3GURA

Crystal structure of mu class glutathione s-transferase (gstm2-2) in complex with glutathione and 6-(7-nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol (nbdhex)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glutathione S-transferase Mu 2
publication title Structural basis for the binding of the anticancer compound 6-(7-nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol to human glutathione s-transferases
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3gurA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gurA01
3RBTA 2H66A 5ECKB 2N5AA 4OMVA 4F0CA 1TRUA 3FZAA 1I5GA 4TRXA 2FWFA 3DGQA 2DJJA 3IBHA 1TK5B 2O8VB 2H76A 4X1UA 1R7HA 2Z9SA 4GRFA 3D21A 1K3LA 1K0AA 5GAND 4ZL7A 2M72A 4TR1A 1YKCA 1OC9B 1M7TA 1QMVA 1GSFA 1MEKA 4HOJA 4AF2A 2A2SA 2GZYA 2OKAA 3EMPA 2IMEA 1HYUA 3ME7A 2QSIA 4ZIJA 1GUKA 4PQ1A 4K2DA 3BBYA 1XWBA 1V98A 2IMIA 5CREA 4F0BA 4KUNA 2PU9C 6GSVA 2DJ0A 3TCOA 4HU7A 1AAZA 1BJXA 2FWGA 4IP6A 1JZRA 2CAIA 4LMWA 18GSA 3PH9A 1TJDA 4RQRA 3Q18A 1GNEA 1F2EA 3IC8A 1Z7RA 3NIVA 3UJ1A 2C3NA 1ERTA 4MF7A 2LJKA 3FRCA 3GH6A 1ERUA 2F8AA 3LWAA 1S3DA 3ZZXA 2N5FA 2LRCA 1E2YA 1AC1A 3DIEA 3DD3A 3M1GA 4IELA 2R2JA 1PRXA 5AGYA 4ZBDA 3QAVA 1ZCPA 2WDUA 2YPMA 4BWQA 5C00A 2HSNB 2EC4A 2L6DA 3KCMA 2YZUA 4IJ3A 3WT1A 4J56E 1YEPA 1JZDA 3TRQA 2I4AA 1TP9A 4NHZA 2YWOA 1EWXA 4OO5A 2QGVA 2X8CA 4DSQA 2X99A 2GT5A 3GSTA 4WF4A 4WEYA 1FG4A 1OKDA 2MMNA 3GA4A 4ACSA 4KNDA 3LQ7A 2FWEA 1O73A 4MF5A 1HQOA 5EL8A 5DALA 2QC7A 1R5AA 1M0UA 2P0GA 3GL5A 10GSA 4AGSA 2IJYA 2XPEA 3C71A 2PVQA 4MABA 3WGEA 3LJRA 2P31A 4G0LA 3H1NA 1TKDB 3LG6A 3GNJA 2NVLA 1XW6A 2BJXA 2G2QA 1V58A 1T4YA 3M9KA 2AAWA 1AXDA 2F9SA 4P3YB 2DC5A 1SKWB 1G7OA 1PSQA 1VRSD 4WETA 4H86A 2NBSA 1R4WA 3U6VA 1X9SB 3Q19A 3LYPA 1T00A 3BCKA 3FZ5A 2FD3A 2JZTA 4IHUA 3L9UA 5ECQB 1ERWA 1ML6A 1SK2A 2J9HA 1EGOA 5CRHA 4FYCA 5HFGA 4K0GA 2K9FA 3R3EA 4N11A 4QQ7A 1U88A 2GSSA 2ZNMA 2IFQA 5J5NA 2FNOA 3ISOA 2HZFA 1OKTA 4IQAA 1B8XA 1HNBA 4PQHA 5J9BA 2FY6A 2O85A 1NHYA 5CRGA 4TOPA 4JU5A 17GSA 3HJMA 1BQ7A 4IW9A 1AW9A 2FLSA 4XTSA 1SYXA 2IIYA 4L0WA 3F6FA 4HI7A 4KGIA 1SK1A 3GKXA 4KF9A 3DYRA 2C0EA 2LNTA 4KX4A 5ID2B 4DEJA 1UA5A 3A2VA 4ZB6A 4JE1A 3BOAA 3GX0A 3TOTA 1TI3A 3SBCA 3BJ5A 4TVEA 3QDNA 4ZB8A 4OD7A 3HXSA 4RI6A 3TGZA 2J23A 4KDYA 3A2WA 4LL1B 4O5RA 1A0FA 4LLRA 5D9VA 5LNKe 5A4UA 1E6BA 3M9JA 2OE3A 4IP1A 2HSMA 3ZIJA 1A24A 3TJGA 3FHKA 4WBJA 5DQYA 2H0HA 4POKA 1M2BA 3RDWA 2LJRA 5ECLB 1RK4A 5G5FA 4MDCA 2MBTA 4I8BA 5F07A 2FHEA 3EVIA 4K7IA 2H1DA 1JFUA 2RM5A 5ECIB 3F0IA 5D9XA 1EV9A 1OAZA 4POBA 3QFBC 4YQUA 5BMUA 2KP1A 5CP1A 2KHPA 4HJMA 3BCIA 5JWQB 2ZUPA 3FYGA 4RQXA 1PGTA 3VK9A 5INYA 2A4VA 3LXTA 3QCPA 1YF0A 1Z6NA 3JCML 4IJIA 4MZBA 2B7KA 2TRCP 1PL2A 3HZ8A 1AUCA 1UN2A 1NSWA 2HT9A 6GSYA 3W6GA 3TJJA 1V9WA 3HCZA 2IL3A 1EGRA 2GTUA 3GTUA 1USBA 1X0RA 2GT6A 5C04A 3IV4A 1HNCA 1PX6A 3DVXA 2PN8A 2R4VA 3QPMA 1XWAA 2OBKA 3APQA 5D9WA 5FHIA 4HJ2A 1Z3EA 1KEBA 1NM3A 4L5LA 2P5QA 5JCUA 2VD1A 4MH2A 2LJAA 2B1KA 2LNSA 1GUHA 5COHA 1PD21 3UBKA 1BG5A 4KH7A 4G2EA 4TR4A 5J4UA 3QFAC 2OACA 1JLWA 2CVBA 2YNXA 3VI5A 5GSSA 3F4SA 1MD3A 3C7MA 3D22A 3LFLA 2LTKA 3VPTA 1EZKA 4TXOA 3L0HA 3ZIVA 4PUAA 1I9DA 2R6KA 5IQYA 1GSDA 2PGTA 2RLIA 4Q5RA 1OC3A 1ZYQB 2X64A 3APOA 2H73A 5DQSA 2PPTA 1GTIA 2ON7A 1S3AA 2JU5A 2V6OA 5CRDA 4MJBA 1GRXA 3VFIA 4GSTA 3ZYWA 3CSJA 4PURA 4TN8A 3TRPA 2I9HA 2CX3A 5JCWA 3HZ4A 2HFDA 6GSSA 2C3TA 4DSSA 4KA0A 3KEBA 4EKZA 4HEA2 2L4CA 1SD9A 1LU4A 5CO3A 3LSZA 4FH8A 1TRVA 3APSA 5D73A 3IAS2 2FCHA 4KSOA 3I9V2 1SENA 5IO0A 4OFTA 20GSA 4JZQA 1XPVA 2YZHA 4BVYA 3C1SA 5HR2A 3CMIA 3MSZA 1U3IA 2CA8A 3G7YA 2HI7A 4OCFA 1J9BA 3ZLPA 1AIUA 12GSA 4YAVA 4OFMA 1X5CA 1N8JA 1XBSA 4HUAA 3KMNA 13GSA 5EVOA 2OE0A 4O7HA 1K0OA 3TKSC 2REMA 3K8NA 2RIIA 4IN0A 2LQOA 5IMDA 5H5RA 3FW2A 4ZXGA 4JEDA 2TIRA 4WXTA 1BYEA 1PKWA 3UARA 2G0FA 4JBBA 1GWCA 2VL3A 1ACVA 2CVDA 4PNFA 3O76A 2VM1A 1M99A 2H70A 3EC3A 2H71A 3HJOA 1BX9A 3PINA 5HFIA 3TKSE 3TB2A 2DJ3A 3G9BA 3MDKA 4XRAA 1THOA 1AQWA 4OFNA 3MWHA 3UVHA 3ED3A 1JLVA 2BMXA 2K18A 5G1LA 1EOHA 1WJKA 2VLVA 4GLTA 2OADA 2MMZA 4PGTA 3RHCA 4EC0A 1F9MA 4NV5A 5LD0A 2HRNA 3H8QA 3LGCA 1OC9A 2EIOA 3F9UA 3H4KA 2JSZA 2LEGA 2PWJA 5A5KA 4G0IA 3IC4A 3GFKA 4DVCA 2FUG2 3DRNA 2CZ3A 2PMTA 3PPUA 5IMFA 3CTFA 2YWIA 1F3BA 3HY2A 1Q98A 2CT6A 2O89A 2H72A 2VL2C 1RW1A 1YY7A 1ZGNA 2CVKA 3HKRA 2JADA 2C1YA 1N2AA 5KN2A 1DE1A 5A4VA 1CQGA 3IA1A 1W4VA 1X9MB 1H75A 5CAXA 4ML6A 2VUPA 4OWYA 1AQXA 1ZMAA 1YDKA 4HDEA 2KUCA 1KBNA 3IR4A 1XIYA 6GSTA 4K7NA 1M9AA 5F8BA 4MK3A 3IHQA 3HVSA 3W8JA 3EYTA 2L59A 3A3TA 2ALBA 3F3QA 3HA9A 5ECRB 1T4ZA 1GLPA 2L6CA 4NV2A 3KD0A 1QK8A 1B4PA 3I69A 2BTOT 1Z5YE 5HR1A 3CXGA 1M9BA 2FWHA 5AISA 1YQ1A 1ILOA 1DBYA 1A2JA 4IVFA 4CW9A 2WRTA 1GSEA 2C80A 3PR8A 3FEUA 1SKSB 2H6ZA 1QGVA 3KP8A 2R5GA 5IO2A 5B7CA 2GQMA 3GUSA 2AUVA 4E8EA 1THXA 3TDGA 4V1Ag 5IIZA 14GSA 1EP7A 4YQMA 5HR3A 3F4RA 4NPBA 3UL3A 3VWWA 2X8GA 4K7OA 1LJRA 3LYKA 3DWVA 4OCEA 2YV9A 4G10A 1ZL9A 3QAGA 4BPYA 4O92A 4HQZA 1GSYA 1R26A 4EL1A 1GLQA 1JZWA 4MPFA 4WBRD 4MZCA 4GQFA 1XW9A 3E3EA 2VLTA 2K8VA 5DVBA 2C8UA 2DMLA 5G2ZA 4XS6A 3LXZA 2MZCA 1K0MA 3FKFA 1SJ6A 1LBKA 4G19A 2VD0A 5ENUA 4KCAA 2JSYA 3HDCA 4LA1A 4V1Ap 1QFNA 4D73B 4PQIA 2VCVA 2WCIA 5D9TA 2PBJA 4ZILA 1U6TA 2KOKA 3ERWA 1SKRB 4GWRA 2K6VA 2H19A 3DMLA 3CRTA 3DEXA 1UVZA 3GRXA 5DBQA 3VWXA 4MZWA 2B5XA 1VF4A 4D73A 2HE3A 4BWSA 4EF0A 2VCTA 1YF1A 4O32A 4F03A 1C72A 2LUSA 5IMAA 1DUGA 1FO5A 3HVXA 1XFLA 5IOWA 3GH9A 2E2MA 1BEDA 4XHMA 1K0CA 1BAYA 4EDYA 2R3XA 4L5OA 5FWGA 3ZFBA 2F8FA 4JR6A 4AJ6A 1GTAA 4KCEA 1OYJA 1XCCA 4KDUA 1XZOA 1TOFA 5DDLA 5ABRA 1B4QA 3QMXA 3EE2A 4AJ7A 5G30A 1XWKA 4EDZA 4GCIA 5ID2A 1PMTA 1F3AA 3ZMLA 2WGRA 5E59A 1VF1A 3ZTLA 4K8MA 3G7JA 1K3YA 3UIWA 3KJYA 2MMOA 1K0DA 2WS2A 4KDXA 1TU8A 1PKZA 1PQNA 4ISDA 3GN3A 2AB6A 4E8HA 5A4WA 1SL0B 3ZVJD 4F2IA 2HNLA 5J41A 1G6YA 2H75A 1FVKA 2JL4A 1OE8A 4WF5A 3IPZA 1NW2A 2DJ2A 3P7XA 3L9VA 1Q4JA 5AN1A 1IYHA 3E9JB 1WMJA 3W8SA 1K0NA 3FY7A 3H79A 3BD2A 1GL8A 5IPHA 1FHEA 1TDIA 2HRKB 5DAKB 22GSA 5B6MA 1O8XA 3F6DA 3IK7A 2H1AA 2LKUA 4YQVA 4GQCA 1FVJA 2ZCTA 1JHBA 3FK8A 3GKNA 5FT3A 4X0XA 5AIXA 3WT2A 5JCGA 1O7UA 2RM6A 5ECOB 4CHSA 5ECNB 2YCDA 2DJKA 2C3QA 1EV4A 5DAKA 2UZ8A 3CSIA 3GIXA 5EPFA 1FB0A 2NDOA 3PGTA 3RHBA 4HQSA 4ILFA 1ZZYA 3LEFA 2B6MA 2CV4A 1J08A 4K1FA 5ECMB 2DIZA 5AIVA 4NMUA 2OE1A 2YANA 2M46A 2RUFA 1A2MA 3N5OA 1TK8B 3P2AA 1XWCA 2VO4A 3QAWA 4ZBAA 2PVOC 2R37A 1SD8A 2QKEA 4BVXB 1WE0A 2B5EA 2GVPA 3WD6A 1PL1A 3V1WA 1K0BA 2CQ9A 4XIHA 2K8SA 2HRFA 5IPGA 3IXRA 1CQHA 4HZ2A 2MYGA 1YZXA 2GQLA 2RUEA 4L8EA 4GSNA 2XBIA 2HQTA 1WOUA 4XS1A 3U5RE 2VM2A 5HFKA 3D0ZA 1HD2A 5LCZA 4G9HA 2I81A 4I5QA 1XW5A 4PX1A 3D4TA 3GX8A 5HR0A 5CRWA 3O3TA 3N9JA 4ECBA 3ZVJA 1A0RP 2C0GA 1GSQA 1J0FA 3EWLA 2OA7A 1ABAA 3TJFA 5KN3A 1MTCA 3CSHA 4XS4B 1TK0B 4HZ4A 3EU3A 4EXJA 3UEMA 1Z7PA 4RUVA 4HU9A 5F06A 1M2DA 1XOAA 4YAPA 1X5EA 5H5QA 2DBCA 1X9WB 3VPQA 3GHAA 4N10A 2F51A 2OBIA 4MLYA 4EVMA 4FYUA 4PTSA 3MNGA 2AV4A 2YN1A 2WJUA 2KLXA 2WZ9A 3CTGA 4MCUA 1WRYA 3M0FA 1Z6MA 4MPGA 2NTOA 6GSWA 3IRAA 3D6IA 1OE7A 3D5JA 1XWGA 5DJMA 3KTBA 1EEJA 2HYXA 2PUKC 4IS0A 1FOVA 1GTUA 4TW5A 2YWNA 1Y6EA 4IBPA 1Z9HA 2XBQA 3VLNA 3UAPA 1PN9A 4TR1B 1KNGA 2LQQA 1SJIA 2HRAA 3AY8A 4MMMA 3KH9A 3CBUA 4GXZA 2GLRA 2CAQA 4V2LA 4Q5QA 4PUFC 2EIQA 2IMDA 3KGKA 3TOUA 2X8HA 2GZPA 4L0UA 2OJLA 3OR5A 1U87A 4NHWA 3ZMKA 3L4NA 1ZYEA 4EUYA 2C4JA 2B7JA 3QD9A 3VURA 2N5BA 4ZL8A 3LORA 1T1VA 1B9XC 3H93A 1TI1A 5IMVA 3DVWA 3HD5A 3IOSA 3IE3A 2H0GA 6GSXA 1H4OA 3TKPA 5ECHB 3GURA 2NPBA 19GSA 2PERA 3HVVA 2F3MA 1VGLA 1G6WA 3GSSA 2H6YA 1ON4A 1OC8A 3EU4A 1T8EB 3GV1A 4K6XA 3ERFA 2H74A 3TJKA 2E2GA 4ML1A 3NOFA 3VWUA 4WKWA 3F4TA 2AJQB 1SK0A 3KP9A 3KXOA 2H30A 2CX4A 1QXHA 4IGJA 1MDJA 2YOIA 4KW6A 5ECPB 1MDIA 5L71A 2VAFA 2IMFA 4Q5FA 4POMA 2DMMA 4N30A 4TXVA 4K0NA 16GSA 3UBLA 1T3BA 3R2QA 1MD4A 3HJPA 3NZNA 2VCZA 2V41A 3O6TA 5DALB 2XC2A 3DKSA 2H1GA 3S9FA 3GKMA 2AYTA 3GKKA 3A2XA 2P5RA 2VIMA 3GYKA 2VCWA 4GSSA 2GSQA 2LRNA 4TR0A 1WIKA 4K9ZA 4KB3A 4KE3A 5JWRB 3ZITA 3FZ9A 2V2GA 4ECCA 4USSA 3Q6OA 4F9ZA 4V2MA 2IMKA 1JZOA 5D8IA 3FZ4A 4MP4A 2FA8A 2YJ7A 2B1LA 2HLSA 3FR6A 3RPNA 1A23A 7GSSA 2HSYA 1A2LA 1XVWA 3P90A 3J7Yk 1YJ6A 3ERGA 2VL9A 1R5PA 3ZFLA 3KIJA 1Y25A 2I1UA 5B6NA 1NHOA 4IQ1A 2FGXA 2ES7A 3TKRA 2H0IA 11GSA 9GSSA 2IFQB 1WWJA 3GMFA 3KTLA 4KAEA 4I2TA 2C0DA 4NWYA 2VOCA 1DE2A 4V2NA 3TKSA 3HHVA 1T7PB 2H6XA 2YV7A 4FYBA 2HXKA 4TR3A 1XVQA 4OO4A 6GSUA 1O8WA 4LMVA 3ZL5A 3C8EA 5DCGA 1TW9A 3M8NA 5J3RA 1GH2A 1V2AA 4TKYA 5IMZA 5GZZB 1OVNA 3UOMA 3CYNA 2L57A 5G5EA 1V40A 2IN3A 5F05A 5IM9A 5ELGA 5IMCA 1MDKA 1AQVA 2LV3A 2GSTA 3C73A 4NXIA 1IYIA 1DSBA 2HZEB 4AJ8A 2A2RA 2FA4A 2B3SA 1U3AA 1B48A 1PX7A 4YH2A 5ECSA 4ZBBA 2JZRA 1O6JA 2DJ1A 2E0QA 1ERVA 5G1KA 1UC7A 3WGXA 4XCSA 4Q5NA 2VCXA 4GF0A 2L4QA 4BA7A 2HSMB 5KEJA 4ZL9A 2HZEA 1GP1A 1GULA 3KH7A 2V1MA 3EINA 4MF6A 1ST9A 2B5YA 2H8LA 4I2UA 4JRRA 2L5LA 4MJAA 1W89A 2C0FA 3SWLA 4IKHA 2VL2A 3F63A 3ME8A 1ZOFA 3KMOA 2H1BA 5DJLA 1G0TA 2YJHA 3CRUA 1V57A 2DLXA 2O7KA 4J57E 3TRXA 2JZSA 4MJCA 1TRSA 4EE0A 2HSHA 1GTBA 4BL7B 2JACA 1A8LA 4QL9A 4KSMA 4GTUA 1O81A 3I43A 3E0UA 3QR6A 3WYWA 2GGTA 4PNGA 4WR5A 5JWOB 2MBSA 4FIWA 1SJZA 3VWVA 4F82A 2GQKA 1B9YC 3DXBA 1EEMA 2DIYA 3I6AA 3GTUB 4X43A 3EURA 1M2AA 4CDOA 4BL7A 4I6XA 3J7Yb 3F3RA 2HRKA 2LSTA 3FR9A 4EO3A 2D2ZA 3KM6A 2V32A 1K3OA 1GUMA 1FAAA 4WR4A 4I97A 1O85A 1RQMA 2V6KA 3IDVA 2MMAA 2VLUA 5D96A 1A8YA 5J9CA 5ELAA 4NAXA 2TRXA 1XOBA 2KP2A 4RI7A 5G31A 5CYYA 1FB6A 4ULXA 3MAKA 4TXOB 3C1RA 3ZREA 4JR4A 5F0GA 1EP8A 4MH3A 2L5OA 3RAZA 3A5WA 1S3CA 1QUWA 5DCHA 2EIRA 2H01A 3M3MA 1TRWA 1GSSA 2YP6A 3TUEA 1TXXA 4MA9A 3HYPA 2AHEA 4LL4B 4G0KA 1PA3A 2GS3A 3F8UA 5E4WA 4ECJA 1WP0A 1URMA 3D4MA 4DSSB 4BVXA 2I3YA 2VCQA 2XPDA 1KTEA 5H5SA 2WB9A 2IPAA 4FO5A 3WGDA 8GSSA 2ON5A 4PXOA 3KZQA 1F37A 1YEXA 1TU7A 5EY6A 4HS1A 3RPPA 1SL2B 3ZRDA 1VF2A 5HQPA 4ECIA 1YKAA 4BVYB 3QOUA 2IWTA 3US3A 2CZ2A 3EMXA 5IOXA 1X5DA 1G7EA 2GZZA 1GSUA 4XRDA 2WFCA 4ZB9A 2LRTA 2M80A 1F6MC 5D93A 1QQ2A 3Q74A 4QL7A 3P8WA 2WULA 4DSRA 3L78A 2GDRA 2XHFA 5KN1A 3IAM2 1GNWA 4MJEA 1XXUA 1SU9A 1EOGA 4XS4A 2GSRA 2E7PA 1HNAA 3IK9A 5B8AA 1SL1B 4Z7XA 4POLA 4N0ZA 3GL3A 3TJBA 3G7IA 2YWMA 3UMAA 1WPIA 4J2FA 1SYRA 5CNWA 3VI7A 1FW1A 5KN0A 4ID0A 3FR3A 3UVTA 3TKQA 4N0VA 1VF3A 4FQUA 1TTZA 5B8BA 2DSAA 5GSTA 2O87A 2LS5A 3L9SA 5GAPD
