 A;  5F06 A;  1XW9 A;  4NMU A;  3M9K A;  5G31 A;  1DBY A;  1PKW A;  2MMZ A;  1YJ6 A;  4MCU A;  2VO4 A;  3H1N A;  4K0N A;  2LNS A;  3TKQ A;  3MAK A;  1AIU A;  5J4Y A;  2IL3 A;  1EOG A;  2HLS A;  1XWA A;  4ZBB A;  1XVQ A;  3S9F A;  1X9S B;  5C04 A;  5DVB A;  4K8M A;  1EV9 A;  3US3 A;  4JBB A;  2HZE A;  16GS A;  2VCW A;  3QAG A;  4I6X A;  5HR0 A;  1UA5 A;  3TKP A;  5D96 A;  1PX6 A;  1S3A A;  2DMM A;  4MJC A;  4I2T A;  1TXU A;  1T4Z A;  4EC0 A;  2YZH A;  2VIM A;  4GDF A;  3LYP A;  1KTE A;  5IPG A;  1ZYQ B;  3HD5 A;  5ECH B;  1WPI A;  1A23 A;  1VRS D;  4G0L A;  18GS A;  5HR2 A;  2R37 A;  1F6M C;  3KIJ A;  3C71 A;  2BJX A;  2DKH A;  4FYU A;  4KW6 A;  2FHE A;  2AJQ B;  3VFI A;  2GT6 A;  3Q74 A;  3GKX A;  3UAR A;  5L71 A;  4MF7 A;  3CRU A;  3F6D A;  2GQM A;  1AQV A;  2A2R A;  2HSY A;  3DKS A;  3FR9 A;  2EIO A;  4YQU A;  11GS A;  3W8S A;  2H30 A;  5DAL B;  5KN3 A;  3P8W A;  2C0D A;  1FVJ A;  5A4U A;  4HOJ A;  2HSN B;  4NPB A;  2VL2 C;  4TVE A;  4ZL7 A;  5IMD A;  1V40 A;  5CRE A;  1K0D A;  4NHZ A;  3BCI A;  2A2S A;  1XOB A;  1HNA A;  3P2A A;  1N25 A;  2M46 A;  4AGS A;  2VLT A;  5BMU B;  1X5D A;  1V98 A;  4BVY A;  1XFL A;  4BA7 A;  1G6W A;  3HCZ A;  4MF5 A;  1WWJ A;  1JZO A;  4N11 A;  4QL7 A;  2GZY A;  4ZL9 A;  1ZCP A;  2H71 A;  1EGO A;  4POL A;  4J57 E;  1YDK A;  2H19 A;  3CTG A;  4K5S A;  3ZZX A;  2F51 A;  2BTO T;  2VOC A;  1PL1 A;  1XWB A;  1M2B A;  3L9V A;  1M9B A;  2X99 A;  1GSY A;  4IW9 A;  3MNG A;  5D9V A;  3LW9 A;  2XPE A;  4XRA A;  2F8A A;  4KA0 A;  4Z7X A;  1ON4 A;  1MDI A;  4X1U A;  4X43 A;  4K9Z A;  4JR6 A;  4E68 A;  3I6A A;  2D2Z A;  20GS A;  4AKI A;  1ST9 A;  2H66 A;  3GKN A;  3RGB C;  1KBN A;  2YJ7 A;  4KSM A;  4IJI A;  4PXO A;  2HRN A;  2F8F A;  6GSV A;  2JSY A;  4GSN A;  2OAD A;  3LYK A;  2WCI A;  1XW6 A;  3GYK A;  3ISO A;  1XW5 A;  5CYY A;  4ML6 A;  4D73 A;  2HI7 A;  4TKY A;  3M8N A;  1F3B A;  3F3R A;  4FIW A;  5IMA A;  1JFU A;  2N5F A;  4H86 A;  2P5R A;  4O7H A;  2RII A;  4XTS A;  1S3R A;  3FR3 A;  3TJB A;  4ZB8 A;  2IWT A;  5B6N A;  1SL1 B;  4G01 A;  4ZBD A;  2KP1 A;  4JRR A;  4I8B A;  3VWV A;  3WGD A;  3A2W A;  2B7K A;  1A8L A;  3L4N A;  4PI0 C;  2AV4 A;  2PMT A;  2EC4 A;  1FAA A;  2YAN A;  4WF5 A;  4PQ1 A;  1U3I A;  1EWX A;  2I1U A;  3BD2 A;  3MWH A;  4V1A p;  3F4S A;  2YNX A;  4PQH A;  1SJZ A;  1LBK A;  3HZ8 A;  2R0P A;  1R4W A;  4BL7 B;  4OO4 A;  1I1I P;  3HYP A;  2PVQ A;  1B9Y C;  3GX8 A;  4EVM A;  5FHI A;  1GRX A;  1M2D A;  5DCG A;  1ML6 A;  1PQN A;  2YV7 A;  4HU9 A;  3PGT A;  2AUV A;  3TRQ A;  1K3O A;  1WOU A;  5D9T A;  4J56 E;  4IVF A;  5GAP D;  1GUM A;  4MDC A;  3TRX A;  2CQ9 A;  1GL8 A;  2WW2 A;  2PVO C;  1C72 A;  1RQM A;  3CSJ A;  3U6V A;  1JHB A;  2VL3 A;  4BPY A;  2K8S A;  4I97 A;  5B8A A;  2KHP A;  2WJU A;  3FR6 A;  3DEX A;  4HDE A;  5FT3 A;  1ERT A;  4O92 A;  10GS A;  2OJL A;  1TRS A;  5D9W A;  2H1A A;  3TKS C;  2IFQ A;  4HQZ A;  2REM A;  4Z2T A;  4NXI A;  4MPF A;  2K8V A;  5AIX A;  2VD1 A;  4HUA A;  1K0M A;  4ML1 A;  1PD2 1;  2FWF A;  3DYR A;  3IHG A;  3GMF A;  3M0F A;  2R5G A;  1EEM A;  1A8Y A;  3DGQ A;  2FUG 2;  4ECB A;  2NVL A;  1E6B A;  4IQ1 A;  5GST A;  4FYB A;  2FWE A;  1K0A A;  1WIK A;  2L6D A;  1SYX A;  4KCE A;  2CAI A;  1G6Y A;  4QMK A;  5EY6 A;  1GLQ A;  4GQF A;  1ERV A;  1OAZ A;  2M72 A;  3TKS E;  4ZIJ A;  3HVV A;  5FWG A;  