4GLTA

Crystal structure of glutathione s-transferase mfla_2116 (target efi-507160) from methylobacillus flagellatus kt with gsh bound
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
208
structure length
208
Chain Sequence
NLYFQSMKLLYSNTSPYARKVRVVAAEKRIDVDMVLVVLADPECPVADHNPLGKIPVLILPDGESLYDSRVIVEYLDHRTPVAHLIPQDHTAKIAVRRWEALADGVTDAAVAAVMEGRRPEGMQDSAVIEKQLNKVERGLRRMDQDLEKRKWCVNESFSLADIAVGCMLGYLELRYQHLDWKQQYPNLARHYAAMMKRASFKDTAPVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase-like protein
publication title Crystal structure of glutathione s-transferase MFLA_2116 (target EFI-507160) from methylobacillus flagellatus kt with gsh bound
rcsb
source organism Methylobacillus flagellatus
molecule tags Transferase
total genus 67
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4gltA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gltA01
5DJLA 3GKMA 1ZMAA 4V2MA 1U3AA 4L5LA 2JL4A 4GQFA 1XW5A 2X99A 2VIMA 1BG5A 2LRCA 2H0IA 1OKTA 2M72A 5B8AA 2F8AA 1ZYQB 4JR4A 5CRHA 2KP1A 3F3RA 3E9JB 1T1VA 3GH9A 2GQLA 1KNGA 1XIYA 1TK0B 3P7XA 2CAQA 5C04A 3A2VA 1SKSB 2H75A 3F6FA 2CX4A 2L6DA 5G2ZA 1K0NA 3HJOA 1GRXA 1G6YA 5GAND 4OCEA 2IMEA 1G7OA 2ON5A 1F37A 1WIKA 5IPHA 3IC4A 3TKPA 1W89A 5EL8A 4ECBA 4HU7A 2HSMA 5D9WA 2C80A 2P0GA 2VCVA 1CQGA 6GSWA 3NZNA 1G0TA 4I8BA 2FWFA 3IA1A 3CRTA 1PL2A 3HZ8A 1GNWA 3ZLPA 3QAVA 3GKKA 4D73A 3IPZA 2H30A 2VL2A 4F2IA 4PQHA 3TOTA 3L4NA 1Z9HA 3TRQA 1SD8A 1T3BA 3GURA 4KB3A 1M0UA 3HDCA 3F4RA 4BVYA 1A24A 4EE0A 11GSA 5G1LA 3UEMA 1WMJA 1FB6A 2GLRA 4G0IA 3F3QA 4JRRA 4BA7A 1XVQA 1OC8A 1JHBA 3HVXA 4HJ2A 2GQMA 3ERGA 1V40A 3CSJA 2G0FA 2F3MA 2LQQA 1YJ6A 3IAS2 4TOPA 4TN8A 1F6MC 3QFAC 2V6KA 1KTEA 5CREA 2XPDA 3TRXA 2CV4A 4NMUA 3D4TA 2H70A 3HA9A 1ZL9A 6GSTA 3FEUA 4IKHA 3HVSA 3ZVJA 3LXTA 4E8EA 3KCMA 5DCGA 2LNSA 1M2AA 1FW1A 4I2UA 3ZIVA 4GLTA 3A2XA 2AUVA 4V2NA 4G0KA 1GUKA 5D9TA 1PGTA 5DCHA 4TVEA 1GSUA 6GSUA 2LEGA 1X5DA 3DWVA 1UVZA 4HZ4A 1U88A 4MDCA 1YEXA 2C0EA 2KHPA 4HEA2 3ME8A 3U5RE 1O85A 3BCIA 5CAXA 2FA4A 4NXIA 4AF2A 1AXDA 2VL9A 2LJKA 2L5OA 2WDUA 5DDLA 1TI1A 1SJIA 3A3TA 1S3CA 4OWYA 1ZGNA 2VLTA 1XWCA 3VPQA 1K0BA 18GSA 1SJ6A 4USSA 2GGTA 4EDYA 3IK9A 5ECHB 3KGKA 2OBKA 2MMAA 5AIXA 5HFIA 3CBUA 1GSEA 4ML6A 1PSQA 2GZPA 4YQUA 2N5FA 2DMLA 4XTSA 4I2TA 5AGYA 2PVOC 3LFLA 2O87A 3GRXA 2H1AA 3KJYA 2H1GA 2YPMA 1RK4A 1Y6EA 1C72A 3FZ5A 4DSSB 4O32A 1XWGA 2HSYA 2I4AA 5ECMB 5HR1A 3EVIA 17GSA 2JACA 5E59A 3UVTA 1RQMA 2YV7A 4KW6A 1X9SB 5IMAA 4H86A 3DVXA 5C00A 6GSYA 1DSBA 5A5KA 5H5SA 2CVBA 5J3RA 1ML6A 2L4CA 4NV2A 1JZRA 3VFIA 2WGRA 4TW5A 5ECIB 3FZ4A 2R2JA 3ZYWA 2KLXA 3ZIJA 4IS0A 1GSDA 1MDKA 5ID2A 3GTUA 4MZBA 3IE3A 4JZQA 2PERA 2HT9A 3CSHA 2HRFA 3GKNA 1HQOA 4G9HA 1TK5B 1K3YA 4N30A 1J9BA 2PUKC 2LQOA 2NBSA 1SL2B 3AY8A 2DJ0A 5B6NA 4AJ6A 1S3AA 2ZNMA 3IHQA 4KE3A 4NHZA 1OE8A 2DLXA 1Z5YE 4XS1A 3I9V2 1EP7A 5B7CA 1ZYEA 5CNWA 4MMMA 1K0CA 2LV3A 5G31A 2DJKA 3UVHA 4TXOB 6GSVA 3F6DA 3ZTLA 4ZILA 3MWHA 2ON7A 3ED3A 4ZL8A 2C4JA 1TU8A 5JWRB 1A0RP 2DJ1A 3IXRA 5IMCA 1T7PB 2C3QA 5J9CA 2H73A 4BL7A 4TR1A 4NWYA 2YOIA 2LRNA 5IPGA 2FHEA 1YQ1A 5D93A 3QPMA 2AAWA 5IMDA 3P90A 3P8WA 1GSSA 2HXKA 3KIJA 3PGTA 2HE3A 5EPFA 2GSQA 2HQTA 3FRCA 4DSSA 1SKRB 2XPEA 1A2LA 5CRGA 3SBCA 1U87A 3FR3A 1EGOA 4GQCA 3ZVJD 1X9WB 3N5OA 1TP9A 3M9JA 3FR6A 2FUG2 2GTUA 4YQMA 1QK8A 3CYNA 1BEDA 3GSTA 2L57A 4FYBA 5IOXA 1MDIA 2FA8A 2H72A 1GTBA 5J4UA 2GVPA 1R4WA 4I5QA 5BMUA 4MH3A 3L9UA 2DSAA 3A2WA 1Z7PA 3Q19A 1GSQA 2IIYA 3UARA 3DYRA 2DIYA 4KAEA 4MK3A 1HNCA 2BJXA 4KUNA 4Z7XA 3GHAA 1F3AA 4MZCA 4HDEA 4GXZA 5ECSA 1O8WA 2X8CA 2HSMB 3KTLA 2E7PA 1GUHA 4L8EA 3TB2A 2CZ3A 2C0GA 4K8MA 1WP0A 3L9SA 4K9ZA 4QL9A 1FHEA 1OE7A 2PBJA 4IGJA 2P5RA 2HRKA 1X0RA 3EU3A 3H4KA 2J23A 1BAYA 1PN9A 3HHVA 4GRFA 3IOSA 4RI7A 2YWMA 4D73B 4ZBAA 1EEMA 3GMFA 4HQZA 5ECQB 4ZL7A 4KDUA 2I1UA 2YJ7A 3CSIA 13GSA 1K0MA 4BVYB 1THOA 2XC2A 1ERVA 2CX3A 3IDVA 1XXUA 2H8LA 4XS6A 3BCKA 1Q98A 2ES7A 2V32A 1OAZA 5HR2A 4ECCA 3FHKA 5F07A 3SWLA 1OC9A 2C8UA 5IQYA 4WR5A 3UAPA 4O92A 4XCSA 3KMOA 5FHIA 1GH2A 1XW6A 5CP1A 2YN1A 1J08A 1ST9A 4K7IA 4TKYA 4PNFA 2PU9C 9GSSA 3FY7A 4BVXA 4IBPA 4GCIA 1ABAA 4V1Ap 4X1UA 3H8QA 4K6XA 1N8JA 5ABRA 4Q5FA 1SD9A 2VCQA 5ECKB 1SL1B 3EMXA 3LYKA 1JZOA 3F63A 1FVKA 3H1NA 3KM6A 5D96A 5IMFA 2REMA 5HR0A 4K1FA 3DMLA 4ULXA 3TKQA 1WJKA 2FGXA 5DJMA 4X0XA 2O89A 2YZUA 3WGDA 4ZXGA 4MA9A 4POLA 1E6BA 2HRAA 2E0QA 4HUAA 3RPNA 2L59A 1M7TA 5B8BA 4ECJA 2TIRA 3MAKA 2V6OA 1FB0A 2RIIA 1YEPA 1A23A 4CW9A 4IVFA 2I9HA 5KN2A 3W8JA 4MZWA 4LL4B 1J0FA 3HXSA 1EZKA 2B5XA 1AC1A 4FIWA 3WD6A 3IAM2 5HFGA 2H66A 1T8EB 5AN1A 2VLVA 3ZZXA 5IIZA 1UN2A 3PPUA 3UBKA 3VURA 1A2JA 2M46A 3BBYA 1NHYA 1DUGA 3F4TA 4ECIA 1XWKA 4N10A 1WE0A 4G2EA 1BJXA 14GSA 4AJ8A 4WBRD 2WB9A 3NIVA 4KCAA 5A4UA 3LQ7A 3E3EA 5ELGA 4MJEA 1UC7A 3D5JA 4WKWA 1B48A 1RW1A 4MP4A 1I9DA 1OYJA 2LSTA 4WBJA 4JU5A 5CO3A 2HYXA 2O85A 2C3NA 2P31A 1I5GA 3TJBA 4FQUA 3EMPA 2LJRA 2FD3A 1GULA 3QD9A 1WWJA 2WCIA 3TJKA 4FH8A 2IN3A 2O7KA 1BQ7A 1GLPA 2VCTA 1Y25A 4LL1B 2P5QA 2L4QA 3L78A 5HFKA 2VAFA 2LS5A 1U6TA 5ID2B 2O8VB 3GTUB 2OE0A 3PR8A 1SU9A 1ACVA 4HU9A 2X8HA 4ZIJA 3G7JA 2BTOT 5JWQB 4GSNA 2WZ9A 5F05A 2H0HA 2IJYA 2M80A 2XHFA 3P2AA 4V1Ag 3PH9A 4PQIA 2VCXA 5DBQA 1DE2A 1K3OA 3FZAA 4TXVA 1DE1A 3TKSA 4GWRA 2HLSA 3QDNA 1M2BA 1B4PA 1LU4A 1MD3A 1XFLA 1NHOA 2JU5A 1V9WA 4IQ1A 1Z7RA 2BMXA 2D2ZA 4FYCA 1G6WA 5JWOB 5INYA 1H75A 2VOCA 1ILOA 2JZTA 2MZCA 4KCEA 3LYPA 4F0CA 1AQWA 2PWJA 1Q4JA 3VI5A 2CVDA 1Z6MA 4BL7B 3KTBA 4TR1B 2IMFA 2EIOA 3KD0A 1G7EA 5CRDA 1B9XC 4TR4A 1R5PA 1SKWB 2HZEA 1H4OA 3UBLA 3EC3A 1YZXA 3E0UA 5EVOA 3IR4A 2OJLA 2MBTA 3CRUA 3LG6A 2FWHA 3JCML 2CAIA 1EV9A 4POKA 2VCZA 12GSA 4MPGA 1AQXA 1JZDA 4KNDA 4IW9A 2AHEA 2LUSA 2E2GA 4KF9A 2H6XA 4OD7A 1B9YC 2F9SA 1SJZA 2VL2C 5FT3A 2R37A 5DQYA 5A4VA 4IN0A 2A4VA 4NAXA 1EGRA 3KH7A 1PD21 3IK7A 2I81A 3ME7A 3QAGA 3GV1A 1XW9A 3IBHA 3GFKA 1GL8A 1EV4A 3I69A 4KSOA 3UOMA 4DVCA 4ZBDA 1PRXA 1O6JA 4L0UA 1XBSA 3ISOA 3L0HA 4RI6A 2HRKB 1B4QA 5CYYA 1GWCA 2HSHA 1PA3A 3VLNA 3C1SA 2YJHA 4X43A 4BWQA 4ZBBA 2K8SA 2E2MA 2B1KA 3I6AA 4ZB9A 3GIXA 3RBTA 3D4MA 1UA5A 2C1YA 2OACA 1EWXA 3O3TA 1XWAA 1GSYA 1V57A 1SENA 5ECNB 3CXGA 1JFUA 4EUYA 2B7JA 3LORA 4MF5A 2C0FA 1GTIA 4FO5A 1QUWA 3M9KA 4ZB6A 3RHCA 3HD5A 4XIHA 1S3DA 1PKWA 3KXOA 1QMVA 1TRVA 1AIUA 1OC9B 3HJPA 3GH6A 2R6KA 3G7IA 3TCOA 1USBA 4MJCA 2PGTA 1K0DA 1GP1A 2H0GA 3GX8A 4RQRA 1TOFA 4NHWA 1WRYA 3TJGA 4BVXB 2YANA 2GT5A 1M9AA 2JSYA 5G5FA 4WF4A 1FVJA 2DBCA 2LTKA 1MD4A 1ON4A 3FZ9A 10GSA 2VL3A 3GL5A 2A2RA 1A2MA 1Z6NA 5KN3A 4L0WA 2AYTA 1PX7A 2H1DA 1K0OA 4MJAA 4OO4A 3ZFLA 1MDJA 4V2LA 1HNAA 3EE2A 4OCFA 4KDYA 4K2DA 1PMTA 4O7HA 2JSZA 5D9VA 5F06A 3TJJA 3KMNA 2H6YA 5A4WA 4JR6A 5F8BA 3G7YA 1F2EA 5LD0A 3GKXA 4YQVA 7GSSA 1V58A 5J9BA 2OKAA 2F8FA 2HSNB 3TRPA 3DD3A 1YY7A 1PQNA 2HNLA 1A8LA 3TDGA 5DALA 2H71A 4HJMA 3D0ZA 5JCWA 3US3A 1XZOA 4EDZA 1V98A 4N0VA 2GZYA 2QSIA 4POBA 1NSWA 4Q5RA 2C0DA 2VO4A 2R5GA 3Q18A 1FO5A 3M3MA 5G1KA 5ECLB 3S9FA 1YKAA 3Q6OA 2LNTA 2UZ8A 3LSZA 2YWOA 1R7HA 2EIRA 1NW2A 3D6IA 5LCZA 2B3SA 3TGZA 5ENUA 1A8YA 4J2FA 3VWVA 1O7UA 3GN3A 2TRXA 3L9VA 3DEXA 2RUEA 1K3LA 1TW9A 4PTSA 4OFNA 1XOBA 2VD0A 4ILFA 1MEKA 3ERWA 1JLVA 5LNKe 2VM2A 1BYEA 3GYKA 1QFNA 4DSRA 2FNOA 4XS4A 3D21A 3NOFA 2IFQA 4KGIA 2RM5A 4YH2A 1V2AA 2R4VA 3QCPA 1BX9A 4K0GA 2QKEA 3DVWA 2OE1A 2H19A 4TR3A 1OC3A 4OO5A 3ZITA 3KP9A 5DVBA 2EC4A 1LJRA 5ECPB 4QQ7A 3ZREA 1VGLA 5GSSA 5ECOB 3F0IA 2K8VA 4O5RA 2CA8A 4PUFC 3WT2A 3QR6A 1ZZYA 4QL7A 1ZCPA 3WGEA 4JBBA 2FWGA 2B1LA 2NTOA 3U6VA 3TKSE 4EXJA 3GNJA 2IMIA 3G9BA 2XBQA 1URMA 1JZWA 2N5BA 6GSXA 4XRAA 2AB6A 2A2SA 2CQ9A 2ZUPA 1O73A 2IWTA 2HZEB 3D22A 4WXTA 4EC0A 2L5LA 3OR5A 3ZMLA 1FAAA 1TRUA 2GZZA 2Z9SA 4I97A 3EWLA 3C71A 2LKUA 2CZ2A 3UL3A 2ALBA 3QAWA 1T00A 22GSA 4ISDA 3TKRA 2V2GA 2FWEA 1SK0A 1YDKA 1X5CA 3GUSA 2GSSA 2PPTA 5G5EA 1T4ZA 4OFTA 3MSZA 1VRSD 4ID0A 3ZRDA 4POMA 3Q74A 3EU4A 4BPYA 5DAKB 4HZ2A 4DSQA 3FYGA 3DIEA 3GSSA 2IMDA 4ML1A 2MMNA 4F03A 2DC5A 1E2YA 2V1MA 3F8UA 2YWIA 5ECRB 3DGQA 4OFMA 20GSA 2MMOA 2XBIA 1O8XA 1TI3A 4GTUA 1ZOFA 4EKZA 4LA1A 3LEFA 1ERWA 4G10A 4XHMA 2CT6A 3R2QA 5KEJA 2KP2A 1VF4A 4IP1A 2WULA 3APSA 2YZHA 3BJ5A 4DEJA 4MH2A 1GTAA 3UMAA 2WRTA 5ELAA 3QFBC 3KH9A 6GSSA 4ZL9A 1THXA 1JLWA 2C3TA 5IO0A 5E4WA 3IC8A 5D9XA 3C73A 5KN0A 4BWSA 3FK8A 3APOA 3QOUA 4FYUA 1AQVA 4N11A 3W8SA 4ACSA 2FY6A 1VF2A 2PVQA 2MYGA 1PKZA 4P3YB 2VM1A 4E8HA 3IV4A 1CQHA 2FCHA 4NPBA 1TK8B 3VPTA 2PMTA 4PGTA 3FR9A 1XOAA 5COHA 1R26A 1VF3A 4KSMA 2H76A 3GA4A 2DJ2A 1F3BA 4IJ3A 4PURA 3APQA 3J7Yb 2AV4A 2RUFA 3RPPA 5F0GA 3LGCA 2DIZA 5H5RA 3MDKA 2EIQA 3V1WA 1EP8A 3FW2A 3ZMKA 4EVMA 3R3EA 5J41A 4K0NA 1TTZA 4F0BA 1SK2A 3BOAA 2VD1A 4N0ZA 3A5WA 2MBSA 2QGVA 3HZ4A 1AAZA 2VCWA 3CTFA 2GT6A 2LRTA 2NVLA 2PN8A 2TRCP 3O6TA 4L5OA 2G2QA 3N9JA 1EOGA 4MPFA 4K7NA 4MLYA 1KEBA 1TKDB 3GL3A 1EEJA 5DAKA 2K9FA 3EINA 1X5EA 4TRXA 4WR4A 4AJ7A 4IQAA 1TRSA 2B5YA 4GSTA 4PUAA 3TJFA 16GSA 3MNGA 3F4SA 4G0LA 1VF1A 2I3YA 1HNBA 1DBYA 2JZSA 1ERUA 4MCUA 4WETA 2YWNA 5DALB 2X64A 2WS2A 2H6ZA 5HQPA 3HJMA 5GZZB 2RM6A 4J56E 1U3IA 5IM9A 4NV5A 5AISA 3M1GA 5IMZA 3CMIA 4EO3A 2V41A 1M9BA 1XPVA 1YF0A 3RHBA 3HCZA 1NM3A 1Z3EA 1HD2A 3IRAA 3VWWA 2HFDA 5FWGA 4AGSA 2B5EA 2KUCA 3VK9A 3CTGA 3W6GA 3TUEA 1TJDA 1TU7A 4WF5A 3F9UA 2WJUA 1R5AA 3KZQA 2R3XA 1AUCA 3HY2A 4MF7A 4JE1A 1ERTA 4GSSA 2HI7A 3O76A 2H01A 3LWAA 4LMVA 2WFCA 2IL3A 1TXXA 5KN1A 3EURA 4PXOA 3GX0A 5EY6A 2IPAA 5G30A 5H5QA 1N2AA 4TR0A 8GSSA 2IMKA 4IHUA 4HOJA 1IYIA 4KA0A 4Q5QA 1SYRA 2CVKA 3HVVA 2OBIA 3TKSC 4HI7A 3ERFA 1SL0B 1AW9A 2JZRA 4GF0A 4XS4B 4F82A 4MF6A 2IFQB 3WGXA 3H93A 1QXHA 1X9MB 2J9HA 2HZFA 2DJJA 1LBKA 2OA7A 3LJRA 3M0FA 3H79A 5D73A 3ZL5A 3WYWA 3FKFA 3DXBA 4F9ZA 4PNGA 4JEDA 1WPIA 4YAVA 3DKSA 3RDWA 2K18A 3LXZA 1MTCA 4HS1A 1OVNA 3UIWA 1YKCA 3VWUA 4OMVA 3UJ1A 1K0AA 4RQXA 5L71A 3DRNA 3TOUA 2KOKA 5CRWA 2GDRA 3HKRA 1XCCA 1A0FA 2FLSA 4MJBA 3VI7A 4CDOA 2JADA 4YAPA 2OE3A 5AIVA 1SK1A 3BD2A 1GLQA 2HRNA 3K8NA 5DQSA 3VWXA 2QC7A 2GSRA 4WEYA 2F51A 1M2DA 2YCDA 2GSTA 2H1BA 4I6XA 1QGVA 3KEBA 2H74A 1KBNA 3QMXA 5IMVA 1GUMA 3PINA 5GSTA 1FOVA 4LMWA 4HQSA 4PX1A 1B8XA 1GTUA 2DMMA 5D8IA 1YF1A 4G19A 4Q5NA 3RAZA 2X8GA 1O81A 19GSA 2NDOA 1OKDA 1PL1A 4IJIA 3I43A 2K6VA 2AJQB 4KDXA 1M99A 4IELA 1FG4A 5IO2A 1W4VA 4KH7A 4J57E 5HR3A 2ZCTA 2GQKA 1EOHA 3M8NA 5JCGA 1WOUA 1PX6A 2VUPA 4MABA 1QQ2A 4PQ1A 2YNXA 4XRDA 4RUVA 2B7KA 1F9MA 3C8EA 1T4YA 4KX4A 1IYHA 4EF0A 4IP6A 2OADA 4LLRA 3C7MA 1XVWA 3ZFBA 3J7Yk 4TXOA 2GS3A 3HYPA 5IOWA 2B6MA 3KP8A 4EL1A 2YV9A 4K7OA 5B6MA 3C1RA 1XWBA 5JCUA 4CHSA 2MMZA 2LJAA 4ZB8A 1SYXA 2L6CA 2NPBA 2YP6A 1TDIA 1TRWA 1GSFA 2N5AA 2VLUA 5GAPD 3EYTA 2RLIA 2DJ3A 5J5NA 1HYUA 1GNEA 3WT1A