chains in the Genus database with same CATH superfamily
3RBTA 2H66A 5ECKB 2N5AA 4OMVA 4F0CA 1TRUA 3FZAA 1I5GA 4TRXA 2FWFA 3DGQA 3HMJG 2DJJA 3IBHA 1TK5B 2O8VB 2H76A 4X1UA 1R7HA 2Z9SA 4GRFA 3D21A 1K3LA 1K0AA 5GAND 4ZL7A 2R0GA 2M72A 4TR1A 4YKGA 4ICYA 1YKCA 1OC9B 1M7TA 5J47A 1QMVA 1Y1UA 1GSFA 1MEKA 4HOJA 4AF2A 2A2SA 2GZYA 2OKAA 3EMPA 2IMEA 1HYUA 3ME7A 2QSIA 4ZIJA 1GUKA 4PQ1A 4K2DA 3BBYA 1XWBA 1V98A 2IMIA 5CREA 4F0BA 4KUNA 2PU9C 6GSVA 2DJ0A 3TCOA 4HU7A 1AAZA 1BJXA 2FWGA 4IP6A 1JZRA 2CAIA 4LMWA 2X49A 18GSA 3PH9A 1TJDA 4RQRA 3Q18A 4K2XA 1GNEA 1F2EA 3IC8A 1Z7RA 3NIVA 5J4VA 3UJ1A 2C3NA 1ERTA 4MF7A 2LJKA 3FRCA 3GH6A 1ERUA 2F8AA 3LWAA 1S3DA 3ZZXA 2N5FA 2LRCA 1E2YA 1AC1A 3DIEA 3DD3A 3M1GA 4IELA 2R2JA 1PRXA 5AGYA 4ZBDA 3QAVA 1ZCPA 2WDUA 2YPMA 4BWQA 5C00A 2HSNB 2EC4A 2L6DA 3KCMA 2YZUA 4IJ3A 3WT1A 4J56E 1YEPA 1JZDA 3TRQA 2I4AA 1TP9A 4NHZA 2YWOA 1EWXA 4OO5A 2QGVA 2X8CA 4DSQA 2X99A 2GT5A 2HSNA 3GSTA 4WF4A 4WEYA 1FG4A 1OKDA 2MMNA 3GA4A 4ACSA 4KNDA 3LQ7A 2FWEA 1O73A 4MF5A 1HQOA 5EL8A 3TU3B 5DALA 2QC7A 1R5AA 1M0UA 2P0GA 1YVLA 4MNNA 3GL5A 10GSA 4AGSA 2IJYA 2XPEA 3C71A 2PVQA 4MABA 3WGEA 3LJRA 2P31A 4G0LA 3H1NA 4K5RA 1TKDB 3LG6A 3GNJA 2NVLA 1TXUA 1XW6A 2BJXA 2G2QA 1ZYPA 1V58A 1T4YA 3M9KA 2AAWA 1AXDA 2F9SA 4P3YB 2DC5A 1SKWB 1G7OA 1PSQA 1VRSD 4WETA 2NBSA 4H86A 1R4WA 3U6VA 1X9SB 3Q19A 3LYPA 1T00A 3BCKA 3FZ5A 2FD3A 3RFRC 2JZTA 4IHUA 3L9UA 5ECQB 1ERWA 1ML6A 1SK2A 2J9HA 1EGOA 5CRHA 4FYCA 5HFGA 4K0GA 2K9FA 4A5PA 3R3EA 4N11A 4QQ7A 1U88A 2GSSA 2ZNMA 2IFQA 5J5NA 2FNOA 3ISOA 2HZFA 1OKTA 4IQAA 1B8XA 1HNBA 4AKGA 4PQHA 5J9BA 1BF5A 2FY6A 2O85A 1NHYA 5CRGA 4TOPA 4JU5A 17GSA 3HJMA 1BQ7A 4IW9A 1AW9A 2FLSA 4XTSA 1SYXA 2IIYA 4L0WA 3F6FA 4HI7A 4KGIA 1SK1A 3GKXA 4KF9A 3DYRA 2C0EA 2LNTA 4KX4A 5J4YA 5ID2B 4DEJA 1UA5A 3A2VA 4ZB6A 4JE1A 3BOAA 3GX0A 3TOTA 1TI3A 3SBCA 3BJ5A 4TVEA 3QDNA 4ZB8A 4OD7A 3HXSA 4RI6A 3TGZA 2J23A 4KDYA 3A2WA 4LL1B 4O5RA 1A0FA 4LLRA 5D9VA 5LNKe 5A4UA 1E6BA 3M9JA 2OE3A 4IP1A 2HSMA 3ZIJA 1A24A 3TJGA 3FHKA 4WBJA 5DQYA 2H0HA 4POKA 1M2BA 3RDWA 2LJRA 5ECLB 5BMUB 1RK4A 5G5FA 4MDCA 2MBTA 4PHZC 4I8BA 5F07A 2FHEA 3EVIA 4K7IA 2H1DA 1JFUA 2RM5A 5ECIB 2O3EA 3F0IA 5D9XA 1EV9A 1OAZA 4POBA 3QFBC 4YQUA 5BMUA 2KP1A 5CP1A 2KHPA 4HJMA 3BCIA 5JWQB 4N3ZA 2ZUPA 3FYGA 4RQXA 1PGTA 3VK9A 5INYA 2A4VA 3LXTA 3QCPA 1YF0A 1Z6NA 3JCML 4IJIA 4MZBA 2B7KA 2TRCP 1PL2A 3HZ8A 1AUCA 2UV8G 1UN2A 1NSWA 2HT9A 6GSYA 3W6GA 3TJJA 1V9WA 3HCZA 2IL3A 1EGRA 2GTUA 3GTUA 1USBA 1X0RA 2GT6A 5C04A 3IV4A 1HNCA 1PX6A 3DVXA 2PN8A 2R4VA 3QPMA 1XWAA 2OBKA 3APQA 5D9WA 5FHIA 4HJ2A 1Z3EA 1KEBA 1NM3A 4L5LA 2P5QA 5JCUA 2VD1A 4MH2A 2LJAA 2B1KA 2LNSA 1GUHA 5COHA 1PD21 3UBKA 2H1LA 1BG5A 4KH7A 4G2EA 4TR4A 5J4UA 3QFAC 2OACA 1JLWA 2CVBA 2YNXA 3VI5A 5GSSA 3F4SA 1MD3A 3C7MA 2WZSA 3D22A 3LFLA 2LTKA 3VPTA 1EZKA 4TXOA 3L0HA 3ZIVA 4PUAA 1I9DA 2R6KA 5IQYA 1GSDA 2PGTA 2RLIA 4Q5RA 1OC3A 1ZYQB 2X64A 3APOA 2H73A 5DQSA 2PPTA 1GTIA 4HSCX 4YKFA 2ON7A 1S3AA 2JU5A 2V6OA 5CRDA 4MJBA 1GRXA 3VFIA 4GSTA 3ZYWA 5A1NA 3CSJA 4PURA 4TN8A 3TRPA 4W66A 2I9HA 4BIKA 2CX3A 5JCWA 3HZ4A 2HFDA 6GSSA 2C3TA 4DSSA 4KA0A 3KEBA 4EKZA 4HEA2 2L4CA 1ZYNA 1SD9A 1LU4A 5CO3A 3LSZA 4FH8A 1TRVA 3APSA 5D73A 3IAS2 2FCHA 4KSOA 3I9V2 1SENA 1I1IP 5IO0A 4OFTA 20GSA 4JZQA 1XPVA 2YZHA 4BVYA 3C1SA 5HR2A 3CMIA 3MSZA 1PFOA 1U3IA 2CA8A 3G7YA 2HI7A 4OCFA 1J9BA 3ZLPA 1AIUA 12GSA 4YAVA 4OFMA 1X5CA 1N8JA 1XBSA 4HUAA 3KMNA 13GSA 5EVOA 2OE0A 4O7HA 1K0OA 3TKSC 2REMA 4E68A 3K8NA 2RIIA 2O36A 4IN0A 2LQOA 5IMDA 5H5RA 3FW2A 4ZXGA 4JEDA 2TIRA 4WXTA 1BYEA 1PKWA 3UARA 2G0FA 4JBBA 1GWCA 2VL3A 1ACVA 2CVDA 4PNFA 3O76A 2VM1A 1M99A 2H70A 3EC3A 2H71A 3HJOA 1BX9A 2EFCA 4PI0C 3PINA 5HFIA 3TKSE 3TB2A 2DJ3A 3G9BA 3MDKA 4XRAA 1THOA 1AQWA 4OFNA 3MWHA 3UVHA 3ED3A 1JLVA 2BMXA 2WW1A 2K18A 5G1LA 1EOHA 1WJKA 2VLVA 4GLTA 2OADA 2MMZA 4PGTA 3RHCA 4EC0A 1F9MA 4NV5A 5LD0A 2HRNA 3H8QA 3LGCA 1OC9A 2EIOA 3F9UA 3H4KA 2JSZA 2LEGA 2PWJA 5A5KA 4G0IA 3IC4A 3GFKA 4DVCA 1SVLA 2FUG2 3DRNA 2CZ3A 2PMTA 3PPUA 5IMFA 3CTFA 2YWIA 1F3BA 3HY2A 1Q98A 4QMKA 2CT6A 2O89A 2H72A 4Z2RA 2VL2C 1RW1A 1YY7A 1ZGNA 2CVKA 3HKRA 2JADA 2C1YA 1N2AA 5KN2A 1DE1A 5A4VA 1CQGA 3IA1A 4O5UA 1W4VA 1X9MB 1H75A 5CAXA 4ML6A 2VUPA 4OWYA 1AQXA 4ZB7A 1YDKA 1ZMAA 4HDEA 2KUCA 1KBNA 3IR4A 1XIYA 6GSTA 4K7NA 1M9AA 5F8BA 4MK3A 4K5SA 3IHQA 3HVSA 3W8JA 3EYTA 2L59A 3A3TA 2ALBA 3F3QA 3HA9A 5ECRB 1T4ZA 1GLPA 2L6CA 4NV2A 3KD0A 1QK8A 2A4HA 1B4PA 3I69A 2BTOT 1Z5YE 5HR1A 3CXGA 1M9BA 2FWHA 5AISA 1YQ1A 1ILOA 3HVNA 1DBYA 1A2JA 4IVFA 4CW9A 2WRTA 1GSEA 2C80A 3PR8A 3FEUA 1SKSB 2H6ZA 1QGVA 3KP8A 2R5GA 5IO2A 5B7CA 2GQMA 3GUSA 2AUVA 4E8EA 4AKXB 1THXA 3TDGA 4V1Ag 5IIZA 14GSA 4CY8A 1EP7A 4YQMA 5HR3A 3MYDA 3F4RA 4NPBA 3UL3A 1XG8A 3VWWA 2X8GA 4K7OA 1LJRA 3LYKA 3DWVA 4OCEA 2YV9A 4G10A 1ZL9A 3QAGA 4BPYA 4O92A 4HQZA 1GSYA 1R26A 4EL1A 1GLQA 1JZWA 4MPFA 4WBRD 4MZCA 4GQFA 1XW9A 3E3EA 2VLTA 2K8VA 5DVBA 2C8UA 2DMLA 5G2ZA 4XS6A 3LXZA 2MZCA 1K0MA 5A34B 4O5QA 3FKFA 1SJ6A 1LBKA 4G19A 2VD0A 5ENUA 4KCAA 2JSYA 3HDCA 4LA1A 4V1Ap 1QFNA 4D73B 4PQIA 2VCVA 2WCIA 5D9TA 2PBJA 4ZILA 1U6TA 2KOKA 3ERWA 1SKRB 4GWRA 2K6VA 2H19A 3DMLA 3CRTA 3DEXA 1UVZA 3GRXA 5DBQA 3VWXA 4MZWA 2B5XA 1VF4A 4D73A 2HE3A 4BWSA 4EF0A 2VCTA 1YF1A 4O32A 4F03A 1C72A 2LUSA 5IMAA 1DUGA 1FO5A 3HVXA 1XFLA 5IOWA 3GH9A 2E2MA 1BEDA 2R0PA 4XHMA 1K0CA 1BAYA 4EDYA 2R3XA 4L5OA 5FWGA 3ZFBA 2F8FA 4JR6A 4AJ6A 1GTAA 4KCEA 1OYJA 1XCCA 4KDUA 1XZOA 1TOFA 5DDLA 5ABRA 1B4QA 3QMXA 3EE2A 4AJ7A 5G30A 1XWKA 5A5HB 1YEWC 4EDZA 4GCIA 5ID2A 1PMTA 2EFHA 1F3AA 3ZMLA 2WGRA 5E59A 1VF1A 3ZTLA 4K8MA 3G7JA 1K3YA 3UIWA 3KJYA 2MMOA 1K0DA 2WS2A 4KDXA 1TU8A 1PKZA 1PQNA 4ISDA 5A5HA 3GN3A 2AB6A 4E8HA 4Z2UA 5A4WA 1SL0B 3ZVJD 4F2IA 2HNLA 5J41A 1G6YA 1PN0A 2H75A 1FVKA 2JL4A 1OE8A 4WF5A 3IPZA 1NW2A 2DJ2A 3P7XA 3L9VA 1Q4JA 5AN1A 1IYHA 3E9JB 1WMJA 3W8SA 1K0NA 3FY7A 3H79A 3BD2A 1GL8A 5IPHA 1FHEA 1TDIA 2HRKB 5DAKB 22GSA 5B6MA 1O8XA 1M3JA 5J40A 3F6DA 3IK7A 2H1AA 2LKUA 4YQVA 4GQCA 1FVJA 2ZCTA 1JHBA 3FK8A 3GKNA 5FT3A 4X0XA 5AIXA 3WT2A 5JCGA 1O7UA 2RM6A 5ECOB 1M3IA 4CHSA 5ECNB 2YCDA 2DJKA 2C3QA 1EV4A 5DAKA 2UZ8A 3CSIA 3GIXA 5EPFA 1FB0A 4AKIA 2NDOA 3PGTA 3RHBA 4HQSA 4ILFA 1ZZYA 3LEFA 2B6MA 2CV4A 1J08A 4K1FA 5ECMB 2DIZA 5AIVA 2QA1A 4NMUA 2OE1A 2YANA 2M46A 2RUFA 1A2MA 3N5OA 1TK8B 3P2AA 1XWCA 2VO4A 3QAWA 4ZBAA 2PVOC 2R37A 1SD8A 2QKEA 4BVXB 1WE0A 2B5EA 2GVPA 3WD6A 1PL1A 3V1WA 1K0BA 2CQ9A 4XIHA 2K8SA 2HRFA 3IHGA 5IPGA 3IXRA 1CQHA 4HZ2A 2MYGA 1YZXA 2GQLA 2RUEA 4L8EA 4GSNA 2XBIA 2HQTA 1WOUA 4FXYP 4XS1A 3U5RE 2VM2A 5HFKA 3D0ZA 1HD2A 5LCZA 4G9HA 2I81A 4I5QA 1XW5A 4PX1A 3D4TA 3GX8A 5HR0A 5CRWA 3O3TA 3N9JA 4ECBA 3ZVJA 1A0RP 2C0GA 1GSQA 1J0FA 3EWLA 2OA7A 1ABAA 3TJFA 5KN3A 1MTCA 3CSHA 4XS4B 1TK0B 4HZ4A 3EU3A 4EXJA 3UEMA 1Z7PA 4RUVA 4HU9A 5F06A 1M2DA 1XOAA 4YAPA 1X5EA 5H5QA 2DBCA 1X9WB 3VPQA 3GHAA 4N10A 2F51A 2OBIA 4MLYA 4EVMA 4FYUA 4PTSA 3MNGA 2AV4A 2YN1A 2WJUA 2KLXA 2WZ9A 3CTGA 4MCUA 1BG1A 1WRYA 3M0FA 1Z6MA 4MPGA 2NTOA 6GSWA 3IRAA 3D6IA 1OE7A 3D5JA 1XWGA 5DJMA 3KTBA 1EEJA 2HYXA 2PUKC 2R0CA 4IS0A 1FOVA 3A5IA 1GTUA 4TW5A 2YWNA 1Y6EA 4IBPA 1Z9HA 2XBQA 3VLNA 3UAPA 1PN9A 4TR1B 1KNGA 2LQQA 1SJIA 2HRAA 3AY8A 4MMMA 3KH9A 3CBUA 4GXZA 2GLRA 2CAQA 4V2LA 4Q5QA 4PUFC 2EIQA 2A2PA 2IMDA 3KGKA 3TOUA 2X8HA 2X4AA 2GZPA 4L0UA 2OJLA 3OR5A 1U87A 4EIQA 4NHWA 3ZMKA 3L4NA 1ZYEA 4EUYA 2C4JA 2B7JA 3QD9A 3VURA 2N5BA 4ZL8A 3LORA 1T1VA 4AI6A 1B9XC 3H93A 1TI1A 5IMVA 3CHXC 3DVWA 3HD5A 3IOSA 3IE3A 2WVYA 2H0GA 6GSXA 4Z2TA 1H4OA 3TKPA 5ECHB 3GURA 2NPBA 19GSA 2PERA 3HVVA 2F3MA 1VGLA 1G6WA 3GSSA 3RGBC 2WVZA 2H6YA 1ON4A 1OC8A 3EU4A 1T8EB 3GV1A 4K6XA 3ERFA 2H74A 3TJKA 2E2GA 4ML1A 3NOFA 3VWUA 5KOWA 4WKWA 3F4TA 2AJQB 1SK0A 3KP9A 3KXOA 2H30A 2CX4A 1QXHA 4IGJA 1MDJA 2YOIA 4KW6A 5ECPB 1MDIA 5L71A 2VAFA 2IMFA 4Q5FA 4POMA 2DMMA 4N30A 4TXVA 1FOHA 4K0NA 1S4BP 16GSA 3UBLA 1T3BA 3R2QA 1MD4A 3HJPA 3NZNA 4X4JA 2VCZA 2V41A 3O6TA 5DALB 2XC2A 3DKSA 2H1GA 3S9FA 3GKMA 2AYTA 3GKKA 3A2XA 2P5RA 2VIMA 3GYKA 2WVXB 2VCWA 4GSSA 2GSQA 2LRNA 4TR0A 1WIKA 4K9ZA 4KB3A 1SVOA 4KE3A 5JWRB 3ZITA 3FZ9A 1N25A 2V2GA 2DKHA 4ECCA 4USSA 3Q6OA 4F9ZA 4V2MA 2IMKA 1JZOA 5D8IA 3FZ4A 4MP4A 2FA8A 2DKIA 2WVXA 2YJ7A 2B1LA 2HLSA 3FR6A 3RPNA 1A23A 7GSSA 2HSYA 1A2LA 1XVWA 3P90A 3J7Yk 1YJ6A 3ERGA 2VL9A 1R5PA 3ZFLA 3KIJA 1Y25A 2I1UA 5B6NA 1NHOA 5A34A 4IQ1A 2FGXA 2ES7A 3TKRA 2H0IA 11GSA 9GSSA 2IFQB 1WWJA 3GMFA 3KTLA 4KAEA 4I2TA 2C0DA 4NWYA 2VOCA 1DE2A 4V2NA 3TKSA 3HHVA 1T7PB 3MIXA 2H6XA 2YV7A 4FYBA 2HXKA 4TR3A 1XVQA 4OO4A 6GSUA 1O8WA 4LMVA 3ZL5A 4CY6A 3C8EA 5DCGA 1TW9A 3M8NA 5J3RA 1GH2A 1V2AA 4TKYA 5IMZA 5GZZB 1OVNA 3UOMA 3CYNA 2L57A 5G5EA 1V40A 2IN3A 5F05A 5IM9A 5ELGA 5IMCA 1MDKA 2OT3A 1AQVA 2LV3A 2GSTA 3C73A 4NXIA 1IYIA 1DSBA 2HZEB 4AJ8A 2A2RA 2FA4A 2B3SA 1U3AA 1B48A 1PX7A 4YH2A 3LW9A 5ECSA 4ZBBA 2JZRA 1O6JA 2DJ1A 2E0QA 4AKHA 1ERVA 5G1KA 1UC7A 3FMWA 3WGXA 2WW3A 4XCSA 4Q5NA 2VCXA 4GF0A 2O5VA 2L4QA 4BA7A 2HSMB 5KEJA 4ZL9A 2HZEA 1GP1A 1GULA 3KH7A 2V1MA 3EINA 4MF6A 1ST9A 2B5YA 2H8LA 