2VCQA

Complex structure of prostaglandin d2 synthase at 1.95a.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vcqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vcqA01
4RI7A 5IQYA 3ZL5A 1WIKA 4XS4A 1JZOA 1Y25A 1NM3A 3TDGA 1GTAA 3KXOA 2VCZA 5D9TA 2B6MA 2AJQB 3IHQA 2FY6A 4MK3A 3IRAA 3FKFA 3HYPA 4HDEA 3TJGA 2LJKA 4NAXA 4KX4A 2KP2A 5ABRA 2H0HA 3VI7A 3CRUA 2QGVA 5CRGA 3UJ1A 3GIXA 2OE3A 3GKNA 2DBCA 3FR6A 4HI7A 2ZUPA 3HVXA 1XWCA 4D73B 4NMUA 20GSA 1W4VA 3L9SA 1OKTA 5GAND 3HD5A 1GNEA 3GL3A 5G5FA 3GHAA 4DSQA 2N5BA 3D22A 3U5RE 2LJRA 1WMJA 4X0XA 4XRAA 2RUEA 2LQQA 3HJMA 4ECBA 3P8WA 5IM9A 4L5OA 3L9VA 4N0VA 2M46A 1ABAA 4XS6A 2VAFA 2I1UA 3FEUA 1MTCA 1VGLA 3KH9A 3FW2A 1EV9A 4WXTA 2H66A 2H8LA 2DLXA 2ES7A 4IQ1A 2HE3A 1TI1A 3OR5A 1SKRB 3APSA 3UOMA 1SK2A 1Z6MA 4IQAA 2C0EA 3IBHA 2HI7A 3TGZA 5DBQA 3SWLA 1B9YC 1J9BA 2L6CA 13GSA 1T00A 2F51A 4F82A 1U3AA 5B6MA 1ZOFA 1WJKA 2KHPA 3GKKA 3CSHA 3IV4A 5DJMA 2YPMA 3FY7A 1FVJA 2V32A 4FO5A 3WGDA 2HRKA 1S3AA 2DJ3A 3FRCA 5A4WA 2PVOC 4YH2A 3LWAA 5B8AA 1TI3A 4EUYA 5G5EA 1WOUA 1WWJA 1TU7A 3ZIVA 4IELA 1THXA 1B4QA 2CVBA 1ML6A 2VOCA 1TP9A 2YWNA 2CZ2A 2FWFA 2CAIA 1BX9A 2C0DA 1PA3A 4O92A 3N5OA 2VD0A 3VK9A 3RPPA 4I8BA 3G9BA 3VI5A 5GSSA 1HNBA 1VF1A 4KUNA 1SKSB 4IKHA 3TKQA 4OFTA 2LRNA 4NWYA 3GX8A 2YANA 4KAEA 1MDJA 1TRWA 4MZCA 4MP4A 3I43A 2JSZA 4GF0A 2VL2A 2CQ9A 1SK1A 4PUAA 3LQ7A 4J2FA 4ILFA 2VCTA 1FAAA 1I9DA 2P31A 1ERVA 3EURA 2CX3A 3DMLA 3IDVA 2FUG2 1K0OA 2KLXA 2H1GA 4TVEA 3TJJA 3TKSE 1GTBA 1FOVA 4ZL8A 2RUFA 1GNWA 1A0FA 3IK9A 1M0UA 4HUAA 1PX7A 2VIMA 4MJAA 4AJ6A 4OO5A 1BQ7A 1X5EA 3A2WA 1ZGNA 4H86A 2H73A 2CZ3A 1O8WA 1BYEA 3QFBC 2HRFA 1UC7A 1TK5B 2KOKA 2R6KA 4N0ZA 1OC9B 3LGCA 1SJZA 4KH7A 4N10A 2HFDA 2LNTA 3FZAA 2TIRA 2JZRA 3GTUA 3FZ9A 1OC8A 2YP6A 2LTKA 3DEXA 3CYNA 4GXZA 3G7IA 1W89A 4PXOA 2HYXA 3APOA 4NPBA 1VF4A 5AIXA 4FYUA 1UN2A 5D96A 1C72A 3TJFA 4HZ4A 4ZBBA 1SD8A 5GAPD 1KBNA 5H5QA 4EE0A 3IR4A 3R2QA 3TKSC 1XWGA 3M8NA 5A4VA 4XS1A 4OD7A 5C00A 3ZIJA 4KA0A 1TKDB 2NTOA 4BVXA 3GKXA 5ECNB 4ML6A 3PGTA 1IYHA 2VCWA 3ZMKA 2HRAA 5ECIB 2B5EA 2K8VA 4XHMA 4DVCA 3G7YA 3CTGA 3TB2A 5F0GA 2E7PA 1QXHA 3BJ5A 3CBUA 3RBTA 3ZVJA 1F9MA 2DJ2A 2OE0A 1S3CA 4MZBA 1O81A 5HR1A 5ECHB 1A2JA 2H70A 3KMNA 2H6XA 4ZB9A 3CXGA 3EU3A 5JCWA 3BCIA 5D9XA 2RM6A 5CRDA 4G10A 3N9JA 3M0FA 3R3EA 2H0GA 5IMAA 2V41A 1PMTA 5HFIA 4N11A 4KDUA 2QKEA 3PH9A 4GSSA 5ID2A 6GSXA 4ZBAA 2J23A 2VL2C 3TKRA 3H1NA 1V9WA 3ZVJD 4JRRA 1YKAA 1T4YA 1Z5YE 2FWHA 3TRPA 3DGQA 3A2VA 2HXKA 3HXSA 3LSZA 4HQZA 4X1UA 3QDNA 1H4OA 3WT2A 4JEDA 1WP0A 5CO3A 4YQUA 1ZYEA 2GTUA 4TR1B 1GSYA 5JCUA 6GSTA 3GMFA 1RQMA 4GQCA 2GT6A 3VWUA 2VUPA 3ZZXA 4BVYB 4EVMA 2MMNA 3NOFA 4GQFA 2X64A 5HR3A 5CYYA 5A5KA 4DSSB 1RK4A 3MWHA 5D8IA 2QC7A 4OMVA 4WR4A 1FW1A 3Q74A 1SENA 2O85A 2L57A 4EO3A 5ECKB 3J7Yk 3GKMA 3LYKA 1GSQA 3KD0A 1V57A 4K8MA 1ZMAA 1ZCPA 1SYRA 1MD3A 4LL4B 4WR5A 3FR3A 1YEPA 1XFLA 5DALA 1SD9A 1GSSA 1PSQA 2I3YA 2MMOA 1KTEA 3HCZA 2LRTA 5INYA 5ECPB 2FLSA 4TRXA 2LSTA 4HZ2A 12GSA 2J9HA 2XPEA 3QCPA 4J56E 4PUFC 5G30A 3VWWA 1TK8B 1KNGA 2IFQB 4RQRA 2R2JA 3ZTLA 5IMZA 2LQOA 2PVQA 4PNGA 4Z7XA 4KCAA 3LORA 1B8XA 3KZQA 4BL7B 2X8GA 3TKPA 2DJJA 3US3A 3UVTA 1TXXA 2F8AA 1VF2A 1GULA 4KSOA 1K0CA 4AF2A 3IK7A 2GQKA 3TJBA 5HFKA 4YAPA 2B5XA 4MF5A 1S3DA 2HZEB 1K0AA 2B3SA 2H76A 4ECJA 3O76A 1SL2B 1M2BA 2MBTA 4KGIA 3Q18A 4POBA 3C1RA 4IBPA 3L78A 2IFQA 2HSNB 1YDKA 4MF6A 2H74A 5KN0A 3HZ8A 1K0MA 3QAGA 5GZZB 1GSFA 4MF7A 1AIUA 4TKYA 5EY6A 1NSWA 3HDCA 5F06A 2WULA 3LXTA 2YV9A 3M1GA 4WEYA 1GP1A 3TJKA 4HU9A 3KM6A 2H19A 5BMUA 1YY7A 1E2YA 4TXOA 1QUWA 3C71A 4OFNA 2L6DA 1UVZA 2HSMA 2JL4A 2GSSA 3ERWA 5HQPA 2RM5A 2R37A 4NHWA 4ISDA 4P3YB 2E2GA 5F8BA 2F3MA 3CSIA 2CA8A 2C0GA 3L4NA 2H1BA 1SJ6A 1K3OA 4IJ3A 3KIJA 2HT9A 3KJYA 4PQ1A 2GQMA 2GSQA 1TU8A 3VWXA 1PKZA 2DC5A 4TN8A 1TRVA 2CV4A 1X9MB 1T3BA 1M2DA 2GZPA 3DVXA 5D93A 2H1AA 5DQSA 5D9VA 3GH6A 1YF0A 4WF5A 4PGTA 3MDKA 3PINA 2LJAA 5GSTA 5JWQB 5HFGA 2C1YA 3VPQA 1PL2A 4O5RA 3WD6A 2VD1A 2DJKA 1F3AA 3FZ5A 4HU7A 3UBLA 4JR4A 3G7JA 4F0BA 2B1KA 4D73A 3SBCA 4AJ8A 4TR0A 1FG4A 4JBBA 2E0QA 3UMAA 1DE2A 1DUGA 2V2GA 4FYCA 3JCML 2GGTA 2EIOA 2X8CA 3Q19A 3LYPA 3RPNA 3GUSA 3HJOA 2XBQA 4HS1A 1SKWB 3RHBA 2C0FA 1TJDA 2PUKC 4V1Ap 3S9FA 1R5AA 3ZREA 5IMVA 3H4KA 4V1Ag 2DMLA 5B7CA 5AISA 3WGEA 3TCOA 4JE1A 1G0TA 5AGYA 2FNOA 1A24A 1XWKA 3C73A 3F3RA 2NBSA 2VLTA 4ZB8A 3ERGA 5DQYA 1TDIA 4WETA 1YKCA 4GCIA 2FA4A 3GFKA 5DCGA 3CMIA 3DKSA 3IC8A 1E6BA 1JFUA 5J41A 2K8SA 1GUHA 1SL1B 4GLTA 1XIYA 5L71A 1X0RA 2H6ZA 4OCFA 1Z3EA 5DJLA 2ON7A 3UAPA 1OE7A 5IO0A 2FA8A 4PQHA 1T1VA 3F9UA 4POKA 2GVPA 3HA9A 1GRXA 5LCZA 3WT1A 2JU5A 1A2MA 2AAWA 2K6VA 2BTOT 2CVKA 4I5QA 1ACVA 1ERTA 2RIIA 4KNDA 4AGSA 5DVBA 2B7JA 3U6VA 2ALBA 4IGJA 1M9AA 1O85A 3C1SA 2YV7A 4ZIJA 2C4JA 5KN2A 1URMA 1I5GA 1O6JA 5HR0A 5LD0A 3RAZA 3LJRA 1JZDA 5DAKB 2GDRA 3QAVA 1XPVA 2HNLA 4IJIA 2LNSA 2AV4A 5B6NA 2F8FA 1XXUA 4F9ZA 1XW9A 4L0WA 4ULXA 2GZZA 3F0IA 3HY2A 4PTSA 4GSNA 4POMA 1ZYQB 1JHBA 1A8YA 3E3EA 4K0NA 2OBIA 4KB3A 3DIEA 2X8HA 1USBA 1OC9A 4CW9A 4HOJA 3BBYA 3D6IA 3MAKA 1X5CA 1LU4A 3NIVA 1WPIA 3GSTA 3ZYWA 5ECSA 2IL3A 4J57E 1NHOA 1EEJA 4Q5NA 4IW9A 3W8SA 1TTZA 3LEFA 4LLRA 4XTSA 1X5DA 5G1KA 1FHEA 1GTUA 2P5RA 2PMTA 3TOUA 4PQIA 2V6OA 4ZXGA 4K0GA 2XHFA 3UL3A 3D4TA 3HVVA 3P7XA 4YQVA 5J3RA 4V2NA 4MCUA 1ST9A 3KH7A 2LRCA 1KEBA 2MZCA 3E0UA 5G2ZA 3UBKA 1XWBA 4WBJA 6GSYA 2FWGA 3LFLA 8GSSA 2OKAA 5CAXA 3HVSA 4O32A 3DRNA 3EC3A 3F8UA 2M80A 3TRQA 2RLIA 2AYTA 3P90A 1EP7A 5CP1A 19GSA 3GV1A 4E8EA 3IXRA 2VCXA 3DWVA 3M9JA 1V40A 2A2RA 1SYXA 5AN1A 4MDCA 5IOXA 4CHSA 1YZXA 2B1LA 1FVKA 3QD9A 2PU9C 2TRXA 3D5JA 1Y6EA 5E4WA 4LMVA 2JACA 3ERFA 2OBKA 2FCHA 4WKWA 1JZWA 4RUVA 4OWYA 4FH8A 2GSRA 4I2TA 2R5GA 2NDOA 1X9WB 4I2UA 2G0FA 4G0IA 3IOSA 4ZL7A 1SK0A 1XCCA 3H93A 2H30A 1T7PB 3UIWA 5IMCA 2O89A 3VFIA 2MMZA 11GSA 2JZSA 2V6KA 1GTIA 2JADA 1XZOA 5ECOB 1EOGA 4KCEA 2XPDA 1U6TA 4EKZA 2A2SA 1QGVA 3CTFA 1HD2A 4K1FA 5A4UA 3GNJA 4OO4A 1N2AA 2C80A 3D4MA 4JU5A 1Z7PA 1TOFA 2OE1A 4MH3A 1V58A 5KN3A 18GSA 4MPFA 4TR1A 2VCQA 4GRFA 1GWCA 3FHKA 1G6YA 4WF4A 3QMXA 2YJHA 3ZFLA 3IA1A 5ECRB 4BVYA 1A23A 1K0NA 3EVIA 3KEBA 4LL1B 1EP8A 4NV2A 3H79A 4BPYA 2YN1A 4K2DA 2LV3A 4ZB6A 4DSSA 4FYBA 3LXZA 4NV5A 2FHEA 1J0FA 2JZTA 4HQSA 3DYRA 2WDUA 3NZNA 1FO5A 4MPGA 4F03A 3IE3A 1M9BA 2AUVA 1V2AA 3IAS2 1QFNA 2JSYA 1F2EA 3DXBA 1NW2A 3MSZA 1JLWA 2YZHA 3DVWA 3QAWA 5JWRB 1A8LA 4EDYA 1AUCA 3WGXA 5J9CA 3ME7A 2PGTA 2H72A 2IMEA 1PL1A 2CAQA 4Q5FA 4YAVA 1F37A 1R5PA 4LA1A 4ECCA 2H6YA 4EXJA 3QOUA 5F05A 2EIRA 1ZL9A 3VPTA 3ED3A 3A5WA 1N8JA 5J4UA 2VL3A 2OACA 5IPGA 1PGTA 1THOA 6GSSA 4XS4B 4OCEA 3M3MA 1G7EA 1B4PA 4NXIA 3I69A 1EWXA 1X9SB 3EU4A 3FK8A 5FWGA 2L59A 2IJYA 2IIYA 4EDZA 4FIWA 1QK8A 3EMXA 5JCGA 3KMOA 1G6WA 2B5YA 4BL7A 4ID0A 4EC0A 4G9HA 1HYUA 3GRXA 3QR6A 2WS2A 2L5LA 3A3TA 3HZ4A 4CDOA 1BG5A 1GUKA 2IMFA 1K0DA 3F4SA 1UA5A 2HZEA 2GLRA 4GSTA 3I9V2 1HNCA 4OFMA 2OADA 1GLQA 1EV4A 4PURA 1OE8A 4L8EA 3FZ4A 2GZYA 3IPZA 1M99A 3AY8A 2WB9A 5IMDA 4BA7A 2N5AA 4EF0A 4POLA 2CVDA 1ZZYA 4QL9A 3DD3A 3PPUA 2QSIA 1BJXA 4HEA2 2HQTA 4MA9A 1XOAA 1ON4A 3HHVA 4Q5RA 1PN9A 3PR8A 2YWOA 4Q5QA 3KGKA 4YQMA 2DIYA 3F3QA 1AQVA 1GH2A 2DJ1A 1PQNA 2DMMA 2K18A 5HR2A 2C8UA 3M9KA 5G1LA 2IPAA 2C3QA 4XCSA 3GX0A 3RDWA 2HSYA 2NVLA 1CQHA 3FYGA 1QQ2A 2N5FA 3C7MA 1GSEA 4IP6A 3APQA 2HRKB 1JLVA 4DSRA 4F2IA 1BAYA 1Q4JA 1EGRA 4TOPA 2MYGA 3VURA 4N30A 2AB6A 2YWMA 3ZFBA 1MDKA 1EZKA 3TKSA 4G0LA 1YF1A 2LEGA 3BOAA 3BD2A 1F3BA 3RHCA 4BWQA 1GLPA 5D9WA 1V98A 2CX4A 2VCVA 2DIZA 3K8NA 1MD4A 4V2MA 2IMIA 1O73A 2EIQA 1PRXA 3WYWA 4IHUA 1SL0B 2MBSA 1CQGA 5CRWA 1XOBA 4HJMA 1F6MC 1Z6NA 1MEKA 3HKRA 4IS0A 14GSA 1O7UA 4HJ2A 5FHIA 1OC3A 2IMKA 3F63A 1DBYA 1GUMA 1G7OA 3O3TA 1YEXA 4USSA 1XWAA 2CT6A 3C8EA 1GSDA 5ENUA 2AHEA 5IIZA 5JWOB 4X43A 4FQUA 1H75A 4F0CA 5DDLA 2HLSA 5ECMB 4QQ7A 5C04A 2C3NA 5COHA 2K9FA 2OJLA 1T8EB 1VF3A 2B7KA 2P0GA 2VM1A 5E59A 1AQWA 1NHYA 5FT3A 2GSTA 5D73A 2LUSA 4MMMA 4KSMA 3W8JA 2FD3A 17GSA 3GTUB 2VLVA 4XRDA 5IMFA 5LNKe 4NHZA 4IP1A 1XW6A 3F4TA 4JR6A 3IC4A 1TRSA 4TXVA 3TUEA 3I6AA 5J9BA 3ZLPA 2FGXA 4KF9A 2I4AA 2PERA 3EE2A 1OAZA 2O8VB 1A2LA 1EGOA 3KTLA 3EWLA 5ELAA 2BMXA 1XVWA 4TR3A 1K3LA 3UARA 3L0HA 3EMPA 5IO2A 1VRSD 2BJXA 4BWSA 4BVXB 1SJIA 3EINA 1B9XC 4I6XA 1K0BA 2YWIA 4RI6A 2PWJA 2I81A 2ZCTA 5CNWA 1U88A 4K7IA 3UVHA 4GWRA 2HZFA 3KP8A 3MNGA 4L0UA 4O7HA 2L4CA 2R4VA 4EL1A 3ZRDA 4ML1A 2WZ9A 3FR9A 1IYIA 2ZNMA 1JZRA 5ECQB 6GSUA 5DAKA 1PKWA 2GT5A 10GSA 1HNAA 3L9UA 3ZMLA 2WFCA 2DSAA 2V1MA 2LS5A 4MLYA 4IVFA 4MJCA 1Z7RA 5KN1A 2O7KA 5ECLB 2VO4A 4G0KA 4DEJA 6GSVA 4KE3A 1LBKA 4PNFA 3VWVA 4TW5A 2OA7A 1LJRA 4KW6A 3ISOA 2ON5A 4ZL9A 4LMWA 1ILOA 1R26A 3F4RA 1YQ1A 5ID2B 2H75A 4GTUA 4XIHA 1R4WA 2HRNA 1K3YA 2KUCA 2WGRA 5IOWA 2YZUA 2XC2A 1PX6A 3O6TA 1Z9HA 5EL8A 3KCMA 4E8HA 3TRXA 3H8QA 2DJ0A 1GSUA 22GSA 5IPHA 1PD21 3F6FA 1TRUA 3D21A 4ZBDA 2L5OA 3W6GA 1DSBA 4MH2A 1M2AA 3GURA 4PX1A 3VLNA 2YJ7A 1OVNA 4KDYA 4ZILA 2O87A 1AAZA 2GQLA 3CSJA 1R7HA 3LG6A 1T4ZA 2PPTA 1ERWA 4IN0A 2WRTA 1XVQA 3GH9A 2X99A 1XBSA 3ME8A 4I97A 1ERUA 2MMAA 4G2EA 2P5QA 4MJBA 5AIVA 3GN3A 5DALB 5CRHA 4K7OA 2VM2A 5EPFA 5DCHA 3CRTA 2WJUA 2EC4A 2H01A 1EOHA 4K9ZA 1EEMA 5B8BA 2IMDA 1Q98A 1B48A 4G19A 2IN3A 3KTBA 3GYKA 1O8XA 1YJ6A 4JZQA 3F6DA 1OYJA 3A2XA 2UZ8A 2LKUA 2NPBA 5J5NA 3ZITA 1DE1A 3Q6OA 4TR4A 3QPMA 4ACSA 3D0ZA 1MDIA 1U87A 1WRYA 1AW9A 2F9SA 9GSSA 4QL7A 2H1DA 1XW5A 16GSA 3GA4A 1AQXA 1TW9A 3UEMA 1M7TA 2D2ZA 5F07A 1RW1A 2YCDA 2KP1A 2WCIA 3GSSA 2C3TA 1GL8A 3QFAC 2G2QA 3TOTA 4MZWA 1U3IA 1TK0B 4MABA 4V2LA 2FWEA 1HQOA 4MJEA 1QMVA 2M72A 5H5RA 2PBJA 2GS3A 4RQXA 1FB0A 2YNXA 2Z9SA 4K6XA 5EVOA 2E2MA 2TRCP 2VLUA 2A4VA 4ECIA 3V1WA 2REMA 4KDXA 5G31A 3HJPA 2PN8A 3GL5A 2XBIA 3IAM2 2VL9A 1SU9A 4AJ7A 1AXDA 4TXOB 5H5SA 1BEDA 3EYTA 3P2AA 5KEJA 2HSMB 1AC1A 4L5LA 7GSSA 2R3XA 2L4QA 5ELGA 1J08A 1FB6A 3J7Yb 4K7NA 2I9HA 1OKDA 2H0IA 2H71A 5CREA 3E9JB 1A0RP 1WE0A 3BCKA 2IWTA 6GSWA 3KP9A 2YOIA 2HSHA 4WBRD
