5DAKB

Crystal structure of human glutathione transferase pi complexed with a metalloid in the absence of glutathione
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
209
structure length
192
Chain Sequence
PPYTVVYFPVRGRAALRMLLADQGQSWKEEVVTQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
total genus 75
structure length 192
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dakB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dakB01
1LJRA 1O81A 3KH7A 3ZZXA 4WF4A 3G9BA 2MMZA 4IKHA 3TKSE 2AV4A 1S3DA 2OE3A 2YZUA 3DWVA 2K18A 1DSBA 4TXOA 3TOTA 3HVSA 1Y25A 4ZB8A 3EINA 1HQOA 2LV3A 2HNLA 1WE0A 2WZ9A 5FT3A 2C80A 2CVKA 2H01A 4L0WA 4KSMA 1FO5A 3CYNA 1XW9A 1YZXA 4TN8A 5D9XA 1TKDB 2OACA 3CTGA 1T3BA 2FWHA 5HR2A 4MJBA 1VF3A 3GMFA 2DJ1A 5KN0A 3IOSA 4OFMA 3IV4A 3VFIA 3ZMLA 1A2JA 2XBIA 2IMDA 1TRSA 4GTUA 1OC9A 2L6DA 2A2RA 6GSTA 4RUVA 1XBSA 4EUYA 2HZEB 3TJJA 1YEXA 5CRHA 3CBUA 3VURA 2EIQA 2H71A 3GA4A 5ECOB 1AQXA 3A2XA 6GSSA 1GH2A 1XZOA 2H0HA 3L4NA 3ERGA 3R2QA 4XIHA 5CRDA 4RQXA 3M9JA 2VLUA 3Q18A 1ZOFA 3W6GA 1B8XA 1WWJA 2H75A 1YF0A 1SK1A 2IFQA 2WB9A 5HFGA 2HSHA 4RQRA 3M9KA 1EGRA 1IYIA 2ON7A 3W8SA 3MDKA 5EL8A 1Z7PA 2G2QA 5DVBA 3FYGA 3QAVA 1IYHA 1GULA 5AISA 22GSA 3EWLA 3C1SA 3E3EA 2KLXA 3QFBC 3ZTLA 2RLIA 1TDIA 4WXTA 3RPNA 1TK0B 3KEBA 4O7HA 1XCCA 4ECCA 3IK9A 1XWAA 1Z6NA 1PL1A 2I4AA 2FA8A 2GSSA 2GT5A 5IMVA 4WBJA 2GGTA 1K0BA 3EMPA 5DALA 3IBHA 1SU9A 3WGXA 3S9FA 3TJFA 4BWSA 1AXDA 2L6CA 1UVZA 2CAQA 1ERUA 1U3IA 3D22A 1WOUA 4ZXGA 3TUEA 1XWKA 4F0CA 4IQAA 1ZMAA 1T4YA 1RK4A 1GUKA 1JLVA 3TJGA 4Q5FA 1I9DA 2FNOA 1G7EA 4IS0A 1UN2A 2LS5A 3C7MA 2YANA 1V57A 1XOAA 2FHEA 4TR3A 1DE1A 2YV9A 2NBSA 5IOWA 3F4TA 2MBTA 4RI7A 2WGRA 3UBLA 3TOUA 2GQLA 2AJQB 4NV2A 2IJYA 1AW9A 1GTBA 4JU5A 2O87A 4LL4B 2C3QA 4PNFA 3HJMA 4FYUA 1F2EA 3A3TA 2X8HA 2PVOC 3G7YA 4J56E 4MDCA 3W8JA 2V6OA 2C3TA 4N10A 2XHFA 4WR5A 3VK9A 2E2MA 4OMVA 4X1UA 1EWXA 1M2AA 1MDKA 1YEPA 2PGTA 1BX9A 3HCZA 4XHMA 3IAS2 5ECIB 2L4CA 2E2GA 3LJRA 4KE3A 5ECHB 1O8XA 1M0UA 1Z5YE 3L0HA 3I6AA 3VLNA 3KP9A 2CAIA 3D0ZA 4K0NA 3L78A 5FWGA 4E8HA 2RM6A 4IELA 4MH2A 2HXKA 2IMEA 1UA5A 4GWRA 5HR1A 1XWCA 3GYKA 1SJZA 4KCEA 4EDZA 2MMNA 4IVFA 2HLSA 3US3A 2H1AA 5ECRB 1BYEA 1USBA 1J08A 2NDOA 2AYTA 1GNEA 1VF2A 2PERA 2I81A 3ZRDA 2HQTA 4AJ8A 4HU7A 4G0LA 2ALBA 2VD1A 5A5KA 2IPAA 1X5EA 4OFNA 3QPMA 1G6YA 3GRXA 4I5QA 2FCHA 5ELAA 2HRKB 1SD8A 1PMTA 4XRAA 2VM2A 3CSHA 3F4RA 4XCSA 1XVWA 1MDJA 1B9XC 1AQVA 3CSJA 3KIJA 5D8IA 1F9MA 1TXXA 2VM1A 3CSIA 3GV1A 2OBIA 2KUCA 5CRGA 1RW1A 3O6TA 3EC3A 2M80A 4PUAA 3I9V2 4ZB9A 2H72A 1BEDA 4V1Ap 2H8LA 2V41A 3TRXA 4JR4A 1GTUA 4IJ3A 5LD0A 2DIZA 11GSA 5G30A 3H79A 1K3LA 4ZBAA 2HZEA 1V2AA 3DGQA 2MYGA 4OCFA 4PUFC 5G2ZA 2YJ7A 2O85A 2A4VA 3ME7A 4P3YB 4D73B 2O7KA 4HZ2A 1SKRB 5IM9A 3WYWA 3IA1A 2YPMA 6GSVA 2YN1A 4Q5QA 4EXJA 3GX0A 1ST9A 1DUGA 1H75A 1T1VA 3F0IA 4X0XA 1OC8A 3TKPA 2KHPA 2YNXA 2GS3A 4KUNA 1GLQA 2XPDA 3IPZA 3EU4A 4ML6A 4ECBA 2LJKA 3D4TA 4FIWA 5CP1A 2XBQA 4GSTA 1SK2A 1YF1A 2X8CA 1AQWA 4K7OA 5B8BA 1B4PA 1ON4A 5DAKB 3APSA 1EGOA 4FYCA 2OADA 4NAXA 3QFAC 4K1FA 4AGSA 2WDUA 1TRVA 3WD6A 3ERWA 2HRFA 1FHEA 4MF5A 4TW5A 2BJXA 3BJ5A 1MD3A 3ZIJA 3L9SA 5AN1A 3U5RE 2PMTA 2JZSA 3KM6A 2DC5A 2DJJA 3RPPA 1WRYA 2OE1A 5IO0A 1NSWA 3F4SA 4ZBBA 4ZB6A 5DQYA 2FY6A 2BTOT 3ZYWA 4PGTA 3IHQA 5JWRB 4QL7A 4KNDA 3CRUA 4NHZA 2H19A 1TW9A 3F6DA 2B1LA 5D73A 1H4OA 4F9ZA 3HVVA 1A0FA 4F03A 5BMUA 3PH9A 4GXZA 5F0GA 3ZFBA 2FD3A 3ZIVA 2FWGA 3GSTA 3ED3A 5EVOA 3HZ4A 5C04A 2XPEA 4IQ1A 4TRXA 2GZYA 3Q19A 5A4UA 3BCKA 5DJMA 1EP8A 5IMAA 5B8AA 2QC7A 2M46A 4PQHA 3FR6A 2HE3A 3CXGA 3O76A 2R2JA 2JZRA 2TRCP 2C4JA 3O3TA 1GSDA 1B48A 2HSYA 4MJCA 3GUSA 4CW9A 5FHIA 1R26A 2RUFA 3HJOA 1K0AA 3ZFLA 5IOXA 2PUKC 1URMA 2EIRA 2QSIA 4EVMA 3PGTA 2DJ0A 2R3XA 3ZREA 2VOCA 2A2SA 3HYPA 3BBYA 5IPHA 2HRKA 4TR0A 1THOA 1Z3EA 2O89A 4NWYA 2RM5A 1GSSA 2JU5A 5F05A 3C1RA 4EO3A 3FZ9A 2F8FA 1XPVA 1KTEA 3V1WA 2WCIA 1QXHA 1EV9A 1EEMA 1K0NA 4GCIA 3P90A 3FK8A 2QKEA 3P2AA 3Q74A 3GNJA 1GTAA 2DIYA 1SENA 3D21A 5H5SA 1PL2A 3QDNA 3CTFA 2MBSA 2H0IA 2R5GA 3TKRA 3I69A 3WT1A 4ULXA 2YWOA 4D73A 3WT2A 2R6KA 3QCPA 1SL1B 4DVCA 2WRTA 1E6BA 2C8UA 3D6IA 4GQCA 3H93A 2B7JA 2VL3A 1BG5A 3GKNA 5COHA 5CRWA 3J7Yk 4KX4A 5EPFA 5GAPD 3LEFA 1QGVA 4OD7A 5DDLA 4HJ2A 1V98A 1Z7RA 1EEJA 2LTKA 1DBYA 3KGKA 2NTOA 2VCZA 4MABA 1R7HA 4V2LA 1ZZYA 2GTUA 5D9VA 1YQ1A 3LGCA 1EV4A 2OJLA 4DEJA 1ILOA 6GSUA 1X9WB 4FO5A 3LXZA 2CX3A 3HJPA 3F9UA 4I2TA 4LMWA 4FH8A 2LRTA 5LNKe 3KD0A 3JCML 4HQZA 4XS4B 5G5FA 4IHUA 5DAKA 2WJUA 2AUVA 4K9ZA 3VWWA 1GNWA 4YAPA 2B6MA 1XWBA 2L57A 4QL9A 5IIZA 2OBKA 2KOKA 2KP1A 4PQ1A 4G0KA 1VGLA 3TJKA 2HZFA 2H76A 2ZUPA 1SL0B 3ZVJA 1YKCA 2B7KA 3I43A 5AIXA 2VCQA 3MWHA 1HYUA 2IWTA 2V2GA 3IAM2 4HZ4A 2CV4A 2HI7A 1F6MC 5CNWA 2AB6A 1Z6MA 4NMUA 4GRFA 2K8VA 4POBA 2H1GA 4MZBA 1GSUA 3ZL5A 1TJDA 2WFCA 4I2UA 2LUSA 2QGVA 4TOPA 2VCVA 5IMCA 5IMFA 3SBCA 5E59A 1R5PA 1GUHA 2VAFA 4TKYA 3GH6A 4BWQA 3FRCA 1OE8A 1U6TA 2H6YA 2MMAA 2GQKA 5G1LA 5B6MA 3ME8A 2DMMA 1OE7A 3KCMA 2RUEA 1EP7A 1N8JA 2F51A 3LYPA 2I3YA 2IL3A 3HZ8A 4IGJA 3FY7A 3CMIA 4KDUA 5GAND 4K7NA 2DSAA 4YQMA 4GQFA 2UZ8A 5F06A 4XS1A 4POMA 3TB2A 2JADA 1ERVA 4O92A 1MTCA 4JE1A 1WMJA 4KDYA 2H6ZA 2REMA 1UC7A 2HSMA 1ERTA 1PKWA 2LKUA 1M2BA 1VF4A 3QMXA 4F82A 1GP1A 2IMIA 5ENUA 3EU3A 1XIYA 3GH9A 4OCEA 3FW2A 2RIIA 1JHBA 3TGZA 2D2ZA 5DCGA 1G6WA 3FR3A 5C00A 3MNGA 4MCUA 1KBNA 3R3EA 4GSSA 2YWIA 2C0GA 2FA4A 2FWEA 1MD4A 4AJ7A 1HD2A 2XC2A 2JSYA 3IC8A 5JWQB 3QR6A 3GFKA 1YY7A 5ECMB 1ERWA 4NXIA 2B5YA 4XS6A 1O6JA 1AIUA 2VIMA 3GURA 1Z9HA 4ZILA 1PSQA 5DJLA 3HHVA 4GSNA 2F8AA 3M8NA 4USSA 4O32A 2GSQA 5ECSA 2R37A 4MF7A 1WPIA 4CHSA 2L4QA 1PX7A 3PINA 4LMVA 3RBTA 2L5LA 4LL1B 5JCGA 1U88A 2GDRA 3UAPA 1TK5B 4ZL7A 1V40A 4LA1A 2BMXA 1I5GA 3TKQA 2FGXA 2MZCA 2VCXA 5B7CA 2FUG2 3PR8A 1BAYA 4YAVA 3J7Yb 4MPGA 1GLPA 1F37A 4ECJA 2PN8A 3IRAA 2JACA 5F07A 1AC1A 4KA0A 3DRNA 1XOBA 1MEKA 5F8BA 1SKSB 4WF5A 3GHAA 2CQ9A 2OKAA 2P31A 2TRXA 4WETA 1B4QA 2VLTA 1HNBA 1SJ6A 2B1KA 4QQ7A 2LNSA 5HQPA 2OA7A 2GZPA 3IC4A 3DXBA 1EOHA 2B5XA 3BD2A 4HQSA 5D9TA 4MH3A 3ZVJD 1W89A 5AGYA 4WKWA 1PKZA 5ECKB 13GSA 1ML6A 4XS4A 2N5FA 3TKSA 4N0ZA 2VO4A 1ACVA 3FR9A 4BL7B 3EVIA 3DKSA 1ABAA 2O8VB 1XXUA 5E4WA 3TKSC 4V1Ag 5ID2A 3GSSA 2JSZA 1T4ZA 1JZDA 1FG4A 3GKKA 4HOJA 4OO4A 1Q4JA 4K0GA 4ECIA 3FZ5A 3LORA 2F3MA 4EF0A 4MZWA 3TJBA 2EC4A 3GIXA 4HI7A 3VWXA 1JZOA 1SL2B 5ECLB 1A24A 1XFLA 3KH9A 5CAXA 4XTSA 4I97A 4IJIA 2ZCTA 3F6FA 3HD5A 1GTIA 5GZZB 2E7PA 2J9HA 1NHYA 3MSZA 4IBPA 4HU9A 3WGDA 4AJ6A 2H30A 3UMAA 3N5OA 4V2MA 2H70A 3APOA 4DSRA 1SK0A 3ZITA 2GT6A 1ZGNA 2K9FA 4ILFA 1O8WA 2V6KA 1TTZA 14GSA 1O85A 4O5RA 4JR6A 4KDXA 3WGEA 5EY6A 3GKMA 2VL9A 3HDCA 1PA3A 4ZIJA 3A2WA 3DMLA 3UL3A 4H86A 3FHKA 4NPBA 1Y6EA 1JZRA 4POLA 1GSFA 2AAWA 5D96A 2YCDA 4E8EA 2VD0A 3VWVA 1VRSD 1TRUA 1PGTA 1TOFA 2CVBA 1M99A 1FAAA 2OE0A 5ELGA 2TIRA 5HFKA 2HYXA 3AY8A 4FYBA 1Q98A 3M3MA 1OKTA 1NHOA 2F9SA 5J3RA 1KEBA 2HSMB 1GL8A 6GSYA 3GTUA 4JRRA 5KN2A 2LNTA 1LBKA 2IN3A 3QAGA 4ID0A 1X9MB 2AHEA 2HFDA 3VI7A 2KP2A 1M9AA 2K8SA 4JZQA 5IPGA 3GL5A 1K3OA 1JFUA 1DE2A 1XVQA 5INYA 2ON5A 3VPTA 1X0RA 1FB6A 4N0VA 4YQVA 1K0OA 5D93A 4MJAA 1CQGA 4GF0A 1HNCA 1R5AA 1OC3A 5A4VA 3TRPA 4FQUA 20GSA 1O73A 1THXA 1XWGA 5AIVA 4DSSB 2N5BA 3APQA 2GSRA 4JEDA 1OKDA 4BPYA 2VUPA 5JCWA 2P5QA 2ZNMA 4AF2A 3HY2A 1SJIA 1SD9A 5IQYA 1OVNA 3C8EA 4NHWA 3IK7A 3DIEA 2H1BA 4BVYB 3GKXA 4KB3A 3EYTA 4PX1A 1T8EB 2YP6A 4Z7XA 3FZAA 4ZL8A 1FVJA 1QQ2A 1S3AA 1EOGA 18GSA 1GWCA 1W4VA 4OFTA 4IP1A 3PPUA 1WJKA 1LU4A 4BVXB 2C3NA 3DYRA 1GUMA 2CT6A 3ISOA 1T7PB 1RQMA 2GQMA 3HXSA 2VCTA 3UARA 4EC0A 5IMDA 5GSTA 3K8NA 3LFLA 3EMXA 1OAZA 2ES7A 1YKAA 1PD21 4EDYA 3DVXA 2J23A 2HRNA 3LQ7A 4G10A 4EE0A 1V58A 4Q5RA 4BL7A 4L8EA 1K0DA 1PRXA 12GSA 5ID2B 5G5EA 5G1KA 1PX6A 3ERFA 1V9WA 2C1YA 2WS2A 2NPBA 2L59A 2N5AA 3HVXA 4MPFA 16GSA 1TP9A 1A8LA 1AUCA 5LCZA 2H74A 3VI5A 10GSA 2EIOA 5CO3A 3TDGA 1B9YC 3NOFA 1O7UA 5KN1A 4K7IA 3M1GA 9GSSA 1M2DA 2LRCA 3F3RA 4X43A 3C73A 4MF6A 3FEUA 2L5OA 2JL4A 5HR0A 3BOAA 4MJEA 3IDVA 4V2NA 3BCIA 2E0QA 3OR5A 4MA9A 2V32A 6GSWA 2VLVA 1GSYA 1SYXA 4POKA 3LG6A 4WR4A 4JBBA 1FW1A 2FLSA 5G31A 1VF1A 3KJYA 2CZ2A 3UBKA 2CX4A 4MK3A 3U6VA 1QMVA 4TR1B 1A0RP 2HSNB 5JCUA 5DCHA 3UOMA 5ECQB 3RAZA 2P5RA 1GSEA 1U3AA 5J9CA 1TK8B 4HS1A 2C0EA 3E0UA 2LJAA 3A2VA 4CDOA 1E2YA 3TRQA 8GSSA 4XRDA 3HKRA 3L9VA 5KN3A 2X99A 4I6XA 2YZHA 4YQUA 2C0DA 1GRXA 2PU9C 1GSQA 3KTBA 5J9BA 3CRTA 4HEA2 5L71A 1PN9A 2Z9SA 2H66A 3GTUB 1S3CA 17GSA 2YV7A 2LRNA 5ABRA 5D9WA 3H1NA 1BJXA 1X5CA 4KW6A 2MMOA 2H0GA 3F8UA 4KGIA 2PPTA 4I8BA 2C0FA 3E9JB 2LSTA 3UIWA 5KEJA 4TXVA 4KAEA 2DJKA 2FWFA 3GX8A 2X64A 1X5DA 4DSQA 1A2MA 4NV5A 1KNGA 4ISDA 4HDEA 1X9SB 4OO5A 1A8YA 1ZL9A 3EE2A 2LQQA 5ECPB 5J5NA 5CREA 2IMKA 1OYJA 4TXOB 4DSSA 1J9BA 1FOVA 1HNAA 4G19A 5J4UA 1G0TA 1PQNA 1U87A 3SWLA 3UVHA 2H6XA 4KSOA 2GZZA 2LQOA 2P0GA 2YOIA 3F63A 1NW2A 2VL2A 4WBRD 3LYKA 2B5EA 4K2DA 2K6VA 1TU8A 5HFIA 1FB0A 2VL2C 5CYYA 4IW9A 1AAZA 3HA9A 1XW5A 4BVYA 2GSTA 5GSSA 1F3BA 2DMLA 4LLRA 4F0BA 1JZWA 4PXOA 4TVEA 7GSSA 2CVDA 3DD3A 4ZBDA 1QK8A 4J2FA 1OC9B 3KP8A 1J0FA 4KH7A 3F3QA 2V1MA 5DQSA 1R4WA 3RHCA 4BVXA 2HT9A 3G7JA 2I9HA 2LJRA 1SYRA 2YWNA 5DBQA 4GLTA 5J41A 2WULA 4MMMA 3KTLA 3IE3A 2H1DA 3UVTA 3P8WA 2VCWA 5H5RA 1ZYQB 2X8GA 3UJ1A 4N30A 3M0FA 2GLRA 4YH2A 4PQIA 1K0MA 3GN3A 2G0FA 3P7XA 4ZL9A 3D4MA 4K6XA 2IFQB 4MP4A 4Q5NA 5B6NA 1TI1A 5A4WA 2M72A 1A23A 4ACSA 4K8MA 3G7IA 5ECNB 3KZQA 4G9HA 1QUWA 4WEYA 3L9UA 4G0IA 3ZLPA 1WP0A 2CA8A 1TU7A 1WIKA 3KMNA 4PNGA 1BQ7A 1YDKA 4G2EA 3QAWA 3RHBA 4KF9A 3DEXA 5DALB 3NIVA 3VWUA 5JWOB 4PTSA 2NVLA 1QFNA 3MAKA 3A5WA 2I1UA 3D5JA 4L5LA 3RDWA 3ZMKA 3EURA 2IIYA 2B3SA 4L5OA 1MDIA 4MZCA 1F3AA 2JZTA 1TRWA 3KXOA 4IP6A 2CZ3A 1N2AA 3LWAA 3FKFA 3NZNA 6GSXA 2PVQA 1C72A 3H4KA 4L0UA 2YJHA 2R4VA 2IMFA 3TCOA 4TR1A 1G7OA 4EKZA 3C71A 1M9BA 5IO2A 4F2IA 2YWMA 1ZYEA 3H8QA 5IMZA 1K3YA 3LXTA 3LSZA 4HJMA 4IN0A 4OWYA 1YJ6A 1EZKA 3IR4A 3Q6OA 1SKWB 1XW6A 2PWJA 3UEMA 5H5QA 1CQHA 4EL1A 4PURA 3N9JA 5HR3A 4BA7A 1FVKA 4TR4A 3GL3A 2DLXA 2GVPA 19GSA 1T00A 1JLWA 3DVWA 2LEGA 4MLYA 1A2LA 4ML1A 2H73A 4HUAA 2DJ3A 1M7TA 1NM3A 3VPQA 3QOUA 3KMOA 2DBCA 4KCAA 2PBJA 2HRAA 1TI3A 4RI6A 4J57E 1K0CA 3QD9A 3IXRA 1ZCPA 3FZ4A 2DJ2A 4N11A