4I2UA 3CQFA 4JRRA 2L5LA 4MJAA 1W89A 5KOXA 2C0FA 3SWLA 4IKHA 2VL2A 3F63A 3EPTA 3ME8A 1ZOFA 3KMOA 2H1BA 5DJLA 1G0TA 2YJHA 5BRTA 3CRUA 1V57A 2DLXA 2O7KA 4J57E 3TRXA 4EIPA 2JZSA 4MJCA 1TRSA 4EE0A 4PI2C 2HSHA 1GTBA 2WW0A 4BL7B 2JACA 1A8LA 4QL9A 4KSMA 4GTUA 1O81A 3I43A 3E0UA 3QR6A 3WYWA 2GGTA 4PNGA 4WR5A 5JWOB 2MBSA 4FIWA 1SJZA 3VWVA 4F82A 2GQKA 1B9YC 3DXBA 1EEMA 2VKZG 2DIYA 3I6AA 3GTUB 2WW2A 4X43A 3EURA 1M2AA 4G01A 4BL7A 4CDOA 4I6XA 3J7Yb 3F3RA 2HRKA 2LSTA 3FR9A 4EO3A 2D2ZA 3KM6A 1S3RA 2V32A 1K3OA 1GUMA 1FAAA 4WR4A 2QA2A 4I97A 1O85A 2EFDA 1RQMA 2V6KA 3IDVA 2MMAA 2VLUA 5D96A 1A8YA 5J9CA 5ELAA 4NAXA 2TRXA 1XOBA 2KP2A 4RI7A 5G31A 5CYYA 1FB6A 4ULXA 3MAKA 4TXOB 3C1RA 3ZREA 4JR4A 5F0GA 1EP8A 4MH3A 2L5OA 3RAZA 3A5WA 1S3CA 1QUWA 5DCHA 2EIRA 2H01A 3M3MA 1TRWA 1GSSA 2YP6A 3TUEA 2EFEA 1TXXA 4MA9A 3HYPA 2AHEA 5A1NB 4LL4B 4G0KA 1PA3A 2GS3A 3F8UA 5E4WA 4ECJA 1WP0A 1URMA 3D4MA 4DSSB 4BVXA 2I3YA 2VCQA 2XPDA 1KTEA 5H5SA 2WB9A 2IPAA 4FO5A 3WGDA 8GSSA 2ON5A 4PXOA 3KZQA 1F37A 1YEXA 1TU7A 5EY6A 4HS1A 3RPPA 1SL2B 3ZRDA 1VF2A 5HQPA 4ECIA 1YKAA 4BVYB 3QOUA 2IWTA 3US3A 2CZ2A 3EMXA 5IOXA 1X5DA 1G7EA 2GZZA 1GSUA 4XRDA 2WFCA 4ZB9A 2LRTA 2M80A 1F6MC 5D93A 1QQ2A 1SVMA 3Q74A 4QL7A 3P8WA 2WULA 3CWGA 4DSRA 3L78A 2GDRA 2XHFA 5KN1A 3IAM2 1GNWA 4MJEA 1XXUA 1SU9A 1EOGA 4XS4A 2GSRA 2E7PA 1HNAA 3IK9A 5B8AA 1SL1B 4Z7XA 4POLA 4N0ZA 3GL3A 4GDFA 3TJBA 3G7IA 2YWMA 3UMAA 1WPIA 4J2FA 1SYRA 5CNWA 3VI7A 1FW1A 5KN0A 4ID0A 3FR3A 3UVTA 3TKQA 4N0VA 1VF3A 4FQUA 1TTZA 5B8BA 2DSAA 5GSTA 2O87A 2LS5A 3L9SA 5GAPD
chains in the Genus database with same CATH topology
3RBTA 2H66A 5ECKB 2N5AA 4OMVA 4F0CA 1TRUA 3FZAA 1I5GA 4TRXA 2FWFA 3DGQA 3HMJG 2DJJA 3IBHA 1TK5B 2O8VB 2H76A 4X1UA 1R7HA 2Z9SA 4GRFA 3D21A 1K3LA 1K0AA 5GAND 4ZL7A 2R0GA 2M72A 4TR1A 4YKGA 4ICYA 1YKCA 1OC9B 1M7TA 5J47A 1QMVA 1Y1UA 1GSFA 1MEKA 4HOJA 4AF2A 2A2SA 2GZYA 2OKAA 3EMPA 2IMEA 1HYUA 3ME7A 2QSIA 4ZIJA 1GUKA 4PQ1A 4K2DA 3BBYA 1XWBA 1V98A 2IMIA 5CREA 4F0BA 4KUNA 2PU9C 6GSVA 2DJ0A 3TCOA 4HU7A 1AAZA 1BJXA 2FWGA 4IP6A 1JZRA 2CAIA 4LMWA 2X49A 18GSA 3PH9A 1TJDA 4RQRA 3Q18A 4K2XA 1GNEA 1F2EA 3IC8A 1Z7RA 3NIVA 5J4VA 3UJ1A 2C3NA 1ERTA 4MF7A 2LJKA 3FRCA 3GH6A 1ERUA 2F8AA 3LWAA 1S3DA 3ZZXA 2N5FA 2LRCA 1E2YA 1AC1A 3DIEA 3DD3A 3M1GA 4IELA 2R2JA 1PRXA 5AGYA 4ZBDA 3QAVA 1ZCPA 2WDUA 2YPMA 4BWQA 5C00A 2HSNB 2EC4A 2L6DA 3KCMA 2YZUA 4IJ3A 3WT1A 4J56E 1YEPA 1JZDA 3TRQA 2I4AA 1TP9A 4NHZA 2YWOA 1EWXA 4OO5A 2QGVA 2X8CA 4DSQA 2X99A 2GT5A 2HSNA 3GSTA 4WF4A 4WEYA 1FG4A 1OKDA 2MMNA 3GA4A 4ACSA 4KNDA 3LQ7A 2FWEA 1O73A 4MF5A 1HQOA 5EL8A 3TU3B 5DALA 2QC7A 1R5AA 1M0UA 2P0GA 1YVLA 4MNNA 3GL5A 10GSA 4AGSA 2IJYA 2XPEA 3C71A 2PVQA 4MABA 3WGEA 3LJRA 2P31A 4G0LA 3H1NA 4K5RA 1TKDB 3LG6A 3GNJA 2NVLA 1TXUA 1XW6A 2BJXA 2G2QA 1ZYPA 1V58A 1T4YA 3M9KA 2AAWA 1AXDA 2F9SA 4P3YB 2DC5A 1SKWB 1G7OA 1PSQA 1VRSD 4WETA 2NBSA 4H86A 1R4WA 3U6VA 1X9SB 3Q19A 3LYPA 1T00A 3BCKA 3FZ5A 2FD3A 2JZTA 4IHUA 3L9UA 5ECQB 1ERWA 1ML6A 1SK2A 2J9HA 1EGOA 5CRHA 4FYCA 5HFGA 4K0GA 2K9FA 4A5PA 3R3EA 4N11A 4QQ7A 1U88A 2GSSA 2ZNMA 2IFQA 5J5NA 2FNOA 3ISOA 2HZFA 1OKTA 4IQAA 1B8XA 1HNBA 4AKGA 4PQHA 5J9BA 1BF5A 2FY6A 2O85A 1NHYA 5CRGA 4TOPA 4JU5A 17GSA 3HJMA 1BQ7A 4IW9A 1AW9A 2FLSA 4XTSA 1SYXA 2IIYA 4L0WA 3F6FA 4HI7A 4KGIA 1SK1A 3GKXA 4KF9A 3DYRA 2C0EA 2LNTA 4KX4A 5J4YA 5ID2B 4DEJA 1UA5A 3A2VA 4ZB6A 4JE1A 3BOAA 3GX0A 3TOTA 1TI3A 3SBCA 3BJ5A 4TVEA 3QDNA 4ZB8A 4OD7A 3HXSA 4RI6A 3TGZA 2J23A 4KDYA 3A2WA 4LL1B 4O5RA 1A0FA 4LLRA 5D9VA 5LNKe 5A4UA 1E6BA 3M9JA 2OE3A 4IP1A 2HSMA 3ZIJA 1A24A 3TJGA 3FHKA 4WBJA 5DQYA 2H0HA 4POKA 1M2BA 3RDWA 2LJRA 5ECLB 5BMUB 1RK4A 5G5FA 4MDCA 2MBTA 4I8BA 5F07A 2FHEA 3EVIA 4K7IA 2H1DA 1JFUA 2RM5A 5ECIB 3F0IA 5D9XA 1EV9A 1OAZA 4POBA 3QFBC 4YQUA 5BMUA 2KP1A 5CP1A 2KHPA 4HJMA 3BCIA 5JWQB 4N3ZA 2ZUPA 3FYGA 4RQXA 1PGTA 3VK9A 5INYA 2A4VA 3LXTA 3QCPA 1YF0A 1Z6NA 3JCML 4IJIA 4MZBA 2B7KA 2TRCP 1PL2A 3HZ8A 1AUCA 2UV8G 1UN2A 1NSWA 2HT9A 6GSYA 3W6GA 3TJJA 1V9WA 3HCZA 2IL3A 1EGRA 2GTUA 3GTUA 1USBA 1X0RA 2GT6A 5C04A 3IV4A 1HNCA 1PX6A 3DVXA 2PN8A 2R4VA 3QPMA 1XWAA 2OBKA 3APQA 5D9WA 5FHIA 4HJ2A 1Z3EA 1KEBA 1NM3A 4L5LA 2P5QA 5JCUA 2VD1A 4MH2A 2LJAA 2B1KA 2LNSA 1GUHA 5COHA 1PD21 3UBKA 2H1LA 1BG5A 4KH7A 4G2EA 4TR4A 5J4UA 3QFAC 2OACA 1JLWA 2CVBA 2YNXA 3VI5A 5GSSA 3F4SA 1MD3A 3C7MA 3D22A 3LFLA 2LTKA 3VPTA 1EZKA 4TXOA 3L0HA 3ZIVA 4PUAA 1I9DA 2R6KA 5IQYA 1GSDA 2PGTA 2RLIA 4Q5RA 1OC3A 1ZYQB 2X64A 3APOA 2H73A 5DQSA 2PPTA 1GTIA 4YKFA 2ON7A 1S3AA 2JU5A 2V6OA 5CRDA 4MJBA 1GRXA 3VFIA 4GSTA 3ZYWA 5A1NA 3CSJA 4PURA 4TN8A 3TRPA 4W66A 2I9HA 2CX3A 5JCWA 3HZ4A 2HFDA 6GSSA 2C3TA 4DSSA 4KA0A 3KEBA 4EKZA 4HEA2 2L4CA 1ZYNA 1SD9A 1LU4A 5CO3A 3LSZA 4FH8A 1TRVA 3APSA 5D73A 3IAS2 2FCHA 4KSOA 3I9V2 1SENA 5IO0A 4OFTA 20GSA 4JZQA 1XPVA 2YZHA 4BVYA 3C1SA 5HR2A 3CMIA 3MSZA 1U3IA 2CA8A 3G7YA 2HI7A 4OCFA 1J9BA 3ZLPA 1AIUA 12GSA 4YAVA 4OFMA 1X5CA 1N8JA 1XBSA 4HUAA 3KMNA 13GSA 5EVOA 2OE0A 4O7HA 1K0OA 3TKSC 2REMA 4E68A 3K8NA 2RIIA 4IN0A 2LQOA 5IMDA 5H5RA 3FW2A 4ZXGA 4JEDA 2TIRA 4WXTA 1BYEA 1PKWA 3UARA 2G0FA 4JBBA 1GWCA 2VL3A 1ACVA 2CVDA 4PNFA 3O76A 2VM1A 1M99A 2H70A 3EC3A 2H71A 3HJOA 1BX9A 2EFCA 3PINA 5HFIA 3TKSE 3TB2A 2DJ3A 3G9BA 3MDKA 4XRAA 1THOA 1AQWA 4OFNA 3MWHA 3UVHA 3ED3A 1JLVA 2BMXA 2K18A 5G1LA 1EOHA 1WJKA 2VLVA 4GLTA 2OADA 2MMZA 4PGTA 3RHCA 4EC0A 1F9MA 4NV5A 5LD0A 2HRNA 3H8QA 3LGCA 1OC9A 2EIOA 3F9UA 3H4KA 2JSZA 2LEGA 2PWJA 5A5KA 4G0IA 3IC4A 3GFKA 4DVCA 1SVLA 2FUG2 3DRNA 2CZ3A 2PMTA 3PPUA 5IMFA 3CTFA 2YWIA 1F3BA 3HY2A 1Q98A 4QMKA 2CT6A 2O89A 2H72A 4Z2RA 2VL2C 1RW1A 1YY7A 1ZGNA 2CVKA 3HKRA 2JADA 2C1YA 1N2AA 5KN2A 1DE1A 5A4VA 1CQGA 3IA1A 4O5UA 1W4VA 1X9MB 1H75A 5CAXA 4ML6A 2VUPA 4OWYA 1AQXA 4ZB7A 1YDKA 1ZMAA 4HDEA 2KUCA 1KBNA 3IR4A 1XIYA 6GSTA 4K7NA 1M9AA 5F8BA 4MK3A 4K5SA 3IHQA 3HVSA 3W8JA 3EYTA 2L59A 3A3TA 2ALBA 3F3QA 3HA9A 5ECRB 1T4ZA 1GLPA 2L6CA 4NV2A 3KD0A 1QK8A 2A4HA 1B4PA 3I69A 2BTOT 1Z5YE 5HR1A 3CXGA 1M9BA 2FWHA 5AISA 1YQ1A 1ILOA 1DBYA 1A2JA 4IVFA 4CW9A 2WRTA 1GSEA 2C80A 3PR8A 3FEUA 1SKSB 2H6ZA 1QGVA 3KP8A 2R5GA 5IO2A 5B7CA 2GQMA 3GUSA 2AUVA 4E8EA 4AKXB 1THXA 3TDGA 4V1Ag 5IIZA 14GSA 4CY8A 1EP7A 4YQMA 5HR3A 3MYDA 3F4RA 4NPBA 3UL3A 3VWWA 2X8GA 4K7OA 1LJRA 3LYKA 3DWVA 4OCEA 2YV9A 4G10A 1ZL9A 3QAGA 4BPYA 4O92A 4HQZA 1GSYA 1R26A 4EL1A 1GLQA 1JZWA 4MPFA 4WBRD 4MZCA 4GQFA 1XW9A 3E3EA 2VLTA 2K8VA 5DVBA 2C8UA 2DMLA 5G2ZA 4XS6A 3LXZA 2MZCA 1K0MA 5A34B 4O5QA 3FKFA 1SJ6A 1LBKA 4G19A 2VD0A 5ENUA 4KCAA 2JSYA 3HDCA 4LA1A 4V1Ap 1QFNA 4D73B 4PQIA 2VCVA 2WCIA 5D9TA 2PBJA 4ZILA 1U6TA 2KOKA 3ERWA 1SKRB 4GWRA 2K6VA 2H19A 3DMLA 3CRTA 3DEXA 1UVZA 3GRXA 5DBQA 3VWXA 4MZWA 2B5XA 1VF4A 4D73A 2HE3A 4BWSA 4EF0A 2VCTA 1YF1A 4O32A 4F03A 1C72A 2LUSA 5IMAA 1DUGA 1FO5A 3HVXA 1XFLA 5IOWA 3GH9A 2E2MA 1BEDA 2R0PA 4XHMA 1K0CA 1BAYA 4EDYA 2R3XA 4L5OA 5FWGA 3ZFBA 2F8FA 4JR6A 4AJ6A 1GTAA 4KCEA 1OYJA 1XCCA 4KDUA 1XZOA 1TOFA 5DDLA 5ABRA 1B4QA 3QMXA 3EE2A 4AJ7A 5G30A 1XWKA 5A5HB 4EDZA 4GCIA 5ID2A 1PMTA 2EFHA 1F3AA 3ZMLA 2WGRA 5E59A 1VF1A 3ZTLA 4K8MA 3G7JA 1K3YA 3UIWA 3KJYA 2MMOA 1K0DA 2WS2A 4KDXA 1TU8A 1PKZA 1PQNA 4ISDA 5A5HA 3GN3A 2AB6A 4E8HA 4Z2UA 5A4WA 1SL0B 3ZVJD 4F2IA 2HNLA 5J41A 1G6YA 1PN0A 2H75A 1FVKA 2JL4A 1OE8A 4WF5A 3IPZA 1NW2A 2DJ2A 3P7XA 3L9VA 1Q4JA 5AN1A 1IYHA 3E9JB 1WMJA 3W8SA 1K0NA 3FY7A 3H79A 3BD2A 1GL8A 5IPHA 1FHEA 1TDIA 2HRKB 5DAKB 22GSA 5B6MA 1O8XA 5J40A 3F6DA 3IK7A 2H1AA 2LKUA 4YQVA 4GQCA 1FVJA 2ZCTA 1JHBA 3FK8A 3GKNA 5FT3A 4X0XA 5AIXA 3WT2A 5JCGA 1O7UA 2RM6A 5ECOB 4CHSA 5ECNB 2YCDA 2DJKA 2C3QA 1EV4A 5DAKA 2UZ8A 3CSIA 3GIXA 5EPFA 1FB0A 4AKIA 2NDOA 3PGTA 3RHBA 4HQSA 4ILFA 1ZZYA 3LEFA 2B6MA 2CV4A 1J08A 4K1FA 5ECMB 2DIZA 5AIVA 2QA1A 4NMUA 2OE1A 2YANA 2M46A 2RUFA 1A2MA 3N5OA 1TK8B 3P2AA 1XWCA 2VO4A 3QAWA 4ZBAA 2PVOC 2R37A 1SD8A 2QKEA 4BVXB 1WE0A 2B5EA 2GVPA 3WD6A 1PL1A 3V1WA 1K0BA 2CQ9A 4XIHA 2K8SA 2HRFA 3IHGA 5IPGA 3IXRA 1CQHA 4HZ2A 2MYGA 1YZXA 2GQLA 2RUEA 4L8EA 4GSNA 2XBIA 2HQTA 1WOUA 4XS1A 3U5RE 2VM2A 5HFKA 3D0ZA 1HD2A 5LCZA 4G9HA 2I81A 4I5QA 1XW5A 4PX1A 3D4TA 3GX8A 5HR0A 5CRWA 3O3TA 3N9JA 4ECBA 3ZVJA 1A0RP 2C0GA 1GSQA 1J0FA 3EWLA 2OA7A 1ABAA 3TJFA 5KN3A 1MTCA 3CSHA 4XS4B 1TK0B 4HZ4A 3EU3A 4EXJA 3UEMA 1Z7PA 4RUVA 4HU9A 5F06A 1M2DA 1XOAA 4YAPA 1X5EA 5H5QA 2DBCA 1X9WB 3VPQA 3GHAA 4N10A 2F51A 2OBIA 4MLYA 4EVMA 4FYUA 4PTSA 3MNGA 2AV4A 2YN1A 2WJUA 2KLXA 2WZ9A 3CTGA 4MCUA 1BG1A 1WRYA 3M0FA 1Z6MA 4MPGA 2NTOA 6GSWA 3IRAA 3D6IA 1OE7A 3D5JA 1XWGA 5DJMA 3KTBA 1EEJA 2HYXA 2PUKC 2R0CA 4IS0A 1FOVA 3A5IA 1GTUA 4TW5A 2YWNA 1Y6EA 4IBPA 1Z9HA 2XBQA 3VLNA 3UAPA 1PN9A 4TR1B 1KNGA 2LQQA 1SJIA 2HRAA 3AY8A 4MMMA 3KH9A 3CBUA 4GXZA 2GLRA 2CAQA 4V2LA 4Q5QA 4PUFC 2EIQA 2A2PA 2IMDA 3KGKA 3TOUA 2X8HA 2X4AA 2GZPA 4L0UA 2OJLA 3OR5A 1U87A 4EIQA 4NHWA 3ZMKA 3L4NA 1ZYEA 4EUYA 2C4JA 2B7JA 3QD9A 3VURA 2N5BA 4ZL8A 3LORA 1T1VA 4AI6A 1B9XC 3H93A 1TI1A 5IMVA 3DVWA 3HD5A 3IOSA 3IE3A 2H0GA 6GSXA 4Z2TA 1H4OA 3TKPA 5ECHB 3GURA 2NPBA 19GSA 2PERA 3HVVA 2F3MA 1VGLA 1G6WA 3GSSA 2H6YA 1ON4A 1OC8A 3EU4A 1T8EB 3GV1A 4K6XA 3ERFA 2H74A 3TJKA 2E2GA 4ML1A 3NOFA 3VWUA 5KOWA 4WKWA 3F4TA 2AJQB 1SK0A 3KP9A 3KXOA 2H30A 2CX4A 1QXHA 4IGJA 1MDJA 2YOIA 4KW6A 5ECPB 1MDIA 5L71A 2VAFA 2IMFA 4Q5FA 4POMA 2DMMA 4N30A 4TXVA 1FOHA 4K0NA 16GSA 3UBLA 1T3BA 3R2QA 1MD4A 3HJPA 3NZNA 4X4JA 2VCZA 2V41A 3O6TA 5DALB 2XC2A 3DKSA 2H1GA 3S9FA 3GKMA 2AYTA 3GKKA 3A2XA 2P5RA 2VIMA 3GYKA 2VCWA 4GSSA 2GSQA 2LRNA 4TR0A 1WIKA 4K9ZA 4KB3A 1SVOA 4KE3A 5JWRB 3ZITA 3FZ9A 1N25A 2V2GA 2DKHA 4ECCA 4USSA 3Q6OA 4F9ZA 4V2MA 2IMKA 1JZOA 5D8IA 3FZ4A 4MP4A 2FA8A 2DKIA 2YJ7A 2B1LA 2HLSA 3FR6A 3RPNA 1A23A 7GSSA 2HSYA 1A2LA 1XVWA 3P90A 3J7Yk 1YJ6A 3ERGA 