1K0OA

Crystal structure of a soluble form of clic1. an intracellular chloride ion channel
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
236
structure length
225
Chain Sequence
PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords CHLORIDE INTRACELLULAR CHANNEL PROTEIN 1
publication title Crystal structure of a soluble form of the intracellular chloride ion channel CLIC1 (NCC27) at 1.4-A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 225
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1k0oA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1k0oA01
2E7PA 1URMA 4GWRA 3F3QA 2KLXA 4DSQA 1K0OA 3ERFA 1SYRA 4K8MA 1V98A 3G7IA 1Z6MA 4KDUA 4WXTA 2IFQB 3UMAA 1TW9A 1YJ6A 2FCHA 2R6KA 4FH8A 2YNXA 2AAWA 3HJMA 1EZKA 1SK0A 1M0UA 3N5OA 4OCFA 1K3YA 4G0KA 4ML1A 4YAPA 4EUYA 3VWUA 2H71A 1O8XA 1SL1B 4J2FA 3ME8A 3WGDA 3ERGA 2DC5A 4MMMA 1MD4A 3F6DA 2J9HA 3F4SA 4K7NA 4EF0A 4KUNA 4PURA 2RLIA 2ZCTA 1BG5A 4MZCA 2LQQA 4XIHA 2WDUA 1I5GA 3GKMA 3ERWA 1PGTA 2GZPA 4MF5A 3WGXA 1R4WA 4IELA 3G7YA 4L0UA 2MMZA 4ACSA 2LSTA 5ECNB 4AGSA 3I43A 4ISDA 3VLNA 4XS4A 2IMDA 1NHYA 4TRXA 2HRNA 2CZ3A 3WT2A 3ZIJA 3HKRA 3R3EA 5G2ZA 3IAM2 2WGRA 1KTEA 4WBRD 1EV4A 4F82A 2YN1A 2D2ZA 2MBTA 5FWGA 1X0RA 2K8VA 4O92A 20GSA 1JLVA 2OE3A 3A2VA 2CVBA 2IN3A 1OE7A 3WYWA 4PUAA 3TKPA 4BL7A 2C8UA 5G5EA 1B4QA 3KD0A 4CW9A 4LLRA 1QFNA 4MPGA 5KN2A 3DVWA 3TRPA 2R3XA 3K8NA 4AF2A 4NHZA 2FLSA 3US3A 4HEA2 3RHCA 4E8EA 2B1KA 2VCXA 1PQNA 3UEMA 4F0CA 3VFIA 2CA8A 4N30A 4K0NA 2OE1A 1M9AA 1TRSA 2V32A 1BEDA 5G31A 2O85A 2C3NA 4WR5A 2P5QA 5GZZB 4MJCA 1J9BA 1N8JA 1PA3A 2HXKA 3FW2A 4KSOA 4EE0A 4L5OA 1SKRB 2PN8A 2LNTA 2CX4A 3H1NA 4YQUA 1ON4A 3GTUA 3MAKA 4G0IA 1JLWA 4H86A 4GTUA 5A4UA 3ZMKA 1MEKA 4RI6A 4XS6A 4KX4A 4MCUA 2DJKA 3P8WA 5D73A 4NXIA 2H6YA 3PPUA 3EC3A 4DEJA 1B9XC 5F0GA 2K18A 1VRSD 4OFMA 2FA8A 2CAQA 1OYJA 2GTUA 4QQ7A 3MNGA 3BJ5A 2PERA 2VCZA 1AC1A 2YWNA 2R2JA 1M2AA 3P7XA 1XWKA 3U5RE 1ZMAA 5IIZA 2I9HA 4XS4B 4K1FA 2VL3A 3QFBC 3FZ5A 4QL9A 3DKSA 3TJKA 2H76A 5IPHA 4PQ1A 5ECLB 1F37A 3WGEA 1OVNA 1YF0A 4K6XA 3UARA 1EOGA 1HD2A 5J9CA 2DMMA 3LORA 3ZYWA 4G0LA 5CP1A 1XW5A 1WE0A 3TOTA 4KNDA 2B6MA 4TOPA 3KM6A 2GGTA 4ZXGA 2CV4A 3EE2A 3CRUA 3RAZA 2L6DA 4N10A 3UAPA 4AJ6A 4BL7B 3IRAA 2FD3A 3QOUA 2LKUA 2DSAA 3F3RA 2H1DA 3U6VA 1A8YA 3PH9A 1MTCA 5JCUA 1O7UA 2LJKA 4TR4A 3TKRA 1AQVA 4KCEA 3HDCA 3CXGA 4POKA 2XC2A 3ZIVA 3HA9A 4LL1B 4V2MA 4EL1A 5KN0A 4KCAA 4L0WA 4Q5RA 4HUAA 1JZWA 3C7MA 5IM9A 3KJYA 5GSSA 2C3QA 1GUKA 2K9FA 3HD5A 5HFIA 3ZVJA 1GSYA 1VF4A 1K0NA 1GSSA 2ES7A 4POLA 4FIWA 3CRTA 1GSUA 1SYXA 3I69A 5B6MA 3GTUB 3NZNA 2YANA 1V9WA 3PGTA 4WEYA 2VO4A 3PINA 4JRRA 1H4OA 3GKKA 5HQPA 2A2SA 2TRXA 3TKSE 4MDCA 3D22A 2IMFA 1EP8A 4ILFA 5EL8A 3M0FA 4TR0A 4KGIA 1A24A 2C0FA 1HQOA 2C0DA 3TKSA 3QAWA 2L59A 3DMLA 1GNWA 5ELAA 1PN9A 1NM3A 1JHBA 5FHIA 2H6XA 1B48A 4KDYA 3IV4A 4YAVA 4TVEA 1FVJA 4NWYA 5HR2A 4JE1A 3D21A 9GSSA 3DD3A 4FYUA 2DJ1A 3F9UA 4XRDA 1WMJA 3IOSA 5GAND 1GUHA 5DJLA 2QKEA 3Q19A 3FKFA 1M9BA 4BWQA 2GT5A 5J3RA 4O7HA 1B9YC 3QDNA 1PL2A 3GHAA 3HY2A 1XXUA 1AQXA 2GSRA 2I1UA 1PX7A 2VL2C 3GUSA 3QAVA 2C0GA 4RUVA 2IMIA 2YJHA 2H70A 1LBKA 16GSA 1SJ6A 3UIWA 4ECBA 3KH9A 1MDJA 2M72A 1W89A 3Q18A 1XWCA 2IJYA 4IBPA 1SD9A 1ZL9A 5D9XA 4Q5QA 1MDKA 3APQA 1QMVA 2OBKA 4OWYA 1A2MA 2DLXA 2GZZA 3VWXA 4HJ2A 2RM6A 1ST9A 1V2AA 5DQYA 4F03A 3C71A 2NPBA 1WOUA 4V1Ap 2A4VA 5BMUA 1FOVA 2AJQB 4TR1A 1Q4JA 1M99A 2EIRA 4K0GA 2HRKA 1G7OA 2H72A 2H8LA 4N0VA 4DSRA 3NIVA 3HXSA 2L5LA 3UBLA 1TU8A 3MDKA 1JZRA 2L5OA 2H74A 3TDGA 3FR6A 3GL5A 1NHOA 4BVXA 5D9VA 4F0BA 3QCPA 2PVQA 2KP2A 5CAXA 4JEDA 2RUEA 3I9V2 5IO2A 1R5PA 3M3MA 4OO5A 2HFDA 2QGVA 4IJ3A 4N0ZA 1JZDA 5IMDA 1T00A 3LSZA 4NHWA 4ZL7A 2CT6A 1ZGNA 2RM5A 3IPZA 1GRXA 1FW1A 3HZ4A 1TDIA 3CMIA 2YZHA 1T4YA 2V2GA 2YCDA 4K7IA 4PNFA 3MWHA 1Y6EA 5EY6A 3I6AA 2GSSA 2GVPA 4OCEA 3R2QA 2GQMA 2TIRA 3RPPA 1CQHA 3KP8A 5E4WA 5ECOB 3APSA 1SU9A 2GZYA 3QAGA 2R5GA 4IP1A 3TJFA 3TRXA 4HU9A 3P90A 3GURA 5HFGA 1SD8A 1EWXA 3ZREA 5D96A 1JZOA 4V1Ag 2IIYA 2AUVA 4K2DA 1WPIA 2X8CA 1GSFA 2XBQA 2REMA 2VIMA 2BMXA 4HQZA 5HR1A 4IJIA 5ECHB 2HRFA 5IMAA 5D9WA 1PL1A 1USBA 4YQMA 1XOAA 1MDIA 1LU4A 1OAZA 3QMXA 3M8NA 5HFKA 5JWOB 4TR1B 4ZBAA 1K0AA 3GFKA 1VF3A 5CREA 2HRKB 2GS3A 4ULXA 2VD0A 2CVDA 3N9JA 5INYA 4HZ4A 3F8UA 3S9FA 3VWVA 1B4PA 3H4KA 3IDVA 2FWHA 4ZL9A 3E9JB 1XCCA 1V58A 5CYYA 2X99A 4BVXB 3KP9A 1T1VA 3IC8A 2MZCA 1AQWA 4HI7A 2V41A 5HR0A 5ECQB 4ECJA 5HR3A 1WP0A 3LEFA 4PGTA 4MH3A 2V1MA 1TJDA 4ZB8A 2VCTA 5CRWA 3TCOA 5A4VA 1TTZA 5DCGA 4MK3A 2EIQA 3VI7A 2C80A 1WJKA 1HYUA 3UVTA 1GSEA 2M80A 4GF0A 6GSTA 3UOMA 3F4TA 2F9SA 2H1BA 3FYGA 1C72A 5H5SA 4PNGA 5J5NA 1T3BA 2WS2A 1E2YA 2IL3A 4MJBA 1K3LA 3CYNA 1M7TA 1TK8B 3W8JA 3FR9A 2CVKA 3M9JA 1M2BA 3ED3A 1TXXA 2X8GA 1G6WA 2OA7A 2LRTA 3IA1A 2B5XA 4WR4A 1UN2A 5H5QA 1EGOA 4POMA 3LGCA 2LV3A 1GL8A 4BVYA 6GSXA 2YOIA 5IOWA 2HZEA 4POBA 1M2DA 1FHEA 2O87A 1J08A 3KZQA 4PXOA 1Z5YE 1SKWB 2WULA 2OKAA 5JWRB 4NAXA 3WT1A 2N5BA 5J41A 6GSWA 3FR3A 1ERVA 1TP9A 3L4NA 5G5FA 5E59A 1GTBA 4FYCA 5ECSA 3EU3A 2MMAA 4O32A 4ZL8A 2HQTA 1QK8A 2BJXA 3FK8A 1GWCA 2OBIA 4GQFA 3O76A 3EVIA 4CHSA 4J56E 2L4QA 5LD0A 1XVWA 2XPDA 5AIVA 2C3TA 1O81A 1BX9A 2H0HA 4JZQA 5ELGA 3BCIA 4KDXA 3HZ8A 3LJRA 3G9BA 2YZUA 3A5WA 5AISA 1THXA 2MYGA 4HDEA 3LXTA 4K9ZA 6GSYA 2JZSA 5F8BA 5G1LA 2LEGA 1MD3A 1DSBA 5ID2A 1UC7A 3GNJA 3VPTA 1BQ7A 3A2XA 2LJRA 4KSMA 1VF2A 2O89A 1F6MC 4YH2A 2NBSA 1T7PB 4ID0A 1U3AA 2VM2A 1XOBA 2N5AA 5IMCA 2WFCA 2WJUA 1NW2A 3IE3A 2H01A 3L0HA 4RQXA 3GL3A 3FHKA 1KNGA 3FZ9A 1B8XA 1FVKA 2FNOA 3RHBA 1TKDB 2LJAA 1A2JA 3GKXA 5AGYA 1A2LA 3EINA 2O8VB 2F3MA 1X9MB 4GXZA 2JSYA 4MZBA 1PX6A 4WBJA 1SL0B 3QD9A 2GT6A 2YWOA 2LRCA 4BVYB 1S3CA 2HZEB 2VCVA 2ON7A 1G0TA 2A2RA 3DWVA 4LL4B 3IAS2 8GSSA 1HNAA 3ZVJD 3VWWA 1GNEA 3E3EA 2OE0A 1LJRA 5ECIB 1PKWA 2DJ2A 1TI3A 3EMPA 4MJEA 5G1KA 4IQ1A 2FUG2 3D0ZA 2H0IA 2E2GA 1O85A 2PBJA 4E8HA 3D6IA 1OKDA 4V2NA 1TK5B 4LMVA 4NV5A 3F4RA 3DGQA 2E2MA 3IK7A 4HZ2A 2QSIA 2YV7A 2YJ7A 2JL4A 1IYIA 2HRAA 3VPQA 3GSTA 4OO4A 1XWGA 1GSQA 5EPFA 3ZITA 2MMOA 1PSQA 1A0FA 3KMOA 3UVHA 1GH2A 4MJAA 1ZZYA 3PR8A 5KN3A 1K0CA 2HNLA 1EEMA 5DCHA 2JZTA 4MH2A 2FY6A 2C1YA 1OC8A 5DAKA 4ECCA 4EDZA 5DQSA 3BOAA 5ID2B 2HE3A 2B7KA 5F05A 2DJ0A 1A23A 5B7CA 2IPAA 2YV9A 2I3YA 5B8AA 2LUSA 1ZCPA 4K7OA 2JU5A 3RPNA 1BAYA 1WRYA 4XRAA 5ECPB 2VUPA 4USSA 1XW6A 2J23A 1ZYQB 3FZAA 3HCZA 4GSSA 1DE1A 3TB2A 4F9ZA 1SJIA 3VURA 5JCWA 1X5CA 2V6KA 4TW5A 2JADA 1IYHA 3GA4A 4EVMA 1K0MA 2KUCA 1ZOFA 4ZB6A 4RQRA 4DVCA 3E0UA 5G30A 4NV2A 4PX1A 3TOUA 4OFNA 4WETA 4AJ7A 3FEUA 2ALBA 6GSVA 5JCGA 2R37A 1XWBA 2L6CA 1K0DA 3P2AA 4MF7A 2FWEA 5AIXA 4GRFA 4KAEA 1GLPA 1S3DA 2IWTA 3QFAC 2KHPA 3LWAA 1QGVA 2LNSA 3UBKA 3TJGA 1PKZA 1Z7PA 4IHUA 2H6ZA 2L57A 3KTBA 4G10A 3FRCA 3HYPA 1TRUA 2NDOA 2HSNB 2VCQA 5GSTA 4WF5A 3EYTA 1AXDA 2OACA 2H75A 4IVFA 2RIIA 2P0GA 3QR6A 3UL3A 1DE2A 1Z6NA 3F6FA 3ZTLA 4D73A 4AJ8A 5A4WA 1RK4A 4ZBBA 2O7KA 4PQIA 2WB9A 1RW1A 4HJMA 4YQVA 2GSQA 3SWLA 3G7JA 4I8BA 4JR4A 5LCZA 2B3SA 5F06A 1V40A 2XBIA 2HLSA 2F51A 3QPMA 3GN3A 4WF4A 1CQGA 4IW9A 1XW9A 2VOCA 4G2EA 4IS0A 3JCML 4FQUA 13GSA 4ZILA 5DAKB 1GUMA 2P31A 2IMEA 19GSA 1TRWA 1OKTA 4ECIA 2VCWA 2N5FA 2GQLA 4JR6A 4X43A 2YWIA 4J57E 4TXOA 2OADA 4ZB9A 3M9KA 1Z7RA 2LTKA 1GTAA 1F3AA 2VAFA 5J9BA 2Z9SA 2HSMA 2GSTA 3TKSC 14GSA 3CBUA 4FO5A 3M1GA 5B6NA 3CSHA 4LA1A 5CRDA 1U88A 3EWLA 2PWJA 4IP6A 3EU4A 2M46A 1QQ2A 3KTLA 4DSSA 4EDYA 3NOFA 2XPEA 1XPVA 6GSSA 10GSA 1S3AA 5L71A 1EP7A 5DDLA 5KEJA 3TGZA 2K6VA 2ON5A 3GX8A 2PGTA 2C0EA 3L9UA 2DJ3A 3ZLPA 3DVXA 3GRXA 1Z9HA 4O5RA 1O73A 3FZ4A 3HJPA 3IR4A 4RI7A 4QL7A 5ECKB 3GYKA 1FG4A 2UZ8A 1Z3EA 4F2IA 1KBNA 1W4VA 2JSZA 4KE3A 3GSSA 1H75A 2H73A 1SKSB 1XFLA 4GQCA 3GKNA 3KXOA 5LNKe 1XVQA 3ZRDA 3BCKA 3ZFLA 4XHMA 4OD7A 3DRNA 1ACVA 2R4VA 2JACA 2V6OA 3HVSA 4D73B 1THOA 3ISOA 2F8FA 3TKQA 1ERUA 1SK2A 4IN0A 1V57A 1YF1A 5D9TA 2B7JA 1X9SB 3F63A 3HVXA 2IMKA 3UJ1A 1YY7A 1U6TA 1VF1A 1X5DA 4IQAA 4BWSA 2VL2A 2F8AA 2H1GA 1K3OA 3KMNA 1SK1A 2QC7A 4X0XA 3L9SA 4BA7A 4I2UA 4I6XA 4KF9A 1F2EA 2JZRA 1TOFA 3GIXA 3J7Yb 2MMNA 3A2WA 5F07A 2AYTA 4X1UA 5CRHA 3J7Yk 1AW9A 3D4TA 1F9MA 3CTGA 1J0FA 1ML6A 4TXOB 1ABAA 4EO3A 3BBYA 3WD6A 2DBCA 22GSA 5IPGA 3KIJA 5FT3A 4LMWA 2HYXA 1YZXA 1HNCA 2AV4A 2HSMB 1YEXA 1GULA 1PRXA 3Q6OA 5D93A 5IMVA 3KH7A 1G6YA 1BJXA 2EC4A 1O8WA 4DSSB 3HJOA 2NVLA 5D8IA 1ERWA 4HS1A 5DVBA 11GSA 3GMFA 1XZOA 4MP4A 4KB3A 1E6BA 3VK9A 3CSIA 5ECRB 4ZBDA 3HVVA 5DJMA 1SL2B 2E0QA 6GSUA 2YPMA 4NMUA 5IO0A 2H66A 1TU7A 7GSSA 1EV9A 4IGJA 2P5RA 2VL9A 3LQ7A 4MF6A 2H0GA 5A5KA 2DMLA 1SENA 1XIYA 2HSHA 4Q5NA 2CQ9A 2VM1A 2AB6A 3LYKA 3DXBA 1U3IA 4V2LA 1A8LA 3IC4A 1FB6A 1WWJA 3LXZA 1VGLA 4MABA 5J4UA 2H1AA 3TRQA 3A3TA 2YP6A 4ZIJA 4XS1A 1FAAA 2ZUPA 2NTOA 2LQOA 3GH6A 4PTSA 5IMZA 4P3YB 1XWAA 1YKAA 2GQKA 3D4MA 1QXHA 3SBCA 3VI5A 2DJJA 2PUKC 5ENUA 1TK0B 1NSWA 3ZMLA 4KW6A 2H19A 1A0RP 17GSA 3KEBA 1ZYEA 4Q5FA 1SJZA 3W6GA 3ZFBA 2B5YA 4HOJA 2PVOC 2XHFA 1U87A 3DEXA 3KCMA 2OJLA 5DBQA 5DALA 1T8EB 2PU9C 3CTFA 1EOHA 4NPBA 3C8EA 2YWMA 1ILOA 3LYPA 2X8HA 4GSNA 1KEBA 3FY7A 1O6JA 3O3TA 1PD21 4WKWA 5ABRA 2B5EA 1TRVA 1WIKA 5COHA 3O6TA 4IKHA 2BTOT 3HHVA 1UVZA 3OR5A 2WRTA 1OC9A 4I97A 3EMXA 4OMVA 2WCIA 5JWQB 4L8EA 1DBYA 4ML6A 1OC3A 1Q98A 5C00A 2I4AA 1GLQA 12GSA 4KA0A 2ZNMA 4I2TA 1X9WB 1EGRA 1K0BA 2GDRA 4EC0A 4G19A 5C04A 4GLTA 1FB0A 4MLYA 2X64A 3CSJA 3ZL5A 3C73A 2FA4A 3H8QA 1R26A 5EVOA 3EURA 3RBTA 4MZWA 4N11A 2MBSA 1DUGA 1X5EA 5IMFA 2FWGA 1UA5A 3C1RA 1T4ZA 3IXRA 2FGXA 4CDOA 4JU5A 3W8SA 1HNBA 4L5LA 1YQ1A 1AIUA 3L78A 2KOKA 1F3BA 4EXJA 3ZZXA 2IFQA 5CRGA 1OE8A 1QUWA 4JBBA 5AN1A 4OFTA 3TUEA 2B1LA 2C4JA 3MSZA 4GCIA 2DIYA 3BD2A 1AAZA 2K8SA 3Q74A 2CX3A 1BYEA 3GH9A 1EEJA 5CNWA 1GP1A 2EIOA 2CZ2A 3IBHA 3DYRA 2FWFA 3H93A 2VLVA 4Z7XA 5CO3A 3APOA 4MA9A 1YDKA 2L4CA 5B8BA 2I81A 3TJBA 2VD1A 2LRNA 2LS5A 3L9VA 2VLUA 3LG6A 4G9HA 1GTIA 2GLRA 2G0FA 2PPTA 1YEPA 2AHEA 4PUFC 4KH7A 2KP1A 1ERTA 4TN8A 4HU7A 1XBSA 1I9DA 2HSYA 4EKZA 4TR3A 3GX0A 2WZ9A 5DALB 1FO5A 1GTUA 1RQMA 3H79A 4FYBA 2H30A 2FHEA 3LFLA 3RDWA 18GSA 2HI7A 3GV1A 2HZFA 1R5AA 4BPYA 4I5QA 5H5RA 2VLTA 2G2QA 3F0IA 2RUFA 4TXVA 1YKCA 4TKYA 4XTSA 3D5JA 4GSTA 4PQHA 2HT9A 2PMTA 1OC9B 3ME7A 3IK9A 4MPFA 2CAIA 1R7HA 3AY8A 3IHQA 5KN1A 5IQYA 4XCSA 3TJJA 5IOXA 1N2AA 1AUCA 4HQSA 1TI1A 3KGKA 5GAPD 1GSDA 3DIEA 1Y25A 3C1SA 1PMTA 5ECMB 3V1WA 2TRCP 1G7EA 2DIZA 1JFUA