chains in the Genus database with same CATH superfamily
5DJLA 3GKMA 1ZMAA 2WW3A 4V2MA 1U3AA 4L5LA 2JL4A 4GQFA 1XW5A 3EPTA 3HMJG 2X99A 2VIMA 1BG5A 2LRCA 2H0IA 1OKTA 2M72A 5B8AA 2F8AA 1ZYQB 4JR4A 5CRHA 2KP1A 3F3RA 4ICYA 3E9JB 1T1VA 3GH9A 2GQLA 1KNGA 1XIYA 1TK0B 3P7XA 2EFDA 2CAQA 5C04A 3A2VA 1SKSB 4PHZC 2H75A 3F6FA 2CX4A 2L6DA 5G2ZA 1K0NA 3HJOA 1GRXA 1G6YA 5GAND 4OCEA 1S3RA 2IMEA 1G7OA 2ON5A 1F37A 1WIKA 5IPHA 3IC4A 3TKPA 1W89A 5EL8A 4ECBA 4HU7A 2HSMA 5D9WA 5A1NA 2C80A 2P0GA 2VCVA 1CQGA 6GSWA 3NZNA 1G0TA 4I8BA 2FWFA 3IA1A 3CRTA 1PL2A 3HZ8A 1GNWA 3ZLPA 3QAVA 3GKKA 4D73A 3IPZA 2H30A 2VL2A 4F2IA 4PQHA 3TOTA 3L4NA 1Z9HA 3TRQA 1SD8A 1T3BA 3GURA 4KB3A 1M0UA 3HDCA 3F4RA 4BVYA 1A24A 4EE0A 11GSA 5G1LA 3UEMA 1WMJA 1BG1A 1FB6A 2GLRA 2WW1A 4G0IA 3F3QA 4JRRA 4BA7A 1XVQA 1OC8A 1JHBA 4N3ZA 3HVXA 4HJ2A 2GQMA 3ERGA 1V40A 3CSJA 2G0FA 2F3MA 2LQQA 1YJ6A 3IAS2 4TOPA 4TN8A 1F6MC 3QFAC 2V6KA 1KTEA 5CREA 2XPDA 3TRXA 2CV4A 4NMUA 3D4TA 2H70A 3HA9A 1ZL9A 6GSTA 3FEUA 1M3JA 3A5IA 3CQFA 5KOWA 4IKHA 3HVSA 3ZVJA 3LXTA 4E8EA 3KCMA 5DCGA 2LNSA 1M2AA 1FW1A 4I2UA 3ZIVA 4GLTA 2R0GA 3A2XA 2AUVA 4V2NA 4G0KA 1GUKA 5D9TA 1PGTA 5DCHA 4TVEA 1GSUA 6GSUA 4PI2C 2LEGA 1X5DA 3DWVA 1UVZA 4HZ4A 1U88A 4MDCA 1YEXA 2C0EA 2KHPA 4HEA2 3ME8A 3U5RE 1O85A 3BCIA 5CAXA 2FA4A 4NXIA 4AF2A 1AXDA 2VL9A 2LJKA 2L5OA 2WDUA 5DDLA 1TI1A 1SJIA 3A3TA 1S3CA 4OWYA 1ZGNA 2VLTA 1XWCA 3VPQA 1K0BA 18GSA 1SJ6A 4USSA 2GGTA 4EDYA 3IK9A 5ECHB 3KGKA 4O5QA 2OBKA 2MMAA 5AIXA 5HFIA 3CBUA 1GSEA 4ML6A 1PSQA 2GZPA 4YQUA 2N5FA 2DMLA 4XTSA 4I2TA 5AGYA 2PVOC 5BRTA 3LFLA 2O87A 3GRXA 2H1AA 3KJYA 2H1GA 2YPMA 2R0CA 1RK4A 1Y6EA 1C72A 3FZ5A 4DSSB 4O32A 1XWGA 2HSYA 4AKXB 1PFOA 2WW2A 2I4AA 5ECMB 4YKFA 5HR1A 3EVIA 17GSA 2JACA 5E59A 3UVTA 1RQMA 2YV7A 4KW6A 1X9SB 5IMAA 4H86A 3DVXA 5C00A 6GSYA 1DSBA 5A5KA 5H5SA 5A34A 2CVBA 5J3RA 1ML6A 2L4CA 4NV2A 1JZRA 3VFIA 2WGRA 4TW5A 5ECIB 3FZ4A 2WVYA 2R2JA 3ZYWA 2KLXA 3ZIJA 4IS0A 1GSDA 1MDKA 5ID2A 3GTUA 4MZBA 3IE3A 4JZQA 2PERA 2HT9A 3CSHA 2HRFA 3GKNA 1HQOA 4G9HA 1TK5B 1K3YA 4N30A 1J9BA 2PUKC 2LQOA 2NBSA 4K2XA 1SL2B 3AY8A 2DJ0A 5B6NA 4AJ6A 1S3AA 2ZNMA 3IHQA 4KE3A 4NHZA 1OE8A 2DLXA 1Z5YE 4XS1A 3I9V2 1EP7A 5B7CA 1ZYEA 5CNWA 4MMMA 1K0CA 2LV3A 5G31A 2DJKA 3UVHA 4TXOB 6GSVA 3F6DA 3ZTLA 4ZILA 3MWHA 2ON7A 3ED3A 4ZL8A 2C4JA 1TU8A 5JWRB 2A4HA 1A0RP 2DJ1A 3IXRA 5IMCA 1T7PB 2C3QA 5J9CA 2H73A 4BL7A 4TR1A 4NWYA 2YOIA 2LRNA 5IPGA 2FHEA 1YQ1A 5D93A 3QPMA 2AAWA 5IMDA 3P90A 3P8WA 1GSSA 2HXKA 3KIJA 3PGTA 2HE3A 5EPFA 2GSQA 2HQTA 3FRCA 4DSSA 1SKRB 2XPEA 1A2LA 5CRGA 3SBCA 1U87A 3FR3A 1EGOA 4GQCA 3ZVJD 1X9WB 3N5OA 1TP9A 3M9JA 3FR6A 2FUG2 2GTUA 4YQMA 1QK8A 3CYNA 1BEDA 3GSTA 4AKGA 2L57A 4FYBA 5IOXA 1MDIA 2FA8A 2H72A 1GTBA 5J4UA 2GVPA 1R4WA 4I5QA 5BMUA 4MH3A 3L9UA 2DSAA 3A2WA 1Z7PA 3Q19A 1GSQA 2IIYA 3UARA 3DYRA 2DIYA 4KAEA 4MK3A 1HNCA 2BJXA 4KUNA 4Z7XA 3GHAA 1F3AA 4MZCA 4HDEA 4GXZA 5ECSA 1O8WA 2X8CA 2HSMB 3KTLA 2E7PA 1GUHA 5A1NB 2QA2A 4L8EA 3TB2A 4Z2RA 2CZ3A 2C0GA 4K8MA 1WP0A 3L9SA 4K9ZA 4QL9A 1FHEA 1OE7A 2PBJA 4IGJA 1M3IA 2P5RA 2HRKA 1X0RA 3EU3A 3H4KA 2J23A 1BAYA 1PN9A 3HHVA 4GRFA 3IOSA 4RI7A 2YWMA 4D73B 4ZBAA 1EEMA 3GMFA 4HQZA 5ECQB 4ZL7A 4KDUA 2I1UA 2YJ7A 3CSIA 13GSA 1K0MA 4BVYB 1THOA 2O3EA 2XC2A 1ERVA 2CX3A 3IDVA 1XXUA 2H8LA 4XS6A 3BCKA 1Q98A 2ES7A 2V32A 1OAZA 5HR2A 4ECCA 3FHKA 5F07A 3SWLA 1OC9A 2C8UA 5IQYA 4WR5A 3UAPA 4O92A 4XCSA 3KMOA 5FHIA 1GH2A 1XW6A 5CP1A 2YN1A 1S4BP 1J08A 1ST9A 4K7IA 4TKYA 4PNFA 1YEWC 2PU9C 9GSSA 3FY7A 4BVXA 4IBPA 4GCIA 1ABAA 3MIXA 4V1Ap 4X1UA 3H8QA 2UV8G 4K6XA 1N8JA 5ABRA 4Q5FA 1SD9A 2VCQA 5ECKB 1SL1B 3EMXA 3LYKA 1JZOA 3F63A 1FVKA 5KOXA 3H1NA 3KM6A 5D96A 5IMFA 2REMA 5HR0A 4K1FA 3DMLA 4ULXA 3TKQA 1WJKA 2FGXA 5DJMA 4X0XA 2O89A 2YZUA 3WGDA 4ZXGA 4MA9A 4POLA 1E6BA 2HRAA 2E0QA 4HUAA 3RPNA 2L59A 1M7TA 5B8BA 4ECJA 2TIRA 3MAKA 2V6OA 1FB0A 2RIIA 1YEPA 1A23A 4CW9A 4IVFA 2I9HA 5KN2A 3W8JA 4MZWA 4LL4B 1J0FA 3HXSA 1EZKA 2B5XA 1AC1A 4FIWA 3WD6A 3IAM2 5HFGA 2HSNA 2H66A 1T8EB 5AN1A 2VLVA 3ZZXA 4EIPA 5IIZA 1UN2A 3PPUA 3UBKA 3VURA 1A2JA 2M46A 3BBYA 1NHYA 1DUGA 3F4TA 4ECIA 4CY8A 1XWKA 4N10A 1WE0A 4G2EA 1BJXA 2DKIA 14GSA 4AJ8A 4WBRD 2WB9A 3NIVA 4KCAA 4O5UA 5A4UA 3LQ7A 3E3EA 5ELGA 4MJEA 1UC7A 3D5JA 4WKWA 1B48A 1RW1A 4MP4A 1I9DA 2O36A 1OYJA 2LSTA 5J4VA 4WBJA 4JU5A 5CO3A 2HYXA 2O85A 2C3NA 2P31A 1I5GA 3TJBA 4Z2TA 4FQUA 3EMPA 2LJRA 2FD3A 2WVZA 1GULA 3QD9A 1WWJA 2WCIA 3TJKA 4FH8A 2IN3A 2O7KA 5A34B 1BQ7A 2VKZG 1GLPA 2VCTA 1Y25A 4LL1B 1BF5A 2P5QA 2L4QA 3L78A 5HFKA 2VAFA 2LS5A 1U6TA 5ID2B 2O8VB 3GTUB 2OE0A 3PR8A 1SU9A 1ACVA 4HU9A 2X8HA 4ZIJA 3G7JA 2BTOT 5JWQB 4GSNA 2WZ9A 5F05A 2H0HA 2IJYA 2M80A 2XHFA 4ZB7A 3P2AA 4V1Ag 3PH9A 4PQIA 2VCXA 5DBQA 1DE2A 1K3OA 3FZAA 4TXVA 1DE1A 3TKSA 4GWRA 2HLSA 2R0PA 3QDNA 1M2BA 1B4PA 1LU4A 1MD3A 1XFLA 1NHOA 2JU5A 1V9WA 4IQ1A 1Z7RA 2BMXA 2D2ZA 4FYCA 1G6WA 5JWOB 5INYA 1H75A 2VOCA 4YKGA 1ILOA 2JZTA 2MZCA 4KCEA 3LYPA 4E68A 4F0CA 1AQWA 2PWJA 1Q4JA 3VI5A 2CVDA 1Z6MA 5A5HA 4BL7B 3KTBA 4TR1B 2IMFA 2EIOA 3KD0A 1G7EA 1SVLA 5CRDA 1B9XC 4TR4A 1R5PA 1SKWB 2HZEA 1H4OA 3UBLA 3EC3A 1YZXA 5J40A 3E0UA 5EVOA 3IR4A 2OJLA 2MBTA 3CRUA 3LG6A 2FWHA 3JCML 2CAIA 1EV9A 4POKA 2VCZA 12GSA 4MPGA 1AQXA 1JZDA 4KNDA 4IW9A 2AHEA 2LUSA 2E2GA 4KF9A 2H6XA 4OD7A 1B9YC 2F9SA 1SJZA 2VL2C 5FT3A 2R37A 5DQYA 5A4VA 4IN0A 5BMUB 2A4VA 4NAXA 1EGRA 3KH7A 1PD21 3IK7A 2I81A 3ME7A 3QAGA 3GV1A 1XW9A 3IBHA 3GFKA 2DKHA 1GL8A 1EV4A 3I69A 4KSOA 3UOMA 4DVCA 4ZBDA 1PRXA 1O6JA 1TXUA 4L0UA 2O5VA 1XBSA 3ISOA 3L0HA 4RI6A 2HRKB 1B4QA 5CYYA 1GWCA 2X4AA 2HSHA 1PA3A 3VLNA 3C1SA 2YJHA 4X43A 4BWQA 4ZBBA 4CY6A 2K8SA 2E2MA 2B1KA 3I6AA 4ZB9A 3GIXA 3RBTA 3D4MA 1UA5A 2C1YA 2OACA 1EWXA 3O3TA 1XWAA 1GSYA 1V57A 1SENA 5ECNB 3CHXC 3CXGA 1JFUA 4EUYA 2B7JA 3LORA 4MF5A 2C0FA 1GTIA 4FO5A 1QUWA 3M9KA 4ZB6A 3RHCA 3HD5A 4XIHA 1S3DA 1PKWA 3KXOA 1QMVA 1TRVA 1AIUA 1OC9B 3HJPA 3GH6A 2R6KA 3G7IA 3TCOA 1USBA 4MJCA 2PGTA 1K0DA 1GP1A 2H0GA 3GX8A 4RQRA 2OT3A 1TOFA 4NHWA 1WRYA 3TJGA 4BVXB 2YANA 2GT5A 1M9AA 2JSYA 5G5FA 4WF4A 1FVJA 2DBCA 2LTKA 1MD4A 2EFHA 1ON4A 3FZ9A 10GSA 2VL3A 3GL5A 2A2RA 1A2MA 4EIQA 1Z6NA 5KN3A 1ZYNA 4L0WA 2AYTA 1PX7A 2H1DA 1K0OA 4MJAA 4OO4A 3ZFLA 1MDJA 4V2LA 1HNAA 3EE2A 4OCFA 4KDYA 4K2DA 1PMTA 4O7HA 2JSZA 5D9VA 5F06A 3TJJA 3KMNA 2H6YA 5A4WA 4JR6A 5F8BA 3G7YA 1F2EA 5LD0A 3GKXA 4YQVA 7GSSA 1V58A 5J9BA 2OKAA 2F8FA 2HSNB 3TRPA 3DD3A 1YY7A 1PQNA 2HNLA 1A8LA 3TDGA 5DALA 2H71A 4HJMA 3D0ZA 2WW0A 5JCWA 3US3A 1XZOA 4PI0C 4EDZA 1V98A 4N0VA 2GZYA 2QSIA 4POBA 1NSWA 4Q5RA 2C0DA 2VO4A 2R5GA 3Q18A 1FO5A 3M3MA 5G1KA 5ECLB 3S9FA 1YKAA 3Q6OA 2LNTA 2UZ8A 3LSZA 2YWOA 1R7HA 2EIRA 1NW2A 3D6IA 5LCZA 3MYDA 2B3SA 3TGZA 5ENUA 1A8YA 4J2FA 1SVMA 3VWVA 1O7UA 3GN3A 2TRXA 3L9VA 3DEXA 2RUEA 1K3LA 1TW9A 4PTSA 4OFNA 1XOBA 2VD0A 4ILFA 1MEKA 3ERWA 1JLVA 5LNKe 2VM2A 1BYEA 3GYKA 1QFNA 4DSRA 2FNOA 4XS4A 3D21A 3NOFA 2IFQA 4K5RA 4KGIA 2RM5A 4HSCX 4YH2A 1V2AA 2R4VA 3QCPA 1BX9A 2EFEA 4K0GA 2QKEA 3DVWA 2OE1A 2H19A 4TR3A 1OC3A 4OO5A 3ZITA 3KP9A 5DVBA 2EC4A 1LJRA 5ECPB 4QQ7A 3ZREA 1VGLA 5GSSA 5ECOB 3F0IA 2K8VA 4O5RA 2CA8A 4PUFC 1PN0A 3WT2A 3QR6A 1ZZYA 4QL7A 1ZCPA 3WGEA 4JBBA 4K5SA 2FWGA 2B1LA 2NTOA 3U6VA 3TKSE 4EXJA 3GNJA 2IMIA 3G9BA 4AKIA 2XBQA 1URMA 1JZWA 2N5BA 6GSXA 5A5HB 4XRAA 2AB6A 3CWGA 3LW9A 2A2SA 2CQ9A 2ZUPA 1O73A 2IWTA 2QA1A 2HZEB 3D22A 4WXTA 4EC0A 2L5LA 3OR5A 3ZMLA 1FAAA 1TRUA 2Z9SA 2GZZA 4I97A 3EWLA 3C71A 2LKUA 2CZ2A 3UL3A 2ALBA 3QAWA 1T00A 22GSA 4ISDA 3TKRA 2V2GA 1SVOA 2FWEA 1SK0A 1YDKA 1X5CA 3GUSA 2GSSA 2PPTA 5J47A 5G5EA 1T4ZA 4OFTA 3MSZA 1VRSD 4ID0A 3ZRDA 4POMA 3Q74A 3EU4A 4BPYA 5DAKB 4GDFA 4HZ2A 4DSQA 3FYGA 3DIEA 3GSSA 2IMDA 4ML1A 2MMNA 4F03A 2DC5A 1E2YA 2V1MA 3F8UA 2YWIA 5ECRB 3IHGA 3DGQA 4OFMA 20GSA 2WVXA 2MMOA 4G01A 2XBIA 1O8XA 2WZSA 1TI3A 4GTUA 1ZOFA 4EKZA 4LA1A 2H1LA 3LEFA 1ERWA 4G10A 4XHMA 4MNNA 2CT6A 3R2QA 5KEJA 2KP2A 1VF4A 4IP1A 2WULA 3APSA 2YZHA 3BJ5A 4DEJA 4MH2A 1GTAA 3UMAA 2WRTA 5ELAA 3QFBC 3KH9A 6GSSA 4ZL9A 1THXA 1JLWA 2C3TA 5IO0A 5E4WA 3IC8A 5D9XA 4W66A 3C73A 4AKHA 5KN0A 4BWSA 3FK8A 3APOA 3QOUA 4FYUA 1AQVA 4N11A 3W8SA 4BIKA 4ACSA 2FY6A 1VF2A 2PVQA 2MYGA 1PKZA 4P3YB 2VM1A 4E8HA 3IV4A 1CQHA 1Y1UA 3FMWA 2FCHA 4NPBA 1TK8B 3VPTA 2PMTA 4PGTA 3FR9A 1XOAA 5COHA 1R26A 1VF3A 4A5PA 4KSMA 2H76A 3GA4A 2DJ2A 1F3BA 4IJ3A 4PURA 3APQA 3J7Yb 2AV4A 2RUFA 3RPPA 5F0GA 3LGCA 2DIZA 5H5RA 3MDKA 1ZYPA 2EIQA 3V1WA 1EP8A 3FW2A 3ZMKA 4EVMA 3R3EA 5J41A 4K0NA 1TTZA 4F0BA 1SK2A 3BOAA 2VD1A 4N0ZA 3A5WA 2MBSA 2QGVA 3HZ4A 1AAZA 2VCWA 3CTFA 2GT6A 2LRTA 2NVLA 2PN8A 2TRCP 3O6TA 4L5OA 2G2QA 3N9JA 1EOGA 4MPFA 4K7NA 4MLYA 1KEBA 1TKDB 3GL3A 1EEJA 5DAKA 2K9FA 3EINA 3TU3B 1X5EA 4TRXA 4WR4A 4AJ7A 4IQAA 1TRSA 2B5YA 4GSTA 4PUAA 3TJFA 16GSA 3MNGA 3F4SA 4G0LA 1VF1A 2I3YA 1HNBA 1DBYA 2JZSA 