2VCQA

Complex structure of prostaglandin d2 synthase at 1.95a.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 73
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vcqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vcqA01
4CHSA 3M9JA 3EWLA 1PA3A 3A5WA 1TK5B 3HKRA 5DALB 5IIZA 2IMEA 1SU9A 1B4QA 4XTSA 3CSJA 4MZBA 1TOFA 1TKDB 3D5JA 5ECSA 1Z6NA 1BG5A 1ZOFA 4YQMA 1QMVA 4GSNA 3W8JA 5DALA 3ZLPA 1TU7A 3IXRA 2JL4A 2MMZA 3G9BA 2F9SA 3FR9A 4YAVA 3Q74A 1HYUA 3MWHA 3HVXA 1XW5A 2D2ZA 4G0IA 2B7JA 4HQSA 4KB3A 1FHEA 3ZMLA 4N30A 2YANA 4TKYA 1PX7A 2CAIA 2H70A 3IK7A 3H8QA 2C0EA 2RM5A 3C1SA 1M2AA 4PXOA 2K9FA 2VL3A 2VLVA 2YCDA 1QGVA 4L5LA 3HDCA 4YH2A 4F82A 1G7EA 2YP6A 1GH2A 1V40A 5KN2A 3CRUA 2DJJA 3D4MA 4PURA 4WBRD 1Y6EA 5AIVA 4PTSA 5D93A 4NWYA 2IMKA 1NHOA 3IOSA 3WGEA 2QKEA 1O8XA 3I9V2 4G0LA 3C73A 1MTCA 3RPNA 1B48A 1MD4A 5H5RA 1AXDA 5F05A 4ML1A 2OBKA 2NDOA 1I5GA 5H5SA 2M46A 4ZBDA 4DEJA 1SENA 4D73B 1GNWA 1U3IA 3GFKA 4X43A 3ZVJD 2MBSA 3DKSA 2CQ9A 3HY2A 1THXA 3HD5A 4XS6A 4TR4A 1SK0A 2TIRA 5A4UA 2L5OA 4HZ4A 3MNGA 2H1AA 3TJGA 1SJZA 6GSTA 4RUVA 4MLYA 3VLNA 3GKKA 1AIUA 1J08A 1THOA 2YJHA 1DUGA 3GL3A 2HYXA 5ELGA 3RBTA 2VAFA 2FLSA 4KCEA 2L4QA 4Q5QA 2PBJA 1LBKA 1IYIA 1N8JA 3KD0A 4FH8A 2FNOA 2R4VA 2K6VA 3UJ1A 1SL0B 3FR3A 2PU9C 1K0AA 5BMUA 2A2RA 3UEMA 1WE0A 3KMOA 1B9YC 3ZL5A 2AAWA 1EP8A 2DMMA 4IP6A 1BYEA 1G0TA 3ZFBA 2VUPA 3GKNA 1H75A 3LGCA 4XS1A 5LCZA 1PL1A 4E8HA 2FD3A 4O7HA 4CW9A 3SWLA 2PMTA 2KHPA 4KSOA 3V1WA 3LJRA 3QFBC 3IDVA 2PUKC 5J5NA 4KUNA 5EY6A 2H72A 2B3SA 4I8BA 3KP9A 2C1YA 3DRNA 1SKWB 1GWCA 2HZEB 3FZ9A 2B5EA 4WKWA 4L5OA 4WR5A 4WBJA 2HNLA 4PUAA 2JU5A 2WGRA 2YPMA 5D9TA 4ISDA 1JZDA 1PKWA 3IC4A 2VIMA 3NOFA 4JR6A 3KGKA 4IVFA 5KN0A 1TU8A 5DVBA 1JLVA 2HZEA 2DSAA 2V41A 1TK8B 2WJUA 1PX6A 2IPAA 1V2AA 1JHBA 1VF4A 3FHKA 1TW9A 3TRQA 1QQ2A 4L0WA 1JLWA 1PL2A 2CA8A 4PQHA 5E59A 1OAZA 3WGXA 3VI5A 3KTBA 3TKSC 5KN3A 1LU4A 5CP1A 2B1LA 5C00A 2F8FA 1WWJA 4DSRA 1M99A 1F2EA 5IMAA 4OWYA 1EOGA 3KJYA 2XHFA 1YZXA 2X8CA 1YQ1A 4DSQA 1T00A 2K8SA 3EE2A 4ECCA 3DMLA 2R37A 1DBYA 3E3EA 1E6BA 1V98A 2IMDA 1Z9HA 4TR0A 5DCHA 4ZL9A 2JZRA 1R5AA 2LV3A 4N10A 2RUFA 5DBQA 2RIIA 4AJ6A 1XZOA 3HJPA 3LEFA 2IFQB 2GSQA 2V32A 4WF5A 3G7JA 2N5FA 4V1Ag 3ZYWA 2PWJA 1GSEA 5ECNB 3KH9A 4LA1A 2KP1A 2HSYA 1SK2A 2YOIA 5D8IA 1QK8A 1AQXA 1Z7RA 3GN3A 2LJAA 1UA5A 2NPBA 1GP1A 2FY6A 2N5AA 5ABRA 1KBNA 2GQLA 2C4JA 4HEA2 3C1RA 1GTBA 3GURA 4GXZA 4NMUA 2YN1A 3UARA 1T1VA 