chains in the Genus database with same CATH superfamily
2E7PA 1URMA 1M3IA 4GWRA 3F3QA 2KLXA 4DSQA 1K0OA 3ERFA 1SYRA 4K8MA 1V98A 3G7IA 1Z6MA 4KDUA 4WXTA 2IFQB 3UMAA 1TW9A 1YJ6A 2FCHA 2R6KA 4FH8A 2YNXA 2AAWA 3HJMA 1EZKA 1SK0A 1M0UA 3N5OA 4OCFA 1K3YA 4G0KA 4ML1A 4YAPA 4EUYA 3VWUA 2H71A 1O8XA 1SL1B 4J2FA 3EPTA 3ME8A 3WGDA 3ERGA 2DC5A 4MMMA 1MD4A 3F6DA 2J9HA 3F4SA 4K7NA 4EF0A 4KUNA 4PURA 2RLIA 2ZCTA 1BG5A 4MZCA 2LQQA 4XIHA 2WDUA 1I5GA 3GKMA 4AI6A 3RGBC 3ERWA 1PGTA 2GZPA 4MF5A 3WGXA 1R4WA 4IELA 3G7YA 4L0UA 2MMZA 4ACSA 2LSTA 5ECNB 4AGSA 3I43A 4ISDA 3VLNA 4XS4A 2IMDA 1NHYA 4TRXA 2HRNA 2CZ3A 3WT2A 3ZIJA 3HKRA 3R3EA 5G2ZA 3IAM2 2WGRA 1KTEA 4WBRD 1EV4A 4F82A 2YN1A 2D2ZA 2MBTA 5FWGA 1X0RA 2K8VA 4O92A 20GSA 1S3RA 1JLVA 2OE3A 3A2VA 2CVBA 1SVLA 2IN3A 1OE7A 3WYWA 4PUAA 1ZYNA 3TKPA 4BL7A 2C8UA 5G5EA 1B4QA 3KD0A 4CW9A 4LLRA 1QFNA 4MPGA 5KN2A 3DVWA 3TRPA 2R3XA 3K8NA 4AF2A 4NHZA 2FLSA 3US3A 4HEA2 3RHCA 4E8EA 2B1KA 2VCXA 1PQNA 3UEMA 4F0CA 3VFIA 2CA8A 4N30A 4K0NA 2OE1A 1M9AA 1TRSA 2V32A 4AKIA 1BEDA 5G31A 2O85A 2C3NA 4WR5A 2P5QA 5GZZB 4MJCA 1I1IP 1J9BA 1N8JA 1PA3A 2HXKA 2EFEA 3FW2A 4KSOA 4EE0A 4L5OA 1SKRB 2PN8A 2LNTA 2CX4A 3H1NA 4YQUA 1ON4A 3GTUA 2WVZA 3MAKA 4G0IA 1JLWA 4H86A 4GTUA 5A4UA 3ZMKA 1MEKA 4RI6A 4XS6A 4KX4A 1N25A 4MCUA 2DJKA 3P8WA 5D73A 4NXIA 2H6YA 3PPUA 3EC3A 4DEJA 1B9XC 5F0GA 2K18A 1VRSD 4OFMA 2FA8A 2CAQA 1OYJA 2GTUA 4QQ7A 3MNGA 3BJ5A 2PERA 2VCZA 1AC1A 2YWNA 2R2JA 1M2AA 2WW2A 3P7XA 1XWKA 3U5RE 1ZMAA 5IIZA 2I9HA 4XS4B 4K1FA 3HVNA 2VL3A 3QFBC 3FZ5A 4QL9A 3DKSA 3TJKA 2H76A 5IPHA 4PQ1A 5ECLB 1F37A 3WGEA 1OVNA 1YF0A 4K6XA 3UARA 1EOGA 1HD2A 5J9CA 2DMMA 3LORA 3ZYWA 4G0LA 5CP1A 1XW5A 1WE0A 5J40A 3TOTA 4KNDA 2B6MA 4TOPA 3KM6A 2GGTA 4ZXGA 2CV4A 3EE2A 3CRUA 3RAZA 2L6DA 4N10A 3UAPA 4AJ6A 4BL7B 3IRAA 2FD3A 3QOUA 2LKUA 2DSAA 3F3RA 2H1DA 4EIPA 3U6VA 1A8YA 3PH9A 1MTCA 5JCUA 1O7UA 2LJKA 4TR4A 3TKRA 1AQVA 4KCEA 3HDCA 3CXGA 5A34A 4POKA 2XC2A 3ZIVA 3HA9A 4LL1B 4V2MA 4EL1A 5KN0A 3MYDA 4KCAA 4L0WA 4Q5RA 4HUAA 1JZWA 3C7MA 5IM9A 3KJYA 1YVLA 5GSSA 2DKHA 2C3QA 1GUKA 2K9FA 3HD5A 5HFIA 3ZVJA 1GSYA 1VF4A 1K0NA 1GSSA 2ES7A 2O3EA 4POLA 4FIWA 3CRTA 2QA1A 1GSUA 1SYXA 3I69A 5B6MA 3GTUB 3NZNA 2YANA 1V9WA 3PGTA 4WEYA 2VO4A 3PINA 4JRRA 1H4OA 3GKKA 5HQPA 2A2SA 2TRXA 3TKSE 4MDCA 3D22A 2IMFA 1EP8A 4ILFA 5EL8A 3M0FA 4TR0A 4KGIA 1A24A 2C0FA 1HQOA 2C0DA 3TKSA 3QAWA 2L59A 3DMLA 1GNWA 5ELAA 1PN9A 1NM3A 1JHBA 5FHIA 2H6XA 1B48A 4KDYA 3IV4A 1XG8A 4YAVA 4TVEA 1FVJA 4NWYA 5HR2A 4JE1A 3IHGA 3D21A 9GSSA 3DD3A 4FYUA 2DJ1A 4O5QA 3F9UA 4XRDA 1WMJA 3IOSA 1ZYPA 5GAND 1GUHA 5DJLA 2QKEA 3Q19A 3FKFA 1M9BA 4BWQA 2GT5A 5J3RA 4O7HA 1B9YC 3QDNA 1PL2A 3GHAA 3HY2A 1XXUA 1AQXA 2GSRA 2I1UA 1PX7A 2VL2C 3GUSA 3QAVA 2C0GA 4RUVA 2IMIA 2YJHA 2H70A 2WZSA 1LBKA 16GSA 1SJ6A 3UIWA 4ECBA 3KH9A 1MDJA 2M72A 1W89A 3Q18A 1XWCA 2IJYA 4IBPA 1SD9A 1ZL9A 5D9XA 4Q5QA 1MDKA 3APQA 1QMVA 2OBKA 4OWYA 1A2MA 2DLXA 2GZZA 3VWXA 4HJ2A 2RM6A 1ST9A 1V2AA 5DQYA 5A34B 4CY8A 4F03A 3CHXC 3C71A 2NPBA 1WOUA 4V1Ap 2A4VA 5BMUA 1FOVA 2AJQB 4TR1A 1Q4JA 1M99A 2EIRA 4K0GA 2HRKA 3TU3B 1G7OA 2H72A 2H8LA 4O5UA 4N0VA 1PFOA 4DSRA 3NIVA 3HXSA 2L5LA 3UBLA 1TU8A 3MDKA 1JZRA 2L5OA 2H74A 3TDGA 4BIKA 3FR6A 3GL5A 1NHOA 4BVXA 5D9VA 4F0BA 3QCPA 2PVQA 2KP2A 5CAXA 4JEDA 2RUEA 3I9V2 5IO2A 1R5PA 3M3MA 4OO5A 2HFDA 2QGVA 4IJ3A 3A5IA 4N0ZA 1JZDA 5IMDA 1T00A 3LSZA 4NHWA 4ZL7A 2CT6A 1ZGNA 2RM5A 3IPZA 1GRXA 1FW1A 3HZ4A 1TDIA 3CMIA 4ICYA 2YZHA 1T4YA 2V2GA 2YCDA 4K7IA 4PNFA 3MWHA 1Y6EA 5EY6A 3I6AA 2GSSA 2GVPA 4OCEA 3R2QA 2GQMA 2TIRA 3RPPA 1CQHA 3KP8A 5E4WA 5ECOB 3APSA 1SU9A 2GZYA 3QAGA 2R5GA 4IP1A 3TJFA 3TRXA 4HU9A 3P90A 3GURA 5HFGA 1SD8A 2OT3A 1EWXA 5J47A 3ZREA 5D96A 1JZOA 4V1Ag 2IIYA 2AUVA 4K2DA 1WPIA 2X8CA 2R0PA 1GSFA 2XBQA 2REMA 2VIMA 2BMXA 4HQZA 5HR1A 4IJIA 5ECHB 2HRFA 5IMAA 5KOXA 5D9WA 1PL1A 1USBA 4YQMA 1XOAA 1MDIA 1LU4A 1OAZA 3QMXA 4Z2UA 5BMUB 3M8NA 5HFKA 5JWOB 4TR1B 4ZBAA 1K0AA 3GFKA 2EFHA 1VF3A 5CREA 2HRKB 2GS3A 4ULXA 2VD0A 2CVDA 3N9JA 5INYA 4HZ4A 3F8UA 3S9FA 3VWVA 1B4PA 3H4KA 3IDVA 2FWHA 4ZL9A 3E9JB 1XCCA 1V58A 5CYYA 2X99A 4BVXB 3KP9A 1T1VA 3IC8A 2MZCA 1AQWA 4HI7A 2V41A 5HR0A 5ECQB 1BG1A 4ECJA 5HR3A 1WP0A 3LEFA 2O36A 4PGTA 4MH3A 2V1MA 1TJDA 4ZB8A 2VCTA 5CRWA 3TCOA 4HSCX 5A4VA 1TTZA 5DCGA 4MK3A 2EIQA 3VI7A 2C80A 1WJKA 1HYUA 3UVTA 1GSEA 2M80A 4GF0A 6GSTA 4G01A 3UOMA 3F4TA 2F9SA 2H1BA 3FYGA 1C72A 5H5SA 4PNGA 5J5NA 1T3BA 2WS2A 1E2YA 2IL3A 4MJBA 1K3LA 3CWGA 3CYNA 1M7TA 1SVOA 1TK8B 3MIXA 3W8JA 3FR9A 2CVKA 3M9JA 1M2BA 3ED3A 1TXXA 2X8GA 1G6WA 5A5HA 1SVMA 3FMWA 2OA7A 2LRTA 3IA1A 2B5XA 4WR4A 1UN2A 5H5QA 1EGOA 4POMA 3LGCA 2LV3A 1GL8A 4BVYA 6GSXA 2YOIA 5IOWA 2HZEA 4POBA 1M2DA 1FHEA 2O87A 4AKGA 1J08A 3KZQA 4PXOA 1Z5YE 1SKWB 2WULA 2OKAA 5JWRB 4NAXA 3WT1A 2N5BA 5J41A 6GSWA 3FR3A 1ERVA 1TP9A 3L4NA 1PN0A 5G5FA 5E59A 1GTBA 2H1LA 4FYCA 5ECSA 3EU3A 2MMAA 4O32A 4ZL8A 2HQTA 1QK8A 2BJXA 3FK8A 1GWCA 2OBIA 4GQFA 3O76A 3EVIA 4CHSA 4J56E 2L4QA 5LD0A 1XVWA 2XPDA 2WVXA 5AIVA 2C3TA 1O81A 1BX9A 2H0HA 4Z2TA 4JZQA 5ELGA 3BCIA 4KDXA 3HZ8A 3LJRA 3G9BA 2YZUA 3A5WA 5AISA 1THXA 2MYGA 4HDEA 3LXTA 3CQFA 4K9ZA 6GSYA 2JZSA 5F8BA 5G1LA 2LEGA 1MD3A 1DSBA 3HMJG 5ID2A 1UC7A 3GNJA 3VPTA 1BQ7A 3A2XA 1S4BP 2LJRA 4KSMA 1VF2A 2O89A 4MNNA 1F6MC 4YH2A 2NBSA 1T7PB 4ID0A 1U3AA 2VM2A 1XOBA 2N5AA 5IMCA 2WFCA 2WJUA 1NW2A 3IE3A 2H01A 3L0HA 4RQXA 3GL3A 3FHKA 1KNGA 3FZ9A 1B8XA 1FVKA 2FNOA 3RHBA 2R0GA 1TKDB 2LJAA 1A2JA 3GKXA 5AGYA 1A2LA 3EINA 2O8VB 5A5HB 2F3MA 1X9MB 4GXZA 2JSYA 4MZBA 1PX6A 4WBJA 1SL0B 3QD9A 2GT6A 2YWOA 2LRCA 4BVYB 1S3CA 2HZEB 2VCVA 2ON7A 1G0TA 2A2RA 3DWVA 4LL4B 3IAS2 8GSSA 1HNAA 3ZVJD 4E68A 3VWWA 1GNEA 3E3EA 2OE0A 1LJRA 4K5RA 5ECIB 1PKWA 2DJ2A 1TI3A 3EMPA 4MJEA 5G1KA 4IQ1A 2FUG2 3D0ZA 2H0IA 2E2GA 1O85A 2PBJA 4E8HA 3D6IA 1OKDA 2HSNA 4V2NA 1TK5B 4LMVA 4NV5A 3F4RA 3DGQA 2E2MA 3IK7A 4HZ2A 2QSIA 2YV7A 2YJ7A 2JL4A 1IYIA 4PI2C 2HRAA 3VPQA 3GSTA 4OO4A 5J4YA 2WVXB 1XWGA 1GSQA 5EPFA 3ZITA 2MMOA 1PSQA 1A0FA 3KMOA 3UVHA 1GH2A 4MJAA 4K5SA 1ZZYA 3PR8A 5KN3A 1K0CA 2HNLA 1EEMA 5DCHA 2JZTA 4MH2A 2FY6A 2C1YA 1OC8A 5DAKA 4ECCA 4EDZA 5DQSA 3BOAA 5ID2B 2HE3A 2B7KA 5F05A 2DJ0A 1A23A 5B7CA 2IPAA 2YV9A 2I3YA 5B8AA 2LUSA 1ZCPA 4K7OA 2JU5A 3RPNA 1BAYA 1WRYA 4XRAA 5ECPB 2VUPA 4USSA 1FOHA 1XW6A 2J23A 1ZYQB 3FZAA 3HCZA 4GSSA 1DE1A 3TB2A 4F9ZA 1SJIA 3VURA 5JCWA 1X5CA 2V6KA 1YEWC 4TW5A 2JADA 4ZB7A 1IYHA 3GA4A 4EVMA 4YKGA 1K0MA 1M3JA 2KUCA 1ZOFA 4ZB6A 4RQRA 4DVCA 3E0UA 5G30A 4NV2A 4PX1A 3TOUA 4OFNA 4WETA 4AJ7A 3FEUA 2ALBA 6GSVA 5JCGA 2R37A 1XWBA 2L6CA 2R0CA 1K0DA 3P2AA 4MF7A 2FWEA 5AIXA 4GRFA 4KAEA 1GLPA 1S3DA 2IWTA 3QFAC 2KHPA 3LWAA 1QGVA 2LNSA 3UBKA 3TJGA 1PKZA 1Z7PA 4IHUA 2H6ZA 2L57A 3KTBA 4G10A 3FRCA 3HYPA 1TRUA 2NDOA 2HSNB 4W66A 2VCQA 5GSTA 4WF5A 2WW0A 3EYTA 1AXDA 2WW1A 2OACA 2H75A 4IVFA 2RIIA 2P0GA 3QR6A 3UL3A 1DE2A 1Z6NA 3F6FA 3ZTLA 4D73A 4AJ8A 5A4WA 1RK4A 4ZBBA 2O7KA 4PQIA 2WB9A 1RW1A 4HJMA 4YQVA 2GSQA 3SWLA 3G7JA 4I8BA 4JR4A 5LCZA 2B3SA 5F06A 1V40A 2XBIA 2HLSA 2F51A 3QPMA 3GN3A 4WF4A 1CQGA 4IW9A 1XW9A 2VOCA 4G2EA 4IS0A 3JCML 4FQUA 13GSA 4ZILA 5DAKB 1GUMA 2P31A 2IMEA 19GSA 1TRWA 1OKTA 4ECIA 2VCWA 2N5FA 2GQLA 4Z2RA 4JR6A 4X43A 2YWIA 4J57E 4TXOA 2OADA 4ZB9A 3M9KA 1Z7RA 2LTKA 1GTAA 1F3AA 2VAFA 5J9BA 2Z9SA 2HSMA 2GSTA 3TKSC 14GSA 3CBUA 4FO5A 3M1GA 5B6NA 3CSHA 4LA1A 5CRDA 1U88A 3EWLA 2PWJA 4IP6A 3EU4A 2M46A 1QQ2A 3KTLA 4DSSA 4EDYA 3NOFA 2XPEA 1XPVA 6GSSA 10GSA 1S3AA 5L71A 1EP7A 5DDLA 5KEJA 2A2PA 5BRTA 3TGZA 2K6VA 2ON5A 3GX8A 2PGTA 2C0EA 3L9UA 2DJ3A 3ZLPA 3DVXA 3GRXA 1Z9HA 4O5RA 1O73A 3FZ4A 3HJPA 3IR4A 4RI7A 4QL7A 5ECKB 3GYKA 1FG4A 2UZ8A 1Z3EA 4F2IA 1KBNA 1W4VA 2JSZA 4KE3A 3GSSA 1H75A 2H73A 5A1NA 1SKSB 1XFLA 5KOWA 4GQCA 3GKNA 3KXOA 5LNKe 1XVQA 3ZRDA 3BCKA 3ZFLA 4XHMA 4OD7A 3DRNA 1ACVA 2R4VA 2JACA 2V6OA 3HVSA 4D73B 4X4JA 1THOA 3ISOA 2F8FA 3TKQA 1ERUA 1SK2A 4IN0A 1V57A 1YF1A 5D9TA 2B7JA 1X9SB 3F63A 3HVXA 2IMKA 3UJ1A 1Y1UA 1YY7A 1U6TA 1VF1A 1X5DA 4IQAA 4BWSA 2VL2A 2F8AA 2H1GA 1K3OA 3KMNA 1SK1A 2QC7A 4X0XA 3L9SA 4BA7A 4AKXB 4I2UA 4I6XA 4KF9A 1F2EA 2JZRA 1TOFA 3GIXA 3J7Yb 2MMNA 3A2WA 5F07A 2AYTA 4X1UA 5CRHA 3J7Yk 1AW9A 4YKFA 3D4TA 1F9MA 3CTGA 1J0FA 1ML6A 4TXOB 1ABAA 4EO3A 3BBYA 3WD6A 2DBCA 22GSA 5IPGA 3KIJA 5FT3A 4LMWA 2HYXA 1YZXA 1HNCA 2AV4A 2HSMB 1YEXA 1GULA 1PRXA 3Q6OA 5D93A 5IMVA 3KH7A 1G6YA 1BJXA 2EC4A 1O8WA 4DSSB 3HJOA 3RFRC 2NVLA 1ERWA 4HS1A 5D8IA 5DVBA 11GSA 3GMFA 1XZOA 4MP4A 4KB3A 1E6BA 3VK9A 3CSIA 5ECRB 4ZBDA 3HVVA 5DJMA 2X49A 1SL2B 2E0QA 6GSUA 2YPMA 4NMUA 5IO0A 2WVYA 2H66A 1TU7A 7GSSA 1EV9A 4IGJA 2P5RA 2VL9A 3LQ7A 4MF6A 2H0GA 5A5KA 2DMLA 1SENA 1XIYA 2HSHA 4Q5NA 2CQ9A 2VM1A 2AB6A 3LYKA 3DXBA 1U3IA 4V2LA 1A8LA 3IC4A 5A1NB 1FB6A 1WWJA 3LXZA 1VGLA 4MABA 5J4UA 2H1AA 3TRQA 3A3TA 2UV8G 2YP6A 4ZIJA 4XS1A 1FAAA 2ZUPA 2NTOA 2LQOA 3GH6A 4PTSA 5IMZA 4P3YB 2EFDA 1XWAA 1YKAA 2GQKA 3D4MA 1QXHA 3SBCA 3VI5A 2DKIA 4N3ZA 2DJJA 2PUKC 5ENUA 1TK0B 1NSWA 3ZMLA 4KW6A 2H19A 1A0RP 17GSA 3KEBA 1ZYEA 2QA2A 4Q5FA 1SJZA 