1ERUA 4MCUA 4WETA 2YWNA 5DALB 2X64A 2WS2A 2H6ZA 5HQPA 3HJMA 5GZZB 2RM6A 4Z2UA 4J56E 3HVNA 1U3IA 5IM9A 4NV5A 1YVLA 5AISA 3M1GA 5IMZA 3CMIA 4EO3A 2V41A 1M9BA 1XPVA 1YF0A 3RHBA 3HCZA 1NM3A 1Z3EA 1HD2A 3IRAA 3VWWA 2HFDA 5FWGA 4AGSA 2B5EA 2KUCA 3VK9A 3CTGA 3W6GA 3TUEA 1TJDA 1TU7A 4WF5A 3F9UA 2WJUA 1R5AA 3KZQA 2R3XA 1AUCA 3HY2A 4MF7A 4JE1A 1ERTA 4GSSA 2HI7A 3O76A 1FOHA 2H01A 3LWAA 4LMVA 2WFCA 2IL3A 1TXXA 5KN1A 3EURA 4PXOA 3GX0A 5EY6A 2IPAA 5G30A 5H5QA 1N2AA 4TR0A 8GSSA 2IMKA 4IHUA 4HOJA 1IYIA 4KA0A 4Q5QA 1SYRA 2CVKA 3HVVA 2OBIA 3TKSC 4HI7A 3ERFA 1SL0B 1AW9A 2JZRA 4GF0A 4XS4B 4F82A 4MF6A 2IFQB 3WGXA 3H93A 1QXHA 1X9MB 2J9HA 2HZFA 2DJJA 1LBKA 2OA7A 3LJRA 3M0FA 3H79A 5D73A 3ZL5A 3WYWA 3FKFA 3DXBA 4F9ZA 4PNGA 4JEDA 1WPIA 4YAVA 3DKSA 3RDWA 2K18A 3RGBC 4X4JA 3LXZA 1MTCA 4HS1A 1OVNA 3UIWA 1YKCA 5J4YA 3VWUA 4OMVA 3UJ1A 1K0AA 4RQXA 5L71A 3DRNA 3TOUA 2KOKA 5CRWA 2GDRA 3HKRA 1XCCA 1A0FA 1XG8A 2FLSA 4MJBA 3VI7A 4CDOA 1N25A 2JADA 4YAPA 2OE3A 5AIVA 1SK1A 3BD2A 1GLQA 2HRNA 3K8NA 5DQSA 3VWXA 2QC7A 2GSRA 4WEYA 2F51A 1M2DA 2YCDA 2GSTA 2H1BA 4I6XA 1QGVA 3KEBA 2H74A 3RFRC 1KBNA 3QMXA 4FXYP 5IMVA 1GUMA 3PINA 5GSTA 1FOVA 4LMWA 4HQSA 4PX1A 1B8XA 1GTUA 2DMMA 5D8IA 1YF1A 4G19A 4Q5NA 3RAZA 2X8GA 1O81A 19GSA 2NDOA 4QMKA 1OKDA 1PL1A 4IJIA 3I43A 2A2PA 2K6VA 2AJQB 4KDXA 1M99A 4IELA 1FG4A 5IO2A 1W4VA 4KH7A 4J57E 5HR3A 2ZCTA 2GQKA 1EOHA 3M8NA 5JCGA 1WOUA 1PX6A 2VUPA 4MABA 1QQ2A 4PQ1A 2YNXA 4XRDA 2EFCA 4RUVA 2B7KA 1F9MA 3C8EA 1T4YA 4KX4A 1IYHA 4EF0A 2X49A 4IP6A 2OADA 4LLRA 3C7MA 1XVWA 3ZFBA 3J7Yk 4TXOA 2GS3A 3HYPA 5IOWA 2B6MA 3KP8A 4EL1A 2YV9A 4K7OA 5B6MA 3C1RA 1XWBA 1I1IP 5JCUA 4CHSA 2MMZA 2LJAA 4ZB8A 1SYXA 2L6CA 2NPBA 2YP6A 1TDIA 1TRWA 1GSFA 2N5AA 2VLUA 5GAPD 3EYTA 2RLIA 2DJ3A 2WVXB 4AI6A 5J5NA 1HYUA 1GNEA 3WT1A
chains in the Genus database with same CATH topology
5DJLA 3GKMA 1ZMAA 4V2MA 1U3AA 4L5LA 2JL4A 4GQFA 1XW5A 3EPTA 3HMJG 2X99A 2VIMA 1BG5A 2LRCA 2H0IA 1OKTA 2M72A 5B8AA 2F8AA 1ZYQB 4JR4A 5CRHA 2KP1A 3F3RA 4ICYA 3E9JB 1T1VA 3GH9A 2GQLA 1KNGA 1XIYA 1TK0B 3P7XA 2EFDA 2CAQA 5C04A 3A2VA 1SKSB 2H75A 3F6FA 2CX4A 2L6DA 5G2ZA 1K0NA 3HJOA 1GRXA 1G6YA 5GAND 4OCEA 2IMEA 1G7OA 2ON5A 1F37A 1WIKA 5IPHA 3IC4A 3TKPA 1W89A 5EL8A 4ECBA 4HU7A 2HSMA 5D9WA 5A1NA 2C80A 2P0GA 2VCVA 1CQGA 6GSWA 3NZNA 1G0TA 4I8BA 2FWFA 3IA1A 3CRTA 1PL2A 3HZ8A 1GNWA 3ZLPA 3QAVA 3GKKA 4D73A 3IPZA 2H30A 2VL2A 4F2IA 4PQHA 3TOTA 3L4NA 1Z9HA 3TRQA 1SD8A 1T3BA 3GURA 4KB3A 1M0UA 3HDCA 3F4RA 4BVYA 1A24A 4EE0A 11GSA 5G1LA 3UEMA 1WMJA 1BG1A 1FB6A 2GLRA 4G0IA 3F3QA 4JRRA 4BA7A 1XVQA 1OC8A 1JHBA 4N3ZA 3HVXA 4HJ2A 2GQMA 3ERGA 1V40A 3CSJA 2G0FA 2F3MA 2LQQA 1YJ6A 3IAS2 4TOPA 4TN8A 1F6MC 3QFAC 2V6KA 1KTEA 5CREA 2XPDA 3TRXA 2CV4A 4NMUA 3D4TA 2H70A 3HA9A 1ZL9A 6GSTA 3FEUA 3A5IA 5KOWA 4IKHA 3HVSA 3ZVJA 3LXTA 4E8EA 3KCMA 5DCGA 2LNSA 1M2AA 1FW1A 4I2UA 3ZIVA 4GLTA 2R0GA 3A2XA 2AUVA 4V2NA 4G0KA 1GUKA 5D9TA 1PGTA 5DCHA 4TVEA 1GSUA 6GSUA 2LEGA 1X5DA 3DWVA 1UVZA 4HZ4A 1U88A 4MDCA 1YEXA 2C0EA 2KHPA 4HEA2 3ME8A 3U5RE 1O85A 3BCIA 5CAXA 2FA4A 4NXIA 4AF2A 1AXDA 2VL9A 2LJKA 2L5OA 2WDUA 5DDLA 1TI1A 1SJIA 3A3TA 1S3CA 4OWYA 1ZGNA 2VLTA 1XWCA 3VPQA 1K0BA 18GSA 1SJ6A 4USSA 2GGTA 4EDYA 3IK9A 5ECHB 3KGKA 4O5QA 2OBKA 2MMAA 5AIXA 5HFIA 3CBUA 1GSEA 4ML6A 1PSQA 2GZPA 4YQUA 2N5FA 2DMLA 4XTSA 4I2TA 5AGYA 2PVOC 5BRTA 3LFLA 2O87A 3GRXA 2H1AA 3KJYA 2H1GA 2YPMA 2R0CA 1RK4A 1Y6EA 1C72A 3FZ5A 4DSSB 4O32A 1XWGA 2HSYA 4AKXB 2I4AA 5ECMB 4YKFA 5HR1A 3EVIA 17GSA 2JACA 5E59A 3UVTA 1RQMA 2YV7A 4KW6A 1X9SB 5IMAA 4H86A 3DVXA 5C00A 6GSYA 1DSBA 5A5KA 5H5SA 5A34A 2CVBA 5J3RA 1ML6A 2L4CA 4NV2A 1JZRA 3VFIA 2WGRA 4TW5A 5ECIB 3FZ4A 2R2JA 3ZYWA 2KLXA 3ZIJA 4IS0A 1GSDA 1MDKA 5ID2A 3GTUA 4MZBA 3IE3A 4JZQA 2PERA 2HT9A 3CSHA 2HRFA 3GKNA 1HQOA 4G9HA 1TK5B 1K3YA 4N30A 1J9BA 2PUKC 2LQOA 2NBSA 4K2XA 1SL2B 3AY8A 2DJ0A 5B6NA 4AJ6A 1S3AA 2ZNMA 3IHQA 4KE3A 4NHZA 1OE8A 2DLXA 1Z5YE 4XS1A 3I9V2 1EP7A 5B7CA 1ZYEA 5CNWA 4MMMA 1K0CA 2LV3A 5G31A 2DJKA 3UVHA 4TXOB 6GSVA 3F6DA 3ZTLA 4ZILA 3MWHA 2ON7A 3ED3A 4ZL8A 2C4JA 1TU8A 5JWRB 2A4HA 1A0RP 2DJ1A 3IXRA 5IMCA 1T7PB 2C3QA 5J9CA 2H73A 4BL7A 4TR1A 4NWYA 2YOIA 2LRNA 5IPGA 2FHEA 1YQ1A 5D93A 3QPMA 2AAWA 5IMDA 3P90A 3P8WA 1GSSA 2HXKA 3KIJA 3PGTA 2HE3A 5EPFA 2GSQA 2HQTA 3FRCA 4DSSA 1SKRB 2XPEA 1A2LA 5CRGA 3SBCA 1U87A 3FR3A 1EGOA 4GQCA 3ZVJD 1X9WB 3N5OA 1TP9A 3M9JA 3FR6A 2FUG2 2GTUA 4YQMA 1QK8A 3CYNA 1BEDA 3GSTA 4AKGA 2L57A 4FYBA 5IOXA 1MDIA 2FA8A 2H72A 1GTBA 5J4UA 2GVPA 1R4WA 4I5QA 5BMUA 4MH3A 3L9UA 2DSAA 3A2WA 1Z7PA 3Q19A 1GSQA 2IIYA 3UARA 3DYRA 2DIYA 4KAEA 4MK3A 1HNCA 2BJXA 4KUNA 4Z7XA 3GHAA 1F3AA 4MZCA 4HDEA 4GXZA 5ECSA 1O8WA 2X8CA 2HSMB 3KTLA 2E7PA 1GUHA 5A1NB 2QA2A 4L8EA 3TB2A 4Z2RA 2CZ3A 2C0GA 4K8MA 1WP0A 3L9SA 4K9ZA 4QL9A 1FHEA 1OE7A 2PBJA 4IGJA 2P5RA 2HRKA 1X0RA 3EU3A 3H4KA 2J23A 1BAYA 1PN9A 3HHVA 4GRFA 3IOSA 4RI7A 2YWMA 4D73B 4ZBAA 1EEMA 3GMFA 4HQZA 5ECQB 4ZL7A 4KDUA 2I1UA 2YJ7A 3CSIA 13GSA 1K0MA 4BVYB 1THOA 2XC2A 1ERVA 2CX3A 3IDVA 1XXUA 2H8LA 4XS6A 3BCKA 1Q98A 2ES7A 2V32A 1OAZA 5HR2A 4ECCA 3FHKA 5F07A 3SWLA 1OC9A 2C8UA 5IQYA 4WR5A 3UAPA 4O92A 4XCSA 3KMOA 5FHIA 1GH2A 1XW6A 5CP1A 2YN1A 1J08A 1ST9A 4K7IA 4TKYA 4PNFA 2PU9C 9GSSA 3FY7A 4BVXA 4IBPA 4GCIA 1ABAA 3MIXA 4V1Ap 4X1UA 3H8QA 2UV8G 4K6XA 1N8JA 5ABRA 4Q5FA 1SD9A 2VCQA 5ECKB 1SL1B 3EMXA 3LYKA 1JZOA 3F63A 1FVKA 5KOXA 3H1NA 3KM6A 5D96A 5IMFA 2REMA 5HR0A 4K1FA 3DMLA 4ULXA 3TKQA 1WJKA 2FGXA 5DJMA 4X0XA 2O89A 2YZUA 3WGDA 4ZXGA 4MA9A 4POLA 1E6BA 2HRAA 2E0QA 4HUAA 3RPNA 2L59A 1M7TA 5B8BA 4ECJA 2TIRA 3MAKA 2V6OA 1FB0A 2RIIA 1YEPA 1A23A 4CW9A 4IVFA 2I9HA 5KN2A 3W8JA 4MZWA 4LL4B 1J0FA 3HXSA 1EZKA 2B5XA 1AC1A 4FIWA 3WD6A 3IAM2 5HFGA 2HSNA 2H66A 1T8EB 5AN1A 2VLVA 3ZZXA 4EIPA 5IIZA 1UN2A 3PPUA 3UBKA 3VURA 1A2JA 2M46A 3BBYA 1NHYA 1DUGA 3F4TA 4ECIA 4CY8A 1XWKA 4N10A 1WE0A 4G2EA 1BJXA 2DKIA 14GSA 4AJ8A 4WBRD 2WB9A 3NIVA 4KCAA 4O5UA 5A4UA 3LQ7A 3E3EA 5ELGA 4MJEA 1UC7A 3D5JA 4WKWA 1B48A 1RW1A 4MP4A 1I9DA 1OYJA 2LSTA 5J4VA 4WBJA 4JU5A 5CO3A 2HYXA 2O85A 2C3NA 2P31A 1I5GA 3TJBA 4Z2TA 4FQUA 3EMPA 2LJRA 2FD3A 1GULA 3QD9A 1WWJA 2WCIA 3TJKA 4FH8A 2IN3A 2O7KA 5A34B 1BQ7A 2VKZG 1GLPA 2VCTA 1Y25A 4LL1B 1BF5A 2P5QA 2L4QA 3L78A 5HFKA 2VAFA 2LS5A 1U6TA 5ID2B 2O8VB 3GTUB 2OE0A 3PR8A 1SU9A 1ACVA 4HU9A 2X8HA 4ZIJA 3G7JA 2BTOT 5JWQB 4GSNA 2WZ9A 5F05A 2H0HA 2IJYA 2M80A 2XHFA 4ZB7A 3P2AA 4V1Ag 3PH9A 4PQIA 2VCXA 5DBQA 1DE2A 1K3OA 3FZAA 4TXVA 1DE1A 3TKSA 4GWRA 2HLSA 2R0PA 3QDNA 1M2BA 1B4PA 1LU4A 1MD3A 1XFLA 1NHOA 2JU5A 1V9WA 4IQ1A 1Z7RA 2BMXA 2D2ZA 4FYCA 1G6WA 5JWOB 5INYA 1H75A 2VOCA 4YKGA 1ILOA 2JZTA 2MZCA 4KCEA 3LYPA 4E68A 4F0CA 1AQWA 2PWJA 1Q4JA 3VI5A 2CVDA 1Z6MA 5A5HA 4BL7B 3KTBA 4TR1B 2IMFA 2EIOA 3KD0A 1G7EA 1SVLA 5CRDA 1B9XC 4TR4A 1R5PA 1SKWB 2HZEA 1H4OA 3UBLA 3EC3A 1YZXA 5J40A 3E0UA 5EVOA 3IR4A 2OJLA 2MBTA 3CRUA 3LG6A 2FWHA 3JCML 2CAIA 1EV9A 4POKA 2VCZA 12GSA 4MPGA 1AQXA 1JZDA 4KNDA 4IW9A 2AHEA 2LUSA 2E2GA 4KF9A 2H6XA 4OD7A 1B9YC 2F9SA 1SJZA 2VL2C 5FT3A 2R37A 5DQYA 5A4VA 4IN0A 5BMUB 2A4VA 4NAXA 1EGRA 3KH7A 1PD21 3IK7A 2I81A 3ME7A 3QAGA 3GV1A 1XW9A 3IBHA 3GFKA 2DKHA 1GL8A 1EV4A 3I69A 4KSOA 3UOMA 4DVCA 4ZBDA 1PRXA 1O6JA 1TXUA 4L0UA 2O5VA 1XBSA 3ISOA 3L0HA 4RI6A 2HRKB 1B4QA 5CYYA 1GWCA 2X4AA 2HSHA 1PA3A 3VLNA 3C1SA 2YJHA 4X43A 4BWQA 4ZBBA 4CY6A 2K8SA 2E2MA 2B1KA 3I6AA 4ZB9A 3GIXA 3RBTA 3D4MA 1UA5A 2C1YA 2OACA 1EWXA 3O3TA 1XWAA 1GSYA 1V57A 1SENA 5ECNB 3CXGA 1JFUA 4EUYA 2B7JA 3LORA 4MF5A 2C0FA 1GTIA 4FO5A 1QUWA 3M9KA 4ZB6A 3RHCA 3HD5A 4XIHA 1S3DA 1PKWA 3KXOA 1QMVA 1TRVA 1AIUA 1OC9B 3HJPA 3GH6A 2R6KA 3G7IA 3TCOA 1USBA 4MJCA 2PGTA 1K0DA 1GP1A 2H0GA 3GX8A 4RQRA 2OT3A 1TOFA 4NHWA 1WRYA 3TJGA 4BVXB 2YANA 2GT5A 1M9AA 2JSYA 5G5FA 4WF4A 1FVJA 2DBCA 2LTKA 1MD4A 2EFHA 1ON4A 3FZ9A 10GSA 2VL3A 3GL5A 2A2RA 1A2MA 4EIQA 1Z6NA 5KN3A 1ZYNA 4L0WA 2AYTA 1PX7A 2H1DA 1K0OA 4MJAA 4OO4A 3ZFLA 1MDJA 4V2LA 1HNAA 3EE2A 4OCFA 4KDYA 4K2DA 1PMTA 4O7HA 2JSZA 5D9VA 5F06A 3TJJA 3KMNA 2H6YA 5A4WA 4JR6A 5F8BA 3G7YA 1F2EA 5LD0A 3GKXA 4YQVA 7GSSA 1V58A 5J9BA 2OKAA 2F8FA 2HSNB 3TRPA 3DD3A 1YY7A 1PQNA 2HNLA 1A8LA 3TDGA 5DALA 2H71A 4HJMA 3D0ZA 5JCWA 3US3A 1XZOA 4EDZA 1V98A 4N0VA 2GZYA 2QSIA 4POBA 1NSWA 4Q5RA 2C0DA 2VO4A 2R5GA 3Q18A 1FO5A 3M3MA 5G1KA 5ECLB 3S9FA 1YKAA 3Q6OA 2LNTA 2UZ8A 3LSZA 2YWOA 1R7HA 2EIRA 1NW2A 3D6IA 5LCZA 3MYDA 2B3SA 3TGZA 5ENUA 1A8YA 4J2FA 1SVMA 3VWVA 1O7UA 3GN3A 2TRXA 3L9VA 3DEXA 2RUEA 1K3LA 1TW9A 4PTSA 4OFNA 1XOBA 2VD0A 4ILFA 1MEKA 3ERWA 1JLVA 5LNKe 2VM2A 1BYEA 3GYKA 1QFNA 4DSRA 2FNOA 4XS4A 3D21A 3NOFA 2IFQA 4K5RA 4KGIA 2RM5A 4YH2A 1V2AA 2R4VA 3QCPA 1BX9A 2EFEA 4K0GA 2QKEA 3DVWA 2OE1A 2H19A 4TR3A 1OC3A 4OO5A 3ZITA 3KP9A 5DVBA 2EC4A 1LJRA 5ECPB 4QQ7A 3ZREA 1VGLA 5GSSA 5ECOB 3F0IA 2K8VA 4O5RA 2CA8A 4PUFC 1PN0A 3WT2A 3QR6A 1ZZYA 4QL7A 1ZCPA 3WGEA 4JBBA 4K5SA 2FWGA 2B1LA 2NTOA 3U6VA 3TKSE 4EXJA 3GNJA 2IMIA 3G9BA 4AKIA 2XBQA 1URMA 1JZWA 2N5BA 6GSXA 5A5HB 4XRAA 2AB6A 3CWGA 3LW9A 2A2SA 2CQ9A 2ZUPA 1O73A 2IWTA 2QA1A 2HZEB 3D22A 4WXTA 4EC0A 2L5LA 3OR5A 3ZMLA 1FAAA 1TRUA 2Z9SA 2GZZA 4I97A 3EWLA 3C71A 2LKUA 2CZ2A 3UL3A 2ALBA 3QAWA 1T00A 22GSA 4ISDA 3TKRA 2V2GA 1SVOA 2FWEA 1SK0A 1YDKA 1X5CA 3GUSA 2GSSA 2PPTA 5J47A 5G5EA 1T4ZA 4OFTA 3MSZA 1VRSD 4ID0A 3ZRDA 4POMA 3Q74A 3EU4A 4BPYA 5DAKB 4GDFA 4HZ2A 4DSQA 3FYGA 3DIEA 3GSSA 2IMDA 4ML1A 2MMNA 4F03A 2DC5A 1E2YA 2V1MA 3F8UA 2YWIA 5ECRB 3IHGA 3DGQA 4OFMA 20GSA 2MMOA 4G01A 2XBIA 1O8XA 1TI3A 4GTUA 1ZOFA 4EKZA 4LA1A 2H1LA 3LEFA 1ERWA 4G10A 4XHMA 4MNNA 2CT6A 3R2QA 5KEJA 2KP2A 1VF4A 4IP1A 2WULA 3APSA 2YZHA 3BJ5A 4DEJA 4MH2A 1GTAA 3UMAA 2WRTA 5ELAA 3QFBC 3KH9A 6GSSA 4ZL9A 1THXA 1JLWA 2C3TA 5IO0A 5E4WA 3IC8A 5D9XA 4W66A 3C73A 4AKHA 5KN0A 4BWSA 3FK8A 