3ED3 A;  1WJK A;  1SVO A;  5LCZ A;  2CVK A;  2K18 A;  1TK5 B;  3CBU A;  1YKA A;  1OC9 A;  1XWG A;  1U3A A;  2YP6 A;  3CSI A;  4TXO A;  1EP7 A;  1YZX A;  4HSC X;  4POM A;  1M7T A;  3VI7 A;  2CA8 A;  1FOV A;  3O6T A;  1FVK A;  2DC5 A;  3L0H A;  4F82 A;  3MSZ A;  4KF9 A;  2OE1 A;  5F0G A;  3VWW A;  3IAS 2;  3C8E A;  2HSM A;  5LD0 A;  3CHX C;  2I4A A;  1ILO A;  1H75 A;  3KEB A;  4OFN A;  2HT9 A;  3ZIJ A;  5ECM B;  1TJD A;  1PFO A;  1HQO A;  1QK8 A;  1VGL A;  3OR5 A;  1PX7 A;  5ECP B;  4TR1 A;  5HR3 A;  1YVL A;  4Q5F A;  1DUG A;  2LJA A;  3D0Z A;  2G2Q A;  1PRX A;  4O32 A;  2GGT A;  1UC7 A;  4LMW A;  4HJ2 A;  5JCW A;  2CX3 A;  4LA1 A;  1DE2 A;  2VLU A;  3RFR C;  4KE3 A;  4CW9 A;  5DQY A;  2C0F A;  1V9W A;  4USS A;  4QQ7 A;  4BIK A;  4ZIL A;  1THX A;  5ID2 B;  2TIR A;  3RBT A;  2EFC A;  3DRN A;  1GTA A;  2YWO A;  2H01 A;  4JE1 A;  2ON7 A;  4ISD A;  1GSD A;  1ZZY A;  4O5U A;  2GSQ A;  4RQX A;  1BYE A;  4AKG A;  3HVN A;  5ENU A;  5JCG A;  3J7Y k;  5KEJ A;  2WVY A;  1SK0 A;  3GHA A;  1TKD B;  1OC3 A;  4Z2R A;  2DJ1 A;  5G30 A;  5AGY A;  4GCI A;  1VF4 A;  3TOT A;  4J2F A;  2PBJ A;  2B6M A;  5GAN D;  2CT6 A;  2H72 A;  5ECN B;  1FB0 A;  3ZRE A;  1T1V A;  3M1G A;  3LJR A;  1TW9 A;  1HD2 A;  2IMD A;  3H93 A;  1GTB A;  5IO0 A;  3NIV A;  4Q5Q A;  2H0H A;  2JZS A;  4EDY A;  1TRW A;  3NZN A;  3GTU A;  4KSO A;  5G2Z A;  3AY8 A;  4JZQ A;  4PX1 A;  5J40 A;  4Z2U A;  4ID0 A;  2O5V A;  3KP9 A;  2H75 A;  1GNE A;  1GSU A;  4DSS A;  2R0C A;  1NHO A;  4TR3 A;  3GSS A;  2XHF A;  5EL8 A;  2WVZ A;  4ZBA A;  4V2N A;  2O3E A;  1XBS A;  4WBJ A;  3UMA A;  1WMJ A;  3GN3 A;  2HSH A;  5IOX A;  1B9X C;  1G7E A;  2B7J A;  3QOU A;  1OKD A;  1XZO A;  2FWH A;  3FZ4 A;  1K0C A;  4KX4 A;  1AW9 A;  3GX0 A;  3L78 A;  4OMV A;  2C4J A;  4TRX A;  3MDK A;  2YWI A;  4G9H A;  4L0U A;  3MIX A;  1SD9 A;  2KP2 A;  2L5L A;  2OBK A;  3FHK A;  3IR4 A;  4EXJ A;  1SKS B;  2LEG A;  4MK3 A;  4IEL A;  4PUR A;  4EO3 A;  2CZ2 A;  4KND A;  5CAX A;  1SYR A;  4AF2 A;  2X4A A;  3IV4 A;  1OE7 A;  3E9J B;  3QD9 A;  4WBR D;  2YN1 A;  3TRP A;  3G7Y A;  3BBY A;  5CRD A;  3VPQ A;  2N5B A;  4MF6 A;  3TJF A;  2O85 A;  5HFI A;  3C1R A;  1J9B A;  2OKA A;  3DML A;  3IC8 A;  2E0Q A;  1A2J A;  2J23 A;  4WR4 A;  3ME8 A;  1M3J A;  2H1B A;  4IN0 A;  5D9X A;  2X64 A;  4XS4 A;  2JAD A;  1TU7 A;  3GKM A;  4PQI A;  5KN0 A;  5D8I A;  5AIV A;  6GSY A;  2WW1 A;  1X9W B;  1USB A;  3QFA C;  2HXK A;  2PUK C;  4DEJ A;  2H76 A;  1WP0 A;  4FH8 A;  3IXR A;  3W8J A;  1MTC A;  3KJY A;  4TXV A;  4K2X A;  1SEN A;  2H73 A;  2MBT A;  2GS3 A;  2PPT A;  1X5E A;  4FO5 A;  4I5Q A;  2WVX A;  2V41 A;  3U5R E;  2K6V A;  4WEY A;  1GSF A;  2R6K A;  2XPD A;  2C80 A;  2WUL A;  1FO5 A;  4OCE A;  2IMI A;  1WE0 A;  2X8G A;  1BJX A;  4DSR A;  4F9Z A;  2OA7 A;  2WW3 A;  4CY8 A;  1GTI A;  3HJP A;  4G19 A;  2R3X A;  1SU9 A;  1V58 A;  3WGE A;  4MP4 A;  3ERW A;  2A4H A;  5A1N A;  2QSI A;  4LL4 B;  5DJM A;  2FGX A;  5E4W A;  2DJ3 A;  4MAB A;  1AAZ A;  1I9D A;  1WRY A;  1A0R P;  3KH7 A;  3LOR A;  2DML A;  2V32 A;  2C0G A;  2JAC A;  3VLN A;  3PR8 A;  5DQS A;  4TN8 A;  3TKR A;  3BJ5 A;  2IJY A;  1ZYN A;  3LFL A;  5ECR B;  3WT2 A;  5DAK A;  3EU4 A;  5IOW A;  5ECO B;  8GSS A;  4YKG A;  5H5S A;  1BF5 A;  2C3Q A;  5CRH A;  2MMA A;  1VF1 A;  3QAV A;  4AJ6 A;  1TDI A;  3KP8 A;  2H1G A;  