3W6GA 3ZFBA 2B5YA 4HOJA 2PVOC 2XHFA 1U87A 3DEXA 3KCMA 2OJLA 5DBQA 5DALA 1T8EB 2PU9C 3CTFA 1EOHA 4NPBA 3C8EA 2YWMA 4AKHA 1ILOA 3LYPA 2X8HA 4GSNA 2X4AA 1KEBA 3FY7A 1O6JA 3O3TA 1PD21 4WKWA 5ABRA 2B5EA 1TRVA 1WIKA 5COHA 3O6TA 4IKHA 2BTOT 3HHVA 1UVZA 3OR5A 2WRTA 4GDFA 1OC9A 4I97A 3EMXA 4OMVA 4QMKA 1BF5A 2WCIA 5JWQB 4L8EA 1DBYA 4ML6A 1OC3A 1Q98A 5C00A 4A5PA 2I4AA 1GLQA 12GSA 4KA0A 2ZNMA 2EFCA 4I2TA 1X9WB 1EGRA 1K0BA 2GDRA 4EC0A 4G19A 5C04A 4GLTA 2WW3A 1FB0A 4MLYA 2X64A 3CSJA 3ZL5A 3C73A 2FA4A 3H8QA 1R26A 5EVOA 3EURA 3RBTA 4MZWA 4N11A 2MBSA 1DUGA 1X5EA 5IMFA 2FWGA 1UA5A 3C1RA 1T4ZA 3IXRA 2FGXA 4CDOA 4JU5A 3W8SA 1HNBA 4L5LA 1YQ1A 1AIUA 3L78A 2KOKA 1F3BA 4EXJA 3ZZXA 2IFQA 5CRGA 1OE8A 2O5VA 1QUWA 4JBBA 5AN1A 4OFTA 3TUEA 2B1LA 2C4JA 3MSZA 4GCIA 2DIYA 3BD2A 1AAZA 2K8SA 3Q74A 2CX3A 5J4VA 1BYEA 3GH9A 1EEJA 5CNWA 1GP1A 2EIOA 2CZ2A 1TXUA 3IBHA 3DYRA 2FWFA 3H93A 2VLVA 4K2XA 4Z7XA 5CO3A 3APOA 4MA9A 1YDKA 3LW9A 2L4CA 5B8BA 2I81A 3TJBA 2VD1A 2LRNA 2LS5A 3L9VA 2VLUA 3LG6A 4G9HA 4PHZC 1GTIA 2GLRA 2G0FA 2PPTA 1YEPA 2AHEA 4PUFC 4KH7A 2KP1A 1ERTA 4EIQA 4TN8A 4HU7A 2VKZG 1XBSA 4PI0C 1I9DA 2HSYA 4EKZA 4TR3A 3GX0A 2WZ9A 5DALB 1FO5A 1GTUA 4CY6A 1RQMA 2A4HA 3H79A 4FYBA 2H30A 2FHEA 3LFLA 3RDWA 18GSA 4FXYP 2HI7A 3GV1A 2HZFA 1R5AA 4BPYA 4I5QA 5H5RA 2VLTA 2G2QA 3F0IA 2RUFA 4TXVA 1YKCA 4TKYA 4XTSA 3D5JA 4GSTA 4PQHA 2HT9A 2PMTA 1OC9B 3ME7A 3IK9A 4MPFA 2CAIA 1R7HA 3AY8A 3IHQA 5KN1A 5IQYA 4XCSA 3TJJA 5IOXA 1N2AA 1AUCA 4HQSA 1TI1A 3KGKA 5GAPD 1GSDA 3DIEA 1Y25A 3C1SA 1PMTA 5ECMB 3V1WA 2TRCP 1G7EA 2DIZA 1JFUA
chains in the Genus database with same CATH topology
2E7PA 1URMA 4GWRA 3F3QA 2KLXA 4DSQA 1K0OA 3ERFA 1SYRA 4K8MA 1V98A 3G7IA 1Z6MA 4KDUA 4WXTA 2IFQB 3UMAA 1TW9A 1YJ6A 2FCHA 2R6KA 4FH8A 2YNXA 2AAWA 3HJMA 1EZKA 1SK0A 1M0UA 3N5OA 4OCFA 1K3YA 4G0KA 4ML1A 4YAPA 4EUYA 3VWUA 2H71A 1O8XA 1SL1B 4J2FA 3EPTA 3ME8A 3WGDA 3ERGA 2DC5A 4MMMA 1MD4A 3F6DA 2J9HA 3F4SA 4K7NA 4EF0A 4KUNA 4PURA 2RLIA 2ZCTA 1BG5A 4MZCA 2LQQA 4XIHA 2WDUA 1I5GA 3GKMA 4AI6A 3ERWA 1PGTA 2GZPA 4MF5A 3WGXA 1R4WA 4IELA 3G7YA 4L0UA 2MMZA 4ACSA 2LSTA 5ECNB 4AGSA 3I43A 4ISDA 3VLNA 4XS4A 2IMDA 1NHYA 4TRXA 2HRNA 2CZ3A 3WT2A 3ZIJA 3HKRA 3R3EA 5G2ZA 3IAM2 2WGRA 1KTEA 4WBRD 1EV4A 4F82A 2YN1A 2D2ZA 2MBTA 5FWGA 1X0RA 2K8VA 4O92A 20GSA 1JLVA 2OE3A 3A2VA 2CVBA 1SVLA 2IN3A 1OE7A 3WYWA 4PUAA 1ZYNA 3TKPA 4BL7A 2C8UA 5G5EA 1B4QA 3KD0A 4CW9A 4LLRA 1QFNA 4MPGA 5KN2A 3DVWA 3TRPA 2R3XA 3K8NA 4AF2A 4NHZA 2FLSA 3US3A 4HEA2 3RHCA 4E8EA 2B1KA 2VCXA 1PQNA 3UEMA 4F0CA 3VFIA 2CA8A 4N30A 4K0NA 2OE1A 1M9AA 1TRSA 2V32A 4AKIA 1BEDA 5G31A 2O85A 2C3NA 4WR5A 2P5QA 5GZZB 4MJCA 1J9BA 1N8JA 1PA3A 2HXKA 2EFEA 3FW2A 4KSOA 4EE0A 4L5OA 1SKRB 2PN8A 2LNTA 2CX4A 3H1NA 4YQUA 1ON4A 3GTUA 3MAKA 4G0IA 1JLWA 4H86A 4GTUA 5A4UA 3ZMKA 1MEKA 4RI6A 4XS6A 4KX4A 1N25A 4MCUA 2DJKA 3P8WA 5D73A 4NXIA 2H6YA 3PPUA 3EC3A 4DEJA 1B9XC 5F0GA 2K18A 1VRSD 4OFMA 2FA8A 2CAQA 1OYJA 2GTUA 4QQ7A 3MNGA 3BJ5A 2PERA 2VCZA 1AC1A 2YWNA 2R2JA 1M2AA 3P7XA 1XWKA 3U5RE 1ZMAA 5IIZA 2I9HA 4XS4B 4K1FA 2VL3A 3QFBC 3FZ5A 4QL9A 3DKSA 3TJKA 2H76A 5IPHA 4PQ1A 5ECLB 1F37A 3WGEA 1OVNA 1YF0A 4K6XA 3UARA 1EOGA 1HD2A 5J9CA 2DMMA 3LORA 3ZYWA 4G0LA 5CP1A 1XW5A 1WE0A 5J40A 3TOTA 4KNDA 2B6MA 4TOPA 3KM6A 2GGTA 4ZXGA 2CV4A 3EE2A 3CRUA 3RAZA 2L6DA 4N10A 3UAPA 4AJ6A 4BL7B 3IRAA 2FD3A 3QOUA 2LKUA 2DSAA 3F3RA 2H1DA 4EIPA 3U6VA 1A8YA 3PH9A 1MTCA 5JCUA 1O7UA 2LJKA 4TR4A 3TKRA 1AQVA 4KCEA 3HDCA 3CXGA 5A34A 4POKA 2XC2A 3ZIVA 3HA9A 4LL1B 4V2MA 4EL1A 5KN0A 3MYDA 4KCAA 4L0WA 4Q5RA 4HUAA 1JZWA 3C7MA 5IM9A 3KJYA 1YVLA 5GSSA 2DKHA 2C3QA 1GUKA 2K9FA 3HD5A 5HFIA 3ZVJA 1GSYA 1VF4A 1K0NA 1GSSA 2ES7A 4POLA 4FIWA 3CRTA 2QA1A 1GSUA 1SYXA 3I69A 5B6MA 3GTUB 3NZNA 2YANA 1V9WA 3PGTA 4WEYA 2VO4A 3PINA 4JRRA 1H4OA 3GKKA 5HQPA 2A2SA 2TRXA 3TKSE 4MDCA 3D22A 2IMFA 1EP8A 4ILFA 5EL8A 3M0FA 4TR0A 4KGIA 1A24A 2C0FA 1HQOA 2C0DA 3TKSA 3QAWA 2L59A 3DMLA 1GNWA 5ELAA 1PN9A 1NM3A 1JHBA 5FHIA 2H6XA 1B48A 4KDYA 3IV4A 4YAVA 4TVEA 1FVJA 4NWYA 5HR2A 4JE1A 3IHGA 3D21A 9GSSA 3DD3A 4FYUA 2DJ1A 4O5QA 3F9UA 4XRDA 1WMJA 3IOSA 1ZYPA 5GAND 1GUHA 5DJLA 2QKEA 3Q19A 3FKFA 1M9BA 4BWQA 2GT5A 5J3RA 4O7HA 1B9YC 3QDNA 1PL2A 3GHAA 3HY2A 1XXUA 1AQXA 2GSRA 2I1UA 1PX7A 2VL2C 3GUSA 3QAVA 2C0GA 4RUVA 2IMIA 2YJHA 2H70A 1LBKA 16GSA 1SJ6A 3UIWA 4ECBA 3KH9A 1MDJA 2M72A 1W89A 3Q18A 1XWCA 2IJYA 4IBPA 1SD9A 1ZL9A 5D9XA 4Q5QA 1MDKA 3APQA 1QMVA 2OBKA 4OWYA 1A2MA 2DLXA 2GZZA 3VWXA 4HJ2A 2RM6A 1ST9A 1V2AA 5DQYA 5A34B 4CY8A 4F03A 3C71A 2NPBA 1WOUA 4V1Ap 2A4VA 5BMUA 1FOVA 2AJQB 4TR1A 1Q4JA 1M99A 2EIRA 4K0GA 2HRKA 3TU3B 1G7OA 2H72A 2H8LA 4O5UA 4N0VA 4DSRA 3NIVA 3HXSA 2L5LA 3UBLA 1TU8A 3MDKA 1JZRA 2L5OA 2H74A 3TDGA 3FR6A 3GL5A 1NHOA 4BVXA 5D9VA 4F0BA 3QCPA 2PVQA 2KP2A 5CAXA 4JEDA 2RUEA 3I9V2 5IO2A 1R5PA 3M3MA 4OO5A 2HFDA 2QGVA 4IJ3A 3A5IA 4N0ZA 1JZDA 5IMDA 1T00A 3LSZA 4NHWA 4ZL7A 2CT6A 1ZGNA 2RM5A 3IPZA 1GRXA 1FW1A 3HZ4A 1TDIA 3CMIA 4ICYA 2YZHA 1T4YA 2V2GA 2YCDA 4K7IA 4PNFA 3MWHA 1Y6EA 5EY6A 3I6AA 2GSSA 2GVPA 4OCEA 3R2QA 2GQMA 2TIRA 3RPPA 1CQHA 3KP8A 5E4WA 5ECOB 3APSA 1SU9A 2GZYA 3QAGA 2R5GA 4IP1A 3TJFA 3TRXA 4HU9A 3P90A 3GURA 5HFGA 1SD8A 2OT3A 1EWXA 5J47A 3ZREA 5D96A 1JZOA 4V1Ag 2IIYA 2AUVA 4K2DA 1WPIA 2X8CA 2R0PA 1GSFA 2XBQA 2REMA 2VIMA 2BMXA 4HQZA 5HR1A 4IJIA 5ECHB 2HRFA 5IMAA 5KOXA 5D9WA 1PL1A 1USBA 4YQMA 1XOAA 1MDIA 1LU4A 1OAZA 3QMXA 4Z2UA 5BMUB 3M8NA 5HFKA 5JWOB 4TR1B 4ZBAA 1K0AA 3GFKA 2EFHA 1VF3A 5CREA 2HRKB 2GS3A 4ULXA 2VD0A 2CVDA 3N9JA 5INYA 4HZ4A 3F8UA 3S9FA 3VWVA 1B4PA 3H4KA 3IDVA 2FWHA 4ZL9A 3E9JB 1XCCA 1V58A 5CYYA 2X99A 4BVXB 3KP9A 1T1VA 3IC8A 2MZCA 1AQWA 4HI7A 2V41A 5HR0A 5ECQB 1BG1A 4ECJA 5HR3A 1WP0A 3LEFA 4PGTA 4MH3A 2V1MA 1TJDA 4ZB8A 2VCTA 5CRWA 3TCOA 5A4VA 1TTZA 5DCGA 4MK3A 2EIQA 3VI7A 2C80A 1WJKA 1HYUA 3UVTA 1GSEA 2M80A 4GF0A 6GSTA 4G01A 3UOMA 3F4TA 2F9SA 2H1BA 3FYGA 1C72A 5H5SA 4PNGA 5J5NA 1T3BA 2WS2A 1E2YA 2IL3A 4MJBA 1K3LA 3CWGA 3CYNA 1M7TA 1SVOA 1TK8B 3MIXA 3W8JA 3FR9A 2CVKA 3M9JA 1M2BA 3ED3A 1TXXA 2X8GA 1G6WA 5A5HA 1SVMA 3FMWA 2OA7A 2LRTA 3IA1A 2B5XA 4WR4A 1UN2A 5H5QA 1EGOA 4POMA 3LGCA 2LV3A 1GL8A 4BVYA 6GSXA 2YOIA 5IOWA 2HZEA 4POBA 1M2DA 1FHEA 2O87A 4AKGA 1J08A 3KZQA 4PXOA 1Z5YE 1SKWB 2WULA 2OKAA 5JWRB 4NAXA 3WT1A 2N5BA 5J41A 6GSWA 3FR3A 1ERVA 1TP9A 3L4NA 1PN0A 5G5FA 5E59A 1GTBA 2H1LA 4FYCA 5ECSA 3EU3A 2MMAA 4O32A 4ZL8A 2HQTA 1QK8A 2BJXA 3FK8A 1GWCA 2OBIA 4GQFA 3O76A 3EVIA 4CHSA 4J56E 2L4QA 5LD0A 1XVWA 2XPDA 5AIVA 2C3TA 1O81A 1BX9A 2H0HA 4Z2TA 4JZQA 5ELGA 3BCIA 4KDXA 3HZ8A 3LJRA 3G9BA 2YZUA 3A5WA 5AISA 1THXA 2MYGA 4HDEA 3LXTA 4K9ZA 6GSYA 2JZSA 5F8BA 5G1LA 2LEGA 1MD3A 1DSBA 3HMJG 5ID2A 1UC7A 3GNJA 3VPTA 1BQ7A 3A2XA 2LJRA 4KSMA 1VF2A 2O89A 4MNNA 1F6MC 4YH2A 2NBSA 1T7PB 4ID0A 1U3AA 2VM2A 1XOBA 2N5AA 5IMCA 2WFCA 2WJUA 1NW2A 3IE3A 2H01A 3L0HA 4RQXA 3GL3A 3FHKA 1KNGA 3FZ9A 1B8XA 1FVKA 2FNOA 3RHBA 2R0GA 1TKDB 2LJAA 1A2JA 3GKXA 5AGYA 1A2LA 3EINA 2O8VB 5A5HB 2F3MA 1X9MB 4GXZA 2JSYA 4MZBA 1PX6A 4WBJA 1SL0B 3QD9A 2GT6A 2YWOA 2LRCA 4BVYB 1S3CA 2HZEB 2VCVA 2ON7A 1G0TA 2A2RA 3DWVA 4LL4B 3IAS2 8GSSA 1HNAA 3ZVJD 4E68A 3VWWA 1GNEA 3E3EA 2OE0A 1LJRA 4K5RA 5ECIB 1PKWA 2DJ2A 1TI3A 3EMPA 4MJEA 5G1KA 4IQ1A 2FUG2 3D0ZA 2H0IA 2E2GA 1O85A 2PBJA 4E8HA 3D6IA 1OKDA 2HSNA 4V2NA 1TK5B 4LMVA 4NV5A 3F4RA 3DGQA 2E2MA 3IK7A 4HZ2A 2QSIA 2YV7A 2YJ7A 2JL4A 1IYIA 2HRAA 3VPQA 3GSTA 4OO4A 5J4YA 1XWGA 1GSQA 5EPFA 3ZITA 2MMOA 1PSQA 1A0FA 3KMOA 3UVHA 1GH2A 4MJAA 4K5SA 1ZZYA 3PR8A 5KN3A 1K0CA 2HNLA 1EEMA 5DCHA 2JZTA 4MH2A 2FY6A 2C1YA 1OC8A 5DAKA 4ECCA 4EDZA 5DQSA 3BOAA 5ID2B 2HE3A 2B7KA 5F05A 2DJ0A 1A23A 5B7CA 2IPAA 2YV9A 2I3YA 5B8AA 2LUSA 1ZCPA 4K7OA 2JU5A 3RPNA 1BAYA 1WRYA 4XRAA 5ECPB 2VUPA 4USSA 1FOHA 1XW6A 2J23A 1ZYQB 3FZAA 3HCZA 4GSSA 1DE1A 3TB2A 4F9ZA 1SJIA 3VURA 5JCWA 1X5CA 2V6KA 4TW5A 2JADA 4ZB7A 1IYHA 3GA4A 4EVMA 4YKGA 1K0MA 2KUCA 1ZOFA 4ZB6A 4RQRA 4DVCA 3E0UA 5G30A 4NV2A 4PX1A 3TOUA 4OFNA 4WETA 4AJ7A 3FEUA 2ALBA 6GSVA 5JCGA 2R37A 1XWBA 2L6CA 2R0CA 1K0DA 3P2AA 4MF7A 2FWEA 5AIXA 4GRFA 4KAEA 1GLPA 1S3DA 2IWTA 3QFAC 2KHPA 3LWAA 1QGVA 2LNSA 3UBKA 3TJGA 1PKZA 1Z7PA 4IHUA 2H6ZA 2L57A 3KTBA 4G10A 3FRCA 3HYPA 1TRUA 2NDOA 2HSNB 4W66A 2VCQA 5GSTA 4WF5A 3EYTA 1AXDA 2OACA 2H75A 4IVFA 2RIIA 2P0GA 3QR6A 3UL3A 1DE2A 1Z6NA 3F6FA 3ZTLA 4D73A 4AJ8A 5A4WA 1RK4A 4ZBBA 2O7KA 4PQIA 2WB9A 1RW1A 4HJMA 4YQVA 2GSQA 3SWLA 3G7JA 4I8BA 4JR4A 5LCZA 2B3SA 5F06A 1V40A 2XBIA 2HLSA 2F51A 3QPMA 3GN3A 4WF4A 1CQGA 4IW9A 1XW9A 2VOCA 4G2EA 4IS0A 3JCML 4FQUA 13GSA 4ZILA 5DAKB 1GUMA 2P31A 2IMEA 19GSA 1TRWA 1OKTA 4ECIA 2VCWA 2N5FA 2GQLA 4Z2RA 4JR6A 4X43A 2YWIA 4J57E 4TXOA 2OADA 4ZB9A 3M9KA 1Z7RA 2LTKA 1GTAA 1F3AA 2VAFA 5J9BA 2Z9SA 2HSMA 2GSTA 3TKSC 14GSA 3CBUA 4FO5A 3M1GA 5B6NA 3CSHA 4LA1A 5CRDA 1U88A 3EWLA 2PWJA 4IP6A 3EU4A 2M46A 1QQ2A 3KTLA 4DSSA 4EDYA 3NOFA 2XPEA 1XPVA 6GSSA 10GSA 1S3AA 5L71A 1EP7A 5DDLA 5KEJA 2A2PA 5BRTA 3TGZA 2K6VA 2ON5A 3GX8A 2PGTA 2C0EA 3L9UA 2DJ3A 3ZLPA 3DVXA 3GRXA 1Z9HA 4O5RA 1O73A 3FZ4A 3HJPA 3IR4A 4RI7A 4QL7A 5ECKB 3GYKA 1FG4A 2UZ8A 1Z3EA 4F2IA 1KBNA 1W4VA 2JSZA 4KE3A 3GSSA 1H75A 2H73A 5A1NA 1SKSB 1XFLA 5KOWA 4GQCA 3GKNA 3KXOA 5LNKe 1XVQA 3ZRDA 3BCKA 3ZFLA 4XHMA 4OD7A 3DRNA 1ACVA 2R4VA 2JACA 2V6OA 3HVSA 4D73B 4X4JA 1THOA 3ISOA 2F8FA 3TKQA 1ERUA 1SK2A 4IN0A 1V57A 1YF1A 5D9TA 2B7JA 1X9SB 3F63A 3HVXA 2IMKA 3UJ1A 1Y1UA 1YY7A 1U6TA 1VF1A 1X5DA 4IQAA 4BWSA 2VL2A 2F8AA 2H1GA 1K3OA 3KMNA 1SK1A 2QC7A 4X0XA 3L9SA 4BA7A 4AKXB 4I2UA 4I6XA 4KF9A 1F2EA 2JZRA 1TOFA 3GIXA 3J7Yb 2MMNA 3A2WA 5F07A 2AYTA 4X1UA 5CRHA 3J7Yk 1AW9A 4YKFA 3D4TA 1F9MA 3CTGA 1J0FA 1ML6A 4TXOB 1ABAA 4EO3A 3BBYA 3WD6A 2DBCA 22GSA 5IPGA 3KIJA 5FT3A 4LMWA 