5ENUA 1K0OA 1PD21 4ZILA 2AYTA 2C0FA 2OBIA 1QXHA 3DYRA 2IWTA 1A0RP 3DVXA 5C04A 4NAXA 1OE8A 2VL9A 3J7Yk 4MJBA 4MF6A 5J9CA 5E4WA 1VRSD 1WPIA 3PGTA 4OO4A 4OCEA 5CREA 4IN0A 4HU9A 3EC3A 1ABAA 2HI7A 1B9XC 17GSA 4MPFA 2CVBA 3MSZA 3E0UA 3UL3A 1EGOA 1JZOA 2K8VA 4GSTA 2J23A 2L57A 3KM6A 3IK9A 1Y25A 6GSWA 4IQ1A 3E9JB 1HQOA 4KDXA 3IAM2 4FIWA 2H1GA 2YZHA 3UBLA 2QC7A 4FYCA 2IMFA 1DE2A 1OC9B 1ZMAA 3RDWA 1C72A 3FR6A 4OMVA 3APOA 1XFLA 2JZTA 1XW6A 4ZB9A 4F2IA 4NHWA 2VO4A 1OYJA 3FRCA 4WR4A 3TUEA 1A8LA 4K0NA 3WT2A 3TKPA 1X5CA 3UIWA 2H6ZA 3HJMA 1OC3A 1ILOA 2H74A 4TXOA 5IO0A 1G7OA 22GSA 3CTGA 1T8EB 3LFLA 4NXIA 1A8YA 1HD2A 3GX8A 2O85A 3QDNA 3H1NA 2VLUA 3ED3A 5EVOA 4DVCA 2VD1A 2O7KA 2GGTA 3J7Yb 4N0VA 2V6OA 4OO5A 4PNFA 3DGQA 3L78A 2HFDA 3ZTLA 4GCIA 5IQYA 3ZZXA 2AJQB 4HQZA 4MP4A 1XBSA 4EC0A 2L5LA 4GQFA 4PQIA 1V9WA 5CNWA 1SD8A 1PSQA 2HSMB 3HCZA 3U6VA 1ZCPA 3F4TA 4IJ3A 4MJEA 11GSA 2DJ0A 3GHAA 3US3A 4H86A 1MDKA 2P5RA 2HSNB 1ZZYA 2F3MA 1EP7A 1QFNA 2HSMA 1NHYA 3IE3A 3KMNA 1X9MB 4FO5A 1PQNA 1IYHA 3BBYA 1S3CA 5FT3A 3F3RA 4F0BA 5FWGA 1XOBA 2VM1A 5IMZA 3Q19A 5ECOB 1XWAA 1FVKA 3LWAA 1ST9A 4LMWA 1X0RA 2LJRA 2PVOC 1OE7A 2R2JA 2HRNA 2HT9A 4OFTA 3O6TA 4HJ2A 5DCGA 2FGXA 3BCIA 1ML6A 5AISA 3OR5A 4MF5A 2VCWA 4K1FA 1XW9A 3IV4A 3WGDA 1WMJA 1R4WA 5G31A 1VF3A 5DAKB 4EDYA 3M1GA 1MDIA 3A2VA 2JACA 1PGTA 2H76A 1ZGNA 1ERWA 1MEKA 4V1Ap 3ZMKA 2VCTA 2C8UA 4BA7A 3TRXA 3F4SA 4ID0A 1USBA 4JR4A 2HRKB 1GTIA 1GL8A 2LQOA 4I5QA 1FVJA 1NSWA 3GV1A 4JBBA 1SK1A 2HRAA 2YZUA 1YEXA 3HA9A 4EDZA 3R2QA 2CAQA 2P31A 1K3OA 3H93A 2LRNA 1CQGA 4BVYB 3TKQA 2C80A 1BAYA 3DEXA 1T4YA 1JFUA 2OE1A 4XS4B 1XXUA 3IHQA 2LRTA 2DC5A 3ERFA 3L0HA 4ZB8A 2RUEA 2VOCA 5IPGA 3KIJA 2XPDA 5F07A 1O6JA 1PRXA 1FG4A 5INYA 3QR6A 2ALBA 5HFKA 3GTUB 4ECJA 1A2MA 4F0CA 5KN1A 1NM3A 2AHEA 3EURA 4GF0A 4K0GA 2IJYA 3UVTA 3L9SA 3D21A 5B8BA 1GUMA 2WZ9A 2BJXA 2BTOT 3FYGA 2YWNA 5ECHB 4TR1B 3ME8A 1X5DA 3TOTA 1AQWA 1U3AA 2H0HA 2ZUPA 1GNEA 2C3QA 1K0BA 3R3EA 1SJIA 2DLXA 4D73A 3Q6OA 2JADA 4MZWA 4F03A 5GAND 3GH9A 2OE3A 1DSBA 2MBTA 3TKSA 4PNGA 5D9VA 5J3RA 1ON4A 4J57E 4BVXB 3U5RE 2C3TA 1ZL9A 3C7MA 3GKXA 1GLQA 3VK9A 2CZ2A 6GSYA 14GSA 3C8EA 2XPEA 12GSA 2I81A 1TRUA 3LQ7A 1YF1A 4BVXA 2ZNMA 3G7YA 3Q18A 4HJMA 1WP0A 5EL8A 2WB9A 2LQQA 3ZIJA 1UVZA 1XWBA 3BCKA 5JCWA 1GUKA 1K3YA 5L71A 3H4KA 4POLA 4QQ7A 4RQRA 2UZ8A 4MA9A 2DBCA 1XCCA 4QL7A 4TXVA 4EKZA 4IHUA 5F06A 2EC4A 3VWWA 2VD0A 4IKHA 5ECMB 4E8EA 3BJ5A 2I1UA 4WEYA 4ECBA 3APQA 