4KAE A;  2BMX A;  2R4V A;  3G9B A;  5J5N A;  5ELG A;  4XS1 A;  1ABA A;  3H8Q A;  1K0O A;  5D73 A;  2OAC A;  2IPA A;  2HZE B;  1B4P A;  4GTU A;  3K8N A;  5G5F A;  5IMC A;  3F8U A;  4MZB A;  5H5Q A;  2JZR A;  2WB9 A;  3ZML A;  2HFD A;  3R2Q A;  5JCU A;  1EGR A;  5CRW A;  1R7H A;  1GSE A;  4KDY A;  2OBI A;  3UBK A;  2FCH A;  4ZXG A;  4W66 A;  1O6J A;  3QAW A;  4AI6 A;  1A2L A;  2H0G A;  2H8L A;  2MBS A;  4HU7 A;  2RUE A;  2ZUP A;  3CTF A;  2VCQ A;  2L59 A;  1OKT A;  3HY2 A;  4EIP A;  4X4J A;  3UVT A;  1ZL9 A;  3WGX A;  2HE3 A;  3D4M A;  2M80 A;  2ALB A;  5E59 A;  4EF0 A;  5KN2 A;  1FHE A;  3TJG A;  5COH A;  1EP8 A;  4LL1 B;  1G0T A;  1Z6N A;  1K3Y A;  4XCS A;  2P0G A;  2C0E A;  1GNW A;  2HYX A;  3HJO A;  2GQL A;  3HXS A;  3KCM A;  3GRX A;  3Q6O A;  4BVY B;  2H0I A;  2VAF A;  4YAV A;  2GVP A;  2YOI A;  2EFD A;  2PWJ A;  2C3N A;  4IP1 A;  5DCH A;  3CQF A;  3GFK A;  5IIZ A;  4ILF A;  3QFB C;  3RHB A;  4OO5 A;  1GSQ A;  1T7P B;  4MA9 A;  4L5L A;  4V2M A;  1XPV A;  3PIN A;  4BVX A;  1TP9 A;  1BED A;  4N0V A;  2AB6 A;  3GST A;  3ZIT A;  1OC8 A;  4PNF A;  4MNN A;  2R2J A;  1N8J A;  4RI6 A;  3KXO A;  4JU5 A;  1T8E B;  2B1L A;  4DVC A;  2OE0 A;  1MDK A;  1F3A A;  1XWC A;  4MJB A;  3RDW A;  3FKF A;  2XBQ A;  4NWY A;  1AQW A;  3IA1 A;  2L4C A;  4WET A;  3ZRD A;  1FOH A;  2AYT A;  3O3T A;  5GZZ B;  1KEB A;  1W4V A;  1OYJ A;  1THO A;  3ZYW A;  2ON5 A;  4K0G A;  1ZYE A;  3GV1 A;  1YEX A;  2VCZ A;  3D4T A;  3EPT A;  4GST A;  4POB A;  4HS1 A;  4D73 B;  1SK1 A;  1PMT A;  3LGC A;  4Q5R A;  2QKE A;  1PKZ A;  3UOM A;  2UZ8 A;  1Z7P A;  4MMM A;  2RM5 A;  2HRA A;  3EYT A;  3ZFB A;  2JL4 A;  4V2L A;  3F3Q A;  2GST A;  2CX4 A;  2WGR A;  3IK7 A;  1NHY A;  2B5X A;  1FB6 A;  2GZZ A;  3TJK A;  4K2D A;  3F0I A;  1R5A A;  5ECL B;  1O73 A;  5CO3 A;  1DSB A;  1T00 A;  2KOK A;  1A24 A;  2DJJ A;  2OE3 A;  4ZB7 A;  3KZQ A;  3GL5 A;  3I43 A;  1QUW A;  3I69 A;  3IHQ A;  1GUL A;  2RLI A;  5F05 A;  3IPZ A;  3KH9 A;  3IK9 A;  1JZD A;  4P3Y B;  3VWU A;  5A34 A;  2IN3 A;  2J9H A;  3TGZ A;  2H6Z A;  4RI7 A;  1TI3 A;  3C7M A;  3A3T A;  2QA1 A;  4HI7 A;  1SKW B;  1SK2 A;  3TUE A;  2A4V A;  2Z9S A;  5J41 A;  2B5Y A;  4YQV A;  3IBH A;  3FK8 A;  5J9B A;  4EIQ A;  2L57 A;  3MYD A;  2GDR A;  1MD3 A;  2YCD A;  2QA2 A;  5A5H A;  5B8B A;  3W6G A;  3P7X A;  2HRK A;  5HFG A;  4MZW A;  2VD0 A;  1ERU A;  2YWN A;  4WXT A;  2VUP A;  3EU3 A;  3EUR A;  3LXZ A;  3DD3 A;  4OFT A;  4K7O A;  1VF2 A;  1O81 A;  4POK A;  1XIY A;  2OT3 A;  1SVM A;  1YKC A;  1TI1 A;  4YAP A;  2IFQ B;  5D93 A;  6GSX A;  1GWC A;  3HJM A;  4L8E A;  3FZ9 A;  2X8C A;  1HNB A;  5IMF A;  4ZB9 A;  2FA8 A;  2V1M A;  4WF4 A;  2IMF A;  1BAY A;  4IQA A;  4N3Z A;  1TRV A;  4CHS A;  2B5E A;  1M99 A;  2X8H A;  2YJH A;  3VUR A;  3ERG A;  1M0U A;  3RPP A;  2IME A;  4ECI A;  1GTU A;  1H4O A;  3HKR A;  4OFM A;  1OC9 B;  3G7I A;  1T4Y A;  2CV4 A;  4TXO B;  4K1F A;  3D6I A;  1V57 A;  1U6T A;  5C00 A;  5G1L A;  3O76 A;  3SBC A;  4TW5 A;  3KM6 A;  2L6C A;  1O7U A;  4TOP A;  3CRT A;  3D22 A;  4ZL8 A;  2HSM B;  3VWX A;  1QMV A;  3QR6 A;  5G5E A;  3ME7 A;  2FLS A;  3RPN A;  5F8B A;  1GSS A;  4G10 A;  2VCT A;  5CRG A;  5HR1 A;  3KMO A;  2HRF A;  4GLT A;  4NV2 A;  1DE1 A;  5J4U A;  1BG1 A;  4TR1 B;  4L0W A;  2EFH A;  2H70 A;  5JWQ B;  3RAZ A;  5F07 A;  19GS A;  1LJR A;  4IKH