chains in the Genus database with same CATH superfamily
1LJRA 1O81A 3KH7A 3ZZXA 4WF4A 3G9BA 2MMZA 4IKHA 3TKSE 2AV4A 1S3DA 2OE3A 2YZUA 3DWVA 2K18A 1DSBA 4TXOA 3TOTA 3HVSA 1Y25A 4ZB8A 3EINA 1HQOA 2LV3A 2HNLA 1WE0A 2WZ9A 5FT3A 2C80A 2CVKA 2H01A 4L0WA 4KSMA 1FO5A 3CYNA 4Z2UA 1XW9A 1YZXA 4TN8A 5D9XA 1TKDB 2OACA 3CTGA 1T3BA 4ZB7A 2FWHA 5HR2A 4MJBA 1VF3A 3GMFA 2DJ1A 5KN0A 3IOSA 4OFMA 3IV4A 3VFIA 3ZMLA 1A2JA 2XBIA 2IMDA 2EFHA 1TRSA 4GTUA 1OC9A 2L6DA 2A2RA 6GSTA 4RUVA 1XBSA 4EUYA 2HZEB 3TJJA 1YEXA 5CRHA 2A2PA 3CBUA 3VURA 2EIQA 2H71A 3GA4A 5ECOB 1AQXA 3A2XA 4G01A 6GSSA 1GH2A 1XZOA 2H0HA 3L4NA 3ERGA 3R2QA 4XIHA 5CRDA 4RQXA 3M9JA 2VLUA 3Q18A 1ZOFA 3W6GA 1B8XA 1WWJA 2H75A 2H1LA 4O5QA 1YF0A 1SK1A 4QMKA 2IFQA 2WB9A 4PI0C 5HFGA 2HSHA 4RQRA 3M9KA 1EGRA 1IYIA 2ON7A 3W8SA 3MDKA 5EL8A 1Z7PA 2G2QA 5DVBA 3FYGA 3QAVA 1IYHA 1GULA 5AISA 22GSA 3EWLA 3C1SA 3E3EA 2KLXA 3QFBC 3ZTLA 2RLIA 1TDIA 4WXTA 3RPNA 1TK0B 3KEBA 4O7HA 1XCCA 4ECCA 3IK9A 1XWAA 1Z6NA 1PL1A 2I4AA 2FA8A 2GSSA 2GT5A 5IMVA 4WBJA 2GGTA 1K0BA 3EMPA 5DALA 3IBHA 1SU9A 3WGXA 3S9FA 3TJFA 4BWSA 1AXDA 2L6CA 1UVZA 2CAQA 1ERUA 1U3IA 3D22A 1WOUA 4ZXGA 3TUEA 1XWKA 4F0CA 4IQAA 1ZMAA 1T4YA 1RK4A 3CQFA 1GUKA 1JLVA 3TJGA 4Q5FA 1I9DA 2EFDA 2FNOA 1G7EA 4IS0A 1UN2A 2LS5A 3C7MA 2YANA 1V57A 1XOAA 2FHEA 4TR3A 1DE1A 2YV9A 2NBSA 5IOWA 3F4TA 2MBTA 4RI7A 2WGRA 3UBLA 3TOUA 3CHXC 2GQLA 2AJQB 4NV2A 2IJYA 1AW9A 1GTBA 4AI6A 2R0CA 4JU5A 2WVYA 2X4AA 2O87A 4LL4B 2C3QA 4PNFA 3HJMA 4FYUA 5BMUB 1F2EA 3A3TA 2X8HA 2PVOC 3G7YA 4J56E 4MDCA 3W8JA 2V6OA 2C3TA 4N10A 2XHFA 4WR5A 3VK9A 2E2MA 4OMVA 4X1UA 1EWXA 1M2AA 1MDKA 1YEPA 2PGTA 1BX9A 3HCZA 4XHMA 3IAS2 3RFRC 5ECIB 2L4CA 2E2GA 3LJRA 4KE3A 5ECHB 1O8XA 1M0UA 1Z5YE 3L0HA 3I6AA 3VLNA 3KP9A 2CAIA 3D0ZA 4K0NA 3L78A 5FWGA 4E8HA 2RM6A 4IELA 4MH2A 2HXKA 2IMEA 1UA5A 4GWRA 5HR1A 1XWCA 3GYKA 1SJZA 4KCEA 4EDZA 2MMNA 4IVFA 2HLSA 3US3A 2H1AA 5ECRB 1BYEA 1USBA 1J08A 2NDOA 2AYTA 1GNEA 1VF2A 2PERA 2I81A 3ZRDA 2HQTA 4AJ8A 4HU7A 4G0LA 2ALBA 2VD1A 5A5KA 2IPAA 1X5EA 4OFNA 3QPMA 1G6YA 3GRXA 4I5QA 2FCHA 2EFCA 5ELAA 2HRKB 1SD8A 1PMTA 4XRAA 2VM2A 3CSHA 3F4RA 1TXUA 4XCSA 1XVWA 1MDJA 1B9XC 4X4JA 1AQVA 3CSJA 3KIJA 5D8IA 1F9MA 4Z2TA 1TXXA 2VM1A 3CSIA 3GV1A 2OBIA 2KUCA 5CRGA 1RW1A 3EC3A 3O6TA 2M80A 4PUAA 3MIXA 3I9V2 4ZB9A 2H72A 1BEDA 4V1Ap 2H8LA 2V41A 3HVNA 3TRXA 4K5SA 4JR4A 1GTUA 4IJ3A 5LD0A 2DIZA 11GSA 5G30A 3H79A 1K3LA 4ZBAA 2HZEA 1V2AA 3DGQA 2MYGA 4OCFA 4PUFC 5G2ZA 2YJ7A 2O85A 2A4VA 3ME7A 4P3YB 4D73B 2O7KA 4HZ2A 1SKRB 5IM9A 3WYWA 3IA1A 2YPMA 4BIKA 6GSVA 2YN1A 4Q5QA 4EXJA 3GX0A 1ST9A 1DUGA 1H75A 1T1VA 1BF5A 3F0IA 4X0XA 1OC8A 3TKPA 2KHPA 2YNXA 2GS3A 4KUNA 1GLQA 2XPDA 3IPZA 3EU4A 4ML6A 4ECBA 2LJKA 3D4TA 4FIWA 5CP1A 2XBQA 4GSTA 1SK2A 2WW3A 1YF1A 2X8CA 1AQWA 4K7OA 5B8BA 1B4PA 4A5PA 1ON4A 5DAKB 3APSA 1EGOA 4FYCA 2OADA 4NAXA 2WW0A 3QFAC 4K1FA 4AGSA 2WDUA 1TRVA 3WD6A 3ERWA 2HRFA 1FHEA 4MF5A 4TW5A 2BJXA 3BJ5A 1MD3A 3ZIJA 3L9SA 5AN1A 3U5RE 2PMTA 4E68A 3KM6A 2JZSA 2DC5A 2DJJA 3RPPA 1WRYA 2OE1A 5IO0A 1NSWA 4EIPA 3F4SA 4ZBBA 4ZB6A 3IHGA 5DQYA 2FY6A 2BTOT 3ZYWA 4PGTA 3IHQA 5JWRB 4QL7A 4KNDA 3CRUA 4NHZA 2H19A 1TW9A 3F6DA 2B1LA 5D73A 1H4OA 4F9ZA 3HVVA 1A0FA 4F03A 5BMUA 3PH9A 4GXZA 5F0GA 3ZFBA 2FD3A 3ZIVA 2FWGA 3GSTA 3ED3A 5EVOA 3HZ4A 5C04A 2XPEA 4IQ1A 3TU3B 5J4YA 4TRXA 2GZYA 3Q19A 5A4UA 3BCKA 5DJMA 1EP8A 5IMAA 5B8AA 2QC7A 2M46A 4PQHA 4W66A 3FR6A 3LW9A 2HE3A 3CXGA 3O76A 2R2JA 2JZRA 2TRCP 2C4JA 3O3TA 5A5HB 1GSDA 1B48A 2HSYA 4MJCA 3GUSA 4CW9A 5FHIA 1R26A 2RUFA 3HJOA 1K0AA 3ZFLA 5IOXA 2PUKC 1URMA 2EIRA 2QSIA 4EVMA 3PGTA 2DJ0A 2R3XA 3ZREA 2VOCA 2A2SA 3HYPA 4CY8A 3BBYA 5IPHA 2HRKA 4TR0A 1THOA 1Z3EA 2O89A 4NWYA 2RM5A 2O3EA 1GSSA 2JU5A 5F05A 3C1RA 4EO3A 3FZ9A 2F8FA 1XPVA 1KTEA 3V1WA 2WCIA 1QXHA 1EV9A 1EEMA 1K0NA 4GCIA 3RGBC 3P90A 3FK8A 2QKEA 3P2AA 3Q74A 3GNJA 1GTAA 4AKGA 2DIYA 1SENA 3D21A 5H5SA 1PL2A 3QDNA 3CTFA 2MBSA 2H0IA 2R5GA 3TKRA 3I69A 3WT1A 4ULXA 2YWOA 4D73A 3WT2A 2R6KA 3QCPA 1SL1B 4DVCA 2WRTA 1E6BA 2C8UA 3D6IA 4GQCA 3H93A 2B7JA 2VL3A 3A5IA 1BG5A 3GKNA 5COHA 5CRWA 3J7Yk 4KX4A 5EPFA 5GAPD 3LEFA 1QGVA 4OD7A 5DDLA 4HJ2A 1V98A 1Z7RA 1EEJA 2LTKA 1DBYA 3KGKA 2NTOA 2VCZA 4MABA 1R7HA 4V2LA 1ZZYA 2GTUA 5D9VA 1YQ1A 3LGCA 1EV4A 2OJLA 4DEJA 1ILOA 6GSUA 1X9WB 4FO5A 3LXZA 2CX3A 3HJPA 3F9UA 4I2TA 2UV8G 1N25A 4LMWA 4FH8A 2LRTA 5LNKe 3KD0A 3JCML 4HQZA 4XS4B 5G5FA 4IHUA 5DAKA 2WJUA 2AUVA 4K9ZA 3VWWA 2DKHA 1GNWA 4YAPA 2B6MA 1XWBA 2L57A 5J40A 4QL9A 5IIZA 2OBKA 2KOKA 2KP1A 4PQ1A 1ZYPA 4G0KA 1VGLA 3TJKA 2HZFA 2H76A 2ZUPA 1SL0B 3ZVJA 1YKCA 2B7KA 3I43A 5AIXA 2VCQA 3MWHA 1HYUA 2IWTA 2V2GA 3IAM2 4HZ4A 2CV4A 2HI7A 1F6MC 1M3JA 5CNWA 2AB6A 1Z6MA 4NMUA 4GRFA 2K8VA 1SVOA 4POBA 2H1GA 4MZBA 1GSUA 3ZL5A 5A1NB 1TJDA 2WFCA 4I2UA 2LUSA 2QGVA 4TOPA 2VCVA 5IMCA 5IMFA 3SBCA 5E59A 1R5PA 1GUHA 2VAFA 4TKYA 3GH6A 4BWQA 3FRCA 1OE8A 1U6TA 2H6YA 2MMAA 2GQKA 5G1LA 5B6MA 3ME8A 2DMMA 1OE7A 3KCMA 2RUEA 1EP7A 1YVLA 1N8JA 2F51A 3LYPA 2I3YA 2IL3A 3HZ8A 4IGJA 3FY7A 3CMIA 4KDUA 5GAND 4K7NA 2DSAA 4YQMA 4GQFA 2UZ8A 5F06A 4XS1A 4POMA 3TB2A 2JADA 1ERVA 4O92A 1MTCA 4JE1A 1WMJA 4KDYA 2H6ZA 2REMA 1UC7A 2HSMA 1ERTA 5A5HA 1PKWA 2LKUA 1M2BA 1VF4A 3QMXA 4F82A 1GP1A 2IMIA 5ENUA 3EU3A 1XIYA 3GH9A 4OCEA 3FW2A 2RIIA 1JHBA 3TGZA 2D2ZA 5DCGA 1G6WA 3FR3A 5C00A 3MNGA 4MCUA 1KBNA 3R3EA 4GSSA 2YWIA 2C0GA 2FA4A 2FWEA 1MD4A 4AJ7A 1HD2A 2DKIA 2XC2A 2JSYA 3IC8A 5JWQB 3QR6A 3GFKA 1YY7A 5ECMB 1ERWA 4NXIA 1XG8A 2B5YA 4XS6A 1O6JA 1AIUA 2VIMA 3GURA 1Z9HA 5BRTA 4ZILA 1PSQA 5DJLA 3HHVA 4GSNA 2F8AA 4Z2RA 3M8NA 4USSA 4O32A 2GSQA 5ECSA 2R37A 4MF7A 1WPIA 4CHSA 2L4QA 1PX7A 3PINA 4LMVA 3RBTA 2L5LA 4LL1B 5JCGA 1U88A 2GDRA 3UAPA 1TK5B 2WVXB 4ZL7A 1V40A 4LA1A 2BMXA 1I5GA 3TKQA 2FGXA 2MZCA 2VCXA 5B7CA 2WZSA 2FUG2 3PR8A 1BAYA 4YAVA 3J7Yb 4MPGA 2QA1A 1GLPA 1F37A 4ECJA 2PN8A 4K2XA 3IRAA 2JACA 5F07A 2O5VA 1AC1A 4KA0A 3DRNA 1XOBA 1MEKA 5F8BA 1SKSB 4WF5A 3GHAA 2CQ9A 2OKAA 2P31A 2TRXA 4WETA 1B4QA 2VLTA 1HNBA 1SJ6A 2B1KA 4QQ7A 2LNSA 5HQPA 2OA7A 2GZPA 3IC4A 4PHZC 3DXBA 4AKXB 1EOHA 2B5XA 3BD2A 4HQSA 5D9TA 4MH3A 3ZVJD 1W89A 5AGYA 4WKWA 1PKZA 5ECKB 13GSA 1ML6A 4XS4A 2N5FA 3TKSA 4N0ZA 2VO4A 1ACVA 4PI2C 3CWGA 3FR9A 4BL7B 3EVIA 3DKSA 1ABAA 2O8VB 1XXUA 5E4WA 3TKSC 4V1Ag 5ID2A 3GSSA 2JSZA 1T4ZA 1JZDA 1FG4A 3GKKA 4HOJA 4OO4A 1Q4JA 4K0GA 4ECIA 1BG1A 3FZ5A 3LORA 2F3MA 4EF0A 4MZWA 3TJBA 2EC4A 5J47A 4K5RA 3GIXA 4HI7A 3VWXA 1JZOA 5A34A 1SL2B 5ECLB 1A24A 1XFLA 3KH9A 5CAXA 4XTSA 4I97A 4IJIA 5A1NA 2ZCTA 3F6FA 3HD5A 1GTIA 5GZZB 2E7PA 2J9HA 1NHYA 3MSZA 4IBPA 4HU9A 3WGDA 4AJ6A 2H30A 3UMAA 3N5OA 4V2MA 2H70A 3APOA 4DSRA 1SK0A 2OT3A 3ZITA 2GT6A 1ZGNA 2K9FA 4ILFA 1O8WA 2WVZA 2V6KA 1TTZA 4O5UA 14GSA 1O85A 4O5RA 4JR6A 4KDXA 4AKIA 3WGEA 5EY6A 3GKMA 2VL9A 3HDCA 1PA3A 4ZIJA 3A2WA 3DMLA 3UL3A 4H86A 3FHKA 4NPBA 1Y6EA 1JZRA 4POLA 1GSFA 2AAWA 5D96A 2YCDA 4E8EA 2VD0A 3VWVA 1VRSD 1TRUA 1PGTA 1TOFA 2CVBA 1M99A 1FAAA 2OE0A 5ELGA 2TIRA 5HFKA 2HYXA 3AY8A 4FYBA 1Q98A 3HMJG 3M3MA 1OKTA 1NHOA 2F9SA 5J3RA 1KEBA 2HSMB 1GL8A 6GSYA 3GTUA 4JRRA 5KN2A 2LNTA 1LBKA 2IN3A 3QAGA 4EIQA 2O36A 4ID0A 1X9MB 2AHEA 2HFDA 3VI7A 2KP2A 1M9AA 2K8SA 4JZQA 5IPGA 3GL5A 1K3OA 1JFUA 1DE2A 1XVQA 5INYA 2ON5A 3VPTA 4N3ZA 1X0RA 1FB6A 4N0VA 4AKHA 4YQVA 1K0OA 5D93A 4MJAA 1CQGA 4GF0A 1HNCA 1R5AA 1OC3A 5A4VA 3TRPA 4FQUA 20GSA 1O73A 1THXA 1XWGA 5AIVA 4DSSB 2N5BA 3APQA 2GSRA 4JEDA 1OKDA 1PN0A 4BPYA 2VUPA 5JCWA 2P5QA 2ZNMA 4AF2A 1S4BP 3HY2A 4MNNA 1SJIA 1SD9A 5IQYA 1OVNA 3C8EA 2WVXA 4NHWA 3IK7A 3DIEA 2H1BA 4BVYB 3GKXA 4KB3A 3EYTA 4PX1A 1T8EB 2YP6A 1I1IP 4Z7XA 3FZAA 4ZL8A 1FVJA 1QQ2A 1S3AA 1EOGA 1SVLA 18GSA 1GWCA 1W4VA 4OFTA 4IP1A 3PPUA 1WJKA 1LU4A 4BVXB 2C3NA 1ZYNA 3DYRA 1GUMA 2CT6A 3ISOA 1T7PB 1RQMA 2GQMA 3HXSA 2VCTA 3UARA 4EC0A 5IMDA 5GSTA 3K8NA 3LFLA 3EMXA 1OAZA 2ES7A 2WW1A 1YKAA 1PD21 4EDYA 3DVXA 2J23A 4GDFA 2HRNA 3LQ7A 4G10A 4EE0A 4FXYP 1V58A 4Q5RA 4BL7A 4L8EA 1K0DA 1PRXA 12GSA 5ID2B 5G5EA 5G1KA 1PX6A 3ERFA 1V9WA 2C1YA 2WS2A 2NPBA 2L59A 4HSCX 2N5AA 3HVXA 4MPFA 16GSA 1TP9A 1A8LA 1AUCA 5LCZA 2H74A 1S3RA 3VI5A 10GSA 2EIOA 5CO3A 3TDGA 1B9YC 5A34B 3NOFA 1O7UA 5KN1A 4K7IA 3M1GA 1SVMA 9GSSA 1M2DA 2LRCA 3F3RA 4X43A 3C73A 4MF6A 3FEUA 2L5OA 4YKFA 2JL4A 5HR0A 3BOAA 4MJEA 3IDVA 4V2NA 3BCIA 2E0QA 3OR5A 4MA9A 2V32A 6GSWA 2VLVA 1GSYA 1Y1UA 1SYXA 4POKA 3LG6A 4WR4A 4JBBA 1FW1A 2FLSA 5G31A 1VF1A 3KJYA 2CZ2A 3UBKA 2CX4A 4MK3A 3U6VA 1QMVA 4TR1B 1A0RP 2HSNB 5JCUA 5DCHA 3UOMA 5ECQB 3RAZA 2P5RA 1GSEA 1U3AA 5J9CA 1TK8B 4HS1A 2C0EA 5J4VA 3E0UA 2LJAA 3A2VA 4CDOA 1E2YA 3TRQA 8GSSA 4XRDA 3HKRA 3L9VA 5KN3A 2X99A 4I6XA 2YZHA 4YQUA 2C0DA 1GRXA 2PU9C 1GSQA 3KTBA 5J9BA 2X49A 3CRTA 4HEA2 1M3IA 5L71A 1PN9A 2Z9SA 2H66A 3GTUB 1S3CA 17GSA 2YV7A 2LRNA 5ABRA 5D9WA 3H1NA 1BJXA 1X5CA 4KW6A 2MMOA 2H0GA 3F8UA 4KGIA 2PPTA 4I8BA 1PFOA 2C0FA 3E9JB 2LSTA 3UIWA 5KEJA 4TXVA 4KAEA 2DJKA 2FWFA 3GX8A 2X64A 1X5DA 4DSQA 1A2MA 4NV5A 1KNGA 4ISDA 4HDEA 1X9SB 4CY6A 4OO5A 2R0GA 1A8YA 1ZL9A 3EE2A 2LQQA 5ECPB 5J5NA 5CREA 2IMKA 1OYJA 4TXOB 4DSSA 1J9BA 1FOVA 1HNAA 4G19A 5J4UA 1G0TA 1PQNA 1U87A 3SWLA 3UVHA 2H6XA 4KSOA 2GZZA 