chains in the Genus database with same CATH superfamily
4RI7A 2R0PA 5IQYA 3ZL5A 1WIKA 4XS4A 1JZOA 1Y25A 1NM3A 3TDGA 3RGBC 1GTAA 3KXOA 2VCZA 5D9TA 2B6MA 2AJQB 3IHQA 2FY6A 4YKFA 4MK3A 3IRAA 3FKFA 3HYPA 4HDEA 3TJGA 2LJKA 3LW9A 4NAXA 4KX4A 2KP2A 5ABRA 2H0HA 3VI7A 4ICYA 3CRUA 2QGVA 5CRGA 3UJ1A 3GIXA 2OE3A 3GKNA 2DBCA 3FR6A 4HI7A 2ZUPA 3HVXA 1XWCA 4D73B 4NMUA 2WZSA 20GSA 1W4VA 3L9SA 1OKTA 5GAND 3HD5A 1GNEA 3GL3A 5G5FA 3CQFA 3GHAA 4DSQA 2N5BA 3D22A 3U5RE 2LJRA 1WMJA 4X0XA 4XRAA 2RUEA 2LQQA 3HJMA 4ECBA 3P8WA 5IM9A 4L5OA 5A1NA 3L9VA 4N0VA 2M46A 1ABAA 4XS6A 2VAFA 2I1UA 3FEUA 1MTCA 1VGLA 4PHZC 3KH9A 3FW2A 1EV9A 4WXTA 2H66A 2H8LA 2DLXA 2ES7A 4IQ1A 2HE3A 1TI1A 3OR5A 3CHXC 1SKRB 3APSA 1I1IP 3UOMA 1SK2A 1Z6MA 4IQAA 2C0EA 3IBHA 2HI7A 3TGZA 5DBQA 3SWLA 3HVNA 1B9YC 1J9BA 2L6CA 13GSA 1T00A 2F51A 4F82A 1U3AA 5B6MA 1ZOFA 1WJKA 2WVXB 2KHPA 3GKKA 3CSHA 3IV4A 5DJMA 2YPMA 3FY7A 1FVJA 2V32A 4FO5A 3WGDA 2HRKA 1S3AA 2DJ3A 3FRCA 5A4WA 2PVOC 4YH2A 3LWAA 5B8AA 1TI3A 4EUYA 5G5EA 1WOUA 1WWJA 1TU7A 3ZIVA 4IELA 1THXA 2DKIA 1B4QA 2CVBA 1ML6A 2VOCA 1TP9A 2YWNA 2CZ2A 4EIPA 2FWFA 2CAIA 1BX9A 2C0DA 1PA3A 4O92A 3N5OA 2VD0A 3VK9A 3RPPA 4I8BA 3G9BA 3VI5A 5GSSA 1HNBA 1M3IA 1VF1A 4KUNA 1SKSB 4IKHA 3TKQA 4OFTA 2LRNA 4NWYA 3GX8A 2YANA 4KAEA 1MDJA 1TRWA 4MZCA 4MP4A 3I43A 2JSZA 4GF0A 2VL2A 4W66A 2CQ9A 1SK1A 4PUAA 3LQ7A 4J2FA 4ILFA 2VCTA 1FAAA 1I9DA 2P31A 1ERVA 3EURA 2CX3A 3DMLA 3IDVA 2FUG2 1K0OA 2KLXA 2H1GA 4TVEA 3TJJA 3TKSE 1GTBA 1FOVA 4ZL8A 2RUFA 1GNWA 1A0FA 3IK9A 1M0UA 4HUAA 1PX7A 2VIMA 4MJAA 4AJ6A 4OO5A 1BQ7A 1X5EA 3A2WA 1ZGNA 4H86A 2H73A 2CZ3A 1O8WA 1BYEA 3QFBC 2HRFA 1UC7A 1TK5B 2KOKA 2R6KA 4N0ZA 1OC9B 3LGCA 1SJZA 4KH7A 4N10A 2HFDA 1Y1UA 2LNTA 3FZAA 2VKZG 2TIRA 4AKGA 2JZRA 3GTUA 2O5VA 3FZ9A 1OC8A 2YP6A 2LTKA 3DEXA 3CYNA 4A5PA 4GXZA 3G7IA 1W89A 4PXOA 2HYXA 3APOA 4NPBA 1VF4A 5AIXA 4FYUA 1UN2A 5D96A 1C72A 3TJFA 4HZ4A 4ZBBA 1SD8A 5GAPD 1KBNA 5H5QA 4EE0A 3IR4A 3R2QA 5A34A 3TKSC 1XWGA 3M8NA 5A4VA 4XS1A 4OD7A 5C00A 3ZIJA 4KA0A 1TKDB 2NTOA 4BVXA 3GKXA 5ECNB 4ML6A 3PGTA 1IYHA 2VCWA 3ZMKA 2HRAA 5ECIB 2B5EA 2K8VA 4XHMA 5A5HA 4DVCA 3G7YA 3CTGA 3TB2A 5F0GA 2E7PA 1QXHA 3BJ5A 3CBUA 3RBTA 3ZVJA 1F9MA 2DJ2A 2OE0A 5J47A 1S3CA 4MZBA 1O81A 5HR1A 5ECHB 1A2JA 2H70A 3KMNA 2H6XA 4ZB9A 3CXGA 3EU3A 5JCWA 3BCIA 5D9XA 2RM6A 5CRDA 4G10A 3N9JA 3M0FA 3R3EA 2H0GA 5IMAA 2V41A 1PMTA 5HFIA 4N11A 4KDUA 2EFDA 2QKEA 1TXUA 3PH9A 4GSSA 5ID2A 6GSXA 4ZBAA 2J23A 2VL2C 3TKRA 3H1NA 1V9WA 3ZVJD 4JRRA 1YKAA 1T4YA 1Z5YE 2FWHA 3TRPA 3DGQA 3A2VA 2HXKA 3HXSA 3LSZA 4HQZA 4X1UA 3QDNA 1H4OA 3WT2A 4JEDA 1WP0A 5CO3A 4AKHA 4YQUA 1ZYEA 2GTUA 4TR1B 1GSYA 5JCUA 6GSTA 3GMFA 1RQMA 4GQCA 2GT6A 3VWUA 2VUPA 3ZZXA 4BVYB 4EVMA 2MMNA 3NOFA 4GQFA 2X64A 5HR3A 5CYYA 5A5KA 4DSSB 1RK4A 3MWHA 5D8IA 4CY6A 2QC7A 4OMVA 4WR4A 1FW1A 3Q74A 1SENA 2O85A 2L57A 4EO3A 5ECKB 3J7Yk 3GKMA 3LYKA 1GSQA 3KD0A 1V57A 4K8MA 1ZMAA 1ZCPA 1SYRA 1MD3A 4LL4B 4WR5A 3FR3A 1YEPA 1XFLA 5DALA 1SD9A 1GSSA 1PSQA 2I3YA 2MMOA 1KTEA 3HCZA 2LRTA 5INYA 5ECPB 2FLSA 4TRXA 2LSTA 4HZ2A 12GSA 2J9HA 2XPEA 3QCPA 4J56E 4PUFC 5G30A 1PN0A 3VWWA 1TK8B 1KNGA 2IFQB 4RQRA 2R2JA 3ZTLA 5IMZA 2LQOA 2PVQA 4PNGA 4K2XA 4Z7XA 4KCAA 3LORA 1B8XA 3KZQA 4BL7B 2X8GA 3TKPA 2DJJA 3US3A 3UVTA 1TXXA 2F8AA 1VF2A 1GULA 4AKXB 4KSOA 1K0CA 4AF2A 3IK7A 2GQKA 3TJBA 5HFKA 4YAPA 2B5XA 4MF5A 1S3DA 2HZEB 1K0AA 2B3SA 4EIQA 2H76A 4ECJA 3O76A 1SL2B 1M2BA 2MBTA 4KGIA 3Q18A 4POBA 3C1RA 4IBPA 3L78A 2IFQA 2HSNB 1YDKA 4MF6A 2H74A 5KN0A 3HZ8A 1K0MA 3QAGA 5GZZB 1GSFA 4MF7A 1AIUA 4TKYA 5EY6A 1NSWA 3HDCA 5F06A 2WULA 3LXTA 2YV9A 3M1GA 4WEYA 1GP1A 3TJKA 3KM6A 4HU9A 2H19A 5BMUA 1YY7A 1E2YA 4TXOA 2QA1A 1QUWA 1N25A 3C71A 4OFNA 2L6DA 1UVZA 3CWGA 2HSMA 2JL4A 2X49A 2GSSA 3ERWA 5HQPA 2RM5A 2R37A 4NHWA 4ISDA 4P3YB 2E2GA 5F8BA 2F3MA 3CSIA 2CA8A 2C0GA 3L4NA 2H1BA 1SJ6A 1K3OA 4IJ3A 3KIJA 2HT9A 3KJYA 4PQ1A 2GQMA 2GSQA 1TU8A 3VWXA 1PKZA 4BIKA 2DC5A 4TN8A 1M3JA 1TRVA 2CV4A 2R0CA 1X9MB 1T3BA 1M2DA 2GZPA 3DVXA 5D93A 2H1AA 5DQSA 5D9VA 3GH6A 1YF0A 4WF5A 4PGTA 3MDKA 3PINA 2LJAA 5GSTA 5JWQB 5HFGA 2C1YA 5J4VA 3VPQA 1PL2A 4O5RA 3WD6A 2VD1A 2DJKA 1F3AA 4QMKA 3FZ5A 4HU7A 3UBLA 4JR4A 3G7JA 4F0BA 2B1KA 4D73A 3SBCA 4AJ8A 4TR0A 1FG4A 4JBBA 2UV8G 2E0QA 3UMAA 1DE2A 1DUGA 2V2GA 4FYCA 3JCML 2GGTA 2EIOA 2X8CA 3Q19A 3LYPA 3RPNA 3GUSA 3HJOA 2XBQA 4HS1A 1SKWB 3RHBA 2C0FA 1TJDA 2PUKC 4V1Ap 3S9FA 1R5AA 3ZREA 5IMVA 3H4KA 4V1Ag 2DMLA 5B7CA 5AISA 2EFHA 3WGEA 3TCOA 4JE1A 1G0TA 5AGYA 2WW1A 2FNOA 2R0GA 1A24A 1XWKA 3C73A 3F3RA 2NBSA 5KOWA 2VLTA 4ZB8A 3ERGA 5DQYA 5J40A 1TDIA 4WETA 1YKCA 4GCIA 2WVXA 1XG8A 2FA4A 3GFKA 5DCGA 3CMIA 3DKSA 3IC8A 1E6BA 1JFUA 5J41A 2K8SA 1GUHA 1SL1B 4GLTA 1XIYA 5L71A 1X0RA 2H6ZA 4OCFA 1Z3EA 5DJLA 2ON7A 3UAPA 1OE7A 5IO0A 2FA8A 4PQHA 1T1VA 3F9UA 4POKA 1SVLA 3A5IA 2GVPA 3HA9A 1GRXA 5LCZA 3WT1A 2JU5A 1FOHA 1A2MA 2AAWA 2K6VA 2BTOT 2CVKA 4I5QA 1ACVA 1ERTA 2RIIA 4KNDA 4AGSA 5DVBA 2B7JA 3U6VA 2ALBA 4IGJA 1M9AA 1O85A 3C1SA 2YV7A 4ZIJA 2C4JA 5KN2A 1URMA 1I5GA 1O6JA 5HR0A 5LD0A 3RAZA 1YEWC 3LJRA 1JZDA 5DAKB 2GDRA 3QAVA 1XPVA 2HNLA 4IJIA 2LNSA 2AV4A 5B6NA 2F8FA 1XXUA 4F9ZA 1XW9A 3IHGA 4L0WA 4ULXA 2GZZA 3F0IA 3HY2A 4PTSA 4GSNA 4POMA 1ZYQB 1JHBA 1A8YA 3E3EA 4K0NA 2OBIA 4KB3A 3DIEA 2X8HA 1USBA 1OC9A 4CW9A 4HOJA 3BBYA 3D6IA 4PI0C 3MAKA 1X5CA 1LU4A 3NIVA 1WPIA 3GSTA 3ZYWA 5ECSA 2IL3A 4J57E 1NHOA 1EEJA 4Q5NA 4IW9A 3W8SA 1TTZA 3LEFA 4LLRA 4XTSA 1X5DA 5G1KA 1FHEA 1GTUA 2P5RA 2X4AA 2PMTA 3TOUA 4PQIA 2V6OA 4ZXGA 4K0GA 2XHFA 3UL3A 3D4TA 3HVVA 3P7XA 4YQVA 5J3RA 4V2NA 4MCUA 1ST9A 3KH7A 2LRCA 1KEBA 2MZCA 3E0UA 5G2ZA 3UBKA 1XWBA 4WBJA 6GSYA 2FWGA 3LFLA 8GSSA 2OKAA 5CAXA 1S4BP 3HVSA 4O32A 3RFRC 3DRNA 3EC3A 3F8UA 2M80A 3TRQA 2RLIA 2AYTA 3P90A 1EP7A 5CP1A 19GSA 3GV1A 4E8EA 3IXRA 2VCXA 2EFCA 3DWVA 3M9JA 1V40A 2A2RA 1SYXA 5AN1A 4MDCA 5IOXA 4CHSA 4FXYP 1YZXA 2B1LA 1FVKA 3QD9A 1SVOA 2PU9C 2TRXA 3D5JA 1Y6EA 5E4WA 4LMVA 4E68A 2JACA 3ERFA 2OBKA 2FCHA 4WKWA 1JZWA 4RUVA 4OWYA 4FH8A 2GSRA 1S3RA 4I2TA 2R5GA 2NDOA 1X9WB 1BF5A 4I2UA 2G0FA 4Z2RA 4G0IA 3IOSA 4ZL7A 1SK0A 1XCCA 3H93A 2H30A 1T7PB 3UIWA 4K5RA 2WW2A 5IMCA 2O89A 3VFIA 2MMZA 11GSA 2JZSA 1ZYPA 2V6KA 1GTIA 2JADA 1XZOA 5ECOB 1EOGA 4KCEA 2XPDA 1U6TA 4EKZA 2A2SA 1QGVA 5BRTA 3CTFA 1HD2A 4K1FA 5A4UA 3GNJA 4OO4A 1N2AA 2C80A 3D4MA 4JU5A 1Z7PA 1TOFA 2OE1A 4MH3A 1V58A 5KN3A 18GSA 4MPFA 4TR1A 2VCQA 4GRFA 1GWCA 3FHKA 1G6YA 4WF4A 3QMXA 2YJHA 3ZFLA 3IA1A 5ECRB 4BVYA 1A23A 1K0NA 3EVIA 3KEBA 4LL1B 1EP8A 4NV2A 3H79A 4BPYA 2YN1A 4K2DA 2LV3A 2QA2A 4ZB6A 4DSSA 4FYBA 3LXZA 4NV5A 2FHEA 1J0FA 2JZTA 4HQSA 3DYRA 2WDUA 3NZNA 1FO5A 4MPGA 4F03A 3IE3A 1M9BA 2AUVA 1V2AA 3IAS2 1QFNA 2JSYA 1F2EA 3DXBA 1NW2A 3MSZA 1JLWA 2YZHA 3DVWA 4GDFA 3QAWA 5JWRB 1A8LA 4EDYA 1AUCA 3WGXA 5J9CA 2H72A 2PGTA 2IMEA 3ME7A 1PL1A 2CAQA 4Q5FA 4YAVA 1F37A 1R5PA 4LA1A 4ECCA 2H6YA 4EXJA 3QOUA 5F05A 2EIRA 1ZL9A 3VPTA 3ED3A 3A5WA 1N8JA 5J4UA 2VL3A 2OACA 5IPGA 1PGTA 1THOA 6GSSA 4XS4B 4OCEA 3M3MA 1G7EA 1B4PA 4NXIA 3I69A 1EWXA 1X9SB 1PFOA 3EU4A 3FK8A 5FWGA 2L59A 2IJYA 2IIYA 4EDZA 4FIWA 1QK8A 3EMXA 5JCGA 3KMOA 1G6WA 2B5YA 4BL7A 4ID0A 4EC0A 4G9HA 1HYUA 3GRXA 3QR6A 2WS2A 2L5LA 3A3TA 3HZ4A 4CDOA 1BG5A 1GUKA 2IMFA 1K0DA 3F4SA 1UA5A 2HZEA 2GLRA 4GSTA 3I9V2 1HNCA 4OFMA 2OADA 1GLQA 1EV4A 4PURA 1OE8A 4L8EA 3FZ4A 2HSNA 2GZYA 3IPZA 4ZB7A 1M99A 3AY8A 2WB9A 5IMDA 4BA7A 4Z2UA 2N5AA 4EF0A 4POLA 5A1NB 2CVDA 1ZZYA 4QL9A 3DD3A 3PPUA 2QSIA 1BJXA 4HEA2 2HQTA 4MA9A 1XOAA 1ON4A 3HHVA 1ZYNA 4Q5RA 1PN9A 3PR8A 2YWOA 4Q5QA 3KGKA 4YQMA 2DIYA 3F3QA 1AQVA 1GH2A 2DJ1A 1PQNA 2DMMA 2K18A 5HR2A 2C8UA 3M9KA 5G1LA 2IPAA 2C3QA 4XCSA 4PI2C 3GX0A 4O5QA 3RDWA 2HSYA 2NVLA 1CQHA 3FYGA 1QQ2A 2N5FA 3C7MA 1GSEA 4IP6A 3APQA 2HRKB 1JLVA 4DSRA 4F2IA 1BAYA 1Q4JA 1EGRA 4TOPA 2MYGA 3VURA 4N30A 2AB6A 2YWMA 3ZFBA 1MDKA 1EZKA 3TKSA 4G0LA 1YF1A 2LEGA 3BOAA 3BD2A 1F3BA 3RHCA 4BWQA 1GLPA 4N3ZA 5D9WA 1V98A 2CX4A 2VCVA 2DIZA 3K8NA 1MD4A 4V2MA 2IMIA 1O73A 2EIQA 1PRXA 3WYWA 3MIXA 4Z2TA 4IHUA 1SL0B 2MBSA 1CQGA 5CRWA 1XOBA 4HJMA 1F6MC 1Z6NA 1MEKA 3HKRA 4IS0A 14GSA 1O7UA 4HJ2A 5FHIA 1OC3A 2IMKA 3HMJG 3F63A 1DBYA 1GUMA 1G7OA 3O3TA 1YEXA 4USSA 1XWAA 2CT6A 2WVZA 3C8EA 1GSDA 5ENUA 2AHEA 5IIZA 5JWOB 1SVMA 4X43A 4FQUA 1H75A 4F0CA 5DDLA 2HLSA 5ECMB 4QQ7A 5C04A 2C3NA 5COHA 2K9FA 2OJLA 2WW3A 1T8EB 1VF3A 2B7KA 2P0GA 2VM1A 5E59A 1AQWA 1NHYA 5FT3A 2GSTA 5D73A 2LUSA 4MMMA 4KSMA 3W8JA 2FD3A 17GSA 3GTUB 2VLVA 4XRDA 2O3EA 5IMFA 5LNKe 4NHZA 4IP1A 1XW6A 3F4TA 4JR6A 3IC4A 1TRSA 4TXVA 3TUEA 3I6AA 5J9BA 3ZLPA 2FGXA 4KF9A 2I4AA 2PERA 3EE2A 1OAZA 2O8VB 1A2LA 1EGOA 3KTLA 5A34B 3EWLA 5ELAA 2BMXA 1XVWA 4TR3A 4X4JA 1K3LA 3UARA 3L0HA 3EMPA 5IO2A 1VRSD 2BJXA 4BWSA 4BVXB 4YKGA 1SJIA 3EINA 1B9XC 4I6XA 1K0BA 4MNNA 2WW0A 4RI6A 2PWJA 2YWIA 3MYDA 2I81A 2ZCTA 5CNWA 1U88A 4K7IA 3UVHA 4HSCX 2OT3A 4GWRA 2HZFA 3KP8A 5KOXA 3MNGA 4L0UA 4O7HA 2L4CA 2R4VA 4EL1A 3ZRDA 3TU3B 5A5HB 4ML1A 2WZ9A 3FR9A 1IYIA 4CY8A 2ZNMA 1JZRA 5ECQB 6GSUA 5DAKA 1PKWA 2GT5A 10GSA 1HNAA 3L9UA 3ZMLA 2WFCA 2DSAA 2V1MA 2LS5A 4MLYA 4IVFA 4MJCA 1Z7RA 5KN1A 2O7KA 5ECLB 2VO4A 4G0KA 4DEJA 6GSVA 4KE3A 1LBKA 1BG1A 4PNFA 3VWVA 4TW5A 2OA7A 1LJRA 4KW6A 3ISOA 1YVLA 2ON5A 4ZL9A 4LMWA 1ILOA 3EPTA 1R26A 3F4RA 1YQ1A 5ID2B 2H75A 2WVYA 4GTUA 4XIHA 1R4WA 2HRNA 1K3YA 2KUCA 2WGRA 5IOWA 2YZUA 2XC2A 1PX6A 3O6TA 1Z9HA 5EL8A 5J4YA 3KCMA 4E8HA 3TRXA 3H8QA 2DJ0A 1GSUA 22GSA 5IPHA 1PD21 3F6FA 1TRUA 3D21A 4ZBDA 2DKHA 2L5OA 3W6GA 1DSBA 4MH2A 1M2AA 3GURA 4PX1A 3VLNA 2YJ7A 1OVNA 4KDYA 4ZILA 2O87A 1AAZA 2GQLA 4K5SA 3CSJA 1R7HA 3LG6A 1T4ZA 2PPTA 1ERWA 4IN0A 2WRTA 1XVQA 3GH9A 2X99A 2O36A 1XBSA 3ME8A 4I97A 1ERUA 2A4HA 2MMAA 4G2EA 2P5QA 4MJBA 5AIVA 3GN3A 5DALB 5CRHA 4K7OA 2VM2A 5EPFA 4AKIA 5DCHA 3CRTA 2WJUA 2EC4A 2H01A 1EOHA 4K9ZA 1EEMA 5B8BA 2IMDA 1Q98A 1B48A 4G19A 2IN3A 3KTBA 3GYKA 1O8XA 1YJ6A 4JZQA 3F6DA 1OYJA 3A2XA 2UZ8A 2LKUA 2NPBA 4O5UA 5J5NA 3ZITA 1DE1A 3Q6OA 4TR4A 2A2PA 3QPMA 4ACSA 3D0ZA 1MDIA 1U87A 1WRYA 1AW9A 2F9SA 9GSSA 4QL7A 2H1DA 1XW5A 16GSA 3GA4A 1AQXA 1TW9A 3UEMA 1M7TA 2D2ZA 5F07A 1RW1A 2YCDA 2KP1A 2WCIA 3GSSA 2C3TA 1GL8A 3QFAC 2G2QA 3TOTA 4MZWA 1U3IA 1TK0B 4MABA 4V2LA 2FWEA 1HQOA 4MJEA 1QMVA 2M72A 5H5RA 2PBJA 2GS3A 4RQXA 1FB0A 2YNXA 2Z9SA 4K6XA 3FMWA 5EVOA 2E2MA 2TRCP 2VLUA 2A4VA 4ECIA 3V1WA 2REMA 4KDXA 5G31A 3HJPA 2PN8A 4AI6A 3GL5A 2XBIA 3IAM2 5BMUB 2VL9A 1SU9A 4AJ7A 4G01A 1AXDA 4TXOB 5H5SA 1BEDA 3EYTA 3P2AA 2EFEA 5KEJA 2HSMB 1AC1A 4L5LA 7GSSA 2R3XA 2H1LA 2L4QA 5ELGA 1J08A 1FB6A 3J7Yb 4K7NA 2I9HA 1OKDA 2H0IA 2H71A 5CREA 3E9JB 1A0RP 1WE0A 3BCKA 2IWTA 6GSWA 3KP9A 2YOIA 2HSHA 4WBRD