5IPHA 2P0GA 3I69A 1Z7PA 4LLRA 5G1LA 3FW2A 6GSUA 5DJMA 5GZZB 2CX4A 5JWRB 4G2EA 1X5EA 2TRCP 2EIOA 1V57A 2H1BA 2OA7A 3TJJA 2JSZA 2H75A 4RI6A 4DSSB 1TP9A 1U87A 5F8BA 4QL9A 5ECKB 3FKFA 2L6CA 3RHCA 4LMVA 5B6NA 5HR1A 5G1KA 5B8AA 2KP2A 1O85A 4MJAA 4DSSA 1F3AA 9GSSA 3GMFA 3HHVA 1W4VA 4K2DA 4TN8A 2GSRA 2VCZA 4GQCA 1X9SB 1FAAA 3EINA 3ME7A 2IN3A 2V6KA 4V2NA 1EWXA 5JCUA 4ZL7A 2HQTA 4WXTA 5F0GA 1KTEA 4X1UA 1TJDA 4AGSA 4GTUA 3HVSA 1M9AA 3LG6A 2REMA 4ACSA 1FB0A 2DJ1A 3GH6A 1BQ7A 18GSA 1CQHA 3P7XA 1MDJA 2K18A 2E2MA 4ZBBA 5KEJA 1O7UA 2FWFA 2X8HA 3PINA 2IFQA 4K7NA 4IGJA 4NHZA 1F3BA 3H79A 1M2BA 2LTKA 4JRRA 3DVWA 5HFGA 3FZAA 4EE0A 4RQXA 2GSSA 1GRXA 1TRWA 5GSTA 3TRPA 2OE0A 2TRXA 4HUAA 3S9FA 2H1DA 5ID2B 1I9DA 1SD9A 4TOPA 2PERA 4OD7A 1VF2A 5LNKe 4HDEA 3UMAA 5ECRB 1FB6A 3FK8A 1GSYA 4WF4A 3EU3A 5G30A 4K8MA 5JWOB 5ID2A 6GSVA 3VPQA 2JSYA 3RAZA 3TJBA 2YWIA 4BL7B 1YF0A 1WOUA 2GT5A 5ECIB 1AC1A 1AUCA 3CSHA 1GTUA 2IMIA 4PGTA 3GSTA 3GIXA 2EIQA 20GSA 4L8EA 1PKZA 4KX4A 10GSA 3AY8A 1PMTA 1TXXA 2O89A 1M7TA 3CXGA 4IBPA 2MMAA 2CT6A 3O3TA 4ZXGA 2L59A 1ERUA 1EOHA 2GT6A 3NIVA 5B6MA 1XVWA 2KUCA 2LUSA 1U6TA 3M3MA 1ACVA 1OC9A 4LL1B 1XWGA 6GSXA 5ECPB 4AJ8A 4MPGA 4BWQA 1LJRA 3IRAA 1TI3A 3VWVA 1XIYA 1HNAA 1OKTA 3ZRDA 3QOUA 3EVIA 1F37A 2WCIA 2HSHA 3P90A 4MJCA 4V2MA 3I43A 4L0UA 2VCQA 4GWRA 1VGLA 2EIRA 4KSMA 2FUG2 5COHA 5DQSA 5CYYA 4ULXA 2H6YA 3PR8A 4X0XA 2DIZA 2Z9SA 2MMNA 2GS3A 3FY7A 4POMA 5IMDA 1F6MC 2WRTA 4KA0A 5HR2A 2H71A 2M72A 3EMXA 2VCXA 2DJ3A 1HNBA 2H66A 3WD6A 3GX0A 1T3BA 3KTLA 2O8VB 2PN8A 4V2LA 2H8LA 2GZZA 1UN2A 3IBHA 2WFCA 2MZCA 2YNXA 5IOWA 4NV5A 4Z7XA 3TGZA 1YEPA 4HOJA 2YWMA 3WT1A 4LL4B 1O81A 2AV4A 3TB2A 2LSTA 5G5FA 4MCUA 5FHIA 4YQVA 2A4VA 3TJFA 2J9HA 1GSFA 1A24A 3DXBA 2VL2C 1KNGA 3HVVA 4K9ZA 4XRAA 1T4ZA 3W6GA 2I3YA 3HYPA 5A4VA 2A2SA 1PN9A 1WRYA 4IELA 1ZYQB 2VLTA 2DMLA 1U88A 2HLSA 3VI7A 2GZYA 1K3LA 1A23A 2F8AA 7GSSA 3GUSA 1TRVA 2LKUA 4KW6A 2R6KA 4MK3A 4KDUA 4GRFA 2FWEA 2H73A 2LRCA 1EEMA 1B8XA 5CRDA 4P3YB 4XCSA 4HU7A 4Q5NA 4USSA 3UVHA 1JZRA 4O5RA 4ZB6A 4I97A 1K0MA 5IOXA 1YJ6A 5CRWA 1YY7A 1YKAA 2GZPA 3QAVA 4ILFA 2H6XA 1X9WB 3A2XA 2BMXA 2XBIA 2HZFA 2C0GA 1EEJA 5DAKA 1A2JA 2X64A 3L9VA 4IP1A 4G10A 3QAGA 3KP8A 5CRGA 3IA1A 5CAXA 1Q98A 3DWVA 1M2DA 2M80A 5ELAA 1J9BA 3A2WA 2HRKA 5J4UA 3CSIA 5HQPA 3QCPA 3CRTA 4TRXA 1ERVA 4IS0A 4Q5FA 1URMA 3QFAC 1TK0B 1Q4JA 1WJKA 3GA4A 2GQMA 2F51A 4FYUA 3TKSE 1H4OA 4WETA 4KAEA 4GLTA 1O8WA 3IC8A 4K7OA 5JCGA 