2LQOA 2P0GA 2YOIA 3F63A 1NW2A 2VL2A 4WBRD 3LYKA 2B5EA 4K2DA 2K6VA 1TU8A 5HFIA 1FB0A 2VL2C 5CYYA 4YKGA 4IW9A 1AAZA 3HA9A 1XW5A 4BVYA 2GSTA 5GSSA 1F3BA 2DMLA 4LLRA 4F0BA 1JZWA 4PXOA 4TVEA 7GSSA 3EPTA 2CVDA 3DD3A 4ZBDA 1QK8A 2VKZG 4J2FA 1OC9B 3KP8A 1J0FA 4KH7A 3F3QA 2V1MA 5DQSA 1FOHA 1R4WA 3RHCA 4BVXA 2HT9A 3G7JA 2I9HA 2LJRA 1SYRA 2YWNA 5DBQA 4GLTA 5J41A 2WULA 4MMMA 3KTLA 3IE3A 2H1DA 3UVTA 3P8WA 2VCWA 5H5RA 1ZYQB 2X8GA 3UJ1A 4N30A 3M0FA 2GLRA 4YH2A 4PQIA 1K0MA 3GN3A 2G0FA 3P7XA 4ZL9A 3D4MA 4K6XA 2IFQB 4MP4A 4Q5NA 5B6NA 1TI1A 5A4WA 2M72A 1A23A 4ACSA 4K8MA 3G7IA 5ECNB 3KZQA 4G9HA 1QUWA 4WEYA 3L9UA 4G0IA 3ZLPA 1WP0A 4ICYA 2CA8A 1TU7A 1WIKA 5KOWA 3KMNA 4PNGA 1BQ7A 1YDKA 4G2EA 3QAWA 3RHBA 4KF9A 3DEXA 5DALB 3NIVA 3VWUA 5JWOB 4PTSA 2NVLA 1QFNA 3MAKA 3A5WA 2I1UA 3D5JA 4L5LA 3RDWA 3ZMKA 3EURA 2IIYA 2B3SA 4L5OA 1MDIA 4MZCA 1F3AA 2JZTA 1TRWA 3KXOA 4IP6A 2CZ3A 1N2AA 3LWAA 3FKFA 3NZNA 6GSXA 2PVQA 1C72A 3H4KA 4L0UA 2YJHA 2R4VA 2IMFA 3TCOA 4TR1A 1G7OA 2R0PA 2HSNA 4EKZA 3C71A 1M9BA 5IO2A 4F2IA 2YWMA 1ZYEA 3H8QA 5IMZA 1K3YA 3LXTA 2QA2A 2A4HA 3LSZA 4HJMA 4IN0A 4OWYA 1YJ6A 1EZKA 3IR4A 3Q6OA 1SKWB 1XW6A 2PWJA 3UEMA 3FMWA 5H5QA 1CQHA 4EL1A 4PURA 3N9JA 5HR3A 1YEWC 4BA7A 1FVKA 4TR4A 3GL3A 2DLXA 2GVPA 19GSA 5KOXA 1T00A 1JLWA 3DVWA 2LEGA 4MLYA 1A2LA 4ML1A 2H73A 4HUAA 2DJ3A 1M7TA 1NM3A 3VPQA 2WW2A 3QOUA 3KMOA 3MYDA 2DBCA 4KCAA 2PBJA 2HRAA 1TI3A 4RI6A 4J57E 1K0CA 3QD9A 3IXRA 1ZCPA 2EFEA 3FZ4A 2DJ2A 4N11A
chains in the Genus database with same CATH topology
1LJRA 1O81A 3KH7A 3ZZXA 4WF4A 3G9BA 2MMZA 4IKHA 3TKSE 2AV4A 1S3DA 2OE3A 2YZUA 3DWVA 2K18A 1DSBA 4TXOA 3TOTA 3HVSA 1Y25A 4ZB8A 3EINA 1HQOA 2LV3A 2HNLA 1WE0A 2WZ9A 5FT3A 2C80A 2CVKA 2H01A 4L0WA 4KSMA 1FO5A 3CYNA 4Z2UA 1XW9A 1YZXA 4TN8A 5D9XA 1TKDB 2OACA 3CTGA 1T3BA 4ZB7A 2FWHA 5HR2A 4MJBA 1VF3A 3GMFA 2DJ1A 5KN0A 3IOSA 4OFMA 3IV4A 3VFIA 3ZMLA 1A2JA 2XBIA 2IMDA 2EFHA 1TRSA 4GTUA 1OC9A 2L6DA 2A2RA 6GSTA 4RUVA 1XBSA 4EUYA 2HZEB 3TJJA 1YEXA 5CRHA 2A2PA 3CBUA 3VURA 2EIQA 2H71A 3GA4A 5ECOB 1AQXA 3A2XA 4G01A 6GSSA 1GH2A 1XZOA 2H0HA 3L4NA 3ERGA 3R2QA 4XIHA 5CRDA 4RQXA 3M9JA 2VLUA 3Q18A 1ZOFA 3W6GA 1B8XA 1WWJA 2H75A 2H1LA 4O5QA 1YF0A 1SK1A 4QMKA 2IFQA 2WB9A 5HFGA 2HSHA 4RQRA 3M9KA 1EGRA 1IYIA 2ON7A 3W8SA 3MDKA 5EL8A 1Z7PA 2G2QA 5DVBA 3FYGA 3QAVA 1IYHA 1GULA 5AISA 22GSA 3EWLA 3C1SA 3E3EA 2KLXA 3QFBC 3ZTLA 2RLIA 1TDIA 4WXTA 3RPNA 1TK0B 3KEBA 4O7HA 1XCCA 4ECCA 3IK9A 1XWAA 1Z6NA 1PL1A 2I4AA 2FA8A 2GSSA 2GT5A 5IMVA 4WBJA 2GGTA 1K0BA 3EMPA 5DALA 3IBHA 1SU9A 3WGXA 3S9FA 3TJFA 4BWSA 1AXDA 2L6CA 1UVZA 2CAQA 1ERUA 1U3IA 3D22A 1WOUA 4ZXGA 3TUEA 1XWKA 4F0CA 4IQAA 1ZMAA 1T4YA 1RK4A 1GUKA 1JLVA 3TJGA 4Q5FA 1I9DA 2EFDA 2FNOA 1G7EA 4IS0A 1UN2A 2LS5A 3C7MA 2YANA 1V57A 1XOAA 2FHEA 4TR3A 1DE1A 2YV9A 2NBSA 5IOWA 3F4TA 2MBTA 4RI7A 2WGRA 3UBLA 3TOUA 2GQLA 2AJQB 4NV2A 2IJYA 1AW9A 1GTBA 4AI6A 2R0CA 4JU5A 2X4AA 2O87A 4LL4B 2C3QA 4PNFA 3HJMA 4FYUA 5BMUB 1F2EA 3A3TA 2X8HA 2PVOC 3G7YA 4J56E 4MDCA 3W8JA 2V6OA 2C3TA 4N10A 2XHFA 4WR5A 3VK9A 2E2MA 4OMVA 4X1UA 1EWXA 1M2AA 1MDKA 1YEPA 2PGTA 1BX9A 3HCZA 4XHMA 3IAS2 5ECIB 2L4CA 2E2GA 3LJRA 4KE3A 5ECHB 1O8XA 1M0UA 1Z5YE 3L0HA 3I6AA 3VLNA 3KP9A 2CAIA 3D0ZA 4K0NA 3L78A 5FWGA 4E8HA 2RM6A 4IELA 4MH2A 2HXKA 2IMEA 1UA5A 4GWRA 5HR1A 1XWCA 3GYKA 1SJZA 4KCEA 4EDZA 2MMNA 4IVFA 2HLSA 3US3A 2H1AA 5ECRB 1BYEA 1USBA 1J08A 2NDOA 2AYTA 1GNEA 1VF2A 2PERA 2I81A 3ZRDA 2HQTA 4AJ8A 4HU7A 4G0LA 2ALBA 2VD1A 5A5KA 2IPAA 1X5EA 4OFNA 3QPMA 1G6YA 3GRXA 4I5QA 2FCHA 2EFCA 5ELAA 2HRKB 1SD8A 1PMTA 4XRAA 2VM2A 3CSHA 3F4RA 1TXUA 4XCSA 1XVWA 1MDJA 1B9XC 4X4JA 1AQVA 3CSJA 3KIJA 5D8IA 1F9MA 4Z2TA 1TXXA 2VM1A 3CSIA 3GV1A 2OBIA 2KUCA 5CRGA 1RW1A 3EC3A 3O6TA 2M80A 4PUAA 3MIXA 3I9V2 4ZB9A 2H72A 1BEDA 4V1Ap 2H8LA 2V41A 3TRXA 4K5SA 4JR4A 1GTUA 4IJ3A 5LD0A 2DIZA 11GSA 5G30A 3H79A 1K3LA 4ZBAA 2HZEA 1V2AA 3DGQA 2MYGA 4OCFA 4PUFC 5G2ZA 2YJ7A 2O85A 2A4VA 3ME7A 4P3YB 4D73B 2O7KA 4HZ2A 1SKRB 5IM9A 3WYWA 3IA1A 2YPMA 6GSVA 2YN1A 4Q5QA 4EXJA 3GX0A 1ST9A 1DUGA 1H75A 1T1VA 1BF5A 3F0IA 4X0XA 1OC8A 3TKPA 2KHPA 2YNXA 2GS3A 4KUNA 1GLQA 2XPDA 3IPZA 3EU4A 4ML6A 4ECBA 2LJKA 3D4TA 4FIWA 5CP1A 2XBQA 4GSTA 1SK2A 1YF1A 2X8CA 1AQWA 4K7OA 5B8BA 1B4PA 4A5PA 1ON4A 5DAKB 3APSA 1EGOA 4FYCA 2OADA 4NAXA 3QFAC 4K1FA 4AGSA 2WDUA 1TRVA 3WD6A 3ERWA 2HRFA 1FHEA 4MF5A 4TW5A 2BJXA 3BJ5A 1MD3A 3ZIJA 3L9SA 5AN1A 3U5RE 2PMTA 4E68A 3KM6A 2JZSA 2DC5A 2DJJA 3RPPA 1WRYA 2OE1A 5IO0A 1NSWA 4EIPA 3F4SA 4ZBBA 4ZB6A 3IHGA 5DQYA 2FY6A 2BTOT 3ZYWA 4PGTA 3IHQA 5JWRB 4QL7A 4KNDA 3CRUA 4NHZA 2H19A 1TW9A 3F6DA 2B1LA 5D73A 1H4OA 4F9ZA 3HVVA 1A0FA 4F03A 5BMUA 3PH9A 4GXZA 5F0GA 3ZFBA 2FD3A 3ZIVA 2FWGA 3GSTA 3ED3A 5EVOA 3HZ4A 5C04A 2XPEA 4IQ1A 3TU3B 5J4YA 4TRXA 2GZYA 3Q19A 5A4UA 3BCKA 5DJMA 1EP8A 5IMAA 5B8AA 2QC7A 2M46A 4PQHA 4W66A 3FR6A 3LW9A 2HE3A 3CXGA 3O76A 2R2JA 2JZRA 2TRCP 2C4JA 3O3TA 5A5HB 1GSDA 1B48A 2HSYA 4MJCA 3GUSA 4CW9A 5FHIA 1R26A 2RUFA 3HJOA 1K0AA 3ZFLA 5IOXA 2PUKC 1URMA 2EIRA 2QSIA 4EVMA 3PGTA 2DJ0A 2R3XA 3ZREA 2VOCA 2A2SA 3HYPA 4CY8A 3BBYA 5IPHA 2HRKA 4TR0A 1THOA 1Z3EA 2O89A 4NWYA 2RM5A 1GSSA 2JU5A 5F05A 3C1RA 4EO3A 3FZ9A 2F8FA 1XPVA 1KTEA 3V1WA 2WCIA 1QXHA 1EV9A 1EEMA 1K0NA 4GCIA 3P90A 3FK8A 2QKEA 3P2AA 3Q74A 3GNJA 1GTAA 4AKGA 2DIYA 1SENA 3D21A 5H5SA 1PL2A 3QDNA 3CTFA 2MBSA 2H0IA 2R5GA 3TKRA 3I69A 3WT1A 4ULXA 2YWOA 4D73A 3WT2A 2R6KA 3QCPA 1SL1B 4DVCA 2WRTA 1E6BA 2C8UA 3D6IA 4GQCA 3H93A 2B7JA 2VL3A 3A5IA 1BG5A 3GKNA 5COHA 5CRWA 3J7Yk 4KX4A 5EPFA 5GAPD 3LEFA 1QGVA 4OD7A 5DDLA 4HJ2A 1V98A 1Z7RA 1EEJA 2LTKA 1DBYA 3KGKA 2NTOA 2VCZA 4MABA 1R7HA 4V2LA 1ZZYA 2GTUA 5D9VA 1YQ1A 3LGCA 1EV4A 2OJLA 4DEJA 1ILOA 6GSUA 1X9WB 4FO5A 3LXZA 2CX3A 3HJPA 3F9UA 4I2TA 2UV8G 1N25A 4LMWA 4FH8A 2LRTA 5LNKe 3KD0A 3JCML 4HQZA 4XS4B 5G5FA 4IHUA 5DAKA 2WJUA 2AUVA 4K9ZA 3VWWA 2DKHA 1GNWA 4YAPA 2B6MA 1XWBA 2L57A 5J40A 4QL9A 5IIZA 2OBKA 2KOKA 2KP1A 4PQ1A 1ZYPA 4G0KA 1VGLA 3TJKA 2HZFA 2H76A 2ZUPA 1SL0B 3ZVJA 1YKCA 2B7KA 3I43A 5AIXA 2VCQA 3MWHA 1HYUA 2IWTA 2V2GA 3IAM2 4HZ4A 2CV4A 2HI7A 1F6MC 5CNWA 2AB6A 1Z6MA 4NMUA 4GRFA 2K8VA 1SVOA 4POBA 2H1GA 4MZBA 1GSUA 3ZL5A 5A1NB 1TJDA 2WFCA 4I2UA 2LUSA 2QGVA 4TOPA 2VCVA 5IMCA 5IMFA 3SBCA 5E59A 1R5PA 1GUHA 2VAFA 4TKYA 3GH6A 4BWQA 3FRCA 1OE8A 1U6TA 2H6YA 2MMAA 2GQKA 5G1LA 5B6MA 3ME8A 2DMMA 1OE7A 3KCMA 2RUEA 1EP7A 1YVLA 1N8JA 2F51A 3LYPA 2I3YA 2IL3A 3HZ8A 4IGJA 3FY7A 3CMIA 4KDUA 5GAND 4K7NA 2DSAA 4YQMA 4GQFA 2UZ8A 5F06A 4XS1A 4POMA 3TB2A 2JADA 1ERVA 4O92A 1MTCA 4JE1A 1WMJA 4KDYA 2H6ZA 2REMA 1UC7A 2HSMA 1ERTA 5A5HA 1PKWA 2LKUA 1M2BA 1VF4A 3QMXA 4F82A 1GP1A 2IMIA 5ENUA 3EU3A 1XIYA 3GH9A 4OCEA 3FW2A 2RIIA 1JHBA 3TGZA 2D2ZA 5DCGA 1G6WA 3FR3A 5C00A 3MNGA 4MCUA 1KBNA 3R3EA 4GSSA 2YWIA 2C0GA 2FA4A 2FWEA 1MD4A 4AJ7A 1HD2A 2DKIA 2XC2A 2JSYA 3IC8A 5JWQB 3QR6A 3GFKA 1YY7A 5ECMB 1ERWA 4NXIA 2B5YA 4XS6A 1O6JA 1AIUA 2VIMA 3GURA 1Z9HA 5BRTA 4ZILA 1PSQA 5DJLA 3HHVA 4GSNA 2F8AA 4Z2RA 3M8NA 4USSA 4O32A 2GSQA 5ECSA 2R37A 4MF7A 1WPIA 4CHSA 2L4QA 1PX7A 3PINA 4LMVA 3RBTA 2L5LA 4LL1B 5JCGA 1U88A 2GDRA 3UAPA 1TK5B 4ZL7A 1V40A 4LA1A 2BMXA 1I5GA 3TKQA 2FGXA 2MZCA 2VCXA 5B7CA 2FUG2 3PR8A 1BAYA 4YAVA 3J7Yb 4MPGA 2QA1A 1GLPA 1F37A 4ECJA 2PN8A 4K2XA 3IRAA 2JACA 5F07A 2O5VA 1AC1A 4KA0A 3DRNA 1XOBA 1MEKA 5F8BA 1SKSB 4WF5A 3GHAA 2CQ9A 2OKAA 2P31A 2TRXA 4WETA 1B4QA 2VLTA 1HNBA 1SJ6A 2B1KA 4QQ7A 2LNSA 5HQPA 2OA7A 2GZPA 3IC4A 3DXBA 4AKXB 1EOHA 2B5XA 3BD2A 4HQSA 5D9TA 4MH3A 3ZVJD 1W89A 5AGYA 4WKWA 1PKZA 5ECKB 13GSA 1ML6A 4XS4A 2N5FA 3TKSA 4N0ZA 2VO4A 1ACVA 3CWGA 3FR9A 4BL7B 3EVIA 3DKSA 1ABAA 2O8VB 1XXUA 5E4WA 3TKSC 4V1Ag 5ID2A 3GSSA 2JSZA 1T4ZA 1JZDA 1FG4A 3GKKA 4HOJA 4OO4A 1Q4JA 4K0GA 4ECIA 1BG1A 3FZ5A 3LORA 2F3MA 4EF0A 4MZWA 3TJBA 2EC4A 5J47A 4K5RA 3GIXA 4HI7A 3VWXA 1JZOA 5A34A 1SL2B 5ECLB 1A24A 1XFLA 3KH9A 5CAXA 4XTSA 4I97A 4IJIA 5A1NA 2ZCTA 3F6FA 3HD5A 1GTIA 5GZZB 2E7PA 2J9HA 3MSZA 1NHYA 4IBPA 4HU9A 3WGDA 4AJ6A 2H30A 3UMAA 3N5OA 4V2MA 2H70A 3APOA 4DSRA 1SK0A 2OT3A 3ZITA 2GT6A 1ZGNA 2K9FA 4ILFA 1O8WA 2V6KA 1TTZA 4O5UA 14GSA 1O85A 4O5RA 4JR6A 4KDXA 4AKIA 3WGEA 5EY6A 3GKMA 2VL9A 3HDCA 1PA3A 4ZIJA 3A2WA 3DMLA 3UL3A 4H86A 3FHKA 4NPBA 1Y6EA 1JZRA 4POLA 1GSFA 2AAWA 5D96A 2YCDA 4E8EA 2VD0A 3VWVA 1VRSD 1TRUA 1PGTA 1TOFA 2CVBA 1M99A 1FAAA 2OE0A 5ELGA 2TIRA 5HFKA 2HYXA 3AY8A 4FYBA 1Q98A 3HMJG 3M3MA 1OKTA 1NHOA 2F9SA 5J3RA 1KEBA 2HSMB 1GL8A 6GSYA 3GTUA 4JRRA 5KN2A 2LNTA 1LBKA 2IN3A 3QAGA 4EIQA 4ID0A 1X9MB 2AHEA 2HFDA 3VI7A 2KP2A 1M9AA 2K8SA 4JZQA 5IPGA 3GL5A 1K3OA 1JFUA 1DE2A 1XVQA 5INYA 2ON5A 3VPTA 4N3ZA 1X0RA 1FB6A 4N0VA 4AKHA 4YQVA 1K0OA 5D93A 4MJAA 1CQGA 4GF0A 1HNCA 1R5AA 1OC3A 5A4VA 3TRPA 4FQUA 20GSA 1O73A 1THXA 1XWGA 5AIVA 4DSSB 2N5BA 3APQA 2GSRA 4JEDA 1OKDA 1PN0A 4BPYA 2VUPA 5JCWA 2P5QA 2ZNMA 4AF2A 3HY2A 4MNNA 1SJIA 1SD9A 5IQYA 1OVNA 3C8EA 4NHWA 3IK7A 3DIEA 2H1BA 4BVYB 3GKXA 4KB3A 3EYTA 4PX1A 1T8EB 2YP6A 4Z7XA 3FZAA 4ZL8A 1FVJA 1QQ2A 1S3AA 1EOGA 1SVLA 18GSA 1GWCA 1W4VA 4OFTA 4IP1A 3PPUA 1WJKA 1LU4A 4BVXB 2C3NA 1ZYNA 3DYRA 1GUMA 2CT6A 3ISOA 1T7PB 1RQMA 2GQMA 3HXSA 2VCTA 3UARA 4EC0A 5IMDA 5GSTA 3K8NA 3LFLA 3EMXA 1OAZA 2ES7A 1YKAA 1PD21 4EDYA 3DVXA 2J23A 4GDFA 2HRNA 3LQ7A 4G10A 4EE0A 1V58A 4Q5RA 4BL7A 4L8EA 1K0DA 1PRXA 12GSA 5ID2B 5G5EA 5G1KA 1PX6A 3ERFA 1V9WA 2C1YA 2WS2A 2NPBA 2L59A 2N5AA 3HVXA 4MPFA 16GSA 1TP9A 1A8LA 1AUCA 5LCZA 2H74A 3VI5A 10GSA 2EIOA 5CO3A 3TDGA 1B9YC 5A34B 3NOFA 1O7UA 5KN1A 4K7IA 3M1GA 1SVMA 9GSSA 1M2DA 2LRCA 3F3RA 4X43A 3C73A 4MF6A 3FEUA 2L5OA 4YKFA 2JL4A 5HR0A 3BOAA 4MJEA 3IDVA 4V2NA 3BCIA 2E0QA 3OR5A 4MA9A 2V32A 6GSWA 2VLVA 1GSYA 1Y1UA 1SYXA 4POKA 3LG6A 4WR4A 4JBBA 1FW1A 2FLSA 5G31A 1VF1A 