2HYXA 1YZXA 1HNCA 2AV4A 2HSMB 1YEXA 1GULA 1PRXA 3Q6OA 5D93A 5IMVA 3KH7A 1G6YA 1BJXA 2EC4A 1O8WA 4DSSB 3HJOA 2NVLA 5D8IA 1ERWA 4HS1A 5DVBA 11GSA 3GMFA 1XZOA 4MP4A 4KB3A 1E6BA 3VK9A 3CSIA 5ECRB 4ZBDA 3HVVA 5DJMA 2X49A 1SL2B 2E0QA 6GSUA 2YPMA 4NMUA 5IO0A 2H66A 1TU7A 7GSSA 1EV9A 4IGJA 2P5RA 2VL9A 3LQ7A 4MF6A 2H0GA 5A5KA 2DMLA 1SENA 1XIYA 2HSHA 4Q5NA 2CQ9A 2VM1A 2AB6A 3LYKA 3DXBA 1U3IA 4V2LA 1A8LA 3IC4A 5A1NB 1FB6A 1WWJA 3LXZA 1VGLA 4MABA 5J4UA 2H1AA 3TRQA 3A3TA 2UV8G 2YP6A 4ZIJA 4XS1A 1FAAA 2ZUPA 2NTOA 2LQOA 3GH6A 4PTSA 5IMZA 4P3YB 2EFDA 1XWAA 1YKAA 2GQKA 3D4MA 1QXHA 3SBCA 3VI5A 2DKIA 4N3ZA 2DJJA 2PUKC 5ENUA 1TK0B 1NSWA 3ZMLA 4KW6A 2H19A 1A0RP 17GSA 3KEBA 1ZYEA 2QA2A 4Q5FA 1SJZA 3W6GA 3ZFBA 2B5YA 4HOJA 2PVOC 2XHFA 1U87A 3DEXA 3KCMA 2OJLA 5DBQA 5DALA 1T8EB 2PU9C 3CTFA 1EOHA 4NPBA 3C8EA 2YWMA 4AKHA 1ILOA 3LYPA 2X8HA 4GSNA 2X4AA 1KEBA 3FY7A 1O6JA 3O3TA 1PD21 4WKWA 5ABRA 2B5EA 1TRVA 1WIKA 5COHA 3O6TA 4IKHA 2BTOT 3HHVA 1UVZA 3OR5A 2WRTA 4GDFA 1OC9A 4I97A 3EMXA 4OMVA 4QMKA 1BF5A 2WCIA 5JWQB 4L8EA 1DBYA 4ML6A 1OC3A 1Q98A 5C00A 4A5PA 2I4AA 1GLQA 12GSA 4KA0A 2ZNMA 2EFCA 4I2TA 1X9WB 1EGRA 1K0BA 2GDRA 4EC0A 4G19A 5C04A 4GLTA 1FB0A 4MLYA 2X64A 3CSJA 3ZL5A 3C73A 2FA4A 3H8QA 1R26A 5EVOA 3EURA 3RBTA 4MZWA 4N11A 2MBSA 1DUGA 1X5EA 5IMFA 2FWGA 1UA5A 3C1RA 1T4ZA 3IXRA 2FGXA 4CDOA 4JU5A 3W8SA 1HNBA 4L5LA 1YQ1A 1AIUA 3L78A 2KOKA 1F3BA 4EXJA 3ZZXA 2IFQA 5CRGA 1OE8A 2O5VA 1QUWA 4JBBA 5AN1A 4OFTA 3TUEA 2B1LA 2C4JA 3MSZA 4GCIA 2DIYA 3BD2A 1AAZA 2K8SA 3Q74A 2CX3A 5J4VA 1BYEA 3GH9A 1EEJA 5CNWA 1GP1A 2EIOA 2CZ2A 1TXUA 3IBHA 3DYRA 2FWFA 3H93A 2VLVA 4K2XA 4Z7XA 5CO3A 3APOA 4MA9A 1YDKA 3LW9A 2L4CA 5B8BA 2I81A 3TJBA 2VD1A 2LRNA 2LS5A 3L9VA 2VLUA 3LG6A 4G9HA 1GTIA 2GLRA 2G0FA 2PPTA 1YEPA 2AHEA 4PUFC 4KH7A 2KP1A 1ERTA 4EIQA 4TN8A 4HU7A 2VKZG 1XBSA 1I9DA 2HSYA 4EKZA 4TR3A 3GX0A 2WZ9A 5DALB 1FO5A 1GTUA 4CY6A 1RQMA 2A4HA 3H79A 4FYBA 2H30A 2FHEA 3LFLA 3RDWA 18GSA 2HI7A 3GV1A 2HZFA 1R5AA 4BPYA 4I5QA 5H5RA 2VLTA 2G2QA 3F0IA 2RUFA 4TXVA 1YKCA 4TKYA 4XTSA 3D5JA 4GSTA 4PQHA 2HT9A 2PMTA 1OC9B 3ME7A 3IK9A 4MPFA 2CAIA 1R7HA 3AY8A 3IHQA 5KN1A 5IQYA 4XCSA 3TJJA 5IOXA 1N2AA 1AUCA 4HQSA 1TI1A 3KGKA 5GAPD 1GSDA 3DIEA 1Y25A 3C1SA 1PMTA 5ECMB 3V1WA 2TRCP 1G7EA 2DIZA 1JFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7P A;  1URM A;  4GWR A;  3F3Q A;  2KLX A;  4DSQ A;  1K0O A;  3ERF A;  1SYR A;  4K8M A;  1V98 A;  3G7I A;  1Z6M A;  4KDU A;  4WXT A;  2IFQ B;  3UMA A;  1TW9 A;  1YJ6 A;  2FCH A;  2R6K A;  4FH8 A;  2YNX A;  2AAW A;  3HJM A;  1EZK A;  1SK0 A;  1M0U A;  3N5O A;  4OCF A;  1K3Y A;  4G0K A;  4ML1 A;  4YAP A;  4EUY A;  3VWU A;  2H71 A;  1O8X A;  1SL1 B;  4J2F A;  3ME8 A;  3WGD A;  3ERG A;  2DC5 A;  4MMM A;  1MD4 A;  3F6D A;  2J9H A;  3F4S A;  4K7N A;  4EF0 A;  4KUN A;  4PUR A;  2RLI A;  2ZCT A;  1BG5 A;  4MZC A;  2LQQ A;  4XIH A;  2WDU A;  1I5G A;  3GKM A;  3ERW A;  1PGT A;  2GZP A;  4MF5 A;  3WGX A;  1R4W A;  4IEL A;  3G7Y A;  4L0U A;  2MMZ A;  4ACS A;  2LST A;  5ECN B;  4AGS A;  3I43 A;  4ISD A;  3VLN A;  4XS4 A;  2IMD A;  1NHY A;  4TRX A;  2HRN A;  2CZ3 A;  3WT2 A;  3ZIJ A;  3HKR A;  3R3E A;  5G2Z A;  3IAM 2;  2WGR A;  1KTE A;  4WBR D;  1EV4 A;  4F82 A;  2YN1 A;  2D2Z A;  2MBT A;  5FWG A;  1X0R A;  2K8V A;  4O92 A;  20GS A;  1JLV A;  2OE3 A;  3A2V A;  2CVB A;  2IN3 A;  1OE7 A;  3WYW A;  4PUA A;  3TKP A;  4BL7 A;  2C8U A;  5G5E A;  1B4Q A;  3KD0 A;  4CW9 A;  4LLR A;  1QFN A;  4MPG A;  5KN2 A;  3DVW A;  3TRP A;  2R3X A;  3K8N A;  4AF2 A;  4NHZ A;  2FLS A;  3US3 A;  4HEA 2;  3RHC A;  4E8E A;  2B1K A;  2VCX A;  1PQN A;  3UEM A;  4F0C A;  3VFI A;  2CA8 A;  4N30 A;  4K0N A;  2OE1 A;  1M9A A;  1TRS A;  2V32 A;  1BED A;  5G31 A;  2O85 A;  2C3N A;  4WR5 A;  2P5Q A;  5GZZ B;  4MJC A;  1J9B A;  1N8J A;  1PA3 A;  2HXK A;  3FW2 A;  4KSO A;  4EE0 A;  4L5O A;  1SKR B;  2PN8 A;  2LNT A;  2CX4 A;  3H1N A;  4YQU A;  1ON4 A;  3GTU A;  3MAK A;  4G0I A;  1JLW A;  4H86 A;  4GTU A;  5A4U A;  3ZMK A;  1MEK A;  4RI6 A;  4XS6 A;  4KX4 A;  4MCU A;  2DJK A;  3P8W A;  5D73 A;  4NXI A;  2H6Y A;  3PPU A;  3EC3 A;  4DEJ A;  1B9X C;  5F0G A;  2K18 A;  1VRS D;  4OFM A;  2FA8 A;  2CAQ A;  1OYJ A;  2GTU A;  4QQ7 A;  3MNG A;  3BJ5 A;  2PER A;  2VCZ A;  1AC1 A;  2YWN A;  2R2J A;  1M2A A;  3P7X A;  1XWK A;  3U5R E;  1ZMA A;  5IIZ A;  2I9H A;  4XS4 B;  4K1F A;  2VL3 A;  3QFB C;  3FZ5 A;  4QL9 A;  3DKS A;  3TJK A;  2H76 A;  5IPH A;  4PQ1 A;  5ECL B;  1F37 A;  3WGE A;  1OVN A;  1YF0 A;  4K6X A;  3UAR A;  1EOG A;  1HD2 A;  5J9C A;  2DMM A;  3LOR A;  3ZYW A;  4G0L A;  5CP1 A;  1XW5 A;  1WE0 A;  3TOT A;  4KND A;  2B6M A;  4TOP A;  3KM6 A;  2GGT A;  4ZXG A;  2CV4 A;  3EE2 A;  3CRU A;  3RAZ A;  2L6D A;  4N10 A;  3UAP A;  4AJ6 A;  4BL7 B;  3IRA A;  2FD3 A;  3QOU A;  2LKU A;  2DSA A;  3F3R A;  2H1D A;  3U6V A;  1A8Y A;  3PH9 A;  1MTC A;  5JCU A;  1O7U A;  2LJK A;  4TR4 A;  3TKR A;  1AQV A;  4KCE A;  3HDC A;  3CXG A;  4POK A;  2XC2 A;  3ZIV A;  3HA9 A;  4LL1 B;  4V2M A;  4EL1 A;  5KN0 A;  4KCA A;  4L0W A;  4Q5R A;  4HUA A;  1JZW A;  3C7M A;  5IM9 A;  3KJY A;  5GSS A;  2C3Q A;  1GUK A;  2K9F A;  3HD5 A;  5HFI A;  3ZVJ A;  1GSY A;  1VF4 A;  1K0N A;  1GSS A;  2ES7 A;  4POL A;  4FIW A;  3CRT A;  1GSU A;  1SYX A;  3I69 A;  5B6M A;  3GTU B;  3NZN A;  2YAN A;  1V9W A;  3PGT A;  4WEY A;  2VO4 A;  3PIN A;  4JRR A;  1H4O A;  3GKK A;  5HQP A;  2A2S A;  2TRX A;  3TKS E;  4MDC A;  3D22 A;  2IMF A;  1EP8 A;  4ILF A;  5EL8 A;  3M0F A;  4TR0 A;  4KGI A;  1A24 A;  2C0F A;  1HQO A;  2C0D A;  3TKS A;  3QAW A;  2L59 A;  3DML A;  1GNW A;  5ELA A;  1PN9 A;  1NM3 A;  1JHB A;  5FHI A;  2H6X A;  1B48 A;  4KDY A;  3IV4 A;  4YAV A;  4TVE A;  1FVJ A;  4NWY A;  5HR2 A;  4JE1 A;  3D21 A;  9GSS A;  3DD3 A;  4FYU A;  2DJ1 A;  3F9U A;  4XRD A;  1WMJ A;  3IOS A;  5GAN D;  1GUH A;  5DJL A;  2QKE A;  3Q19 A;  3FKF A;  1M9B A;  4BWQ A;  2GT5 A;  5J3R A;  4O7H A;  1B9Y C;  3QDN A;  1PL2 A;  3GHA A;  3HY2 A;  1XXU A;  1AQX A;  2GSR A;  2I1U A;  1PX7 A;  2VL2 C;  3GUS A;  3QAV A;  2C0G A;  4RUV A;  2IMI A;  2YJH A;  2H70 A;  1LBK A;  16GS A;  1SJ6 A;  3UIW A;  4ECB A;  3KH9 A;  1MDJ A;  2M72 A;  1W89 A;  3Q18 A;  1XWC A;  2IJY A;  4IBP A;  1SD9 A;  1ZL9 A;  5D9X A;  4Q5Q A;  1MDK A;  3APQ A;  1QMV A;  2OBK A;  4OWY A;  1A2M A;  2DLX A;  2GZZ A;  3VWX A;  4HJ2 A;  2RM6 A;  1ST9 A;  1V2A A;  5DQY A;  4F03 A;  3C71 A;  2NPB A;  1WOU A;  4V1A p;  2A4V A;  5BMU A;  1FOV A;  2AJQ B;  4TR1 A;  1Q4J A;  1M99 A;  2EIR A;  4K0G A;  2HRK A;  1G7O A;  2H72 A;  2H8L A;  4N0V A;  4DSR A;  3NIV A;  3HXS A;  2L5L A;  3UBL A;  1TU8 A;  3MDK A;  1JZR A;  2L5O A;  2H74 A;  3TDG A;  3FR6 A;  3GL5 A;  1NHO A;  4BVX A;  5D9V A;  4F0B A;  3QCP A;  2PVQ A;  2KP2 A;  5CAX A;  4JED A;  2RUE A;  3I9V 2;  5IO2 A;  1R5P A;  3M3M A;  4OO5 A;  2HFD A;  2QGV A;  4IJ3 A;  4N0Z A;  1JZD A;  5IMD A;  1T00 A;  3LSZ A;  4NHW A;  4ZL7 A;  2CT6 A;  1ZGN A;  2RM5 A;  3IPZ A;  1GRX A;  1FW1 A;  3HZ4 A;  1TDI A;  3CMI A;  2YZH A;  1T4Y A;  2V2G A;  2YCD A;  4K7I A;  4PNF A;  3MWH A;  1Y6E A;  5EY6 A;  3I6A A;  2GSS A;  2GVP A;  4OCE A;  3R2Q A;  2GQM A;  2TIR A;  3RPP A;  1CQH A;  3KP8 A;  5E4W A;  5ECO B;  3APS A;  1SU9 A;  2GZY A;  3QAG A;  2R5G A;  4IP1 A;  3TJF A;  3TRX A;  4HU9 A;  3P90 A;  3GUR A;  5HFG A;  1SD8 A;  1EWX A;  3ZRE A;  5D96 A;  1JZO A;  4V1A g;  2IIY A;  2AUV A;  4K2D A;  1WPI A;  2X8C A;  1GSF A;  2XBQ A;  2REM A;  2VIM A;  2BMX A;  4HQZ A;  5HR1 A;  4IJI A;  5ECH B;  2HRF A;  5IMA A;  5D9W A;  1PL1 A;  1USB A;  4YQM A;  1XOA A;  1MDI A;  1LU4 A;  1OAZ A;  3QMX A;  3M8N A;  5HFK A;  5JWO B;  4TR1 B;  4ZBA A;  1K0A A;  3GFK A;  1VF3 A;  5CRE A;  2HRK B;  2GS3 A;  4ULX A;  2VD0 A;  2CVD A;  3N9J A;  5INY A;  4HZ4 A;  3F8U A;  3S9F A;  3VWV A;  1B4P A;  3H4K A;  3IDV A;  2FWH A;  4ZL9 A;  3E9J B;  1XCC A;  1V58 A;  5CYY A;  2X99 A;  4BVX B;  3KP9 A;  1T1V A;  3IC8 A;  2MZC A;  1AQW A;  4HI7 A;  2V41 A;  5HR0 A;  5ECQ B;  4ECJ A;  5HR3 A;  1WP0 A;  3LEF A;  4PGT A;  4MH3 A;  2V1M A;  1TJD A;  4ZB8 A;  2VCT A;  5CRW A;  3TCO A;  5A4V A;  1TTZ A;  5DCG A;  4MK3 A;  2EIQ A;  3VI7 A;  2C80 A;  1WJK A;  1HYU A;  3UVT A;  1GSE A;  2M80 A;  4GF0 A;  6GST A;  3UOM A;  3F4T A;  2F9S A;  2H1B A;  3FYG A;  1C72 A;  5H5S A;  4PNG A;  5J5N A;  1T3B A;  2WS2 A;  1E2Y A;  2IL3 A;  4MJB A;  1K3L A;  3CYN A;  1M7T A;  1TK8 B;  3W8J A;  3FR9 A;  2CVK A;  3M9J A;  1M2B A;  3ED3 A;  1TXX A;  2X8G A;  1G6W A;  2OA7 A;  2LRT A;  3IA1 A;  2B5X A;  4WR4 A;  1UN2 A;  5H5Q A;  1EGO A;  4POM A;  3LGC A;  2LV3 A;  1GL8 A;  4BVY A;  6GSX A;  2YOI A;  5IOW A;  2HZE A;  4POB A;  1M2D A;  1FHE A;  2O87 A;  1J08 A;  3KZQ A;  4PXO A;  1Z5Y E;  1SKW B;  2WUL A;  2OKA A;  5JWR B;  4NAX A;  3WT1 A;  2N5B A;  5J41 A;  6GSW A;  3FR3 A;  1ERV A;  1TP9 A;  3L4N A;  5G5F A;  5E59 A;  1GTB A;  4FYC A;  5ECS A;  3EU3 A;  2MMA A;  4O32 A;  4ZL8 A;  2HQT A;  1QK8 A;  2BJX A;  3FK8 A;  1GWC A;  2OBI A;  4GQF A;  3O76 A;  3EVI A;  4CHS A;  4J56 E;  2L4Q A;  5LD0 A;  1XVW A;  2XPD A;  5AIV A;  2C3T A;  1O81 A;  1BX9 A;  2H0H A;  4JZQ A;  5ELG A;  3BCI A;  4KDX A;  3HZ8 A;  3LJR A;  3G9B A;  2YZU A;  3A5W A;  5AIS A;  1THX A;  2MYG A;  4HDE A;  3LXT A;  4K9Z A;  6GSY A;  2JZS A;  5F8B A;  5G1L A;  2LEG A;  1MD3 A;  1DSB A;  5ID2 A;  1UC7 A;  3GNJ A;  3VPT A;  1BQ7 A;  3A2X A;  2LJR A;  4KSM A;  1VF2 A;  2O89 A;  1F6M C;  4YH2 A;  2NBS A;  1T7P B;  4ID0 A;  1U3A A;  2VM2 A;  1XOB A;  2N5A A;  5IMC A;  2WFC A;  2WJU A;  1NW2 A;  3IE3 A;  