3APOA 3QOUA 4FYUA 1AQVA 4N11A 3W8SA 4ACSA 2FY6A 1VF2A 2PVQA 2MYGA 1PKZA 4P3YB 2VM1A 4E8HA 3IV4A 1CQHA 1Y1UA 3FMWA 2FCHA 4NPBA 1TK8B 3VPTA 2PMTA 4PGTA 3FR9A 1XOAA 5COHA 1R26A 1VF3A 4A5PA 4KSMA 2H76A 3GA4A 2DJ2A 1F3BA 4IJ3A 4PURA 3APQA 3J7Yb 2AV4A 2RUFA 3RPPA 5F0GA 3LGCA 2DIZA 5H5RA 3MDKA 1ZYPA 2EIQA 3V1WA 1EP8A 3FW2A 3ZMKA 4EVMA 3R3EA 5J41A 4K0NA 1TTZA 4F0BA 1SK2A 3BOAA 2VD1A 4N0ZA 3A5WA 2MBSA 2QGVA 3HZ4A 1AAZA 2VCWA 3CTFA 2GT6A 2LRTA 2NVLA 2PN8A 2TRCP 3O6TA 4L5OA 2G2QA 3N9JA 1EOGA 4MPFA 4K7NA 4MLYA 1KEBA 1TKDB 3GL3A 1EEJA 5DAKA 2K9FA 3EINA 3TU3B 1X5EA 4TRXA 4WR4A 4AJ7A 4IQAA 1TRSA 2B5YA 4GSTA 4PUAA 3TJFA 16GSA 3MNGA 3F4SA 4G0LA 1VF1A 2I3YA 1HNBA 1DBYA 2JZSA 1ERUA 4MCUA 4WETA 2YWNA 5DALB 2X64A 2WS2A 2H6ZA 5HQPA 3HJMA 5GZZB 2RM6A 4Z2UA 4J56E 1U3IA 5IM9A 4NV5A 1YVLA 5AISA 3M1GA 5IMZA 3CMIA 4EO3A 2V41A 1M9BA 1XPVA 1YF0A 3RHBA 3HCZA 1NM3A 1Z3EA 1HD2A 3IRAA 3VWWA 2HFDA 5FWGA 4AGSA 2B5EA 2KUCA 3VK9A 3CTGA 3W6GA 3TUEA 1TJDA 1TU7A 4WF5A 3F9UA 2WJUA 1R5AA 3KZQA 2R3XA 1AUCA 3HY2A 4MF7A 4JE1A 1ERTA 4GSSA 2HI7A 3O76A 1FOHA 2H01A 3LWAA 4LMVA 2WFCA 2IL3A 1TXXA 5KN1A 3EURA 4PXOA 3GX0A 5EY6A 2IPAA 5G30A 5H5QA 1N2AA 4TR0A 8GSSA 2IMKA 4IHUA 4HOJA 1IYIA 4KA0A 4Q5QA 1SYRA 2CVKA 3HVVA 2OBIA 3TKSC 4HI7A 3ERFA 1SL0B 1AW9A 2JZRA 4GF0A 4XS4B 4F82A 4MF6A 2IFQB 3WGXA 3H93A 1QXHA 1X9MB 2J9HA 2HZFA 2DJJA 1LBKA 2OA7A 3LJRA 3M0FA 3H79A 5D73A 3ZL5A 3WYWA 3FKFA 3DXBA 4F9ZA 4PNGA 4JEDA 1WPIA 4YAVA 3DKSA 3RDWA 2K18A 4X4JA 3LXZA 1MTCA 4HS1A 1OVNA 3UIWA 1YKCA 5J4YA 3VWUA 4OMVA 3UJ1A 1K0AA 4RQXA 5L71A 3DRNA 3TOUA 2KOKA 5CRWA 2GDRA 3HKRA 1XCCA 1A0FA 2FLSA 4MJBA 3VI7A 4CDOA 1N25A 2JADA 4YAPA 2OE3A 5AIVA 1SK1A 3BD2A 1GLQA 2HRNA 3K8NA 5DQSA 3VWXA 2QC7A 2GSRA 4WEYA 2F51A 1M2DA 2YCDA 2GSTA 2H1BA 4I6XA 1QGVA 3KEBA 2H74A 1KBNA 3QMXA 5IMVA 1GUMA 3PINA 5GSTA 1FOVA 4LMWA 4HQSA 4PX1A 1B8XA 1GTUA 2DMMA 5D8IA 1YF1A 4G19A 4Q5NA 3RAZA 2X8GA 1O81A 19GSA 2NDOA 4QMKA 1OKDA 1PL1A 4IJIA 3I43A 2A2PA 2K6VA 2AJQB 4KDXA 1M99A 4IELA 1FG4A 5IO2A 1W4VA 4KH7A 4J57E 5HR3A 2ZCTA 2GQKA 1EOHA 3M8NA 5JCGA 1WOUA 1PX6A 2VUPA 4MABA 1QQ2A 4PQ1A 2YNXA 4XRDA 2EFCA 4RUVA 2B7KA 1F9MA 3C8EA 1T4YA 4KX4A 1IYHA 4EF0A 2X49A 4IP6A 2OADA 4LLRA 3C7MA 1XVWA 3ZFBA 3J7Yk 4TXOA 2GS3A 3HYPA 5IOWA 2B6MA 3KP8A 4EL1A 2YV9A 4K7OA 5B6MA 3C1RA 1XWBA 5JCUA 4CHSA 2MMZA 2LJAA 4ZB8A 1SYXA 2L6CA 2NPBA 2YP6A 1TDIA 1TRWA 1GSFA 2N5AA 2VLUA 5GAPD 3EYTA 2RLIA 2DJ3A 4AI6A 5J5NA 1HYUA 1GNEA 3WT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DJL A;  3GKM A;  1ZMA A;  4V2M A;  1U3A A;  4L5L A;  2JL4 A;  4GQF A;  1XW5 A;  2X99 A;  2VIM A;  1BG5 A;  2LRC A;  2H0I A;  1OKT A;  2M72 A;  5B8A A;  2F8A A;  1ZYQ B;  4JR4 A;  5CRH A;  2KP1 A;  3F3R A;  3E9J B;  1T1V A;  3GH9 A;  2GQL A;  1KNG A;  1XIY A;  1TK0 B;  3P7X A;  2CAQ A;  5C04 A;  3A2V A;  1SKS B;  2H75 A;  3F6F A;  2CX4 A;  2L6D A;  5G2Z A;  1K0N A;  3HJO A;  1GRX A;  1G6Y A;  5GAN D;  4OCE A;  2IME A;  1G7O A;  2ON5 A;  1F37 A;  1WIK A;  5IPH A;  3IC4 A;  3TKP A;  1W89 A;  5EL8 A;  4ECB A;  4HU7 A;  2HSM A;  5D9W A;  2C80 A;  2P0G A;  2VCV A;  1CQG A;  6GSW A;  3NZN A;  1G0T A;  4I8B A;  2FWF A;  3IA1 A;  3CRT A;  1PL2 A;  3HZ8 A;  1GNW A;  3ZLP A;  3QAV A;  3GKK A;  4D73 A;  3IPZ A;  2H30 A;  2VL2 A;  4F2I A;  4PQH A;  3TOT A;  3L4N A;  1Z9H A;  3TRQ A;  1SD8 A;  1T3B A;  3GUR A;  4KB3 A;  1M0U A;  3HDC A;  3F4R A;  4BVY A;  1A24 A;  4EE0 A;  11GS A;  5G1L A;  3UEM A;  1WMJ A;  1FB6 A;  2GLR A;  4G0I A;  3F3Q A;  4JRR A;  4BA7 A;  1XVQ A;  1OC8 A;  1JHB A;  3HVX A;  4HJ2 A;  2GQM A;  3ERG A;  1V40 A;  3CSJ A;  2G0F A;  2F3M A;  2LQQ A;  1YJ6 A;  3IAS 2;  4TOP A;  4TN8 A;  1F6M C;  3QFA C;  2V6K A;  1KTE A;  5CRE A;  2XPD A;  3TRX A;  2CV4 A;  4NMU A;  3D4T A;  2H70 A;  3HA9 A;  1ZL9 A;  6GST A;  3FEU A;  4IKH A;  3HVS A;  3ZVJ A;  3LXT A;  4E8E A;  3KCM A;  5DCG A;  2LNS A;  1M2A A;  1FW1 A;  4I2U A;  3ZIV A;  4GLT A;  3A2X A;  2AUV A;  4V2N A;  4G0K A;  1GUK A;  5D9T A;  1PGT A;  5DCH A;  4TVE A;  1GSU A;  6GSU A;  2LEG A;  1X5D A;  3DWV A;  1UVZ A;  4HZ4 A;  1U88 A;  4MDC A;  1YEX A;  2C0E A;  2KHP A;  4HEA 2;  3ME8 A;  3U5R E;  1O85 A;  3BCI A;  5CAX A;  2FA4 A;  4NXI A;  4AF2 A;  1AXD A;  2VL9 A;  2LJK A;  2L5O A;  2WDU A;  5DDL A;  1TI1 A;  1SJI A;  3A3T A;  1S3C A;  4OWY A;  1ZGN A;  2VLT A;  1XWC A;  3VPQ A;  1K0B A;  18GS A;  1SJ6 A;  4USS A;  2GGT A;  4EDY A;  3IK9 A;  5ECH B;  3KGK A;  2OBK A;  2MMA A;  5AIX A;  5HFI A;  3CBU A;  1GSE A;  4ML6 A;  1PSQ A;  2GZP A;  4YQU A;  2N5F A;  2DML A;  4XTS A;  4I2T A;  5AGY A;  2PVO C;  3LFL A;  2O87 A;  3GRX A;  2H1A A;  3KJY A;  2H1G A;  2YPM A;  1RK4 A;  1Y6E A;  1C72 A;  3FZ5 A;  4DSS B;  4O32 A;  1XWG A;  2HSY A;  2I4A A;  5ECM B;  5HR1 A;  3EVI A;  17GS A;  2JAC A;  5E59 A;  3UVT A;  1RQM A;  2YV7 A;  4KW6 A;  1X9S B;  5IMA A;  4H86 A;  3DVX A;  5C00 A;  6GSY A;  1DSB A;  5A5K A;  5H5S A;  2CVB A;  5J3R A;  1ML6 A;  2L4C A;  4NV2 A;  1JZR A;  3VFI A;  2WGR A;  4TW5 A;  5ECI B;  3FZ4 A;  2R2J A;  3ZYW A;  2KLX A;  3ZIJ A;  4IS0 A;  1GSD A;  1MDK A;  5ID2 A;  3GTU A;  4MZB A;  3IE3 A;  4JZQ A;  2PER A;  2HT9 A;  3CSH A;  2HRF A;  3GKN A;  1HQO A;  4G9H A;  1TK5 B;  1K3Y A;  4N30 A;  1J9B A;  2PUK C;  2LQO A;  2NBS A;  1SL2 B;  3AY8 A;  2DJ0 A;  5B6N A;  4AJ6 A;  1S3A A;  2ZNM A;  3IHQ A;  4KE3 A;  4NHZ A;  1OE8 A;  2DLX A;  1Z5Y E;  4XS1 A;  3I9V 2;  1EP7 A;  5B7C A;  1ZYE A;  5CNW A;  4MMM A;  1K0C A;  2LV3 A;  5G31 A;  2DJK A;  3UVH A;  4TXO B;  6GSV A;  3F6D A;  3ZTL A;  4ZIL A;  3MWH A;  2ON7 A;  3ED3 A;  4ZL8 A;  2C4J A;  1TU8 A;  5JWR B;  1A0R P;  2DJ1 A;  3IXR A;  5IMC A;  1T7P B;  2C3Q A;  5J9C A;  2H73 A;  4BL7 A;  4TR1 A;  4NWY A;  2YOI A;  2LRN A;  5IPG A;  2FHE A;  1YQ1 A;  5D93 A;  3QPM A;  2AAW A;  5IMD A;  3P90 A;  3P8W A;  1GSS A;  2HXK A;  3KIJ A;  3PGT A;  2HE3 A;  5EPF A;  2GSQ A;  2HQT A;  3FRC A;  4DSS A;  1SKR B;  2XPE A;  1A2L A;  5CRG A;  3SBC A;  1U87 A;  3FR3 A;  1EGO A;  4GQC A;  3ZVJ D;  1X9W B;  3N5O A;  1TP9 A;  3M9J A;  3FR6 A;  2FUG 2;  2GTU A;  4YQM A;  1QK8 A;  3CYN A;  1BED A;  3GST A;  2L57 A;  4FYB A;  5IOX A;  1MDI A;  2FA8 A;  2H72 A;  1GTB A;  5J4U A;  2GVP A;  1R4W A;  4I5Q A;  5BMU A;  4MH3 A;  3L9U A;  2DSA A;  3A2W A;  1Z7P A;  3Q19 A;  1GSQ A;  2IIY A;  3UAR A;  3DYR A;  2DIY A;  4KAE A;  4MK3 A;  1HNC A;  2BJX A;  4KUN A;  4Z7X A;  3GHA A;  1F3A A;  4MZC A;  4HDE A;  4GXZ A;  5ECS A;  1O8W A;  2X8C A;  2HSM B;  3KTL A;  2E7P A;  1GUH A;  4L8E A;  3TB2 A;  2CZ3 A;  2C0G A;  4K8M A;  1WP0 A;  3L9S A;  4K9Z A;  4QL9 A;  1FHE A;  1OE7 A;  2PBJ A;  4IGJ A;  2P5R A;  2HRK A;  1X0R A;  3EU3 A;  3H4K A;  2J23 A;  1BAY A;  1PN9 A;  3HHV A;  4GRF A;  3IOS A;  4RI7 A;  2YWM A;  4D73 B;  4ZBA A;  1EEM A;  3GMF A;  4HQZ A;  5ECQ B;  4ZL7 A;  4KDU A;  2I1U A;  2YJ7 A;  3CSI A;  13GS A;  1K0M A;  4BVY B;  1THO A;  2XC2 A;  1ERV A;  2CX3 A;  3IDV A;  1XXU A;  2H8L A;  4XS6 A;  3BCK A;  1Q98 A;  2ES7 A;  2V32 A;  1OAZ A;  5HR2 A;  4ECC A;  3FHK A;  5F07 A;  3SWL A;  1OC9 A;  2C8U A;  5IQY A;  4WR5 A;  3UAP A;  4O92 A;  4XCS A;  3KMO A;  5FHI A;  1GH2 A;  1XW6 A;  5CP1 A;  2YN1 A;  1J08 A;  1ST9 A;  4K7I A;  4TKY A;  4PNF A;  2PU9 C;  9GSS A;  3FY7 A;  4BVX A;  4IBP A;  4GCI A;  1ABA A;  4V1A p;  4X1U A;  3H8Q A;  4K6X A;  1N8J A;  5ABR A;  4Q5F A;  1SD9 A;  2VCQ A;  5ECK B;  1SL1 B;  3EMX A;  3LYK A;  1JZO A;  3F63 A;  1FVK A;  3H1N A;  3KM6 A;  5D96 A;  5IMF A;  2REM A;  5HR0 A;  4K1F A;  3DML A;  4ULX A;  3TKQ A;  1WJK A;  2FGX A;  5DJM A;  4X0X A;  2O89 A;  2YZU A;  3WGD A;  4ZXG A;  4MA9 A;  4POL A;  1E6B A;  2HRA A;  2E0Q A;  4HUA A;  3RPN A;  2L59 A;  1M7T A;  5B8B A;  4ECJ A;  2TIR A;  3MAK A;  2V6O A;  1FB0 A;  2RII A;  1YEP A;  1A23 A;  4CW9 A;  4IVF A;  2I9H A;  5KN2 A;  3W8J A;  4MZW A;  4LL4 B;  1J0F A;  3HXS A;  1EZK A;  2B5X A;  1AC1 A;  4FIW A;  3WD6 A;  3IAM 2;  5HFG A;  2H66 A;  1T8E B;  5AN1 A;  2VLV A;  3ZZX A;  5IIZ A;  1UN2 A;  3PPU A;  3UBK A;  3VUR A;  1A2J A;  2M46 A;  3BBY A;  1NHY A;  1DUG A;  3F4T A;  4ECI A;  1XWK A;  4N10 A;  1WE0 A;  4G2E A;  1BJX A;  14GS A;  4AJ8 A;  4WBR D;  2WB9 A;  3NIV A;  4KCA A;  5A4U A;  3LQ7 A;  3E3E A;  5ELG A;  4MJE A;  1UC7 A;  3D5J A;  4WKW A;  1B48 A;  1RW1 A;  4MP4 A;  1I9D A;  1OYJ A;  2LST A;  4WBJ A;  4JU5 A;  5CO3 A;  2HYX A;  2O85 A;  2C3N A;  2P31 A;  1I5G A;  3TJB A;  4FQU A;  3EMP A;  2LJR A;  2FD3 A;  1GUL A;  3QD9 A;  1WWJ A;  2WCI A;  3TJK A;  4FH8 A;  2IN3 A;  2O7K A;  1BQ7 A;  1GLP A;  2VCT A;  1Y25 A;  4LL1 B;  2P5Q A;  2L4Q A;  3L78 A;  5HFK A;  2VAF A;  2LS5 A;  1U6T A;  5ID2 B;  2O8V B;  3GTU B;  2OE0 A;  3PR8 A;  1SU9 A;  1ACV A;  4HU9 A;  2X8H A;  4ZIJ A;  3G7J A;  2BTO T;  5JWQ B;  4GSN A;  2WZ9 A;  5F05 A;  2H0H A;  2IJY A;  2M80 A;  2XHF A;  3P2A A;  4V1A g;  3PH9 A;  4PQI A;  2VCX A;  5DBQ A;  1DE2 A;  1K3O A;  3FZA A;  4TXV A;  1DE1 A;  3TKS A;  4GWR A;  2HLS A;  3QDN A;  1M2B A;  1B4P A;  1LU4 A;  1MD3 A;  1XFL A;  1NHO A;  2JU5 A;  1V9W A;  4IQ1 A;  1Z7R A;  2BMX A;  2D2Z A;  4FYC A;  1G6W A;  5JWO B;  5INY A;  1H75 A;  2VOC A;  1ILO A;  2JZT A;  2MZC A;  4KCE A;  3LYP A;  4F0C A;  1AQW A;  2PWJ A;  1Q4J A;  3VI5 A;  2CVD A;  1Z6M A;  4BL7 B;  3KTB A;  4TR1 B;  2IMF A;  2EIO A;  3KD0 A;  1G7E A;  5CRD A;  1B9X C;  4TR4 A;  1R5P A;  1SKW B;  2HZE A;  1H4O A;  3UBL A;  3EC3 A;  1YZX A;  3E0U A;  5EVO A;  3IR4 A;  2OJL A;  2MBT A;  3CRU A;  3LG6 A;  2FWH A;  3JCM L;  2CAI A;  1EV9 A;  4POK A;  2VCZ A;  12GS A;  4MPG A;  1AQX A;  1JZD A;  4KND A;  4IW9 