3KJYA 2CZ2A 3UBKA 2CX4A 4MK3A 3U6VA 1QMVA 4TR1B 1A0RP 2HSNB 5JCUA 5DCHA 3UOMA 5ECQB 3RAZA 2P5RA 1GSEA 1U3AA 5J9CA 1TK8B 4HS1A 2C0EA 5J4VA 3E0UA 2LJAA 3A2VA 4CDOA 1E2YA 3TRQA 8GSSA 4XRDA 3HKRA 3L9VA 5KN3A 2X99A 4I6XA 2YZHA 4YQUA 2C0DA 1GRXA 2PU9C 1GSQA 3KTBA 5J9BA 2X49A 3CRTA 4HEA2 5L71A 1PN9A 2Z9SA 2H66A 3GTUB 1S3CA 17GSA 2YV7A 2LRNA 5ABRA 5D9WA 3H1NA 1BJXA 1X5CA 4KW6A 2MMOA 2H0GA 3F8UA 4KGIA 2PPTA 4I8BA 2C0FA 3E9JB 2LSTA 3UIWA 5KEJA 4TXVA 4KAEA 2DJKA 2FWFA 3GX8A 2X64A 1X5DA 4DSQA 1A2MA 4NV5A 1KNGA 4ISDA 4HDEA 1X9SB 4CY6A 4OO5A 2R0GA 1A8YA 1ZL9A 3EE2A 2LQQA 5ECPB 5J5NA 5CREA 2IMKA 1OYJA 4TXOB 4DSSA 1J9BA 1FOVA 1HNAA 4G19A 5J4UA 1G0TA 1PQNA 1U87A 3SWLA 3UVHA 2H6XA 4KSOA 2GZZA 2LQOA 2P0GA 2YOIA 3F63A 1NW2A 2VL2A 4WBRD 3LYKA 2B5EA 4K2DA 2K6VA 1TU8A 5HFIA 1FB0A 2VL2C 5CYYA 4YKGA 4IW9A 1AAZA 3HA9A 1XW5A 4BVYA 2GSTA 5GSSA 1F3BA 2DMLA 4LLRA 4F0BA 1JZWA 4PXOA 4TVEA 7GSSA 3EPTA 2CVDA 3DD3A 4ZBDA 1QK8A 2VKZG 4J2FA 1OC9B 3KP8A 1J0FA 4KH7A 3F3QA 2V1MA 5DQSA 1FOHA 1R4WA 3RHCA 4BVXA 2HT9A 3G7JA 2I9HA 2LJRA 1SYRA 2YWNA 5DBQA 4GLTA 5J41A 2WULA 4MMMA 3KTLA 3IE3A 2H1DA 3UVTA 3P8WA 2VCWA 5H5RA 1ZYQB 2X8GA 3UJ1A 4N30A 3M0FA 2GLRA 4YH2A 4PQIA 1K0MA 3GN3A 2G0FA 3P7XA 4ZL9A 3D4MA 4K6XA 2IFQB 4MP4A 4Q5NA 5B6NA 1TI1A 5A4WA 2M72A 1A23A 4ACSA 4K8MA 3G7IA 5ECNB 3KZQA 4G9HA 1QUWA 4WEYA 3L9UA 4G0IA 3ZLPA 1WP0A 4ICYA 2CA8A 1TU7A 1WIKA 5KOWA 3KMNA 4PNGA 1BQ7A 1YDKA 4G2EA 3QAWA 3RHBA 4KF9A 3DEXA 5DALB 3NIVA 3VWUA 5JWOB 4PTSA 2NVLA 1QFNA 3MAKA 3A5WA 2I1UA 3D5JA 4L5LA 3RDWA 3ZMKA 3EURA 2IIYA 2B3SA 4L5OA 1MDIA 4MZCA 1F3AA 2JZTA 1TRWA 3KXOA 4IP6A 2CZ3A 1N2AA 3LWAA 3FKFA 3NZNA 6GSXA 2PVQA 1C72A 3H4KA 4L0UA 2YJHA 2R4VA 2IMFA 3TCOA 4TR1A 1G7OA 2R0PA 2HSNA 4EKZA 3C71A 1M9BA 5IO2A 4F2IA 2YWMA 1ZYEA 3H8QA 5IMZA 1K3YA 3LXTA 2QA2A 2A4HA 3LSZA 4HJMA 4IN0A 4OWYA 1YJ6A 1EZKA 3IR4A 3Q6OA 1SKWB 1XW6A 2PWJA 3UEMA 3FMWA 5H5QA 1CQHA 4EL1A 4PURA 3N9JA 5HR3A 4BA7A 1FVKA 4TR4A 3GL3A 2DLXA 2GVPA 19GSA 5KOXA 1T00A 1JLWA 3DVWA 2LEGA 4MLYA 1A2LA 4ML1A 2H73A 4HUAA 2DJ3A 1M7TA 1NM3A 3VPQA 3QOUA 3KMOA 3MYDA 2DBCA 4KCAA 2PBJA 2HRAA 1TI3A 4RI6A 4J57E 1K0CA 3QD9A 3IXRA 1ZCPA 2EFEA 3FZ4A 2DJ2A 4N11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LJR A;  1O81 A;  3KH7 A;  3ZZX A;  4WF4 A;  3G9B A;  2MMZ A;  4IKH A;  3TKS E;  2AV4 A;  1S3D A;  2OE3 A;  2YZU A;  3DWV A;  2K18 A;  1DSB A;  4TXO A;  3TOT A;  3HVS A;  1Y25 A;  4ZB8 A;  3EIN A;  1HQO A;  2LV3 A;  2HNL A;  1WE0 A;  2WZ9 A;  5FT3 A;  2C80 A;  2CVK A;  2H01 A;  4L0W A;  4KSM A;  1FO5 A;  3CYN A;  1XW9 A;  1YZX A;  4TN8 A;  5D9X A;  1TKD B;  2OAC A;  3CTG A;  1T3B A;  2FWH A;  5HR2 A;  4MJB A;  1VF3 A;  3GMF A;  2DJ1 A;  5KN0 A;  3IOS A;  4OFM A;  3IV4 A;  3VFI A;  3ZML A;  1A2J A;  2XBI A;  2IMD A;  1TRS A;  4GTU A;  1OC9 A;  2L6D A;  2A2R A;  6GST A;  4RUV A;  1XBS A;  4EUY A;  2HZE B;  3TJJ A;  1YEX A;  5CRH A;  3CBU A;  3VUR A;  2EIQ A;  2H71 A;  3GA4 A;  5ECO B;  1AQX A;  3A2X A;  6GSS A;  1GH2 A;  1XZO A;  2H0H A;  3L4N A;  3ERG A;  3R2Q A;  4XIH A;  5CRD A;  4RQX A;  3M9J A;  2VLU A;  3Q18 A;  1ZOF A;  3W6G A;  1B8X A;  1WWJ A;  2H75 A;  1YF0 A;  1SK1 A;  2IFQ A;  2WB9 A;  5HFG A;  2HSH A;  4RQR A;  3M9K A;  1EGR A;  1IYI A;  2ON7 A;  3W8S A;  3MDK A;  5EL8 A;  1Z7P A;  2G2Q A;  5DVB A;  3FYG A;  3QAV A;  1IYH A;  1GUL A;  5AIS A;  22GS A;  3EWL A;  3C1S A;  3E3E A;  2KLX A;  3QFB C;  3ZTL A;  2RLI A;  1TDI A;  4WXT A;  3RPN A;  1TK0 B;  3KEB A;  4O7H A;  1XCC A;  4ECC A;  3IK9 A;  1XWA A;  1Z6N A;  1PL1 A;  2I4A A;  2FA8 A;  2GSS A;  2GT5 A;  5IMV A;  4WBJ A;  2GGT A;  1K0B A;  3EMP A;  5DAL A;  3IBH A;  1SU9 A;  3WGX A;  3S9F A;  3TJF A;  4BWS A;  1AXD A;  2L6C A;  1UVZ A;  2CAQ A;  1ERU A;  1U3I A;  3D22 A;  1WOU A;  4ZXG A;  3TUE A;  1XWK A;  4F0C A;  4IQA A;  1ZMA A;  1T4Y A;  1RK4 A;  1GUK A;  1JLV A;  3TJG A;  4Q5F A;  1I9D A;  2FNO A;  1G7E A;  4IS0 A;  1UN2 A;  2LS5 A;  3C7M A;  2YAN A;  1V57 A;  1XOA A;  2FHE A;  4TR3 A;  1DE1 A;  2YV9 A;  2NBS A;  5IOW A;  3F4T A;  2MBT A;  4RI7 A;  2WGR A;  3UBL A;  3TOU A;  2GQL A;  2AJQ B;  4NV2 A;  2IJY A;  1AW9 A;  1GTB A;  4JU5 A;  2O87 A;  4LL4 B;  2C3Q A;  4PNF A;  3HJM A;  4FYU A;  1F2E A;  3A3T A;  2X8H A;  2PVO C;  3G7Y A;  4J56 E;  4MDC A;  3W8J A;  2V6O A;  2C3T A;  4N10 A;  2XHF A;  4WR5 A;  3VK9 A;  2E2M A;  4OMV A;  4X1U A;  1EWX A;  1M2A A;  1MDK A;  1YEP A;  2PGT A;  1BX9 A;  3HCZ A;  4XHM A;  3IAS 2;  5ECI B;  2L4C A;  2E2G A;  3LJR A;  4KE3 A;  5ECH B;  1O8X A;  1M0U A;  1Z5Y E;  3L0H A;  3I6A A;  3VLN A;  3KP9 A;  2CAI A;  3D0Z A;  4K0N A;  3L78 A;  5FWG A;  4E8H A;  2RM6 A;  4IEL A;  4MH2 A;  2HXK A;  2IME A;  1UA5 A;  4GWR A;  5HR1 A;  1XWC A;  3GYK A;  1SJZ A;  4KCE A;  4EDZ A;  2MMN A;  4IVF A;  2HLS A;  3US3 A;  2H1A A;  5ECR B;  1BYE A;  1USB A;  1J08 A;  2NDO A;  2AYT A;  1GNE A;  1VF2 A;  2PER A;  2I81 A;  3ZRD A;  2HQT A;  4AJ8 A;  4HU7 A;  4G0L A;  2ALB A;  2VD1 A;  5A5K A;  2IPA A;  1X5E A;  4OFN A;  3QPM A;  1G6Y A;  3GRX A;  4I5Q A;  2FCH A;  5ELA A;  2HRK B;  1SD8 A;  1PMT A;  4XRA A;  2VM2 A;  3CSH A;  3F4R A;  4XCS A;  1XVW A;  1MDJ A;  1B9X C;  1AQV A;  3CSJ A;  3KIJ A;  5D8I A;  1F9M A;  1TXX A;  2VM1 A;  3CSI A;  3GV1 A;  2OBI A;  2KUC A;  5CRG A;  1RW1 A;  3O6T A;  3EC3 A;  2M80 A;  4PUA A;  3I9V 2;  4ZB9 A;  2H72 A;  1BED A;  4V1A p;  2H8L A;  2V41 A;  3TRX A;  4JR4 A;  1GTU A;  4IJ3 A;  5LD0 A;  2DIZ A;  11GS A;  5G30 A;  3H79 A;  1K3L A;  4ZBA A;  2HZE A;  1V2A A;  3DGQ A;  2MYG A;  4OCF A;  4PUF C;  5G2Z A;  2YJ7 A;  2O85 A;  2A4V A;  3ME7 A;  4P3Y B;  4D73 B;  2O7K A;  4HZ2 A;  1SKR B;  5IM9 A;  3WYW A;  3IA1 A;  2YPM A;  6GSV A;  2YN1 A;  4Q5Q A;  4EXJ A;  3GX0 A;  1ST9 A;  1DUG A;  1H75 A;  1T1V A;  3F0I A;  4X0X A;  1OC8 A;  3TKP A;  2KHP A;  2YNX A;  2GS3 A;  4KUN A;  1GLQ A;  2XPD A;  3IPZ A;  3EU4 A;  4ML6 A;  4ECB A;  2LJK A;  3D4T A;  4FIW A;  5CP1 A;  2XBQ A;  4GST A;  1SK2 A;  1YF1 A;  2X8C A;  1AQW A;  4K7O A;  5B8B A;  1B4P A;  1ON4 A;  5DAK B;  3APS A;  1EGO A;  4FYC A;  2OAD A;  4NAX A;  3QFA C;  4K1F A;  4AGS A;  2WDU A;  1TRV A;  3WD6 A;  3ERW A;  2HRF A;  1FHE A;  4MF5 A;  4TW5 A;  2BJX A;  3BJ5 A;  1MD3 A;  3ZIJ A;  3L9S A;  5AN1 A;  3U5R E;  2PMT A;  2JZS A;  3KM6 A;  2DC5 A;  2DJJ A;  3RPP A;  1WRY A;  2OE1 A;  5IO0 A;  1NSW A;  3F4S A;  4ZBB A;  4ZB6 A;  5DQY A;  2FY6 A;  2BTO T;  3ZYW A;  4PGT A;  3IHQ A;  5JWR B;  4QL7 A;  4KND A;  3CRU A;  4NHZ A;  2H19 A;  1TW9 A;  3F6D A;  2B1L A;  5D73 A;  1H4O A;  4F9Z A;  3HVV A;  1A0F A;  4F03 A;  5BMU A;  3PH9 A;  4GXZ A;  5F0G A;  3ZFB A;  2FD3 A;  3ZIV A;  2FWG A;  3GST A;  3ED3 A;  5EVO A;  3HZ4 A;  5C04 A;  2XPE A;  4IQ1 A;  4TRX A;  2GZY A;  3Q19 A;  5A4U A;  3BCK A;  5DJM A;  1EP8 A;  5IMA A;  5B8A A;  2QC7 A;  2M46 A;  4PQH A;  3FR6 A;  2HE3 A;  3CXG A;  3O76 A;  2R2J A;  2JZR A;  2TRC P;  2C4J A;  3O3T A;  1GSD A;  1B48 A;  2HSY A;  4MJC A;  3GUS A;  4CW9 A;  5FHI A;  1R26 A;  2RUF A;  3HJO A;  1K0A A;  3ZFL A;  5IOX A;  2PUK C;  1URM A;  2EIR A;  2QSI A;  4EVM A;  3PGT A;  2DJ0 A;  2R3X A;  3ZRE A;  2VOC A;  2A2S A;  3HYP A;  3BBY A;  5IPH A;  2HRK A;  4TR0 A;  1THO A;  1Z3E A;  2O89 A;  4NWY A;  2RM5 A;  1GSS A;  2JU5 A;  5F05 A;  3C1R A;  4EO3 A;  3FZ9 A;  2F8F A;  1XPV A;  1KTE A;  3V1W A;  2WCI A;  1QXH A;  1EV9 A;  1EEM A;  1K0N A;  4GCI A;  3P90 A;  3FK8 A;  2QKE A;  3P2A A;  3Q74 A;  3GNJ A;  1GTA A;  2DIY A;  1SEN A;  3D21 A;  5H5S A;  1PL2 A;  3QDN A;  3CTF A;  2MBS A;  2H0I A;  2R5G A;  3TKR A;  3I69 A;  3WT1 A;  4ULX A;  2YWO A;  4D73 A;  3WT2 A;  2R6K A;  3QCP A;  1SL1 B;  4DVC A;  2WRT A;  1E6B A;  2C8U A;  3D6I A;  4GQC A;  3H93 A;  2B7J A;  2VL3 A;  1BG5 A;  3GKN A;  5COH A;  5CRW A;  3J7Y k;  4KX4 A;  5EPF A;  5GAP D;  3LEF A;  1QGV A;  4OD7 A;  5DDL A;  4HJ2 A;  1V98 A;  1Z7R A;  1EEJ A;  2LTK A;  1DBY A;  3KGK A;  2NTO A;  2VCZ A;  4MAB A;  1R7H A;  4V2L A;  1ZZY A;  2GTU A;  5D9V A;  1YQ1 A;  3LGC A;  1EV4 A;  2OJL A;  4DEJ A;  1ILO A;  6GSU A;  1X9W B;  4FO5 A;  3LXZ A;  2CX3 A;  3HJP A;  3F9U A;  4I2T A;  4LMW A;  4FH8 A;  2LRT A;  5LNK e;  3KD0 A;  3JCM L;  4HQZ A;  4XS4 B;  5G5F A;  4IHU A;  5DAK A;  2WJU A;  2AUV A;  4K9Z A;  3VWW A;  1GNW A;  4YAP A;  2B6M A;  1XWB A;  2L57 A;  4QL9 A;  5IIZ A;  2OBK A;  2KOK A;  2KP1 A;  4PQ1 A;  4G0K A;  1VGL A;  3TJK A;  2HZF A;  2H76 A;  2ZUP A;  1SL0 B;  3ZVJ A;  1YKC A;  2B7K A;  3I43 A;  5AIX A;  2VCQ A;  3MWH A;  1HYU A;  2IWT A;  2V2G A;  3IAM 2;  4HZ4 A;  2CV4 A;  2HI7 A;  1F6M C;  5CNW A;  2AB6 A;  1Z6M A;  4NMU A;  4GRF A;  2K8V A;  4POB A;  2H1G A;  4MZB A;  1GSU A;  3ZL5 A;  1TJD A;  2WFC A;  4I2U A;  2LUS A;  2QGV A;  4TOP A;  2VCV A;  5IMC A;  5IMF A;  3SBC A;  5E59 A;  1R5P A;  1GUH A;  2VAF A;  4TKY A;  3GH6 A;  4BWQ A;  3FRC A;  1OE8 A;  1U6T A;  2H6Y A;  2MMA A;  2GQK A;  5G1L A;  5B6M A;  3ME8 A;  2DMM A;  1OE7 A;  3KCM A;  2RUE A;  1EP7 A;  1N8J A;  2F51 A;  3LYP A;  2I3Y A;  2IL3 A;  3HZ8 A;  4IGJ A;  3FY7 A;  3CMI A;  4KDU A;  5GAN D;  4K7N A;  2DSA A;  4YQM A;  4GQF A;  2UZ8 A;  5F06 A;  4XS1 A;  4POM A;  3TB2 A;  2JAD A;  1ERV A;  4O92 A;  1MTC A;  4JE1 A;  1WMJ A;  4KDY A;  2H6Z A;  2REM A;  1UC7 A;  2HSM A;  1ERT A;  1PKW A;  2LKU A;  1M2B A;  1VF4 A;  3QMX A;  4F82 A;  1GP1 A;  2IMI A;  5ENU A;  3EU3 A;  1XIY A;  3GH9 A;  4OCE A;  3FW2 A;  2RII A;  1JHB A;  3TGZ A;  2D2Z A;  5DCG A;  1G6W A;  3FR3 A;  5C00 A;  3MNG A;  4MCU A;  1KBN A;  3R3E A;  4GSS A;  2YWI A;  