2H01 A;  3L0H A;  4RQX A;  3GL3 A;  3FHK A;  1KNG A;  3FZ9 A;  1B8X A;  1FVK A;  2FNO A;  3RHB A;  1TKD B;  2LJA A;  1A2J A;  3GKX A;  5AGY A;  1A2L A;  3EIN A;  2O8V B;  2F3M A;  1X9M B;  4GXZ A;  2JSY A;  4MZB A;  1PX6 A;  4WBJ A;  1SL0 B;  3QD9 A;  2GT6 A;  2YWO A;  2LRC A;  4BVY B;  1S3C A;  2HZE B;  2VCV A;  2ON7 A;  1G0T A;  2A2R A;  3DWV A;  4LL4 B;  3IAS 2;  8GSS A;  1HNA A;  3ZVJ D;  3VWW A;  1GNE A;  3E3E A;  2OE0 A;  1LJR A;  5ECI B;  1PKW A;  2DJ2 A;  1TI3 A;  3EMP A;  4MJE A;  5G1K A;  4IQ1 A;  2FUG 2;  3D0Z A;  2H0I A;  2E2G A;  1O85 A;  2PBJ A;  4E8H A;  3D6I A;  1OKD A;  4V2N A;  1TK5 B;  4LMV A;  4NV5 A;  3F4R A;  3DGQ A;  2E2M A;  3IK7 A;  4HZ2 A;  2QSI A;  2YV7 A;  2YJ7 A;  2JL4 A;  1IYI A;  2HRA A;  3VPQ A;  3GST A;  4OO4 A;  1XWG A;  1GSQ A;  5EPF A;  3ZIT A;  2MMO A;  1PSQ A;  1A0F A;  3KMO A;  3UVH A;  1GH2 A;  4MJA A;  1ZZY A;  3PR8 A;  5KN3 A;  1K0C A;  2HNL A;  1EEM A;  5DCH A;  2JZT A;  4MH2 A;  2FY6 A;  2C1Y A;  1OC8 A;  5DAK A;  4ECC A;  4EDZ A;  5DQS A;  3BOA A;  5ID2 B;  2HE3 A;  2B7K A;  5F05 A;  2DJ0 A;  1A23 A;  5B7C A;  2IPA A;  2YV9 A;  2I3Y A;  5B8A A;  2LUS A;  1ZCP A;  4K7O A;  2JU5 A;  3RPN A;  1BAY A;  1WRY A;  4XRA A;  5ECP B;  2VUP A;  4USS A;  1XW6 A;  2J23 A;  1ZYQ B;  3FZA A;  3HCZ A;  4GSS A;  1DE1 A;  3TB2 A;  4F9Z A;  1SJI A;  3VUR A;  5JCW A;  1X5C A;  2V6K A;  4TW5 A;  2JAD A;  1IYH A;  3GA4 A;  4EVM A;  1K0M A;  2KUC A;  1ZOF A;  4ZB6 A;  4RQR A;  4DVC A;  3E0U A;  5G30 A;  4NV2 A;  4PX1 A;  3TOU A;  4OFN A;  4WET A;  4AJ7 A;  3FEU A;  2ALB A;  6GSV A;  5JCG A;  2R37 A;  1XWB A;  2L6C A;  1K0D A;  3P2A A;  4MF7 A;  2FWE A;  5AIX A;  4GRF A;  4KAE A;  1GLP A;  1S3D A;  2IWT A;  3QFA C;  2KHP A;  3LWA A;  1QGV A;  2LNS A;  3UBK A;  3TJG A;  1PKZ A;  1Z7P A;  4IHU A;  2H6Z A;  2L57 A;  3KTB A;  4G10 A;  3FRC A;  3HYP A;  1TRU A;  2NDO A;  2HSN B;  2VCQ A;  5GST A;  4WF5 A;  3EYT A;  1AXD A;  2OAC A;  2H75 A;  4IVF A;  2RII A;  2P0G A;  3QR6 A;  3UL3 A;  1DE2 A;  1Z6N A;  3F6F A;  3ZTL A;  4D73 A;  4AJ8 A;  5A4W A;  1RK4 A;  4ZBB A;  2O7K A;  4PQI A;  2WB9 A;  1RW1 A;  4HJM A;  4YQV A;  2GSQ A;  3SWL A;  3G7J A;  4I8B A;  4JR4 A;  5LCZ A;  2B3S A;  5F06 A;  1V40 A;  2XBI A;  2HLS A;  2F51 A;  3QPM A;  3GN3 A;  4WF4 A;  1CQG A;  4IW9 A;  1XW9 A;  2VOC A;  4G2E A;  4IS0 A;  3JCM L;  4FQU A;  13GS A;  4ZIL A;  5DAK B;  1GUM A;  2P31 A;  2IME A;  19GS A;  1TRW A;  1OKT A;  4ECI A;  2VCW A;  2N5F A;  2GQL A;  4JR6 A;  4X43 A;  2YWI A;  4J57 E;  4TXO A;  2OAD A;  4ZB9 A;  3M9K A;  1Z7R A;  2LTK A;  1GTA A;  1F3A A;  2VAF A;  5J9B A;  2Z9S A;  2HSM A;  2GST A;  3TKS C;  14GS A;  3CBU A;  4FO5 A;  3M1G A;  5B6N A;  3CSH A;  4LA1 A;  5CRD A;  1U88 A;  3EWL A;  2PWJ A;  4IP6 A;  3EU4 A;  2M46 A;  1QQ2 A;  3KTL A;  4DSS A;  4EDY A;  3NOF A;  2XPE A;  1XPV A;  6GSS A;  10GS A;  1S3A A;  5L71 A;  1EP7 A;  5DDL A;  5KEJ A;  3TGZ A;  2K6V A;  2ON5 A;  3GX8 A;  2PGT A;  2C0E A;  3L9U A;  2DJ3 A;  3ZLP A;  3DVX A;  3GRX A;  1Z9H A;  4O5R A;  1O73 A;  3FZ4 A;  3HJP A;  3IR4 A;  4RI7 A;  4QL7 A;  5ECK B;  3GYK A;  1FG4 A;  2UZ8 A;  1Z3E A;  4F2I A;  1KBN A;  1W4V A;  2JSZ A;  4KE3 A;  3GSS A;  1H75 A;  2H73 A;  1SKS B;  1XFL A;  4GQC A;  3GKN A;  3KXO A;  5LNK e;  1XVQ A;  3ZRD A;  3BCK A;  3ZFL A;  4XHM A;  4OD7 A;  3DRN A;  1ACV A;  2R4V A;  2JAC A;  2V6O A;  3HVS A;  4D73 B;  1THO A;  3ISO A;  2F8F A;  3TKQ A;  1ERU A;  1SK2 A;  4IN0 A;  1V57 A;  1YF1 A;  5D9T A;  2B7J A;  1X9S B;  3F63 A;  3HVX A;  2IMK A;  3UJ1 A;  1YY7 A;  1U6T A;  1VF1 A;  1X5D A;  4IQA A;  4BWS A;  2VL2 A;  2F8A A;  2H1G A;  1K3O A;  3KMN A;  1SK1 A;  2QC7 A;  4X0X A;  3L9S A;  4BA7 A;  4I2U A;  4I6X A;  4KF9 A;  1F2E A;  2JZR A;  1TOF A;  3GIX A;  3J7Y b;  2MMN A;  3A2W A;  5F07 A;  2AYT A;  4X1U A;  5CRH A;  3J7Y k;  1AW9 A;  3D4T A;  1F9M A;  3CTG A;  1J0F A;  1ML6 A;  4TXO B;  1ABA A;  4EO3 A;  3BBY A;  3WD6 A;  2DBC A;  22GS A;  5IPG A;  3KIJ A;  5FT3 A;  4LMW A;  2HYX A;  1YZX A;  1HNC A;  2AV4 A;  2HSM B;  1YEX A;  1GUL A;  1PRX A;  3Q6O A;  5D93 A;  5IMV A;  3KH7 A;  1G6Y A;  1BJX A;  2EC4 A;  1O8W A;  4DSS B;  3HJO A;  2NVL A;  5D8I A;  1ERW A;  4HS1 A;  5DVB A;  11GS A;  3GMF A;  1XZO A;  4MP4 A;  4KB3 A;  1E6B A;  3VK9 A;  3CSI A;  5ECR B;  4ZBD A;  3HVV A;  5DJM A;  1SL2 B;  2E0Q A;  6GSU A;  2YPM A;  4NMU A;  5IO0 A;  2H66 A;  1TU7 A;  7GSS A;  1EV9 A;  4IGJ A;  2P5R A;  2VL9 A;  3LQ7 A;  4MF6 A;  2H0G A;  5A5K A;  2DML A;  1SEN A;  1XIY A;  2HSH A;  4Q5N A;  2CQ9 A;  2VM1 A;  2AB6 A;  3LYK A;  3DXB A;  1U3I A;  4V2L A;  1A8L A;  3IC4 A;  1FB6 A;  1WWJ A;  3LXZ A;  1VGL A;  4MAB A;  5J4U A;  2H1A A;  3TRQ A;  3A3T A;  2YP6 A;  4ZIJ A;  4XS1 A;  1FAA A;  2ZUP A;  2NTO A;  2LQO A;  3GH6 A;  4PTS A;  5IMZ A;  4P3Y B;  1XWA A;  1YKA A;  2GQK A;  3D4M A;  1QXH A;  3SBC A;  3VI5 A;  2DJJ A;  2PUK C;  5ENU A;  1TK0 B;  1NSW A;  3ZML A;  4KW6 A;  2H19 A;  1A0R P;  17GS A;  3KEB A;  1ZYE A;  4Q5F A;  1SJZ A;  3W6G A;  3ZFB A;  2B5Y A;  4HOJ A;  2PVO C;  2XHF A;  1U87 A;  3DEX A;  3KCM A;  2OJL A;  5DBQ A;  5DAL A;  1T8E B;  2PU9 C;  3CTF A;  1EOH A;  4NPB A;  3C8E A;  2YWM A;  1ILO A;  3LYP A;  2X8H A;  4GSN A;  1KEB A;  3FY7 A;  1O6J A;  3O3T A;  1PD2 1;  4WKW A;  5ABR A;  2B5E A;  1TRV A;  1WIK A;  5COH A;  3O6T A;  4IKH A;  2BTO T;  3HHV A;  1UVZ A;  3OR5 A;  2WRT A;  1OC9 A;  4I97 A;  3EMX A;  4OMV A;  2WCI A;  5JWQ B;  4L8E A;  1DBY A;  4ML6 A;  1OC3 A;  1Q98 A;  5C00 A;  2I4A A;  1GLQ A;  12GS A;  4KA0 A;  2ZNM A;  4I2T A;  1X9W B;  1EGR A;  1K0B A;  2GDR A;  4EC0 A;  4G19 A;  5C04 A;  4GLT A;  1FB0 A;  4MLY A;  2X64 A;  3CSJ A;  3ZL5 A;  3C73 A;  2FA4 A;  3H8Q A;  1R26 A;  5EVO A;  3EUR A;  3RBT A;  4MZW A;  4N11 A;  2MBS A;  1DUG A;  1X5E A;  5IMF A;  2FWG A;  1UA5 A;  3C1R A;  1T4Z A;  3IXR A;  2FGX A;  4CDO A;  4JU5 A;  3W8S A;  1HNB A;  4L5L A;  1YQ1 A;  1AIU A;  3L78 A;  2KOK A;  1F3B A;  4EXJ A;  3ZZX A;  2IFQ A;  5CRG A;  1OE8 A;  1QUW A;  4JBB A;  5AN1 A;  4OFT A;  3TUE A;  2B1L A;  2C4J A;  3MSZ A;  4GCI A;  2DIY A;  3BD2 A;  1AAZ A;  2K8S A;  3Q74 A;  2CX3 A;  1BYE A;  3GH9 A;  1EEJ A;  5CNW A;  1GP1 A;  2EIO A;  2CZ2 A;  3IBH A;  3DYR A;  2FWF A;  3H93 A;  2VLV A;  4Z7X A;  5CO3 A;  3APO A;  4MA9 A;  1YDK A;  2L4C A;  5B8B A;  2I81 A;  3TJB A;  2VD1 A;  2LRN A;  2LS5 A;  3L9V A;  2VLU A;  3LG6 A;  4G9H A;  1GTI A;  2GLR A;  2G0F A;  2PPT A;  1YEP A;  2AHE A;  4PUF C;  4KH7 A;  2KP1 A;  1ERT A;  4TN8 A;  4HU7 A;  1XBS A;  1I9D A;  2HSY A;  4EKZ A;  4TR3 A;  3GX0 A;  2WZ9 A;  5DAL B;  1FO5 A;  1GTU A;  1RQM A;  3H79 A;  4FYB A;  2H30 A;  2FHE A;  3LFL A;  3RDW A;  18GS A;  2HI7 A;  3GV1 A;  2HZF A;  1R5A A;  4BPY A;  4I5Q A;  5H5R A;  2VLT A;  2G2Q A;  3F0I A;  2RUF A;  4TXV A;  1YKC A;  4TKY A;  4XTS A;  3D5J A;  4GST A;  4PQH A;  2HT9 A;  2PMT A;  1OC9 B;  3ME7 A;  3IK9 A;  4MPF A;  2CAI A;  1R7H A;  3AY8 A;  3IHQ A;  5KN1 A;  5IQY A;  4XCS A;  3TJJ A;  5IOX A;  1N2A A;  1AUC A;  4HQS A;  1TI1 A;  3KGK A;  5GAP D;  1GSD A;  3DIE A;  1Y25 A;  3C1S A;  1PMT A;  5ECM B;  3V1W A;  2TRC P;  1G7E A;  2DIZ A;  1JFU A; 
#chains in the Genus database with same CATH topology
 2E7P A;  1URM A;  1M3I A;  4GWR A;  3F3Q A;  2KLX A;  4DSQ A;  1K0O A;  3ERF A;  1SYR A;  4K8M A;  1V98 A;  3G7I A;  1Z6M A;  4KDU A;  4WXT A;  2IFQ B;  3UMA A;  1TW9 A;  1YJ6 A;  2FCH A;  2R6K A;  4FH8 A;  2YNX A;  2AAW A;  3HJM A;  1EZK A;  1SK0 A;  1M0U A;  3N5O A;  4OCF A;  1K3Y A;  4G0K A;  4ML1 A;  4YAP A;  4EUY A;  3VWU A;  2H71 A;  1O8X A;  1SL1 B;  4J2F A;  3EPT A;  3ME8 A;  3WGD A;  3ERG A;  2DC5 A;  4MMM A;  1MD4 A;  3F6D A;  2J9H A;  3F4S A;  4K7N A;  4EF0 A;  4KUN A;  4PUR A;  2RLI A;  2ZCT A;  1BG5 A;  4MZC A;  2LQQ A;  4XIH A;  2WDU A;  1I5G A;  3GKM A;  4AI6 A;  3RGB C;  3ERW A;  1PGT A;  2GZP A;  4MF5 A;  3WGX A;  1R4W A;  4IEL A;  3G7Y A;  4L0U A;  2MMZ A;  4ACS A;  2LST A;  5ECN B;  4AGS A;  3I43 A;  4ISD A;  3VLN A;  4XS4 A;  2IMD A;  1NHY A;  4TRX A;  2HRN A;  2CZ3 A;  3WT2 A;  3ZIJ A;  3HKR A;  3R3E A;  5G2Z A;  3IAM 2;  2WGR A;  1KTE A;  4WBR D;  1EV4 A;  4F82 A;  2YN1 A;  2D2Z A;  2MBT A;  5FWG A;  1X0R A;  2K8V A;  4O92 A;  20GS A;  1S3R A;  1JLV A;  2OE3 A;  3A2V A;  2CVB A;  1SVL A;  2IN3 A;  1OE7 A;  3WYW A;  4PUA A;  1ZYN A;  3TKP A;  4BL7 A;  2C8U A;  5G5E A;  1B4Q A;  3KD0 A;  4CW9 A;  4LLR A;  1QFN A;  4MPG A;  5KN2 A;  3DVW A;  3TRP A;  2R3X A;  3K8N A;  4AF2 A;  4NHZ A;  2FLS A;  3US3 A;  4HEA 2;  3RHC A;  4E8E A;  2B1K A;  2VCX A;  1PQN A;  3UEM A;  4F0C A;  3VFI A;  2CA8 A;  4N30 A;  4K0N A;  2OE1 A;  1M9A A;  1TRS A;  2V32 A;  4AKI A;  1BED A;  5G31 A;  2O85 A;  2C3N A;  4WR5 A;  2P5Q A;  5GZZ B;  4MJC A;  1I1I P;  1J9B A;  1N8J A;  1PA3 A;  2HXK A;  2EFE A;  3FW2 A;  4KSO A;  4EE0 A;  4L5O A;  1SKR B;  2PN8 A;  2LNT A;  2CX4 A;  3H1N A;  4YQU A;  1ON4 A;  3GTU A;  2WVZ A;  3MAK A;  4G0I A;  1JLW A;  4H86 A;  4GTU A;  5A4U A;  3ZMK A;  1MEK A;  4RI6 A;  4XS6 A;  4KX4 A;  1N25 A;  4MCU A;  2DJK A;  3P8W A;  5D73 A;  4NXI A;  2H6Y A;  3PPU A;  3EC3 A;  4DEJ A;  1B9X C;  5F0G A;  2K18 A;  1VRS D;  4OFM A;  2FA8 A;  2CAQ A;  1OYJ A;  2GTU A;  4QQ7 A;  3MNG A;  3BJ5 A;  2PER A;  2VCZ A;  1AC1 A;  2YWN A;  2R2J A;  1M2A A;  2WW2 A;  3P7X A;  1XWK A;  3U5R E;  1ZMA A;  5IIZ A;  2I9H A;  4XS4 B;  4K1F A;  3HVN A;  2VL3 A;  3QFB C;  3FZ5 A;  4QL9 A;  3DKS A;  3TJK A;  2H76 A;  5IPH A;  4PQ1 A;  5ECL B;  1F37 A;  3WGE A;  