A;  2AHE A;  2LUS A;  2E2G A;  4KF9 A;  2H6X A;  4OD7 A;  1B9Y C;  2F9S A;  1SJZ A;  2VL2 C;  5FT3 A;  2R37 A;  5DQY A;  5A4V A;  4IN0 A;  2A4V A;  4NAX A;  1EGR A;  3KH7 A;  1PD2 1;  3IK7 A;  2I81 A;  3ME7 A;  3QAG A;  3GV1 A;  1XW9 A;  3IBH A;  3GFK A;  1GL8 A;  1EV4 A;  3I69 A;  4KSO A;  3UOM A;  4DVC A;  4ZBD A;  1PRX A;  1O6J A;  4L0U A;  1XBS A;  3ISO A;  3L0H A;  4RI6 A;  2HRK B;  1B4Q A;  5CYY A;  1GWC A;  2HSH A;  1PA3 A;  3VLN A;  3C1S A;  2YJH A;  4X43 A;  4BWQ A;  4ZBB A;  2K8S A;  2E2M A;  2B1K A;  3I6A A;  4ZB9 A;  3GIX A;  3RBT A;  3D4M A;  1UA5 A;  2C1Y A;  2OAC A;  1EWX A;  3O3T A;  1XWA A;  1GSY A;  1V57 A;  1SEN A;  5ECN B;  3CXG A;  1JFU A;  4EUY A;  2B7J A;  3LOR A;  4MF5 A;  2C0F A;  1GTI A;  4FO5 A;  1QUW A;  3M9K A;  4ZB6 A;  3RHC A;  3HD5 A;  4XIH A;  1S3D A;  1PKW A;  3KXO A;  1QMV A;  1TRV A;  1AIU A;  1OC9 B;  3HJP A;  3GH6 A;  2R6K A;  3G7I A;  3TCO A;  1USB A;  4MJC A;  2PGT A;  1K0D A;  1GP1 A;  2H0G A;  3GX8 A;  4RQR A;  1TOF A;  4NHW A;  1WRY A;  3TJG A;  4BVX B;  2YAN A;  2GT5 A;  1M9A A;  2JSY A;  5G5F A;  4WF4 A;  1FVJ A;  2DBC A;  2LTK A;  1MD4 A;  1ON4 A;  3FZ9 A;  10GS A;  2VL3 A;  3GL5 A;  2A2R A;  1A2M A;  1Z6N A;  5KN3 A;  4L0W A;  2AYT A;  1PX7 A;  2H1D A;  1K0O A;  4MJA A;  4OO4 A;  3ZFL A;  1MDJ A;  4V2L A;  1HNA A;  3EE2 A;  4OCF A;  4KDY A;  4K2D A;  1PMT A;  4O7H A;  2JSZ A;  5D9V A;  5F06 A;  3TJJ A;  3KMN A;  2H6Y A;  5A4W A;  4JR6 A;  5F8B A;  3G7Y A;  1F2E A;  5LD0 A;  3GKX A;  4YQV A;  7GSS A;  1V58 A;  5J9B A;  2OKA A;  2F8F A;  2HSN B;  3TRP A;  3DD3 A;  1YY7 A;  1PQN A;  2HNL A;  1A8L A;  3TDG A;  5DAL A;  2H71 A;  4HJM A;  3D0Z A;  5JCW A;  3US3 A;  1XZO A;  4EDZ A;  1V98 A;  4N0V A;  2GZY A;  2QSI A;  4POB A;  1NSW A;  4Q5R A;  2C0D A;  2VO4 A;  2R5G A;  3Q18 A;  1FO5 A;  3M3M A;  5G1K A;  5ECL B;  3S9F A;  1YKA A;  3Q6O A;  2LNT A;  2UZ8 A;  3LSZ A;  2YWO A;  1R7H A;  2EIR A;  1NW2 A;  3D6I A;  5LCZ A;  2B3S A;  3TGZ A;  5ENU A;  1A8Y A;  4J2F A;  3VWV A;  1O7U A;  3GN3 A;  2TRX A;  3L9V A;  3DEX A;  2RUE A;  1K3L A;  1TW9 A;  4PTS A;  4OFN A;  1XOB A;  2VD0 A;  4ILF A;  1MEK A;  3ERW A;  1JLV A;  5LNK e;  2VM2 A;  1BYE A;  3GYK A;  1QFN A;  4DSR A;  2FNO A;  4XS4 A;  3D21 A;  3NOF A;  2IFQ A;  4KGI A;  2RM5 A;  4YH2 A;  1V2A A;  2R4V A;  3QCP A;  1BX9 A;  4K0G A;  2QKE A;  3DVW A;  2OE1 A;  2H19 A;  4TR3 A;  1OC3 A;  4OO5 A;  3ZIT A;  3KP9 A;  5DVB A;  2EC4 A;  1LJR A;  5ECP B;  4QQ7 A;  3ZRE A;  1VGL A;  5GSS A;  5ECO B;  3F0I A;  2K8V A;  4O5R A;  2CA8 A;  4PUF C;  3WT2 A;  3QR6 A;  1ZZY A;  4QL7 A;  1ZCP A;  3WGE A;  4JBB A;  2FWG A;  2B1L A;  2NTO A;  3U6V A;  3TKS E;  4EXJ A;  3GNJ A;  2IMI A;  3G9B A;  2XBQ A;  1URM A;  1JZW A;  2N5B A;  6GSX A;  4XRA A;  2AB6 A;  2A2S A;  2CQ9 A;  2ZUP A;  1O73 A;  2IWT A;  2HZE B;  3D22 A;  4WXT A;  4EC0 A;  2L5L A;  3OR5 A;  3ZML A;  1FAA A;  1TRU A;  2GZZ A;  2Z9S A;  4I97 A;  3EWL A;  3C71 A;  2LKU A;  2CZ2 A;  3UL3 A;  2ALB A;  3QAW A;  1T00 A;  22GS A;  4ISD A;  3TKR A;  2V2G A;  2FWE A;  1SK0 A;  1YDK A;  1X5C A;  3GUS A;  2GSS A;  2PPT A;  5G5E A;  1T4Z A;  4OFT A;  3MSZ A;  1VRS D;  4ID0 A;  3ZRD A;  4POM A;  3Q74 A;  3EU4 A;  4BPY A;  5DAK B;  4HZ2 A;  4DSQ A;  3FYG A;  3DIE A;  3GSS A;  2IMD A;  4ML1 A;  2MMN A;  4F03 A;  2DC5 A;  1E2Y A;  2V1M A;  3F8U A;  2YWI A;  5ECR B;  3DGQ A;  4OFM A;  20GS A;  2MMO A;  2XBI A;  1O8X A;  1TI3 A;  4GTU A;  1ZOF A;  4EKZ A;  4LA1 A;  3LEF A;  1ERW A;  4G10 A;  4XHM A;  2CT6 A;  3R2Q A;  5KEJ A;  2KP2 A;  1VF4 A;  4IP1 A;  2WUL A;  3APS A;  2YZH A;  3BJ5 A;  4DEJ A;  4MH2 A;  1GTA A;  3UMA A;  2WRT A;  5ELA A;  3QFB C;  3KH9 A;  6GSS A;  4ZL9 A;  1THX A;  1JLW A;  2C3T A;  5IO0 A;  5E4W A;  3IC8 A;  5D9X A;  3C73 A;  5KN0 A;  4BWS A;  3FK8 A;  3APO A;  3QOU A;  4FYU A;  1AQV A;  4N11 A;  3W8S A;  4ACS A;  2FY6 A;  1VF2 A;  2PVQ A;  2MYG A;  1PKZ A;  4P3Y B;  2VM1 A;  4E8H A;  3IV4 A;  1CQH A;  2FCH A;  4NPB A;  1TK8 B;  3VPT A;  2PMT A;  4PGT A;  3FR9 A;  1XOA A;  5COH A;  1R26 A;  1VF3 A;  4KSM A;  2H76 A;  3GA4 A;  2DJ2 A;  1F3B A;  4IJ3 A;  4PUR A;  3APQ A;  3J7Y b;  2AV4 A;  2RUF A;  3RPP A;  5F0G A;  3LGC A;  2DIZ A;  5H5R A;  3MDK A;  2EIQ A;  3V1W A;  1EP8 A;  3FW2 A;  3ZMK A;  4EVM A;  3R3E A;  5J41 A;  4K0N A;  1TTZ A;  4F0B A;  1SK2 A;  3BOA A;  2VD1 A;  4N0Z A;  3A5W A;  2MBS A;  2QGV A;  3HZ4 A;  1AAZ A;  2VCW A;  3CTF A;  2GT6 A;  2LRT A;  2NVL A;  2PN8 A;  2TRC P;  3O6T A;  4L5O A;  2G2Q A;  3N9J A;  1EOG A;  4MPF A;  4K7N A;  4MLY A;  1KEB A;  1TKD B;  3GL3 A;  1EEJ A;  5DAK A;  2K9F A;  3EIN A;  1X5E A;  4TRX A;  4WR4 A;  4AJ7 A;  4IQA A;  1TRS A;  2B5Y A;  4GST A;  4PUA A;  3TJF A;  16GS A;  3MNG A;  3F4S A;  4G0L A;  1VF1 A;  2I3Y A;  1HNB A;  1DBY A;  2JZS A;  1ERU A;  4MCU A;  4WET A;  2YWN A;  5DAL B;  2X64 A;  2WS2 A;  2H6Z A;  5HQP A;  3HJM A;  5GZZ B;  2RM6 A;  4J56 E;  1U3I A;  5IM9 A;  4NV5 A;  5AIS A;  3M1G A;  5IMZ A;  3CMI A;  4EO3 A;  2V41 A;  1M9B A;  1XPV A;  1YF0 A;  3RHB A;  3HCZ A;  1NM3 A;  1Z3E A;  1HD2 A;  3IRA A;  3VWW A;  2HFD A;  5FWG A;  4AGS A;  2B5E A;  2KUC A;  3VK9 A;  3CTG A;  3W6G A;  3TUE A;  1TJD A;  1TU7 A;  4WF5 A;  3F9U A;  2WJU A;  1R5A A;  3KZQ A;  2R3X A;  1AUC A;  3HY2 A;  4MF7 A;  4JE1 A;  1ERT A;  4GSS A;  2HI7 A;  3O76 A;  2H01 A;  3LWA A;  4LMV A;  2WFC A;  2IL3 A;  1TXX A;  5KN1 A;  3EUR A;  4PXO A;  3GX0 A;  5EY6 A;  2IPA A;  5G30 A;  5H5Q A;  1N2A A;  4TR0 A;  8GSS A;  2IMK A;  4IHU A;  4HOJ A;  1IYI A;  4KA0 A;  4Q5Q A;  1SYR A;  2CVK A;  3HVV A;  2OBI A;  3TKS C;  4HI7 A;  3ERF A;  1SL0 B;  1AW9 A;  2JZR A;  4GF0 A;  4XS4 B;  4F82 A;  4MF6 A;  2IFQ B;  3WGX A;  3H93 A;  1QXH A;  1X9M B;  2J9H A;  2HZF A;  2DJJ A;  1LBK A;  2OA7 A;  3LJR A;  3M0F A;  3H79 A;  5D73 A;  3ZL5 A;  3WYW A;  3FKF A;  3DXB A;  4F9Z A;  4PNG A;  4JED A;  1WPI A;  4YAV A;  3DKS A;  3RDW A;  2K18 A;  3LXZ A;  1MTC A;  4HS1 A;  1OVN A;  3UIW A;  1YKC A;  3VWU A;  4OMV A;  3UJ1 A;  1K0A A;  4RQX A;  5L71 A;  3DRN A;  3TOU A;  2KOK A;  5CRW A;  2GDR A;  3HKR A;  1XCC A;  1A0F A;  2FLS A;  4MJB A;  3VI7 A;  4CDO A;  2JAD A;  4YAP A;  2OE3 A;  5AIV A;  1SK1 A;  3BD2 A;  1GLQ A;  2HRN A;  3K8N A;  5DQS A;  3VWX A;  2QC7 A;  2GSR A;  4WEY A;  2F51 A;  1M2D A;  2YCD A;  2GST A;  2H1B A;  4I6X A;  1QGV A;  3KEB A;  2H74 A;  1KBN A;  3QMX A;  5IMV A;  1GUM A;  3PIN A;  5GST A;  1FOV A;  4LMW A;  4HQS A;  4PX1 A;  1B8X A;  1GTU A;  2DMM A;  5D8I A;  1YF1 A;  4G19 A;  4Q5N A;  3RAZ A;  2X8G A;  1O81 A;  19GS A;  2NDO A;  1OKD A;  1PL1 A;  4IJI A;  3I43 A;  2K6V A;  2AJQ B;  4KDX A;  1M99 A;  4IEL A;  1FG4 A;  5IO2 A;  1W4V A;  4KH7 A;  4J57 E;  5HR3 A;  2ZCT A;  2GQK A;  1EOH A;  3M8N A;  5JCG A;  1WOU A;  1PX6 A;  2VUP A;  4MAB A;  1QQ2 A;  4PQ1 A;  2YNX A;  4XRD A;  4RUV A;  2B7K A;  1F9M A;  3C8E A;  1T4Y A;  4KX4 A;  1IYH A;  4EF0 A;  4IP6 A;  2OAD A;  4LLR A;  3C7M A;  1XVW A;  3ZFB A;  3J7Y k;  4TXO A;  2GS3 A;  3HYP A;  5IOW A;  2B6M A;  3KP8 A;  4EL1 A;  2YV9 A;  4K7O A;  5B6M A;  3C1R A;  1XWB A;  5JCU A;  4CHS A;  2MMZ A;  2LJA A;  4ZB8 A;  1SYX A;  2L6C A;  2NPB A;  2YP6 A;  1TDI A;  1TRW A;  1GSF A;  2N5A A;  2VLU A;  5GAP D;  3EYT A;  2RLI A;  2DJ3 A;  5J5N A;  1HYU A;  1GNE A;  3WT1 A; 
#chains in the Genus database with same CATH topology
 5DJL A;  3GKM A;  1ZMA A;  2WW3 A;  4V2M A;  1U3A A;  4L5L A;  2JL4 A;  4GQF A;  1XW5 A;  3EPT A;  3HMJ G;  2X99 A;  2VIM A;  1BG5 A;  2LRC A;  2H0I A;  1OKT A;  2M72 A;  5B8A A;  2F8A A;  1ZYQ B;  4JR4 A;  5CRH A;  2KP1 A;  3F3R A;  4ICY A;  3E9J B;  1T1V A;  3GH9 A;  2GQL A;  1KNG A;  1XIY A;  1TK0 B;  3P7X A;  2EFD A;  2CAQ A;  5C04 A;  3A2V A;  1SKS B;  4PHZ C;  2H75 A;  3F6F A;  2CX4 A;  2L6D A;  5G2Z A;  1K0N A;  3HJO A;  1GRX A;  1G6Y A;  5GAN D;  4OCE A;  1S3R A;  2IME A;  1G7O A;  2ON5 A;  1F37 A;  1WIK A;  5IPH A;  3IC4 A;  3TKP A;  1W89 A;  5EL8 A;  4ECB A;  4HU7 A;  2HSM A;  5D9W A;  5A1N A;  2C80 A;  2P0G A;  2VCV A;  1CQG A;  6GSW A;  3NZN A;  1G0T A;  4I8B A;  2FWF A;  3IA1 A;  3CRT A;  1PL2 A;  3HZ8 A;  1GNW A;  3ZLP A;  3QAV A;  3GKK A;  4D73 A;  3IPZ A;  2H30 A;  2VL2 A;  4F2I A;  4PQH A;  3TOT A;  3L4N A;  1Z9H A;  3TRQ A;  1SD8 A;  1T3B A;  3GUR A;  4KB3 A;  1M0U A;  3HDC A;  3F4R A;  4BVY A;  1A24 A;  4EE0 A;  11GS A;  5G1L A;  3UEM A;  1WMJ A;  1BG1 A;  1FB6 A;  2GLR A;  2WW1 A;  4G0I A;  3F3Q A;  4JRR A;  4BA7 A;  1XVQ A;  1OC8 A;  1JHB A;  4N3Z A;  3HVX A;  4HJ2 A;  2GQM A;  3ERG A;  1V40 A;  3CSJ A;  2G0F A;  2F3M A;  2LQQ A;  1YJ6 A;  3IAS 2;  4TOP A;  4TN8 A;  1F6M C;  3QFA C;  2V6K A;  1KTE A;  5CRE A;  2XPD A;  3TRX A;  2CV4 A;  4NMU A;  3D4T A;  2H70 A;  3HA9 A;  1ZL9 A;  6GST A;  3FEU A;  1M3J A;  3A5I A;  3CQF A;  5KOW A;  4IKH A;  3HVS A;  3ZVJ A;  3LXT A;  4E8E A;  3KCM A;  5DCG A;  2LNS A;  1M2A A;  1FW1 A;  4I2U A;  3ZIV A;  4GLT A;  2R0G A;  3A2X A;  2AUV A;  4V2N A;  4G0K A;  1GUK A;  5D9T A;  1PGT A;  5DCH A;  4TVE A;  1GSU A;  6GSU A;  4PI2 C;  2LEG A;  1X5D A;  3DWV A;  1UVZ A;  4HZ4 A;  1U88 A;  4MDC A;  1YEX A;  2C0E A;  2KHP A;  4HEA 2;  3ME8 A;  3U5R E;  1O85 A;  3BCI A;  5CAX A;  2FA4 A;  4NXI A;  4AF2 A;  1AXD A;  2VL9 A;  2LJK A;  2L5O A;  2WDU A;  5DDL A;  1TI1 A;  1SJI A;  3A3T A;  1S3C A;  4OWY A;  1ZGN A;  2VLT A;  1XWC A;  3VPQ A;  1K0B A;  18GS A;  1SJ6 A;  4USS A;  2GGT A;  4EDY A;  3IK9 A;  5ECH B;  3KGK A;  4O5Q A;  2OBK A;  2MMA A;  5AIX A;  5HFI A;  3CBU A;  1GSE A;  4ML6 A;  1PSQ A;  