5ECLB 4BVYA 1A0FA 3FZ5A 2FA8A 1R26A 4K7IA 4CDOA 2GSTA 3VFIA 3FEUA 5D9WA 4KDYA 2AUVA 1Z3EA 1TDIA 3D22A 4XS4A 4MABA 4KNDA 2QSIA 1XWKA 4K6XA 5ECQB 1QUWA 1BX9A 3I6AA 1HNCA 1K0NA 3D4TA 4EO3A 5GAPD 5B7CA 3M0FA 2E7PA 1TI1A 1VF1A 3VWUA 3GTUA 4EVMA 4XRDA 2HRFA 3F6FA 5GSSA 2LNSA 3UOMA 2ES7A 3KCMA 4I2UA 4PQ1A 2NTOA 3LYKA 2P5QA 5G5EA 4GSSA 1FO5A 4TR1A 5HR3A 4BWSA 2B5XA 2YV7A 2MYGA 1BEDA 4MH3A 3LSZA 4EL1A 3KXOA 1EV4A 2R3XA 5A5KA 4OFMA 4BPYA 2GDRA 1S3DA 3TCOA 1AQVA 3W8SA 2H01A 3F9UA 4HZ2A 3TOUA 5IMFA 3ZREA 4KH7A 2L6DA 2GVPA 3KH7A 3SBCA 2VCVA 4OCFA 4NV2A 4G0KA 3UBKA 2R5GA 1SKRB 2RLIA 2GLRA 2GTUA 4NPBA 5DJLA 3QD9A 2I9HA 4JU5A 3MAKA 5HFIA 1S3AA 1OVNA 2XC2A 3F0IA 3A3TA 4TW5A 2G2QA 2KOKA 2B6MA 1GSSA 2VM2A 3VPTA 4YAPA 3F63A 5IMCA 1XVQA 4G19A 3DIEA 3D0ZA 3LXZA 2CVDA 2LNTA 1GSQA 1O73A 4MDCA 5HR0A 1XPVA 1K0DA 2H0IA 3CTFA 3ERWA 4ZL8A 2FCHA 4N11A 2WDUA 3ERGA 5H5QA 4J2FA 1V58A 1Z5YE 4KE3A 2FHEA 4IQAA 1W89A 5DDLA 4JEDA 4J56E 4POKA 3ZIVA 1GSUA 4G9HA 2FA4A 1EZKA 2O87A 4TR3A 3L4NA 2I4AA 5D9XA 3L9UA 5AIXA 1RK4A 4RI7A 4EF0A 2PPTA 2OACA 2B1KA 2CVKA 4MF7A 3IAS2 4JE1A 1SYXA 1SYRA 5A4WA 2L4CA 5IM9A 1SL1B 19GSA 3HZ4A 4KCAA 3CMIA 1N2AA 2AB6A 1SKSB 1J0FA 2B7KA 3RHBA 1AW9A 2V1MA 13GSA 2E2GA 3EMPA 3QMXA 3M8NA 3HXSA 3RPPA 3GRXA 2CX3A 2LS5A 4AF2A 5AGYA 2OJLA 3BD2A 2ON5A 1MD3A 4ZBAA 5IMVA 3GYKA 4ZIJA 3JCML 1XOAA 3VURA 3CYNA 3LYPA 1ZYEA 2V2GA 2H0GA 3APSA 3MDKA 2N5BA 1FW1A 2C3NA 2HE3A 3N5OA 3PH9A 1EGRA 2ON7A 3WYWA 1K0CA 4EUYA 3ZVJA 1GUHA 2C0DA 3N9JA 3F3QA 3GKMA 2CV4A 1GTAA 4N0ZA 3GNJA 4IW9A 1JZWA 3PPUA 4ML6A 4I2TA 1UC7A 4YQUA 3IPZA 1E2YA 2OADA 3ZITA 1KEBA 16GSA 1TRSA 2H19A 4PX1A 3GSSA 2GQKA 2LEGA 3QAWA 6GSSA 5CRHA 4EXJA 3TJKA 8GSSA 4IJIA 4I6XA 2X99A 4KGIA 4HS1A 3D6IA 2QGVA 5AN1A 3LORA 3EYTA 4FYBA 3UAPA 3HZ8A 3F4RA 1YDKA 5LD0A 2X8GA 3GL5A 1GLPA 4HI7A 2WS2A 1M9BA 3P8WA 4BL7A 4TVEA 2NBSA 1WIKA 5J9BA 2PVQA 3ZFLA 2VL2A 1GULA 1RQMA 4F9ZA 5IO2A 3IR4A 2RM6A 1R5PA 2YWOA 3EU4A 4O32A 2DJ2A 2OKAA 2FWHA 2YJ7A 5EPFA 2HXKA 3CBUA 1ERTA 3NZNA 5G2ZA 4Q5RA 3KZQA 3HJOA 3LXTA 2IIYA 1OKDA 3BOAA 1DE1A 3M9KA 4TXOB 3VWXA 2LJKA 3DD3A 1FOVA 2WULA 3F8UA 4MZCA 4JZQA 5JWQB 2YV9A 4POBA 4XIHA 3FZ4A 5DQYA 2MMOA 5CO3A 1AAZA 2DIYA 2ZCTA 1GSDA 3G7IA 1F9MA 4MMMA 3TKRA 1A2LA 1TTZA 1SL2B 2H30A 3C71A 2DJKA 2FWGA 1OC8A 4PUFC 5J41A 2PGTA 1G6YA 3F6DA 1M0UA 1RW1A 3ISOA 4XHMA 2NVLA 4FQUA 2E0QA 2KLXA 4AJ7A 4KF9A 4OFNA 3O76A 2G0FA 1B4PA 1SJ6A 3K8NA 1G6WA 3KEBA 2XBQA 4ECIA 1R7HA 3QPMA 5D96A 1T7PB 2JZSA 3P2AA 4MH2A 1YKCA 1BJXA 1Z6MA 1XWCA 3TDGA 1NW2A 2IL3A 2CZ3A 2B5YA 1EV9A 5D73A 4O92A