chains in the Genus database with same CATH topology
4RI7A 2R0PA 5IQYA 3ZL5A 1WIKA 4XS4A 1JZOA 1Y25A 1NM3A 3TDGA 1GTAA 3KXOA 2VCZA 5D9TA 2B6MA 2AJQB 3IHQA 2FY6A 4YKFA 4MK3A 3IRAA 3FKFA 3HYPA 4HDEA 3TJGA 2LJKA 3LW9A 4NAXA 4KX4A 2KP2A 5ABRA 2H0HA 3VI7A 4ICYA 3CRUA 2QGVA 5CRGA 3UJ1A 3GIXA 2OE3A 3GKNA 2DBCA 3FR6A 4HI7A 2ZUPA 3HVXA 1XWCA 4D73B 4NMUA 20GSA 1W4VA 3L9SA 1OKTA 5GAND 3HD5A 1GNEA 3GL3A 5G5FA 3GHAA 4DSQA 2N5BA 3D22A 3U5RE 2LJRA 1WMJA 4X0XA 4XRAA 2RUEA 2LQQA 3HJMA 4ECBA 3P8WA 5IM9A 4L5OA 5A1NA 3L9VA 4N0VA 2M46A 1ABAA 4XS6A 2VAFA 2I1UA 3FEUA 1MTCA 1VGLA 3KH9A 3FW2A 1EV9A 4WXTA 2H66A 2H8LA 2DLXA 2ES7A 4IQ1A 2HE3A 1TI1A 3OR5A 1SKRB 3APSA 3UOMA 1SK2A 1Z6MA 4IQAA 2C0EA 3IBHA 2HI7A 3TGZA 5DBQA 3SWLA 1B9YC 1J9BA 2L6CA 13GSA 1T00A 2F51A 4F82A 1U3AA 5B6MA 1ZOFA 1WJKA 2KHPA 3GKKA 3CSHA 3IV4A 5DJMA 2YPMA 3FY7A 1FVJA 2V32A 4FO5A 3WGDA 2HRKA 1S3AA 2DJ3A 3FRCA 5A4WA 2PVOC 4YH2A 3LWAA 5B8AA 1TI3A 4EUYA 5G5EA 1WOUA 1WWJA 1TU7A 3ZIVA 4IELA 1THXA 2DKIA 1B4QA 2CVBA 1ML6A 2VOCA 1TP9A 2YWNA 2CZ2A 4EIPA 2FWFA 2CAIA 1BX9A 2C0DA 1PA3A 4O92A 3N5OA 2VD0A 3VK9A 3RPPA 4I8BA 3G9BA 3VI5A 5GSSA 1HNBA 1VF1A 4KUNA 1SKSB 4IKHA 3TKQA 4OFTA 2LRNA 4NWYA 3GX8A 2YANA 4KAEA 1MDJA 1TRWA 4MZCA 4MP4A 3I43A 2JSZA 4GF0A 2VL2A 4W66A 2CQ9A 1SK1A 4PUAA 3LQ7A 4J2FA 4ILFA 2VCTA 1FAAA 1I9DA 2P31A 1ERVA 3EURA 2CX3A 3DMLA 3IDVA 2FUG2 1K0OA 2KLXA 2H1GA 4TVEA 3TJJA 3TKSE 1GTBA 1FOVA 4ZL8A 2RUFA 1GNWA 1A0FA 3IK9A 1M0UA 4HUAA 1PX7A 2VIMA 4MJAA 4AJ6A 4OO5A 1BQ7A 1X5EA 3A2WA 1ZGNA 4H86A 2H73A 2CZ3A 1O8WA 1BYEA 3QFBC 2HRFA 1UC7A 1TK5B 2KOKA 2R6KA 4N0ZA 1OC9B 3LGCA 1SJZA 4KH7A 4N10A 2HFDA 1Y1UA 2LNTA 3FZAA 2VKZG 2TIRA 4AKGA 2JZRA 3GTUA 2O5VA 3FZ9A 1OC8A 2YP6A 2LTKA 3DEXA 3CYNA 4A5PA 4GXZA 3G7IA 1W89A 4PXOA 2HYXA 3APOA 4NPBA 1VF4A 5AIXA 4FYUA 1UN2A 5D96A 1C72A 3TJFA 4HZ4A 4ZBBA 1SD8A 5GAPD 1KBNA 5H5QA 4EE0A 3IR4A 3R2QA 5A34A 3TKSC 1XWGA 3M8NA 5A4VA 4XS1A 4OD7A 5C00A 3ZIJA 4KA0A 1TKDB 2NTOA 4BVXA 3GKXA 5ECNB 4ML6A 3PGTA 1IYHA 2VCWA 3ZMKA 2HRAA 5ECIB 2B5EA 2K8VA 4XHMA 5A5HA 4DVCA 3G7YA 3CTGA 3TB2A 5F0GA 2E7PA 1QXHA 3BJ5A 3CBUA 3RBTA 3ZVJA 1F9MA 2DJ2A 2OE0A 5J47A 1S3CA 4MZBA 1O81A 5HR1A 5ECHB 1A2JA 2H70A 3KMNA 2H6XA 4ZB9A 3CXGA 3EU3A 5JCWA 3BCIA 5D9XA 2RM6A 5CRDA 4G10A 3N9JA 3M0FA 3R3EA 2H0GA 5IMAA 2V41A 1PMTA 5HFIA 4N11A 4KDUA 2EFDA 2QKEA 1TXUA 3PH9A 4GSSA 5ID2A 6GSXA 4ZBAA 2J23A 2VL2C 3TKRA 3H1NA 1V9WA 3ZVJD 4JRRA 1YKAA 1T4YA 1Z5YE 2FWHA 3TRPA 3DGQA 3A2VA 2HXKA 3HXSA 3LSZA 4HQZA 4X1UA 3QDNA 1H4OA 3WT2A 4JEDA 1WP0A 5CO3A 4AKHA 4YQUA 1ZYEA 2GTUA 4TR1B 1GSYA 5JCUA 6GSTA 3GMFA 1RQMA 4GQCA 2GT6A 3VWUA 2VUPA 3ZZXA 4BVYB 4EVMA 2MMNA 3NOFA 4GQFA 2X64A 5HR3A 5CYYA 5A5KA 4DSSB 1RK4A 3MWHA 5D8IA 4CY6A 2QC7A 4OMVA 4WR4A 1FW1A 3Q74A 1SENA 2O85A 2L57A 4EO3A 5ECKB 3J7Yk 3GKMA 3LYKA 1GSQA 3KD0A 1V57A 4K8MA 1ZMAA 1ZCPA 1SYRA 1MD3A 4LL4B 4WR5A 3FR3A 1YEPA 1XFLA 5DALA 1SD9A 1GSSA 1PSQA 2I3YA 2MMOA 1KTEA 3HCZA 2LRTA 5INYA 5ECPB 2FLSA 4TRXA 2LSTA 4HZ2A 12GSA 2J9HA 2XPEA 3QCPA 4J56E 4PUFC 5G30A 1PN0A 3VWWA 1TK8B 1KNGA 2IFQB 4RQRA 2R2JA 3ZTLA 5IMZA 2LQOA 2PVQA 4PNGA 4K2XA 4Z7XA 4KCAA 3LORA 1B8XA 3KZQA 4BL7B 2X8GA 3TKPA 2DJJA 3US3A 3UVTA 1TXXA 2F8AA 1VF2A 1GULA 4AKXB 4KSOA 1K0CA 4AF2A 3IK7A 2GQKA 3TJBA 5HFKA 4YAPA 2B5XA 4MF5A 1S3DA 2HZEB 1K0AA 2B3SA 4EIQA 2H76A 4ECJA 3O76A 1SL2B 1M2BA 2MBTA 4KGIA 3Q18A 4POBA 3C1RA 4IBPA 3L78A 2IFQA 2HSNB 1YDKA 4MF6A 2H74A 5KN0A 3HZ8A 1K0MA 3QAGA 5GZZB 1GSFA 4MF7A 1AIUA 4TKYA 5EY6A 1NSWA 3HDCA 5F06A 2WULA 3LXTA 2YV9A 3M1GA 4WEYA 1GP1A 3TJKA 3KM6A 4HU9A 2H19A 5BMUA 1YY7A 1E2YA 4TXOA 2QA1A 1QUWA 1N25A 3C71A 4OFNA 2L6DA 1UVZA 3CWGA 2HSMA 2JL4A 2X49A 2GSSA 3ERWA 5HQPA 2RM5A 2R37A 4NHWA 4ISDA 4P3YB 2E2GA 5F8BA 2F3MA 3CSIA 2CA8A 2C0GA 3L4NA 2H1BA 1SJ6A 1K3OA 4IJ3A 3KIJA 2HT9A 3KJYA 4PQ1A 2GQMA 2GSQA 1TU8A 3VWXA 1PKZA 2DC5A 4TN8A 1TRVA 2CV4A 2R0CA 1X9MB 1T3BA 1M2DA 2GZPA 3DVXA 5D93A 2H1AA 5DQSA 5D9VA 3GH6A 1YF0A 4WF5A 4PGTA 3MDKA 3PINA 2LJAA 5GSTA 5JWQB 5HFGA 2C1YA 5J4VA 3VPQA 1PL2A 4O5RA 3WD6A 2VD1A 2DJKA 1F3AA 4QMKA 3FZ5A 4HU7A 3UBLA 4JR4A 3G7JA 4F0BA 2B1KA 4D73A 3SBCA 4AJ8A 4TR0A 1FG4A 4JBBA 2UV8G 2E0QA 3UMAA 1DE2A 1DUGA 2V2GA 4FYCA 3JCML 2GGTA 2EIOA 2X8CA 3Q19A 3LYPA 3RPNA 3GUSA 3HJOA 2XBQA 4HS1A 1SKWB 3RHBA 2C0FA 1TJDA 2PUKC 4V1Ap 3S9FA 1R5AA 3ZREA 5IMVA 3H4KA 4V1Ag 2DMLA 5B7CA 5AISA 2EFHA 3WGEA 3TCOA 4JE1A 1G0TA 5AGYA 2FNOA 2R0GA 1A24A 1XWKA 3C73A 3F3RA 2NBSA 5KOWA 2VLTA 4ZB8A 3ERGA 5DQYA 5J40A 1TDIA 4WETA 1YKCA 4GCIA 2FA4A 3GFKA 5DCGA 3CMIA 3DKSA 3IC8A 1E6BA 1JFUA 5J41A 2K8SA 1GUHA 1SL1B 4GLTA 1XIYA 5L71A 1X0RA 2H6ZA 4OCFA 1Z3EA 5DJLA 2ON7A 3UAPA 1OE7A 5IO0A 2FA8A 4PQHA 1T1VA 3F9UA 4POKA 1SVLA 3A5IA 2GVPA 3HA9A 1GRXA 5LCZA 3WT1A 2JU5A 1FOHA 1A2MA 2AAWA 2K6VA 2BTOT 2CVKA 4I5QA 1ACVA 1ERTA 2RIIA 4KNDA 4AGSA 5DVBA 2B7JA 3U6VA 2ALBA 4IGJA 1M9AA 1O85A 3C1SA 2YV7A 4ZIJA 2C4JA 5KN2A 1URMA 1I5GA 1O6JA 5HR0A 5LD0A 3RAZA 3LJRA 1JZDA 5DAKB 2GDRA 3QAVA 1XPVA 2HNLA 4IJIA 2LNSA 2AV4A 5B6NA 2F8FA 1XXUA 4F9ZA 1XW9A 3IHGA 4L0WA 4ULXA 2GZZA 3F0IA 3HY2A 4PTSA 4GSNA 4POMA 1ZYQB 1JHBA 1A8YA 3E3EA 4K0NA 2OBIA 4KB3A 3DIEA 2X8HA 1USBA 1OC9A 4CW9A 4HOJA 3BBYA 3D6IA 3MAKA 1X5CA 1LU4A 3NIVA 1WPIA 3GSTA 3ZYWA 5ECSA 2IL3A 4J57E 1NHOA 1EEJA 4Q5NA 4IW9A 3W8SA 1TTZA 3LEFA 4LLRA 4XTSA 1X5DA 5G1KA 1FHEA 1GTUA 2P5RA 2X4AA 2PMTA 3TOUA 4PQIA 2V6OA 4ZXGA 4K0GA 2XHFA 3UL3A 3D4TA 3HVVA 3P7XA 4YQVA 5J3RA 4V2NA 4MCUA 1ST9A 3KH7A 2LRCA 1KEBA 2MZCA 3E0UA 5G2ZA 3UBKA 1XWBA 4WBJA 6GSYA 2FWGA 3LFLA 8GSSA 2OKAA 5CAXA 3HVSA 4O32A 3DRNA 3EC3A 3F8UA 2M80A 3TRQA 2RLIA 2AYTA 3P90A 1EP7A 5CP1A 19GSA 3GV1A 4E8EA 3IXRA 2VCXA 2EFCA 3DWVA 3M9JA 1V40A 2A2RA 1SYXA 5AN1A 4MDCA 5IOXA 4CHSA 1YZXA 2B1LA 1FVKA 3QD9A 1SVOA 2PU9C 2TRXA 3D5JA 1Y6EA 5E4WA 4LMVA 4E68A 2JACA 3ERFA 2OBKA 2FCHA 4WKWA 1JZWA 4RUVA 4OWYA 4FH8A 2GSRA 4I2TA 2R5GA 2NDOA 1X9WB 1BF5A 4I2UA 2G0FA 4Z2RA 4G0IA 3IOSA 4ZL7A 1SK0A 1XCCA 3H93A 2H30A 1T7PB 3UIWA 4K5RA 5IMCA 2O89A 3VFIA 2MMZA 11GSA 2JZSA 1ZYPA 2V6KA 1GTIA 2JADA 1XZOA 5ECOB 1EOGA 4KCEA 2XPDA 1U6TA 4EKZA 2A2SA 1QGVA 5BRTA 3CTFA 1HD2A 4K1FA 5A4UA 3GNJA 4OO4A 1N2AA 2C80A 3D4MA 4JU5A 1Z7PA 1TOFA 2OE1A 4MH3A 1V58A 5KN3A 18GSA 4MPFA 4TR1A 2VCQA 4GRFA 1GWCA 3FHKA 1G6YA 4WF4A 3QMXA 2YJHA 3ZFLA 3IA1A 5ECRB 4BVYA 1A23A 1K0NA 3EVIA 3KEBA 4LL1B 1EP8A 4NV2A 3H79A 4BPYA 2YN1A 4K2DA 2LV3A 2QA2A 4ZB6A 4DSSA 4FYBA 3LXZA 4NV5A 2FHEA 1J0FA 2JZTA 4HQSA 3DYRA 2WDUA 3NZNA 1FO5A 4MPGA 4F03A 3IE3A 1M9BA 2AUVA 1V2AA 3IAS2 1QFNA 2JSYA 1F2EA 3DXBA 1NW2A 3MSZA 1JLWA 2YZHA 3DVWA 4GDFA 3QAWA 5JWRB 1A8LA 4EDYA 1AUCA 3WGXA 5J9CA 3ME7A 2PGTA 2H72A 2IMEA 1PL1A 2CAQA 4Q5FA 4YAVA 1F37A 1R5PA 4LA1A 4ECCA 2H6YA 4EXJA 3QOUA 5F05A 2EIRA 1ZL9A 3VPTA 3ED3A 3A5WA 1N8JA 5J4UA 2VL3A 2OACA 5IPGA 1PGTA 1THOA 6GSSA 4XS4B 4OCEA 3M3MA 1G7EA 1B4PA 4NXIA 3I69A 1EWXA 1X9SB 3EU4A 3FK8A 5FWGA 2L59A 2IJYA 2IIYA 4EDZA 4FIWA 1QK8A 3EMXA 5JCGA 3KMOA 1G6WA 2B5YA 4BL7A 4ID0A 4EC0A 4G9HA 1HYUA 3GRXA 3QR6A 2WS2A 2L5LA 3A3TA 3HZ4A 4CDOA 1BG5A 1GUKA 2IMFA 1K0DA 3F4SA 1UA5A 2HZEA 2GLRA 4GSTA 3I9V2 1HNCA 4OFMA 2OADA 1GLQA 1EV4A 4PURA 1OE8A 4L8EA 3FZ4A 2HSNA 2GZYA 3IPZA 4ZB7A 1M99A 3AY8A 2WB9A 5IMDA 4BA7A 4Z2UA 2N5AA 4EF0A 4POLA 5A1NB 2CVDA 1ZZYA 4QL9A 3DD3A 3PPUA 2QSIA 1BJXA 4HEA2 2HQTA 4MA9A 1XOAA 1ON4A 3HHVA 1ZYNA 4Q5RA 1PN9A 3PR8A 2YWOA 4Q5QA 3KGKA 4YQMA 2DIYA 3F3QA 1AQVA 1GH2A 2DJ1A 1PQNA 2DMMA 2K18A 5HR2A 2C8UA 3M9KA 5G1LA 2IPAA 2C3QA 4XCSA 3GX0A 4O5QA 3RDWA 2HSYA 2NVLA 1CQHA 3FYGA 1QQ2A 2N5FA 3C7MA 1GSEA 4IP6A 3APQA 2HRKB 1JLVA 4DSRA 4F2IA 1BAYA 1Q4JA 1EGRA 4TOPA 2MYGA 3VURA 4N30A 2AB6A 2YWMA 3ZFBA 1MDKA 1EZKA 3TKSA 4G0LA 1YF1A 2LEGA 3BOAA 3BD2A 1F3BA 3RHCA 4BWQA 1GLPA 4N3ZA 5D9WA 1V98A 2CX4A 2VCVA 2DIZA 3K8NA 1MD4A 4V2MA 2IMIA 1O73A 2EIQA 1PRXA 3WYWA 3MIXA 4Z2TA 4IHUA 1SL0B 2MBSA 1CQGA 5CRWA 1XOBA 4HJMA 1F6MC 1Z6NA 1MEKA 3HKRA 4IS0A 14GSA 1O7UA 4HJ2A 5FHIA 1OC3A 2IMKA 3HMJG 3F63A 1DBYA 1GUMA 1G7OA 3O3TA 1YEXA 4USSA 1XWAA 2CT6A 3C8EA 1GSDA 5ENUA 2AHEA 5IIZA 5JWOB 1SVMA 4X43A 4FQUA 1H75A 4F0CA 5DDLA 2HLSA 5ECMB 4QQ7A 5C04A 2C3NA 5COHA 2K9FA 2OJLA 1T8EB 1VF3A 2B7KA 2P0GA 2VM1A 5E59A 1AQWA 1NHYA 5FT3A 2GSTA 5D73A 2LUSA 4MMMA 4KSMA 3W8JA 2FD3A 17GSA 3GTUB 2VLVA 4XRDA 5IMFA 5LNKe 4NHZA 4IP1A 1XW6A 3F4TA 4JR6A 3IC4A 1TRSA 4TXVA 3TUEA 3I6AA 5J9BA 3ZLPA 2FGXA 4KF9A 