A;  3VK9 A;  3APS A;  1IYH A;  3DWV A;  2LJR A;  3UEM A;  3M3M A;  3FZ5 A;  2YPM A;  2LQQ A;  3M9J A;  3HVS A;  1PGT A;  2EIQ A;  2GQK A;  2YV9 A;  2V2G A;  3DVX A;  3BOA A;  1UVZ A;  4KUN A;  4K7N A;  2VL9 A;  2X49 A;  1JZR A;  3GUS A;  2G0F A;  3FEU A;  5DAL A;  3PPU A;  2C8U A;  1M9A A;  5IMV A;  4I2U A;  2C1Y A;  4NHW A;  1M2A A;  2HSN A;  2E2G A;  3GH9 A;  2I81 A;  2E2M A;  2H6X A;  1YY7 A;  2WZ9 A;  1UN2 A;  4K6X A;  2PN8 A;  1PSQ A;  1TOF A;  2LRN A;  2FWG A;  5IM9 A;  1MDJ A;  2DSA A;  3TB2 A;  1SKR B;  3LSZ A;  2O89 A;  3FZA A;  1SJI A;  5KOX A;  4NV5 A;  5BMU A;  1XCC A;  4KH7 A;  2A2P A;  1Z5Y E;  4MZC A;  1F9M A;  5H5R A;  3APQ A;  2VM1 A;  4TR4 A;  1QXH A;  3EVI A;  3LXT A;  2TRC P;  1NM3 A;  1TK0 B;  4BWS A;  3GTU B;  2DBC A;  1GH2 A;  3ZVJ D;  3TCO A;  2DIZ A;  3Q19 A;  1OVN A;  2DJ0 A;  5HFK A;  3VI5 A;  2QC7 A;  3CXG A;  1ZOF A;  4DSS B;  5GSS A;  1RK4 A;  2YWM A;  2ES7 A;  4EE0 A;  1ERW A;  1SD8 A;  5BRT A;  4F2I A;  5DBQ A;  3KTL A;  3L9S A;  4LMV A;  1K3L A;  4RUV A;  1EV4 A;  3APO A;  1KNG A;  2R0G A;  4XS6 A;  3ZTL A;  3BCK A;  4PI2 C;  4PNG A;  3ERF A;  1ZYP A;  2FY6 A;  6GSW A;  4GF0 A;  9GSS A;  1YEP A;  4CDO A;  3EWL A;  4ECC A;  3F4T A;  2PGT A;  4IGJ A;  1M3I A;  1IYI A;  1W89 A;  3GL3 A;  2YZU A;  5IPH A;  1GUH A;  2GLR A;  1CQH A;  4AJ8 A;  1G7O A;  1EZK A;  2WW0 A;  4PUF C;  7GSS A;  2MZC A;  13GS A;  3KD0 A;  5DDL A;  2K9F A;  4G0I A;  1TTZ A;  1E2Y A;  3V1W A; 
#chains in the Genus database with same CATH homology
 1X0R A;  4E8H A;  4K5R A;  1QFN A;  3ZIV A;  2VCV A;  2O7K A;  1F2E A;  4PUA A;  5HQP A;  2F3M A;  4G2E A;  3KGK A;  5A4V A;  1PN9 A;  4BL7 A;  2GZP A;  4HZ2 A;  1URM A;  2B1K A;  1A2M A;  1NW2 A;  2H1L A;  4OD7 A;  2L5O A;  3ZFL A;  1GUK A;  3UBL A;  3LWA A;  2VL2 A;  3FW2 A;  2B3S A;  2LTK A;  4XS4 B;  4N10 A;  3EE2 A;  1EEJ A;  3DVW A;  2QGV A;  2IMK A;  3FMW A;  5JWO B;  4WKW A;  1ZGN A;  5B6M A;  3VPT A;  2DJ2 A;  4TR0 A;  3J7Y b;  3N9J A;  4KB3 A;  2LJK A;  2JSZ A;  2PU9 C;  4MLY A;  1GLP A;  1PL2 A;  2GSS A;  1LU4 A;  2NDO A;  2JZT A;  4AJ7 A;  4IS0 A;  3P90 A;  2HZF A;  2WDU A;  2WRT A;  2ZCT A;  2FA4 A;  3H79 A;  3ZLP A;  1Z9H A;  3R3E A;  2JU5 A;  3A2X A;  3UL3 A;  4ULX A;  6GSS A;  4L5O A;  5CP1 A;  1I5G A;  3IRA A;  1CQG A;  4RQR A;  1K0B A;  5AIS A;  5INY A;  1R26 A;  1F37 A;  3DXB A;  4QL9 A;  4XIH A;  5A1N B;  4DSQ A;  4YH2 A;  2LQO A;  3G7J A;  3GNJ A;  2FD3 A;  5EPF A;  1PA3 A;  4OWY A;  4EL1 A;  1Z6M A;  2O8V B;  3QMX A;  4ICY A;  1PN0 A;  22GS A;  2HQT A;  2P5Q A;  5DAK B;  5ECQ B;  2I9H A;  4IJ3 A;  4WR5 A;  6GSU A;  4GSS A;  4KDX A;  1XVW A;  2GSR A;  1AC1 A;  2LV3 A;  1XWK A;  3KTB A;  4O5R A;  2KLX A;  4HQS A;  2MMN A;  2P31 A;  5ECS A;  1Y25 A;  2RM6 A;  3LG6 A;  2DJK A;  2VKZ G;  3IDV A;  1B4Q A;  3FY7 A;  5A4W A;  1MD4 A;  1XOA A;  5ECK B;  2KUC A;  1Y1U A;  3F4R A;  3A5W A;  4GXZ A;  4LLR A;  4KDU A;  2ZNM A;  1B8X A;  4EDZ A;  3QCP A;  6GST A;  3A5I A;  3HDC A;  2GTU A;  4MJE A;  2FNO A;  3F9U A;  4E8E A;  3CSH A;  1SJ6 A;  1SVL A;  5J3R A;  1U88 A;  1S3C A;  2IIY A;  2WFC A;  3GIX A;  1BQ7 A;  1AQX A;  4GRF A;  1NSW A;  2CZ3 A;  3UIW A;  2I3Y A;  1JLV A;  2NTO A;  2AAW A;  1A0F A;  5AN1 A;  3GH6 A;  5ID2 A;  4CY6 A;  1XXU A;  3D21 A;  1YF1 A;  2WS2 A;  2EIR A;  4O5Q A;  4PTS A;  3GA4 A;  