2VL9A 1R5PA 3ZFLA 3KIJA 1Y25A 2I1UA 5B6NA 1NHOA 5A34A 4IQ1A 2FGXA 2ES7A 3TKRA 2H0IA 11GSA 9GSSA 2IFQB 1WWJA 3GMFA 3KTLA 4KAEA 4I2TA 2C0DA 4NWYA 2VOCA 1DE2A 4V2NA 3TKSA 3HHVA 1T7PB 3MIXA 2H6XA 2YV7A 4FYBA 2HXKA 4TR3A 1XVQA 4OO4A 6GSUA 1O8WA 4LMVA 3ZL5A 4CY6A 3C8EA 5DCGA 1TW9A 3M8NA 5J3RA 1GH2A 1V2AA 4TKYA 5IMZA 5GZZB 1OVNA 3UOMA 3CYNA 2L57A 5G5EA 1V40A 2IN3A 5F05A 5IM9A 5ELGA 5IMCA 1MDKA 2OT3A 1AQVA 2LV3A 2GSTA 3C73A 4NXIA 1IYIA 1DSBA 2HZEB 4AJ8A 2A2RA 2FA4A 2B3SA 1U3AA 1B48A 1PX7A 4YH2A 3LW9A 5ECSA 4ZBBA 2JZRA 1O6JA 2DJ1A 2E0QA 4AKHA 1ERVA 5G1KA 1UC7A 3FMWA 3WGXA 4XCSA 4Q5NA 2VCXA 4GF0A 2O5VA 2L4QA 4BA7A 2HSMB 5KEJA 4ZL9A 2HZEA 1GP1A 1GULA 3KH7A 2V1MA 3EINA 4MF6A 1ST9A 2B5YA 2H8LA 4I2UA 4JRRA 2L5LA 4MJAA 1W89A 5KOXA 2C0FA 3SWLA 4IKHA 2VL2A 3F63A 3EPTA 3ME8A 1ZOFA 3KMOA 2H1BA 5DJLA 1G0TA 2YJHA 5BRTA 3CRUA 1V57A 2DLXA 2O7KA 4J57E 3TRXA 4EIPA 2JZSA 4MJCA 1TRSA 4EE0A 2HSHA 1GTBA 4BL7B 2JACA 1A8LA 4QL9A 4KSMA 4GTUA 1O81A 3I43A 3E0UA 3QR6A 3WYWA 2GGTA 4PNGA 4WR5A 5JWOB 2MBSA 4FIWA 1SJZA 3VWVA 4F82A 2GQKA 1B9YC 3DXBA 1EEMA 2VKZG 2DIYA 3I6AA 3GTUB 4X43A 3EURA 1M2AA 4G01A 4BL7A 4CDOA 4I6XA 3J7Yb 3F3RA 2HRKA 2LSTA 3FR9A 4EO3A 2D2ZA 3KM6A 2V32A 1K3OA 1GUMA 1FAAA 4WR4A 2QA2A 4I97A 1O85A 2EFDA 1RQMA 2V6KA 3IDVA 2MMAA 2VLUA 5D96A 1A8YA 5J9CA 5ELAA 4NAXA 2TRXA 1XOBA 2KP2A 4RI7A 5G31A 5CYYA 1FB6A 4ULXA 3MAKA 4TXOB 3C1RA 3ZREA 4JR4A 5F0GA 1EP8A 4MH3A 2L5OA 3RAZA 3A5WA 1S3CA 1QUWA 5DCHA 2EIRA 2H01A 3M3MA 1TRWA 1GSSA 2YP6A 3TUEA 2EFEA 1TXXA 4MA9A 3HYPA 2AHEA 5A1NB 4LL4B 4G0KA 1PA3A 2GS3A 3F8UA 5E4WA 4ECJA 1WP0A 1URMA 3D4MA 4DSSB 4BVXA 2I3YA 2VCQA 2XPDA 1KTEA 5H5SA 2WB9A 2IPAA 4FO5A 3WGDA 8GSSA 2ON5A 4PXOA 3KZQA 1F37A 1YEXA 1TU7A 5EY6A 4HS1A 3RPPA 1SL2B 3ZRDA 1VF2A 5HQPA 4ECIA 1YKAA 4BVYB 3QOUA 2IWTA 3US3A 2CZ2A 3EMXA 5IOXA 1X5DA 1G7EA 2GZZA 1GSUA 4XRDA 2WFCA 4ZB9A 2LRTA 2M80A 1F6MC 5D93A 1QQ2A 1SVMA 3Q74A 4QL7A 3P8WA 2WULA 3CWGA 4DSRA 3L78A 2GDRA 2XHFA 5KN1A 3IAM2 1GNWA 4MJEA 1XXUA 1SU9A 1EOGA 4XS4A 2GSRA 2E7PA 1HNAA 3IK9A 5B8AA 1SL1B 4Z7XA 4POLA 4N0ZA 3GL3A 4GDFA 3TJBA 3G7IA 2YWMA 3UMAA 1WPIA 4J2FA 1SYRA 5CNWA 3VI7A 1FW1A 5KN0A 4ID0A 3FR3A 3UVTA 3TKQA 4N0VA 1VF3A 4FQUA 1TTZA 5B8BA 2DSAA 5GSTA 2O87A 2LS5A 3L9SA 5GAPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBT A;  2H66 A;  5ECK B;  2N5A A;  4OMV A;  4F0C A;  1TRU A;  3FZA A;  1I5G A;  4TRX A;  2FWF A;  3DGQ A;  2DJJ A;  3IBH A;  1TK5 B;  2O8V B;  2H76 A;  4X1U A;  1R7H A;  2Z9S A;  4GRF A;  3D21 A;  1K3L A;  1K0A A;  5GAN D;  4ZL7 A;  2M72 A;  4TR1 A;  1YKC A;  1OC9 B;  1M7T A;  1QMV A;  1GSF A;  1MEK A;  4HOJ A;  4AF2 A;  2A2S A;  2GZY A;  2OKA A;  3EMP A;  2IME A;  1HYU A;  3ME7 A;  2QSI A;  4ZIJ A;  1GUK A;  4PQ1 A;  4K2D A;  3BBY A;  1XWB A;  1V98 A;  2IMI A;  5CRE A;  4F0B A;  4KUN A;  2PU9 C;  6GSV A;  2DJ0 A;  3TCO A;  4HU7 A;  1AAZ A;  1BJX A;  2FWG A;  4IP6 A;  1JZR A;  2CAI A;  4LMW A;  18GS A;  3PH9 A;  1TJD A;  4RQR A;  3Q18 A;  1GNE A;  1F2E A;  3IC8 A;  1Z7R A;  3NIV A;  3UJ1 A;  2C3N A;  1ERT A;  4MF7 A;  2LJK A;  3FRC A;  3GH6 A;  1ERU A;  2F8A A;  3LWA A;  1S3D A;  3ZZX A;  2N5F A;  2LRC A;  1E2Y A;  1AC1 A;  3DIE A;  3DD3 A;  3M1G A;  4IEL A;  2R2J A;  1PRX A;  5AGY A;  4ZBD A;  3QAV A;  1ZCP A;  2WDU A;  2YPM A;  4BWQ A;  5C00 A;  2HSN B;  2EC4 A;  2L6D A;  3KCM A;  2YZU A;  4IJ3 A;  3WT1 A;  4J56 E;  1YEP A;  1JZD A;  3TRQ A;  2I4A A;  1TP9 A;  4NHZ A;  2YWO A;  1EWX A;  4OO5 A;  2QGV A;  2X8C A;  4DSQ A;  2X99 A;  2GT5 A;  3GST A;  4WF4 A;  4WEY A;  1FG4 A;  1OKD A;  2MMN A;  3GA4 A;  4ACS A;  4KND A;  3LQ7 A;  2FWE A;  1O73 A;  4MF5 A;  1HQO A;  5EL8 A;  5DAL A;  2QC7 A;  1R5A A;  1M0U A;  2P0G A;  3GL5 A;  10GS A;  4AGS A;  2IJY A;  2XPE A;  3C71 A;  2PVQ A;  4MAB A;  3WGE A;  3LJR A;  2P31 A;  4G0L A;  3H1N A;  1TKD B;  3LG6 A;  3GNJ A;  2NVL A;  1XW6 A;  2BJX A;  2G2Q A;  1V58 A;  1T4Y A;  3M9K A;  2AAW A;  1AXD A;  2F9S A;  4P3Y B;  2DC5 A;  1SKW B;  1G7O A;  1PSQ A;  1VRS D;  4WET A;  4H86 A;  2NBS A;  1R4W A;  3U6V A;  1X9S B;  3Q19 A;  3LYP A;  1T00 A;  3BCK A;  3FZ5 A;  2FD3 A;  2JZT A;  4IHU A;  3L9U A;  5ECQ B;  1ERW A;  1ML6 A;  1SK2 A;  2J9H A;  1EGO A;  5CRH A;  4FYC A;  5HFG A;  4K0G A;  2K9F A;  3R3E A;  4N11 A;  4QQ7 A;  1U88 A;  2GSS A;  2ZNM A;  2IFQ A;  5J5N A;  2FNO A;  3ISO A;  2HZF A;  1OKT A;  4IQA A;  1B8X A;  1HNB A;  4PQH A;  5J9B A;  2FY6 A;  2O85 A;  1NHY A;  5CRG A;  4TOP A;  4JU5 A;  17GS A;  3HJM A;  1BQ7 A;  4IW9 A;  1AW9 A;  2FLS A;  4XTS A;  1SYX A;  2IIY A;  4L0W A;  3F6F A;  4HI7 A;  4KGI A;  1SK1 A;  3GKX A;  4KF9 A;  3DYR A;  2C0E A;  2LNT A;  4KX4 A;  5ID2 B;  4DEJ A;  1UA5 A;  3A2V A;  4ZB6 A;  4JE1 A;  3BOA A;  3GX0 A;  3TOT A;  1TI3 A;  3SBC A;  3BJ5 A;  4TVE A;  3QDN A;  4ZB8 A;  4OD7 A;  3HXS A;  4RI6 A;  3TGZ A;  2J23 A;  4KDY A;  3A2W A;  4LL1 B;  4O5R A;  1A0F A;  4LLR A;  5D9V A;  5LNK e;  5A4U A;  1E6B A;  3M9J A;  2OE3 A;  4IP1 A;  2HSM A;  3ZIJ A;  1A24 A;  3TJG A;  3FHK A;  4WBJ A;  5DQY A;  2H0H A;  4POK A;  1M2B A;  3RDW A;  2LJR A;  5ECL B;  1RK4 A;  5G5F A;  4MDC A;  2MBT A;  4I8B A;  5F07 A;  2FHE A;  3EVI A;  4K7I A;  2H1D A;  1JFU A;  2RM5 A;  5ECI B;  3F0I A;  5D9X A;  1EV9 A;  1OAZ A;  4POB A;  3QFB C;  4YQU A;  5BMU A;  2KP1 A;  5CP1 A;  2KHP A;  4HJM A;  3BCI A;  5JWQ B;  2ZUP A;  3FYG A;  4RQX A;  1PGT A;  3VK9 A;  5INY A;  2A4V A;  3LXT A;  3QCP A;  1YF0 A;  1Z6N A;  3JCM L;  4IJI A;  4MZB A;  2B7K A;  2TRC P;  1PL2 A;  3HZ8 A;  1AUC A;  1UN2 A;  1NSW A;  2HT9 A;  6GSY A;  3W6G A;  3TJJ A;  1V9W A;  3HCZ A;  2IL3 A;  1EGR A;  2GTU A;  3GTU A;  1USB A;  1X0R A;  2GT6 A;  5C04 A;  3IV4 A;  1HNC A;  1PX6 A;  3DVX A;  2PN8 A;  2R4V A;  3QPM A;  1XWA A;  2OBK A;  3APQ A;  5D9W A;  5FHI A;  4HJ2 A;  1Z3E A;  1KEB A;  1NM3 A;  4L5L A;  2P5Q A;  5JCU A;  2VD1 A;  4MH2 A;  2LJA A;  2B1K A;  2LNS A;  1GUH A;  5COH A;  1PD2 1;  3UBK A;  1BG5 A;  4KH7 A;  4G2E A;  4TR4 A;  5J4U A;  3QFA C;  2OAC A;  1JLW A;  2CVB A;  2YNX A;  3VI5 A;  5GSS A;  3F4S A;  1MD3 A;  3C7M A;  3D22 A;  3LFL A;  2LTK A;  3VPT A;  1EZK A;  4TXO A;  3L0H A;  3ZIV A;  4PUA A;  1I9D A;  2R6K A;  5IQY A;  1GSD A;  2PGT A;  2RLI A;  4Q5R A;  1OC3 A;  1ZYQ B;  2X64 A;  3APO A;  2H73 A;  5DQS A;  2PPT A;  1GTI A;  2ON7 A;  1S3A A;  2JU5 A;  2V6O A;  5CRD A;  4MJB A;  1GRX A;  3VFI A;  4GST A;  3ZYW A;  3CSJ A;  4PUR A;  4TN8 A;  3TRP A;  2I9H A;  2CX3 A;  5JCW A;  3HZ4 A;  2HFD A;  6GSS A;  2C3T A;  4DSS A;  4KA0 A;  3KEB A;  4EKZ A;  4HEA 2;  2L4C A;  1SD9 A;  1LU4 A;  5CO3 A;  3LSZ A;  4FH8 A;  1TRV A;  3APS A;  5D73 A;  3IAS 2;  2FCH A;  4KSO A;  3I9V 2;  1SEN A;  5IO0 A;  4OFT A;  20GS A;  4JZQ A;  1XPV A;  2YZH A;  4BVY A;  3C1S A;  5HR2 A;  3CMI A;  3MSZ A;  1U3I A;  2CA8 A;  3G7Y A;  2HI7 A;  4OCF A;  1J9B A;  3ZLP A;  1AIU A;  12GS A;  4YAV A;  4OFM A;  1X5C A;  1N8J A;  1XBS A;  4HUA A;  3KMN A;  13GS A;  5EVO A;  2OE0 A;  4O7H A;  1K0O A;  3TKS C;  2REM A;  3K8N A;  2RII A;  4IN0 A;  2LQO A;  5IMD A;  5H5R A;  3FW2 A;  4ZXG A;  4JED A;  2TIR A;  4WXT A;  1BYE A;  1PKW A;  3UAR A;  2G0F A;  4JBB A;  1GWC A;  2VL3 A;  1ACV A;  2CVD A;  4PNF A;  3O76 A;  2VM1 A;  1M99 A;  2H70 A;  3EC3 A;  2H71 A;  3HJO A;  1BX9 A;  3PIN A;  5HFI A;  3TKS E;  3TB2 A;  2DJ3 A;  3G9B A;  3MDK A;  4XRA A;  1THO A;  1AQW A;  4OFN A;  3MWH A;  3UVH A;  3ED3 A;  1JLV A;  2BMX A;  2K18 A;  5G1L A;  1EOH A;  1WJK A;  2VLV A;  4GLT A;  2OAD A;  2MMZ A;  4PGT A;  3RHC A;  4EC0 A;  1F9M A;  4NV5 A;  5LD0 A;  2HRN A;  3H8Q A;  3LGC A;  1OC9 A;  2EIO A;  3F9U A;  3H4K A;  2JSZ A;  2LEG A;  2PWJ A;  5A5K A;  4G0I A;  3IC4 A;  3GFK A;  4DVC A;  2FUG 2;  3DRN A;  2CZ3 A;  2PMT A;  3PPU A;  5IMF A;  3CTF A;  2YWI A;  1F3B A;  3HY2 A;  1Q98 A;  2CT6 A;  2O89 A;  2H72 A;  2VL2 C;  1RW1 A;  1YY7 A;  1ZGN A;  2CVK A;  3HKR A;  2JAD A;  2C1Y A;  1N2A A;  5KN2 A;  1DE1 A;  5A4V A;  1CQG A;  3IA1 A;  1W4V A;  1X9M B;  1H75 A;  5CAX A;  4ML6 A;  2VUP A;  4OWY A;  1AQX A;  1ZMA A;  1YDK A;  4HDE A;  2KUC A;  1KBN A;  3IR4 A;  1XIY A;  6GST A;  4K7N A;  1M9A A;  5F8B A;  4MK3 A;  3IHQ A;  3HVS A;  3W8J A;  3EYT A;  2L59 A;  3A3T A;  2ALB A;  3F3Q A;  3HA9 A;  5ECR B;  1T4Z A;  1GLP A;  2L6C A;  4NV2 A;  3KD0 A;  1QK8 A;  1B4P A;  3I69 A;  2BTO T;  1Z5Y E;  5HR1 A;  3CXG A;  1M9B A;  2FWH A;  5AIS A;  1YQ1 A;  1ILO A;  1DBY A;  1A2J A;  4IVF A;  4CW9 A;  2WRT A;  1GSE A;  2C80 A;  3PR8 A;  3FEU A;  1SKS B;  2H6Z A;  1QGV A;  3KP8 A;  2R5G A;  5IO2 A;  5B7C A;  2GQM A;  3GUS A;  2AUV A;  4E8E A;  1THX A;  3TDG A;  4V1A g;  5IIZ A;  14GS A;  1EP7 A;  4YQM A;  5HR3 A;  3F4R A;  4NPB A;  3UL3 A;  3VWW A;  2X8G A;  4K7O A;  1LJR A;  3LYK A;  3DWV A;  4OCE A;  2YV9 A;  4G10 A;  1ZL9 A;  3QAG A;  4BPY A;  4O92 A;  4HQZ A;  1GSY A;  1R26 A;  4EL1 A;  1GLQ A;  1JZW A;  4MPF A;  4WBR D;  4MZC A;  4GQF A;  1XW9 A;  3E3E A;  2VLT A;  2K8V A;  5DVB A;  2C8U A;  2DML A;  5G2Z A;  4XS6 A;  3LXZ A;  2MZC A;  1K0M A;  3FKF A;  1SJ6 A;  1LBK A;  4G19 A;  2VD0 A;  5ENU A;  4KCA A;  2JSY A;  3HDC A;  4LA1 A;  4V1A p;  1QFN A;  4D73 B;  4PQI A;  2VCV A;  2WCI A;  5D9T A;  2PBJ A;  4ZIL A;  1U6T A;  2KOK A;  3ERW A;  1SKR B;  4GWR A;  2K6V A;  2H19 A;  3DML A;  3CRT A;  3DEX A;  1UVZ A;  3GRX A;  5DBQ A;  3VWX A;  4MZW A;  2B5X A;  1VF4 A;  4D73 A;  2HE3 A;  4BWS A;  4EF0 A;  2VCT A;  1YF1 A;  4O32 A;  4F03 A;  1C72 A;  2LUS A;  5IMA A;  1DUG A;  1FO5 A;  3HVX A;  1XFL A;  5IOW A;  3GH9 A;  2E2M A;  1BED