1OVN A;  1YF0 A;  4K6X A;  3UAR A;  1EOG A;  1HD2 A;  5J9C A;  2DMM A;  3LOR A;  3ZYW A;  4G0L A;  5CP1 A;  1XW5 A;  1WE0 A;  5J40 A;  3TOT A;  4KND A;  2B6M A;  4TOP A;  3KM6 A;  2GGT A;  4ZXG A;  2CV4 A;  3EE2 A;  3CRU A;  3RAZ A;  2L6D A;  4N10 A;  3UAP A;  4AJ6 A;  4BL7 B;  3IRA A;  2FD3 A;  3QOU A;  2LKU A;  2DSA A;  3F3R A;  2H1D A;  4EIP A;  3U6V A;  1A8Y A;  3PH9 A;  1MTC A;  5JCU A;  1O7U A;  2LJK A;  4TR4 A;  3TKR A;  1AQV A;  4KCE A;  3HDC A;  3CXG A;  5A34 A;  4POK A;  2XC2 A;  3ZIV A;  3HA9 A;  4LL1 B;  4V2M A;  4EL1 A;  5KN0 A;  3MYD A;  4KCA A;  4L0W A;  4Q5R A;  4HUA A;  1JZW A;  3C7M A;  5IM9 A;  3KJY A;  1YVL A;  5GSS A;  2DKH A;  2C3Q A;  1GUK A;  2K9F A;  3HD5 A;  5HFI A;  3ZVJ A;  1GSY A;  1VF4 A;  1K0N A;  1GSS A;  2ES7 A;  2O3E A;  4POL A;  4FIW A;  3CRT A;  2QA1 A;  1GSU A;  1SYX A;  3I69 A;  5B6M A;  3GTU B;  3NZN A;  2YAN A;  1V9W A;  3PGT A;  4WEY A;  2VO4 A;  3PIN A;  4JRR A;  1H4O A;  3GKK A;  5HQP A;  2A2S A;  2TRX A;  3TKS E;  4MDC A;  3D22 A;  2IMF A;  1EP8 A;  4ILF A;  5EL8 A;  3M0F A;  4TR0 A;  4KGI A;  1A24 A;  2C0F A;  1HQO A;  2C0D A;  3TKS A;  3QAW A;  2L59 A;  3DML A;  1GNW A;  5ELA A;  1PN9 A;  1NM3 A;  1JHB A;  5FHI A;  2H6X A;  1B48 A;  4KDY A;  3IV4 A;  1XG8 A;  4YAV A;  4TVE A;  1FVJ A;  4NWY A;  5HR2 A;  4JE1 A;  3IHG A;  3D21 A;  9GSS A;  3DD3 A;  4FYU A;  2DJ1 A;  4O5Q A;  3F9U A;  4XRD A;  1WMJ A;  3IOS A;  1ZYP A;  5GAN D;  1GUH A;  5DJL A;  2QKE A;  3Q19 A;  3FKF A;  1M9B A;  4BWQ A;  2GT5 A;  5J3R A;  4O7H A;  1B9Y C;  3QDN A;  1PL2 A;  3GHA A;  3HY2 A;  1XXU A;  1AQX A;  2GSR A;  2I1U A;  1PX7 A;  2VL2 C;  3GUS A;  3QAV A;  2C0G A;  4RUV A;  2IMI A;  2YJH A;  2H70 A;  2WZS A;  1LBK A;  16GS A;  1SJ6 A;  3UIW A;  4ECB A;  3KH9 A;  1MDJ A;  2M72 A;  1W89 A;  3Q18 A;  1XWC A;  2IJY A;  4IBP A;  1SD9 A;  1ZL9 A;  5D9X A;  4Q5Q A;  1MDK A;  3APQ A;  1QMV A;  2OBK A;  4OWY A;  1A2M A;  2DLX A;  2GZZ A;  3VWX A;  4HJ2 A;  2RM6 A;  1ST9 A;  1V2A A;  5DQY A;  5A34 B;  4CY8 A;  4F03 A;  3CHX C;  3C71 A;  2NPB A;  1WOU A;  4V1A p;  2A4V A;  5BMU A;  1FOV A;  2AJQ B;  4TR1 A;  1Q4J A;  1M99 A;  2EIR A;  4K0G A;  2HRK A;  3TU3 B;  1G7O A;  2H72 A;  2H8L A;  4O5U A;  4N0V A;  1PFO A;  4DSR A;  3NIV A;  3HXS A;  2L5L A;  3UBL A;  1TU8 A;  3MDK A;  1JZR A;  2L5O A;  2H74 A;  3TDG A;  4BIK A;  3FR6 A;  3GL5 A;  1NHO A;  4BVX A;  5D9V A;  4F0B A;  3QCP A;  2PVQ A;  2KP2 A;  5CAX A;  4JED A;  2RUE A;  3I9V 2;  5IO2 A;  1R5P A;  3M3M A;  4OO5 A;  2HFD A;  2QGV A;  4IJ3 A;  3A5I A;  4N0Z A;  1JZD A;  5IMD A;  1T00 A;  3LSZ A;  4NHW A;  4ZL7 A;  2CT6 A;  1ZGN A;  2RM5 A;  3IPZ A;  1GRX A;  1FW1 A;  3HZ4 A;  1TDI A;  3CMI A;  4ICY A;  2YZH A;  1T4Y A;  2V2G A;  2YCD A;  4K7I A;  4PNF A;  3MWH A;  1Y6E A;  5EY6 A;  3I6A A;  2GSS A;  2GVP A;  4OCE A;  3R2Q A;  2GQM A;  2TIR A;  3RPP A;  1CQH A;  3KP8 A;  5E4W A;  5ECO B;  3APS A;  1SU9 A;  2GZY A;  3QAG A;  2R5G A;  4IP1 A;  3TJF A;  3TRX A;  4HU9 A;  3P90 A;  3GUR A;  5HFG A;  1SD8 A;  2OT3 A;  1EWX A;  5J47 A;  3ZRE A;  5D96 A;  1JZO A;  4V1A g;  2IIY A;  2AUV A;  4K2D A;  1WPI A;  2X8C A;  2R0P A;  1GSF A;  2XBQ A;  2REM A;  2VIM A;  2BMX A;  4HQZ A;  5HR1 A;  4IJI A;  5ECH B;  2HRF A;  5IMA A;  5KOX A;  5D9W A;  1PL1 A;  1USB A;  4YQM A;  1XOA A;  1MDI A;  1LU4 A;  1OAZ A;  3QMX A;  4Z2U A;  5BMU B;  3M8N A;  5HFK A;  5JWO B;  4TR1 B;  4ZBA A;  1K0A A;  3GFK A;  2EFH A;  1VF3 A;  5CRE A;  2HRK B;  2GS3 A;  4ULX A;  2VD0 A;  2CVD A;  3N9J A;  5INY A;  4HZ4 A;  3F8U A;  3S9F A;  3VWV A;  1B4P A;  3H4K A;  3IDV A;  2FWH A;  4ZL9 A;  3E9J B;  1XCC A;  1V58 A;  5CYY A;  2X99 A;  4BVX B;  3KP9 A;  1T1V A;  3IC8 A;  2MZC A;  1AQW A;  4HI7 A;  2V41 A;  5HR0 A;  5ECQ B;  1BG1 A;  4ECJ A;  5HR3 A;  1WP0 A;  3LEF A;  2O36 A;  4PGT A;  4MH3 A;  2V1M A;  1TJD A;  4ZB8 A;  2VCT A;  5CRW A;  3TCO A;  4HSC X;  5A4V A;  1TTZ A;  5DCG A;  4MK3 A;  2EIQ A;  3VI7 A;  2C80 A;  1WJK A;  1HYU A;  3UVT A;  1GSE A;  2M80 A;  4GF0 A;  6GST A;  4G01 A;  3UOM A;  3F4T A;  2F9S A;  2H1B A;  3FYG A;  1C72 A;  5H5S A;  4PNG A;  5J5N A;  1T3B A;  2WS2 A;  1E2Y A;  2IL3 A;  4MJB A;  1K3L A;  3CWG A;  3CYN A;  1M7T A;  1SVO A;  1TK8 B;  3MIX A;  3W8J A;  3FR9 A;  2CVK A;  3M9J A;  1M2B A;  3ED3 A;  1TXX A;  2X8G A;  1G6W A;  5A5H A;  1SVM A;  3FMW A;  2OA7 A;  2LRT A;  3IA1 A;  2B5X A;  4WR4 A;  1UN2 A;  5H5Q A;  1EGO A;  4POM A;  3LGC A;  2LV3 A;  1GL8 A;  4BVY A;  6GSX A;  2YOI A;  5IOW A;  2HZE A;  4POB A;  1M2D A;  1FHE A;  2O87 A;  4AKG A;  1J08 A;  3KZQ A;  4PXO A;  1Z5Y E;  1SKW B;  2WUL A;  2OKA A;  5JWR B;  4NAX A;  3WT1 A;  2N5B A;  5J41 A;  6GSW A;  3FR3 A;  1ERV A;  1TP9 A;  3L4N A;  1PN0 A;  5G5F A;  5E59 A;  1GTB A;  2H1L A;  4FYC A;  5ECS A;  3EU3 A;  2MMA A;  4O32 A;  4ZL8 A;  2HQT A;  1QK8 A;  2BJX A;  3FK8 A;  1GWC A;  2OBI A;  4GQF A;  3O76 A;  3EVI A;  4CHS A;  4J56 E;  2L4Q A;  5LD0 A;  1XVW A;  2XPD A;  2WVX A;  5AIV A;  2C3T A;  1O81 A;  1BX9 A;  2H0H A;  4Z2T A;  4JZQ A;  5ELG A;  3BCI A;  4KDX A;  3HZ8 A;  3LJR A;  3G9B A;  2YZU A;  3A5W A;  5AIS A;  1THX A;  2MYG A;  4HDE A;  3LXT A;  3CQF A;  4K9Z A;  6GSY A;  2JZS A;  5F8B A;  5G1L A;  2LEG A;  1MD3 A;  1DSB A;  3HMJ G;  5ID2 A;  1UC7 A;  3GNJ A;  3VPT A;  1BQ7 A;  3A2X A;  1S4B P;  2LJR A;  4KSM A;  1VF2 A;  2O89 A;  4MNN A;  1F6M C;  4YH2 A;  2NBS A;  1T7P B;  4ID0 A;  1U3A A;  2VM2 A;  1XOB A;  2N5A A;  5IMC A;  2WFC A;  2WJU A;  1NW2 A;  3IE3 A;  2H01 A;  3L0H A;  4RQX A;  3GL3 A;  3FHK A;  1KNG A;  3FZ9 A;  1B8X A;  1FVK A;  2FNO A;  3RHB A;  2R0G A;  1TKD B;  2LJA A;  1A2J A;  3GKX A;  5AGY A;  1A2L A;  3EIN A;  2O8V B;  5A5H B;  2F3M A;  1X9M B;  4GXZ A;  2JSY A;  4MZB A;  1PX6 A;  4WBJ A;  1SL0 B;  3QD9 A;  2GT6 A;  2YWO A;  2LRC A;  4BVY B;  1S3C A;  2HZE B;  2VCV A;  2ON7 A;  1G0T A;  2A2R A;  3DWV A;  4LL4 B;  3IAS 2;  8GSS A;  1HNA A;  3ZVJ D;  4E68 A;  3VWW A;  1GNE A;  3E3E A;  2OE0 A;  1LJR A;  4K5R A;  5ECI B;  1PKW A;  2DJ2 A;  1TI3 A;  3EMP A;  4MJE A;  5G1K A;  4IQ1 A;  2FUG 2;  3D0Z A;  2H0I A;  2E2G A;  1O85 A;  2PBJ A;  4E8H A;  3D6I A;  1OKD A;  2HSN A;  4V2N A;  1TK5 B;  4LMV A;  4NV5 A;  3F4R A;  3DGQ A;  2E2M A;  3IK7 A;  4HZ2 A;  2QSI A;  2YV7 A;  2YJ7 A;  2JL4 A;  1IYI A;  4PI2 C;  2HRA A;  3VPQ A;  3GST A;  4OO4 A;  5J4Y A;  2WVX B;  1XWG A;  1GSQ A;  5EPF A;  3ZIT A;  2MMO A;  1PSQ A;  1A0F A;  3KMO A;  3UVH A;  1GH2 A;  4MJA A;  4K5S A;  1ZZY A;  3PR8 A;  5KN3 A;  1K0C A;  2HNL A;  1EEM A;  5DCH A;  2JZT A;  4MH2 A;  2FY6 A;  2C1Y A;  1OC8 A;  5DAK A;  4ECC A;  4EDZ A;  5DQS A;  3BOA A;  5ID2 B;  2HE3 A;  2B7K A;  5F05 A;  2DJ0 A;  1A23 A;  5B7C A;  2IPA A;  2YV9 A;  2I3Y A;  5B8A A;  2LUS A;  1ZCP A;  4K7O A;  2JU5 A;  3RPN A;  1BAY A;  1WRY A;  4XRA A;  5ECP B;  2VUP A;  4USS A;  1FOH A;  1XW6 A;  2J23 A;  1ZYQ B;  3FZA A;  3HCZ A;  4GSS A;  1DE1 A;  3TB2 A;  4F9Z A;  1SJI A;  3VUR A;  5JCW A;  1X5C A;  2V6K A;  1YEW C;  4TW5 A;  2JAD A;  4ZB7 A;  1IYH A;  3GA4 A;  4EVM A;  4YKG A;  1K0M A;  1M3J A;  2KUC A;  1ZOF A;  4ZB6 A;  4RQR A;  4DVC A;  3E0U A;  5G30 A;  4NV2 A;  4PX1 A;  3TOU A;  4OFN A;  4WET A;  4AJ7 A;  3FEU A;  2ALB A;  6GSV A;  5JCG A;  2R37 A;  1XWB A;  2L6C A;  2R0C A;  1K0D A;  3P2A A;  4MF7 A;  2FWE A;  5AIX A;  4GRF A;  4KAE A;  1GLP A;  1S3D A;  2IWT A;  3QFA C;  2KHP A;  3LWA A;  1QGV A;  2LNS A;  3UBK A;  3TJG A;  1PKZ A;  1Z7P A;  4IHU A;  2H6Z A;  2L57 A;  3KTB A;  4G10 A;  3FRC A;  3HYP A;  1TRU A;  2NDO A;  2HSN B;  4W66 A;  2VCQ A;  5GST A;  4WF5 A;  2WW0 A;  3EYT A;  1AXD A;  2WW1 A;  2OAC A;  2H75 A;  4IVF A;  2RII A;  2P0G A;  3QR6 A;  3UL3 A;  1DE2 A;  1Z6N A;  3F6F A;  3ZTL A;  4D73 A;  4AJ8 A;  5A4W A;  1RK4 A;  4ZBB A;  2O7K A;  4PQI A;  2WB9 A;  1RW1 A;  4HJM A;  4YQV A;  2GSQ A;  3SWL A;  3G7J A;  4I8B A;  4JR4 A;  5LCZ A;  2B3S A;  5F06 A;  1V40 A;  2XBI A;  2HLS A;  2F51 A;  3QPM A;  3GN3 A;  4WF4 A;  1CQG A;  4IW9 A;  1XW9 A;  2VOC A;  4G2E A;  4IS0 A;  3JCM L;  4FQU A;  13GS A;  4ZIL A;  5DAK B;  1GUM A;  2P31 A;  2IME A;  19GS A;  1TRW A;  1OKT A;  4ECI A;  2VCW A;  2N5F A;  2GQL A;  4Z2R A;  4JR6 A;  4X43 A;  2YWI A;  4J57 E;  4TXO A;  2OAD A;  4ZB9 A;  3M9K A;  1Z7R A;  2LTK A;  1GTA A;  1F3A A;  2VAF A;  5J9B A;  2Z9S A;  2HSM A;  2GST A;  3TKS C;  14GS A;  3CBU A;  4FO5 A;  3M1G A;  5B6N A;  3CSH A;  4LA1 A;  5CRD A;  1U88 A;  3EWL A;  2PWJ A;  4IP6 A;  3EU4 A;  2M46 A;  1QQ2 A;  3KTL A;  4DSS A;  4EDY A;  3NOF A;  2XPE A;  1XPV A;  6GSS A;  10GS A;  1S3A A;  5L71 A;  1EP7 A;  5DDL A;  5KEJ A;  2A2P A;  5BRT A;  3TGZ A;  2K6V A;  2ON5 A;  3GX8 A;  2PGT A;  2C0E A;  3L9U A;  2DJ3 A;  3ZLP A;  3DVX A;  3GRX A;  1Z9H A;  4O5R A;  1O73 A;  3FZ4 A;  3HJP A;  3IR4 A;  4RI7 A;  4QL7 A;  5ECK B;  3GYK A;  1FG4 A;  2UZ8 A;  1Z3E A;  4F2I A;  1KBN A;  1W4V A;  2JSZ A;  4KE3 A;  3GSS A;  1H75 A;  2H73 A;  5A1N A;  1SKS B;  1XFL A;  5KOW A;  4GQC A;  3GKN A;  3KXO A;  5LNK e;  1XVQ A;  3ZRD A;  3BCK A;  3ZFL A;  4XHM A;  4OD7 A;  3DRN A;  1ACV A;  2R4V A;  2JAC A;  2V6O A;  3HVS A;  4D73 B;  4X4J A;  1THO A;  3ISO A;  2F8F A;  3TKQ A;  1ERU A;  1SK2 A;  4IN0 A;  1V57 A;  1YF1 A;  5D9T A;  2B7J A;  1X9S B;  3F63 A;  3HVX A;  2IMK A;  3UJ1 A;  1Y1U A;  1YY7 A;  1U6T A;  1VF1 A;  1X5D A;  4IQA A;  4BWS A;  2VL2 A;  2F8A A;  2H1G A;  1K3O A;  3KMN A;  1SK1 A;  2QC7 A;  4X0X A;  3L9S A;  4BA7 A;  4AKX B;  4I2U A;  4I6X A;  4KF9 A;  1F2E A;  2JZR