2V6K A;  3TJJ A;  3HVX A;  1T3B A;  5J47 A;  3EMX A;  2VM2 A;  3NOF A;  1O8X A;  3TKS A;  1AUC A;  2DKI A;  2GT5 A;  1ACV A;  4JR4 A;  3N5O A;  3CYN A;  4K7I A;  12GS A;  1TRU A;  2CAQ A;  5A5K A;  3ZVJ A;  1HYU A;  3TU3 B;  1YF0 A;  3H4K A;  1K0N A;  5ELA A;  4BVX B;  2LUS A;  4NAX A;  4A5P A;  3EIN A;  4MJA A;  3IAM 2;  5J4V A;  4X0X A;  1B48 A;  1S3D A;  2LST A;  1RW1 A;  2E7P A;  3DIE A;  3IC4 A;  4V1A g;  4XHM A;  1HNC A;  1J0F A;  3UAP A;  4AKH A;  1QGV A;  3JCM L;  2NPB A;  4AKX B;  4PGT A;  5DJL A;  4GWR A;  4OCF A;  3D5J A;  3EC3 A;  2CVD A;  1Z7R A;  2F9S A;  5CNW A;  2VCX A;  5ABR A;  1U87 A;  4YKF A;  4XRD A;  2NBS A;  1GP1 A;  2LNT A;  2DLX A;  4N0Z A;  4F0C A;  4HZ4 A;  4HJM A;  1V2A A;  1FW1 A;  4MH2 A;  1TXX A;  1O85 A;  4Q5N A;  2MYG A;  1X5C A;  3FYG A;  4MH3 A;  1OE8 A;  1Z3E A;  3EMP A;  1O8W A;  3LQ7 A;  3TOU A;  3WT1 A;  2LRT A;  5IMZ A;  3F6F A;  4JED A;  5JWR B;  1JZW A;  5B7C A;  3GKK A;  2PER A;  3GUR A;  5IO2 A;  3KMN A;  1Q98 A;  3LEF A;  3E3E A;  4EUY A;  4KGI A;  5EVO A;  5G1K A;  4N30 A;  3RHC A;  5A34 B;  1J08 A;  3SWL A;  3ZMK A;  1JLW A;  1SL2 B;  2VLV A;  2DIY A;  1FG4 A;  2V6O A;  1QQ2 A;  1SL0 B;  4IBP A;  1TK8 B;  3HMJ G;  5ECI B;  3HZ4 A;  1EOH A;  1BX9 A;  5J9C A;  17GS A;  1ZMA A;  3L9U A;  3UVH A;  3FRC A;  1N2A A;  2LRC A;  2XBI A;  1Q4J A;  4ECJ A;  3WYW A;  3TDG A;  2HNL A;  4YQM A;  3I9V 2;  3CWG A;  5A5H B;  3HA9 A;  1TU8 A;  3HHV A;  2HRK B;  2CVB A;  3QDN A;  3C1S A;  1VF3 A;  4GQC A;  1R5P A;  4F0B A;  2AHE A;  4ACS A;  1Y6E A;  4BWQ A;  4F03 A;  1AXD A;  5KN1 A;  4MPG A;  2H74 A;  4FQU A;  4IP6 A;  1X9M B;  2TRX A;  2N5A A;  3A2V A;  2L4Q A;  1MEK A;  3Q18 A;  3C73 A;  3PH9 A;  3UJ1 A;  4HEA 2;  4ZB6 A;  2EFE A;  5IQY A;  2UV8 G;  3QPM A;  2H6Y A;  2MMO A;  2LKU A;  4FYC A;  4KCA A;  2H1D A;  3F63 A;  2RUF A;  3E0U A;  5KOW A;  4G0K A;  5LNK e;  3CMI A;  2LS5 A;  1YQ1 A;  2O87 A;  3IE3 A;  3IOS A;  14GS A;  4IHU A;  3ZL5 A;  2XC2 A;  4EKZ A;  2C3T A;  3WD6 A;  1BG5 A;  5F06 A;  1XW9 A;  4NMU A;  3M9K A;  5G31 A;  1DBY A;  1PKW A;  2MMZ A;  1YJ6 A;  4MCU A;  2VO4 A;  3H1N A;  4K0N A;  2LNS A;  3TKQ A;  3MAK A;  1AIU A;  5J4Y A;  2IL3 A;  1EOG A;  2HLS A;  1XWA A;  4ZBB A;  1XVQ A;  3S9F A;  1X9S B;  5C04 A;  5DVB A;  4K8M A;  1EV9 A;  3US3 A;  4JBB A;  2HZE A;  16GS A;  2VCW A;  3QAG A;  4I6X A;  5HR0 A;  1UA5 A;  3TKP A;  5D96 A;  1PX6 A;  1S3A A;  2DMM A;  4MJC A;  4I2T A;  1TXU A;  1T4Z A;  4EC0 A;  2YZH A;  2VIM A;  4GDF A;  3LYP A;  1KTE A;  5IPG A;  1ZYQ B;  3HD5 A;  5ECH B;  1WPI A;  1A23 A;  1VRS D;  4G0L A;  18GS A;  5HR2 A;  2R37 A;  1F6M C;  3KIJ A;  3C71 A;  2BJX A;  2DKH A;  4FYU A;  4KW6 A;  2FHE A;  2AJQ B;  3VFI A;  2GT6 A;  3Q74 A;  3GKX A;  3UAR A;  5L71 A;  4MF7 A;  3CRU A;  3F6D A;  2GQM A;  1AQV A;  2A2R A;  2HSY A;  3DKS A;  3FR9 A;  2EIO A;  4YQU A;  11GS A;  3W8S A;  2H30 A;  5DAL B;  5KN3 A;  3P8W A;  2C0D A;  1FVJ A;  5A4U A;  4HOJ A;  2HSN B;  4NPB A;  2VL2 C;  4TVE A;  4ZL7 A;  5IMD A;  1V40 A;  5CRE A;  1K0D A;  4NHZ A;  3BCI A;  2A2S A;  1XOB A;  1HNA A;  3P2A A;  1N25 A;  2M46 A;  4AGS A;  2VLT A;  5BMU B;  1X5D A;  1V98 A;  4BVY A;  1XFL A;  4BA7 A;  1G6W A;  3HCZ A;  4MF5 A;  1WWJ A;  1JZO A;  4N11 A;  4QL7 A;  2GZY A;  4ZL9 A;  1ZCP A;  2H71 A;  1EGO A;  4POL A;  4J57 E;  1YDK