A;  4XHM A;  1K0C A;  1BAY A;  4EDY A;  2R3X A;  4L5O A;  5FWG A;  3ZFB A;  2F8F A;  4JR6 A;  4AJ6 A;  1GTA A;  4KCE A;  1OYJ A;  1XCC A;  4KDU A;  1XZO A;  1TOF A;  5DDL A;  5ABR A;  1B4Q A;  3QMX A;  3EE2 A;  4AJ7 A;  5G30 A;  1XWK A;  4EDZ A;  4GCI A;  5ID2 A;  1PMT A;  1F3A A;  3ZML A;  2WGR A;  5E59 A;  1VF1 A;  3ZTL A;  4K8M A;  3G7J A;  1K3Y A;  3UIW A;  3KJY A;  2MMO A;  1K0D A;  2WS2 A;  4KDX A;  1TU8 A;  1PKZ A;  1PQN A;  4ISD A;  3GN3 A;  2AB6 A;  4E8H A;  5A4W A;  1SL0 B;  3ZVJ D;  4F2I A;  2HNL A;  5J41 A;  1G6Y A;  2H75 A;  1FVK A;  2JL4 A;  1OE8 A;  4WF5 A;  3IPZ A;  1NW2 A;  2DJ2 A;  3P7X A;  3L9V A;  1Q4J A;  5AN1 A;  1IYH A;  3E9J B;  1WMJ A;  3W8S A;  1K0N A;  3FY7 A;  3H79 A;  3BD2 A;  1GL8 A;  5IPH A;  1FHE A;  1TDI A;  2HRK B;  5DAK B;  22GS A;  5B6M A;  1O8X A;  3F6D A;  3IK7 A;  2H1A A;  2LKU A;  4YQV A;  4GQC A;  1FVJ A;  2ZCT A;  1JHB A;  3FK8 A;  3GKN A;  5FT3 A;  4X0X A;  5AIX A;  3WT2 A;  5JCG A;  1O7U A;  2RM6 A;  5ECO B;  4CHS A;  5ECN B;  2YCD A;  2DJK A;  2C3Q A;  1EV4 A;  5DAK A;  2UZ8 A;  3CSI A;  3GIX A;  5EPF A;  1FB0 A;  2NDO A;  3PGT A;  3RHB A;  4HQS A;  4ILF A;  1ZZY A;  3LEF A;  2B6M A;  2CV4 A;  1J08 A;  4K1F A;  5ECM B;  2DIZ A;  5AIV A;  4NMU A;  2OE1 A;  2YAN A;  2M46 A;  2RUF A;  1A2M A;  3N5O A;  1TK8 B;  3P2A A;  1XWC A;  2VO4 A;  3QAW A;  4ZBA A;  2PVO C;  2R37 A;  1SD8 A;  2QKE A;  4BVX B;  1WE0 A;  2B5E A;  2GVP A;  3WD6 A;  1PL1 A;  3V1W A;  1K0B A;  2CQ9 A;  4XIH A;  2K8S A;  2HRF A;  5IPG A;  3IXR A;  1CQH A;  4HZ2 A;  2MYG A;  1YZX A;  2GQL A;  2RUE A;  4L8E A;  4GSN A;  2XBI A;  2HQT A;  1WOU A;  4XS1 A;  3U5R E;  2VM2 A;  5HFK A;  3D0Z A;  1HD2 A;  5LCZ A;  4G9H A;  2I81 A;  4I5Q A;  1XW5 A;  4PX1 A;  3D4T A;  3GX8 A;  5HR0 A;  5CRW A;  3O3T A;  3N9J A;  4ECB A;  3ZVJ A;  1A0R P;  2C0G A;  1GSQ A;  1J0F A;  3EWL A;  2OA7 A;  1ABA A;  3TJF A;  5KN3 A;  1MTC A;  3CSH A;  4XS4 B;  1TK0 B;  4HZ4 A;  3EU3 A;  4EXJ A;  3UEM A;  1Z7P A;  4RUV A;  4HU9 A;  5F06 A;  1M2D A;  1XOA A;  4YAP A;  1X5E A;  5H5Q A;  2DBC A;  1X9W B;  3VPQ A;  3GHA A;  4N10 A;  2F51 A;  2OBI A;  4MLY A;  4EVM A;  4FYU A;  4PTS A;  3MNG A;  2AV4 A;  2YN1 A;  2WJU A;  2KLX A;  2WZ9 A;  3CTG A;  4MCU A;  1WRY A;  3M0F A;  1Z6M A;  4MPG A;  2NTO A;  6GSW A;  3IRA A;  3D6I A;  1OE7 A;  3D5J A;  1XWG A;  5DJM A;  3KTB A;  1EEJ A;  2HYX A;  2PUK C;  4IS0 A;  1FOV A;  1GTU A;  4TW5 A;  2YWN A;  1Y6E A;  4IBP A;  1Z9H A;  2XBQ A;  3VLN A;  3UAP A;  1PN9 A;  4TR1 B;  1KNG A;  2LQQ A;  1SJI A;  2HRA A;  3AY8 A;  4MMM A;  3KH9 A;  3CBU A;  4GXZ A;  2GLR A;  2CAQ A;  4V2L A;  4Q5Q A;  4PUF C;  2EIQ A;  2IMD A;  3KGK A;  3TOU A;  2X8H A;  2GZP A;  4L0U A;  2OJL A;  3OR5 A;  1U87 A;  4NHW A;  3ZMK A;  3L4N A;  1ZYE A;  4EUY A;  2C4J A;  2B7J A;  3QD9 A;  3VUR A;  2N5B A;  4ZL8 A;  3LOR A;  1T1V A;  1B9X C;  3H93 A;  1TI1 A;  5IMV A;  3DVW A;  3HD5 A;  3IOS A;  3IE3 A;  2H0G A;  6GSX A;  1H4O A;  3TKP A;  5ECH B;  3GUR A;  2NPB A;  19GS A;  2PER A;  3HVV A;  2F3M A;  1VGL A;  1G6W A;  3GSS A;  2H6Y A;  1ON4 A;  1OC8 A;  3EU4 A;  1T8E B;  3GV1 A;  4K6X A;  3ERF A;  2H74 A;  3TJK A;  2E2G A;  4ML1 A;  3NOF A;  3VWU A;  4WKW A;  3F4T A;  2AJQ B;  1SK0 A;  3KP9 A;  3KXO A;  2H30 A;  2CX4 A;  1QXH A;  4IGJ A;  1MDJ A;  2YOI A;  4KW6 A;  5ECP B;  1MDI A;  5L71 A;  2VAF A;  2IMF A;  4Q5F A;  4POM A;  2DMM A;  4N30 A;  4TXV A;  4K0N A;  16GS A;  3UBL A;  1T3B A;  3R2Q A;  1MD4 A;  3HJP A;  3NZN A;  2VCZ A;  2V41 A;  3O6T A;  5DAL B;  2XC2 A;  3DKS A;  2H1G A;  3S9F A;  3GKM A;  2AYT A;  3GKK A;  3A2X A;  2P5R A;  2VIM A;  3GYK A;  2VCW A;  4GSS A;  2GSQ A;  2LRN A;  4TR0 A;  1WIK A;  4K9Z A;  4KB3 A;  4KE3 A;  5JWR B;  3ZIT A;  3FZ9 A;  2V2G A;  4ECC A;  4USS A;  3Q6O A;  4F9Z A;  4V2M A;  2IMK A;  1JZO A;  5D8I A;  3FZ4 A;  4MP4 A;  2FA8 A;  2YJ7 A;  2B1L A;  2HLS A;  3FR6 A;  3RPN A;  1A23 A;  7GSS A;  2HSY A;  1A2L A;  1XVW A;  3P90 A;  3J7Y k;  1YJ6 A;  3ERG A;  2VL9 A;  1R5P A;  3ZFL A;  3KIJ A;  1Y25 A;  2I1U A;  5B6N A;  1NHO A;  4IQ1 A;  2FGX A;  2ES7 A;  3TKR A;  2H0I A;  11GS A;  9GSS A;  2IFQ B;  1WWJ A;  3GMF A;  3KTL A;  4KAE A;  4I2T A;  2C0D A;  4NWY A;  2VOC A;  1DE2 A;  4V2N A;  3TKS A;  3HHV A;  1T7P B;  2H6X A;  2YV7 A;  4FYB A;  2HXK A;  4TR3 A;  1XVQ A;  4OO4 A;  6GSU A;  1O8W A;  4LMV A;  3ZL5 A;  3C8E A;  5DCG A;  1TW9 A;  3M8N A;  5J3R A;  1GH2 A;  1V2A A;  4TKY A;  5IMZ A;  5GZZ B;  1OVN A;  3UOM A;  3CYN A;  2L57 A;  5G5E A;  1V40 A;  2IN3 A;  5F05 A;  5IM9 A;  5ELG A;  5IMC A;  1MDK A;  1AQV A;  2LV3 A;  2GST A;  3C73 A;  4NXI A;  1IYI A;  1DSB A;  2HZE B;  4AJ8 A;  2A2R A;  2FA4 A;  2B3S A;  1U3A A;  1B48 A;  1PX7 A;  4YH2 A;  5ECS A;  4ZBB A;  2JZR A;  1O6J A;  2DJ1 A;  2E0Q A;  1ERV A;  5G1K A;  1UC7 A;  3WGX A;  4XCS A;  4Q5N A;  2VCX A;  4GF0 A;  2L4Q A;  4BA7 A;  2HSM B;  5KEJ A;  4ZL9 A;  2HZE A;  1GP1 A;  1GUL A;  3KH7 A;  2V1M A;  3EIN A;  4MF6 A;  1ST9 A;  2B5Y A;  2H8L A;  4I2U A;  4JRR A;  2L5L A;  4MJA A;  1W89 A;  2C0F A;  3SWL A;  4IKH A;  2VL2 A;  3F63 A;  3ME8 A;  1ZOF A;  3KMO A;  2H1B A;  5DJL A;  1G0T A;  2YJH A;  3CRU A;  1V57 A;  2DLX A;  2O7K A;  4J57 E;  3TRX A;  2JZS A;  4MJC A;  1TRS A;  4EE0 A;  2HSH A;  1GTB A;  4BL7 B;  2JAC A;  1A8L A;  4QL9 A;  4KSM A;  4GTU A;  1O81 A;  3I43 A;  3E0U A;  3QR6 A;  3WYW A;  2GGT A;  4PNG A;  4WR5 A;  5JWO B;  2MBS A;  4FIW A;  1SJZ A;  3VWV A;  4F82 A;  2GQK A;  1B9Y C;  3DXB A;  1EEM A;  2DIY A;  3I6A A;  3GTU B;  4X43 A;  3EUR A;  1M2A A;  4CDO A;  4BL7 A;  4I6X A;  3J7Y b;  3F3R A;  2HRK A;  2LST A;  3FR9 A;  4EO3 A;  2D2Z A;  3KM6 A;  2V32 A;  1K3O A;  1GUM A;  1FAA A;  4WR4 A;  4I97 A;  1O85 A;  1RQM A;  2V6K A;  3IDV A;  2MMA A;  2VLU A;  5D96 A;  1A8Y A;  5J9C A;  5ELA A;  4NAX A;  2TRX A;  1XOB A;  2KP2 A;  4RI7 A;  5G31 A;  5CYY A;  1FB6 A;  4ULX A;  3MAK A;  4TXO B;  3C1R A;  3ZRE A;  4JR4 A;  5F0G A;  1EP8 A;  4MH3 A;  2L5O A;  3RAZ A;  3A5W A;  1S3C A;  1QUW A;  5DCH A;  2EIR A;  2H01 A;  3M3M A;  1TRW A;  1GSS A;  2YP6 A;  3TUE A;  1TXX A;  4MA9 A;  3HYP A;  2AHE A;  4LL4 B;  4G0K A;  1PA3 A;  2GS3 A;  3F8U A;  5E4W A;  4ECJ A;  1WP0 A;  1URM A;  3D4M A;  4DSS B;  4BVX A;  2I3Y A;  2VCQ A;  2XPD A;  1KTE A;  5H5S A;  2WB9 A;  2IPA A;  4FO5 A;  3WGD A;  8GSS A;  2ON5 A;  4PXO A;  3KZQ A;  1F37 A;  1YEX A;  1TU7 A;  5EY6 A;  4HS1 A;  3RPP A;  1SL2 B;  3ZRD A;  1VF2 A;  5HQP A;  4ECI A;  1YKA A;  4BVY B;  3QOU A;  2IWT A;  3US3 A;  2CZ2 A;  3EMX A;  5IOX A;  1X5D A;  1G7E A;  2GZZ A;  1GSU A;  4XRD A;  2WFC A;  4ZB9 A;  2LRT A;  2M80 A;  1F6M C;  5D93 A;  1QQ2 A;  3Q74 A;  4QL7 A;  3P8W A;  2WUL A;  4DSR A;  3L78 A;  2GDR A;  2XHF A;  5KN1 A;  3IAM 2;  1GNW A;  4MJE A;  1XXU A;  1SU9 A;  1EOG A;  4XS4 A;  2GSR A;  2E7P A;  1HNA A;  3IK9 A;  5B8A A;  1SL1 B;  4Z7X A;  4POL A;  4N0Z A;  3GL3 A;  3TJB A;  3G7I A;  2YWM A;  3UMA A;  1WPI A;  4J2F A;  1SYR A;  5CNW A;  3VI7 A;  1FW1 A;  5KN0 A;  4ID0 A;  3FR3 A;  3UVT A;  3TKQ A;  4N0V A;  1VF3 A;  4FQU A;  1TTZ A;  5B8B A;  2DSA A;  5GST A;  2O87 A;  2LS5 A;  3L9S A;  5GAP D; 
#chains in the Genus database with same CATH topology
 3RBT A;  2H66 A;  5ECK B;  2N5A A;  4OMV A;  4F0C A;  1TRU A;  3FZA A;  1I5G A;  4TRX A;  2FWF A;  3DGQ A;  3HMJ G;  2DJJ A;  3IBH A;  1TK5 B;  2O8V B;  2H76 A;  4X1U A;  1R7H A;  2Z9S A;  4GRF A;  3D21 A;  1K3L A;  1K0A A;  5GAN D;  4ZL7 A;  2R0G A;  2M72 A;  4TR1 A;  4YKG A;  4ICY A;  1YKC A;  1OC9 B;  1M7T A;  5J47 A;  1QMV A;  1Y1U A;  1GSF A;  1MEK A;  4HOJ A;  4AF2 A;  2A2S A;  2GZY A;  2OKA A;  3EMP A;  2IME A;  1HYU A;  3ME7 A;  2QSI A;  4ZIJ A;  1GUK A;  4PQ1 A;  4K2D A;  3BBY A;  1XWB A;  1V98 A;  2IMI A;  5CRE A;  4F0B A;  4KUN A;  2PU9 C;  6GSV A;  2DJ0 A;  3TCO A;  4HU7 A;  1AAZ A;  1BJX A;  2FWG A;  4IP6 A;  1JZR A;  2CAI A;  4LMW A;  2X49 A;  18GS A;  3PH9 A;  1TJD A;  4RQR A;  3Q18 A;  4K2X A;  1GNE A;  1F2E A;  3IC8 A;  1Z7R A;  3NIV A;  5J4V A;  3UJ1 A;  2C3N A;  1ERT A;  4MF7 A;  2LJK A;  3FRC A;  3GH6 A;  1ERU A;  2F8A A;  3LWA A;  1S3D A;  3ZZX A;  2N5F A;  2LRC A;  1E2Y A;  1AC1 A;  3DIE A;  3DD3 A;  3M1G A;  4IEL A;  2R2J A;  1PRX A;  5AGY A;  4ZBD A;  3QAV A;  1ZCP A;  2WDU A;  2YPM A;  4BWQ A;  5C00 A;  2HSN B;  2EC4 A;  2L6D A;  3KCM A;  2YZU A;  4IJ3 A;  3WT1 A;  4J56 E;  1YEP A;  1JZD A;  3TRQ A;  2I4A A;  1TP9 A;  4NHZ A;  2YWO A;  1EWX A;  4OO5 A;  2QGV A;  2X8C A;  4DSQ A;  2X99 A;  2GT5 A;  2HSN A;  3GST A;  4WF4 A;  4WEY A;  1FG4 A;  1OKD A;  2MMN A;  3GA4 A;  4ACS A;  4KND A;  3LQ7 A;  2FWE A;  1O73 A;  4MF5 A;  1HQO A;  5EL8 A;  3TU3 B;  5DAL A;  2QC7 A;  1R5A A;  1M0U A;  2P0G A;  1YVL A;  4MNN A;  3GL5 A;  10GS A;  4AGS A;  2IJY A;  2XPE A;  3C71 A;  2PVQ A;  4MAB A;  3WGE A;  3LJR A;  2P31 A;  4G0L A;  3H1N A;  4K5R A;  1TKD B;  3LG6 A;  3GNJ A;  2NVL A;  1TXU A;  1XW6 A;  2BJX A;  2G2Q A;  1ZYP A;  1V58 A;  1T4Y A;  3M9K A;  2AAW A;  1AXD A;  2F9S A;  4P3Y B;  2DC5 A;  1SKW B;  1G7O A;  1PSQ A;  1VRS D;  4WET A;  2NBS A;  4H86 A;  1R4W A;  3U6V A;  1X9S B;  3Q19 A;  3LYP A;  1T00 A;  3BCK A;  3FZ5 A;  2FD3 A;  3RFR C;  2JZT A;  4IHU A;  3L9U A;  5ECQ B;  1ERW A;  1ML6 A;  1SK2 A;  2J9H A;  1EGO A;  5CRH A;  4FYC A;  5HFG A;  4K0G A;  2K9F A;  4A5P A;  3R3E A;  4N11 A;  4QQ7 A;  1U88 A;  2GSS A;  2ZNM A;  2IFQ A;  5J5N A;  2FNO A;  3ISO A;  2HZF A;  1OKT A;  4IQA A;  1B8X A;  1HNB A;  4AKG A;  4PQH A;  5J9B A;  1BF5 A;  