2C0G A;  2FA4 A;  2FWE A;  1MD4 A;  4AJ7 A;  1HD2 A;  2XC2 A;  2JSY A;  3IC8 A;  5JWQ B;  3QR6 A;  3GFK A;  1YY7 A;  5ECM B;  1ERW A;  4NXI A;  2B5Y A;  4XS6 A;  1O6J A;  1AIU A;  2VIM A;  3GUR A;  1Z9H A;  4ZIL A;  1PSQ A;  5DJL A;  3HHV A;  4GSN A;  2F8A A;  3M8N A;  4USS A;  4O32 A;  2GSQ A;  5ECS A;  2R37 A;  4MF7 A;  1WPI A;  4CHS A;  2L4Q A;  1PX7 A;  3PIN A;  4LMV A;  3RBT A;  2L5L A;  4LL1 B;  5JCG A;  1U88 A;  2GDR A;  3UAP A;  1TK5 B;  4ZL7 A;  1V40 A;  4LA1 A;  2BMX A;  1I5G A;  3TKQ A;  2FGX A;  2MZC A;  2VCX A;  5B7C A;  2FUG 2;  3PR8 A;  1BAY A;  4YAV A;  3J7Y b;  4MPG A;  1GLP A;  1F37 A;  4ECJ A;  2PN8 A;  3IRA A;  2JAC A;  5F07 A;  1AC1 A;  4KA0 A;  3DRN A;  1XOB A;  1MEK A;  5F8B A;  1SKS B;  4WF5 A;  3GHA A;  2CQ9 A;  2OKA A;  2P31 A;  2TRX A;  4WET A;  1B4Q A;  2VLT A;  1HNB A;  1SJ6 A;  2B1K A;  4QQ7 A;  2LNS A;  5HQP A;  2OA7 A;  2GZP A;  3IC4 A;  3DXB A;  1EOH A;  2B5X A;  3BD2 A;  4HQS A;  5D9T A;  4MH3 A;  3ZVJ D;  1W89 A;  5AGY A;  4WKW A;  1PKZ A;  5ECK B;  13GS A;  1ML6 A;  4XS4 A;  2N5F A;  3TKS A;  4N0Z A;  2VO4 A;  1ACV A;  3FR9 A;  4BL7 B;  3EVI A;  3DKS A;  1ABA A;  2O8V B;  1XXU A;  5E4W A;  3TKS C;  4V1A g;  5ID2 A;  3GSS A;  2JSZ A;  1T4Z A;  1JZD A;  1FG4 A;  3GKK A;  4HOJ A;  4OO4 A;  1Q4J A;  4K0G A;  4ECI A;  3FZ5 A;  3LOR A;  2F3M A;  4EF0 A;  4MZW A;  3TJB A;  2EC4 A;  3GIX A;  4HI7 A;  3VWX A;  1JZO A;  1SL2 B;  5ECL B;  1A24 A;  1XFL A;  3KH9 A;  5CAX A;  4XTS A;  4I97 A;  4IJI A;  2ZCT A;  3F6F A;  3HD5 A;  1GTI A;  5GZZ B;  2E7P A;  2J9H A;  1NHY A;  3MSZ A;  4IBP A;  4HU9 A;  3WGD A;  4AJ6 A;  2H30 A;  3UMA A;  3N5O A;  4V2M A;  2H70 A;  3APO A;  4DSR A;  1SK0 A;  3ZIT A;  2GT6 A;  1ZGN A;  2K9F A;  4ILF A;  1O8W A;  2V6K A;  1TTZ A;  14GS A;  1O85 A;  4O5R A;  4JR6 A;  4KDX A;  3WGE A;  5EY6 A;  3GKM A;  2VL9 A;  3HDC A;  1PA3 A;  4ZIJ A;  3A2W A;  3DML A;  3UL3 A;  4H86 A;  3FHK A;  4NPB A;  1Y6E A;  1JZR A;  4POL A;  1GSF A;  2AAW A;  5D96 A;  2YCD A;  4E8E A;  2VD0 A;  3VWV A;  1VRS D;  1TRU A;  1PGT A;  1TOF A;  2CVB A;  1M99 A;  1FAA A;  2OE0 A;  5ELG A;  2TIR A;  5HFK A;  2HYX A;  3AY8 A;  4FYB A;  1Q98 A;  3M3M A;  1OKT A;  1NHO A;  2F9S A;  5J3R A;  1KEB A;  2HSM B;  1GL8 A;  6GSY A;  3GTU A;  4JRR A;  5KN2 A;  2LNT A;  1LBK A;  2IN3 A;  3QAG A;  4ID0 A;  1X9M B;  2AHE A;  2HFD A;  3VI7 A;  2KP2 A;  1M9A A;  2K8S A;  4JZQ A;  5IPG A;  3GL5 A;  1K3O A;  1JFU A;  1DE2 A;  1XVQ A;  5INY A;  2ON5 A;  3VPT A;  1X0R A;  1FB6 A;  4N0V A;  4YQV A;  1K0O A;  5D93 A;  4MJA A;  1CQG A;  4GF0 A;  1HNC A;  1R5A A;  1OC3 A;  5A4V A;  3TRP A;  4FQU A;  20GS A;  1O73 A;  1THX A;  1XWG A;  5AIV A;  4DSS B;  2N5B A;  3APQ A;  2GSR A;  4JED A;  1OKD A;  4BPY A;  2VUP A;  5JCW A;  2P5Q A;  2ZNM A;  4AF2 A;  3HY2 A;  1SJI A;  1SD9 A;  5IQY A;  1OVN A;  3C8E A;  4NHW A;  3IK7 A;  3DIE A;  2H1B A;  4BVY B;  3GKX A;  4KB3 A;  3EYT A;  4PX1 A;  1T8E B;  2YP6 A;  4Z7X A;  3FZA A;  4ZL8 A;  1FVJ A;  1QQ2 A;  1S3A A;  1EOG A;  18GS A;  1GWC A;  1W4V A;  4OFT A;  4IP1 A;  3PPU A;  1WJK A;  1LU4 A;  4BVX B;  2C3N A;  3DYR A;  1GUM A;  2CT6 A;  3ISO A;  1T7P B;  1RQM A;  2GQM A;  3HXS A;  2VCT A;  3UAR A;  4EC0 A;  5IMD A;  5GST A;  3K8N A;  3LFL A;  3EMX A;  1OAZ A;  2ES7 A;  1YKA A;  1PD2 1;  4EDY A;  3DVX A;  2J23 A;  2HRN A;  3LQ7 A;  4G10 A;  4EE0 A;  1V58 A;  4Q5R A;  4BL7 A;  4L8E A;  1K0D A;  1PRX A;  12GS A;  5ID2 B;  5G5E A;  5G1K A;  1PX6 A;  3ERF A;  1V9W A;  2C1Y A;  2WS2 A;  2NPB A;  2L59 A;  2N5A A;  3HVX A;  4MPF A;  16GS A;  1TP9 A;  1A8L A;  1AUC A;  5LCZ A;  2H74 A;  3VI5 A;  10GS A;  2EIO A;  5CO3 A;  3TDG A;  1B9Y C;  3NOF A;  1O7U A;  5KN1 A;  4K7I A;  3M1G A;  9GSS A;  1M2D A;  2LRC A;  3F3R A;  4X43 A;  3C73 A;  4MF6 A;  3FEU A;  2L5O A;  2JL4 A;  5HR0 A;  3BOA A;  4MJE A;  3IDV A;  4V2N A;  3BCI A;  2E0Q A;  3OR5 A;  4MA9 A;  2V32 A;  6GSW A;  2VLV A;  1GSY A;  1SYX A;  4POK A;  3LG6 A;  4WR4 A;  4JBB A;  1FW1 A;  2FLS A;  5G31 A;  1VF1 A;  3KJY A;  2CZ2 A;  3UBK A;  2CX4 A;  4MK3 A;  3U6V A;  1QMV A;  4TR1 B;  1A0R P;  2HSN B;  5JCU A;  5DCH A;  3UOM A;  5ECQ B;  3RAZ A;  2P5R A;  1GSE A;  1U3A A;  5J9C A;  1TK8 B;  4HS1 A;  2C0E A;  3E0U A;  2LJA A;  3A2V A;  4CDO A;  1E2Y A;  3TRQ A;  8GSS A;  4XRD A;  3HKR A;  3L9V A;  5KN3 A;  2X99 A;  4I6X A;  2YZH A;  4YQU A;  2C0D A;  1GRX A;  2PU9 C;  1GSQ A;  3KTB A;  5J9B A;  3CRT A;  4HEA 2;  5L71 A;  1PN9 A;  2Z9S A;  2H66 A;  3GTU B;  1S3C A;  17GS A;  2YV7 A;  2LRN A;  5ABR A;  5D9W A;  3H1N A;  1BJX A;  1X5C A;  4KW6 A;  2MMO A;  2H0G A;  3F8U A;  4KGI A;  2PPT A;  4I8B A;  2C0F A;  3E9J B;  2LST A;  3UIW A;  5KEJ A;  4TXV A;  4KAE A;  2DJK A;  2FWF A;  3GX8 A;  2X64 A;  1X5D A;  4DSQ A;  1A2M A;  4NV5 A;  1KNG A;  4ISD A;  4HDE A;  1X9S B;  4OO5 A;  1A8Y A;  1ZL9 A;  3EE2 A;  2LQQ A;  5ECP B;  5J5N A;  5CRE A;  2IMK A;  1OYJ A;  4TXO B;  4DSS A;  1J9B A;  1FOV A;  1HNA A;  4G19 A;  5J4U A;  1G0T A;  1PQN A;  1U87 A;  3SWL A;  3UVH A;  2H6X A;  4KSO A;  2GZZ A;  2LQO A;  2P0G A;  2YOI A;  3F63 A;  1NW2 A;  2VL2 A;  4WBR D;  3LYK A;  2B5E A;  4K2D A;  2K6V A;  1TU8 A;  5HFI A;  1FB0 A;  2VL2 C;  5CYY A;  4IW9 A;  1AAZ A;  3HA9 A;  1XW5 A;  4BVY A;  2GST A;  5GSS A;  1F3B A;  2DML A;  4LLR A;  4F0B A;  1JZW A;  4PXO A;  4TVE A;  7GSS A;  2CVD A;  3DD3 A;  4ZBD A;  1QK8 A;  4J2F A;  1OC9 B;  3KP8 A;  1J0F A;  4KH7 A;  3F3Q A;  2V1M A;  5DQS A;  1R4W A;  3RHC A;  4BVX A;  2HT9 A;  3G7J A;  2I9H A;  2LJR A;  1SYR A;  2YWN A;  5DBQ A;  4GLT A;  5J41 A;  2WUL A;  4MMM A;  3KTL A;  3IE3 A;  2H1D A;  3UVT A;  3P8W A;  2VCW A;  5H5R A;  1ZYQ B;  2X8G A;  3UJ1 A;  4N30 A;  3M0F A;  2GLR A;  4YH2 A;  4PQI A;  1K0M A;  3GN3 A;  2G0F A;  3P7X A;  4ZL9 A;  3D4M A;  4K6X A;  2IFQ B;  4MP4 A;  4Q5N A;  5B6N A;  1TI1 A;  5A4W A;  2M72 A;  1A23 A;  4ACS A;  4K8M A;  3G7I A;  5ECN B;  3KZQ A;  4G9H A;  1QUW A;  4WEY A;  3L9U A;  4G0I A;  3ZLP A;  1WP0 A;  2CA8 A;  1TU7 A;  1WIK A;  3KMN A;  4PNG A;  1BQ7 A;  1YDK A;  4G2E A;  3QAW A;  3RHB A;  4KF9 A;  3DEX A;  5DAL B;  3NIV A;  3VWU A;  5JWO B;  4PTS A;  2NVL A;  1QFN A;  3MAK A;  3A5W A;  2I1U A;  3D5J A;  4L5L A;  3RDW A;  3ZMK A;  3EUR A;  2IIY A;  2B3S A;  4L5O A;  1MDI A;  4MZC A;  1F3A A;  2JZT A;  1TRW A;  3KXO A;  4IP6 A;  2CZ3 A;  1N2A A;  3LWA A;  3FKF A;  3NZN A;  6GSX A;  2PVQ A;  1C72 A;  3H4K A;  4L0U A;  2YJH A;  2R4V A;  2IMF A;  3TCO A;  4TR1 A;  1G7O A;  4EKZ A;  3C71 A;  1M9B A;  5IO2 A;  4F2I A;  2YWM A;  1ZYE A;  3H8Q A;  5IMZ A;  1K3Y A;  3LXT A;  3LSZ A;  4HJM A;  4IN0 A;  4OWY A;  1YJ6 A;  1EZK A;  3IR4 A;  3Q6O A;  1SKW B;  1XW6 A;  2PWJ A;  3UEM A;  5H5Q A;  1CQH A;  4EL1 A;  4PUR A;  3N9J A;  5HR3 A;  4BA7 A;  1FVK A;  4TR4 A;  3GL3 A;  2DLX A;  2GVP A;  19GS A;  1T00 A;  1JLW A;  3DVW A;  2LEG A;  4MLY A;  1A2L A;  4ML1 A;  2H73 A;  4HUA A;  2DJ3 A;  1M7T A;  1NM3 A;  3VPQ A;  3QOU A;  3KMO A;  2DBC A;  4KCA A;  2PBJ A;  2HRA A;  1TI3 A;  4RI6 A;  4J57 E;  1K0C A;  3QD9 A;  3IXR A;  1ZCP A;  3FZ4 A;  2DJ2 A;  4N11 A; 
#chains in the Genus database with same CATH topology
 1LJR A;  1O81 A;  3KH7 A;  3ZZX A;  4WF4 A;  3G9B A;  2MMZ A;  4IKH A;  3TKS E;  2AV4 A;  1S3D A;  2OE3 A;  2YZU A;  3DWV A;  2K18 A;  1DSB A;  4TXO A;  3TOT A;  3HVS A;  1Y25 A;  4ZB8 A;  3EIN A;  1HQO A;  2LV3 A;  2HNL A;  1WE0 A;  2WZ9 A;  5FT3 A;  2C80 A;  2CVK A;  2H01 A;  4L0W A;  4KSM A;  1FO5 A;  3CYN A;  4Z2U A;  1XW9 A;  1YZX A;  4TN8 A;  5D9X A;  1TKD B;  2OAC A;  3CTG A;  1T3B A;  4ZB7 A;  2FWH A;  5HR2 A;  4MJB A;  1VF3 A;  3GMF A;  2DJ1 A;  5KN0 A;  3IOS A;  4OFM A;  3IV4 A;  3VFI A;  3ZML A;  1A2J A;  2XBI A;  2IMD A;  2EFH A;  1TRS A;  4GTU A;  1OC9 A;  2L6D A;  2A2R A;  6GST A;  4RUV A;  1XBS A;  4EUY A;  2HZE B;  3TJJ A;  1YEX A;  5CRH A;  2A2P A;  3CBU A;  3VUR A;  2EIQ A;  2H71 A;  3GA4 A;  5ECO B;  1AQX A;  3A2X A;  4G01 A;  6GSS A;  1GH2 A;  1XZO A;  2H0H A;  3L4N A;  3ERG A;  3R2Q A;  4XIH A;  5CRD A;  4RQX A;  3M9J A;  2VLU A;  3Q18 A;  1ZOF A;  3W6G A;  1B8X A;  1WWJ A;  2H75 A;  2H1L A;  4O5Q A;  1YF0 A;  1SK1 A;  4QMK A;  2IFQ A;  2WB9 A;  4PI0 C;  5HFG A;  2HSH A;  4RQR A;  3M9K A;  1EGR A;  1IYI A;  2ON7 A;  3W8S A;  3MDK A;  5EL8 A;  1Z7P A;  2G2Q A;  5DVB A;  3FYG A;  3QAV A;  1IYH A;  1GUL A;  5AIS A;  22GS A;  3EWL A;  3C1S A;  3E3E A;  2KLX A;  3QFB C;  3ZTL A;  2RLI A;  1TDI A;  4WXT A;  3RPN A;  1TK0 B;  3KEB A;  4O7H A;  1XCC A;  4ECC A;  3IK9 A;  1XWA A;  1Z6N A;  1PL1 A;  2I4A A;  2FA8 A;  2GSS A;  2GT5 A;  5IMV A;  4WBJ A;  2GGT A;  1K0B A;  3EMP A;  5DAL A;  3IBH A;  1SU9 A;  3WGX A;  3S9F A;  3TJF A;  4BWS A;  1AXD A;  2L6C A;  1UVZ A;  2CAQ A;  1ERU A;  1U3I A;  3D22 A;  1WOU A;  4ZXG A;  3TUE A;  1XWK A;  4F0C A;  4IQA A;  1ZMA A;  1T4Y A;  1RK4 A;  3CQF A;  1GUK A;  1JLV A;  3TJG A;  4Q5F A;  1I9D A;  2EFD A;  2FNO A;  1G7E A;  4IS0 A;  1UN2 A;  2LS5 A;  3C7M A;  2YAN A;  1V57 A;  1XOA A;  2FHE A;  4TR3 A;  1DE1 A;  2YV9 A;  2NBS A;  5IOW A;  3F4T A;  2MBT A;  4RI7 A;  2WGR A;  3UBL A;  3TOU A;  3CHX C;  2GQL A;  2AJQ B;  4NV2 A;  2IJY A;  1AW9 A;  1GTB A;  4AI6 A;  2R0C A;  4JU5 A;  2WVY A;  2X4A A;  2O87 A;  4LL4 B;  2C3Q A;  4PNF A;  3HJM A;  4FYU A;  5BMU B;  1F2E A;  3A3T A;  2X8H A;  2PVO C;  3G7Y A;  4J56 E;  4MDC A;  3W8J A;  2V6O A;  2C3T A;  4N10 A;  2XHF A;  4WR5 A;  3VK9 A;  2E2M A;  4OMV A;  4X1U A;  1EWX A;  1M2A A;  1MDK A;  1YEP A;  