A;  2H19 A;  3CTG A;  4K5S A;  3ZZX A;  2F51 A;  2BTO T;  2VOC A;  1PL1 A;  1XWB A;  1M2B A;  3L9V A;  1M9B A;  2X99 A;  1GSY A;  4IW9 A;  3MNG A;  5D9V A;  3LW9 A;  2XPE A;  4XRA A;  2F8A A;  4KA0 A;  4Z7X A;  1ON4 A;  1MDI A;  4X1U A;  4X43 A;  4K9Z A;  4JR6 A;  4E68 A;  3I6A A;  2D2Z A;  20GS A;  4AKI A;  1ST9 A;  2H66 A;  3GKN A;  1KBN A;  2YJ7 A;  4KSM A;  4IJI A;  4PXO A;  2HRN A;  2F8F A;  6GSV A;  2JSY A;  4GSN A;  2OAD A;  3LYK A;  2WCI A;  1XW6 A;  3GYK A;  3ISO A;  1XW5 A;  5CYY A;  4ML6 A;  4D73 A;  2HI7 A;  4TKY A;  3M8N A;  1F3B A;  3F3R A;  4FIW A;  5IMA A;  1JFU A;  2N5F A;  4H86 A;  2P5R A;  4O7H A;  2RII A;  4XTS A;  3FR3 A;  3TJB A;  4ZB8 A;  2IWT A;  5B6N A;  1SL1 B;  4G01 A;  4ZBD A;  2KP1 A;  4JRR A;  4I8B A;  3VWV A;  3WGD A;  3A2W A;  2B7K A;  1A8L A;  3L4N A;  2AV4 A;  2PMT A;  2EC4 A;  1FAA A;  2YAN A;  4WF5 A;  4PQ1 A;  1U3I A;  1EWX A;  2I1U A;  3BD2 A;  3MWH A;  4V1A p;  3F4S A;  2YNX A;  4PQH A;  1SJZ A;  1LBK A;  3HZ8 A;  2R0P A;  1R4W A;  4BL7 B;  4OO4 A;  3HYP A;  2PVQ A;  1B9Y C;  3GX8 A;  4EVM A;  5FHI A;  1GRX A;  1M2D A;  5DCG A;  1ML6 A;  1PQN A;  2YV7 A;  4HU9 A;  3PGT A;  2AUV A;  3TRQ A;  1K3O A;  1WOU A;  5D9T A;  4J56 E;  4IVF A;  5GAP D;  1GUM A;  4MDC A;  3TRX A;  2CQ9 A;  1GL8 A;  2PVO C;  1C72 A;  1RQM A;  3CSJ A;  3U6V A;  1JHB A;  2VL3 A;  4BPY A;  2K8S A;  4I97 A;  5B8A A;  2KHP A;  2WJU A;  3FR6 A;  3DEX A;  4HDE A;  5FT3 A;  1ERT A;  4O92 A;  10GS A;  2OJL A;  1TRS A;  5D9W A;  2H1A A;  3TKS C;  2IFQ A;  4HQZ A;  2REM A;  4Z2T A;  4NXI A;  4MPF A;  2K8V A;  5AIX A;  2VD1 A;  4HUA A;  1K0M A;  4ML1 A;  1PD2 1;  2FWF A;  3DYR A;  3IHG A;  3GMF A;  3M0F A;  2R5G A;  1EEM A;  1A8Y A;  3DGQ A;  2FUG 2;  4ECB A;  2NVL A;  1E6B A;  4IQ1 A;  5GST A;  4FYB A;  2FWE A;  1K0A A;  1WIK A;  2L6D A;  1SYX A;  4KCE A;  2CAI A;  1G6Y A;  4QMK A;  5EY6 A;  1GLQ A;  4GQF A;  1ERV A;  1OAZ A;  2M72 A;  3TKS E;  4ZIJ A;  3HVV A;  5FWG A;  3ED3 A;  1WJK A;  1SVO A;  5LCZ A;  2CVK A;  2K18 A;  1TK5 B;  3CBU A;  1YKA A;  1OC9 A;  1XWG A;  1U3A A;  2YP6 A;  3CSI A;  4TXO A;  1EP7 A;  1YZX A;  4POM A;  1M7T A;  3VI7 A;  2CA8 A;  1FOV A;  3O6T A;  1FVK A;  2DC5 A;  3L0H A;  4F82 A;  3MSZ A;  4KF9 A;  2OE1 A;  5F0G A;  3VWW A;  3IAS 2;  3C8E A;  2HSM A;  5LD0 A;  2I4A A;  1ILO A;  1H75 A;  3KEB A;  4OFN A;  2HT9 A;  3ZIJ A;  5ECM B;  1TJD A;  1HQO A;  1QK8 A;  1VGL A;  3OR5 A;  1PX7 A;  5ECP B;  4TR1 A;  5HR3 A;  1YVL A;  4Q5F A;  1DUG A;  2LJA A;  3D0Z A;  2G2Q A;  1PRX A;  4O32 A;  2GGT A;  1UC7 A;  4LMW A;  4HJ2 A;  5JCW A;  2CX3 A;  4LA1 A;  1DE2 A;  2VLU A;  4KE3 A;  4CW9 A;  5DQY A;  2C0F A;  1V9W A;  4USS A;  4QQ7 A;  4ZIL A;  1THX A;  5ID2 B;  2TIR A;  3RBT A;  2EFC A;  3DRN A;  1GTA A;  2YWO A;  2H01 A;  4JE1 A;  2ON7 A;  4ISD A;  1GSD A;  1ZZY A;  4O5U A;  2GSQ A;  4RQX A;  1BYE A;  4AKG A;  5ENU A;  5JCG A;  3J7Y k;  5KEJ A;  1SK0 A;  3GHA A;  1TKD B;  1OC3 A;  4Z2R A;  2DJ1 A;  5G30 A;  5AGY A;  4GCI A;  1VF4 A;  3TOT A;  4J2F A;  2PBJ A;  2B6M A;  5GAN D;  2CT6 A;  2H72 A;  5ECN B;  1FB0 A;  3ZRE A;  1T1V A;  3M1G A;  3LJR A;  1TW9 A;  1HD2 A;  2IMD A;  3H93 A;  1GTB A;  5IO0 A;  3NIV A;  4Q5Q A;  2H0H A;  2JZS A;  4EDY A;  1TRW A;  3NZN A;  3GTU A;  4KSO A;  5G2Z A;  3AY8 A;  4JZQ A;  4PX1 A;  5J40 A;  4Z2U A;  4ID0 