2GZP A;  4YQU A;  2N5F A;  2DML A;  4XTS A;  4I2T A;  5AGY A;  2PVO C;  5BRT A;  3LFL A;  2O87 A;  3GRX A;  2H1A A;  3KJY A;  2H1G A;  2YPM A;  2R0C A;  1RK4 A;  1Y6E A;  1C72 A;  3FZ5 A;  4DSS B;  4O32 A;  1XWG A;  2HSY A;  4AKX B;  1PFO A;  2WW2 A;  2I4A A;  5ECM B;  4YKF A;  5HR1 A;  3EVI A;  17GS A;  2JAC A;  5E59 A;  3UVT A;  1RQM A;  2YV7 A;  4KW6 A;  1X9S B;  5IMA A;  4H86 A;  3DVX A;  5C00 A;  6GSY A;  1DSB A;  5A5K A;  5H5S A;  5A34 A;  2CVB A;  5J3R A;  1ML6 A;  2L4C A;  4NV2 A;  1JZR A;  3VFI A;  2WGR A;  4TW5 A;  5ECI B;  3FZ4 A;  2WVY A;  2R2J A;  3ZYW A;  2KLX A;  3ZIJ A;  4IS0 A;  1GSD A;  1MDK A;  5ID2 A;  3GTU A;  4MZB A;  3IE3 A;  4JZQ A;  2PER A;  2HT9 A;  3CSH A;  2HRF A;  3GKN A;  1HQO A;  4G9H A;  1TK5 B;  1K3Y A;  4N30 A;  1J9B A;  2PUK C;  2LQO A;  2NBS A;  4K2X A;  1SL2 B;  3AY8 A;  2DJ0 A;  5B6N A;  4AJ6 A;  1S3A A;  2ZNM A;  3IHQ A;  4KE3 A;  4NHZ A;  1OE8 A;  2DLX A;  1Z5Y E;  4XS1 A;  3I9V 2;  1EP7 A;  5B7C A;  1ZYE A;  5CNW A;  4MMM A;  1K0C A;  2LV3 A;  5G31 A;  2DJK A;  3UVH A;  4TXO B;  6GSV A;  3F6D A;  3ZTL A;  4ZIL A;  3MWH A;  2ON7 A;  3ED3 A;  4ZL8 A;  2C4J A;  1TU8 A;  5JWR B;  2A4H A;  1A0R P;  2DJ1 A;  3IXR A;  5IMC A;  1T7P B;  2C3Q A;  5J9C A;  2H73 A;  4BL7 A;  4TR1 A;  4NWY A;  2YOI A;  2LRN A;  5IPG A;  2FHE A;  1YQ1 A;  5D93 A;  3QPM A;  2AAW A;  5IMD A;  3P90 A;  3P8W A;  1GSS A;  2HXK A;  3KIJ A;  3PGT A;  2HE3 A;  5EPF A;  2GSQ A;  2HQT A;  3FRC A;  4DSS A;  1SKR B;  2XPE A;  1A2L A;  5CRG A;  3SBC A;  1U87 A;  3FR3 A;  1EGO A;  4GQC A;  3ZVJ D;  1X9W B;  3N5O A;  1TP9 A;  3M9J A;  3FR6 A;  2FUG 2;  2GTU A;  4YQM A;  1QK8 A;  3CYN A;  1BED A;  3GST A;  4AKG A;  2L57 A;  4FYB A;  5IOX A;  1MDI A;  2FA8 A;  2H72 A;  1GTB A;  5J4U A;  2GVP A;  1R4W A;  4I5Q A;  5BMU A;  4MH3 A;  3L9U A;  2DSA A;  3A2W A;  1Z7P A;  3Q19 A;  1GSQ A;  2IIY A;  3UAR A;  3DYR A;  2DIY A;  4KAE A;  4MK3 A;  1HNC A;  2BJX A;  4KUN A;  4Z7X A;  3GHA A;  1F3A A;  4MZC A;  4HDE A;  4GXZ A;  5ECS A;  1O8W A;  2X8C A;  2HSM B;  3KTL A;  2E7P A;  1GUH A;  5A1N B;  2QA2 A;  4L8E A;  3TB2 A;  4Z2R A;  2CZ3 A;  2C0G A;  4K8M A;  1WP0 A;  3L9S A;  4K9Z A;  4QL9 A;  1FHE A;  1OE7 A;  2PBJ A;  4IGJ A;  1M3I A;  2P5R A;  2HRK A;  1X0R A;  3EU3 A;  3H4K A;  2J23 A;  1BAY A;  1PN9 A;  3HHV A;  4GRF A;  3IOS A;  4RI7 A;  2YWM A;  4D73 B;  4ZBA A;  1EEM A;  3GMF A;  4HQZ A;  5ECQ B;  4ZL7 A;  4KDU A;  2I1U A;  2YJ7 A;  3CSI A;  13GS A;  1K0M A;  4BVY B;  1THO A;  2O3E A;  2XC2 A;  1ERV A;  2CX3 A;  3IDV A;  1XXU A;  2H8L A;  4XS6 A;  3BCK A;  1Q98 A;  2ES7 A;  2V32 A;  1OAZ A;  5HR2 A;  4ECC A;  3FHK A;  5F07 A;  3SWL A;  1OC9 A;  2C8U A;  5IQY A;  4WR5 A;  3UAP A;  4O92 A;  4XCS A;  3KMO A;  5FHI A;  1GH2 A;  1XW6 A;  5CP1 A;  2YN1 A;  1S4B P;  1J08 A;  1ST9 A;  4K7I A;  4TKY A;  4PNF A;  1YEW C;  2PU9 C;  9GSS A;  3FY7 A;  4BVX A;  4IBP A;  4GCI A;  1ABA A;  3MIX A;  4V1A p;  4X1U A;  3H8Q A;  2UV8 G;  4K6X A;  1N8J A;  5ABR A;  4Q5F A;  1SD9 A;  2VCQ A;  5ECK B;  1SL1 B;  3EMX A;  3LYK A;  1JZO A;  3F63 A;  1FVK A;  5KOX A;  3H1N A;  3KM6 A;  5D96 A;  5IMF A;  2REM A;  5HR0 A;  4K1F A;  3DML A;  4ULX A;  3TKQ A;  1WJK A;  2FGX A;  5DJM A;  4X0X A;  2O89 A;  2YZU A;  3WGD A;  4ZXG A;  4MA9 A;  4POL A;  1E6B A;  2HRA A;  2E0Q A;  4HUA A;  3RPN A;  2L59 A;  1M7T A;  5B8B A;  4ECJ A;  2TIR A;  3MAK A;  2V6O A;  1FB0 A;  2RII A;  1YEP A;  1A23 A;  4CW9 A;  4IVF A;  2I9H A;  5KN2 A;  3W8J A;  4MZW A;  4LL4 B;  1J0F A;  3HXS A;  1EZK A;  2B5X A;  1AC1 A;  4FIW A;  3WD6 A;  3IAM 2;  5HFG A;  2HSN A;  2H66 A;  1T8E B;  5AN1 A;  2VLV A;  3ZZX A;  4EIP A;  5IIZ A;  1UN2 A;  3PPU A;  3UBK A;  3VUR A;  1A2J A;  2M46 A;  3BBY A;  1NHY A;  1DUG A;  3F4T A;  4ECI A;  4CY8 A;  1XWK A;  4N10 A;  1WE0 A;  4G2E A;  1BJX A;  2DKI A;  14GS A;  4AJ8 A;  4WBR D;  2WB9 A;  3NIV A;  4KCA A;  4O5U A;  5A4U A;  3LQ7 A;  3E3E A;  5ELG A;  4MJE A;  1UC7 A;  3D5J A;  4WKW A;  1B48 A;  1RW1 A;  4MP4 A;  1I9D A;  2O36 A;  1OYJ A;  2LST A;  5J4V A;  4WBJ A;  4JU5 A;  5CO3 A;  2HYX A;  2O85 A;  2C3N A;  2P31 A;  1I5G A;  3TJB A;  4Z2T A;  4FQU A;  3EMP A;  2LJR A;  2FD3 A;  2WVZ A;  1GUL A;  3QD9 A;  1WWJ A;  2WCI A;  3TJK A;  4FH8 A;  2IN3 A;  2O7K A;  5A34 B;  1BQ7 A;  2VKZ G;  1GLP A;  2VCT A;  1Y25 A;  4LL1 B;  1BF5 A;  2P5Q A;  2L4Q A;  3L78 A;  5HFK A;  2VAF A;  2LS5 A;  1U6T A;  5ID2 B;  2O8V B;  3GTU B;  2OE0 A;  3PR8 A;  1SU9 A;  1ACV A;  4HU9 A;  2X8H A;  4ZIJ A;  3G7J A;  2BTO T;  5JWQ B;  4GSN A;  2WZ9 A;  5F05 A;  2H0H A;  2IJY A;  2M80 A;  2XHF A;  4ZB7 A;  3P2A A;  4V1A g;  3PH9 A;  4PQI A;  2VCX A;  5DBQ A;  1DE2 A;  1K3O A;  3FZA A;  4TXV A;  1DE1 A;  3TKS A;  4GWR A;  2HLS A;  2R0P A;  3QDN A;  1M2B A;  1B4P A;  1LU4 A;  1MD3 A;  1XFL A;  1NHO A;  2JU5 A;  1V9W A;  4IQ1 A;  1Z7R A;  2BMX A;  2D2Z A;  4FYC A;  1G6W A;  5JWO B;  5INY A;  1H75 A;  2VOC A;  4YKG A;  1ILO A;  2JZT A;  2MZC A;  4KCE A;  3LYP A;  4E68 A;  4F0C A;  1AQW A;  2PWJ A;  1Q4J A;  3VI5 A;  2CVD A;  1Z6M A;  5A5H A;  4BL7 B;  3KTB A;  4TR1 B;  2IMF A;  2EIO A;  3KD0 A;  1G7E A;  1SVL A;  5CRD A;  1B9X C;  4TR4 A;  1R5P A;  1SKW B;  2HZE A;  1H4O A;  3UBL A;  3EC3 A;  1YZX A;  5J40 A;  3E0U A;  5EVO A;  3IR4 A;  2OJL A;  2MBT A;  3CRU A;  3LG6 A;  2FWH A;  3JCM L;  2CAI A;  1EV9 A;  4POK A;  2VCZ A;  12GS A;  4MPG A;  1AQX A;  1JZD A;  4KND A;  4IW9 A;  2AHE A;  2LUS A;  2E2G A;  4KF9 A;  2H6X A;  4OD7 A;  1B9Y C;  2F9S A;  1SJZ A;  2VL2 C;  5FT3 A;  2R37 A;  5DQY A;  5A4V A;  4IN0 A;  5BMU B;  2A4V A;  4NAX A;  1EGR A;  3KH7 A;  1PD2 1;  3IK7 A;  2I81 A;  3ME7 A;  3QAG A;  3GV1 A;  1XW9 A;  3IBH A;  3GFK A;  2DKH A;  1GL8 A;  1EV4 A;  3I69 A;  4KSO A;  3UOM A;  4DVC A;  4ZBD A;  1PRX A;  1O6J A;  1TXU A;  4L0U A;  2O5V A;  1XBS A;  3ISO A;  3L0H A;  4RI6 A;  2HRK B;  1B4Q A;  5CYY A;  1GWC A;  2X4A A;  2HSH A;  1PA3 A;  3VLN A;  3C1S A;  2YJH A;  4X43 A;  4BWQ A;  4ZBB A;  4CY6 A;  2K8S A;  2E2M A;  2B1K A;  3I6A A;  4ZB9 A;  3GIX A;  3RBT A;  3D4M A;  1UA5 A;  2C1Y A;  2OAC A;  1EWX A;  3O3T A;  1XWA A;  1GSY A;  1V57 A;  1SEN A;  5ECN B;  3CHX C;  3CXG A;  1JFU A;  4EUY A;  2B7J A;  3LOR A;  4MF5 A;  2C0F A;  1GTI A;  4FO5 A;  1QUW A;  3M9K A;  4ZB6 A;  3RHC A;  3HD5 A;  4XIH A;  1S3D A;  1PKW A;  3KXO A;  1QMV A;  1TRV A;  1AIU A;  1OC9 B;  3HJP A;  3GH6 A;  2R6K A;  3G7I A;  3TCO A;  1USB A;  4MJC A;  2PGT A;  1K0D A;  1GP1 A;  2H0G A;  3GX8 A;  4RQR A;  2OT3 A;  1TOF A;  4NHW A;  1WRY A;  3TJG A;  4BVX B;  2YAN A;  2GT5 A;  1M9A A;  2JSY A;  5G5F A;  4WF4 A;  1FVJ A;  2DBC A;  2LTK A;  1MD4 A;  2EFH A;  1ON4 A;  3FZ9 A;  10GS A;  2VL3 A;  3GL5 A;  2A2R A;  1A2M A;  4EIQ A;  1Z6N A;  5KN3 A;  1ZYN A;  4L0W A;  2AYT A;  1PX7 A;  2H1D A;  1K0O A;  4MJA A;  4OO4 A;  3ZFL A;  1MDJ A;  4V2L A;  1HNA A;  3EE2 A;  4OCF A;  4KDY A;  4K2D A;  1PMT A;  4O7H A;  2JSZ A;  5D9V A;  5F06 A;  3TJJ A;  3KMN A;  2H6Y A;  5A4W A;  4JR6 A;  5F8B A;  3G7Y A;  1F2E A;  5LD0 A;  3GKX A;  4YQV A;  7GSS A;  1V58 A;  5J9B A;  2OKA A;  2F8F A;  2HSN B;  3TRP A;  3DD3 A;  1YY7 A;  1PQN A;  2HNL A;  1A8L A;  3TDG A;  5DAL A;  2H71 A;  4HJM A;  3D0Z A;  2WW0 A;  5JCW A;  3US3 A;  1XZO A;  4PI0 C;  4EDZ A;  1V98 A;  4N0V A;  2GZY A;  2QSI A;  4POB A;  1NSW A;  4Q5R A;  2C0D A;  2VO4 A;  2R5G A;  3Q18 A;  1FO5 A;  3M3M A;  5G1K A;  5ECL B;  3S9F A;  1YKA A;  3Q6O A;  2LNT A;  2UZ8 A;  3LSZ A;  2YWO A;  1R7H A;  2EIR A;  1NW2 A;  3D6I A;  5LCZ A;  3MYD A;  2B3S A;  3TGZ A;  5ENU A;  1A8Y A;  4J2F A;  1SVM A;  3VWV A;  1O7U A;  3GN3 A;  2TRX A;  3L9V A;  3DEX A;  2RUE A;  1K3L A;  1TW9 A;  4PTS A;  4OFN A;  1XOB A;  2VD0 A;  4ILF A;  1MEK A;  3ERW A;  1JLV A;  5LNK e;  2VM2 A;  1BYE A;  3GYK A;  1QFN A;  4DSR A;  2FNO A;  4XS4 A;  3D21 A;  3NOF A;  2IFQ A;  4K5R A;  4KGI A;  2RM5 A;  4HSC X;  4YH2 A;  1V2A A;  2R4V A;  3QCP A;  1BX9 A;  2EFE A;  4K0G A;  2QKE A;  3DVW A;  2OE1 A;  2H19 A;  4TR3 A;  1OC3 A;  4OO5 A;  3ZIT A;  3KP9 A;  5DVB A;  2EC4 A;  1LJR A;  5ECP B;  4QQ7 A;  3ZRE A;  1VGL A;  5GSS A;  5ECO B;  3F0I A;  2K8V A;  4O5R A;  2CA8 A;  4PUF C;  1PN0 A;  3WT2 A;  3QR6 A;  1ZZY A;  4QL7 A;  1ZCP A;  3WGE A;  4JBB A;  4K5S A;  2FWG A;  2B1L A;  2NTO A;  3U6V A;  3TKS E;  4EXJ A;  3GNJ A;  2IMI A;  3G9B A;  4AKI A;  2XBQ A;  1URM A;  1JZW A;  2N5B A;  6GSX A;  5A5H B;  4XRA A;  2AB6 A;  3CWG A;  3LW9 A;  2A2S A;  2CQ9 A;  2ZUP A;  1O73 A;  2IWT A;  2QA1 A;  2HZE B;  3D22 A;  4WXT A;  4EC0 A;  2L5L A;  3OR5 A;  3ZML A;  1FAA A;  1TRU A;  2Z9S A;  2GZZ A;  4I97 A;  3EWL A;  3C71 A;  2LKU A;  2CZ2 A;  3UL3 A;  2ALB A;  3QAW A;  1T00 A;  22GS A;  4ISD A;  3TKR A;  2V2G A;  1SVO A;  2FWE A;  1SK0 A;  1YDK A;  1X5C A;  3GUS A;  2GSS A;  2PPT A;  5J47 A;  5G5E A;  1T4Z A;  4OFT A;  3MSZ A;  1VRS D;  4ID0 A;  3ZRD A;  4POM A;  3Q74 A;  3EU4 A;  4BPY A;  5DAK B;  4GDF A;  4HZ2 A;  4DSQ A;  3FYG A;  3DIE A;  3GSS A;  2IMD A;  4ML1 A;  2MMN A;  4F03 A;  2DC5 A;  1E2Y A;  2V1M A;  3F8U A;  2YWI A;  5ECR B;  3IHG A;  3DGQ A;  4OFM A;  20GS A;  2WVX A;  2MMO A;  4G01 A;  2XBI A;  1O8X A;  2WZS A;  1TI3 A;  4GTU A;  1ZOF A;  4EKZ A;  4LA1 A;  2H1L A;  3LEF A;  1ERW A;  4G10 A;  4XHM A;  4MNN A;  2CT6 A;  3R2Q A;  5KEJ A;  2KP2 A;  1VF4 A;  4IP1 A;  2WUL A;  3APS A;  2YZH A;  3BJ5 A;  4DEJ A;  4MH2 A;  1GTA A;  3UMA A;  2WRT A;  5ELA A;  3QFB C;  3KH9 A;  6GSS A;  4ZL9 A;  1THX A;  1JLW A;  2C3T A;  5IO0 A;  5E4W A;  3IC8 A;  5D9X A;  4W66 