2I4AA 2PERA 3EE2A 1OAZA 2O8VB 1A2LA 1EGOA 3KTLA 5A34B 3EWLA 5ELAA 2BMXA 1XVWA 4TR3A 4X4JA 1K3LA 3UARA 3L0HA 3EMPA 5IO2A 1VRSD 2BJXA 4BWSA 4BVXB 4YKGA 1SJIA 3EINA 1B9XC 4I6XA 1K0BA 4MNNA 2YWIA 4RI6A 2PWJA 3MYDA 2I81A 2ZCTA 5CNWA 1U88A 4K7IA 3UVHA 2OT3A 4GWRA 2HZFA 3KP8A 5KOXA 3MNGA 4L0UA 4O7HA 2L4CA 2R4VA 4EL1A 3ZRDA 3TU3B 5A5HB 4ML1A 2WZ9A 3FR9A 1IYIA 4CY8A 2ZNMA 1JZRA 5ECQB 6GSUA 5DAKA 1PKWA 2GT5A 10GSA 1HNAA 3L9UA 3ZMLA 2WFCA 2DSAA 2V1MA 2LS5A 4MLYA 4IVFA 4MJCA 1Z7RA 5KN1A 2O7KA 5ECLB 2VO4A 4G0KA 4DEJA 6GSVA 4KE3A 1LBKA 1BG1A 4PNFA 3VWVA 4TW5A 2OA7A 1LJRA 4KW6A 3ISOA 1YVLA 2ON5A 4ZL9A 4LMWA 1ILOA 3EPTA 1R26A 3F4RA 1YQ1A 5ID2B 2H75A 4GTUA 4XIHA 1R4WA 2HRNA 1K3YA 2KUCA 2WGRA 5IOWA 2YZUA 2XC2A 1PX6A 3O6TA 1Z9HA 5EL8A 5J4YA 3KCMA 4E8HA 3TRXA 3H8QA 2DJ0A 1GSUA 22GSA 5IPHA 1PD21 3F6FA 1TRUA 3D21A 4ZBDA 2DKHA 2L5OA 3W6GA 1DSBA 4MH2A 1M2AA 3GURA 4PX1A 3VLNA 2YJ7A 1OVNA 4KDYA 4ZILA 2O87A 1AAZA 2GQLA 4K5SA 3CSJA 1R7HA 3LG6A 1T4ZA 2PPTA 1ERWA 4IN0A 2WRTA 1XVQA 3GH9A 2X99A 1XBSA 3ME8A 4I97A 1ERUA 2A4HA 2MMAA 4G2EA 2P5QA 4MJBA 5AIVA 3GN3A 5DALB 5CRHA 4K7OA 2VM2A 5EPFA 4AKIA 5DCHA 3CRTA 2WJUA 2EC4A 2H01A 1EOHA 4K9ZA 1EEMA 5B8BA 2IMDA 1Q98A 1B48A 4G19A 2IN3A 3KTBA 3GYKA 1O8XA 1YJ6A 4JZQA 3F6DA 1OYJA 3A2XA 2UZ8A 2LKUA 2NPBA 4O5UA 5J5NA 3ZITA 1DE1A 3Q6OA 4TR4A 2A2PA 3QPMA 4ACSA 3D0ZA 1MDIA 1U87A 1WRYA 1AW9A 2F9SA 9GSSA 4QL7A 2H1DA 1XW5A 16GSA 3GA4A 1AQXA 1TW9A 3UEMA 1M7TA 2D2ZA 5F07A 1RW1A 2YCDA 2KP1A 2WCIA 3GSSA 2C3TA 1GL8A 3QFAC 2G2QA 3TOTA 4MZWA 1U3IA 1TK0B 4MABA 4V2LA 2FWEA 1HQOA 4MJEA 1QMVA 2M72A 5H5RA 2PBJA 2GS3A 4RQXA 1FB0A 2YNXA 2Z9SA 4K6XA 3FMWA 5EVOA 2E2MA 2TRCP 2VLUA 2A4VA 4ECIA 3V1WA 2REMA 4KDXA 5G31A 3HJPA 2PN8A 4AI6A 3GL5A 2XBIA 3IAM2 5BMUB 2VL9A 1SU9A 4AJ7A 4G01A 1AXDA 4TXOB 5H5SA 1BEDA 3EYTA 3P2AA 2EFEA 5KEJA 2HSMB 1AC1A 4L5LA 7GSSA 2R3XA 2H1LA 2L4QA 5ELGA 1J08A 1FB6A 3J7Yb 4K7NA 2I9HA 1OKDA 2H0IA 2H71A 5CREA 3E9JB 1A0RP 1WE0A 3BCKA 2IWTA 6GSWA 3KP9A 2YOIA 2HSHA 4WBRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RI7 A;  5IQY A;  3ZL5 A;  1WIK A;  4XS4 A;  1JZO A;  1Y25 A;  1NM3 A;  3TDG A;  1GTA A;  3KXO A;  2VCZ A;  5D9T A;  2B6M A;  2AJQ B;  3IHQ A;  2FY6 A;  4MK3 A;  3IRA A;  3FKF A;  3HYP A;  4HDE A;  3TJG A;  2LJK A;  4NAX A;  4KX4 A;  2KP2 A;  5ABR A;  2H0H A;  3VI7 A;  3CRU A;  2QGV A;  5CRG A;  3UJ1 A;  3GIX A;  2OE3 A;  3GKN A;  2DBC A;  3FR6 A;  4HI7 A;  2ZUP A;  3HVX A;  1XWC A;  4D73 B;  4NMU A;  20GS A;  1W4V A;  3L9S A;  1OKT A;  5GAN D;  3HD5 A;  1GNE A;  3GL3 A;  5G5F A;  3GHA A;  4DSQ A;  2N5B A;  3D22 A;  3U5R E;  2LJR A;  1WMJ A;  4X0X A;  4XRA A;  2RUE A;  2LQQ A;  3HJM A;  4ECB A;  3P8W A;  5IM9 A;  4L5O A;  3L9V A;  4N0V A;  2M46 A;  1ABA A;  4XS6 A;  2VAF A;  2I1U A;  3FEU A;  1MTC A;  1VGL A;  3KH9 A;  3FW2 A;  1EV9 A;  4WXT A;  2H66 A;  2H8L A;  2DLX A;  2ES7 A;  4IQ1 A;  2HE3 A;  1TI1 A;  3OR5 A;  1SKR B;  3APS A;  3UOM A;  1SK2 A;  1Z6M A;  4IQA A;  2C0E A;  3IBH A;  2HI7 A;  3TGZ A;  5DBQ A;  3SWL A;  1B9Y C;  1J9B A;  2L6C A;  13GS A;  1T00 A;  2F51 A;  4F82 A;  1U3A A;  5B6M A;  1ZOF A;  1WJK A;  2KHP A;  3GKK A;  3CSH A;  3IV4 A;  5DJM A;  2YPM A;  3FY7 A;  1FVJ A;  2V32 A;  4FO5 A;  3WGD A;  2HRK A;  1S3A A;  2DJ3 A;  3FRC A;  5A4W A;  2PVO C;  4YH2 A;  3LWA A;  5B8A A;  1TI3 A;  4EUY A;  5G5E A;  1WOU A;  1WWJ A;  1TU7 A;  3ZIV A;  4IEL A;  1THX A;  1B4Q A;  2CVB A;  1ML6 A;  2VOC A;  1TP9 A;  2YWN A;  2CZ2 A;  2FWF A;  2CAI A;  1BX9 A;  2C0D A;  1PA3 A;  4O92 A;  3N5O A;  2VD0 A;  3VK9 A;  3RPP A;  4I8B A;  3G9B A;  3VI5 A;  5GSS A;  1HNB A;  1VF1 A;  4KUN A;  1SKS B;  4IKH A;  3TKQ A;  4OFT A;  2LRN A;  4NWY A;  3GX8 A;  2YAN A;  4KAE A;  1MDJ A;  1TRW A;  4MZC A;  4MP4 A;  3I43 A;  2JSZ A;  4GF0 A;  2VL2 A;  2CQ9 A;  1SK1 A;  4PUA A;  3LQ7 A;  4J2F A;  4ILF A;  2VCT A;  1FAA A;  1I9D A;  2P31 A;  1ERV A;  3EUR A;  2CX3 A;  3DML A;  3IDV A;  2FUG 2;  1K0O A;  2KLX A;  2H1G A;  4TVE A;  3TJJ A;  3TKS E;  1GTB A;  1FOV A;  4ZL8 A;  2RUF A;  1GNW A;  1A0F A;  3IK9 A;  1M0U A;  4HUA A;  1PX7 A;  2VIM A;  4MJA A;  4AJ6 A;  4OO5 A;  1BQ7 A;  1X5E A;  3A2W A;  1ZGN A;  4H86 A;  2H73 A;  2CZ3 A;  1O8W A;  1BYE A;  3QFB C;  2HRF A;  1UC7 A;  1TK5 B;  2KOK A;  2R6K A;  4N0Z A;  1OC9 B;  3LGC A;  1SJZ A;  4KH7 A;  4N10 A;  2HFD A;  2LNT A;  3FZA A;  2TIR A;  2JZR A;  3GTU A;  3FZ9 A;  1OC8 A;  2YP6 A;  2LTK A;  3DEX A;  3CYN A;  4GXZ A;  3G7I A;  1W89 A;  4PXO A;  2HYX A;  3APO A;  4NPB A;  1VF4 A;  5AIX A;  4FYU A;  1UN2 A;  5D96 A;  1C72 A;  3TJF A;  4HZ4 A;  4ZBB A;  1SD8 A;  5GAP D;  1KBN A;  5H5Q A;  4EE0 A;  3IR4 A;  3R2Q A;  3TKS C;  1XWG A;  3M8N A;  5A4V A;  4XS1 A;  4OD7 A;  5C00 A;  3ZIJ A;  4KA0 A;  1TKD B;  2NTO A;  4BVX A;  3GKX A;  5ECN B;  4ML6 A;  3PGT A;  1IYH A;  2VCW A;  3ZMK A;  2HRA A;  5ECI B;  2B5E A;  2K8V A;  4XHM A;  4DVC A;  3G7Y A;  3CTG A;  3TB2 A;  5F0G A;  2E7P A;  1QXH A;  3BJ5 A;  3CBU A;  3RBT A;  3ZVJ A;  1F9M A;  2DJ2 A;  2OE0 A;  1S3C A;  4MZB A;  1O81 A;  5HR1 A;  5ECH B;  1A2J A;  2H70 A;  3KMN A;  2H6X A;  4ZB9 A;  3CXG A;  3EU3 A;  5JCW A;  3BCI A;  5D9X A;  2RM6 A;  5CRD A;  4G10 A;  3N9J A;  3M0F A;  3R3E A;  2H0G A;  5IMA A;  2V41 A;  1PMT A;  5HFI A;  4N11 A;  4KDU A;  2QKE A;  3PH9 A;  4GSS A;  5ID2 A;  6GSX A;  4ZBA A;  2J23 A;  2VL2 C;  3TKR A;  3H1N A;  1V9W A;  3ZVJ D;  4JRR A;  1YKA A;  1T4Y A;  1Z5Y E;  2FWH A;  3TRP A;  3DGQ A;  3A2V A;  2HXK A;  3HXS A;  3LSZ A;  4HQZ A;  4X1U A;  3QDN A;  1H4O A;  3WT2 A;  4JED A;  1WP0 A;  5CO3 A;  4YQU A;  1ZYE A;  2GTU A;  4TR1 B;  1GSY A;  5JCU A;  6GST A;  3GMF A;  1RQM A;  4GQC A;  2GT6 A;  3VWU A;  2VUP A;  3ZZX A;  4BVY B;  4EVM A;  2MMN A;  3NOF A;  4GQF A;  2X64 A;  5HR3 A;  5CYY A;  5A5K A;  4DSS B;  1RK4 A;  3MWH A;  5D8I A;  2QC7 A;  4OMV A;  4WR4 A;  1FW1 A;  3Q74 A;  1SEN A;  2O85 A;  2L57 A;  4EO3 A;  5ECK B;  3J7Y k;  3GKM A;  3LYK A;  1GSQ A;  3KD0 A;  1V57 A;  4K8M A;  1ZMA A;  1ZCP A;  1SYR A;  1MD3 A;  4LL4 B;  4WR5 A;  3FR3 A;  1YEP A;  1XFL A;  5DAL A;  1SD9 A;  1GSS A;  1PSQ A;  2I3Y A;  2MMO A;  1KTE A;  3HCZ A;  2LRT A;  5INY A;  5ECP B;  2FLS A;  4TRX A;  2LST A;  4HZ2 A;  12GS A;  2J9H A;  2XPE A;  3QCP A;  4J56 E;  4PUF C;  5G30 A;  3VWW A;  1TK8 B;  1KNG A;  2IFQ B;  4RQR A;  2R2J A;  3ZTL A;  5IMZ A;  2LQO A;  2PVQ A;  4PNG A;  4Z7X A;  4KCA A;  3LOR A;  1B8X A;  3KZQ A;  4BL7 B;  2X8G A;  3TKP A;  2DJJ A;  3US3 A;  3UVT A;  1TXX A;  2F8A A;  1VF2 A;  1GUL A;  4KSO A;  1K0C A;  4AF2 A;  3IK7 A;  2GQK A;  3TJB A;  5HFK A;  4YAP A;  2B5X A;  4MF5 A;  1S3D A;  2HZE B;  1K0A A;  2B3S A;  2H76 A;  4ECJ A;  3O76 A;  1SL2 B;  1M2B A;  2MBT A;  4KGI A;  3Q18 A;  4POB A;  3C1R A;  4IBP A;  3L78 A;  2IFQ A;  2HSN B;  1YDK A;  4MF6 A;  2H74 A;  5KN0 A;  3HZ8 A;  1K0M A;  3QAG A;  5GZZ B;  1GSF A;  4MF7 A;  1AIU A;  4TKY A;  5EY6 A;  1NSW A;  3HDC A;  5F06 A;  2WUL A;  3LXT A;  2YV9 A;  3M1G A;  4WEY A;  1GP1 A;  3TJK A;  4HU9 A;  3KM6 A;  2H19 A;  5BMU A;  1YY7 A;  1E2Y A;  4TXO A;  1QUW A;  3C71 A;  4OFN A;  2L6D A;  1UVZ A;  2HSM A;  2JL4 A;  2GSS A;  3ERW A;  5HQP A;  2RM5 A;  2R37 A;  4NHW A;  4ISD A;  4P3Y B;  2E2G A;  5F8B A;  2F3M A;  3CSI A;  2CA8 A;  2C0G A;  3L4N A;  2H1B A;  1SJ6 A;  1K3O A;  4IJ3 A;  3KIJ A;  2HT9 A;  3KJY A;  4PQ1 A;  2GQM A;  2GSQ A;  1TU8 A;  3VWX A;  1PKZ A;  2DC5 A;  4TN8 A;  1TRV A;  2CV4 A;  1X9M B;  1T3B A;  1M2D A;  2GZP A;  3DVX A;  5D93 A;  2H1A A;  5DQS A;  5D9V A;  3GH6 A;  1YF0 A;  4WF5 A;  4PGT A;  3MDK A;  3PIN A;  2LJA A;  5GST A;  5JWQ B;  5HFG A;  2C1Y A;  3VPQ A;  1PL2 A;  4O5R A;  3WD6 A;  2VD1 A;  2DJK A;  1F3A A;  3FZ5 A;  4HU7 A;  3UBL A;  4JR4 A;  3G7J A;  4F0B A;  2B1K A;  4D73 A;  3SBC A;  4AJ8 A;  4TR0 A;  1FG4 A;  4JBB A;  2E0Q A;  3UMA A;  1DE2 A;  1DUG A;  2V2G A;  4FYC A;  3JCM L;  2GGT A;  2EIO A;  2X8C A;  3Q19 A;  3LYP A;  3RPN A;  3GUS A;  3HJO A;  2XBQ A;  4HS1 A;  1SKW B;  3RHB A;  2C0F A;  1TJD A;  2PUK C;  4V1A p;  3S9F A;  1R5A A;  3ZRE A;  5IMV A;  3H4K A;  4V1A g;  2DML A;  5B7C A;  5AIS A;  3WGE A;  3TCO A;  4JE1 A;  1G0T A;  5AGY A;  2FNO A;  1A24 A;  1XWK A;  3C73 A;  3F3R A;  2NBS A;  2VLT A;  4ZB8 A;  3ERG A;  5DQY A;  1TDI A;  4WET A;  1YKC A;  4GCI A;  2FA4 A;  3GFK A;  5DCG A;  3CMI A;  3DKS A;  3IC8 A;  1E6B A;  1JFU A;  5J41 A;  2K8S A;  1GUH A;  1SL1 B;  4GLT A;  1XIY A;  5L71 A;  1X0R A;  2H6Z A;  4OCF A;  1Z3E A;  5DJL A;  2ON7 A;  3UAP A;  1OE7 A;  5IO0 A;  2FA8 A;  4PQH A;  1T1V A;  3F9U A;  4POK A;  2GVP A;  3HA9 A;  1GRX A;  5LCZ A;  3WT1 A;  2JU5 A;  1A2M A;  2AAW A;  2K6V A;  2BTO T;  2CVK A;  4I5Q A;  1ACV A;  1ERT A;  2RII A;  4KND A;  4AGS A;  5DVB A;  2B7J A;  3U6V A;  2ALB A;  4IGJ A;  1M9A A;  1O85 A;  3C1S A;  2YV7 A;  4ZIJ A;  2C4J A;  5KN2 A;  1URM A;  1I5G A;  1O6J A;  5HR0 A;  5LD0 A;  3RAZ A;  3LJR A;  1JZD A;  5DAK B;  2GDR A;  3QAV A;  1XPV A;  2HNL A;  4IJI A;  2LNS A;  2AV4 A;  5B6N A;  2F8F A;  1XXU A;  4F9Z A;  1XW9 A;  4L0W A;  4ULX A;  2GZZ A;  3F0I A;  3HY2 A;  4PTS A;  4GSN A;  4POM A;  1ZYQ B;  1JHB A;  1A8Y A;  3E3E A;  4K0N A;  2OBI A;  4KB3 A;  3DIE A;  2X8H A;  1USB A;  1OC9 A;  4CW9 A;  4HOJ A;  3BBY A;  3D6I A;  3MAK A;  1X5C A;  1LU4 A;  3NIV A;  1WPI A;  3GST A;  3ZYW A;  5ECS A;  2IL3 A;  4J57 E;  1NHO A;  1EEJ A;  4Q5N A;  4IW9 A;  3W8S A;  1TTZ A;  3LEF A;  4LLR A;  4XTS A;  1X5D A;  5G1K A;  1FHE A;  1GTU A;  2P5R A;  2PMT