2PGT A;  1BX9 A;  3HCZ A;  4XHM A;  3IAS 2;  3RFR C;  5ECI B;  2L4C A;  2E2G A;  3LJR A;  4KE3 A;  5ECH B;  1O8X A;  1M0U A;  1Z5Y E;  3L0H A;  3I6A A;  3VLN A;  3KP9 A;  2CAI A;  3D0Z A;  4K0N A;  3L78 A;  5FWG A;  4E8H A;  2RM6 A;  4IEL A;  4MH2 A;  2HXK A;  2IME A;  1UA5 A;  4GWR A;  5HR1 A;  1XWC A;  3GYK A;  1SJZ A;  4KCE A;  4EDZ A;  2MMN A;  4IVF A;  2HLS A;  3US3 A;  2H1A A;  5ECR B;  1BYE A;  1USB A;  1J08 A;  2NDO A;  2AYT A;  1GNE A;  1VF2 A;  2PER A;  2I81 A;  3ZRD A;  2HQT A;  4AJ8 A;  4HU7 A;  4G0L A;  2ALB A;  2VD1 A;  5A5K A;  2IPA A;  1X5E A;  4OFN A;  3QPM A;  1G6Y A;  3GRX A;  4I5Q A;  2FCH A;  2EFC A;  5ELA A;  2HRK B;  1SD8 A;  1PMT A;  4XRA A;  2VM2 A;  3CSH A;  3F4R A;  1TXU A;  4XCS A;  1XVW A;  1MDJ A;  1B9X C;  4X4J A;  1AQV A;  3CSJ A;  3KIJ A;  5D8I A;  1F9M A;  4Z2T A;  1TXX A;  2VM1 A;  3CSI A;  3GV1 A;  2OBI A;  2KUC A;  5CRG A;  1RW1 A;  3EC3 A;  3O6T A;  2M80 A;  4PUA A;  3MIX A;  3I9V 2;  4ZB9 A;  2H72 A;  1BED A;  4V1A p;  2H8L A;  2V41 A;  3HVN A;  3TRX A;  4K5S A;  4JR4 A;  1GTU A;  4IJ3 A;  5LD0 A;  2DIZ A;  11GS A;  5G30 A;  3H79 A;  1K3L A;  4ZBA A;  2HZE A;  1V2A A;  3DGQ A;  2MYG A;  4OCF A;  4PUF C;  5G2Z A;  2YJ7 A;  2O85 A;  2A4V A;  3ME7 A;  4P3Y B;  4D73 B;  2O7K A;  4HZ2 A;  1SKR B;  5IM9 A;  3WYW A;  3IA1 A;  2YPM A;  4BIK A;  6GSV A;  2YN1 A;  4Q5Q A;  4EXJ A;  3GX0 A;  1ST9 A;  1DUG A;  1H75 A;  1T1V A;  1BF5 A;  3F0I A;  4X0X A;  1OC8 A;  3TKP A;  2KHP A;  2YNX A;  2GS3 A;  4KUN A;  1GLQ A;  2XPD A;  3IPZ A;  3EU4 A;  4ML6 A;  4ECB A;  2LJK A;  3D4T A;  4FIW A;  5CP1 A;  2XBQ A;  4GST A;  1SK2 A;  2WW3 A;  1YF1 A;  2X8C A;  1AQW A;  4K7O A;  5B8B A;  1B4P A;  4A5P A;  1ON4 A;  5DAK B;  3APS A;  1EGO A;  4FYC A;  2OAD A;  4NAX A;  2WW0 A;  3QFA C;  4K1F A;  4AGS A;  2WDU A;  1TRV A;  3WD6 A;  3ERW A;  2HRF A;  1FHE A;  4MF5 A;  4TW5 A;  2BJX A;  3BJ5 A;  1MD3 A;  3ZIJ A;  3L9S A;  5AN1 A;  3U5R E;  2PMT A;  4E68 A;  3KM6 A;  2JZS A;  2DC5 A;  2DJJ A;  3RPP A;  1WRY A;  2OE1 A;  5IO0 A;  1NSW A;  4EIP A;  3F4S A;  4ZBB A;  4ZB6 A;  3IHG A;  5DQY A;  2FY6 A;  2BTO T;  3ZYW A;  4PGT A;  3IHQ A;  5JWR B;  4QL7 A;  4KND A;  3CRU A;  4NHZ A;  2H19 A;  1TW9 A;  3F6D A;  2B1L A;  5D73 A;  1H4O A;  4F9Z A;  3HVV A;  1A0F A;  4F03 A;  5BMU A;  3PH9 A;  4GXZ A;  5F0G A;  3ZFB A;  2FD3 A;  3ZIV A;  2FWG A;  3GST A;  3ED3 A;  5EVO A;  3HZ4 A;  5C04 A;  2XPE A;  4IQ1 A;  3TU3 B;  5J4Y A;  4TRX A;  2GZY A;  3Q19 A;  5A4U A;  3BCK A;  5DJM A;  1EP8 A;  5IMA A;  5B8A A;  2QC7 A;  2M46 A;  4PQH A;  4W66 A;  3FR6 A;  3LW9 A;  2HE3 A;  3CXG A;  3O76 A;  2R2J A;  2JZR A;  2TRC P;  2C4J A;  3O3T A;  5A5H B;  1GSD A;  1B48 A;  2HSY A;  4MJC A;  3GUS A;  4CW9 A;  5FHI A;  1R26 A;  2RUF A;  3HJO A;  1K0A A;  3ZFL A;  5IOX A;  2PUK C;  1URM A;  2EIR A;  2QSI A;  4EVM A;  3PGT A;  2DJ0 A;  2R3X A;  3ZRE A;  2VOC A;  2A2S A;  3HYP A;  4CY8 A;  3BBY A;  5IPH A;  2HRK A;  4TR0 A;  1THO A;  1Z3E A;  2O89 A;  4NWY A;  2RM5 A;  2O3E A;  1GSS A;  2JU5 A;  5F05 A;  3C1R A;  4EO3 A;  3FZ9 A;  2F8F A;  1XPV A;  1KTE A;  3V1W A;  2WCI A;  1QXH A;  1EV9 A;  1EEM A;  1K0N A;  4GCI A;  3RGB C;  3P90 A;  3FK8 A;  2QKE A;  3P2A A;  3Q74 A;  3GNJ A;  1GTA A;  4AKG A;  2DIY A;  1SEN A;  3D21 A;  5H5S A;  1PL2 A;  3QDN A;  3CTF A;  2MBS A;  2H0I A;  2R5G A;  3TKR A;  3I69 A;  3WT1 A;  4ULX A;  2YWO A;  4D73 A;  3WT2 A;  2R6K A;  3QCP A;  1SL1 B;  4DVC A;  2WRT A;  1E6B A;  2C8U A;  3D6I A;  4GQC A;  3H93 A;  2B7J A;  2VL3 A;  3A5I A;  1BG5 A;  3GKN A;  5COH A;  5CRW A;  3J7Y k;  4KX4 A;  5EPF A;  5GAP D;  3LEF A;  1QGV A;  4OD7 A;  5DDL A;  4HJ2 A;  1V98 A;  1Z7R A;  1EEJ A;  2LTK A;  1DBY A;  3KGK A;  2NTO A;  2VCZ A;  4MAB A;  1R7H A;  4V2L A;  1ZZY A;  2GTU A;  5D9V A;  1YQ1 A;  3LGC A;  1EV4 A;  2OJL A;  4DEJ A;  1ILO A;  6GSU A;  1X9W B;  4FO5 A;  3LXZ A;  2CX3 A;  3HJP A;  3F9U A;  4I2T A;  2UV8 G;  1N25 A;  4LMW A;  4FH8 A;  2LRT A;  5LNK e;  3KD0 A;  3JCM L;  4HQZ A;  4XS4 B;  5G5F A;  4IHU A;  5DAK A;  2WJU A;  2AUV A;  4K9Z A;  3VWW A;  2DKH A;  1GNW A;  4YAP A;  2B6M A;  1XWB A;  2L57 A;  5J40 A;  4QL9 A;  5IIZ A;  2OBK A;  2KOK A;  2KP1 A;  4PQ1 A;  1ZYP A;  4G0K A;  1VGL A;  3TJK A;  2HZF A;  2H76 A;  2ZUP A;  1SL0 B;  3ZVJ A;  1YKC A;  2B7K A;  3I43 A;  5AIX A;  2VCQ A;  3MWH A;  1HYU A;  2IWT A;  2V2G A;  3IAM 2;  4HZ4 A;  2CV4 A;  2HI7 A;  1F6M C;  1M3J A;  5CNW A;  2AB6 A;  1Z6M A;  4NMU A;  4GRF A;  2K8V A;  1SVO A;  4POB A;  2H1G A;  4MZB A;  1GSU A;  3ZL5 A;  5A1N B;  1TJD A;  2WFC A;  4I2U A;  2LUS A;  2QGV A;  4TOP A;  2VCV A;  5IMC A;  5IMF A;  3SBC A;  5E59 A;  1R5P A;  1GUH A;  2VAF A;  4TKY A;  3GH6 A;  4BWQ A;  3FRC A;  1OE8 A;  1U6T A;  2H6Y A;  2MMA A;  2GQK A;  5G1L A;  5B6M A;  3ME8 A;  2DMM A;  1OE7 A;  3KCM A;  2RUE A;  1EP7 A;  1YVL A;  1N8J A;  2F51 A;  3LYP A;  2I3Y A;  2IL3 A;  3HZ8 A;  4IGJ A;  3FY7 A;  3CMI A;  4KDU A;  5GAN D;  4K7N A;  2DSA A;  4YQM A;  4GQF A;  2UZ8 A;  5F06 A;  4XS1 A;  4POM A;  3TB2 A;  2JAD A;  1ERV A;  4O92 A;  1MTC A;  4JE1 A;  1WMJ A;  4KDY A;  2H6Z A;  2REM A;  1UC7 A;  2HSM A;  1ERT A;  5A5H A;  1PKW A;  2LKU A;  1M2B A;  1VF4 A;  3QMX A;  4F82 A;  1GP1 A;  2IMI A;  5ENU A;  3EU3 A;  1XIY A;  3GH9 A;  4OCE A;  3FW2 A;  2RII A;  1JHB A;  3TGZ A;  2D2Z A;  5DCG A;  1G6W A;  3FR3 A;  5C00 A;  3MNG A;  4MCU A;  1KBN A;  3R3E A;  4GSS A;  2YWI A;  2C0G A;  2FA4 A;  2FWE A;  1MD4 A;  4AJ7 A;  1HD2 A;  2DKI A;  2XC2 A;  2JSY A;  3IC8 A;  5JWQ B;  3QR6 A;  3GFK A;  1YY7 A;  5ECM B;  1ERW A;  4NXI A;  1XG8 A;  2B5Y A;  4XS6 A;  1O6J A;  1AIU A;  2VIM A;  3GUR A;  1Z9H A;  5BRT A;  4ZIL A;  1PSQ A;  5DJL A;  3HHV A;  4GSN A;  2F8A A;  4Z2R A;  3M8N A;  4USS A;  4O32 A;  2GSQ A;  5ECS A;  2R37 A;  4MF7 A;  1WPI A;  4CHS A;  2L4Q A;  1PX7 A;  3PIN A;  4LMV A;  3RBT A;  2L5L A;  4LL1 B;  5JCG A;  1U88 A;  2GDR A;  3UAP A;  1TK5 B;  2WVX B;  4ZL7 A;  1V40 A;  4LA1 A;  2BMX A;  1I5G A;  3TKQ A;  2FGX A;  2MZC A;  2VCX A;  5B7C A;  2WZS A;  2FUG 2;  3PR8 A;  1BAY A;  4YAV A;  3J7Y b;  4MPG A;  2QA1 A;  1GLP A;  1F37 A;  4ECJ A;  2PN8 A;  4K2X A;  3IRA A;  2JAC A;  5F07 A;  2O5V A;  1AC1 A;  4KA0 A;  3DRN A;  1XOB A;  1MEK A;  5F8B A;  1SKS B;  4WF5 A;  3GHA A;  2CQ9 A;  2OKA A;  2P31 A;  2TRX A;  4WET A;  1B4Q A;  2VLT A;  1HNB A;  1SJ6 A;  2B1K A;  4QQ7 A;  2LNS A;  5HQP A;  2OA7 A;  2GZP A;  3IC4 A;  4PHZ C;  3DXB A;  4AKX B;  1EOH A;  2B5X A;  3BD2 A;  4HQS A;  5D9T A;  4MH3 A;  3ZVJ D;  1W89 A;  5AGY A;  4WKW A;  1PKZ A;  5ECK B;  13GS A;  1ML6 A;  4XS4 A;  2N5F A;  3TKS A;  4N0Z A;  2VO4 A;  1ACV A;  4PI2 C;  3CWG A;  3FR9 A;  4BL7 B;  3EVI A;  3DKS A;  1ABA A;  2O8V B;  1XXU A;  5E4W A;  3TKS C;  4V1A g;  5ID2 A;  3GSS A;  2JSZ A;  1T4Z A;  1JZD A;  1FG4 A;  3GKK A;  4HOJ A;  4OO4 A;  1Q4J A;  4K0G A;  4ECI A;  1BG1 A;  3FZ5 A;  3LOR A;  2F3M A;  4EF0 A;  4MZW A;  3TJB A;  2EC4 A;  5J47 A;  4K5R A;  3GIX A;  4HI7 A;  3VWX A;  1JZO A;  5A34 A;  1SL2 B;  5ECL B;  1A24 A;  1XFL A;  3KH9 A;  5CAX A;  4XTS A;  4I97 A;  4IJI A;  5A1N A;  2ZCT A;  3F6F A;  3HD5 A;  1GTI A;  5GZZ B;  2E7P A;  2J9H A;  1NHY A;  3MSZ A;  4IBP A;  4HU9 A;  3WGD A;  4AJ6 A;  2H30 A;  3UMA A;  3N5O A;  4V2M A;  2H70 A;  3APO A;  4DSR A;  1SK0 A;  2OT3 A;  3ZIT A;  2GT6 A;  1ZGN A;  2K9F A;  4ILF A;  1O8W A;  2WVZ A;  2V6K A;  1TTZ A;  4O5U A;  14GS A;  1O85 A;  4O5R A;  4JR6 A;  4KDX A;  4AKI A;  3WGE A;  5EY6 A;  3GKM A;  2VL9 A;  3HDC A;  1PA3 A;  4ZIJ A;  3A2W A;  3DML A;  3UL3 A;  4H86 A;  3FHK A;  4NPB A;  1Y6E A;  1JZR A;  4POL A;  1GSF A;  2AAW A;  5D96 A;  2YCD A;  4E8E A;  2VD0 A;  3VWV A;  1VRS D;  1TRU A;  1PGT A;  1TOF A;  2CVB A;  1M99 A;  1FAA A;  2OE0 A;  5ELG A;  2TIR A;  5HFK A;  2HYX A;  3AY8 A;  4FYB A;  1Q98 A;  3HMJ G;  3M3M A;  1OKT A;  1NHO A;  2F9S A;  5J3R A;  1KEB A;  2HSM B;  1GL8 A;  6GSY A;  3GTU A;  4JRR A;  5KN2 A;  2LNT A;  1LBK A;  2IN3 A;  3QAG A;  4EIQ A;  2O36 A;  4ID0 A;  1X9M B;  2AHE A;  2HFD A;  3VI7 A;  2KP2 A;  1M9A A;  2K8S A;  4JZQ A;  5IPG A;  3GL5 A;  1K3O A;  1JFU A;  1DE2 A;  1XVQ A;  5INY A;  2ON5 A;  3VPT A;  4N3Z A;  1X0R A;  1FB6 A;  4N0V A;  4AKH A;  4YQV A;  1K0O A;  5D93 A;  4MJA A;  1CQG A;  4GF0 A;  1HNC A;  1R5A A;  1OC3 A;  5A4V A;  3TRP A;  4FQU A;  20GS A;  1O73 A;  1THX A;  1XWG A;  5AIV A;  4DSS B;  2N5B A;  3APQ A;  2GSR A;  4JED A;  1OKD A;  1PN0 A;  4BPY A;  2VUP A;  5JCW A;  2P5Q A;  2ZNM A;  4AF2 A;  1S4B P;  3HY2 A;  4MNN A;  1SJI A;  1SD9 A;  5IQY A;  1OVN A;  3C8E A;  2WVX A;  4NHW A;  3IK7 A;  3DIE A;  2H1B A;  4BVY B;  3GKX A;  4KB3 A;  3EYT A;  4PX1 A;  1T8E B;  2YP6 A;  1I1I P;  4Z7X A;  3FZA A;  4ZL8 A;  1FVJ A;  1QQ2 A;  1S3A A;  1EOG A;  1SVL A;  18GS A;  1GWC A;  1W4V A;  4OFT A;  4IP1 A;  3PPU A;  1WJK A;  1LU4 A;  4BVX B;  2C3N A;  1ZYN A;  3DYR A;  1GUM A;  2CT6 A;  3ISO A;  1T7P B;  1RQM A;  2GQM A;  3HXS A;  2VCT A;  3UAR A;  4EC0 A;  5IMD A;  5GST A;  3K8N A;  3LFL A;  3EMX A;  1OAZ A;  2ES7 A;  2WW1 A;  1YKA A;  1PD2 1;  4EDY A;  3DVX A;  2J23 A;  4GDF A;  2HRN A;  3LQ7 A;  4G10 A;  4EE0 A;  4FXY P;  1V58 A;  4Q5R A;  4BL7 A;  4L8E A;  1K0D A;  1PRX A;  12GS A;  5ID2 B;  5G5E A;  5G1K A;  1PX6 A;  3ERF A;  1V9W A;  2C1Y A;  2WS2 A;  2NPB A;  2L59 A;  4HSC X;  2N5A A;  3HVX A;  4MPF A;  16GS A;  1TP9 A;  1A8L A;  1AUC A;  5LCZ A;  2H74 A;  1S3R A;  3VI5 A;  10GS A;  2EIO A;  5CO3 A;  3TDG A;  1B9Y C;  