A;  1TOF A;  3GIX A;  3J7Y b;  2MMN A;  3A2W A;  5F07 A;  2AYT A;  4X1U A;  5CRH A;  3J7Y k;  1AW9 A;  4YKF A;  3D4T A;  1F9M A;  3CTG A;  1J0F A;  1ML6 A;  4TXO B;  1ABA A;  4EO3 A;  3BBY A;  3WD6 A;  2DBC A;  22GS A;  5IPG A;  3KIJ A;  5FT3 A;  4LMW A;  2HYX A;  1YZX A;  1HNC A;  2AV4 A;  2HSM B;  1YEX A;  1GUL A;  1PRX A;  3Q6O A;  5D93 A;  5IMV A;  3KH7 A;  1G6Y A;  1BJX A;  2EC4 A;  1O8W A;  4DSS B;  3HJO A;  3RFR C;  2NVL A;  1ERW A;  4HS1 A;  5D8I A;  5DVB A;  11GS A;  3GMF A;  1XZO A;  4MP4 A;  4KB3 A;  1E6B A;  3VK9 A;  3CSI A;  5ECR B;  4ZBD A;  3HVV A;  5DJM A;  2X49 A;  1SL2 B;  2E0Q A;  6GSU A;  2YPM A;  4NMU A;  5IO0 A;  2WVY A;  2H66 A;  1TU7 A;  7GSS A;  1EV9 A;  4IGJ A;  2P5R A;  2VL9 A;  3LQ7 A;  4MF6 A;  2H0G A;  5A5K A;  2DML A;  1SEN A;  1XIY A;  2HSH A;  4Q5N A;  2CQ9 A;  2VM1 A;  2AB6 A;  3LYK A;  3DXB A;  1U3I A;  4V2L A;  1A8L A;  3IC4 A;  5A1N B;  1FB6 A;  1WWJ A;  3LXZ A;  1VGL A;  4MAB A;  5J4U A;  2H1A A;  3TRQ A;  3A3T A;  2UV8 G;  2YP6 A;  4ZIJ A;  4XS1 A;  1FAA A;  2ZUP A;  2NTO A;  2LQO A;  3GH6 A;  4PTS A;  5IMZ A;  4P3Y B;  2EFD A;  1XWA A;  1YKA A;  2GQK A;  3D4M A;  1QXH A;  3SBC A;  3VI5 A;  2DKI A;  4N3Z A;  2DJJ A;  2PUK C;  5ENU A;  1TK0 B;  1NSW A;  3ZML A;  4KW6 A;  2H19 A;  1A0R P;  17GS A;  3KEB A;  1ZYE A;  2QA2 A;  4Q5F A;  1SJZ A;  3W6G A;  3ZFB A;  2B5Y A;  4HOJ A;  2PVO C;  2XHF A;  1U87 A;  3DEX A;  3KCM A;  2OJL A;  5DBQ A;  5DAL A;  1T8E B;  2PU9 C;  3CTF A;  1EOH A;  4NPB A;  3C8E A;  2YWM A;  4AKH A;  1ILO A;  3LYP A;  2X8H A;  4GSN A;  2X4A A;  1KEB A;  3FY7 A;  1O6J A;  3O3T A;  1PD2 1;  4WKW A;  5ABR A;  2B5E A;  1TRV A;  1WIK A;  5COH A;  3O6T A;  4IKH A;  2BTO T;  3HHV A;  1UVZ A;  3OR5 A;  2WRT A;  4GDF A;  1OC9 A;  4I97 A;  3EMX A;  4OMV A;  4QMK A;  1BF5 A;  2WCI A;  5JWQ B;  4L8E A;  1DBY A;  4ML6 A;  1OC3 A;  1Q98 A;  5C00 A;  4A5P A;  2I4A A;  1GLQ A;  12GS A;  4KA0 A;  2ZNM A;  2EFC A;  4I2T A;  1X9W B;  1EGR A;  1K0B A;  2GDR A;  4EC0 A;  4G19 A;  5C04 A;  4GLT A;  2WW3 A;  1FB0 A;  4MLY A;  2X64 A;  3CSJ A;  3ZL5 A;  3C73 A;  2FA4 A;  3H8Q A;  1R26 A;  5EVO A;  3EUR A;  3RBT A;  4MZW A;  4N11 A;  2MBS A;  1DUG A;  1X5E A;  5IMF A;  2FWG A;  1UA5 A;  3C1R A;  1T4Z A;  3IXR A;  2FGX A;  4CDO A;  4JU5 A;  3W8S A;  1HNB A;  4L5L A;  1YQ1 A;  1AIU A;  3L78 A;  2KOK A;  1F3B A;  4EXJ A;  3ZZX A;  2IFQ A;  5CRG A;  1OE8 A;  2O5V A;  1QUW A;  4JBB A;  5AN1 A;  4OFT A;  3TUE A;  2B1L A;  2C4J A;  3MSZ A;  4GCI A;  2DIY A;  3BD2 A;  1AAZ A;  2K8S A;  3Q74 A;  2CX3 A;  5J4V A;  1BYE A;  3GH9 A;  1EEJ A;  5CNW A;  1GP1 A;  2EIO A;  2CZ2 A;  1TXU A;  3IBH A;  3DYR A;  2FWF A;  3H93 A;  2VLV A;  4K2X A;  4Z7X A;  5CO3 A;  3APO A;  4MA9 A;  1YDK A;  3LW9 A;  2L4C A;  5B8B A;  2I81 A;  3TJB A;  2VD1 A;  2LRN A;  2LS5 A;  3L9V A;  2VLU A;  3LG6 A;  4G9H A;  4PHZ C;  1GTI A;  2GLR A;  2G0F A;  2PPT A;  1YEP A;  2AHE A;  4PUF C;  4KH7 A;  2KP1 A;  1ERT A;  4EIQ A;  4TN8 A;  4HU7 A;  2VKZ G;  1XBS A;  4PI0 C;  1I9D A;  2HSY A;  4EKZ A;  4TR3 A;  3GX0 A;  2WZ9 A;  5DAL B;  1FO5 A;  1GTU A;  4CY6 A;  1RQM A;  2A4H A;  3H79 A;  4FYB A;  2H30 A;  2FHE A;  3LFL A;  3RDW A;  18GS A;  4FXY P;  2HI7 A;  3GV1 A;  2HZF A;  1R5A A;  4BPY A;  4I5Q A;  5H5R A;  2VLT A;  2G2Q A;  3F0I A;  2RUF A;  4TXV A;  1YKC A;  4TKY A;  4XTS A;  3D5J A;  4GST A;  4PQH A;  2HT9 A;  2PMT A;  1OC9 B;  3ME7 A;  3IK9 A;  4MPF A;  2CAI A;  1R7H A;  3AY8 A;  3IHQ A;  5KN1 A;  5IQY A;  4XCS A;  3TJJ A;  5IOX A;  1N2A A;  1AUC A;  4HQS A;  1TI1 A;  3KGK A;  5GAP D;  1GSD A;  3DIE A;  1Y25 A;  3C1S A;  1PMT A;  5ECM B;  3V1W A;  2TRC P;  1G7E A;  2DIZ A;  1JFU A; 
#chains in the Genus database with same CATH homology
 2E7P A;  1URM A;  4GWR A;  3F3Q A;  2KLX A;  4DSQ A;  1K0O A;  3ERF A;  1SYR A;  4K8M A;  1V98 A;  3G7I A;  1Z6M A;  4KDU A;  4WXT A;  2IFQ B;  3UMA A;  1TW9 A;  1YJ6 A;  2FCH A;  2R6K A;  4FH8 A;  2YNX A;  2AAW A;  3HJM A;  1EZK A;  1SK0 A;  1M0U A;  3N5O A;  4OCF A;  1K3Y A;  4G0K A;  4ML1 A;  4YAP A;  4EUY A;  3VWU A;  2H71 A;  1O8X A;  1SL1 B;  4J2F A;  3EPT A;  3ME8 A;  3WGD A;  3ERG A;  2DC5 A;  4MMM A;  1MD4 A;  3F6D A;  2J9H A;  3F4S A;  4K7N A;  4EF0 A;  4KUN A;  4PUR A;  2RLI A;  2ZCT A;  1BG5 A;  4MZC A;  2LQQ A;  4XIH A;  2WDU A;  1I5G A;  3GKM A;  4AI6 A;  3ERW A;  1PGT A;  2GZP A;  4MF5 A;  3WGX A;  1R4W A;  4IEL A;  3G7Y A;  4L0U A;  2MMZ A;  4ACS A;  2LST A;  5ECN B;  4AGS A;  3I43 A;  4ISD A;  3VLN A;  4XS4 A;  2IMD A;  1NHY A;  4TRX A;  2HRN A;  2CZ3 A;  3WT2 A;  3ZIJ A;  3HKR A;  3R3E A;  5G2Z A;  3IAM 2;  2WGR A;  1KTE A;  4WBR D;  1EV4 A;  4F82 A;  2YN1 A;  2D2Z A;  2MBT A;  5FWG A;  1X0R A;  2K8V A;  4O92 A;  20GS A;  1JLV A;  2OE3 A;  3A2V A;  2CVB A;  1SVL A;  2IN3 A;  1OE7 A;  3WYW A;  4PUA A;  1ZYN A;  3TKP A;  4BL7 A;  2C8U A;  5G5E A;  1B4Q A;  3KD0 A;  4CW9 A;  4LLR A;  1QFN A;  4MPG A;  5KN2 A;  3DVW A;  3TRP A;  2R3X A;  3K8N A;  4AF2 A;  4NHZ A;  2FLS A;  3US3 A;  4HEA 2;  3RHC A;  4E8E A;  2B1K A;  2VCX A;  1PQN A;  3UEM A;  4F0C A;  3VFI A;  2CA8 A;  4N30 A;  4K0N A;  2OE1 A;  1M9A A;  1TRS A;  2V32 A;  4AKI A;  1BED A;  5G31 A;  2O85 A;  2C3N A;  4WR5 A;  2P5Q A;  5GZZ B;  4MJC A;  1J9B A;  1N8J A;  1PA3 A;  2HXK A;  2EFE A;  3FW2 A;  4KSO A;  4EE0 A;  4L5O A;  1SKR B;  2PN8 A;  2LNT A;  2CX4 A;  3H1N A;  4YQU A;  1ON4 A;  3GTU A;  3MAK A;  4G0I A;  1JLW A;  4H86 A;  4GTU A;  5A4U A;  3ZMK A;  1MEK A;  4RI6 A;  4XS6 A;  4KX4 A;  1N25 A;  4MCU A;  2DJK A;  3P8W A;  5D73 A;  4NXI A;  2H6Y A;  3PPU A;  3EC3 A;  4DEJ A;  1B9X C;  5F0G A;  2K18 A;  1VRS D;  4OFM A;  2FA8 A;  2CAQ A;  1OYJ A;  2GTU A;  4QQ7 A;  3MNG A;  3BJ5 A;  2PER A;  2VCZ A;  1AC1 A;  2YWN A;  2R2J A;  1M2A A;  3P7X A;  1XWK A;  3U5R E;  1ZMA A;  5IIZ A;  2I9H A;  4XS4 B;  4K1F A;  2VL3 A;  3QFB C;  3FZ5 A;  4QL9 A;  3DKS A;  3TJK A;  2H76 A;  5IPH A;  4PQ1 A;  5ECL B;  1F37 A;  3WGE A;  1OVN A;  1YF0 A;  4K6X A;  3UAR A;  1EOG A;  1HD2 A;  5J9C A;  2DMM A;  3LOR A;  3ZYW A;  4G0L A;  5CP1 A;  1XW5 A;  1WE0 A;  5J40 A;  3TOT A;  4KND A;  2B6M A;  4TOP A;  3KM6 A;  2GGT A;  4ZXG A;  2CV4 A;  3EE2 A;  3CRU A;  3RAZ A;  2L6D A;  4N10 A;  3UAP A;  4AJ6 A;  4BL7 B;  3IRA A;  2FD3 A;  3QOU A;  2LKU A;  2DSA A;  3F3R A;  2H1D A;  4EIP A;  3U6V A;  1A8Y A;  3PH9 A;  1MTC A;  5JCU A;  1O7U A;  2LJK A;  4TR4 A;  3TKR A;  1AQV A;  4KCE A;  3HDC A;  3CXG A;  5A34 A;  4POK A;  2XC2 A;  3ZIV A;  3HA9 A;  4LL1 B;  4V2M A;  4EL1 A;  5KN0 A;  3MYD A;  4KCA A;  4L0W A;  4Q5R A;  4HUA A;  1JZW A;  3C7M A;  5IM9 A;  3KJY A;  1YVL A;  5GSS A;  2DKH A;  2C3Q A;  1GUK A;  2K9F A;  3HD5 A;  5HFI A;  3ZVJ A;  1GSY A;  1VF4 A;  1K0N A;  1GSS A;  2ES7 A;  4POL A;  4FIW A;  3CRT A;  2QA1 A;  1GSU A;  1SYX A;  3I69 A;  5B6M A;  3GTU B;  3NZN A;  2YAN A;  1V9W A;  3PGT A;  4WEY A;  2VO4 A;  3PIN A;  4JRR A;  1H4O A;  3GKK A;  5HQP A;  2A2S A;  2TRX A;  3TKS E;  4MDC A;  3D22 A;  2IMF A;  1EP8 A;  4ILF A;  5EL8 A;  3M0F A;  4TR0 A;  4KGI A;  1A24 A;  2C0F A;  1HQO A;  2C0D A;  3TKS A;  3QAW A;  2L59 A;  3DML A;  1GNW A;  5ELA A;  1PN9 A;  1NM3 A;  1JHB A;  5FHI A;  2H6X A;  1B48 A;  4KDY A;  3IV4 A;  4YAV A;  4TVE A;  1FVJ A;  4NWY A;  5HR2 A;  4JE1 A;  3IHG A;  3D21 A;  9GSS A;  3DD3 A;  4FYU A;  2DJ1 A;  4O5Q A;  3F9U A;  4XRD A;  1WMJ A;  3IOS A;  1ZYP A;  5GAN D;  1GUH A;  5DJL A;  2QKE A;  3Q19 A;  3FKF A;  1M9B A;  4BWQ A;  2GT5 A;  5J3R A;  4O7H A;  1B9Y C;  3QDN A;  1PL2 A;  3GHA A;  3HY2 A;  1XXU A;  1AQX A;  2GSR A;  2I1U A;  1PX7 A;  2VL2 C;  3GUS A;  3QAV A;  2C0G A;  4RUV A;  2IMI A;  2YJH A;  2H70 A;  1LBK A;  16GS A;  1SJ6 A;  3UIW A;  4ECB A;  3KH9 A;  1MDJ A;  2M72 A;  1W89 A;  3Q18 A;  1XWC A;  2IJY A;  4IBP A;  1SD9 A;  1ZL9 A;  5D9X A;  4Q5Q A;  1MDK A;  3APQ A;  1QMV A;  2OBK A;  4OWY A;  1A2M A;  2DLX A;  2GZZ A;  3VWX A;  4HJ2 A;  2RM6 A;  1ST9 A;  1V2A A;  5DQY A;  5A34 B;  4CY8 A;  4F03 A;  3C71 A;  2NPB A;  1WOU A;  4V1A p;  2A4V A;  5BMU A;  1FOV A;  2AJQ B;  4TR1 A;  1Q4J A;  1M99 A;  2EIR A;  4K0G A;  2HRK A;  3TU3 B;  1G7O A;  2H72 A;  2H8L A;  4O5U A;  4N0V A;  4DSR A;  3NIV A;  3HXS A;  2L5L A;  3UBL A;  1TU8 A;  3MDK A;  1JZR A;  2L5O A;  2H74 A;  3TDG A;  3FR6 A;  3GL5 A;  1NHO A;  4BVX A;  5D9V A;  4F0B A;  3QCP A;  2PVQ A;  2KP2 A;  5CAX A;  4JED A;  2RUE A;  3I9V 2;  5IO2 A;  1R5P A;  3M3M A;  4OO5 A;  2HFD A;  2QGV A;  4IJ3 A;  3A5I A;  4N0Z A;  1JZD A;  5IMD A;  1T00 A;  3LSZ A;  4NHW A;  4ZL7 A;  2CT6 A;  1ZGN A;  2RM5 A;  3IPZ A;  1GRX A;  1FW1 A;  3HZ4 A;  1TDI A;  3CMI A;  4ICY A;  2YZH A;  1T4Y A;  2V2G A;  2YCD A;  4K7I A;  4PNF A;  3MWH A;  1Y6E A;  5EY6 A;  3I6A A;  2GSS A;  2GVP A;  4OCE A;  3R2Q A;  2GQM A;  2TIR A;  3RPP A;  1CQH A;  3KP8 A;  5E4W A;  5ECO B;  3APS A;  1SU9 A;  2GZY A;  3QAG A;  2R5G A;  4IP1 A;  3TJF A;  3TRX A;  4HU9 A;  3P90 A;  3GUR A;  5HFG A;  1SD8 A;  2OT3 A;  1EWX A;  5J47 A;  3ZRE A;  5D96 A;  1JZO A;  4V1A g;  2IIY A;  2AUV A;  4K2D A;  1WPI A;  2X8C A;  2R0P A;  1GSF A;  2XBQ A;  2REM A;  2VIM A;  2BMX A;  4HQZ A;  5HR1 A;  4IJI A;  5ECH B;  2HRF A;  5IMA A;  5KOX A;  5D9W A;  1PL1 A;  1USB A;  4YQM A;  1XOA A;  1MDI A;  1LU4 A;  1OAZ A;  3QMX A;  4Z2U A;  5BMU B;  3M8N A;  5HFK A;  5JWO B;  4TR1 B;  4ZBA A;  1K0A A;  3GFK A;  2EFH A;  1VF3 A;  5CRE A;  2HRK B;  2GS3 A;  4ULX A;  2VD0 A;  2CVD A;  3N9J A;  5INY A;  4HZ4 A;  3F8U A;  3S9F A;  3VWV A;  1B4P A;  