chains in the Genus database with same CATH superfamily
4CHSA 3M9JA 3EWLA 1PA3A 3A5WA 1TK5B 3HKRA 5DALB 5IIZA 2IMEA 1SU9A 1B4QA 4XTSA 3CSJA 4MZBA 1TOFA 1TKDB 3D5JA 5ECSA 1Z6NA 1BG5A 1ZOFA 4YQMA 1QMVA 4GSNA 3W8JA 5DALA 3ZLPA 1TU7A 3IXRA 2JL4A 2MMZA 3G9BA 2F9SA 3FR9A 4YAVA 3Q74A 1HYUA 3MWHA 3HVXA 1XW5A 2D2ZA 4G0IA 2B7JA 4HQSA 4KB3A 1FHEA 3ZMLA 4N30A 2EFCA 2YANA 4TKYA 1PX7A 2CAIA 2H70A 1S4BP 3IK7A 3H8QA 2C0EA 2RM5A 3C1SA 4BIKA 1M2AA 4PXOA 2K9FA 2VL3A 2VLVA 2YCDA 1QGVA 4L5LA 3HDCA 4YH2A 4F82A 1G7EA 2YP6A 1GH2A 1V40A 5KN2A 3CRUA 2DJJA 3D4MA 4PURA 4WBRD 1Y6EA 5AIVA 4PTSA 5D93A 4NWYA 2IMKA 1NHOA 3IOSA 3WGEA 2QKEA 1O8XA 3I9V2 4G0LA 3C73A 1MTCA 3RPNA 1B48A 1MD4A 5H5RA 1AXDA 5F05A 4ML1A 2OBKA 2NDOA 1I5GA 5H5SA 2M46A 4ZBDA 4DEJA 1SENA 4ICYA 4D73B 1GNWA 1U3IA 3GFKA 4X43A 3ZVJD 2MBSA 3DKSA 2CQ9A 3HY2A 1THXA 3HD5A 2X4AA 4XS6A 4TR4A 1SK0A 2TIRA 5A4UA 2L5OA 4HZ4A 3MNGA 2H1AA 3TJGA 1SJZA 6GSTA 4RUVA 4MLYA 3VLNA 3GKKA 1AIUA 1J08A 1THOA 2YJHA 1DUGA 3GL3A 2HYXA 5ELGA 3RBTA 5BMUB 2VAFA 5A1NB 2FLSA 4KCEA 2L4QA 4Q5QA 2PBJA 1LBKA 1IYIA 4O5QA 1N8JA 3KD0A 4FH8A 2FNOA 2R4VA 2K6VA 3UJ1A 1SL0B 3FR3A 2PU9C 1K0AA 5BMUA 2A2RA 3UEMA 1WE0A 3KMOA 1B9YC 3ZL5A 2AAWA 1EP8A 2DMMA 4IP6A 1BYEA 1G0TA 3ZFBA 2VUPA 3GKNA 1H75A 3LGCA 4XS1A 5LCZA 1PL1A 4E8HA 2FD3A 4O7HA 4CW9A 3SWLA 2PMTA 2KHPA 4KSOA 3V1WA 3LJRA 3QFBC 3IDVA 2PUKC 5J5NA 4KUNA 5EY6A 2H72A 2B3SA 4I8BA 3KP9A 2C1YA 3DRNA 1SKWB 1GWCA 2HZEB 3FZ9A 2B5EA 4WKWA 4L5OA 4WR5A 4WBJA 2HNLA 4PUAA 2QA1A 2JU5A 2WGRA 2YPMA 5D9TA 4ISDA 1JZDA 1PKWA 3IC4A 2VIMA 3NOFA 4JR6A 3KGKA 4IVFA 5KN0A 1TU8A 5DVBA 1JLVA 2HZEA 2DSAA 2V41A 1TK8B 2WJUA 1PX6A 4AKHA 2IPAA 1V2AA 1JHBA 1VF4A 3FHKA 1TW9A 3TRQA 1QQ2A 4L0WA 1JLWA 1PL2A 2CA8A 4PQHA 5E59A 1OAZA 3WGXA 3VI5A 3KTBA 3TKSC 5KN3A 1LU4A 5CP1A 2B1LA 5C00A 4PI2C 2F8FA 1WWJA 4DSRA 1M99A 4AI6A 1F2EA 5IMAA 4OWYA 1EOGA 3KJYA 2XHFA 1YZXA 2X8CA 1YQ1A 4DSQA 1T00A 2K8SA 3EE2A 4ECCA 2DKIA 3DMLA 2R37A 1DBYA 3HVNA 3E3EA 1E6BA 1V98A 2IMDA 1Z9HA 4TR0A 5DCHA 4G01A 2JZRA 4ZL9A 1R5AA 2LV3A 4N10A 2RUFA 5DBQA 2RIIA 4AJ6A 1XZOA 3HJPA 3LEFA 2IFQB 2GSQA 2V32A 4WF5A 3G7JA 2N5FA 4V1Ag 3ZYWA 2PWJA 1GSEA 4O5UA 5ECNB 3KH9A 4LA1A 2WW0A 2KP1A 2HSYA 1SK2A 2YOIA 5D8IA 1QK8A 1AQXA 4YKGA 1Z7RA 3GN3A 2LJAA 1UA5A 2NPBA 1GP1A 2FY6A 2N5AA 5ABRA 1KBNA 2GQLA 2C4JA 4HEA2 3C1RA 1GTBA 