2FY6 A;  2O85 A;  1NHY A;  5CRG A;  4TOP A;  4JU5 A;  17GS A;  3HJM A;  1BQ7 A;  4IW9 A;  1AW9 A;  2FLS A;  4XTS A;  1SYX A;  2IIY A;  4L0W A;  3F6F A;  4HI7 A;  4KGI A;  1SK1 A;  3GKX A;  4KF9 A;  3DYR A;  2C0E A;  2LNT A;  4KX4 A;  5J4Y A;  5ID2 B;  4DEJ A;  1UA5 A;  3A2V A;  4ZB6 A;  4JE1 A;  3BOA A;  3GX0 A;  3TOT A;  1TI3 A;  3SBC A;  3BJ5 A;  4TVE A;  3QDN A;  4ZB8 A;  4OD7 A;  3HXS A;  4RI6 A;  3TGZ A;  2J23 A;  4KDY A;  3A2W A;  4LL1 B;  4O5R A;  1A0F A;  4LLR A;  5D9V A;  5LNK e;  5A4U A;  1E6B A;  3M9J A;  2OE3 A;  4IP1 A;  2HSM A;  3ZIJ A;  1A24 A;  3TJG A;  3FHK A;  4WBJ A;  5DQY A;  2H0H A;  4POK A;  1M2B A;  3RDW A;  2LJR A;  5ECL B;  5BMU B;  1RK4 A;  5G5F A;  4MDC A;  2MBT A;  4PHZ C;  4I8B A;  5F07 A;  2FHE A;  3EVI A;  4K7I A;  2H1D A;  1JFU A;  2RM5 A;  5ECI B;  2O3E A;  3F0I A;  5D9X A;  1EV9 A;  1OAZ A;  4POB A;  3QFB C;  4YQU A;  5BMU A;  2KP1 A;  5CP1 A;  2KHP A;  4HJM A;  3BCI A;  5JWQ B;  4N3Z A;  2ZUP A;  3FYG A;  4RQX A;  1PGT A;  3VK9 A;  5INY A;  2A4V A;  3LXT A;  3QCP A;  1YF0 A;  1Z6N A;  3JCM L;  4IJI A;  4MZB A;  2B7K A;  2TRC P;  1PL2 A;  3HZ8 A;  1AUC A;  2UV8 G;  1UN2 A;  1NSW A;  2HT9 A;  6GSY A;  3W6G A;  3TJJ A;  1V9W A;  3HCZ A;  2IL3 A;  1EGR A;  2GTU A;  3GTU A;  1USB A;  1X0R A;  2GT6 A;  5C04 A;  3IV4 A;  1HNC A;  1PX6 A;  3DVX A;  2PN8 A;  2R4V A;  3QPM A;  1XWA A;  2OBK A;  3APQ A;  5D9W A;  5FHI A;  4HJ2 A;  1Z3E A;  1KEB A;  1NM3 A;  4L5L A;  2P5Q A;  5JCU A;  2VD1 A;  4MH2 A;  2LJA A;  2B1K A;  2LNS A;  1GUH A;  5COH A;  1PD2 1;  3UBK A;  2H1L A;  1BG5 A;  4KH7 A;  4G2E A;  4TR4 A;  5J4U A;  3QFA C;  2OAC A;  1JLW A;  2CVB A;  2YNX A;  3VI5 A;  5GSS A;  3F4S A;  1MD3 A;  3C7M A;  2WZS A;  3D22 A;  3LFL A;  2LTK A;  3VPT A;  1EZK A;  4TXO A;  3L0H A;  3ZIV A;  4PUA A;  1I9D A;  2R6K A;  5IQY A;  1GSD A;  2PGT A;  2RLI A;  4Q5R A;  1OC3 A;  1ZYQ B;  2X64 A;  3APO A;  2H73 A;  5DQS A;  2PPT A;  1GTI A;  4HSC X;  4YKF A;  2ON7 A;  1S3A A;  2JU5 A;  2V6O A;  5CRD A;  4MJB A;  1GRX A;  3VFI A;  4GST A;  3ZYW A;  5A1N A;  3CSJ A;  4PUR A;  4TN8 A;  3TRP A;  4W66 A;  2I9H A;  4BIK A;  2CX3 A;  5JCW A;  3HZ4 A;  2HFD A;  6GSS A;  2C3T A;  4DSS A;  4KA0 A;  3KEB A;  4EKZ A;  4HEA 2;  2L4C A;  1ZYN A;  1SD9 A;  1LU4 A;  5CO3 A;  3LSZ A;  4FH8 A;  1TRV A;  3APS A;  5D73 A;  3IAS 2;  2FCH A;  4KSO A;  3I9V 2;  1SEN A;  1I1I P;  5IO0 A;  4OFT A;  20GS A;  4JZQ A;  1XPV A;  2YZH A;  4BVY A;  3C1S A;  5HR2 A;  3CMI A;  3MSZ A;  1PFO A;  1U3I A;  2CA8 A;  3G7Y A;  2HI7 A;  4OCF A;  1J9B A;  3ZLP A;  1AIU A;  12GS A;  4YAV A;  4OFM A;  1X5C A;  1N8J A;  1XBS A;  4HUA A;  3KMN A;  13GS A;  5EVO A;  2OE0 A;  4O7H A;  1K0O A;  3TKS C;  2REM A;  4E68 A;  3K8N A;  2RII A;  2O36 A;  4IN0 A;  2LQO A;  5IMD A;  5H5R A;  3FW2 A;  4ZXG A;  4JED A;  2TIR A;  4WXT A;  1BYE A;  1PKW A;  3UAR A;  2G0F A;  4JBB A;  1GWC A;  2VL3 A;  1ACV A;  2CVD A;  4PNF A;  3O76 A;  2VM1 A;  1M99 A;  2H70 A;  3EC3 A;  2H71 A;  3HJO A;  1BX9 A;  2EFC A;  4PI0 C;  3PIN A;  5HFI A;  3TKS E;  3TB2 A;  2DJ3 A;  3G9B A;  3MDK A;  4XRA A;  1THO A;  1AQW A;  4OFN A;  3MWH A;  3UVH A;  3ED3 A;  1JLV A;  2BMX A;  2WW1 A;  2K18 A;  5G1L A;  1EOH A;  1WJK A;  2VLV A;  4GLT A;  2OAD A;  2MMZ A;  4PGT A;  3RHC A;  4EC0 A;  1F9M A;  4NV5 A;  5LD0 A;  2HRN A;  3H8Q A;  3LGC A;  1OC9 A;  2EIO A;  3F9U A;  3H4K A;  2JSZ A;  2LEG A;  2PWJ A;  5A5K A;  4G0I A;  3IC4 A;  3GFK A;  4DVC A;  1SVL A;  2FUG 2;  3DRN A;  2CZ3 A;  2PMT A;  3PPU A;  5IMF A;  3CTF A;  2YWI A;  1F3B A;  3HY2 A;  1Q98 A;  4QMK A;  2CT6 A;  2O89 A;  2H72 A;  4Z2R A;  2VL2 C;  1RW1 A;  1YY7 A;  1ZGN A;  2CVK A;  3HKR A;  2JAD A;  2C1Y A;  1N2A A;  5KN2 A;  1DE1 A;  5A4V A;  1CQG A;  3IA1 A;  4O5U A;  1W4V A;  1X9M B;  1H75 A;  5CAX A;  4ML6 A;  2VUP A;  4OWY A;  1AQX A;  4ZB7 A;  1YDK A;  1ZMA A;  4HDE A;  2KUC A;  1KBN A;  3IR4 A;  1XIY A;  6GST A;  4K7N A;  1M9A A;  5F8B A;  4MK3 A;  4K5S A;  3IHQ A;  3HVS A;  3W8J A;  3EYT A;  2L59 A;  3A3T A;  2ALB A;  3F3Q A;  3HA9 A;  5ECR B;  1T4Z A;  1GLP A;  2L6C A;  4NV2 A;  3KD0 A;  1QK8 A;  2A4H A;  1B4P A;  3I69 A;  2BTO T;  1Z5Y E;  5HR1 A;  3CXG A;  1M9B A;  2FWH A;  5AIS A;  1YQ1 A;  1ILO A;  3HVN A;  1DBY A;  1A2J A;  4IVF A;  4CW9 A;  2WRT A;  1GSE A;  2C80 A;  3PR8 A;  3FEU A;  1SKS B;  2H6Z A;  1QGV A;  3KP8 A;  2R5G A;  5IO2 A;  5B7C A;  2GQM A;  3GUS A;  2AUV A;  4E8E A;  4AKX B;  1THX A;  3TDG A;  4V1A g;  5IIZ A;  14GS A;  4CY8 A;  1EP7 A;  4YQM A;  5HR3 A;  3MYD A;  3F4R A;  4NPB A;  3UL3 A;  1XG8 A;  3VWW A;  2X8G A;  4K7O A;  1LJR A;  3LYK A;  3DWV A;  4OCE A;  2YV9 A;  4G10 A;  1ZL9 A;  3QAG A;  4BPY A;  4O92 A;  4HQZ A;  1GSY A;  1R26 A;  4EL1 A;  1GLQ A;  1JZW A;  4MPF A;  4WBR D;  4MZC A;  4GQF A;  1XW9 A;  3E3E A;  2VLT A;  2K8V A;  5DVB A;  2C8U A;  2DML A;  5G2Z A;  4XS6 A;  3LXZ A;  2MZC A;  1K0M A;  5A34 B;  4O5Q A;  3FKF A;  1SJ6 A;  1LBK A;  4G19 A;  2VD0 A;  5ENU A;  4KCA A;  2JSY A;  3HDC A;  4LA1 A;  4V1A p;  1QFN A;  4D73 B;  4PQI A;  2VCV A;  2WCI A;  5D9T A;  2PBJ A;  4ZIL A;  1U6T A;  2KOK A;  3ERW A;  1SKR B;  4GWR A;  2K6V A;  2H19 A;  3DML A;  3CRT A;  3DEX A;  1UVZ A;  3GRX A;  5DBQ A;  3VWX A;  4MZW A;  2B5X A;  1VF4 A;  4D73 A;  2HE3 A;  4BWS A;  4EF0 A;  2VCT A;  1YF1 A;  4O32 A;  4F03 A;  1C72 A;  2LUS A;  5IMA A;  1DUG A;  1FO5 A;  3HVX A;  1XFL A;  5IOW A;  3GH9 A;  2E2M A;  1BED A;  2R0P A;  4XHM A;  1K0C A;  1BAY A;  4EDY A;  2R3X A;  4L5O A;  5FWG A;  3ZFB A;  2F8F A;  4JR6 A;  4AJ6 A;  1GTA A;  4KCE A;  1OYJ A;  1XCC A;  4KDU A;  1XZO A;  1TOF A;  5DDL A;  5ABR A;  1B4Q A;  3QMX A;  3EE2 A;  4AJ7 A;  5G30 A;  1XWK A;  5A5H B;  1YEW C;  4EDZ A;  4GCI A;  5ID2 A;  1PMT A;  2EFH A;  1F3A A;  3ZML A;  2WGR A;  5E59 A;  1VF1 A;  3ZTL A;  4K8M A;  3G7J A;  1K3Y A;  3UIW A;  3KJY A;  2MMO A;  1K0D A;  2WS2 A;  4KDX A;  1TU8 A;  1PKZ A;  1PQN A;  4ISD A;  5A5H A;  3GN3 A;  2AB6 A;  4E8H A;  4Z2U A;  5A4W A;  1SL0 B;  3ZVJ D;  4F2I A;  2HNL A;  5J41 A;  1G6Y A;  1PN0 A;  2H75 A;  1FVK A;  2JL4 A;  1OE8 A;  4WF5 A;  3IPZ A;  1NW2 A;  2DJ2 A;  3P7X A;  3L9V A;  1Q4J A;  5AN1 A;  1IYH A;  3E9J B;  1WMJ A;  3W8S A;  1K0N A;  3FY7 A;  3H79 A;  3BD2 A;  1GL8 A;  5IPH A;  1FHE A;  1TDI A;  2HRK B;  5DAK B;  22GS A;  5B6M A;  1O8X A;  1M3J A;  5J40 A;  3F6D A;  3IK7 A;  2H1A A;  2LKU A;  4YQV A;  4GQC A;  1FVJ A;  2ZCT A;  1JHB A;  3FK8 A;  3GKN A;  5FT3 A;  4X0X A;  5AIX A;  3WT2 A;  5JCG A;  1O7U A;  2RM6 A;  5ECO B;  1M3I A;  4CHS A;  5ECN B;  2YCD A;  2DJK A;  2C3Q A;  1EV4 A;  5DAK A;  2UZ8 A;  3CSI A;  3GIX A;  5EPF A;  1FB0 A;  4AKI A;  2NDO A;  3PGT A;  3RHB A;  4HQS A;  4ILF A;  1ZZY A;  3LEF A;  2B6M A;  2CV4 A;  1J08 A;  4K1F A;  5ECM B;  2DIZ A;  5AIV A;  2QA1 A;  4NMU A;  2OE1 A;  2YAN A;  2M46 A;  2RUF A;  1A2M A;  3N5O A;  1TK8 B;  3P2A A;  1XWC A;  2VO4 A;  3QAW A;  4ZBA A;  2PVO C;  2R37 A;  1SD8 A;  2QKE A;  4BVX B;  1WE0 A;  2B5E A;  2GVP A;  3WD6 A;  1PL1 A;  3V1W A;  1K0B A;  2CQ9 A;  4XIH A;  2K8S A;  2HRF A;  3IHG A;  5IPG A;  3IXR A;  1CQH A;  4HZ2 A;  2MYG A;  1YZX A;  2GQL A;  2RUE A;  4L8E A;  4GSN A;  2XBI A;  2HQT A;  1WOU A;  4FXY P;  4XS1 A;  3U5R E;  2VM2 A;  5HFK A;  3D0Z A;  1HD2 A;  5LCZ A;  4G9H A;  2I81 A;  4I5Q A;  1XW5 A;  4PX1 A;  3D4T A;  3GX8 A;  5HR0 A;  5CRW A;  3O3T A;  3N9J A;  4ECB A;  3ZVJ A;  1A0R P;  2C0G A;  1GSQ A;  1J0F A;  3EWL A;  2OA7 A;  1ABA A;  3TJF A;  5KN3 A;  1MTC A;  3CSH A;  4XS4 B;  1TK0 B;  4HZ4 A;  3EU3 A;  4EXJ A;  3UEM A;  1Z7P A;  4RUV A;  4HU9 A;  5F06 A;  1M2D A;  1XOA A;  4YAP A;  1X5E A;  5H5Q A;  2DBC A;  1X9W B;  3VPQ A;  3GHA A;  4N10 A;  2F51 A;  2OBI A;  4MLY A;  4EVM A;  4FYU A;  4PTS A;  3MNG A;  2AV4 A;  2YN1 A;  2WJU A;  2KLX A;  2WZ9 A;  3CTG A;  4MCU A;  1BG1 A;  1WRY A;  3M0F A;  1Z6M A;  4MPG A;  2NTO A;  6GSW A;  3IRA A;  3D6I A;  1OE7 A;  3D5J A;  1XWG A;  5DJM A;  3KTB A;  1EEJ A;  2HYX A;  2PUK C;  2R0C A;  4IS0 A;  1FOV A;  3A5I A;  1GTU A;  4TW5 A;  2YWN A;  1Y6E A;  4IBP A;  1Z9H A;  2XBQ A;  3VLN A;  3UAP A;  1PN9 A;  4TR1 B;  1KNG A;  2LQQ A;  1SJI A;  2HRA A;  3AY8 A;  4MMM A;  3KH9 A;  3CBU A;  4GXZ A;  2GLR A;  2CAQ A;  4V2L A;  4Q5Q A;  4PUF C;  2EIQ A;  2A2P A;  2IMD A;  3KGK A;  3TOU A;  2X8H A;  2X4A A;  2GZP A;  4L0U A;  2OJL A;  3OR5 A;  1U87 A;  4EIQ A;  4NHW A;  3ZMK A;  3L4N A;  1ZYE A;  4EUY A;  2C4J A;  2B7J A;  3QD9 A;  3VUR A;  2N5B A;  4ZL8 A;  3LOR A;  1T1V A;  4AI6 A;  1B9X C;  3H93 A;  1TI1 A;  5IMV A;  3CHX C;  3DVW A;  3HD5 A;  3IOS A;  3IE3 A;  2WVY A;  2H0G A;  6GSX A;  4Z2T A;  1H4O A;  3TKP A;  5ECH B;  3GUR A;  2NPB A;  19GS A;  2PER A;  3HVV A;  2F3M A;  1VGL A;  1G6W A;  3GSS A;  3RGB C;  2WVZ A;  2H6Y A;  1ON4 A;  1OC8 A;  3EU4 A;  1T8E B;  3GV1 A;  4K6X A;  3ERF A;  2H74 A;  3TJK A;  2E2G A;  4ML1 A;  3NOF A;  3VWU A;  5KOW A;  4WKW A;  3F4T A;  2AJQ B;  1SK0 A;  3KP9 A;  3KXO A;  2H30 A;  2CX4 A;  1QXH A;  4IGJ A;  1MDJ A;  2YOI A;  4KW6 A;  5ECP B;  1MDI A;  5L71 A;  2VAF A;  2IMF A;  4Q5F A;  4POM A;  2DMM A;  4N30 A;  4TXV A;  1FOH A;  4K0N A;  1S4B P;  16GS A;  3UBL A;  1T3B A;  3R2Q A;  1MD4 A;  3HJP A;  3NZN A;  4X4J A;  2VCZ A;  2V41 A;  3O6T A;  5DAL B;  2XC2 A;  3DKS A;  2H1G A;  3S9F A;  3GKM A;  2AYT A;  3GKK A;  3A2X A;  2P5R A;  2VIM A;  3GYK A;  2WVX B;  2VCW A;  4GSS A;  2GSQ A;  2LRN A;  4TR0 A;  1WIK A;  4K9Z A;  4KB3 A;  1SVO A;  4KE3 A;  5JWR B;  3ZIT A;  