5A34 B;  3NOF A;  1O7U A;  5KN1 A;  4K7I A;  3M1G A;  1SVM A;  9GSS A;  1M2D A;  2LRC A;  3F3R A;  4X43 A;  3C73 A;  4MF6 A;  3FEU A;  2L5O A;  4YKF A;  2JL4 A;  5HR0 A;  3BOA A;  4MJE A;  3IDV A;  4V2N A;  3BCI A;  2E0Q A;  3OR5 A;  4MA9 A;  2V32 A;  6GSW A;  2VLV A;  1GSY A;  1Y1U A;  1SYX A;  4POK A;  3LG6 A;  4WR4 A;  4JBB A;  1FW1 A;  2FLS A;  5G31 A;  1VF1 A;  3KJY A;  2CZ2 A;  3UBK A;  2CX4 A;  4MK3 A;  3U6V A;  1QMV A;  4TR1 B;  1A0R P;  2HSN B;  5JCU A;  5DCH A;  3UOM A;  5ECQ B;  3RAZ A;  2P5R A;  1GSE A;  1U3A A;  5J9C A;  1TK8 B;  4HS1 A;  2C0E A;  5J4V A;  3E0U A;  2LJA A;  3A2V A;  4CDO A;  1E2Y A;  3TRQ A;  8GSS A;  4XRD A;  3HKR A;  3L9V A;  5KN3 A;  2X99 A;  4I6X A;  2YZH A;  4YQU A;  2C0D A;  1GRX A;  2PU9 C;  1GSQ A;  3KTB A;  5J9B A;  2X49 A;  3CRT A;  4HEA 2;  1M3I A;  5L71 A;  1PN9 A;  2Z9S A;  2H66 A;  3GTU B;  1S3C A;  17GS A;  2YV7 A;  2LRN A;  5ABR A;  5D9W A;  3H1N A;  1BJX A;  1X5C A;  4KW6 A;  2MMO A;  2H0G A;  3F8U A;  4KGI A;  2PPT A;  4I8B A;  1PFO A;  2C0F A;  3E9J B;  2LST A;  3UIW A;  5KEJ A;  4TXV A;  4KAE A;  2DJK A;  2FWF A;  3GX8 A;  2X64 A;  1X5D A;  4DSQ A;  1A2M A;  4NV5 A;  1KNG A;  4ISD A;  4HDE A;  1X9S B;  4CY6 A;  4OO5 A;  2R0G A;  1A8Y A;  1ZL9 A;  3EE2 A;  2LQQ A;  5ECP B;  5J5N A;  5CRE A;  2IMK A;  1OYJ A;  4TXO B;  4DSS A;  1J9B A;  1FOV A;  1HNA A;  4G19 A;  5J4U A;  1G0T A;  1PQN A;  1U87 A;  3SWL A;  3UVH A;  2H6X A;  4KSO A;  2GZZ A;  2LQO A;  2P0G A;  2YOI A;  3F63 A;  1NW2 A;  2VL2 A;  4WBR D;  3LYK A;  2B5E A;  4K2D A;  2K6V A;  1TU8 A;  5HFI A;  1FB0 A;  2VL2 C;  5CYY A;  4YKG A;  4IW9 A;  1AAZ A;  3HA9 A;  1XW5 A;  4BVY A;  2GST A;  5GSS A;  1F3B A;  2DML A;  4LLR A;  4F0B A;  1JZW A;  4PXO A;  4TVE A;  7GSS A;  3EPT A;  2CVD A;  3DD3 A;  4ZBD A;  1QK8 A;  2VKZ G;  4J2F A;  1OC9 B;  3KP8 A;  1J0F A;  4KH7 A;  3F3Q A;  2V1M A;  5DQS A;  1FOH A;  1R4W A;  3RHC A;  4BVX A;  2HT9 A;  3G7J A;  2I9H A;  2LJR A;  1SYR A;  2YWN A;  5DBQ A;  4GLT A;  5J41 A;  2WUL A;  4MMM A;  3KTL A;  3IE3 A;  2H1D A;  3UVT A;  3P8W A;  2VCW A;  5H5R A;  1ZYQ B;  2X8G A;  3UJ1 A;  4N30 A;  3M0F A;  2GLR A;  4YH2 A;  4PQI A;  1K0M A;  3GN3 A;  2G0F A;  3P7X A;  4ZL9 A;  3D4M A;  4K6X A;  2IFQ B;  4MP4 A;  4Q5N A;  5B6N A;  1TI1 A;  5A4W A;  2M72 A;  1A23 A;  4ACS A;  4K8M A;  3G7I A;  5ECN B;  3KZQ A;  4G9H A;  1QUW A;  4WEY A;  3L9U A;  4G0I A;  3ZLP A;  1WP0 A;  4ICY A;  2CA8 A;  1TU7 A;  1WIK A;  5KOW A;  3KMN A;  4PNG A;  1BQ7 A;  1YDK A;  4G2E A;  3QAW A;  3RHB A;  4KF9 A;  3DEX A;  5DAL B;  3NIV A;  3VWU A;  5JWO B;  4PTS A;  2NVL A;  1QFN A;  3MAK A;  3A5W A;  2I1U A;  3D5J A;  4L5L A;  3RDW A;  3ZMK A;  3EUR A;  2IIY A;  2B3S A;  4L5O A;  1MDI A;  4MZC A;  1F3A A;  2JZT A;  1TRW A;  3KXO A;  4IP6 A;  2CZ3 A;  1N2A A;  3LWA A;  3FKF A;  3NZN A;  6GSX A;  2PVQ A;  1C72 A;  3H4K A;  4L0U A;  2YJH A;  2R4V A;  2IMF A;  3TCO A;  4TR1 A;  1G7O A;  2R0P A;  2HSN A;  4EKZ A;  3C71 A;  1M9B A;  5IO2 A;  4F2I A;  2YWM A;  1ZYE A;  3H8Q A;  5IMZ A;  1K3Y A;  3LXT A;  2QA2 A;  2A4H A;  3LSZ A;  4HJM A;  4IN0 A;  4OWY A;  1YJ6 A;  1EZK A;  3IR4 A;  3Q6O A;  1SKW B;  1XW6 A;  2PWJ A;  3UEM A;  3FMW A;  5H5Q A;  1CQH A;  4EL1 A;  4PUR A;  3N9J A;  5HR3 A;  1YEW C;  4BA7 A;  1FVK A;  4TR4 A;  3GL3 A;  2DLX A;  2GVP A;  19GS A;  5KOX A;  1T00 A;  1JLW A;  3DVW A;  2LEG A;  4MLY A;  1A2L A;  4ML1 A;  2H73 A;  4HUA A;  2DJ3 A;  1M7T A;  1NM3 A;  3VPQ A;  2WW2 A;  3QOU A;  3KMO A;  3MYD A;  2DBC A;  4KCA A;  2PBJ A;  2HRA A;  1TI3 A;  4RI6 A;  4J57 E;  1K0C A;  3QD9 A;  3IXR A;  1ZCP A;  2EFE A;  3FZ4 A;  2DJ2 A;  4N11 A; 
#chains in the Genus database with same CATH homology
 1LJR A;  1O81 A;  3KH7 A;  3ZZX A;  4WF4 A;  3G9B A;  2MMZ A;  4IKH A;  3TKS E;  2AV4 A;  1S3D A;  2OE3 A;  2YZU A;  3DWV A;  2K18 A;  1DSB A;  4TXO A;  3TOT A;  3HVS A;  1Y25 A;  4ZB8 A;  3EIN A;  1HQO A;  2LV3 A;  2HNL A;  1WE0 A;  2WZ9 A;  5FT3 A;  2C80 A;  2CVK A;  2H01 A;  4L0W A;  4KSM A;  1FO5 A;  3CYN A;  4Z2U A;  1XW9 A;  1YZX A;  4TN8 A;  5D9X A;  1TKD B;  2OAC A;  3CTG A;  1T3B A;  4ZB7 A;  2FWH A;  5HR2 A;  4MJB A;  1VF3 A;  3GMF A;  2DJ1 A;  5KN0 A;  3IOS A;  4OFM A;  3IV4 A;  3VFI A;  3ZML A;  1A2J A;  2XBI A;  2IMD A;  2EFH A;  1TRS A;  4GTU A;  1OC9 A;  2L6D A;  2A2R A;  6GST A;  4RUV A;  1XBS A;  4EUY A;  2HZE B;  3TJJ A;  1YEX A;  5CRH A;  2A2P A;  3CBU A;  3VUR A;  2EIQ A;  2H71 A;  3GA4 A;  5ECO B;  1AQX A;  3A2X A;  4G01 A;  6GSS A;  1GH2 A;  1XZO A;  2H0H A;  3L4N A;  3ERG A;  3R2Q A;  4XIH A;  5CRD A;  4RQX A;  3M9J A;  2VLU A;  3Q18 A;  1ZOF A;  3W6G A;  1B8X A;  1WWJ A;  2H75 A;  2H1L A;  4O5Q A;  1YF0 A;  1SK1 A;  4QMK A;  2IFQ A;  2WB9 A;  5HFG A;  2HSH A;  4RQR A;  3M9K A;  1EGR A;  1IYI A;  2ON7 A;  3W8S A;  3MDK A;  5EL8 A;  1Z7P A;  2G2Q A;  5DVB A;  3FYG A;  3QAV A;  1IYH A;  1GUL A;  5AIS A;  22GS A;  3EWL A;  3C1S A;  3E3E A;  2KLX A;  3QFB C;  3ZTL A;  2RLI A;  1TDI A;  4WXT A;  3RPN A;  1TK0 B;  3KEB A;  4O7H A;  1XCC A;  4ECC A;  3IK9 A;  1XWA A;  1Z6N A;  1PL1 A;  2I4A A;  2FA8 A;  2GSS A;  2GT5 A;  5IMV A;  4WBJ A;  2GGT A;  1K0B A;  3EMP A;  5DAL A;  3IBH A;  1SU9 A;  3WGX A;  3S9F A;  3TJF A;  4BWS A;  1AXD A;  2L6C A;  1UVZ A;  2CAQ A;  1ERU A;  1U3I A;  3D22 A;  1WOU A;  4ZXG A;  3TUE A;  1XWK A;  4F0C A;  4IQA A;  1ZMA A;  1T4Y A;  1RK4 A;  1GUK A;  1JLV A;  3TJG A;  4Q5F A;  1I9D A;  2EFD A;  2FNO A;  1G7E A;  4IS0 A;  1UN2 A;  2LS5 A;  3C7M A;  2YAN A;  1V57 A;  1XOA A;  2FHE A;  4TR3 A;  1DE1 A;  2YV9 A;  2NBS A;  5IOW A;  3F4T A;  2MBT A;  4RI7 A;  2WGR A;  3UBL A;  3TOU A;  2GQL A;  2AJQ B;  4NV2 A;  2IJY A;  1AW9 A;  1GTB A;  4AI6 A;  2R0C A;  4JU5 A;  2X4A A;  2O87 A;  4LL4 B;  2C3Q A;  4PNF A;  3HJM A;  4FYU A;  5BMU B;  1F2E A;  3A3T A;  2X8H A;  2PVO C;  3G7Y A;  4J56 E;  4MDC A;  3W8J A;  2V6O A;  2C3T A;  4N10 A;  2XHF A;  4WR5 A;  3VK9 A;  2E2M A;  4OMV A;  4X1U A;  1EWX A;  1M2A A;  1MDK A;  1YEP A;  2PGT A;  1BX9 A;  3HCZ A;  4XHM A;  3IAS 2;  5ECI B;  2L4C A;  2E2G A;  3LJR A;  4KE3 A;  5ECH B;  1O8X A;  1M0U A;  1Z5Y E;  3L0H A;  3I6A A;  3VLN A;  3KP9 A;  2CAI A;  3D0Z A;  4K0N A;  3L78 A;  5FWG A;  4E8H A;  2RM6 A;  4IEL A;  4MH2 A;  2HXK A;  2IME A;  1UA5 A;  4GWR A;  5HR1 A;  1XWC A;  3GYK A;  1SJZ A;  4KCE A;  4EDZ A;  2MMN A;  4IVF A;  2HLS A;  3US3 A;  2H1A A;  5ECR B;  1BYE A;  1USB A;  1J08 A;  2NDO A;  2AYT A;  1GNE A;  1VF2 A;  2PER A;  2I81 A;  3ZRD A;  2HQT A;  4AJ8 A;  4HU7 A;  4G0L A;  2ALB A;  2VD1 A;  5A5K A;  2IPA A;  1X5E A;  4OFN A;  3QPM A;  1G6Y A;  3GRX A;  4I5Q A;  2FCH A;  2EFC A;  5ELA A;  2HRK B;  1SD8 A;  1PMT A;  4XRA A;  2VM2 A;  3CSH A;  3F4R A;  1TXU A;  4XCS A;  1XVW A;  1MDJ A;  1B9X C;  4X4J A;  1AQV A;  3CSJ A;  3KIJ A;  5D8I A;  1F9M A;  4Z2T A;  1TXX A;  2VM1 A;  3CSI A;  3GV1 A;  2OBI A;  2KUC A;  5CRG A;  1RW1 A;  3EC3 A;  3O6T A;  2M80 A;  4PUA A;  3MIX A;  3I9V 2;  4ZB9 A;  2H72 A;  1BED A;  4V1A p;  2H8L A;  2V41 A;  3TRX A;  4K5S A;  4JR4 A;  1GTU A;  4IJ3 A;  5LD0 A;  2DIZ A;  11GS A;  5G30 A;  3H79 A;  1K3L A;  4ZBA A;  2HZE A;  1V2A A;  3DGQ A;  2MYG A;  4OCF A;  4PUF C;  5G2Z A;  2YJ7 A;  2O85 A;  2A4V A;  3ME7 A;  4P3Y B;  4D73 B;  2O7K A;  4HZ2 A;  1SKR B;  5IM9 A;  3WYW A;  3IA1 A;  2YPM A;  6GSV A;  2YN1 A;  4Q5Q A;  4EXJ A;  3GX0 A;  1ST9 A;  1DUG A;  1H75 A;  1T1V A;  1BF5 A;  3F0I A;  4X0X A;  1OC8 A;  3TKP A;  2KHP A;  2YNX A;  2GS3 A;  4KUN A;  1GLQ A;  2XPD A;  3IPZ A;  3EU4 A;  4ML6 A;  4ECB A;  2LJK A;  3D4T A;  4FIW A;  5CP1 A;  2XBQ A;  4GST A;  1SK2 A;  1YF1 A;  2X8C A;  1AQW A;  4K7O A;  5B8B A;  1B4P A;  4A5P A;  1ON4 A;  5DAK B;  3APS A;  1EGO A;  4FYC A;  2OAD A;  4NAX A;  3QFA C;  4K1F A;  4AGS A;  2WDU A;  1TRV A;  3WD6 A;  3ERW A;  2HRF A;  1FHE A;  4MF5 A;  4TW5 A;  2BJX A;  3BJ5 A;  1MD3 A;  3ZIJ A;  3L9S A;  5AN1 A;  3U5R E;  2PMT A;  4E68 A;  3KM6 A;  2JZS A;  2DC5 A;  2DJJ A;  3RPP A;  1WRY A;  2OE1 A;  5IO0 A;  1NSW A;  4EIP A;  3F4S A;  4ZBB A;  4ZB6 A;  3IHG A;  5DQY A;  2FY6 A;  2BTO T;  3ZYW A;  4PGT A;  3IHQ A;  5JWR B;  4QL7 A;  4KND A;  3CRU A;  4NHZ A;  2H19 A;  1TW9 A;  3F6D A;  2B1L A;  5D73 A;  1H4O A;  4F9Z A;  3HVV A;  1A0F A;  4F03 A;  5BMU A;  3PH9 A;  4GXZ A;  5F0G A;  3ZFB A;  2FD3 A;  3ZIV A;  2FWG A;  3GST A;  3ED3 A;  5EVO A;  3HZ4 A;  5C04 A;  2XPE A;  4IQ1 A;  3TU3 B;  5J4Y A;  4TRX A;  2GZY A;  3Q19 A;  5A4U A;  3BCK A;  5DJM A;  1EP8 A;  5IMA A;  5B8A A;  2QC7 A;  2M46 A;  4PQH A;  4W66 A;  3FR6 A;  3LW9 A;  2HE3 A;  3CXG A;  3O76 A;  2R2J A;  2JZR A;  2TRC P;  2C4J A;  3O3T A;  5A5H B;  1GSD A;  1B48 A;  2HSY A;  4MJC A;  3GUS A;  4CW9 A;  5FHI A;  1R26 A;  2RUF A;  3HJO A;  1K0A A;  3ZFL A;  5IOX A;  2PUK C;  1URM A;  2EIR A;  2QSI A;  4EVM A;  3PGT A;  2DJ0 A;  2R3X A;  3ZRE A;  2VOC A;  2A2S A;  3HYP A;  4CY8 A;  3BBY A;  5IPH A;  2HRK A;  4TR0 A;  1THO A;  1Z3E A;  2O89 A;  4NWY A;  2RM5 A;  1GSS A;  2JU5 A;  5F05 A;  3C1R A;  4EO3 A;  3FZ9 A;  2F8F A;  1XPV A;  1KTE A;  3V1W A;  2WCI A;  1QXH A;  1EV9 A;  1EEM A;  1K0N A;  4GCI A;  3P90 A;  3FK8 A;  2QKE A;  3P2A A;  3Q74 A;  3GNJ A;  1GTA A;  4AKG A;  2DIY A;  1SEN A;  3D21 A;  5H5S A;  1PL2 A;  3QDN A;  3CTF A;  2MBS A;  2H0I A;  2R5G A;  3TKR A;  3I69 A;  3WT1 A;  4ULX A;  2YWO A;  4D73 A;  3WT2 A;  2R6K A;  3QCP A;  1SL1 B;  4DVC A;  2WRT A;  1E6B A;  2C8U A;  3D6I A;  4GQC A;  3H93 A;  2B7J A;  2VL3 