3GURA 4GXZA 2O36A 4NMUA 2YN1A 3UARA 1T1VA 5ENUA 1K0OA 1PD21 4ZILA 2AYTA 2C0FA 2OBIA 1QXHA 3DYRA 2IWTA 1A0RP 3DVXA 5C04A 4NAXA 1OE8A 2VL9A 3J7Yk 4MJBA 4MF6A 5J9CA 5E4WA 1VRSD 1WPIA 3PGTA 4OO4A 4OCEA 5CREA 4IN0A 4HU9A 3EC3A 1ABAA 2HI7A 1B9XC 17GSA 4MPFA 2CVBA 3MSZA 3E0UA 3UL3A 1EGOA 1BF5A 1JZOA 2K8VA 4GSTA 2J23A 2L57A 3KM6A 3IK9A 1Y25A 6GSWA 4IQ1A 3E9JB 3A5IA 1HQOA 4KDXA 1M3JA 3IAM2 4FIWA 2H1GA 2YZHA 3UBLA 2QC7A 4FYCA 2IMFA 1DE2A 1OC9B 1ZMAA 3RDWA 1C72A 3FR6A 4OMVA 3APOA 1XFLA 2JZTA 1XW6A 4ZB9A 4F2IA 4NHWA 2VO4A 1OYJA 3FRCA 4WR4A 3TUEA 1A8LA 4K0NA 3WT2A 3TKPA 3MYDA 1X5CA 3UIWA 2H6ZA 3HJMA 1BG1A 1OC3A 1ILOA 2H74A 4TXOA 5IO0A 1G7OA 22GSA 3CTGA 1T8EB 3LFLA 4NXIA 1A8YA 1HD2A 3GX8A 1S3RA 2O85A 3QDNA 3H1NA 2VLUA 3ED3A 5EVOA 4DVCA 2VD1A 2O7KA 2GGTA 4AKGA 3J7Yb 4N0VA 2V6OA 3TU3B 4OO5A 4PNFA 3DGQA 3L78A 2HFDA 3ZTLA 4GCIA 5IQYA 3ZZXA 2AJQB 4HQZA 4MP4A 1XBSA 4EC0A 2L5LA 4GQFA 4PQIA 1V9WA 5CNWA 1SD8A 1PSQA 2HSMB 3HCZA 4GDFA 3U6VA 1ZCPA 3F4TA 4IJ3A 4MJEA 11GSA 2DJ0A 3GHAA 3US3A 4H86A 1MDKA 2P5RA 2HSNB 1ZZYA 2F3MA 1EP7A 1QFNA 2HSMA 1NHYA 3IE3A 3KMNA 1X9MB 4FO5A 1PQNA 1IYHA 3BBYA 1S3CA 5FT3A 3F3RA 4F0BA 5FWGA 1XOBA 2H1LA 2VM1A 5IMZA 3Q19A 5ECOB 1XWAA 1FVKA 3LWAA 1ST9A 4LMWA 1X0RA 2LJRA 2PVOC 1OE7A 2R2JA 2HRNA 1PFOA 2HT9A 4OFTA 3O6TA 4HJ2A 5DCGA 1PN0A 2FGXA 2VKZG 3BCIA 1ML6A 5AISA 3OR5A 4MF5A 5A34B 2VCWA 4K1FA 1XW9A 3IV4A 3WGDA 1WMJA 1R4WA 5G31A 1VF3A 5DAKB 4EDYA 3M1GA 1MDIA 3A2VA 2JACA 4CY6A 1PGTA 2H76A 1ZGNA 1ERWA 1MEKA 5A34A 4V1Ap 3ZMKA 2VCTA 2C8UA 4BA7A 3TRXA 3F4SA 4ID0A 1USBA 4JR4A 2HRKB 1GTIA 1ZYPA 1GL8A 2LQOA 4I5QA 1FVJA 1NSWA 3GV1A 4JBBA 1SK1A 2HRAA 2YZUA 1YEXA 3HA9A 4EDZA 3R2QA 2CAQA 2P31A 1K3OA 3H93A 2LRNA 4W66A 1CQGA 4BVYB 3TKQA 2C80A 1BAYA 3DEXA 1T4YA 1JFUA 2OE1A 4XS4B 1XXUA 3IHQA 1FOHA 2LRTA 2DC5A 3ERFA 3L0HA 4ZB8A 2RUEA 2VOCA 5IPGA 2WZSA 3KIJA 2XPDA 5F07A 1O6JA 1PRXA 1FG4A 5INYA 2WW3A 3QR6A 2ALBA 5HFKA 3GTUB 4ECJA 1A2MA 4F0CA 5KN1A 1NM3A 2AHEA 3EURA 4GF0A 4AKIA 4K0GA 2IJYA 1M3IA 3UVTA 3L9SA 3D21A 5B8BA 1GUMA 2WZ9A 2BJXA 2BTOT 3FYGA 2YWNA 5ECHB 4TR1B 3ME8A 1X5DA 3TOTA 1AQWA 1U3AA 2H0HA 2QA2A 2ZUPA 1GNEA 2C3QA 1K0BA 3R3EA 1SJIA 2DLXA 4D73A 3Q6OA 2JADA 4MZWA 4F03A 5GAND 3GH9A 2OE3A 1DSBA 2MBTA 3TKSA 4PNGA 5D9VA 5J3RA 1ON4A 4J57E 4BVXB 3U5RE 2C3TA 1ZL9A 3C7MA 3GKXA 1GLQA 3VK9A 2R0PA 5A1NA 2CZ2A 6GSYA 14GSA 3C8EA 2XPEA 12GSA 2I81A 1TRUA 3LQ7A 1YF1A 4BVXA 2ZNMA 3G7YA 3Q18A 4HJMA 1WP0A 5EL8A 5KOWA 