A;  3TOU A;  4PQI A;  2V6O A;  4ZXG A;  4K0G A;  2XHF A;  3UL3 A;  3D4T A;  3HVV A;  3P7X A;  4YQV A;  5J3R A;  4V2N A;  4MCU A;  1ST9 A;  3KH7 A;  2LRC A;  1KEB A;  2MZC A;  3E0U A;  5G2Z A;  3UBK A;  1XWB A;  4WBJ A;  6GSY A;  2FWG A;  3LFL A;  8GSS A;  2OKA A;  5CAX A;  3HVS A;  4O32 A;  3DRN A;  3EC3 A;  3F8U A;  2M80 A;  3TRQ A;  2RLI A;  2AYT A;  3P90 A;  1EP7 A;  5CP1 A;  19GS A;  3GV1 A;  4E8E A;  3IXR A;  2VCX A;  3DWV A;  3M9J A;  1V40 A;  2A2R A;  1SYX A;  5AN1 A;  4MDC A;  5IOX A;  4CHS A;  1YZX A;  2B1L A;  1FVK A;  3QD9 A;  2PU9 C;  2TRX A;  3D5J A;  1Y6E A;  5E4W A;  4LMV A;  2JAC A;  3ERF A;  2OBK A;  2FCH A;  4WKW A;  1JZW A;  4RUV A;  4OWY A;  4FH8 A;  2GSR A;  4I2T A;  2R5G A;  2NDO A;  1X9W B;  4I2U A;  2G0F A;  4G0I A;  3IOS A;  4ZL7 A;  1SK0 A;  1XCC A;  3H93 A;  2H30 A;  1T7P B;  3UIW A;  5IMC A;  2O89 A;  3VFI A;  2MMZ A;  11GS A;  2JZS A;  2V6K A;  1GTI A;  2JAD A;  1XZO A;  5ECO B;  1EOG A;  4KCE A;  2XPD A;  1U6T A;  4EKZ A;  2A2S A;  1QGV A;  3CTF A;  1HD2 A;  4K1F A;  5A4U A;  3GNJ A;  4OO4 A;  1N2A A;  2C80 A;  3D4M A;  4JU5 A;  1Z7P A;  1TOF A;  2OE1 A;  4MH3 A;  1V58 A;  5KN3 A;  18GS A;  4MPF A;  4TR1 A;  2VCQ A;  4GRF A;  1GWC A;  3FHK A;  1G6Y A;  4WF4 A;  3QMX A;  2YJH A;  3ZFL A;  3IA1 A;  5ECR B;  4BVY A;  1A23 A;  1K0N A;  3EVI A;  3KEB A;  4LL1 B;  1EP8 A;  4NV2 A;  3H79 A;  4BPY A;  2YN1 A;  4K2D A;  2LV3 A;  4ZB6 A;  4DSS A;  4FYB A;  3LXZ A;  4NV5 A;  2FHE A;  1J0F A;  2JZT A;  4HQS A;  3DYR A;  2WDU A;  3NZN A;  1FO5 A;  4MPG A;  4F03 A;  3IE3 A;  1M9B A;  2AUV A;  1V2A A;  3IAS 2;  1QFN A;  2JSY A;  1F2E A;  3DXB A;  1NW2 A;  3MSZ A;  1JLW A;  2YZH A;  3DVW A;  3QAW A;  5JWR B;  1A8L A;  4EDY A;  1AUC A;  3WGX A;  5J9C A;  3ME7 A;  2PGT A;  2H72 A;  2IME A;  1PL1 A;  2CAQ A;  4Q5F A;  4YAV A;  1F37 A;  1R5P A;  4LA1 A;  4ECC A;  2H6Y A;  4EXJ A;  3QOU A;  5F05 A;  2EIR A;  1ZL9 A;  3VPT A;  3ED3 A;  3A5W A;  1N8J A;  5J4U A;  2VL3 A;  2OAC A;  5IPG A;  1PGT A;  1THO A;  6GSS A;  4XS4 B;  4OCE A;  3M3M A;  1G7E A;  1B4P A;  4NXI A;  3I69 A;  1EWX A;  1X9S B;  3EU4 A;  3FK8 A;  5FWG A;  2L59 A;  2IJY A;  2IIY A;  4EDZ A;  4FIW A;  1QK8 A;  3EMX A;  5JCG A;  3KMO A;  1G6W A;  2B5Y A;  4BL7 A;  4ID0 A;  4EC0 A;  4G9H A;  1HYU A;  3GRX A;  3QR6 A;  2WS2 A;  2L5L A;  3A3T A;  3HZ4 A;  4CDO A;  1BG5 A;  1GUK A;  2IMF A;  1K0D A;  3F4S A;  1UA5 A;  2HZE A;  2GLR A;  4GST A;  3I9V 2;  1HNC A;  4OFM A;  2OAD A;  1GLQ A;  1EV4 A;  4PUR A;  1OE8 A;  4L8E A;  3FZ4 A;  2GZY A;  3IPZ A;  1M99 A;  3AY8 A;  2WB9 A;  5IMD A;  4BA7 A;  2N5A A;  4EF0 A;  4POL A;  2CVD A;  1ZZY A;  4QL9 A;  3DD3 A;  3PPU A;  2QSI A;  1BJX A;  4HEA 2;  2HQT A;  4MA9 A;  1XOA A;  1ON4 A;  3HHV A;  4Q5R A;  1PN9 A;  3PR8 A;  2YWO A;  4Q5Q A;  3KGK A;  4YQM A;  2DIY A;  3F3Q A;  1AQV A;  1GH2 A;  2DJ1 A;  1PQN A;  2DMM A;  2K18 A;  5HR2 A;  2C8U A;  3M9K A;  5G1L A;  2IPA A;  2C3Q A;  4XCS A;  3GX0 A;  3RDW A;  2HSY A;  2NVL A;  1CQH A;  3FYG A;  1QQ2 A;  2N5F A;  3C7M A;  1GSE A;  4IP6 A;  3APQ A;  2HRK B;  1JLV A;  4DSR A;  4F2I A;  1BAY A;  1Q4J A;  1EGR A;  4TOP A;  2MYG A;  3VUR A;  4N30 A;  2AB6 A;  2YWM A;  3ZFB A;  1MDK A;  1EZK A;  3TKS A;  4G0L A;  1YF1 A;  2LEG A;  3BOA A;  3BD2 A;  1F3B A;  3RHC A;  4BWQ A;  1GLP A;  5D9W A;  1V98 A;  2CX4 A;  2VCV A;  2DIZ A;  3K8N A;  1MD4 A;  4V2M A;  2IMI A;  1O73 A;  2EIQ A;  1PRX A;  3WYW A;  4IHU A;  1SL0 B;  2MBS A;  1CQG A;  5CRW A;  1XOB A;  4HJM A;  1F6M C;  1Z6N A;  1MEK A;  3HKR A;  4IS0 A;  14GS A;  1O7U A;  4HJ2 A;  5FHI A;  1OC3 A;  2IMK A;  3F63 A;  1DBY A;  1GUM A;  1G7O A;  3O3T A;  1YEX A;  4USS A;  1XWA A;  2CT6 A;  3C8E A;  1GSD A;  5ENU A;  2AHE A;  5IIZ A;  5JWO B;  4X43 A;  4FQU A;  1H75 A;  4F0C A;  5DDL A;  2HLS A;  5ECM B;  4QQ7 A;  5C04 A;  2C3N A;  5COH A;  2K9F A;  2OJL A;  1T8E B;  1VF3 A;  2B7K A;  2P0G A;  2VM1 A;  5E59 A;  1AQW A;  1NHY A;  5FT3 A;  2GST A;  5D73 A;  2LUS A;  4MMM A;  4KSM A;  3W8J A;  2FD3 A;  17GS A;  3GTU B;  2VLV A;  4XRD A;  5IMF A;  5LNK e;  4NHZ A;  4IP1 A;  1XW6 A;  3F4T A;  4JR6 A;  3IC4 A;  1TRS A;  4TXV A;  3TUE A;  3I6A A;  5J9B A;  3ZLP A;  2FGX A;  4KF9 A;  2I4A A;  2PER A;  3EE2 A;  1OAZ A;  2O8V B;  1A2L A;  1EGO A;  3KTL A;  3EWL A;  5ELA A;  2BMX A;  1XVW A;  4TR3 A;  1K3L A;  3UAR A;  3L0H A;  3EMP A;  5IO2 A;  1VRS D;  2BJX A;  4BWS A;  4BVX B;  1SJI A;  3EIN A;  1B9X C;  4I6X A;  1K0B A;  2YWI A;  4RI6 A;  2PWJ A;  2I81 A;  2ZCT A;  5CNW A;  1U88 A;  4K7I A;  3UVH A;  4GWR A;  2HZF A;  3KP8 A;  3MNG A;  4L0U A;  4O7H A;  2L4C A;  2R4V A;  4EL1 A;  3ZRD A;  4ML1 A;  2WZ9 A;  3FR9 A;  1IYI A;  2ZNM A;  1JZR A;  5ECQ B;  6GSU A;  5DAK A;  1PKW A;  2GT5 A;  10GS A;  1HNA A;  3L9U A;  3ZML A;  2WFC A;  2DSA A;  2V1M A;  2LS5 A;  4MLY A;  4IVF A;  4MJC A;  1Z7R A;  5KN1 A;  2O7K A;  5ECL B;  2VO4 A;  4G0K A;  4DEJ A;  6GSV A;  4KE3 A;  1LBK A;  4PNF A;  3VWV A;  4TW5 A;  2OA7 A;  1LJR A;  4KW6 A;  3ISO A;  2ON5 A;  4ZL9 A;  4LMW A;  1ILO A;  1R26 A;  3F4R A;  1YQ1 A;  5ID2 B;  2H75 A;  4GTU A;  4XIH A;  1R4W A;  2HRN A;  1K3Y A;  2KUC A;  2WGR A;  5IOW A;  2YZU A;  2XC2 A;  1PX6 A;  3O6T A;  1Z9H A;  5EL8 A;  3KCM A;  4E8H A;  3TRX A;  3H8Q A;  2DJ0 A;  1GSU A;  22GS A;  5IPH A;  1PD2 1;  3F6F A;  1TRU A;  3D21 A;  4ZBD A;  2L5O A;  3W6G A;  1DSB A;  4MH2 A;  1M2A A;  3GUR A;  4PX1 A;  3VLN A;  2YJ7 A;  1OVN A;  4KDY A;  4ZIL A;  2O87 A;  1AAZ A;  2GQL A;  3CSJ A;  1R7H A;  3LG6 A;  1T4Z A;  2PPT A;  1ERW A;  4IN0 A;  2WRT A;  1XVQ A;  3GH9 A;  2X99 A;  1XBS A;  3ME8 A;  4I97 A;  1ERU A;  2MMA A;  4G2E A;  2P5Q A;  4MJB A;  5AIV A;  3GN3 A;  5DAL B;  5CRH A;  4K7O A;  2VM2 A;  5EPF A;  5DCH A;  3CRT A;  2WJU A;  2EC4 A;  2H01 A;  1EOH A;  4K9Z A;  1EEM A;  5B8B A;  2IMD A;  1Q98 A;  1B48 A;  4G19 A;  2IN3 A;  3KTB A;  3GYK A;  1O8X A;  1YJ6 A;  4JZQ A;  3F6D A;  1OYJ A;  3A2X A;  2UZ8 A;  2LKU A;  2NPB A;  5J5N A;  3ZIT A;  1DE1 A;  3Q6O A;  4TR4 A;  3QPM A;  4ACS A;  3D0Z A;  1MDI A;  1U87 A;  1WRY A;  1AW9 A;  2F9S A;  9GSS A;  4QL7 A;  2H1D A;  1XW5 A;  16GS A;  3GA4 A;  1AQX A;  1TW9 A;  3UEM A;  1M7T A;  2D2Z A;  5F07 A;  1RW1 A;  2YCD A;  2KP1 A;  2WCI A;  3GSS A;  2C3T A;  1GL8 A;  3QFA C;  2G2Q A;  3TOT A;  4MZW A;  1U3I A;  1TK0 B;  4MAB A;  4V2L A;  2FWE A;  1HQO A;  4MJE A;  1QMV A;  2M72 A;  5H5R A;  2PBJ A;  2GS3 A;  4RQX A;  1FB0 A;  2YNX A;  2Z9S A;  4K6X A;  5EVO A;  2E2M A;  2TRC P;  2VLU A;  2A4V A;  4ECI A;  3V1W A;  2REM A;  4KDX A;  5G31 A;  3HJP A;  2PN8 A;  3GL5 A;  2XBI A;  3IAM 2;  2VL9 A;  1SU9 A;  4AJ7 A;  1AXD A;  4TXO B;  5H5S A;  1BED A;  3EYT A;  3P2A A;  5KEJ A;  2HSM B;  1AC1 A;  4L5L A;  7GSS A;  2R3X A;  2L4Q A;  5ELG A;  1J08 A;  1FB6 A;  3J7Y b;  4K7N A;  2I9H A;  1OKD A;  2H0I A;  2H71 A;  5CRE A;  3E9J B;  1A0R P;  1WE0 A;  3BCK A;  2IWT A;  6GSW A;  3KP9 A;  2YOI A;  2HSH A;  4WBR D; 
#chains in the Genus database with same CATH topology
 4RI7 A;  2R0P A;  5IQY A;  3ZL5 A;  1WIK A;  4XS4 A;  1JZO A;  1Y25 A;  1NM3 A;  3TDG A;  3RGB C;  1GTA A;  3KXO A;  2VCZ A;  5D9T A;  2B6M A;  2AJQ B;  3IHQ A;  2FY6 A;  4YKF A;  4MK3 A;  3IRA A;  3FKF A;  3HYP A;  4HDE A;  3TJG A;  2LJK A;  3LW9 A;  4NAX A;  4KX4 A;  2KP2 A;  5ABR A;  2H0H A;  3VI7 A;  4ICY A;  3CRU A;  2QGV A;  5CRG A;  3UJ1 A;  3GIX A;  2OE3 A;  3GKN A;  2DBC A;  3FR6 A;  4HI7 A;  2ZUP A;  3HVX A;  1XWC A;  4D73 B;  4NMU A;  2WZS A;  20GS A;  1W4V A;  3L9S A;  1OKT A;  5GAN D;  3HD5 A;  1GNE A;  3GL3 A;  5G5F A;  3CQF A;  3GHA A;  4DSQ A;  2N5B A;  3D22 A;  3U5R E;  2LJR A;  1WMJ A;  4X0X A;  4XRA A;  2RUE A;  2LQQ A;  3HJM A;  4ECB A;  3P8W A;  5IM9 A;  4L5O A;  5A1N A;  3L9V A;  4N0V A;  2M46 A;  1ABA A;  4XS6 A;  2VAF A;  2I1U A;  3FEU A;  1MTC A;  1VGL A;  4PHZ C;  3KH9 A;  3FW2 A;  1EV9 A;  4WXT A;  2H66 A;  2H8L A;  2DLX A;  2ES7 A;  4IQ1 A;  2HE3 A;  1TI1 A;  3OR5 A;  3CHX C;  1SKR B;  3APS A;  1I1I P;  3UOM A;  1SK2 A;  1Z6M A;  4IQA A;  2C0E A;  3IBH A;  2HI7 A;  3TGZ A;  5DBQ A;  3SWL A;  3HVN A;  1B9Y C;  1J9B A;  2L6C A;  13GS A;  1T00 A;  2F51 A;  4F82 A;  1U3A A;  5B6M A;  1ZOF A;  1WJK A;  2WVX B;  2KHP A;  3GKK A;  3CSH A;  3IV4 A;  5DJM A;  2YPM A;  3FY7 A;  1FVJ A;  2V32 A;  4FO5 A;  3WGD A;  2HRK A;  1S3A A;  2DJ3 A;  3FRC A;  5A4W A;  2PVO C;  4YH2 A;  3LWA A;  5B8A A;  1TI3 A;  4EUY A;  5G5E A;  1WOU A;  1WWJ A;  1TU7 A;  3ZIV A;  4IEL A;  1THX A;  2DKI A;  1B4Q A;  2CVB A;  1ML6 A;  2VOC A;  1TP9 A;  2YWN A;  2CZ2 A;  4EIP A;  2FWF A;  2CAI A;  1BX9 A;  2C0D A;  1PA3 A;  4O92 A;  3N5O A;  2VD0 A;  3VK9 A;  3RPP A;  4I8B A;  3G9B A;  3VI5 A;  5GSS A;  1HNB A;  1M3I A;  1VF1 A;  4KUN A;  1SKS B;  4IKH A;  3TKQ A;  4OFT A;  2LRN A;  4NWY A;  3GX8 A;  2YAN A;  4KAE A;  1MDJ A;  1TRW A;  4MZC A;  4MP4 A;  3I43 A;  2JSZ A;  4GF0 A;  2VL2 A;  4W66 A;  2CQ9 A;  1SK1 A;  4PUA A;  3LQ7 A;  4J2F A;  4ILF A;  2VCT A;  1FAA A;  1I9D A;  2P31 A;  1ERV A;  3EUR A;  2CX3 A;  3DML A;  3IDV A;  2FUG 2;  1K0O A;  2KLX A;  2H1G A;  4TVE A;  3TJJ A;  3TKS E;  1GTB A;  1FOV A;  4ZL8 A;  2RUF A;  1GNW A;  1A0F A;  3IK9 A;  1M0U A;  4HUA A;  1PX7 A;  2VIM A;  4MJA A;  4AJ6 A;  4OO5 A;  1BQ7 A;  1X5E A;  3A2W A;  1ZGN A;  4H86 A;  2H73 A;  2CZ3 A;  1O8W A;  1BYE A;  3QFB C;  2HRF A;  1UC7 A;  1TK5 B;  2KOK A;  2R6K A;  4N0Z A;  1OC9 B;  3LGC A;  1SJZ A;  4KH7 A;  4N10 A;  2HFD