3FZ9 A;  1N25 A;  2V2G A;  2DKH A;  4ECC A;  4USS A;  3Q6O A;  4F9Z A;  4V2M A;  2IMK A;  1JZO A;  5D8I A;  3FZ4 A;  4MP4 A;  2FA8 A;  2DKI A;  2WVX A;  2YJ7 A;  2B1L A;  2HLS A;  3FR6 A;  3RPN A;  1A23 A;  7GSS A;  2HSY A;  1A2L A;  1XVW A;  3P90 A;  3J7Y k;  1YJ6 A;  3ERG A;  2VL9 A;  1R5P A;  3ZFL A;  3KIJ A;  1Y25 A;  2I1U A;  5B6N A;  1NHO A;  5A34 A;  4IQ1 A;  2FGX A;  2ES7 A;  3TKR A;  2H0I A;  11GS A;  9GSS A;  2IFQ B;  1WWJ A;  3GMF A;  3KTL A;  4KAE A;  4I2T A;  2C0D A;  4NWY A;  2VOC A;  1DE2 A;  4V2N A;  3TKS A;  3HHV A;  1T7P B;  3MIX A;  2H6X A;  2YV7 A;  4FYB A;  2HXK A;  4TR3 A;  1XVQ A;  4OO4 A;  6GSU A;  1O8W A;  4LMV A;  3ZL5 A;  4CY6 A;  3C8E A;  5DCG A;  1TW9 A;  3M8N A;  5J3R A;  1GH2 A;  1V2A A;  4TKY A;  5IMZ A;  5GZZ B;  1OVN A;  3UOM A;  3CYN A;  2L57 A;  5G5E A;  1V40 A;  2IN3 A;  5F05 A;  5IM9 A;  5ELG A;  5IMC A;  1MDK A;  2OT3 A;  1AQV A;  2LV3 A;  2GST A;  3C73 A;  4NXI A;  1IYI A;  1DSB A;  2HZE B;  4AJ8 A;  2A2R A;  2FA4 A;  2B3S A;  1U3A A;  1B48 A;  1PX7 A;  4YH2 A;  3LW9 A;  5ECS A;  4ZBB A;  2JZR A;  1O6J A;  2DJ1 A;  2E0Q A;  4AKH A;  1ERV A;  5G1K A;  1UC7 A;  3FMW A;  3WGX A;  2WW3 A;  4XCS A;  4Q5N A;  2VCX A;  4GF0 A;  2O5V A;  2L4Q A;  4BA7 A;  2HSM B;  5KEJ A;  4ZL9 A;  2HZE A;  1GP1 A;  1GUL A;  3KH7 A;  2V1M A;  3EIN A;  4MF6 A;  1ST9 A;  2B5Y A;  2H8L A;  4I2U A;  3CQF A;  4JRR A;  2L5L A;  4MJA A;  1W89 A;  5KOX A;  2C0F A;  3SWL A;  4IKH A;  2VL2 A;  3F63 A;  3EPT A;  3ME8 A;  1ZOF A;  3KMO A;  2H1B A;  5DJL A;  1G0T A;  2YJH A;  5BRT A;  3CRU A;  1V57 A;  2DLX A;  2O7K A;  4J57 E;  3TRX A;  4EIP A;  2JZS A;  4MJC A;  1TRS A;  4EE0 A;  4PI2 C;  2HSH A;  1GTB A;  2WW0 A;  4BL7 B;  2JAC A;  1A8L A;  4QL9 A;  4KSM A;  4GTU A;  1O81 A;  3I43 A;  3E0U A;  3QR6 A;  3WYW A;  2GGT A;  4PNG A;  4WR5 A;  5JWO B;  2MBS A;  4FIW A;  1SJZ A;  3VWV A;  4F82 A;  2GQK A;  1B9Y C;  3DXB A;  1EEM A;  2VKZ G;  2DIY A;  3I6A A;  3GTU B;  2WW2 A;  4X43 A;  3EUR A;  1M2A A;  4G01 A;  4BL7 A;  4CDO A;  4I6X A;  3J7Y b;  3F3R A;  2HRK A;  2LST A;  3FR9 A;  4EO3 A;  2D2Z A;  3KM6 A;  1S3R A;  2V32 A;  1K3O A;  1GUM A;  1FAA A;  4WR4 A;  2QA2 A;  4I97 A;  1O85 A;  2EFD A;  1RQM A;  2V6K A;  3IDV A;  2MMA A;  2VLU A;  5D96 A;  1A8Y A;  5J9C A;  5ELA A;  4NAX A;  2TRX A;  1XOB A;  2KP2 A;  4RI7 A;  5G31 A;  5CYY A;  1FB6 A;  4ULX A;  3MAK A;  4TXO B;  3C1R A;  3ZRE A;  4JR4 A;  5F0G A;  1EP8 A;  4MH3 A;  2L5O A;  3RAZ A;  3A5W A;  1S3C A;  1QUW A;  5DCH A;  2EIR A;  2H01 A;  3M3M A;  1TRW A;  1GSS A;  2YP6 A;  3TUE A;  2EFE A;  1TXX A;  4MA9 A;  3HYP A;  2AHE A;  5A1N B;  4LL4 B;  4G0K A;  1PA3 A;  2GS3 A;  3F8U A;  5E4W A;  4ECJ A;  1WP0 A;  1URM A;  3D4M A;  4DSS B;  4BVX A;  2I3Y A;  2VCQ A;  2XPD A;  1KTE A;  5H5S A;  2WB9 A;  2IPA A;  4FO5 A;  3WGD A;  8GSS A;  2ON5 A;  4PXO A;  3KZQ A;  1F37 A;  1YEX A;  1TU7 A;  5EY6 A;  4HS1 A;  3RPP A;  1SL2 B;  3ZRD A;  1VF2 A;  5HQP A;  4ECI A;  1YKA A;  4BVY B;  3QOU A;  2IWT A;  3US3 A;  2CZ2 A;  3EMX A;  5IOX A;  1X5D A;  1G7E A;  2GZZ A;  1GSU A;  4XRD A;  2WFC A;  4ZB9 A;  2LRT A;  2M80 A;  1F6M C;  5D93 A;  1QQ2 A;  1SVM A;  3Q74 A;  4QL7 A;  3P8W A;  2WUL A;  3CWG A;  4DSR A;  3L78 A;  2GDR A;  2XHF A;  5KN1 A;  3IAM 2;  1GNW A;  4MJE A;  1XXU A;  1SU9 A;  1EOG A;  4XS4 A;  2GSR A;  2E7P A;  1HNA A;  3IK9 A;  5B8A A;  1SL1 B;  4Z7X A;  4POL A;  4N0Z A;  3GL3 A;  4GDF A;  3TJB A;  3G7I A;  2YWM A;  3UMA A;  1WPI A;  4J2F A;  1SYR A;  5CNW A;  3VI7 A;  1FW1 A;  5KN0 A;  4ID0 A;  3FR3 A;  3UVT A;  3TKQ A;  4N0V A;  1VF3 A;  4FQU A;  1TTZ A;  5B8B A;  2DSA A;  5GST A;  2O87 A;  2LS5 A;  3L9S A;  5GAP D; 
#chains in the Genus database with same CATH homology
 3RBT A;  2H66 A;  5ECK B;  2N5A A;  4OMV A;  4F0C A;  1TRU A;  3FZA A;  1I5G A;  4TRX A;  2FWF A;  3DGQ A;  3HMJ G;  2DJJ A;  3IBH A;  1TK5 B;  2O8V B;  2H76 A;  4X1U A;  1R7H A;  2Z9S A;  4GRF A;  3D21 A;  1K3L A;  1K0A A;  5GAN D;  4ZL7 A;  2R0G A;  2M72 A;  4TR1 A;  4YKG A;  4ICY A;  1YKC A;  1OC9 B;  1M7T A;  5J47 A;  1QMV A;  1Y1U A;  1GSF A;  1MEK A;  4HOJ A;  4AF2 A;  2A2S A;  2GZY A;  2OKA A;  3EMP A;  2IME A;  1HYU A;  3ME7 A;  2QSI A;  4ZIJ A;  1GUK A;  4PQ1 A;  4K2D A;  3BBY A;  1XWB A;  1V98 A;  2IMI A;  5CRE A;  4F0B A;  4KUN A;  2PU9 C;  6GSV A;  2DJ0 A;  3TCO A;  4HU7 A;  1AAZ A;  1BJX A;  2FWG A;  4IP6 A;  1JZR A;  2CAI A;  4LMW A;  2X49 A;  18GS A;  3PH9 A;  1TJD A;  4RQR A;  3Q18 A;  4K2X A;  1GNE A;  1F2E A;  3IC8 A;  1Z7R A;  3NIV A;  5J4V A;  3UJ1 A;  2C3N A;  1ERT A;  4MF7 A;  2LJK A;  3FRC A;  3GH6 A;  1ERU A;  2F8A A;  3LWA A;  1S3D A;  3ZZX A;  2N5F A;  2LRC A;  1E2Y A;  1AC1 A;  3DIE A;  3DD3 A;  3M1G A;  4IEL A;  2R2J A;  1PRX A;  5AGY A;  4ZBD A;  3QAV A;  1ZCP A;  2WDU A;  2YPM A;  4BWQ A;  5C00 A;  2HSN B;  2EC4 A;  2L6D A;  3KCM A;  2YZU A;  4IJ3 A;  3WT1 A;  4J56 E;  1YEP A;  1JZD A;  3TRQ A;  2I4A A;  1TP9 A;  4NHZ A;  2YWO A;  1EWX A;  4OO5 A;  2QGV A;  2X8C A;  4DSQ A;  2X99 A;  2GT5 A;  2HSN A;  3GST A;  4WF4 A;  4WEY A;  1FG4 A;  1OKD A;  2MMN A;  3GA4 A;  4ACS A;  4KND A;  3LQ7 A;  2FWE A;  1O73 A;  4MF5 A;  1HQO A;  5EL8 A;  3TU3 B;  5DAL A;  2QC7 A;  1R5A A;  1M0U A;  2P0G A;  1YVL A;  4MNN A;  3GL5 A;  10GS A;  4AGS A;  2IJY A;  2XPE A;  3C71 A;  2PVQ A;  4MAB A;  3WGE A;  3LJR A;  2P31 A;  4G0L A;  3H1N A;  4K5R A;  1TKD B;  3LG6 A;  3GNJ A;  2NVL A;  1TXU A;  1XW6 A;  2BJX A;  2G2Q A;  1ZYP A;  1V58 A;  1T4Y A;  3M9K A;  2AAW A;  1AXD A;  2F9S A;  4P3Y B;  2DC5 A;  1SKW B;  1G7O A;  1PSQ A;  1VRS D;  4WET A;  2NBS A;  4H86 A;  1R4W A;  3U6V A;  1X9S B;  3Q19 A;  3LYP A;  1T00 A;  3BCK A;  3FZ5 A;  2FD3 A;  2JZT A;  4IHU A;  3L9U A;  5ECQ B;  1ERW A;  1ML6 A;  1SK2 A;  2J9H A;  1EGO A;  5CRH A;  4FYC A;  5HFG A;  4K0G A;  2K9F A;  4A5P A;  3R3E A;  4N11 A;  4QQ7 A;  1U88 A;  2GSS A;  2ZNM A;  2IFQ A;  5J5N A;  2FNO A;  3ISO A;  2HZF A;  1OKT A;  4IQA A;  1B8X A;  1HNB A;  4AKG A;  4PQH A;  5J9B A;  1BF5 A;  2FY6 A;  2O85 A;  1NHY A;  5CRG A;  4TOP A;  4JU5 A;  17GS A;  3HJM A;  1BQ7 A;  4IW9 A;  1AW9 A;  2FLS A;  4XTS A;  1SYX A;  2IIY A;  4L0W A;  3F6F A;  4HI7 A;  4KGI A;  1SK1 A;  3GKX A;  4KF9 A;  3DYR A;  2C0E A;  2LNT A;  4KX4 A;  5J4Y A;  5ID2 B;  4DEJ A;  1UA5 A;  3A2V A;  4ZB6 A;  4JE1 A;  3BOA A;  3GX0 A;  3TOT A;  1TI3 A;  3SBC A;  3BJ5 A;  4TVE A;  3QDN A;  4ZB8 A;  4OD7 A;  3HXS A;  4RI6 A;  3TGZ A;  2J23 A;  4KDY A;  3A2W A;  4LL1 B;  4O5R A;  1A0F A;  4LLR A;  5D9V A;  5LNK e;  5A4U A;  1E6B A;  3M9J A;  2OE3 A;  4IP1 A;  2HSM A;  3ZIJ A;  1A24 A;  3TJG A;  3FHK A;  4WBJ A;  5DQY A;  2H0H A;  4POK A;  1M2B A;  3RDW A;  2LJR A;  5ECL B;  5BMU B;  1RK4 A;  5G5F A;  4MDC A;  2MBT A;  4I8B A;  5F07 A;  2FHE A;  3EVI A;  4K7I A;  2H1D A;  1JFU A;  2RM5 A;  5ECI B;  3F0I A;  5D9X A;  1EV9 A;  1OAZ A;  4POB A;  3QFB C;  4YQU A;  5BMU A;  2KP1 A;  5CP1 A;  2KHP A;  4HJM A;  3BCI A;  5JWQ B;  4N3Z A;  2ZUP A;  3FYG A;  4RQX A;  1PGT A;  3VK9 A;  5INY A;  2A4V A;  3LXT A;  3QCP A;  1YF0 A;  1Z6N A;  3JCM L;  4IJI A;  4MZB A;  2B7K A;  2TRC P;  1PL2 A;  3HZ8 A;  1AUC A;  2UV8 G;  1UN2 A;  1NSW A;  2HT9 A;  6GSY A;  3W6G A;  3TJJ A;  1V9W A;  3HCZ A;  2IL3 A;  1EGR A;  2GTU A;  3GTU A;  1USB A;  1X0R A;  2GT6 A;  5C04 A;  3IV4 A;  1HNC A;  1PX6 A;  3DVX A;  2PN8 A;  2R4V A;  3QPM A;  1XWA A;  2OBK A;  3APQ A;  5D9W A;  5FHI A;  4HJ2 A;  1Z3E A;  1KEB A;  1NM3 A;  4L5L A;  2P5Q A;  5JCU A;  2VD1 A;  4MH2 A;  2LJA A;  2B1K A;  2LNS A;  1GUH A;  5COH A;  1PD2 1;  3UBK A;  2H1L A;  1BG5 A;  4KH7 A;  4G2E A;  4TR4 A;  5J4U A;  3QFA C;  2OAC A;  1JLW A;  2CVB A;  2YNX A;  3VI5 A;  5GSS A;  3F4S A;  1MD3 A;  3C7M A;  3D22 A;  3LFL A;  2LTK A;  3VPT A;  1EZK A;  4TXO A;  3L0H A;  3ZIV A;  4PUA A;  1I9D A;  2R6K A;  5IQY A;  1GSD A;  2PGT A;  2RLI A;  4Q5R A;  1OC3 A;  1ZYQ B;  2X64 A;  3APO A;  2H73 A;  5DQS A;  2PPT A;  1GTI A;  4YKF A;  2ON7 A;  1S3A A;  2JU5 A;  2V6O A;  5CRD A;  4MJB A;  1GRX A;  3VFI A;  4GST A;  3ZYW A;  5A1N A;  3CSJ A;  4PUR A;  4TN8 A;  3TRP A;  4W66 A;  2I9H A;  2CX3 A;  5JCW A;  3HZ4 A;  2HFD A;  6GSS A;  2C3T A;  4DSS A;  4KA0 A;  3KEB A;  4EKZ A;  4HEA 2;  2L4C A;  1ZYN A;  1SD9 A;  1LU4 A;  5CO3 A;  3LSZ A;  4FH8 A;  1TRV A;  3APS A;  5D73 A;  3IAS 2;  2FCH A;  4KSO A;  3I9V 2;  1SEN A;  5IO0 A;  4OFT A;  20GS A;  4JZQ A;  1XPV A;  2YZH A;  4BVY A;  3C1S A;  5HR2 A;  3CMI A;  3MSZ A;  1U3I A;  2CA8 A;  3G7Y A;  2HI7 A;  4OCF A;  1J9B A;  3ZLP A;  1AIU A;  12GS A;  4YAV A;  4OFM A;  1X5C A;  1N8J A;  1XBS A;  4HUA A;  3KMN A;  13GS A;  5EVO A;  2OE0 A;  4O7H A;  1K0O A;  3TKS C;  2REM A;  4E68 A;  3K8N A;  2RII A;  4IN0 A;  2LQO A;  5IMD A;  5H5R A;  3FW2 A;  4ZXG A;  4JED A;  2TIR A;  4WXT A;  1BYE A;  1PKW A;  3UAR A;  2G0F A;  4JBB A;  1GWC A;  2VL3 A;  1ACV A;  2CVD A;  4PNF A;  3O76 A;  2VM1 A;  1M99 A;  2H70 A;  3EC3 A;  2H71 A;  3HJO A;  1BX9 A;  2EFC A;  3PIN A;  5HFI A;  3TKS E;  3TB2 A;  2DJ3 A;  3G9B A;  3MDK A;  4XRA A;  1THO A;  1AQW A;  4OFN A;  3MWH A;  3UVH A;  3ED3 A;  1JLV A;  2BMX A;  2K18 A;  5G1L A;  1EOH A;  1WJK A;  2VLV A;  4GLT A;  2OAD A;  2MMZ A;  4PGT A;  3RHC A;  4EC0 A;  1F9M A;  4NV5 A;  5LD0 A;  2HRN A;  3H8Q A;  3LGC A;  1OC9 A;  2EIO A;  3F9U A;  3H4K A;  2JSZ A;  2LEG A;  2PWJ A;  5A5K A;  4G0I A;  3IC4 A;  3GFK A;  4DVC A;  1SVL A;  2FUG 2;  3DRN A;  2CZ3 A;  2PMT A;  3PPU A;  5IMF A;  3CTF A;  2YWI A;  1F3B