A;  3C73 A;  4AKH A;  5KN0 A;  4BWS A;  3FK8 A;  3APO A;  3QOU A;  4FYU A;  1AQV A;  4N11 A;  3W8S A;  4BIK A;  4ACS A;  2FY6 A;  1VF2 A;  2PVQ A;  2MYG A;  1PKZ A;  4P3Y B;  2VM1 A;  4E8H A;  3IV4 A;  1CQH A;  1Y1U A;  3FMW A;  2FCH A;  4NPB A;  1TK8 B;  3VPT A;  2PMT A;  4PGT A;  3FR9 A;  1XOA A;  5COH A;  1R26 A;  1VF3 A;  4A5P A;  4KSM A;  2H76 A;  3GA4 A;  2DJ2 A;  1F3B A;  4IJ3 A;  4PUR A;  3APQ A;  3J7Y b;  2AV4 A;  2RUF A;  3RPP A;  5F0G A;  3LGC A;  2DIZ A;  5H5R A;  3MDK A;  1ZYP A;  2EIQ A;  3V1W A;  1EP8 A;  3FW2 A;  3ZMK A;  4EVM A;  3R3E A;  5J41 A;  4K0N A;  1TTZ A;  4F0B A;  1SK2 A;  3BOA A;  2VD1 A;  4N0Z A;  3A5W A;  2MBS A;  2QGV A;  3HZ4 A;  1AAZ A;  2VCW A;  3CTF A;  2GT6 A;  2LRT A;  2NVL A;  2PN8 A;  2TRC P;  3O6T A;  4L5O A;  2G2Q A;  3N9J A;  1EOG A;  4MPF A;  4K7N A;  4MLY A;  1KEB A;  1TKD B;  3GL3 A;  1EEJ A;  5DAK A;  2K9F A;  3EIN A;  3TU3 B;  1X5E A;  4TRX A;  4WR4 A;  4AJ7 A;  4IQA A;  1TRS A;  2B5Y A;  4GST A;  4PUA A;  3TJF A;  16GS A;  3MNG A;  3F4S A;  4G0L A;  1VF1 A;  2I3Y A;  1HNB A;  1DBY A;  2JZS A;  1ERU A;  4MCU A;  4WET A;  2YWN A;  5DAL B;  2X64 A;  2WS2 A;  2H6Z A;  5HQP A;  3HJM A;  5GZZ B;  2RM6 A;  4Z2U A;  4J56 E;  3HVN A;  1U3I A;  5IM9 A;  4NV5 A;  1YVL A;  5AIS A;  3M1G A;  5IMZ A;  3CMI A;  4EO3 A;  2V41 A;  1M9B A;  1XPV A;  1YF0 A;  3RHB A;  3HCZ A;  1NM3 A;  1Z3E A;  1HD2 A;  3IRA A;  3VWW A;  2HFD A;  5FWG A;  4AGS A;  2B5E A;  2KUC A;  3VK9 A;  3CTG A;  3W6G A;  3TUE A;  1TJD A;  1TU7 A;  4WF5 A;  3F9U A;  2WJU A;  1R5A A;  3KZQ A;  2R3X A;  1AUC A;  3HY2 A;  4MF7 A;  4JE1 A;  1ERT A;  4GSS A;  2HI7 A;  3O76 A;  1FOH A;  2H01 A;  3LWA A;  4LMV A;  2WFC A;  2IL3 A;  1TXX A;  5KN1 A;  3EUR A;  4PXO A;  3GX0 A;  5EY6 A;  2IPA A;  5G30 A;  5H5Q A;  1N2A A;  4TR0 A;  8GSS A;  2IMK A;  4IHU A;  4HOJ A;  1IYI A;  4KA0 A;  4Q5Q A;  1SYR A;  2CVK A;  3HVV A;  2OBI A;  3TKS C;  4HI7 A;  3ERF A;  1SL0 B;  1AW9 A;  2JZR A;  4GF0 A;  4XS4 B;  4F82 A;  4MF6 A;  2IFQ B;  3WGX A;  3H93 A;  1QXH A;  1X9M B;  2J9H A;  2HZF A;  2DJJ A;  1LBK A;  2OA7 A;  3LJR A;  3M0F A;  3H79 A;  5D73 A;  3ZL5 A;  3WYW A;  3FKF A;  3DXB A;  4F9Z A;  4PNG A;  4JED A;  1WPI A;  4YAV A;  3DKS A;  3RDW A;  2K18 A;  3RGB C;  4X4J A;  3LXZ A;  1MTC A;  4HS1 A;  1OVN A;  3UIW A;  1YKC A;  5J4Y A;  3VWU A;  4OMV A;  3UJ1 A;  1K0A A;  4RQX A;  5L71 A;  3DRN A;  3TOU A;  2KOK A;  5CRW A;  2GDR A;  3HKR A;  1XCC A;  1A0F A;  1XG8 A;  2FLS A;  4MJB A;  3VI7 A;  4CDO A;  1N25 A;  2JAD A;  4YAP A;  2OE3 A;  5AIV A;  1SK1 A;  3BD2 A;  1GLQ A;  2HRN A;  3K8N A;  5DQS A;  3VWX A;  2QC7 A;  2GSR A;  4WEY A;  2F51 A;  1M2D A;  2YCD A;  2GST A;  2H1B A;  4I6X A;  1QGV A;  3KEB A;  2H74 A;  3RFR C;  1KBN A;  3QMX A;  4FXY P;  5IMV A;  1GUM A;  3PIN A;  5GST A;  1FOV A;  4LMW A;  4HQS A;  4PX1 A;  1B8X A;  1GTU A;  2DMM A;  5D8I A;  1YF1 A;  4G19 A;  4Q5N A;  3RAZ A;  2X8G A;  1O81 A;  19GS A;  2NDO A;  4QMK A;  1OKD A;  1PL1 A;  4IJI A;  3I43 A;  2A2P A;  2K6V A;  2AJQ B;  4KDX A;  1M99 A;  4IEL A;  1FG4 A;  5IO2 A;  1W4V A;  4KH7 A;  4J57 E;  5HR3 A;  2ZCT A;  2GQK A;  1EOH A;  3M8N A;  5JCG A;  1WOU A;  1PX6 A;  2VUP A;  4MAB A;  1QQ2 A;  4PQ1 A;  2YNX A;  4XRD A;  2EFC A;  4RUV A;  2B7K A;  1F9M A;  3C8E A;  1T4Y A;  4KX4 A;  1IYH A;  4EF0 A;  2X49 A;  4IP6 A;  2OAD A;  4LLR A;  3C7M A;  1XVW A;  3ZFB A;  3J7Y k;  4TXO A;  2GS3 A;  3HYP A;  5IOW A;  2B6M A;  3KP8 A;  4EL1 A;  2YV9 A;  4K7O A;  5B6M A;  3C1R A;  1XWB A;  1I1I P;  5JCU A;  4CHS A;  2MMZ A;  2LJA A;  4ZB8 A;  1SYX A;  2L6C A;  2NPB A;  2YP6 A;  1TDI A;  1TRW A;  1GSF A;  2N5A A;  2VLU A;  5GAP D;  3EYT A;  2RLI A;  2DJ3 A;  2WVX B;  4AI6 A;  5J5N A;  1HYU A;  1GNE A;  3WT1 A; 
#chains in the Genus database with same CATH homology
 5DJL A;  3GKM A;  1ZMA A;  4V2M A;  1U3A A;  4L5L A;  2JL4 A;  4GQF A;  1XW5 A;  3EPT A;  3HMJ G;  2X99 A;  2VIM A;  1BG5 A;  2LRC A;  2H0I A;  1OKT A;  2M72 A;  5B8A A;  2F8A A;  1ZYQ B;  4JR4 A;  5CRH A;  2KP1 A;  3F3R A;  4ICY A;  3E9J B;  1T1V A;  3GH9 A;  2GQL A;  1KNG A;  1XIY A;  1TK0 B;  3P7X A;  2EFD A;  2CAQ A;  5C04 A;  3A2V A;  1SKS B;  2H75 A;  3F6F A;  2CX4 A;  2L6D A;  5G2Z A;  1K0N A;  3HJO A;  1GRX A;  1G6Y A;  5GAN D;  4OCE A;  2IME A;  1G7O A;  2ON5 A;  1F37 A;  1WIK A;  5IPH A;  3IC4 A;  3TKP A;  1W89 A;  5EL8 A;  4ECB A;  4HU7 A;  2HSM A;  5D9W A;  5A1N A;  2C80 A;  2P0G A;  2VCV A;  1CQG A;  6GSW A;  3NZN A;  1G0T A;  4I8B A;  2FWF A;  3IA1 A;  3CRT A;  1PL2 A;  3HZ8 A;  1GNW A;  3ZLP A;  3QAV A;  3GKK A;  4D73 A;  3IPZ A;  2H30 A;  2VL2 A;  4F2I A;  4PQH A;  3TOT A;  3L4N A;  1Z9H A;  3TRQ A;  1SD8 A;  1T3B A;  3GUR A;  4KB3 A;  1M0U A;  3HDC A;  3F4R A;  4BVY A;  1A24 A;  4EE0 A;  11GS A;  5G1L A;  3UEM A;  1WMJ A;  1BG1 A;  1FB6 A;  2GLR A;  4G0I A;  3F3Q A;  4JRR A;  4BA7 A;  1XVQ A;  1OC8 A;  1JHB A;  4N3Z A;  3HVX A;  4HJ2 A;  2GQM A;  3ERG A;  1V40 A;  3CSJ A;  2G0F A;  2F3M A;  2LQQ A;  1YJ6 A;  3IAS 2;  4TOP A;  4TN8 A;  1F6M C;  3QFA C;  2V6K A;  1KTE A;  5CRE A;  2XPD A;  3TRX A;  2CV4 A;  4NMU A;  3D4T A;  2H70 A;  3HA9 A;  1ZL9 A;  6GST A;  3FEU A;  3A5I A;  5KOW A;  4IKH A;  3HVS A;  3ZVJ A;  3LXT A;  4E8E A;  3KCM A;  5DCG A;  2LNS A;  1M2A A;  1FW1 A;  4I2U A;  3ZIV A;  4GLT A;  2R0G A;  3A2X A;  2AUV A;  4V2N A;  4G0K A;  1GUK A;  5D9T A;  1PGT A;  5DCH A;  4TVE A;  1GSU A;  6GSU A;  2LEG A;  1X5D A;  3DWV A;  1UVZ A;  4HZ4 A;  1U88 A;  4MDC A;  1YEX A;  2C0E A;  2KHP A;  4HEA 2;  3ME8 A;  3U5R E;  1O85 A;  3BCI A;  5CAX A;  2FA4 A;  4NXI A;  4AF2 A;  1AXD A;  2VL9 A;  2LJK A;  2L5O A;  2WDU A;  5DDL A;  1TI1 A;  1SJI A;  3A3T A;  1S3C A;  4OWY A;  1ZGN A;  2VLT A;  1XWC A;  3VPQ A;  1K0B A;  18GS A;  1SJ6 A;  4USS A;  2GGT A;  4EDY A;  3IK9 A;  5ECH B;  3KGK A;  4O5Q A;  2OBK A;  2MMA A;  5AIX A;  5HFI A;  3CBU A;  1GSE A;  4ML6 A;  1PSQ A;  2GZP A;  4YQU A;  2N5F A;  2DML A;  4XTS A;  4I2T A;  5AGY A;  2PVO C;  5BRT A;  3LFL A;  2O87 A;  3GRX A;  2H1A A;  3KJY A;  2H1G A;  2YPM A;  2R0C A;  1RK4 A;  1Y6E A;  1C72 A;  3FZ5 A;  4DSS B;  4O32 A;  1XWG A;  2HSY A;  4AKX B;  2I4A A;  5ECM B;  4YKF A;  5HR1 A;  3EVI A;  17GS A;  2JAC A;  5E59 A;  3UVT A;  1RQM A;  2YV7 A;  4KW6 A;  1X9S B;  5IMA A;  4H86 A;  3DVX A;  5C00 A;  6GSY A;  1DSB A;  5A5K A;  5H5S A;  5A34 A;  2CVB A;  5J3R A;  1ML6 A;  2L4C A;  4NV2 A;  1JZR A;  3VFI A;  2WGR A;  4TW5 A;  5ECI B;  3FZ4 A;  2R2J A;  3ZYW A;  2KLX A;  3ZIJ A;  4IS0 A;  1GSD A;  1MDK A;  5ID2 A;  3GTU A;  4MZB A;  3IE3 A;  4JZQ A;  2PER A;  2HT9 A;  3CSH A;  2HRF A;  3GKN A;  1HQO A;  4G9H A;  1TK5 B;  1K3Y A;  4N30 A;  1J9B A;  2PUK C;  2LQO A;  2NBS A;  4K2X A;  1SL2 B;  3AY8 A;  2DJ0 A;  5B6N A;  4AJ6 A;  1S3A A;  2ZNM A;  3IHQ A;  4KE3 A;  4NHZ A;  1OE8 A;  2DLX A;  1Z5Y E;  4XS1 A;  3I9V 2;  1EP7 A;  5B7C A;  1ZYE A;  5CNW A;  4MMM A;  1K0C A;  2LV3 A;  5G31 A;  2DJK A;  3UVH A;  4TXO B;  6GSV A;  3F6D A;  3ZTL A;  4ZIL A;  3MWH A;  2ON7 A;  3ED3 A;  4ZL8 A;  2C4J A;  1TU8 A;  5JWR B;  2A4H A;  1A0R P;  2DJ1 A;  3IXR A;  5IMC A;  1T7P B;  2C3Q A;  5J9C A;  2H73 A;  4BL7 A;  4TR1 A;  4NWY A;  2YOI A;  2LRN A;  5IPG A;  2FHE A;  1YQ1 A;  5D93 A;  3QPM A;  2AAW A;  5IMD A;  3P90 A;  3P8W A;  1GSS A;  2HXK A;  3KIJ A;  3PGT A;  2HE3 A;  5EPF A;  2GSQ A;  2HQT A;  3FRC A;  4DSS A;  1SKR B;  2XPE A;  1A2L A;  5CRG A;  3SBC A;  1U87 A;  3FR3 A;  1EGO A;  4GQC A;  3ZVJ D;  1X9W B;  3N5O A;  1TP9 A;  3M9J A;  3FR6 A;  2FUG 2;  2GTU A;  4YQM A;  1QK8 A;  3CYN A;  1BED A;  3GST A;  4AKG A;  2L57 A;  4FYB A;  5IOX A;  1MDI A;  2FA8 A;  2H72 A;  1GTB A;  5J4U A;  2GVP A;  1R4W A;  4I5Q A;  5BMU A;  4MH3 A;  3L9U A;  2DSA A;  3A2W A;  1Z7P A;  3Q19 A;  1GSQ A;  2IIY A;  3UAR A;  3DYR A;  2DIY A;  4KAE A;  4MK3 A;  1HNC A;  2BJX A;  4KUN A;  4Z7X A;  3GHA A;  1F3A A;  4MZC A;  4HDE A;  4GXZ A;  5ECS A;  1O8W A;  2X8C A;  2HSM B;  3KTL A;  2E7P A;  1GUH A;  5A1N B;  2QA2 A;  4L8E A;  3TB2 A;  4Z2R A;  2CZ3 A;  2C0G A;  4K8M A;  1WP0 A;  3L9S A;  4K9Z A;  4QL9 A;  1FHE A;  1OE7 A;  2PBJ A;  4IGJ A;  2P5R A;  2HRK A;  1X0R A;  3EU3 A;  3H4K A;  2J23 A;  1BAY A;  1PN9 A;  3HHV A;  4GRF A;  3IOS A;  4RI7 A;  2YWM A;  4D73 B;  4ZBA A;  1EEM A;  3GMF A;  4HQZ A;  5ECQ B;  4ZL7 A;  4KDU A;  2I1U A;  2YJ7 A;  3CSI A;  13GS A;  1K0M A;  4BVY B;  1THO A;  2XC2 A;  1ERV A;  2CX3 A;  3IDV A;  1XXU A;  2H8L A;  4XS6 A;  3BCK A;  1Q98 A;  2ES7 A;  2V32 A;  1OAZ A;  5HR2 A;  4ECC A;  3FHK A;  5F07 A;  3SWL A;  1OC9 A;  2C8U A;  5IQY A;  4WR5 A;  3UAP A;  4O92 A;  4XCS A;  3KMO A;  5FHI A;  1GH2 A;  1XW6 A;  5CP1 A;  2YN1 A;  1J08 A;  1ST9 A;  4K7I A;  4TKY A;  4PNF A;  2PU9 C;  9GSS A;  3FY7 A;  4BVX A;  4IBP A;  4GCI A;  1ABA A;  3MIX A;  4V1A p;  4X1U A;  3H8Q A;  2UV8 G;  4K6X A;  1N8J A;  5ABR A;  4Q5F A;  1SD9 A;  2VCQ A;  5ECK B;  1SL1 B;  3EMX A;  3LYK A;  1JZO A;  3F63 A;  1FVK A;  5KOX A;  3H1N A;  3KM6 A;  5D96 A;  5IMF A;  2REM A;  5HR0 A;  4K1F A;  3DML A;  4ULX A;  3TKQ A;  1WJK A;  2FGX A;  5DJM A;  4X0X A;  2O89 A;  2YZU A;  3WGD A;  4ZXG A;  4MA9 A;  4POL A;  1E6B A;  2HRA A;  2E0Q A;  4HUA A;  3RPN A;  2L59 A;  1M7T A;  5B8B A;  4ECJ A;  2TIR A;  3MAK A;  2V6O A;  1FB0 A;  2RII A;  1YEP A;  1A23 A;  4CW9 A;  4IVF A;  2I9H A;  5KN2 A;  3W8J A;  4MZW A;  4LL4 B;  1J0F A;  3HXS A;  1EZK A;  2B5X A;  1AC1 A;  4FIW A;  3WD6 A;  3IAM 2;  5HFG A;  2HSN A;  2H66 A;  1T8E B;  5AN1 A;  2VLV A;  3ZZX A;  4EIP A;  