A;  1Y1U A;  2LNT A;  3FZA A;  2VKZ G;  2TIR A;  4AKG A;  2JZR A;  3GTU A;  2O5V A;  3FZ9 A;  1OC8 A;  2YP6 A;  2LTK A;  3DEX A;  3CYN A;  4A5P A;  4GXZ A;  3G7I A;  1W89 A;  4PXO A;  2HYX A;  3APO A;  4NPB A;  1VF4 A;  5AIX A;  4FYU A;  1UN2 A;  5D96 A;  1C72 A;  3TJF A;  4HZ4 A;  4ZBB A;  1SD8 A;  5GAP D;  1KBN A;  5H5Q A;  4EE0 A;  3IR4 A;  3R2Q A;  5A34 A;  3TKS C;  1XWG A;  3M8N A;  5A4V A;  4XS1 A;  4OD7 A;  5C00 A;  3ZIJ A;  4KA0 A;  1TKD B;  2NTO A;  4BVX A;  3GKX A;  5ECN B;  4ML6 A;  3PGT A;  1IYH A;  2VCW A;  3ZMK A;  2HRA A;  5ECI B;  2B5E A;  2K8V A;  4XHM A;  5A5H A;  4DVC A;  3G7Y A;  3CTG A;  3TB2 A;  5F0G A;  2E7P A;  1QXH A;  3BJ5 A;  3CBU A;  3RBT A;  3ZVJ A;  1F9M A;  2DJ2 A;  2OE0 A;  5J47 A;  1S3C A;  4MZB A;  1O81 A;  5HR1 A;  5ECH B;  1A2J A;  2H70 A;  3KMN A;  2H6X A;  4ZB9 A;  3CXG A;  3EU3 A;  5JCW A;  3BCI A;  5D9X A;  2RM6 A;  5CRD A;  4G10 A;  3N9J A;  3M0F A;  3R3E A;  2H0G A;  5IMA A;  2V41 A;  1PMT A;  5HFI A;  4N11 A;  4KDU A;  2EFD A;  2QKE A;  1TXU A;  3PH9 A;  4GSS A;  5ID2 A;  6GSX A;  4ZBA A;  2J23 A;  2VL2 C;  3TKR A;  3H1N A;  1V9W A;  3ZVJ D;  4JRR A;  1YKA A;  1T4Y A;  1Z5Y E;  2FWH A;  3TRP A;  3DGQ A;  3A2V A;  2HXK A;  3HXS A;  3LSZ A;  4HQZ A;  4X1U A;  3QDN A;  1H4O A;  3WT2 A;  4JED A;  1WP0 A;  5CO3 A;  4AKH A;  4YQU A;  1ZYE A;  2GTU A;  4TR1 B;  1GSY A;  5JCU A;  6GST A;  3GMF A;  1RQM A;  4GQC A;  2GT6 A;  3VWU A;  2VUP A;  3ZZX A;  4BVY B;  4EVM A;  2MMN A;  3NOF A;  4GQF A;  2X64 A;  5HR3 A;  5CYY A;  5A5K A;  4DSS B;  1RK4 A;  3MWH A;  5D8I A;  4CY6 A;  2QC7 A;  4OMV A;  4WR4 A;  1FW1 A;  3Q74 A;  1SEN A;  2O85 A;  2L57 A;  4EO3 A;  5ECK B;  3J7Y k;  3GKM A;  3LYK A;  1GSQ A;  3KD0 A;  1V57 A;  4K8M A;  1ZMA A;  1ZCP A;  1SYR A;  1MD3 A;  4LL4 B;  4WR5 A;  3FR3 A;  1YEP A;  1XFL A;  5DAL A;  1SD9 A;  1GSS A;  1PSQ A;  2I3Y A;  2MMO A;  1KTE A;  3HCZ A;  2LRT A;  5INY A;  5ECP B;  2FLS A;  4TRX A;  2LST A;  4HZ2 A;  12GS A;  2J9H A;  2XPE A;  3QCP A;  4J56 E;  4PUF C;  5G30 A;  1PN0 A;  3VWW A;  1TK8 B;  1KNG A;  2IFQ B;  4RQR A;  2R2J A;  3ZTL A;  5IMZ A;  2LQO A;  2PVQ A;  4PNG A;  4K2X A;  4Z7X A;  4KCA A;  3LOR A;  1B8X A;  3KZQ A;  4BL7 B;  2X8G A;  3TKP A;  2DJJ A;  3US3 A;  3UVT A;  1TXX A;  2F8A A;  1VF2 A;  1GUL A;  4AKX B;  4KSO A;  1K0C A;  4AF2 A;  3IK7 A;  2GQK A;  3TJB A;  5HFK A;  4YAP A;  2B5X A;  4MF5 A;  1S3D A;  2HZE B;  1K0A A;  2B3S A;  4EIQ A;  2H76 A;  4ECJ A;  3O76 A;  1SL2 B;  1M2B A;  2MBT A;  4KGI A;  3Q18 A;  4POB A;  3C1R A;  4IBP A;  3L78 A;  2IFQ A;  2HSN B;  1YDK A;  4MF6 A;  2H74 A;  5KN0 A;  3HZ8 A;  1K0M A;  3QAG A;  5GZZ B;  1GSF A;  4MF7 A;  1AIU A;  4TKY A;  5EY6 A;  1NSW A;  3HDC A;  5F06 A;  2WUL A;  3LXT A;  2YV9 A;  3M1G A;  4WEY A;  1GP1 A;  3TJK A;  3KM6 A;  4HU9 A;  2H19 A;  5BMU A;  1YY7 A;  1E2Y A;  4TXO A;  2QA1 A;  1QUW A;  1N25 A;  3C71 A;  4OFN A;  2L6D A;  1UVZ A;  3CWG A;  2HSM A;  2JL4 A;  2X49 A;  2GSS A;  3ERW A;  5HQP A;  2RM5 A;  2R37 A;  4NHW A;  4ISD A;  4P3Y B;  2E2G A;  5F8B A;  2F3M A;  3CSI A;  2CA8 A;  2C0G A;  3L4N A;  2H1B A;  1SJ6 A;  1K3O A;  4IJ3 A;  3KIJ A;  2HT9 A;  3KJY A;  4PQ1 A;  2GQM A;  2GSQ A;  1TU8 A;  3VWX A;  1PKZ A;  4BIK A;  2DC5 A;  4TN8 A;  1M3J A;  1TRV A;  2CV4 A;  2R0C A;  1X9M B;  1T3B A;  1M2D A;  2GZP A;  3DVX A;  5D93 A;  2H1A A;  5DQS A;  5D9V A;  3GH6 A;  1YF0 A;  4WF5 A;  4PGT A;  3MDK A;  3PIN A;  2LJA A;  5GST A;  5JWQ B;  5HFG A;  2C1Y A;  5J4V A;  3VPQ A;  1PL2 A;  4O5R A;  3WD6 A;  2VD1 A;  2DJK A;  1F3A A;  4QMK A;  3FZ5 A;  4HU7 A;  3UBL A;  4JR4 A;  3G7J A;  4F0B A;  2B1K A;  4D73 A;  3SBC A;  4AJ8 A;  4TR0 A;  1FG4 A;  4JBB A;  2UV8 G;  2E0Q A;  3UMA A;  1DE2 A;  1DUG A;  2V2G A;  4FYC A;  3JCM L;  2GGT A;  2EIO A;  2X8C A;  3Q19 A;  3LYP A;  3RPN A;  3GUS A;  3HJO A;  2XBQ A;  4HS1 A;  1SKW B;  3RHB A;  2C0F A;  1TJD A;  2PUK C;  4V1A p;  3S9F A;  1R5A A;  3ZRE A;  5IMV A;  3H4K A;  4V1A g;  2DML A;  5B7C A;  5AIS A;  2EFH A;  3WGE A;  3TCO A;  4JE1 A;  1G0T A;  5AGY A;  2WW1 A;  2FNO A;  2R0G A;  1A24 A;  1XWK A;  3C73 A;  3F3R A;  2NBS A;  5KOW A;  2VLT A;  4ZB8 A;  3ERG A;  5DQY A;  5J40 A;  1TDI A;  4WET A;  1YKC A;  4GCI A;  2WVX A;  1XG8 A;  2FA4 A;  3GFK A;  5DCG A;  3CMI A;  3DKS A;  3IC8 A;  1E6B A;  1JFU A;  5J41 A;  2K8S A;  1GUH A;  1SL1 B;  4GLT A;  1XIY A;  5L71 A;  1X0R A;  2H6Z A;  4OCF A;  1Z3E A;  5DJL A;  2ON7 A;  3UAP A;  1OE7 A;  5IO0 A;  2FA8 A;  4PQH A;  1T1V A;  3F9U A;  4POK A;  1SVL A;  3A5I A;  2GVP A;  3HA9 A;  1GRX A;  5LCZ A;  3WT1 A;  2JU5 A;  1FOH A;  1A2M A;  2AAW A;  2K6V A;  2BTO T;  2CVK A;  4I5Q A;  1ACV A;  1ERT A;  2RII A;  4KND A;  4AGS A;  5DVB A;  2B7J A;  3U6V A;  2ALB A;  4IGJ A;  1M9A A;  1O85 A;  3C1S A;  2YV7 A;  4ZIJ A;  2C4J A;  5KN2 A;  1URM A;  1I5G A;  1O6J A;  5HR0 A;  5LD0 A;  3RAZ A;  1YEW C;  3LJR A;  1JZD A;  5DAK B;  2GDR A;  3QAV A;  1XPV A;  2HNL A;  4IJI A;  2LNS A;  2AV4 A;  5B6N A;  2F8F A;  1XXU A;  4F9Z A;  1XW9 A;  3IHG A;  4L0W A;  4ULX A;  2GZZ A;  3F0I A;  3HY2 A;  4PTS A;  4GSN A;  4POM A;  1ZYQ B;  1JHB A;  1A8Y A;  3E3E A;  4K0N A;  2OBI A;  4KB3 A;  3DIE A;  2X8H A;  1USB A;  1OC9 A;  4CW9 A;  4HOJ A;  3BBY A;  3D6I A;  4PI0 C;  3MAK A;  1X5C A;  1LU4 A;  3NIV A;  1WPI A;  3GST A;  3ZYW A;  5ECS A;  2IL3 A;  4J57 E;  1NHO A;  1EEJ A;  4Q5N A;  4IW9 A;  3W8S A;  1TTZ A;  3LEF A;  4LLR A;  4XTS A;  1X5D A;  5G1K A;  1FHE A;  1GTU A;  2P5R A;  2X4A A;  2PMT A;  3TOU A;  4PQI A;  2V6O A;  4ZXG A;  4K0G A;  2XHF A;  3UL3 A;  3D4T A;  3HVV A;  3P7X A;  4YQV A;  5J3R A;  4V2N A;  4MCU A;  1ST9 A;  3KH7 A;  2LRC A;  1KEB A;  2MZC A;  3E0U A;  5G2Z A;  3UBK A;  1XWB A;  4WBJ A;  6GSY A;  2FWG A;  3LFL A;  8GSS A;  2OKA A;  5CAX A;  1S4B P;  3HVS A;  4O32 A;  3RFR C;  3DRN A;  3EC3 A;  3F8U A;  2M80 A;  3TRQ A;  2RLI A;  2AYT A;  3P90 A;  1EP7 A;  5CP1 A;  19GS A;  3GV1 A;  4E8E A;  3IXR A;  2VCX A;  2EFC A;  3DWV A;  3M9J A;  1V40 A;  2A2R A;  1SYX A;  5AN1 A;  4MDC A;  5IOX A;  4CHS A;  4FXY P;  1YZX A;  2B1L A;  1FVK A;  3QD9 A;  1SVO A;  2PU9 C;  2TRX A;  3D5J A;  1Y6E A;  5E4W A;  4LMV A;  4E68 A;  2JAC A;  3ERF A;  2OBK A;  2FCH A;  4WKW A;  1JZW A;  4RUV A;  4OWY A;  4FH8 A;  2GSR A;  1S3R A;  4I2T A;  2R5G A;  2NDO A;  1X9W B;  1BF5 A;  4I2U A;  2G0F A;  4Z2R A;  4G0I A;  3IOS A;  4ZL7 A;  1SK0 A;  1XCC A;  3H93 A;  2H30 A;  1T7P B;  3UIW A;  4K5R A;  2WW2 A;  5IMC A;  2O89 A;  3VFI A;  2MMZ A;  11GS A;  2JZS A;  1ZYP A;  2V6K A;  1GTI A;  2JAD A;  1XZO A;  5ECO B;  1EOG A;  4KCE A;  2XPD A;  1U6T A;  4EKZ A;  2A2S A;  1QGV A;  5BRT A;  3CTF A;  1HD2 A;  4K1F A;  5A4U A;  3GNJ A;  4OO4 A;  1N2A A;  2C80 A;  3D4M A;  4JU5 A;  1Z7P A;  1TOF A;  2OE1 A;  4MH3 A;  1V58 A;  5KN3 A;  18GS A;  4MPF A;  4TR1 A;  2VCQ A;  4GRF A;  1GWC A;  3FHK A;  1G6Y A;  4WF4 A;  3QMX A;  2YJH A;  3ZFL A;  3IA1 A;  5ECR B;  4BVY A;  1A23 A;  1K0N A;  3EVI A;  3KEB A;  4LL1 B;  1EP8 A;  4NV2 A;  3H79 A;  4BPY A;  2YN1 A;  4K2D A;  2LV3 A;  2QA2 A;  4ZB6 A;  4DSS A;  4FYB A;  3LXZ A;  4NV5 A;  2FHE A;  1J0F A;  2JZT A;  4HQS A;  3DYR A;  2WDU A;  3NZN A;  1FO5 A;  4MPG A;  4F03 A;  3IE3 A;  1M9B A;  2AUV A;  1V2A A;  3IAS 2;  1QFN A;  2JSY A;  1F2E A;  3DXB A;  1NW2 A;  3MSZ A;  1JLW A;  2YZH A;  3DVW A;  4GDF A;  3QAW A;  5JWR B;  1A8L A;  4EDY A;  1AUC A;  3WGX A;  5J9C A;  2H72 A;  2PGT A;  2IME A;  3ME7 A;  1PL1 A;  2CAQ A;  4Q5F A;  4YAV A;  1F37 A;  1R5P A;  4LA1 A;  4ECC A;  2H6Y A;  4EXJ A;  3QOU A;  5F05 A;  2EIR A;  1ZL9 A;  3VPT A;  3ED3 A;  3A5W A;  1N8J A;  5J4U A;  2VL3 A;  2OAC A;  5IPG A;  1PGT A;  1THO A;  6GSS A;  4XS4 B;  4OCE A;  3M3M A;  1G7E A;  1B4P A;  4NXI A;  3I69 A;  1EWX A;  1X9S B;  1PFO A;  3EU4 A;  3FK8 A;  5FWG A;  2L59 A;  2IJY A;  2IIY A;  4EDZ A;  4FIW A;  1QK8 A;  3EMX A;  5JCG A;  3KMO A;  1G6W A;  2B5Y A;  4BL7 A;  4ID0 A;  4EC0 A;  4G9H A;  1HYU A;  3GRX A;  3QR6 A;  2WS2 A;  2L5L A;  3A3T A;  3HZ4 A;  4CDO A;  1BG5 A;  1GUK A;  2IMF A;  1K0D A;  3F4S A;  1UA5 A;  2HZE A;  2GLR A;  4GST A;  3I9V 2;  1HNC A;  4OFM A;  2OAD A;  1GLQ A;  1EV4 A;  4PUR A;  1OE8 A;  4L8E A;  3FZ4 A;  2HSN A;  2GZY A;  3IPZ A;  4ZB7 A;  1M99 A;  3AY8 A;  2WB9 A;  5IMD A;  4BA7 A;  4Z2U A;  2N5A A;  4EF0 A;  4POL A;  5A1N B;  2CVD A;  1ZZY A;  4QL9 A;  3DD3 A;  3PPU A;  2QSI A;  1BJX A;  4HEA 2;  2HQT A;  4MA9 A;  1XOA A;  1ON4 A;  3HHV A;  1ZYN A;  4Q5R A;  1PN9 A;  3PR8 A;  2YWO A;  4Q5Q A;  3KGK A;  4YQM A;  2DIY A;  3F3Q A;  1AQV A;  1GH2 A;  2DJ1 A;  1PQN A;  2DMM A;  2K18 A;  5HR2 A;  2C8U A;  3M9K A;  5G1L A;  2IPA A;  2C3Q A;  4XCS A;  4PI2 C;  3GX0 A;  4O5Q A;  3RDW A;  2HSY A;  2NVL A;  1CQH A;  3FYG A;  1QQ2 A;  2N5F A;  3C7M A;  1GSE A;  4IP6 A;  3APQ A;  2HRK B;  1JLV A;  4DSR A;  4F2I A;  1BAY A;  1Q4J A;  1EGR A;  4TOP A;  2MYG A;  3VUR A;  4N30 A;  2AB6 A;  2YWM A;  3ZFB A;  1MDK A;  1EZK A;  3TKS A;  4G0L A;  1YF1 A;  2LEG A;  3BOA A;  3BD2 A;  1F3B A;  3RHC A;  4BWQ A;  1GLP A;  4N3Z A;  5D9W A;  1V98 A;  2CX4 A;  2VCV A;  2DIZ A;  3K8N A;  1MD4 A;  4V2M A;  2IMI A;  1O73 A;  2EIQ A;  1PRX A;  3WYW A;  3MIX A;  4Z2T A;  4IHU A;  1SL0 B;  2MBS A;  1CQG A;  5CRW A;  1XOB A;  4HJM A;  1F6M C;  1Z6N A;  1MEK A;  3HKR A;  4IS0 A;  14GS A;  1O7U A;  4HJ2 A;  5FHI A;  1OC3 A;  2IMK A;  3HMJ G;  3F63 A;  1DBY A;  1GUM A;  1G7O A;  3O3T A;  1YEX A;  4USS