A;  3A5I A;  1BG5 A;  3GKN A;  5COH A;  5CRW A;  3J7Y k;  4KX4 A;  5EPF A;  5GAP D;  3LEF A;  1QGV A;  4OD7 A;  5DDL A;  4HJ2 A;  1V98 A;  1Z7R A;  1EEJ A;  2LTK A;  1DBY A;  3KGK A;  2NTO A;  2VCZ A;  4MAB A;  1R7H A;  4V2L A;  1ZZY A;  2GTU A;  5D9V A;  1YQ1 A;  3LGC A;  1EV4 A;  2OJL A;  4DEJ A;  1ILO A;  6GSU A;  1X9W B;  4FO5 A;  3LXZ A;  2CX3 A;  3HJP A;  3F9U A;  4I2T A;  2UV8 G;  1N25 A;  4LMW A;  4FH8 A;  2LRT A;  5LNK e;  3KD0 A;  3JCM L;  4HQZ A;  4XS4 B;  5G5F A;  4IHU A;  5DAK A;  2WJU A;  2AUV A;  4K9Z A;  3VWW A;  2DKH A;  1GNW A;  4YAP A;  2B6M A;  1XWB A;  2L57 A;  5J40 A;  4QL9 A;  5IIZ A;  2OBK A;  2KOK A;  2KP1 A;  4PQ1 A;  1ZYP A;  4G0K A;  1VGL A;  3TJK A;  2HZF A;  2H76 A;  2ZUP A;  1SL0 B;  3ZVJ A;  1YKC A;  2B7K A;  3I43 A;  5AIX A;  2VCQ A;  3MWH A;  1HYU A;  2IWT A;  2V2G A;  3IAM 2;  4HZ4 A;  2CV4 A;  2HI7 A;  1F6M C;  5CNW A;  2AB6 A;  1Z6M A;  4NMU A;  4GRF A;  2K8V A;  1SVO A;  4POB A;  2H1G A;  4MZB A;  1GSU A;  3ZL5 A;  5A1N B;  1TJD A;  2WFC A;  4I2U A;  2LUS A;  2QGV A;  4TOP A;  2VCV A;  5IMC A;  5IMF A;  3SBC A;  5E59 A;  1R5P A;  1GUH A;  2VAF A;  4TKY A;  3GH6 A;  4BWQ A;  3FRC A;  1OE8 A;  1U6T A;  2H6Y A;  2MMA A;  2GQK A;  5G1L A;  5B6M A;  3ME8 A;  2DMM A;  1OE7 A;  3KCM A;  2RUE A;  1EP7 A;  1YVL A;  1N8J A;  2F51 A;  3LYP A;  2I3Y A;  2IL3 A;  3HZ8 A;  4IGJ A;  3FY7 A;  3CMI A;  4KDU A;  5GAN D;  4K7N A;  2DSA A;  4YQM A;  4GQF A;  2UZ8 A;  5F06 A;  4XS1 A;  4POM A;  3TB2 A;  2JAD A;  1ERV A;  4O92 A;  1MTC A;  4JE1 A;  1WMJ A;  4KDY A;  2H6Z A;  2REM A;  1UC7 A;  2HSM A;  1ERT A;  5A5H A;  1PKW A;  2LKU A;  1M2B A;  1VF4 A;  3QMX A;  4F82 A;  1GP1 A;  2IMI A;  5ENU A;  3EU3 A;  1XIY A;  3GH9 A;  4OCE A;  3FW2 A;  2RII A;  1JHB A;  3TGZ A;  2D2Z A;  5DCG A;  1G6W A;  3FR3 A;  5C00 A;  3MNG A;  4MCU A;  1KBN A;  3R3E A;  4GSS A;  2YWI A;  2C0G A;  2FA4 A;  2FWE A;  1MD4 A;  4AJ7 A;  1HD2 A;  2DKI A;  2XC2 A;  2JSY A;  3IC8 A;  5JWQ B;  3QR6 A;  3GFK A;  1YY7 A;  5ECM B;  1ERW A;  4NXI A;  2B5Y A;  4XS6 A;  1O6J A;  1AIU A;  2VIM A;  3GUR A;  1Z9H A;  5BRT A;  4ZIL A;  1PSQ A;  5DJL A;  3HHV A;  4GSN A;  2F8A A;  4Z2R A;  3M8N A;  4USS A;  4O32 A;  2GSQ A;  5ECS A;  2R37 A;  4MF7 A;  1WPI A;  4CHS A;  2L4Q A;  1PX7 A;  3PIN A;  4LMV A;  3RBT A;  2L5L A;  4LL1 B;  5JCG A;  1U88 A;  2GDR A;  3UAP A;  1TK5 B;  4ZL7 A;  1V40 A;  4LA1 A;  2BMX A;  1I5G A;  3TKQ A;  2FGX A;  2MZC A;  2VCX A;  5B7C A;  2FUG 2;  3PR8 A;  1BAY A;  4YAV A;  3J7Y b;  4MPG A;  2QA1 A;  1GLP A;  1F37 A;  4ECJ A;  2PN8 A;  4K2X A;  3IRA A;  2JAC A;  5F07 A;  2O5V A;  1AC1 A;  4KA0 A;  3DRN A;  1XOB A;  1MEK A;  5F8B A;  1SKS B;  4WF5 A;  3GHA A;  2CQ9 A;  2OKA A;  2P31 A;  2TRX A;  4WET A;  1B4Q A;  2VLT A;  1HNB A;  1SJ6 A;  2B1K A;  4QQ7 A;  2LNS A;  5HQP A;  2OA7 A;  2GZP A;  3IC4 A;  3DXB A;  4AKX B;  1EOH A;  2B5X A;  3BD2 A;  4HQS A;  5D9T A;  4MH3 A;  3ZVJ D;  1W89 A;  5AGY A;  4WKW A;  1PKZ A;  5ECK B;  13GS A;  1ML6 A;  4XS4 A;  2N5F A;  3TKS A;  4N0Z A;  2VO4 A;  1ACV A;  3CWG A;  3FR9 A;  4BL7 B;  3EVI A;  3DKS A;  1ABA A;  2O8V B;  1XXU A;  5E4W A;  3TKS C;  4V1A g;  5ID2 A;  3GSS A;  2JSZ A;  1T4Z A;  1JZD A;  1FG4 A;  3GKK A;  4HOJ A;  4OO4 A;  1Q4J A;  4K0G A;  4ECI A;  1BG1 A;  3FZ5 A;  3LOR A;  2F3M A;  4EF0 A;  4MZW A;  3TJB A;  2EC4 A;  5J47 A;  4K5R A;  3GIX A;  4HI7 A;  3VWX A;  1JZO A;  5A34 A;  1SL2 B;  5ECL B;  1A24 A;  1XFL A;  3KH9 A;  5CAX A;  4XTS A;  4I97 A;  4IJI A;  5A1N A;  2ZCT A;  3F6F A;  3HD5 A;  1GTI A;  5GZZ B;  2E7P A;  2J9H A;  3MSZ A;  1NHY A;  4IBP A;  4HU9 A;  3WGD A;  4AJ6 A;  2H30 A;  3UMA A;  3N5O A;  4V2M A;  2H70 A;  3APO A;  4DSR A;  1SK0 A;  2OT3 A;  3ZIT A;  2GT6 A;  1ZGN A;  2K9F A;  4ILF A;  1O8W A;  2V6K A;  1TTZ A;  4O5U A;  14GS A;  1O85 A;  4O5R A;  4JR6 A;  4KDX A;  4AKI A;  3WGE A;  5EY6 A;  3GKM A;  2VL9 A;  3HDC A;  1PA3 A;  4ZIJ A;  3A2W A;  3DML A;  3UL3 A;  4H86 A;  3FHK A;  4NPB A;  1Y6E A;  1JZR A;  4POL A;  1GSF A;  2AAW A;  5D96 A;  2YCD A;  4E8E A;  2VD0 A;  3VWV A;  1VRS D;  1TRU A;  1PGT A;  1TOF A;  2CVB A;  1M99 A;  1FAA A;  2OE0 A;  5ELG A;  2TIR A;  5HFK A;  2HYX A;  3AY8 A;  4FYB A;  1Q98 A;  3HMJ G;  3M3M A;  1OKT A;  1NHO A;  2F9S A;  5J3R A;  1KEB A;  2HSM B;  1GL8 A;  6GSY A;  3GTU A;  4JRR A;  5KN2 A;  2LNT A;  1LBK A;  2IN3 A;  3QAG A;  4EIQ A;  4ID0 A;  1X9M B;  2AHE A;  2HFD A;  3VI7 A;  2KP2 A;  1M9A A;  2K8S A;  4JZQ A;  5IPG A;  3GL5 A;  1K3O A;  1JFU A;  1DE2 A;  1XVQ A;  5INY A;  2ON5 A;  3VPT A;  4N3Z A;  1X0R A;  1FB6 A;  4N0V A;  4AKH A;  4YQV A;  1K0O A;  5D93 A;  4MJA A;  1CQG A;  4GF0 A;  1HNC A;  1R5A A;  1OC3 A;  5A4V A;  3TRP A;  4FQU A;  20GS A;  1O73 A;  1THX A;  1XWG A;  5AIV A;  4DSS B;  2N5B A;  3APQ A;  2GSR A;  4JED A;  1OKD A;  1PN0 A;  4BPY A;  2VUP A;  5JCW A;  2P5Q A;  2ZNM A;  4AF2 A;  3HY2 A;  4MNN A;  1SJI A;  1SD9 A;  5IQY A;  1OVN A;  3C8E A;  4NHW A;  3IK7 A;  3DIE A;  2H1B A;  4BVY B;  3GKX A;  4KB3 A;  3EYT A;  4PX1 A;  1T8E B;  2YP6 A;  4Z7X A;  3FZA A;  4ZL8 A;  1FVJ A;  1QQ2 A;  1S3A A;  1EOG A;  1SVL A;  18GS A;  1GWC A;  1W4V A;  4OFT A;  4IP1 A;  3PPU A;  1WJK A;  1LU4 A;  4BVX B;  2C3N A;  1ZYN A;  3DYR A;  1GUM A;  2CT6 A;  3ISO A;  1T7P B;  1RQM A;  2GQM A;  3HXS A;  2VCT A;  3UAR A;  4EC0 A;  5IMD A;  5GST A;  3K8N A;  3LFL A;  3EMX A;  1OAZ A;  2ES7 A;  1YKA A;  1PD2 1;  4EDY A;  3DVX A;  2J23 A;  4GDF A;  2HRN A;  3LQ7 A;  4G10 A;  4EE0 A;  1V58 A;  4Q5R A;  4BL7 A;  4L8E A;  1K0D A;  1PRX A;  12GS A;  5ID2 B;  5G5E A;  5G1K A;  1PX6 A;  3ERF A;  1V9W A;  2C1Y A;  2WS2 A;  2NPB A;  2L59 A;  2N5A A;  3HVX A;  4MPF A;  16GS A;  1TP9 A;  1A8L A;  1AUC A;  5LCZ A;  2H74 A;  3VI5 A;  10GS A;  2EIO A;  5CO3 A;  3TDG A;  1B9Y C;  5A34 B;  3NOF A;  1O7U A;  5KN1 A;  4K7I A;  3M1G A;  1SVM A;  9GSS A;  1M2D A;  2LRC A;  3F3R A;  4X43 A;  3C73 A;  4MF6 A;  3FEU A;  2L5O A;  4YKF A;  2JL4 A;  5HR0 A;  3BOA A;  4MJE A;  3IDV A;  4V2N A;  3BCI A;  2E0Q A;  3OR5 A;  4MA9 A;  2V32 A;  6GSW A;  2VLV A;  1GSY A;  1Y1U A;  1SYX A;  4POK A;  3LG6 A;  4WR4 A;  4JBB A;  1FW1 A;  2FLS A;  5G31 A;  1VF1 A;  3KJY A;  2CZ2 A;  3UBK A;  2CX4 A;  4MK3 A;  3U6V A;  1QMV A;  4TR1 B;  1A0R P;  2HSN B;  5JCU A;  5DCH A;  3UOM A;  5ECQ B;  3RAZ A;  2P5R A;  1GSE A;  1U3A A;  5J9C A;  1TK8 B;  4HS1 A;  2C0E A;  5J4V A;  3E0U A;  2LJA A;  3A2V A;  4CDO A;  1E2Y A;  3TRQ A;  8GSS A;  4XRD A;  3HKR A;  3L9V A;  5KN3 A;  2X99 A;  4I6X A;  2YZH A;  4YQU A;  2C0D A;  1GRX A;  2PU9 C;  1GSQ A;  3KTB A;  5J9B A;  2X49 A;  3CRT A;  4HEA 2;  5L71 A;  1PN9 A;  2Z9S A;  2H66 A;  3GTU B;  1S3C A;  17GS A;  2YV7 A;  2LRN A;  5ABR A;  5D9W A;  3H1N A;  1BJX A;  1X5C A;  4KW6 A;  2MMO A;  2H0G A;  3F8U A;  4KGI A;  2PPT A;  4I8B A;  2C0F A;  3E9J B;  2LST A;  3UIW A;  5KEJ A;  4TXV A;  4KAE A;  2DJK A;  2FWF A;  3GX8 A;  2X64 A;  1X5D A;  4DSQ A;  1A2M A;  4NV5 A;  1KNG A;  4ISD A;  4HDE A;  1X9S B;  4CY6 A;  4OO5 A;  2R0G A;  1A8Y A;  1ZL9 A;  3EE2 A;  2LQQ A;  5ECP B;  5J5N A;  5CRE A;  2IMK A;  1OYJ A;  4TXO B;  4DSS A;  1J9B A;  1FOV A;  1HNA A;  4G19 A;  5J4U A;  1G0T A;  1PQN A;  1U87 A;  3SWL A;  3UVH A;  2H6X A;  4KSO A;  2GZZ A;  2LQO A;  2P0G A;  2YOI A;  3F63 A;  1NW2 A;  2VL2 A;  4WBR D;  3LYK A;  2B5E A;  4K2D A;  2K6V A;  1TU8 A;  5HFI A;  1FB0 A;  2VL2 C;  5CYY A;  4YKG A;  4IW9 A;  1AAZ A;  3HA9 A;  1XW5 A;  4BVY A;  2GST A;  5GSS A;  1F3B A;  2DML A;  4LLR A;  4F0B A;  1JZW A;  4PXO A;  4TVE A;  7GSS A;  3EPT A;  2CVD A;  3DD3 A;  4ZBD A;  1QK8 A;  2VKZ G;  4J2F A;  1OC9 B;  3KP8 A;  1J0F A;  4KH7 A;  3F3Q A;  2V1M A;  5DQS A;  1FOH A;  1R4W A;  3RHC A;  4BVX A;  2HT9 A;  3G7J A;  2I9H A;  2LJR A;  1SYR A;  2YWN A;  5DBQ A;  4GLT A;  5J41 A;  2WUL A;  4MMM A;  3KTL A;  3IE3 A;  2H1D A;  3UVT A;  3P8W A;  2VCW A;  5H5R A;  1ZYQ B;  2X8G A;  3UJ1 A;  4N30 A;  3M0F A;  2GLR A;  4YH2 A;  4PQI A;  1K0M A;  3GN3 A;  2G0F A;  3P7X A;  4ZL9 A;  3D4M A;  4K6X A;  2IFQ B;  4MP4 A;  4Q5N A;  5B6N A;  1TI1 A;  5A4W A;  2M72 A;  1A23 A;  4ACS A;  4K8M A;  3G7I A;  5ECN B;  3KZQ A;  4G9H A;  1QUW A;  4WEY A;  3L9U A;  4G0I A;  3ZLP A;  1WP0 A;  4ICY A;  2CA8 A;  1TU7 A;  1WIK A;  5KOW A;  3KMN A;  4PNG A;  1BQ7 A;  1YDK A;  4G2E A;  3QAW A;  3RHB A;  4KF9 A;  3DEX A;  5DAL B;  3NIV A;  3VWU A;  5JWO B;  4PTS A;  2NVL A;  1QFN A;  3MAK A;  3A5W A;  2I1U A;  3D5J A;  4L5L A;  3RDW A;  3ZMK A;  3EUR A;  2IIY A;  2B3S A;  4L5O A;  1MDI A;  4MZC A;  1F3A A;  2JZT A;  1TRW A;  3KXO A;  4IP6 A;  2CZ3 A;  1N2A A;  3LWA A;  3FKF A;  3NZN A;  6GSX A;  2PVQ A;  1C72 A;  3H4K A;  4L0U A;  2YJH A;  2R4V A;  2IMF A;  3TCO A;  4TR1 A;  1G7O A;  2R0P A;  2HSN A;  4EKZ A;  3C71 A;  1M9B A;  5IO2 A;  4F2I A;  2YWM A;  1ZYE A;  3H8Q A;  5IMZ A;  1K3Y A;  3LXT A;  2QA2 A;  2A4H A;  3LSZ A;  4HJM A;  4IN0 A;  4OWY A;  1YJ6 A;  1EZK A;  3IR4 A;  3Q6O A;  1SKW B;  1XW6 A;  2PWJ A;  3UEM A;  3FMW A;  5H5Q A;  1CQH A;  4EL1 A;  4PUR A;  3N9J A;  5HR3 A;  4BA7 A;  1FVK A;  4TR4 A;  3GL3 A;  2DLX A;  2GVP A;  19GS A;  5KOX A;  1T00 A;  1JLW A;  3DVW A;  2LEG A;  4MLY A;  1A2L A;  4ML1 A;  2H73 A;  4HUA A;  2DJ3 A;  1M7T A;  1NM3 A;  3VPQ A;  3QOU A;  3KMO A;  3MYD A;  2DBC A;  4KCA A;  2PBJ A;  2HRA A;  1TI3 A;  4RI6 A;  4J57 E;  1K0C A;  3QD9 A;  3IXR A;  1ZCP A;  2EFE A;  3FZ4 A;  2DJ2 A;  4N11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...