A;  2O5V A;  3KP9 A;  2H75 A;  1GNE A;  1GSU A;  4DSS A;  2R0C A;  1NHO A;  4TR3 A;  3GSS A;  2XHF A;  5EL8 A;  4ZBA A;  4V2N A;  1XBS A;  4WBJ A;  3UMA A;  1WMJ A;  3GN3 A;  2HSH A;  5IOX A;  1B9X C;  1G7E A;  2B7J A;  3QOU A;  1OKD A;  1XZO A;  2FWH A;  3FZ4 A;  1K0C A;  4KX4 A;  1AW9 A;  3GX0 A;  3L78 A;  4OMV A;  2C4J A;  4TRX A;  3MDK A;  2YWI A;  4G9H A;  4L0U A;  3MIX A;  1SD9 A;  2KP2 A;  2L5L A;  2OBK A;  3FHK A;  3IR4 A;  4EXJ A;  1SKS B;  2LEG A;  4MK3 A;  4IEL A;  4PUR A;  4EO3 A;  2CZ2 A;  4KND A;  5CAX A;  1SYR A;  4AF2 A;  2X4A A;  3IV4 A;  1OE7 A;  3E9J B;  3QD9 A;  4WBR D;  2YN1 A;  3TRP A;  3G7Y A;  3BBY A;  5CRD A;  3VPQ A;  2N5B A;  4MF6 A;  3TJF A;  2O85 A;  5HFI A;  3C1R A;  1J9B A;  2OKA A;  3DML A;  3IC8 A;  2E0Q A;  1A2J A;  2J23 A;  4WR4 A;  3ME8 A;  2H1B A;  4IN0 A;  5D9X A;  2X64 A;  4XS4 A;  2JAD A;  1TU7 A;  3GKM A;  4PQI A;  5KN0 A;  5D8I A;  5AIV A;  6GSY A;  1X9W B;  1USB A;  3QFA C;  2HXK A;  2PUK C;  4DEJ A;  2H76 A;  1WP0 A;  4FH8 A;  3IXR A;  3W8J A;  1MTC A;  3KJY A;  4TXV A;  4K2X A;  1SEN A;  2H73 A;  2MBT A;  2GS3 A;  2PPT A;  1X5E A;  4FO5 A;  4I5Q A;  2V41 A;  3U5R E;  2K6V A;  4WEY A;  1GSF A;  2R6K A;  2XPD A;  2C80 A;  2WUL A;  1FO5 A;  4OCE A;  2IMI A;  1WE0 A;  2X8G A;  1BJX A;  4DSR A;  4F9Z A;  2OA7 A;  4CY8 A;  1GTI A;  3HJP A;  4G19 A;  2R3X A;  1SU9 A;  1V58 A;  3WGE A;  4MP4 A;  3ERW A;  2A4H A;  5A1N A;  2QSI A;  4LL4 B;  5DJM A;  2FGX A;  5E4W A;  2DJ3 A;  4MAB A;  1AAZ A;  1I9D A;  1WRY A;  1A0R P;  3KH7 A;  3LOR A;  2DML A;  2V32 A;  2C0G A;  2JAC A;  3VLN A;  3PR8 A;  5DQS A;  4TN8 A;  3TKR A;  3BJ5 A;  2IJY A;  1ZYN A;  3LFL A;  5ECR B;  3WT2 A;  5DAK A;  3EU4 A;  5IOW A;  5ECO B;  8GSS A;  4YKG A;  5H5S A;  1BF5 A;  2C3Q A;  5CRH A;  2MMA A;  1VF1 A;  3QAV A;  4AJ6 A;  1TDI A;  3KP8 A;  2H1G A;  4KAE A;  2BMX A;  2R4V A;  3G9B A;  5J5N A;  5ELG A;  4XS1 A;  1ABA A;  3H8Q A;  1K0O A;  5D73 A;  2OAC A;  2IPA A;  2HZE B;  1B4P A;  4GTU A;  3K8N A;  5G5F A;  5IMC A;  3F8U A;  4MZB A;  5H5Q A;  2JZR A;  2WB9 A;  3ZML A;  2HFD A;  3R2Q A;  5JCU A;  1EGR A;  5CRW A;  1R7H A;  1GSE A;  4KDY A;  2OBI A;  3UBK A;  2FCH A;  4ZXG A;  4W66 A;  1O6J A;  3QAW A;  4AI6 A;  1A2L A;  2H0G A;  2H8L A;  2MBS A;  4HU7 A;  2RUE A;  2ZUP A;  3CTF A;  2VCQ A;  2L59 A;  1OKT A;  3HY2 A;  4EIP A;  4X4J A;  3UVT A;  1ZL9 A;  3WGX A;  2HE3 A;  3D4M A;  2M80 A;  2ALB A;  5E59 A;  4EF0 A;  5KN2 A;  1FHE A;  3TJG A;  5COH A;  1EP8 A;  4LL1 B;  1G0T A;  1Z6N A;  1K3Y A;  4XCS A;  2P0G A;  2C0E A;  1GNW A;  2HYX A;  3HJO A;  2GQL A;  3HXS A;  3KCM A;  3GRX A;  3Q6O A;  4BVY B;  2H0I A;  2VAF A;  4YAV A;  2GVP A;  2YOI A;  2EFD A;  2PWJ A;  2C3N A;  4IP1 A;  5DCH A;  3GFK A;  5IIZ A;  4ILF A;  3QFB C;  3RHB A;  4OO5 A;  1GSQ A;  1T7P B;  4MA9 A;  4L5L A;  4V2M A;  1XPV A;  3PIN A;  4BVX A;  1TP9 A;  1BED A;  4N0V A;  2AB6 A;  3GST A;  3ZIT A;  1OC8 A;  4PNF A;  4MNN A;  2R2J A;  1N8J A;  4RI6 A;  3KXO A;  4JU5 A;  1T8E B;  2B1L A;  4DVC A;  2OE0 A;  1MDK A;  1F3A A;  1XWC A;  4MJB A;  3RDW A;  3FKF A;  2XBQ A;  4NWY A;  1AQW A;  3IA1 A;  2L4C A;  4WET A;  3ZRD A;  1FOH A;  2AYT A;  3O3T A;  5GZZ B;  1KEB A;  1W4V A;  1OYJ A;  1THO A;  3ZYW A;  2ON5 A;  4K0G A;  1ZYE A;  3GV1 A;  1YEX A;  2VCZ A;  3D4T A;  3EPT A;  4GST A;  4POB A;  