A;  1XWA A;  2CT6 A;  2WVZ A;  3C8E A;  1GSD A;  5ENU A;  2AHE A;  5IIZ A;  5JWO B;  1SVM A;  4X43 A;  4FQU A;  1H75 A;  4F0C A;  5DDL A;  2HLS A;  5ECM B;  4QQ7 A;  5C04 A;  2C3N A;  5COH A;  2K9F A;  2OJL A;  2WW3 A;  1T8E B;  1VF3 A;  2B7K A;  2P0G A;  2VM1 A;  5E59 A;  1AQW A;  1NHY A;  5FT3 A;  2GST A;  5D73 A;  2LUS A;  4MMM A;  4KSM A;  3W8J A;  2FD3 A;  17GS A;  3GTU B;  2VLV A;  4XRD A;  2O3E A;  5IMF A;  5LNK e;  4NHZ A;  4IP1 A;  1XW6 A;  3F4T A;  4JR6 A;  3IC4 A;  1TRS A;  4TXV A;  3TUE A;  3I6A A;  5J9B A;  3ZLP A;  2FGX A;  4KF9 A;  2I4A A;  2PER A;  3EE2 A;  1OAZ A;  2O8V B;  1A2L A;  1EGO A;  3KTL A;  5A34 B;  3EWL A;  5ELA A;  2BMX A;  1XVW A;  4TR3 A;  4X4J A;  1K3L A;  3UAR A;  3L0H A;  3EMP A;  5IO2 A;  1VRS D;  2BJX A;  4BWS A;  4BVX B;  4YKG A;  1SJI A;  3EIN A;  1B9X C;  4I6X A;  1K0B A;  4MNN A;  2WW0 A;  4RI6 A;  2PWJ A;  2YWI A;  3MYD A;  2I81 A;  2ZCT A;  5CNW A;  1U88 A;  4K7I A;  3UVH A;  4HSC X;  2OT3 A;  4GWR A;  2HZF A;  3KP8 A;  5KOX A;  3MNG A;  4L0U A;  4O7H A;  2L4C A;  2R4V A;  4EL1 A;  3ZRD A;  3TU3 B;  5A5H B;  4ML1 A;  2WZ9 A;  3FR9 A;  1IYI A;  4CY8 A;  2ZNM A;  1JZR A;  5ECQ B;  6GSU A;  5DAK A;  1PKW A;  2GT5 A;  10GS A;  1HNA A;  3L9U A;  3ZML A;  2WFC A;  2DSA A;  2V1M A;  2LS5 A;  4MLY A;  4IVF A;  4MJC A;  1Z7R A;  5KN1 A;  2O7K A;  5ECL B;  2VO4 A;  4G0K A;  4DEJ A;  6GSV A;  4KE3 A;  1LBK A;  1BG1 A;  4PNF A;  3VWV A;  4TW5 A;  2OA7 A;  1LJR A;  4KW6 A;  3ISO A;  1YVL A;  2ON5 A;  4ZL9 A;  4LMW A;  1ILO A;  3EPT A;  1R26 A;  3F4R A;  1YQ1 A;  5ID2 B;  2H75 A;  2WVY A;  4GTU A;  4XIH A;  1R4W A;  2HRN A;  1K3Y A;  2KUC A;  2WGR A;  5IOW A;  2YZU A;  2XC2 A;  1PX6 A;  3O6T A;  1Z9H A;  5EL8 A;  5J4Y A;  3KCM A;  4E8H A;  3TRX A;  3H8Q A;  2DJ0 A;  1GSU A;  22GS A;  5IPH A;  1PD2 1;  3F6F A;  1TRU A;  3D21 A;  4ZBD A;  2DKH A;  2L5O A;  3W6G A;  1DSB A;  4MH2 A;  1M2A A;  3GUR A;  4PX1 A;  3VLN A;  2YJ7 A;  1OVN A;  4KDY A;  4ZIL A;  2O87 A;  1AAZ A;  2GQL A;  4K5S A;  3CSJ A;  1R7H A;  3LG6 A;  1T4Z A;  2PPT A;  1ERW A;  4IN0 A;  2WRT A;  1XVQ A;  3GH9 A;  2X99 A;  2O36 A;  1XBS A;  3ME8 A;  4I97 A;  1ERU A;  2A4H A;  2MMA A;  4G2E A;  2P5Q A;  4MJB A;  5AIV A;  3GN3 A;  5DAL B;  5CRH A;  4K7O A;  2VM2 A;  5EPF A;  4AKI A;  5DCH A;  3CRT A;  2WJU A;  2EC4 A;  2H01 A;  1EOH A;  4K9Z A;  1EEM A;  5B8B A;  2IMD A;  1Q98 A;  1B48 A;  4G19 A;  2IN3 A;  3KTB A;  3GYK A;  1O8X A;  1YJ6 A;  4JZQ A;  3F6D A;  1OYJ A;  3A2X A;  2UZ8 A;  2LKU A;  2NPB A;  4O5U A;  5J5N A;  3ZIT A;  1DE1 A;  3Q6O A;  4TR4 A;  2A2P A;  3QPM A;  4ACS A;  3D0Z A;  1MDI A;  1U87 A;  1WRY A;  1AW9 A;  2F9S A;  9GSS A;  4QL7 A;  2H1D A;  1XW5 A;  16GS A;  3GA4 A;  1AQX A;  1TW9 A;  3UEM A;  1M7T A;  2D2Z A;  5F07 A;  1RW1 A;  2YCD A;  2KP1 A;  2WCI A;  3GSS A;  2C3T A;  1GL8 A;  3QFA C;  2G2Q A;  3TOT A;  4MZW A;  1U3I A;  1TK0 B;  4MAB A;  4V2L A;  2FWE A;  1HQO A;  4MJE A;  1QMV A;  2M72 A;  5H5R A;  2PBJ A;  2GS3 A;  4RQX A;  1FB0 A;  2YNX A;  2Z9S A;  4K6X A;  3FMW A;  5EVO A;  2E2M A;  2TRC P;  2VLU A;  2A4V A;  4ECI A;  3V1W A;  2REM A;  4KDX A;  5G31 A;  3HJP A;  2PN8 A;  4AI6 A;  3GL5 A;  2XBI A;  3IAM 2;  5BMU B;  2VL9 A;  1SU9 A;  4AJ7 A;  4G01 A;  1AXD A;  4TXO B;  5H5S A;  1BED A;  3EYT A;  3P2A A;  2EFE A;  5KEJ A;  2HSM B;  1AC1 A;  4L5L A;  7GSS A;  2R3X A;  2H1L A;  2L4Q A;  5ELG A;  1J08 A;  1FB6 A;  3J7Y b;  4K7N A;  2I9H A;  1OKD A;  2H0I A;  2H71 A;  5CRE A;  3E9J B;  1A0R P;  1WE0 A;  3BCK A;  2IWT A;  6GSW A;  3KP9 A;  2YOI A;  2HSH A;  4WBR D; 
#chains in the Genus database with same CATH homology
 4RI7 A;  2R0P A;  5IQY A;  3ZL5 A;  1WIK A;  4XS4 A;  1JZO A;  1Y25 A;  1NM3 A;  3TDG A;  1GTA A;  3KXO A;  2VCZ A;  5D9T A;  2B6M A;  2AJQ B;  3IHQ A;  2FY6 A;  4YKF A;  4MK3 A;  3IRA A;  3FKF A;  3HYP A;  4HDE A;  3TJG A;  2LJK A;  3LW9 A;  4NAX A;  4KX4 A;  2KP2 A;  5ABR A;  2H0H A;  3VI7 A;  4ICY A;  3CRU A;  2QGV A;  5CRG A;  3UJ1 A;  3GIX A;  2OE3 A;  3GKN A;  2DBC A;  3FR6 A;  4HI7 A;  2ZUP A;  3HVX A;  1XWC A;  4D73 B;  4NMU A;  20GS A;  1W4V A;  3L9S A;  1OKT A;  5GAN D;  3HD5 A;  1GNE A;  3GL3 A;  5G5F A;  3GHA A;  4DSQ A;  2N5B A;  3D22 A;  3U5R E;  2LJR A;  1WMJ A;  4X0X A;  4XRA A;  2RUE A;  2LQQ A;  3HJM A;  4ECB A;  3P8W A;  5IM9 A;  4L5O A;  5A1N A;  3L9V A;  4N0V A;  2M46 A;  1ABA A;  4XS6 A;  2VAF A;  2I1U A;  3FEU A;  1MTC A;  1VGL A;  3KH9 A;  3FW2 A;  1EV9 A;  4WXT A;  2H66 A;  2H8L A;  2DLX A;  2ES7 A;  4IQ1 A;  2HE3 A;  1TI1 A;  3OR5 A;  1SKR B;  3APS A;  3UOM A;  1SK2 A;  1Z6M A;  4IQA A;  2C0E A;  3IBH A;  2HI7 A;  3TGZ A;  5DBQ A;  3SWL A;  1B9Y C;  1J9B A;  2L6C A;  13GS A;  1T00 A;  2F51 A;  4F82 A;  1U3A A;  5B6M A;  1ZOF A;  1WJK A;  2KHP A;  3GKK A;  3CSH A;  3IV4 A;  5DJM A;  2YPM A;  3FY7 A;  1FVJ A;  2V32 A;  4FO5 A;  3WGD A;  2HRK A;  1S3A A;  2DJ3 A;  3FRC A;  5A4W A;  2PVO C;  4YH2 A;  3LWA A;  5B8A A;  1TI3 A;  4EUY A;  5G5E A;  1WOU A;  1WWJ A;  1TU7 A;  3ZIV A;  4IEL A;  1THX A;  2DKI A;  1B4Q A;  2CVB A;  1ML6 A;  2VOC A;  1TP9 A;  2YWN A;  2CZ2 A;  4EIP A;  2FWF A;  2CAI A;  1BX9 A;  2C0D A;  1PA3 A;  4O92 A;  3N5O A;  2VD0 A;  3VK9 A;  3RPP A;  4I8B A;  3G9B A;  3VI5 A;  5GSS A;  1HNB A;  1VF1 A;  4KUN A;  1SKS B;  4IKH A;  3TKQ A;  4OFT A;  2LRN A;  4NWY A;  3GX8 A;  2YAN A;  4KAE A;  1MDJ A;  1TRW A;  4MZC A;  4MP4 A;  3I43 A;  2JSZ A;  4GF0 A;  2VL2 A;  4W66 A;  2CQ9 A;  1SK1 A;  4PUA A;  3LQ7 A;  4J2F A;  4ILF A;  2VCT A;  1FAA A;  1I9D A;  2P31 A;  1ERV A;  3EUR A;  2CX3 A;  3DML A;  3IDV A;  2FUG 2;  1K0O A;  2KLX A;  2H1G A;  4TVE A;  3TJJ A;  3TKS E;  1GTB A;  1FOV A;  4ZL8 A;  2RUF A;  1GNW A;  1A0F A;  3IK9 A;  1M0U A;  4HUA A;  1PX7 A;  2VIM A;  4MJA A;  4AJ6 A;  4OO5 A;  1BQ7 A;  1X5E A;  3A2W A;  1ZGN A;  4H86 A;  2H73 A;  2CZ3 A;  1O8W A;  1BYE A;  3QFB C;  2HRF A;  1UC7 A;  1TK5 B;  2KOK A;  2R6K A;  4N0Z A;  1OC9 B;  3LGC A;  1SJZ A;  4KH7 A;  4N10 A;  2HFD A;  1Y1U A;  2LNT A;  3FZA A;  2VKZ G;  2TIR A;  4AKG A;  2JZR A;  3GTU A;  2O5V A;  3FZ9 A;  1OC8 A;  2YP6 A;  2LTK A;  3DEX A;  3CYN A;  4A5P A;  4GXZ A;  3G7I A;  1W89 A;  4PXO A;  2HYX A;  3APO A;  4NPB A;  1VF4 A;  5AIX A;  4FYU A;  1UN2 A;  5D96 A;  1C72 A;  3TJF A;  4HZ4 A;  4ZBB A;  1SD8 A;  5GAP D;  1KBN A;  5H5Q A;  4EE0 A;  3IR4 A;  3R2Q A;  5A34 A;  3TKS C;  1XWG A;  3M8N A;  5A4V A;  4XS1 A;  4OD7 A;  5C00 A;  3ZIJ A;  4KA0 A;  1TKD B;  2NTO A;  4BVX A;  3GKX A;  5ECN B;  4ML6 A;  3PGT A;  1IYH A;  2VCW A;  3ZMK A;  2HRA A;  5ECI B;  2B5E A;  2K8V A;  4XHM A;  5A5H A;  4DVC A;  3G7Y A;  3CTG A;  3TB2 A;  5F0G A;  2E7P A;  1QXH A;  3BJ5 A;  3CBU A;  3RBT A;  3ZVJ A;  1F9M A;  2DJ2 A;  2OE0 A;  5J47 A;  1S3C A;  4MZB A;  1O81 A;  5HR1 A;  5ECH B;  1A2J A;  2H70 A;  3KMN A;  2H6X A;  4ZB9 A;  3CXG A;  3EU3 A;  5JCW A;  3BCI A;  5D9X A;  2RM6 A;  5CRD A;  4G10 A;  3N9J A;  3M0F A;  3R3E A;  2H0G A;  5IMA A;  2V41 A;  1PMT A;  5HFI A;  4N11 A;  4KDU A;  2EFD A;  2QKE A;  1TXU A;  3PH9 A;  4GSS A;  5ID2 A;  6GSX A;  4ZBA A;  2J23 A;  2VL2 C;  3TKR A;  3H1N A;  1V9W A;  3ZVJ D;  4JRR A;  1YKA A;  1T4Y A;  1Z5Y E;  2FWH A;  3TRP A;  3DGQ A;  3A2V A;  2HXK A;  3HXS A;  3LSZ A;  4HQZ A;  4X1U A;  3QDN A;  1H4O A;  3WT2 A;  4JED A;  1WP0 A;  5CO3 A;  4AKH A;  4YQU A;  1ZYE A;  2GTU A;  4TR1 B;  1GSY A;  5JCU A;  6GST A;  3GMF A;  1RQM A;  4GQC A;  2GT6 A;  3VWU A;  2VUP A;  3ZZX A;  4BVY B;  4EVM A;  2MMN A;  3NOF A;  4GQF A;  2X64 A;  5HR3 A;  5CYY A;  5A5K A;  4DSS B;  1RK4 A;  3MWH A;  5D8I A;  4CY6 A;  2QC7 A;  4OMV A;  4WR4 A;  1FW1 A;  3Q74 A;  1SEN A;  2O85 A;  2L57 A;  4EO3 A;  5ECK B;  3J7Y k;  3GKM A;  3LYK A;  1GSQ A;  3KD0 A;  1V57 A;  4K8M A;  1ZMA A;  1ZCP A;  1SYR A;  1MD3 A;  4LL4 B;  4WR5 A;  3FR3 A;  1YEP A;  1XFL A;  5DAL A;  1SD9 A;  1GSS A;  1PSQ A;  2I3Y A;  2MMO A;  1KTE A;  3HCZ A;  2LRT A;  5INY A;  5ECP B;  2FLS A;  4TRX A;  2LST A;  4HZ2 A;  12GS A;  2J9H A;  2XPE A;  3QCP A;  4J56 E;  4PUF C;  5G30 A;  1PN0 A;  3VWW A;  1TK8 B;  1KNG A;  2IFQ B;  4RQR A;  2R2J A;  3ZTL A;  5IMZ A;  2LQO A;  2PVQ A;  4PNG A;  4K2X A;  4Z7X A;  4KCA A;  3LOR A;  1B8X A;  3KZQ A;  4BL7 B;  2X8G A;  3TKP A;  2DJJ A;  3US3 A;  3UVT A;  1TXX A;  2F8A A;  1VF2 A;  1GUL A;  4AKX B;  4KSO A;  1K0C A;  4AF2 A;  3IK7 A;  2GQK A;  3TJB A;  5HFK A;  4YAP A;  2B5X A;  4MF5 A;  1S3D A;  2HZE B;  1K0A A;  2B3S A;  4EIQ A;  2H76 A;  4ECJ A;  3O76 A;  1SL2 B;  1M2B A;  2MBT A;  4KGI A;  3Q18 A;  4POB A;  3C1R A;  4IBP A;  3L78 A;  2IFQ A;  2HSN B;  1YDK A;  4MF6 A;  2H74 A;  5KN0 A;  3HZ8 A;  1K0M A;  3QAG A;  5GZZ B;  1GSF A;  4MF7 A;  1AIU A;  4TKY A;  5EY6 A;  1NSW A;  3HDC A;  5F06 A;  2WUL A;  3LXT A;  2YV9 A;  3M1G A;  4WEY A;  1GP1 A;  3TJK A;  3KM6 A;  4HU9 A;  2H19 A;  5BMU A;  1YY7 A;  1E2Y A;  4TXO A;  2QA1 A;  1QUW A;  1N25 A;  3C71 A;  4OFN A;  2L6D A;  1UVZ A;  3CWG A;  2HSM A;  2JL4 A;  2X49 A;  2GSS A;  3ERW A;  5HQP A;  2RM5 A;  2R37 A;  4NHW A;  4ISD A;  4P3Y B;  2E2G A;  5F8B A;  2F3M A;  3CSI A;  2CA8 A;  2C0G A;  3L4N A;  2H1B A;  1SJ6 A;  1K3O A;  4IJ3 A;  3KIJ A;  2HT9 A;  3KJY A;  4PQ1 A;  2GQM A;  2GSQ A;  1TU8 A;  3VWX A;  1PKZ A;  2DC5 A;  4TN8 A;  1TRV A;  2CV4 A;  2R0C A;  1X9M B;  1T3B A;  1M2D A;  2GZP A;  3DVX A;  5D93 A;  2H1A A;  5DQS A;  5D9V A;  3GH6 A;  1YF0 A;  4WF5 A;  4PGT A;  3MDK A;  3PIN A;  2LJA A;  5GST