5IIZ A;  1UN2 A;  3PPU A;  3UBK A;  3VUR A;  1A2J A;  2M46 A;  3BBY A;  1NHY A;  1DUG A;  3F4T A;  4ECI A;  4CY8 A;  1XWK A;  4N10 A;  1WE0 A;  4G2E A;  1BJX A;  2DKI A;  14GS A;  4AJ8 A;  4WBR D;  2WB9 A;  3NIV A;  4KCA A;  4O5U A;  5A4U A;  3LQ7 A;  3E3E A;  5ELG A;  4MJE A;  1UC7 A;  3D5J A;  4WKW A;  1B48 A;  1RW1 A;  4MP4 A;  1I9D A;  1OYJ A;  2LST A;  5J4V A;  4WBJ A;  4JU5 A;  5CO3 A;  2HYX A;  2O85 A;  2C3N A;  2P31 A;  1I5G A;  3TJB A;  4Z2T A;  4FQU A;  3EMP A;  2LJR A;  2FD3 A;  1GUL A;  3QD9 A;  1WWJ A;  2WCI A;  3TJK A;  4FH8 A;  2IN3 A;  2O7K A;  5A34 B;  1BQ7 A;  2VKZ G;  1GLP A;  2VCT A;  1Y25 A;  4LL1 B;  1BF5 A;  2P5Q A;  2L4Q A;  3L78 A;  5HFK A;  2VAF A;  2LS5 A;  1U6T A;  5ID2 B;  2O8V B;  3GTU B;  2OE0 A;  3PR8 A;  1SU9 A;  1ACV A;  4HU9 A;  2X8H A;  4ZIJ A;  3G7J A;  2BTO T;  5JWQ B;  4GSN A;  2WZ9 A;  5F05 A;  2H0H A;  2IJY A;  2M80 A;  2XHF A;  4ZB7 A;  3P2A A;  4V1A g;  3PH9 A;  4PQI A;  2VCX A;  5DBQ A;  1DE2 A;  1K3O A;  3FZA A;  4TXV A;  1DE1 A;  3TKS A;  4GWR A;  2HLS A;  2R0P A;  3QDN A;  1M2B A;  1B4P A;  1LU4 A;  1MD3 A;  1XFL A;  1NHO A;  2JU5 A;  1V9W A;  4IQ1 A;  1Z7R A;  2BMX A;  2D2Z A;  4FYC A;  1G6W A;  5JWO B;  5INY A;  1H75 A;  2VOC A;  4YKG A;  1ILO A;  2JZT A;  2MZC A;  4KCE A;  3LYP A;  4E68 A;  4F0C A;  1AQW A;  2PWJ A;  1Q4J A;  3VI5 A;  2CVD A;  1Z6M A;  5A5H A;  4BL7 B;  3KTB A;  4TR1 B;  2IMF A;  2EIO A;  3KD0 A;  1G7E A;  1SVL A;  5CRD A;  1B9X C;  4TR4 A;  1R5P A;  1SKW B;  2HZE A;  1H4O A;  3UBL A;  3EC3 A;  1YZX A;  5J40 A;  3E0U A;  5EVO A;  3IR4 A;  2OJL A;  2MBT A;  3CRU A;  3LG6 A;  2FWH A;  3JCM L;  2CAI A;  1EV9 A;  4POK A;  2VCZ A;  12GS A;  4MPG A;  1AQX A;  1JZD A;  4KND A;  4IW9 A;  2AHE A;  2LUS A;  2E2G A;  4KF9 A;  2H6X A;  4OD7 A;  1B9Y C;  2F9S A;  1SJZ A;  2VL2 C;  5FT3 A;  2R37 A;  5DQY A;  5A4V A;  4IN0 A;  5BMU B;  2A4V A;  4NAX A;  1EGR A;  3KH7 A;  1PD2 1;  3IK7 A;  2I81 A;  3ME7 A;  3QAG A;  3GV1 A;  1XW9 A;  3IBH A;  3GFK A;  2DKH A;  1GL8 A;  1EV4 A;  3I69 A;  4KSO A;  3UOM A;  4DVC A;  4ZBD A;  1PRX A;  1O6J A;  1TXU A;  4L0U A;  2O5V A;  1XBS A;  3ISO A;  3L0H A;  4RI6 A;  2HRK B;  1B4Q A;  5CYY A;  1GWC A;  2X4A A;  2HSH A;  1PA3 A;  3VLN A;  3C1S A;  2YJH A;  4X43 A;  4BWQ A;  4ZBB A;  4CY6 A;  2K8S A;  2E2M A;  2B1K A;  3I6A A;  4ZB9 A;  3GIX A;  3RBT A;  3D4M A;  1UA5 A;  2C1Y A;  2OAC A;  1EWX A;  3O3T A;  1XWA A;  1GSY A;  1V57 A;  1SEN A;  5ECN B;  3CXG A;  1JFU A;  4EUY A;  2B7J A;  3LOR A;  4MF5 A;  2C0F A;  1GTI A;  4FO5 A;  1QUW A;  3M9K A;  4ZB6 A;  3RHC A;  3HD5 A;  4XIH A;  1S3D A;  1PKW A;  3KXO A;  1QMV A;  1TRV A;  1AIU A;  1OC9 B;  3HJP A;  3GH6 A;  2R6K A;  3G7I A;  3TCO A;  1USB A;  4MJC A;  2PGT A;  1K0D A;  1GP1 A;  2H0G A;  3GX8 A;  4RQR A;  2OT3 A;  1TOF A;  4NHW A;  1WRY A;  3TJG A;  4BVX B;  2YAN A;  2GT5 A;  1M9A A;  2JSY A;  5G5F A;  4WF4 A;  1FVJ A;  2DBC A;  2LTK A;  1MD4 A;  2EFH A;  1ON4 A;  3FZ9 A;  10GS A;  2VL3 A;  3GL5 A;  2A2R A;  1A2M A;  4EIQ A;  1Z6N A;  5KN3 A;  1ZYN A;  4L0W A;  2AYT A;  1PX7 A;  2H1D A;  1K0O A;  4MJA A;  4OO4 A;  3ZFL A;  1MDJ A;  4V2L A;  1HNA A;  3EE2 A;  4OCF A;  4KDY A;  4K2D A;  1PMT A;  4O7H A;  2JSZ A;  5D9V A;  5F06 A;  3TJJ A;  3KMN A;  2H6Y A;  5A4W A;  4JR6 A;  5F8B A;  3G7Y A;  1F2E A;  5LD0 A;  3GKX A;  4YQV A;  7GSS A;  1V58 A;  5J9B A;  2OKA A;  2F8F A;  2HSN B;  3TRP A;  3DD3 A;  1YY7 A;  1PQN A;  2HNL A;  1A8L A;  3TDG A;  5DAL A;  2H71 A;  4HJM A;  3D0Z A;  5JCW A;  3US3 A;  1XZO A;  4EDZ A;  1V98 A;  4N0V A;  2GZY A;  2QSI A;  4POB A;  1NSW A;  4Q5R A;  2C0D A;  2VO4 A;  2R5G A;  3Q18 A;  1FO5 A;  3M3M A;  5G1K A;  5ECL B;  3S9F A;  1YKA A;  3Q6O A;  2LNT A;  2UZ8 A;  3LSZ A;  2YWO A;  1R7H A;  2EIR A;  1NW2 A;  3D6I A;  5LCZ A;  3MYD A;  2B3S A;  3TGZ A;  5ENU A;  1A8Y A;  4J2F A;  1SVM A;  3VWV A;  1O7U A;  3GN3 A;  2TRX A;  3L9V A;  3DEX A;  2RUE A;  1K3L A;  1TW9 A;  4PTS A;  4OFN A;  1XOB A;  2VD0 A;  4ILF A;  1MEK A;  3ERW A;  1JLV A;  5LNK e;  2VM2 A;  1BYE A;  3GYK A;  1QFN A;  4DSR A;  2FNO A;  4XS4 A;  3D21 A;  3NOF A;  2IFQ A;  4K5R A;  4KGI A;  2RM5 A;  4YH2 A;  1V2A A;  2R4V A;  3QCP A;  1BX9 A;  2EFE A;  4K0G A;  2QKE A;  3DVW A;  2OE1 A;  2H19 A;  4TR3 A;  1OC3 A;  4OO5 A;  3ZIT A;  3KP9 A;  5DVB A;  2EC4 A;  1LJR A;  5ECP B;  4QQ7 A;  3ZRE A;  1VGL A;  5GSS A;  5ECO B;  3F0I A;  2K8V A;  4O5R A;  2CA8 A;  4PUF C;  1PN0 A;  3WT2 A;  3QR6 A;  1ZZY A;  4QL7 A;  1ZCP A;  3WGE A;  4JBB A;  4K5S A;  2FWG A;  2B1L A;  2NTO A;  3U6V A;  3TKS E;  4EXJ A;  3GNJ A;  2IMI A;  3G9B A;  4AKI A;  2XBQ A;  1URM A;  1JZW A;  2N5B A;  6GSX A;  5A5H B;  4XRA A;  2AB6 A;  3CWG A;  3LW9 A;  2A2S A;  2CQ9 A;  2ZUP A;  1O73 A;  2IWT A;  2QA1 A;  2HZE B;  3D22 A;  4WXT A;  4EC0 A;  2L5L A;  3OR5 A;  3ZML A;  1FAA A;  1TRU A;  2Z9S A;  2GZZ A;  4I97 A;  3EWL A;  3C71 A;  2LKU A;  2CZ2 A;  3UL3 A;  2ALB A;  3QAW A;  1T00 A;  22GS A;  4ISD A;  3TKR A;  2V2G A;  1SVO A;  2FWE A;  1SK0 A;  1YDK A;  1X5C A;  3GUS A;  2GSS A;  2PPT A;  5J47 A;  5G5E A;  1T4Z A;  4OFT A;  3MSZ A;  1VRS D;  4ID0 A;  3ZRD A;  4POM A;  3Q74 A;  3EU4 A;  4BPY A;  5DAK B;  4GDF A;  4HZ2 A;  4DSQ A;  3FYG A;  3DIE A;  3GSS A;  2IMD A;  4ML1 A;  2MMN A;  4F03 A;  2DC5 A;  1E2Y A;  2V1M A;  3F8U A;  2YWI A;  5ECR B;  3IHG A;  3DGQ A;  4OFM A;  20GS A;  2MMO A;  4G01 A;  2XBI A;  1O8X A;  1TI3 A;  4GTU A;  1ZOF A;  4EKZ A;  4LA1 A;  2H1L A;  3LEF A;  1ERW A;  4G10 A;  4XHM A;  4MNN A;  2CT6 A;  3R2Q A;  5KEJ A;  2KP2 A;  1VF4 A;  4IP1 A;  2WUL A;  3APS A;  2YZH A;  3BJ5 A;  4DEJ A;  4MH2 A;  1GTA A;  3UMA A;  2WRT A;  5ELA A;  3QFB C;  3KH9 A;  6GSS A;  4ZL9 A;  1THX A;  1JLW A;  2C3T A;  5IO0 A;  5E4W A;  3IC8 A;  5D9X A;  4W66 A;  3C73 A;  4AKH A;  5KN0 A;  4BWS A;  3FK8 A;  3APO A;  3QOU A;  4FYU A;  1AQV A;  4N11 A;  3W8S A;  4ACS A;  2FY6 A;  1VF2 A;  2PVQ A;  2MYG A;  1PKZ A;  4P3Y B;  2VM1 A;  4E8H A;  3IV4 A;  1CQH A;  1Y1U A;  3FMW A;  2FCH A;  4NPB A;  1TK8 B;  3VPT A;  2PMT A;  4PGT A;  3FR9 A;  1XOA A;  5COH A;  1R26 A;  1VF3 A;  4A5P A;  4KSM A;  2H76 A;  3GA4 A;  2DJ2 A;  1F3B A;  4IJ3 A;  4PUR A;  3APQ A;  3J7Y b;  2AV4 A;  2RUF A;  3RPP A;  5F0G A;  3LGC A;  2DIZ A;  5H5R A;  3MDK A;  1ZYP A;  2EIQ A;  3V1W A;  1EP8 A;  3FW2 A;  3ZMK A;  4EVM A;  3R3E A;  5J41 A;  4K0N A;  1TTZ A;  4F0B A;  1SK2 A;  3BOA A;  2VD1 A;  4N0Z A;  3A5W A;  2MBS A;  2QGV A;  3HZ4 A;  1AAZ A;  2VCW A;  3CTF A;  2GT6 A;  2LRT A;  2NVL A;  2PN8 A;  2TRC P;  3O6T A;  4L5O A;  2G2Q A;  3N9J A;  1EOG A;  4MPF A;  4K7N A;  4MLY A;  1KEB A;  1TKD B;  3GL3 A;  1EEJ A;  5DAK A;  2K9F A;  3EIN A;  3TU3 B;  1X5E A;  4TRX A;  4WR4 A;  4AJ7 A;  4IQA A;  1TRS A;  2B5Y A;  4GST A;  4PUA A;  3TJF A;  16GS A;  3MNG A;  3F4S A;  4G0L A;  1VF1 A;  2I3Y A;  1HNB A;  1DBY A;  2JZS A;  1ERU A;  4MCU A;  4WET A;  2YWN A;  5DAL B;  2X64 A;  2WS2 A;  2H6Z A;  5HQP A;  3HJM A;  5GZZ B;  2RM6 A;  4Z2U A;  4J56 E;  1U3I A;  5IM9 A;  4NV5 A;  1YVL A;  5AIS A;  3M1G A;  5IMZ A;  3CMI A;  4EO3 A;  2V41 A;  1M9B A;  1XPV A;  1YF0 A;  3RHB A;  3HCZ A;  1NM3 A;  1Z3E A;  1HD2 A;  3IRA A;  3VWW A;  2HFD A;  5FWG A;  4AGS A;  2B5E A;  2KUC A;  3VK9 A;  3CTG A;  3W6G A;  3TUE A;  1TJD A;  1TU7 A;  4WF5 A;  3F9U A;  2WJU A;  1R5A A;  3KZQ A;  2R3X A;  1AUC A;  3HY2 A;  4MF7 A;  4JE1 A;  1ERT A;  4GSS A;  2HI7 A;  3O76 A;  1FOH A;  2H01 A;  3LWA A;  4LMV A;  2WFC A;  2IL3 A;  1TXX A;  5KN1 A;  3EUR A;  4PXO A;  3GX0 A;  5EY6 A;  2IPA A;  5G30 A;  5H5Q A;  1N2A A;  4TR0 A;  8GSS A;  2IMK A;  4IHU A;  4HOJ A;  1IYI A;  4KA0 A;  4Q5Q A;  1SYR A;  2CVK A;  3HVV A;  2OBI A;  3TKS C;  4HI7 A;  3ERF A;  1SL0 B;  1AW9 A;  2JZR A;  4GF0 A;  4XS4 B;  4F82 A;  4MF6 A;  2IFQ B;  3WGX A;  3H93 A;  1QXH A;  1X9M B;  2J9H A;  2HZF A;  2DJJ A;  1LBK A;  2OA7 A;  3LJR A;  3M0F A;  3H79 A;  5D73 A;  3ZL5 A;  3WYW A;  3FKF A;  3DXB A;  4F9Z A;  4PNG A;  4JED A;  1WPI A;  4YAV A;  3DKS A;  3RDW A;  2K18 A;  4X4J A;  3LXZ A;  1MTC A;  4HS1 A;  1OVN A;  3UIW A;  1YKC A;  5J4Y A;  3VWU A;  4OMV A;  3UJ1 A;  1K0A A;  4RQX A;  5L71 A;  3DRN A;  3TOU A;  2KOK A;  5CRW A;  2GDR A;  3HKR A;  1XCC A;  1A0F A;  2FLS A;  4MJB A;  3VI7 A;  4CDO A;  1N25 A;  2JAD A;  4YAP A;  2OE3 A;  5AIV A;  1SK1 A;  3BD2 A;  1GLQ A;  2HRN A;  3K8N A;  5DQS A;  3VWX A;  2QC7 A;  2GSR A;  4WEY A;  2F51 A;  1M2D A;  2YCD A;  2GST A;  2H1B A;  4I6X A;  1QGV A;  3KEB A;  2H74 A;  1KBN A;  3QMX A;  5IMV A;  1GUM A;  3PIN A;  5GST A;  1FOV A;  4LMW A;  4HQS A;  4PX1 A;  1B8X A;  1GTU A;  2DMM A;  5D8I A;  1YF1 A;  4G19 A;  4Q5N A;  3RAZ A;  2X8G A;  1O81 A;  19GS A;  2NDO A;  4QMK A;  1OKD A;  1PL1 A;  4IJI A;  3I43 A;  2A2P A;  2K6V A;  2AJQ B;  4KDX A;  1M99 A;  4IEL A;  1FG4 A;  5IO2 A;  1W4V A;  4KH7 A;  4J57 E;  5HR3 A;  2ZCT A;  2GQK A;  1EOH A;  3M8N A;  5JCG A;  1WOU A;  1PX6 A;  2VUP A;  4MAB A;  1QQ2 A;  4PQ1 A;  2YNX A;  4XRD A;  2EFC A;  4RUV A;  2B7K A;  1F9M A;  3C8E A;  1T4Y A;  4KX4 A;  1IYH A;  4EF0 A;  2X49 A;  4IP6 A;  2OAD A;  4LLR A;  3C7M A;  1XVW A;  3ZFB A;  3J7Y k;  4TXO A;  2GS3 A;  3HYP A;  5IOW A;  2B6M A;  3KP8 A;  4EL1 A;  2YV9 A;  4K7O A;  5B6M A;  3C1R A;  1XWB A;  5JCU A;  4CHS A;  2MMZ A;  2LJA A;  4ZB8 A;  1SYX A;  2L6C A;  2NPB A;  2YP6 A;  1TDI A;  1TRW A;  1GSF A;  2N5A A;  2VLU A;  5GAP D;  3EYT A;  2RLI A;  2DJ3 A;  4AI6 A;  5J5N A;  1HYU A;  1GNE A;  3WT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...