2WB9A 2LQQA 3ZIJA 1UVZA 1XWBA 3BCKA 5JCWA 1YVLA 1GUKA 1K3YA 5L71A 3H4KA 4POLA 4QQ7A 4RQRA 2UZ8A 2X49A 4MA9A 2DBCA 1XCCA 4QL7A 4TXVA 4EKZA 4IHUA 5F06A 2EC4A 3VWWA 2VD0A 4IKHA 5ECMB 4E8EA 3BJ5A 2I1UA 4WEYA 4ECBA 3APQA 5IPHA 2P0GA 3I69A 1Z7PA 4LLRA 5G1LA 3FW2A 6GSUA 5DJMA 5GZZB 2CX4A 5JWRB 4G2EA 1X5EA 2TRCP 2EIOA 1V57A 2H1BA 2OA7A 3TJJA 2JSZA 2H75A 4RI6A 4DSSB 1TP9A 2O3EA 1U87A 5F8BA 4QL9A 5ECKB 3FKFA 4K5SA 2L6CA 3RHCA 4LMVA 5B6NA 5HR1A 5G1KA 5B8AA 2KP2A 1O85A 4MJAA 4DSSA 1F3AA 9GSSA 3GMFA 3HHVA 1W4VA 4K2DA 4TN8A 2GSRA 2VCZA 3LW9A 4GQCA 1X9SB 1FAAA 3EINA 3ME7A 2IN3A 2V6KA 4V2NA 1EWXA 5JCUA 4ZL7A 2HQTA 4WXTA 5F0GA 1KTEA 4X1UA 2EFDA 1TJDA 4Z2RA 4AGSA 4GTUA 3HVSA 1M9AA 3LG6A 2REMA 4ACSA 1FB0A 2DJ1A 3GH6A 1BQ7A 18GSA 4A5PA 1CQHA 3P7XA 1MDJA 2K18A 2E2MA 4AKXB 3EPTA 4ZBBA 5KEJA 1O7UA 2FWFA 2EFEA 2X8HA 3PINA 2IFQA 4K7NA 4IGJA 4NHZA 1F3BA 4E68A 1M2BA 3H79A 2LTKA 4JRRA 3DVWA 5HFGA 3FZAA 4EE0A 4RQXA 2GSSA 1GRXA 1TRWA 5GSTA 3TRPA 2OE0A 2TRXA 4HUAA 3S9FA 2H1DA 5ID2B 1I9DA 1SD9A 4TOPA 2PERA 4OD7A 4X4JA 1VF2A 5LNKe 4HDEA 3UMAA 5ECRB 1FB6A 3FK8A 1GSYA 4WF4A 3EU3A 5G30A 4K8MA 5JWOB 5ID2A 6GSVA 3VPQA 2OT3A 2JSYA 3RAZA 5J4YA 3TJBA 2YWIA 4BL7B 1YF0A 1WOUA 4ZB7A 2GT5A 5ECIB 1AC1A 1AUCA 3CSHA 1GTUA 2IMIA 4PGTA 3GSTA 3GIXA 2EIQA 20GSA 4L8EA 1PKZA 4KX4A 10GSA 3AY8A 1PMTA 1TXXA 2O89A 1M7TA 2O5VA 3CXGA 4IBPA 2MMAA 2CT6A 3O3TA 4ZXGA 2L59A 1ERUA 1EOHA 3IHGA 2GT6A 3NIVA 5B6MA 4Z2TA 1XVWA 2KUCA 2LUSA 1U6TA 3M3MA 1ACVA 4K5RA 3CWGA 1OC9A 4LL1B 1XWGA 6GSXA 5ECPB 4AJ8A 4MPGA 4HSCX 4BWQA 1LJRA 3IRAA 2R0GA 1TI3A 3VWVA 1XIYA 1HNAA 1OKTA 3ZRDA 3QOUA 4QMKA 3EVIA 1F37A 2WCIA 2HSHA 3P90A 4MJCA 4V2MA 3I43A 4L0UA 2VCQA 4GWRA 4EIPA 1VGLA 2EIRA 4KSMA 2FUG2 5COHA 5DQSA 5CYYA 4ULXA 2H6YA 3PR8A 4X0XA 2DIZA 2Z9SA 2MMNA 2GS3A 3FY7A 4POMA 5IMDA 1F6MC 2WRTA 4KA0A 5HR2A 2H71A 2M72A 3EMXA 2VCXA 2DJ3A 1HNBA 2H66A 3WD6A 3GX0A 1T3BA 3KTLA 2O8VB 2PN8A 4V2LA 2H8LA 2GZZA 1UN2A 3IBHA 2WFCA 2MZCA 2YNXA 5IOWA 4NV5A 4Z7XA 3TGZA 1YEPA 4HOJA 2YWMA 3WT1A 4LL4B 1O81A 2AV4A 3TB2A 2LSTA 5G5FA 4MCUA 5FHIA 4YQVA 2A4VA 3TJFA 2J9HA 1GSFA 1A24A 3DXBA 2VL2C 1KNGA 3HVVA 4K9ZA 4XRAA 1T4ZA 3W6GA 2I3YA 3HYPA 5A4VA 2A2SA 1PN9A 1WRYA 4IELA 1ZYQB 2VLTA 2DMLA 1U88A 2HLSA 4YKFA 3VI7A 4FXYP 2HSNA 1K3LA 2GZYA 1A23A 2F8AA 7GSSA 3GUSA 1TRVA 2LKUA 3HMJG 4KW6A 2R6KA 4MK3A 4KDUA 4GRFA 4PI0C 2FWEA 2H73A 2LRCA 1EEMA 1B8XA 4CY8A 5CRDA 4P3YB 4XCSA 4HU7A 4Q5NA 4USSA 3UVHA 1JZRA 