A;  5JWQ B;  5HFG A;  2C1Y A;  5J4V A;  3VPQ A;  1PL2 A;  4O5R A;  3WD6 A;  2VD1 A;  2DJK A;  1F3A A;  4QMK A;  3FZ5 A;  4HU7 A;  3UBL A;  4JR4 A;  3G7J A;  4F0B A;  2B1K A;  4D73 A;  3SBC A;  4AJ8 A;  4TR0 A;  1FG4 A;  4JBB A;  2UV8 G;  2E0Q A;  3UMA A;  1DE2 A;  1DUG A;  2V2G A;  4FYC A;  3JCM L;  2GGT A;  2EIO A;  2X8C A;  3Q19 A;  3LYP A;  3RPN A;  3GUS A;  3HJO A;  2XBQ A;  4HS1 A;  1SKW B;  3RHB A;  2C0F A;  1TJD A;  2PUK C;  4V1A p;  3S9F A;  1R5A A;  3ZRE A;  5IMV A;  3H4K A;  4V1A g;  2DML A;  5B7C A;  5AIS A;  2EFH A;  3WGE A;  3TCO A;  4JE1 A;  1G0T A;  5AGY A;  2FNO A;  2R0G A;  1A24 A;  1XWK A;  3C73 A;  3F3R A;  2NBS A;  5KOW A;  2VLT A;  4ZB8 A;  3ERG A;  5DQY A;  5J40 A;  1TDI A;  4WET A;  1YKC A;  4GCI A;  2FA4 A;  3GFK A;  5DCG A;  3CMI A;  3DKS A;  3IC8 A;  1E6B A;  1JFU A;  5J41 A;  2K8S A;  1GUH A;  1SL1 B;  4GLT A;  1XIY A;  5L71 A;  1X0R A;  2H6Z A;  4OCF A;  1Z3E A;  5DJL A;  2ON7 A;  3UAP A;  1OE7 A;  5IO0 A;  2FA8 A;  4PQH A;  1T1V A;  3F9U A;  4POK A;  1SVL A;  3A5I A;  2GVP A;  3HA9 A;  1GRX A;  5LCZ A;  3WT1 A;  2JU5 A;  1FOH A;  1A2M A;  2AAW A;  2K6V A;  2BTO T;  2CVK A;  4I5Q A;  1ACV A;  1ERT A;  2RII A;  4KND A;  4AGS A;  5DVB A;  2B7J A;  3U6V A;  2ALB A;  4IGJ A;  1M9A A;  1O85 A;  3C1S A;  2YV7 A;  4ZIJ A;  2C4J A;  5KN2 A;  1URM A;  1I5G A;  1O6J A;  5HR0 A;  5LD0 A;  3RAZ A;  3LJR A;  1JZD A;  5DAK B;  2GDR A;  3QAV A;  1XPV A;  2HNL A;  4IJI A;  2LNS A;  2AV4 A;  5B6N A;  2F8F A;  1XXU A;  4F9Z A;  1XW9 A;  3IHG A;  4L0W A;  4ULX A;  2GZZ A;  3F0I A;  3HY2 A;  4PTS A;  4GSN A;  4POM A;  1ZYQ B;  1JHB A;  1A8Y A;  3E3E A;  4K0N A;  2OBI A;  4KB3 A;  3DIE A;  2X8H A;  1USB A;  1OC9 A;  4CW9 A;  4HOJ A;  3BBY A;  3D6I A;  3MAK A;  1X5C A;  1LU4 A;  3NIV A;  1WPI A;  3GST A;  3ZYW A;  5ECS A;  2IL3 A;  4J57 E;  1NHO A;  1EEJ A;  4Q5N A;  4IW9 A;  3W8S A;  1TTZ A;  3LEF A;  4LLR A;  4XTS A;  1X5D A;  5G1K A;  1FHE A;  1GTU A;  2P5R A;  2X4A A;  2PMT A;  3TOU A;  4PQI A;  2V6O A;  4ZXG A;  4K0G A;  2XHF A;  3UL3 A;  3D4T A;  3HVV A;  3P7X A;  4YQV A;  5J3R A;  4V2N A;  4MCU A;  1ST9 A;  3KH7 A;  2LRC A;  1KEB A;  2MZC A;  3E0U A;  5G2Z A;  3UBK A;  1XWB A;  4WBJ A;  6GSY A;  2FWG A;  3LFL A;  8GSS A;  2OKA A;  5CAX A;  3HVS A;  4O32 A;  3DRN A;  3EC3 A;  3F8U A;  2M80 A;  3TRQ A;  2RLI A;  2AYT A;  3P90 A;  1EP7 A;  5CP1 A;  19GS A;  3GV1 A;  4E8E A;  3IXR A;  2VCX A;  2EFC A;  3DWV A;  3M9J A;  1V40 A;  2A2R A;  1SYX A;  5AN1 A;  4MDC A;  5IOX A;  4CHS A;  1YZX A;  2B1L A;  1FVK A;  3QD9 A;  1SVO A;  2PU9 C;  2TRX A;  3D5J A;  1Y6E A;  5E4W A;  4LMV A;  4E68 A;  2JAC A;  3ERF A;  2OBK A;  2FCH A;  4WKW A;  1JZW A;  4RUV A;  4OWY A;  4FH8 A;  2GSR A;  4I2T A;  2R5G A;  2NDO A;  1X9W B;  1BF5 A;  4I2U A;  2G0F A;  4Z2R A;  4G0I A;  3IOS A;  4ZL7 A;  1SK0 A;  1XCC A;  3H93 A;  2H30 A;  1T7P B;  3UIW A;  4K5R A;  5IMC A;  2O89 A;  3VFI A;  2MMZ A;  11GS A;  2JZS A;  1ZYP A;  2V6K A;  1GTI A;  2JAD A;  1XZO A;  5ECO B;  1EOG A;  4KCE A;  2XPD A;  1U6T A;  4EKZ A;  2A2S A;  1QGV A;  5BRT A;  3CTF A;  1HD2 A;  4K1F A;  5A4U A;  3GNJ A;  4OO4 A;  1N2A A;  2C80 A;  3D4M A;  4JU5 A;  1Z7P A;  1TOF A;  2OE1 A;  4MH3 A;  1V58 A;  5KN3 A;  18GS A;  4MPF A;  4TR1 A;  2VCQ A;  4GRF A;  1GWC A;  3FHK A;  1G6Y A;  4WF4 A;  3QMX A;  2YJH A;  3ZFL A;  3IA1 A;  5ECR B;  4BVY A;  1A23 A;  1K0N A;  3EVI A;  3KEB A;  4LL1 B;  1EP8 A;  4NV2 A;  3H79 A;  4BPY A;  2YN1 A;  4K2D A;  2LV3 A;  2QA2 A;  4ZB6 A;  4DSS A;  4FYB A;  3LXZ A;  4NV5 A;  2FHE A;  1J0F A;  2JZT A;  4HQS A;  3DYR A;  2WDU A;  3NZN A;  1FO5 A;  4MPG A;  4F03 A;  3IE3 A;  1M9B A;  2AUV A;  1V2A A;  3IAS 2;  1QFN A;  2JSY A;  1F2E A;  3DXB A;  1NW2 A;  3MSZ A;  1JLW A;  2YZH A;  3DVW A;  4GDF A;  3QAW A;  5JWR B;  1A8L A;  4EDY A;  1AUC A;  3WGX A;  5J9C A;  3ME7 A;  2PGT A;  2H72 A;  2IME A;  1PL1 A;  2CAQ A;  4Q5F A;  4YAV A;  1F37 A;  1R5P A;  4LA1 A;  4ECC A;  2H6Y A;  4EXJ A;  3QOU A;  5F05 A;  2EIR A;  1ZL9 A;  3VPT A;  3ED3 A;  3A5W A;  1N8J A;  5J4U A;  2VL3 A;  2OAC A;  5IPG A;  1PGT A;  1THO A;  6GSS A;  4XS4 B;  4OCE A;  3M3M A;  1G7E A;  1B4P A;  4NXI A;  3I69 A;  1EWX A;  1X9S B;  3EU4 A;  3FK8 A;  5FWG A;  2L59 A;  2IJY A;  2IIY A;  4EDZ A;  4FIW A;  1QK8 A;  3EMX A;  5JCG A;  3KMO A;  1G6W A;  2B5Y A;  4BL7 A;  4ID0 A;  4EC0 A;  4G9H A;  1HYU A;  3GRX A;  3QR6 A;  2WS2 A;  2L5L A;  3A3T A;  3HZ4 A;  4CDO A;  1BG5 A;  1GUK A;  2IMF A;  1K0D A;  3F4S A;  1UA5 A;  2HZE A;  2GLR A;  4GST A;  3I9V 2;  1HNC A;  4OFM A;  2OAD A;  1GLQ A;  1EV4 A;  4PUR A;  1OE8 A;  4L8E A;  3FZ4 A;  2HSN A;  2GZY A;  3IPZ A;  4ZB7 A;  1M99 A;  3AY8 A;  2WB9 A;  5IMD A;  4BA7 A;  4Z2U A;  2N5A A;  4EF0 A;  4POL A;  5A1N B;  2CVD A;  1ZZY A;  4QL9 A;  3DD3 A;  3PPU A;  2QSI A;  1BJX A;  4HEA 2;  2HQT A;  4MA9 A;  1XOA A;  1ON4 A;  3HHV A;  1ZYN A;  4Q5R A;  1PN9 A;  3PR8 A;  2YWO A;  4Q5Q A;  3KGK A;  4YQM A;  2DIY A;  3F3Q A;  1AQV A;  1GH2 A;  2DJ1 A;  1PQN A;  2DMM A;  2K18 A;  5HR2 A;  2C8U A;  3M9K A;  5G1L A;  2IPA A;  2C3Q A;  4XCS A;  3GX0 A;  4O5Q A;  3RDW A;  2HSY A;  2NVL A;  1CQH A;  3FYG A;  1QQ2 A;  2N5F A;  3C7M A;  1GSE A;  4IP6 A;  3APQ A;  2HRK B;  1JLV A;  4DSR A;  4F2I A;  1BAY A;  1Q4J A;  1EGR A;  4TOP A;  2MYG A;  3VUR A;  4N30 A;  2AB6 A;  2YWM A;  3ZFB A;  1MDK A;  1EZK A;  3TKS A;  4G0L A;  1YF1 A;  2LEG A;  3BOA A;  3BD2 A;  1F3B A;  3RHC A;  4BWQ A;  1GLP A;  4N3Z A;  5D9W A;  1V98 A;  2CX4 A;  2VCV A;  2DIZ A;  3K8N A;  1MD4 A;  4V2M A;  2IMI A;  1O73 A;  2EIQ A;  1PRX A;  3WYW A;  3MIX A;  4Z2T A;  4IHU A;  1SL0 B;  2MBS A;  1CQG A;  5CRW A;  1XOB A;  4HJM A;  1F6M C;  1Z6N A;  1MEK A;  3HKR A;  4IS0 A;  14GS A;  1O7U A;  4HJ2 A;  5FHI A;  1OC3 A;  2IMK A;  3HMJ G;  3F63 A;  1DBY A;  1GUM A;  1G7O A;  3O3T A;  1YEX A;  4USS A;  1XWA A;  2CT6 A;  3C8E A;  1GSD A;  5ENU A;  2AHE A;  5IIZ A;  5JWO B;  1SVM A;  4X43 A;  4FQU A;  1H75 A;  4F0C A;  5DDL A;  2HLS A;  5ECM B;  4QQ7 A;  5C04 A;  2C3N A;  5COH A;  2K9F A;  2OJL A;  1T8E B;  1VF3 A;  2B7K A;  2P0G A;  2VM1 A;  5E59 A;  1AQW A;  1NHY A;  5FT3 A;  2GST A;  5D73 A;  2LUS A;  4MMM A;  4KSM A;  3W8J A;  2FD3 A;  17GS A;  3GTU B;  2VLV A;  4XRD A;  5IMF A;  5LNK e;  4NHZ A;  4IP1 A;  1XW6 A;  3F4T A;  4JR6 A;  3IC4 A;  1TRS A;  4TXV A;  3TUE A;  3I6A A;  5J9B A;  3ZLP A;  2FGX A;  4KF9 A;  2I4A A;  2PER A;  3EE2 A;  1OAZ A;  2O8V B;  1A2L A;  1EGO A;  3KTL A;  5A34 B;  3EWL A;  5ELA A;  2BMX A;  1XVW A;  4TR3 A;  4X4J A;  1K3L A;  3UAR A;  3L0H A;  3EMP A;  5IO2 A;  1VRS D;  2BJX A;  4BWS A;  4BVX B;  4YKG A;  1SJI A;  3EIN A;  1B9X C;  4I6X A;  1K0B A;  4MNN A;  2YWI A;  4RI6 A;  2PWJ A;  3MYD A;  2I81 A;  2ZCT A;  5CNW A;  1U88 A;  4K7I A;  3UVH A;  2OT3 A;  4GWR A;  2HZF A;  3KP8 A;  5KOX A;  3MNG A;  4L0U A;  4O7H A;  2L4C A;  2R4V A;  4EL1 A;  3ZRD A;  3TU3 B;  5A5H B;  4ML1 A;  2WZ9 A;  3FR9 A;  1IYI A;  4CY8 A;  2ZNM A;  1JZR A;  5ECQ B;  6GSU A;  5DAK A;  1PKW A;  2GT5 A;  10GS A;  1HNA A;  3L9U A;  3ZML A;  2WFC A;  2DSA A;  2V1M A;  2LS5 A;  4MLY A;  4IVF A;  4MJC A;  1Z7R A;  5KN1 A;  2O7K A;  5ECL B;  2VO4 A;  4G0K A;  4DEJ A;  6GSV A;  4KE3 A;  1LBK A;  1BG1 A;  4PNF A;  3VWV A;  4TW5 A;  2OA7 A;  1LJR A;  4KW6 A;  3ISO A;  1YVL A;  2ON5 A;  4ZL9 A;  4LMW A;  1ILO A;  3EPT A;  1R26 A;  3F4R A;  1YQ1 A;  5ID2 B;  2H75 A;  4GTU A;  4XIH A;  1R4W A;  2HRN A;  1K3Y A;  2KUC A;  2WGR A;  5IOW A;  2YZU A;  2XC2 A;  1PX6 A;  3O6T A;  1Z9H A;  5EL8 A;  5J4Y A;  3KCM A;  4E8H A;  3TRX A;  3H8Q A;  2DJ0 A;  1GSU A;  22GS A;  5IPH A;  1PD2 1;  3F6F A;  1TRU A;  3D21 A;  4ZBD A;  2DKH A;  2L5O A;  3W6G A;  1DSB A;  4MH2 A;  1M2A A;  3GUR A;  4PX1 A;  3VLN A;  2YJ7 A;  1OVN A;  4KDY A;  4ZIL A;  2O87 A;  1AAZ A;  2GQL A;  4K5S A;  3CSJ A;  1R7H A;  3LG6 A;  1T4Z A;  2PPT A;  1ERW A;  4IN0 A;  2WRT A;  1XVQ A;  3GH9 A;  2X99 A;  1XBS A;  3ME8 A;  4I97 A;  1ERU A;  2A4H A;  2MMA A;  4G2E A;  2P5Q A;  4MJB A;  5AIV A;  3GN3 A;  5DAL B;  5CRH A;  4K7O A;  2VM2 A;  5EPF A;  4AKI A;  5DCH A;  3CRT A;  2WJU A;  2EC4 A;  2H01 A;  1EOH A;  4K9Z A;  1EEM A;  5B8B A;  2IMD A;  1Q98 A;  1B48 A;  4G19 A;  2IN3 A;  3KTB A;  3GYK A;  1O8X A;  1YJ6 A;  4JZQ A;  3F6D A;  1OYJ A;  3A2X A;  2UZ8 A;  2LKU A;  2NPB A;  4O5U A;  5J5N A;  3ZIT A;  1DE1 A;  3Q6O A;  4TR4 A;  2A2P A;  3QPM A;  4ACS A;  3D0Z A;  1MDI A;  1U87 A;  1WRY A;  1AW9 A;  2F9S A;  9GSS A;  4QL7 A;  2H1D A;  1XW5 A;  16GS A;  3GA4 A;  1AQX A;  1TW9 A;  3UEM A;  1M7T A;  2D2Z A;  5F07 A;  1RW1 A;  2YCD A;  2KP1 A;  2WCI A;  3GSS A;  2C3T A;  1GL8 A;  3QFA C;  2G2Q A;  3TOT A;  4MZW A;  1U3I A;  1TK0 B;  4MAB A;  4V2L A;  2FWE A;  1HQO A;  4MJE A;  1QMV A;  2M72 A;  5H5R A;  2PBJ A;  2GS3 A;  4RQX A;  1FB0 A;  2YNX A;  2Z9S A;  4K6X A;  3FMW A;  5EVO A;  2E2M A;  2TRC P;  2VLU A;  2A4V A;  4ECI A;  3V1W A;  2REM A;  4KDX A;  5G31 A;  3HJP A;  2PN8 A;  4AI6 A;  3GL5 A;  2XBI A;  3IAM 2;  5BMU B;  2VL9 A;  1SU9 A;  4AJ7 A;  4G01 A;  1AXD A;  4TXO B;  5H5S A;  1BED A;  3EYT A;  3P2A A;  2EFE A;  5KEJ A;  2HSM B;  1AC1 A;  4L5L A;  7GSS A;  2R3X A;  2H1L A;  2L4Q A;  5ELG A;  1J08 A;  1FB6 A;  3J7Y b;  4K7N A;  2I9H A;  1OKD A;  2H0I A;  2H71 A;  5CRE A;  3E9J B;  1A0R P;  1WE0 A;  3BCK A;  2IWT A;  6GSW A;  3KP9 A;  2YOI A;  2HSH A;  4WBR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...