A;  3HY2 A;  1Q98 A;  4QMK A;  2CT6 A;  2O89 A;  2H72 A;  4Z2R A;  2VL2 C;  1RW1 A;  1YY7 A;  1ZGN A;  2CVK A;  3HKR A;  2JAD A;  2C1Y A;  1N2A A;  5KN2 A;  1DE1 A;  5A4V A;  1CQG A;  3IA1 A;  4O5U A;  1W4V A;  1X9M B;  1H75 A;  5CAX A;  4ML6 A;  2VUP A;  4OWY A;  1AQX A;  4ZB7 A;  1YDK A;  1ZMA A;  4HDE A;  2KUC A;  1KBN A;  3IR4 A;  1XIY A;  6GST A;  4K7N A;  1M9A A;  5F8B A;  4MK3 A;  4K5S A;  3IHQ A;  3HVS A;  3W8J A;  3EYT A;  2L59 A;  3A3T A;  2ALB A;  3F3Q A;  3HA9 A;  5ECR B;  1T4Z A;  1GLP A;  2L6C A;  4NV2 A;  3KD0 A;  1QK8 A;  2A4H A;  1B4P A;  3I69 A;  2BTO T;  1Z5Y E;  5HR1 A;  3CXG A;  1M9B A;  2FWH A;  5AIS A;  1YQ1 A;  1ILO A;  1DBY A;  1A2J A;  4IVF A;  4CW9 A;  2WRT A;  1GSE A;  2C80 A;  3PR8 A;  3FEU A;  1SKS B;  2H6Z A;  1QGV A;  3KP8 A;  2R5G A;  5IO2 A;  5B7C A;  2GQM A;  3GUS A;  2AUV A;  4E8E A;  4AKX B;  1THX A;  3TDG A;  4V1A g;  5IIZ A;  14GS A;  4CY8 A;  1EP7 A;  4YQM A;  5HR3 A;  3MYD A;  3F4R A;  4NPB A;  3UL3 A;  3VWW A;  2X8G A;  4K7O A;  1LJR A;  3LYK A;  3DWV A;  4OCE A;  2YV9 A;  4G10 A;  1ZL9 A;  3QAG A;  4BPY A;  4O92 A;  4HQZ A;  1GSY A;  1R26 A;  4EL1 A;  1GLQ A;  1JZW A;  4MPF A;  4WBR D;  4MZC A;  4GQF A;  1XW9 A;  3E3E A;  2VLT A;  2K8V A;  5DVB A;  2C8U A;  2DML A;  5G2Z A;  4XS6 A;  3LXZ A;  2MZC A;  1K0M A;  5A34 B;  4O5Q A;  3FKF A;  1SJ6 A;  1LBK A;  4G19 A;  2VD0 A;  5ENU A;  4KCA A;  2JSY A;  3HDC A;  4LA1 A;  4V1A p;  1QFN A;  4D73 B;  4PQI A;  2VCV A;  2WCI A;  5D9T A;  2PBJ A;  4ZIL A;  1U6T A;  2KOK A;  3ERW A;  1SKR B;  4GWR A;  2K6V A;  2H19 A;  3DML A;  3CRT A;  3DEX A;  1UVZ A;  3GRX A;  5DBQ A;  3VWX A;  4MZW A;  2B5X A;  1VF4 A;  4D73 A;  2HE3 A;  4BWS A;  4EF0 A;  2VCT A;  1YF1 A;  4O32 A;  4F03 A;  1C72 A;  2LUS A;  5IMA A;  1DUG A;  1FO5 A;  3HVX A;  1XFL A;  5IOW A;  3GH9 A;  2E2M A;  1BED A;  2R0P A;  4XHM A;  1K0C A;  1BAY A;  4EDY A;  2R3X A;  4L5O A;  5FWG A;  3ZFB A;  2F8F A;  4JR6 A;  4AJ6 A;  1GTA A;  4KCE A;  1OYJ A;  1XCC A;  4KDU A;  1XZO A;  1TOF A;  5DDL A;  5ABR A;  1B4Q A;  3QMX A;  3EE2 A;  4AJ7 A;  5G30 A;  1XWK A;  5A5H B;  4EDZ A;  4GCI A;  5ID2 A;  1PMT A;  2EFH A;  1F3A A;  3ZML A;  2WGR A;  5E59 A;  1VF1 A;  3ZTL A;  4K8M A;  3G7J A;  1K3Y A;  3UIW A;  3KJY A;  2MMO A;  1K0D A;  2WS2 A;  4KDX A;  1TU8 A;  1PKZ A;  1PQN A;  4ISD A;  5A5H A;  3GN3 A;  2AB6 A;  4E8H A;  4Z2U A;  5A4W A;  1SL0 B;  3ZVJ D;  4F2I A;  2HNL A;  5J41 A;  1G6Y A;  1PN0 A;  2H75 A;  1FVK A;  2JL4 A;  1OE8 A;  4WF5 A;  3IPZ A;  1NW2 A;  2DJ2 A;  3P7X A;  3L9V A;  1Q4J A;  5AN1 A;  1IYH A;  3E9J B;  1WMJ A;  3W8S A;  1K0N A;  3FY7 A;  3H79 A;  3BD2 A;  1GL8 A;  5IPH A;  1FHE A;  1TDI A;  2HRK B;  5DAK B;  22GS A;  5B6M A;  1O8X A;  5J40 A;  3F6D A;  3IK7 A;  2H1A A;  2LKU A;  4YQV A;  4GQC A;  1FVJ A;  2ZCT A;  1JHB A;  3FK8 A;  3GKN A;  5FT3 A;  4X0X A;  5AIX A;  3WT2 A;  5JCG A;  1O7U A;  2RM6 A;  5ECO B;  4CHS A;  5ECN B;  2YCD A;  2DJK A;  2C3Q A;  1EV4 A;  5DAK A;  2UZ8 A;  3CSI A;  3GIX A;  5EPF A;  1FB0 A;  4AKI A;  2NDO A;  3PGT A;  3RHB A;  4HQS A;  4ILF A;  1ZZY A;  3LEF A;  2B6M A;  2CV4 A;  1J08 A;  4K1F A;  5ECM B;  2DIZ A;  5AIV A;  2QA1 A;  4NMU A;  2OE1 A;  2YAN A;  2M46 A;  2RUF A;  1A2M A;  3N5O A;  1TK8 B;  3P2A A;  1XWC A;  2VO4 A;  3QAW A;  4ZBA A;  2PVO C;  2R37 A;  1SD8 A;  2QKE A;  4BVX B;  1WE0 A;  2B5E A;  2GVP A;  3WD6 A;  1PL1 A;  3V1W A;  1K0B A;  2CQ9 A;  4XIH A;  2K8S A;  2HRF A;  3IHG A;  5IPG A;  3IXR A;  1CQH A;  4HZ2 A;  2MYG A;  1YZX A;  2GQL A;  2RUE A;  4L8E A;  4GSN A;  2XBI A;  2HQT A;  1WOU A;  4XS1 A;  3U5R E;  2VM2 A;  5HFK A;  3D0Z A;  1HD2 A;  5LCZ A;  4G9H A;  2I81 A;  4I5Q A;  1XW5 A;  4PX1 A;  3D4T A;  3GX8 A;  5HR0 A;  5CRW A;  3O3T A;  3N9J A;  4ECB A;  3ZVJ A;  1A0R P;  2C0G A;  1GSQ A;  1J0F A;  3EWL A;  2OA7 A;  1ABA A;  3TJF A;  5KN3 A;  1MTC A;  3CSH A;  4XS4 B;  1TK0 B;  4HZ4 A;  3EU3 A;  4EXJ A;  3UEM A;  1Z7P A;  4RUV A;  4HU9 A;  5F06 A;  1M2D A;  1XOA A;  4YAP A;  1X5E A;  5H5Q A;  2DBC A;  1X9W B;  3VPQ A;  3GHA A;  4N10 A;  2F51 A;  2OBI A;  4MLY A;  4EVM A;  4FYU A;  4PTS A;  3MNG A;  2AV4 A;  2YN1 A;  2WJU A;  2KLX A;  2WZ9 A;  3CTG A;  4MCU A;  1BG1 A;  1WRY A;  3M0F A;  1Z6M A;  4MPG A;  2NTO A;  6GSW A;  3IRA A;  3D6I A;  1OE7 A;  3D5J A;  1XWG A;  5DJM A;  3KTB A;  1EEJ A;  2HYX A;  2PUK C;  2R0C A;  4IS0 A;  1FOV A;  3A5I A;  1GTU A;  4TW5 A;  2YWN A;  1Y6E A;  4IBP A;  1Z9H A;  2XBQ A;  3VLN A;  3UAP A;  1PN9 A;  4TR1 B;  1KNG A;  2LQQ A;  1SJI A;  2HRA A;  3AY8 A;  4MMM A;  3KH9 A;  3CBU A;  4GXZ A;  2GLR A;  2CAQ A;  4V2L A;  4Q5Q A;  4PUF C;  2EIQ A;  2A2P A;  2IMD A;  3KGK A;  3TOU A;  2X8H A;  2X4A A;  2GZP A;  4L0U A;  2OJL A;  3OR5 A;  1U87 A;  4EIQ A;  4NHW A;  3ZMK A;  3L4N A;  1ZYE A;  4EUY A;  2C4J A;  2B7J A;  3QD9 A;  3VUR A;  2N5B A;  4ZL8 A;  3LOR A;  1T1V A;  4AI6 A;  1B9X C;  3H93 A;  1TI1 A;  5IMV A;  3DVW A;  3HD5 A;  3IOS A;  3IE3 A;  2H0G A;  6GSX A;  4Z2T A;  1H4O A;  3TKP A;  5ECH B;  3GUR A;  2NPB A;  19GS A;  2PER A;  3HVV A;  2F3M A;  1VGL A;  1G6W A;  3GSS A;  2H6Y A;  1ON4 A;  1OC8 A;  3EU4 A;  1T8E B;  3GV1 A;  4K6X A;  3ERF A;  2H74 A;  3TJK A;  2E2G A;  4ML1 A;  3NOF A;  3VWU A;  5KOW A;  4WKW A;  3F4T A;  2AJQ B;  1SK0 A;  3KP9 A;  3KXO A;  2H30 A;  2CX4 A;  1QXH A;  4IGJ A;  1MDJ A;  2YOI A;  4KW6 A;  5ECP B;  1MDI A;  5L71 A;  2VAF A;  2IMF A;  4Q5F A;  4POM A;  2DMM A;  4N30 A;  4TXV A;  1FOH A;  4K0N A;  16GS A;  3UBL A;  1T3B A;  3R2Q A;  1MD4 A;  3HJP A;  3NZN A;  4X4J A;  2VCZ A;  2V41 A;  3O6T A;  5DAL B;  2XC2 A;  3DKS A;  2H1G A;  3S9F A;  3GKM A;  2AYT A;  3GKK A;  3A2X A;  2P5R A;  2VIM A;  3GYK A;  2VCW A;  4GSS A;  2GSQ A;  2LRN A;  4TR0 A;  1WIK A;  4K9Z A;  4KB3 A;  1SVO A;  4KE3 A;  5JWR B;  3ZIT A;  3FZ9 A;  1N25 A;  2V2G A;  2DKH A;  4ECC A;  4USS A;  3Q6O A;  4F9Z A;  4V2M A;  2IMK A;  1JZO A;  5D8I A;  3FZ4 A;  4MP4 A;  2FA8 A;  2DKI A;  2YJ7 A;  2B1L A;  2HLS A;  3FR6 A;  3RPN A;  1A23 A;  7GSS A;  2HSY A;  1A2L A;  1XVW A;  3P90 A;  3J7Y k;  1YJ6 A;  3ERG A;  2VL9 A;  1R5P A;  3ZFL A;  3KIJ A;  1Y25 A;  2I1U A;  5B6N A;  1NHO A;  5A34 A;  4IQ1 A;  2FGX A;  2ES7 A;  3TKR A;  2H0I A;  11GS A;  9GSS A;  2IFQ B;  1WWJ A;  3GMF A;  3KTL A;  4KAE A;  4I2T A;  2C0D A;  4NWY A;  2VOC A;  1DE2 A;  4V2N A;  3TKS A;  3HHV A;  1T7P B;  3MIX A;  2H6X A;  2YV7 A;  4FYB A;  2HXK A;  4TR3 A;  1XVQ A;  4OO4 A;  6GSU A;  1O8W A;  4LMV A;  3ZL5 A;  4CY6 A;  3C8E A;  5DCG A;  1TW9 A;  3M8N A;  5J3R A;  1GH2 A;  1V2A A;  4TKY A;  5IMZ A;  5GZZ B;  1OVN A;  3UOM A;  3CYN A;  2L57 A;  5G5E A;  1V40 A;  2IN3 A;  5F05 A;  5IM9 A;  5ELG A;  5IMC A;  1MDK A;  2OT3 A;  1AQV A;  2LV3 A;  2GST A;  3C73 A;  4NXI A;  1IYI A;  1DSB A;  2HZE B;  4AJ8 A;  2A2R A;  2FA4 A;  2B3S A;  1U3A A;  1B48 A;  1PX7 A;  4YH2 A;  3LW9 A;  5ECS A;  4ZBB A;  2JZR A;  1O6J A;  2DJ1 A;  2E0Q A;  4AKH A;  1ERV A;  5G1K A;  1UC7 A;  3FMW A;  3WGX A;  4XCS A;  4Q5N A;  2VCX A;  4GF0 A;  2O5V A;  2L4Q A;  4BA7 A;  2HSM B;  5KEJ A;  4ZL9 A;  2HZE A;  1GP1 A;  1GUL A;  3KH7 A;  2V1M A;  3EIN A;  4MF6 A;  1ST9 A;  2B5Y A;  2H8L A;  4I2U A;  4JRR A;  2L5L A;  4MJA A;  1W89 A;  5KOX A;  2C0F A;  3SWL A;  4IKH A;  2VL2 A;  3F63 A;  3EPT A;  3ME8 A;  1ZOF A;  3KMO A;  2H1B A;  5DJL A;  1G0T A;  2YJH A;  5BRT A;  3CRU A;  1V57 A;  2DLX A;  2O7K A;  4J57 E;  3TRX A;  4EIP A;  2JZS A;  4MJC A;  1TRS A;  4EE0 A;  2HSH A;  1GTB A;  4BL7 B;  2JAC A;  1A8L A;  4QL9 A;  4KSM A;  4GTU A;  1O81 A;  3I43 A;  3E0U A;  3QR6 A;  3WYW A;  2GGT A;  4PNG A;  4WR5 A;  5JWO B;  2MBS A;  4FIW A;  1SJZ A;  3VWV A;  4F82 A;  2GQK A;  1B9Y C;  3DXB A;  1EEM A;  2VKZ G;  2DIY A;  3I6A A;  3GTU B;  4X43 A;  3EUR A;  1M2A A;  4G01 A;  4BL7 A;  4CDO A;  4I6X A;  3J7Y b;  3F3R A;  2HRK A;  2LST A;  3FR9 A;  4EO3 A;  2D2Z A;  3KM6 A;  2V32 A;  1K3O A;  1GUM A;  1FAA A;  4WR4 A;  2QA2 A;  4I97 A;  1O85 A;  2EFD A;  1RQM A;  2V6K A;  3IDV A;  2MMA A;  2VLU A;  5D96 A;  1A8Y A;  5J9C A;  5ELA A;  4NAX A;  2TRX A;  1XOB A;  2KP2 A;  4RI7 A;  5G31 A;  5CYY A;  1FB6 A;  4ULX A;  3MAK A;  4TXO B;  3C1R A;  3ZRE A;  4JR4 A;  5F0G A;  1EP8 A;  4MH3 A;  2L5O A;  3RAZ A;  3A5W A;  1S3C A;  1QUW A;  5DCH A;  2EIR A;  2H01 A;  3M3M A;  1TRW A;  1GSS A;  2YP6 A;  3TUE A;  2EFE A;  1TXX A;  4MA9 A;  3HYP A;  2AHE A;  5A1N B;  4LL4 B;  4G0K A;  1PA3 A;  2GS3 A;  3F8U A;  5E4W A;  4ECJ A;  1WP0 A;  1URM A;  3D4M A;  4DSS B;  4BVX A;  2I3Y A;  2VCQ A;  2XPD A;  1KTE A;  5H5S A;  2WB9 A;  2IPA A;  4FO5 A;  3WGD A;  8GSS A;  2ON5 A;  4PXO A;  3KZQ A;  1F37 A;  1YEX A;  1TU7 A;  5EY6 A;  4HS1 A;  3RPP A;  1SL2 B;  3ZRD A;  1VF2 A;  5HQP A;  4ECI A;  1YKA A;  4BVY B;  3QOU A;  2IWT A;  3US3 A;  2CZ2 A;  3EMX A;  5IOX A;  1X5D A;  1G7E A;  2GZZ A;  1GSU A;  4XRD A;  2WFC A;  4ZB9 A;  2LRT A;  2M80 A;  1F6M C;  5D93 A;  1QQ2 A;  1SVM A;  3Q74 A;  4QL7 A;  3P8W A;  2WUL A;  3CWG A;  4DSR A;  3L78 A;  2GDR A;  2XHF A;  5KN1 A;  3IAM 2;  1GNW A;  4MJE A;  1XXU A;  1SU9 A;  1EOG A;  4XS4 A;  2GSR A;  2E7P A;  1HNA A;  3IK9 A;  5B8A A;  1SL1 B;  4Z7X A;  4POL A;  4N0Z A;  3GL3 A;  4GDF A;  3TJB A;  3G7I A;  2YWM A;  3UMA A;  1WPI A;  4J2F A;  1SYR A;  5CNW A;  3VI7 A;  1FW1 A;  5KN0 A;  4ID0 A;  3FR3 A;  3UVT A;  3TKQ A;  4N0V A;  1VF3 A;  4FQU A;  1TTZ A;  5B8B A;  2DSA A;  5GST A;  2O87 A;  2LS5 A;  3L9S A;  5GAP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...