4HS1 A;  4D73 B;  1SK1 A;  1PMT A;  3LGC A;  4Q5R A;  2QKE A;  1PKZ A;  3UOM A;  2UZ8 A;  1Z7P A;  4MMM A;  2RM5 A;  2HRA A;  3EYT A;  3ZFB A;  2JL4 A;  4V2L A;  3F3Q A;  2GST A;  2CX4 A;  2WGR A;  3IK7 A;  1NHY A;  2B5X A;  1FB6 A;  2GZZ A;  3TJK A;  4K2D A;  3F0I A;  1R5A A;  5ECL B;  1O73 A;  5CO3 A;  1DSB A;  1T00 A;  2KOK A;  1A24 A;  2DJJ A;  2OE3 A;  4ZB7 A;  3KZQ A;  3GL5 A;  3I43 A;  1QUW A;  3I69 A;  3IHQ A;  1GUL A;  2RLI A;  5F05 A;  3IPZ A;  3KH9 A;  3IK9 A;  1JZD A;  4P3Y B;  3VWU A;  5A34 A;  2IN3 A;  2J9H A;  3TGZ A;  2H6Z A;  4RI7 A;  1TI3 A;  3C7M A;  3A3T A;  2QA1 A;  4HI7 A;  1SKW B;  1SK2 A;  3TUE A;  2A4V A;  2Z9S A;  5J41 A;  2B5Y A;  4YQV A;  3IBH A;  3FK8 A;  5J9B A;  4EIQ A;  2L57 A;  3MYD A;  2GDR A;  1MD3 A;  2YCD A;  2QA2 A;  5A5H A;  5B8B A;  3W6G A;  3P7X A;  2HRK A;  5HFG A;  4MZW A;  2VD0 A;  1ERU A;  2YWN A;  4WXT A;  2VUP A;  3EU3 A;  3EUR A;  3LXZ A;  3DD3 A;  4OFT A;  4K7O A;  1VF2 A;  1O81 A;  4POK A;  1XIY A;  2OT3 A;  1SVM A;  1YKC A;  1TI1 A;  4YAP A;  2IFQ B;  5D93 A;  6GSX A;  1GWC A;  3HJM A;  4L8E A;  3FZ9 A;  2X8C A;  1HNB A;  5IMF A;  4ZB9 A;  2FA8 A;  2V1M A;  4WF4 A;  2IMF A;  1BAY A;  4IQA A;  4N3Z A;  1TRV A;  4CHS A;  2B5E A;  1M99 A;  2X8H A;  2YJH A;  3VUR A;  3ERG A;  1M0U A;  3RPP A;  2IME A;  4ECI A;  1GTU A;  1H4O A;  3HKR A;  4OFM A;  1OC9 B;  3G7I A;  1T4Y A;  2CV4 A;  4TXO B;  4K1F A;  3D6I A;  1V57 A;  1U6T A;  5C00 A;  5G1L A;  3O76 A;  3SBC A;  4TW5 A;  3KM6 A;  2L6C A;  1O7U A;  4TOP A;  3CRT A;  3D22 A;  4ZL8 A;  2HSM B;  3VWX A;  1QMV A;  3QR6 A;  5G5E A;  3ME7 A;  2FLS A;  3RPN A;  5F8B A;  1GSS A;  4G10 A;  2VCT A;  5CRG A;  5HR1 A;  3KMO A;  2HRF A;  4GLT A;  4NV2 A;  1DE1 A;  5J4U A;  1BG1 A;  4TR1 B;  4L0W A;  2EFH A;  2H70 A;  5JWQ B;  3RAZ A;  5F07 A;  19GS A;  1LJR A;  4IKH A;  3VK9 A;  3APS A;  1IYH A;  3DWV A;  2LJR A;  3UEM A;  3M3M A;  3FZ5 A;  2YPM A;  2LQQ A;  3M9J A;  3HVS A;  1PGT A;  2EIQ A;  2GQK A;  2YV9 A;  2V2G A;  3DVX A;  3BOA A;  1UVZ A;  4KUN A;  4K7N A;  2VL9 A;  2X49 A;  1JZR A;  3GUS A;  2G0F A;  3FEU A;  5DAL A;  3PPU A;  2C8U A;  1M9A A;  5IMV A;  4I2U A;  2C1Y A;  4NHW A;  1M2A A;  2HSN A;  2E2G A;  3GH9 A;  2I81 A;  2E2M A;  2H6X A;  1YY7 A;  2WZ9 A;  1UN2 A;  4K6X A;  2PN8 A;  1PSQ A;  1TOF A;  2LRN A;  2FWG A;  5IM9 A;  1MDJ A;  2DSA A;  3TB2 A;  1SKR B;  3LSZ A;  2O89 A;  3FZA A;  1SJI A;  5KOX A;  4NV5 A;  5BMU A;  1XCC A;  4KH7 A;  2A2P A;  1Z5Y E;  4MZC A;  1F9M A;  5H5R A;  3APQ A;  2VM1 A;  4TR4 A;  1QXH A;  3EVI A;  3LXT A;  2TRC P;  1NM3 A;  1TK0 B;  4BWS A;  3GTU B;  2DBC A;  1GH2 A;  3ZVJ D;  3TCO A;  2DIZ A;  3Q19 A;  1OVN A;  2DJ0 A;  5HFK A;  3VI5 A;  2QC7 A;  3CXG A;  1ZOF A;  4DSS B;  5GSS A;  1RK4 A;  2YWM A;  2ES7 A;  4EE0 A;  1ERW A;  1SD8 A;  5BRT A;  4F2I A;  5DBQ A;  3KTL A;  3L9S A;  4LMV A;  1K3L A;  4RUV A;  1EV4 A;  3APO A;  1KNG A;  2R0G A;  4XS6 A;  3ZTL A;  3BCK A;  4PNG A;  3ERF A;  1ZYP A;  2FY6 A;  6GSW A;  4GF0 A;  9GSS A;  1YEP A;  4CDO A;  3EWL A;  4ECC A;  3F4T A;  2PGT A;  4IGJ A;  1IYI A;  1W89 A;  3GL3 A;  2YZU A;  5IPH A;  1GUH A;  2GLR A;  1CQH A;  4AJ8 A;  1G7O A;  1EZK A;  4PUF C;  7GSS A;  2MZC A;  13GS A;  3KD0 A;  5DDL A;  2K9F A;  4G0I A;  1TTZ A;  1E2Y A;  3V1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...