3H4K A;  3IDV A;  2FWH A;  4ZL9 A;  3E9J B;  1XCC A;  1V58 A;  5CYY A;  2X99 A;  4BVX B;  3KP9 A;  1T1V A;  3IC8 A;  2MZC A;  1AQW A;  4HI7 A;  2V41 A;  5HR0 A;  5ECQ B;  1BG1 A;  4ECJ A;  5HR3 A;  1WP0 A;  3LEF A;  4PGT A;  4MH3 A;  2V1M A;  1TJD A;  4ZB8 A;  2VCT A;  5CRW A;  3TCO A;  5A4V A;  1TTZ A;  5DCG A;  4MK3 A;  2EIQ A;  3VI7 A;  2C80 A;  1WJK A;  1HYU A;  3UVT A;  1GSE A;  2M80 A;  4GF0 A;  6GST A;  4G01 A;  3UOM A;  3F4T A;  2F9S A;  2H1B A;  3FYG A;  1C72 A;  5H5S A;  4PNG A;  5J5N A;  1T3B A;  2WS2 A;  1E2Y A;  2IL3 A;  4MJB A;  1K3L A;  3CWG A;  3CYN A;  1M7T A;  1SVO A;  1TK8 B;  3MIX A;  3W8J A;  3FR9 A;  2CVK A;  3M9J A;  1M2B A;  3ED3 A;  1TXX A;  2X8G A;  1G6W A;  5A5H A;  1SVM A;  3FMW A;  2OA7 A;  2LRT A;  3IA1 A;  2B5X A;  4WR4 A;  1UN2 A;  5H5Q A;  1EGO A;  4POM A;  3LGC A;  2LV3 A;  1GL8 A;  4BVY A;  6GSX A;  2YOI A;  5IOW A;  2HZE A;  4POB A;  1M2D A;  1FHE A;  2O87 A;  4AKG A;  1J08 A;  3KZQ A;  4PXO A;  1Z5Y E;  1SKW B;  2WUL A;  2OKA A;  5JWR B;  4NAX A;  3WT1 A;  2N5B A;  5J41 A;  6GSW A;  3FR3 A;  1ERV A;  1TP9 A;  3L4N A;  1PN0 A;  5G5F A;  5E59 A;  1GTB A;  2H1L A;  4FYC A;  5ECS A;  3EU3 A;  2MMA A;  4O32 A;  4ZL8 A;  2HQT A;  1QK8 A;  2BJX A;  3FK8 A;  1GWC A;  2OBI A;  4GQF A;  3O76 A;  3EVI A;  4CHS A;  4J56 E;  2L4Q A;  5LD0 A;  1XVW A;  2XPD A;  5AIV A;  2C3T A;  1O81 A;  1BX9 A;  2H0H A;  4Z2T A;  4JZQ A;  5ELG A;  3BCI A;  4KDX A;  3HZ8 A;  3LJR A;  3G9B A;  2YZU A;  3A5W A;  5AIS A;  1THX A;  2MYG A;  4HDE A;  3LXT A;  4K9Z A;  6GSY A;  2JZS A;  5F8B A;  5G1L A;  2LEG A;  1MD3 A;  1DSB A;  3HMJ G;  5ID2 A;  1UC7 A;  3GNJ A;  3VPT A;  1BQ7 A;  3A2X A;  2LJR A;  4KSM A;  1VF2 A;  2O89 A;  4MNN A;  1F6M C;  4YH2 A;  2NBS A;  1T7P B;  4ID0 A;  1U3A A;  2VM2 A;  1XOB A;  2N5A A;  5IMC A;  2WFC A;  2WJU A;  1NW2 A;  3IE3 A;  2H01 A;  3L0H A;  4RQX A;  3GL3 A;  3FHK A;  1KNG A;  3FZ9 A;  1B8X A;  1FVK A;  2FNO A;  3RHB A;  2R0G A;  1TKD B;  2LJA A;  1A2J A;  3GKX A;  5AGY A;  1A2L A;  3EIN A;  2O8V B;  5A5H B;  2F3M A;  1X9M B;  4GXZ A;  2JSY A;  4MZB A;  1PX6 A;  4WBJ A;  1SL0 B;  3QD9 A;  2GT6 A;  2YWO A;  2LRC A;  4BVY B;  1S3C A;  2HZE B;  2VCV A;  2ON7 A;  1G0T A;  2A2R A;  3DWV A;  4LL4 B;  3IAS 2;  8GSS A;  1HNA A;  3ZVJ D;  4E68 A;  3VWW A;  1GNE A;  3E3E A;  2OE0 A;  1LJR A;  4K5R A;  5ECI B;  1PKW A;  2DJ2 A;  1TI3 A;  3EMP A;  4MJE A;  5G1K A;  4IQ1 A;  2FUG 2;  3D0Z A;  2H0I A;  2E2G A;  1O85 A;  2PBJ A;  4E8H A;  3D6I A;  1OKD A;  2HSN A;  4V2N A;  1TK5 B;  4LMV A;  4NV5 A;  3F4R A;  3DGQ A;  2E2M A;  3IK7 A;  4HZ2 A;  2QSI A;  2YV7 A;  2YJ7 A;  2JL4 A;  1IYI A;  2HRA A;  3VPQ A;  3GST A;  4OO4 A;  5J4Y A;  1XWG A;  1GSQ A;  5EPF A;  3ZIT A;  2MMO A;  1PSQ A;  1A0F A;  3KMO A;  3UVH A;  1GH2 A;  4MJA A;  4K5S A;  1ZZY A;  3PR8 A;  5KN3 A;  1K0C A;  2HNL A;  1EEM A;  5DCH A;  2JZT A;  4MH2 A;  2FY6 A;  2C1Y A;  1OC8 A;  5DAK A;  4ECC A;  4EDZ A;  5DQS A;  3BOA A;  5ID2 B;  2HE3 A;  2B7K A;  5F05 A;  2DJ0 A;  1A23 A;  5B7C A;  2IPA A;  2YV9 A;  2I3Y A;  5B8A A;  2LUS A;  1ZCP A;  4K7O A;  2JU5 A;  3RPN A;  1BAY A;  1WRY A;  4XRA A;  5ECP B;  2VUP A;  4USS A;  1FOH A;  1XW6 A;  2J23 A;  1ZYQ B;  3FZA A;  3HCZ A;  4GSS A;  1DE1 A;  3TB2 A;  4F9Z A;  1SJI A;  3VUR A;  5JCW A;  1X5C A;  2V6K A;  4TW5 A;  2JAD A;  4ZB7 A;  1IYH A;  3GA4 A;  4EVM A;  4YKG A;  1K0M A;  2KUC A;  1ZOF A;  4ZB6 A;  4RQR A;  4DVC A;  3E0U A;  5G30 A;  4NV2 A;  4PX1 A;  3TOU A;  4OFN A;  4WET A;  4AJ7 A;  3FEU A;  2ALB A;  6GSV A;  5JCG A;  2R37 A;  1XWB A;  2L6C A;  2R0C A;  1K0D A;  3P2A A;  4MF7 A;  2FWE A;  5AIX A;  4GRF A;  4KAE A;  1GLP A;  1S3D A;  2IWT A;  3QFA C;  2KHP A;  3LWA A;  1QGV A;  2LNS A;  3UBK A;  3TJG A;  1PKZ A;  1Z7P A;  4IHU A;  2H6Z A;  2L57 A;  3KTB A;  4G10 A;  3FRC A;  3HYP A;  1TRU A;  2NDO A;  2HSN B;  4W66 A;  2VCQ A;  5GST A;  4WF5 A;  3EYT A;  1AXD A;  2OAC A;  2H75 A;  4IVF A;  2RII A;  2P0G A;  3QR6 A;  3UL3 A;  1DE2 A;  1Z6N A;  3F6F A;  3ZTL A;  4D73 A;  4AJ8 A;  5A4W A;  1RK4 A;  4ZBB A;  2O7K A;  4PQI A;  2WB9 A;  1RW1 A;  4HJM A;  4YQV A;  2GSQ A;  3SWL A;  3G7J A;  4I8B A;  4JR4 A;  5LCZ A;  2B3S A;  5F06 A;  1V40 A;  2XBI A;  2HLS A;  2F51 A;  3QPM A;  3GN3 A;  4WF4 A;  1CQG A;  4IW9 A;  1XW9 A;  2VOC A;  4G2E A;  4IS0 A;  3JCM L;  4FQU A;  13GS A;  4ZIL A;  5DAK B;  1GUM A;  2P31 A;  2IME A;  19GS A;  1TRW A;  1OKT A;  4ECI A;  2VCW A;  2N5F A;  2GQL A;  4Z2R A;  4JR6 A;  4X43 A;  2YWI A;  4J57 E;  4TXO A;  2OAD A;  4ZB9 A;  3M9K A;  1Z7R A;  2LTK A;  1GTA A;  1F3A A;  2VAF A;  5J9B A;  2Z9S A;  2HSM A;  2GST A;  3TKS C;  14GS A;  3CBU A;  4FO5 A;  3M1G A;  5B6N A;  3CSH A;  4LA1 A;  5CRD A;  1U88 A;  3EWL A;  2PWJ A;  4IP6 A;  3EU4 A;  2M46 A;  1QQ2 A;  3KTL A;  4DSS A;  4EDY A;  3NOF A;  2XPE A;  1XPV A;  6GSS A;  10GS A;  1S3A A;  5L71 A;  1EP7 A;  5DDL A;  5KEJ A;  2A2P A;  5BRT A;  3TGZ A;  2K6V A;  2ON5 A;  3GX8 A;  2PGT A;  2C0E A;  3L9U A;  2DJ3 A;  3ZLP A;  3DVX A;  3GRX A;  1Z9H A;  4O5R A;  1O73 A;  3FZ4 A;  3HJP A;  3IR4 A;  4RI7 A;  4QL7 A;  5ECK B;  3GYK A;  1FG4 A;  2UZ8 A;  1Z3E A;  4F2I A;  1KBN A;  1W4V A;  2JSZ A;  4KE3 A;  3GSS A;  1H75 A;  2H73 A;  5A1N A;  1SKS B;  1XFL A;  5KOW A;  4GQC A;  3GKN A;  3KXO A;  5LNK e;  1XVQ A;  3ZRD A;  3BCK A;  3ZFL A;  4XHM A;  4OD7 A;  3DRN A;  1ACV A;  2R4V A;  2JAC A;  2V6O A;  3HVS A;  4D73 B;  4X4J A;  1THO A;  3ISO A;  2F8F A;  3TKQ A;  1ERU A;  1SK2 A;  4IN0 A;  1V57 A;  1YF1 A;  5D9T A;  2B7J A;  1X9S B;  3F63 A;  3HVX A;  2IMK A;  3UJ1 A;  1Y1U A;  1YY7 A;  1U6T A;  1VF1 A;  1X5D A;  4IQA A;  4BWS A;  2VL2 A;  2F8A A;  2H1G A;  1K3O A;  3KMN A;  1SK1 A;  2QC7 A;  4X0X A;  3L9S A;  4BA7 A;  4AKX B;  4I2U A;  4I6X A;  4KF9 A;  1F2E A;  2JZR A;  1TOF A;  3GIX A;  3J7Y b;  2MMN A;  3A2W A;  5F07 A;  2AYT A;  4X1U A;  5CRH A;  3J7Y k;  1AW9 A;  4YKF A;  3D4T A;  1F9M A;  3CTG A;  1J0F A;  1ML6 A;  4TXO B;  1ABA A;  4EO3 A;  3BBY A;  3WD6 A;  2DBC A;  22GS A;  5IPG A;  3KIJ A;  5FT3 A;  4LMW A;  2HYX A;  1YZX A;  1HNC A;  2AV4 A;  2HSM B;  1YEX A;  1GUL A;  1PRX A;  3Q6O A;  5D93 A;  5IMV A;  3KH7 A;  1G6Y A;  1BJX A;  2EC4 A;  1O8W A;  4DSS B;  3HJO A;  2NVL A;  5D8I A;  1ERW A;  4HS1 A;  5DVB A;  11GS A;  3GMF A;  1XZO A;  4MP4 A;  4KB3 A;  1E6B A;  3VK9 A;  3CSI A;  5ECR B;  4ZBD A;  3HVV A;  5DJM A;  2X49 A;  1SL2 B;  2E0Q A;  6GSU A;  2YPM A;  4NMU A;  5IO0 A;  2H66 A;  1TU7 A;  7GSS A;  1EV9 A;  4IGJ A;  2P5R A;  2VL9 A;  3LQ7 A;  4MF6 A;  2H0G A;  5A5K A;  2DML A;  1SEN A;  1XIY A;  2HSH A;  4Q5N A;  2CQ9 A;  2VM1 A;  2AB6 A;  3LYK A;  3DXB A;  1U3I A;  4V2L A;  1A8L A;  3IC4 A;  5A1N B;  1FB6 A;  1WWJ A;  3LXZ A;  1VGL A;  4MAB A;  5J4U A;  2H1A A;  3TRQ A;  3A3T A;  2UV8 G;  2YP6 A;  4ZIJ A;  4XS1 A;  1FAA A;  2ZUP A;  2NTO A;  2LQO A;  3GH6 A;  4PTS A;  5IMZ A;  4P3Y B;  2EFD A;  1XWA A;  1YKA A;  2GQK A;  3D4M A;  1QXH A;  3SBC A;  3VI5 A;  2DKI A;  4N3Z A;  2DJJ A;  2PUK C;  5ENU A;  1TK0 B;  1NSW A;  3ZML A;  4KW6 A;  2H19 A;  1A0R P;  17GS A;  3KEB A;  1ZYE A;  2QA2 A;  4Q5F A;  1SJZ A;  3W6G A;  3ZFB A;  2B5Y A;  4HOJ A;  2PVO C;  2XHF A;  1U87 A;  3DEX A;  3KCM A;  2OJL A;  5DBQ A;  5DAL A;  1T8E B;  2PU9 C;  3CTF A;  1EOH A;  4NPB A;  3C8E A;  2YWM A;  4AKH A;  1ILO A;  3LYP A;  2X8H A;  4GSN A;  2X4A A;  1KEB A;  3FY7 A;  1O6J A;  3O3T A;  1PD2 1;  4WKW A;  5ABR A;  2B5E A;  1TRV A;  1WIK A;  5COH A;  3O6T A;  4IKH A;  2BTO T;  3HHV A;  1UVZ A;  3OR5 A;  2WRT A;  4GDF A;  1OC9 A;  4I97 A;  3EMX A;  4OMV A;  4QMK A;  1BF5 A;  2WCI A;  5JWQ B;  4L8E A;  1DBY A;  4ML6 A;  1OC3 A;  1Q98 A;  5C00 A;  4A5P A;  2I4A A;  1GLQ A;  12GS A;  4KA0 A;  2ZNM A;  2EFC A;  4I2T A;  1X9W B;  1EGR A;  1K0B A;  2GDR A;  4EC0 A;  4G19 A;  5C04 A;  4GLT A;  1FB0 A;  4MLY A;  2X64 A;  3CSJ A;  3ZL5 A;  3C73 A;  2FA4 A;  3H8Q A;  1R26 A;  5EVO A;  3EUR A;  3RBT A;  4MZW A;  4N11 A;  2MBS A;  1DUG A;  1X5E A;  5IMF A;  2FWG A;  1UA5 A;  3C1R A;  1T4Z A;  3IXR A;  2FGX A;  4CDO A;  4JU5 A;  3W8S A;  1HNB A;  4L5L A;  1YQ1 A;  1AIU A;  3L78 A;  2KOK A;  1F3B A;  4EXJ A;  3ZZX A;  2IFQ A;  5CRG A;  1OE8 A;  2O5V A;  1QUW A;  4JBB A;  5AN1 A;  4OFT A;  3TUE A;  2B1L A;  2C4J A;  3MSZ A;  4GCI A;  2DIY A;  3BD2 A;  1AAZ A;  2K8S A;  3Q74 A;  2CX3 A;  5J4V A;  1BYE A;  3GH9 A;  1EEJ A;  5CNW A;  1GP1 A;  2EIO A;  2CZ2 A;  1TXU A;  3IBH A;  3DYR A;  2FWF A;  3H93 A;  2VLV A;  4K2X A;  4Z7X A;  5CO3 A;  3APO A;  4MA9 A;  1YDK A;  3LW9 A;  2L4C A;  5B8B A;  2I81 A;  3TJB A;  2VD1 A;  2LRN A;  2LS5 A;  3L9V A;  2VLU A;  3LG6 A;  4G9H A;  1GTI A;  2GLR A;  2G0F A;  2PPT A;  1YEP A;  2AHE A;  4PUF C;  4KH7 A;  2KP1 A;  1ERT A;  4EIQ A;  4TN8 A;  4HU7 A;  2VKZ G;  1XBS A;  1I9D A;  2HSY A;  4EKZ A;  4TR3 A;  3GX0 A;  2WZ9 A;  5DAL B;  1FO5 A;  1GTU A;  4CY6 A;  1RQM A;  2A4H A;  3H79 A;  4FYB A;  2H30 A;  2FHE A;  3LFL A;  3RDW A;  18GS A;  2HI7 A;  3GV1 A;  2HZF A;  1R5A A;  4BPY A;  4I5Q A;  5H5R A;  2VLT A;  2G2Q A;  3F0I A;  2RUF A;  4TXV A;  1YKC A;  4TKY A;  4XTS A;  3D5J A;  4GST A;  4PQH A;  2HT9 A;  2PMT A;  1OC9 B;  3ME7 A;  3IK9 A;  4MPF A;  2CAI A;  1R7H A;  3AY8 A;  3IHQ A;  5KN1 A;  5IQY A;  4XCS A;  3TJJ A;  5IOX A;  1N2A A;  1AUC A;  4HQS A;  1TI1 A;  3KGK A;  5GAP D;  1GSD A;  3DIE A;  1Y25 A;  3C1S A;  1PMT A;  5ECM B;  3V1W A;  2TRC P;  1G7E A;  2DIZ A;  1JFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...