4O5RA 4ZB6A 4I97A 1K0MA 5IOXA 1YJ6A 5CRWA 1YY7A 1YKAA 2GZPA 3QAVA 4ILFA 2H6XA 1X9WB 3A2XA 2BMXA 2XBIA 2HZFA 2C0GA 1EEJA 5DAKA 1A2JA 2X64A 3L9VA 4IP1A 5BRTA 4G10A 3QAGA 3KP8A 5CRGA 3IA1A 5CAXA 1SVLA 1Q98A 3DWVA 1M2DA 2M80A 5ELAA 1J9BA 3A2WA 2HRKA 5J4UA 3CSIA 5HQPA 3QCPA 3CRTA 4TRXA 1ERVA 4IS0A 4Q5FA 1URMA 3QFAC 2R0CA 1TK0B 1Q4JA 1WJKA 3GA4A 2GQMA 2F51A 4FYUA 3TKSE 1H4OA 4WETA 4KAEA 4GLTA 1O8WA 3IC8A 4K7OA 5JCGA 5ECLB 4BVYA 1A0FA 3FZ5A 2FA8A 1R26A 4K7IA 4CDOA 2GSTA 3VFIA 3FEUA 5D9WA 4KDYA 2AUVA 1Z3EA 1TDIA 3D22A 4XS4A 4MABA 4KNDA 2QSIA 1XWKA 4K6XA 5ECQB 1QUWA 3RFRC 1BX9A 3I6AA 1HNCA 1K0NA 3D4TA 4EO3A 5GAPD 5B7CA 3M0FA 2E7PA 1TI1A 1VF1A 3VWUA 3GTUA 4EVMA 4XRDA 2HRFA 3F6FA 5GSSA 2DKHA 4Z2UA 2LNSA 3UOMA 2UV8G 2ES7A 3KCMA 5J47A 4I2UA 4PQ1A 2NTOA 3LYKA 2P5QA 5G5EA 4GSSA 1FO5A 4TR1A 5HR3A 4BWSA 2B5XA 2YV7A 2MYGA 1BEDA 4MH3A 3LSZA 4EL1A 3KXOA 1N25A 1EV4A 2R3XA 5A5KA 4N3ZA 4OFMA 4BPYA 2GDRA 1S3DA 3TCOA 1AQVA 3W8SA 2H01A 3F9UA 4HZ2A 3TOUA 5IMFA 3ZREA 4KH7A 2L6DA 2GVPA 3KH7A 3SBCA 2VCVA 4OCFA 4NV2A 4G0KA 3UBKA 2R5GA 1SKRB 2RLIA 2GLRA 2GTUA 4NPBA 5DJLA 3QD9A 2I9HA 4JU5A 3MAKA 5HFIA 1S3AA 3MIXA 1OVNA 2XC2A 3FMWA 3F0IA 3A3TA 4TW5A 2G2QA 2KOKA 2B6MA 3RGBC 1GSSA 2VM2A 3VPTA 4YAPA 3F63A 5IMCA 1XVQA 1TXUA 4G19A 3DIEA 3D0ZA 3LXZA 2CVDA 2LNTA 1GSQA 1O73A 4MDCA 4EIQA 5HR0A 1XPVA 1K0DA 2H0IA 3CTFA 3ERWA 4ZL8A 2FCHA 4N11A 2WDUA 3ERGA 3CHXC 5H5QA 1YEWC 4J2FA 1V58A 1Z5YE 4KE3A 2FHEA 4IQAA 1W89A 5DDLA 4JEDA 4J56E 4POKA 3ZIVA 1GSUA 4G9HA 2FA4A 1EZKA 2O87A 4TR3A 3L4NA 2I4AA 5D9XA 3L9UA 5AIXA 1RK4A 4RI7A 4EF0A 2PPTA 2OACA 2B1KA 2CVKA 4MF7A 3IAS2 4JE1A 1SYXA 1SYRA 5A4WA 2L4CA 5IM9A 1SL1B 4MNNA 19GSA 3HZ4A 4PHZC 1Y1UA 4KCAA 3CMIA 1N2AA 2AB6A 1SKSB 1J0FA 2B7KA 3RHBA 1AW9A 2V1MA 13GSA 2E2GA 3EMPA 3QMXA 3M8NA 3HXSA 3RPPA 3GRXA 2CX3A 2LS5A 4AF2A 5AGYA 2OJLA 4K2XA 3BD2A 2ON5A 1MD3A 4ZBAA 2WVXB 5A5HB 2WVZA 5IMVA 3GYKA 4ZIJA 3JCML 1XOAA 3VURA 3CYNA 3LYPA 1ZYEA 2V2GA 2H0GA 3APSA 3MDKA 2N5BA 1FW1A 2C3NA 2HE3A 3N5OA 2WVXA 3PH9A 5A5HA 1EGRA 2ON7A 5KOXA 3WYWA 1K0CA 1I1IP 4EUYA 3ZVJA 1GUHA 2C0DA 3N9JA 3F3QA 3GKMA 2CV4A 1GTAA 4N0ZA 3GNJA 4IW9A 2EFHA 1JZWA 3PPUA 4ML6A 4I2TA 1UC7A 4YQUA 3IPZA 2A4HA 1E2YA 2OADA 3ZITA 1KEBA 16GSA 1TRSA 2H19A 4PX1A 3GSSA 2GQKA 2LEGA 3QAWA 6GSSA 5CRHA 4EXJA 3TJKA 8GSSA 4IJIA 4I6XA 2X99A 4KGIA 4HS1A 3D6IA 2QGVA 5AN1A 3LORA 3EYTA 4FYBA 3UAPA 3HZ8A 3F4RA 2WW2A 1YDKA 5LD0A 2X8GA 3GL5A 1GLPA 4HI7A 2WS2A 1M9BA 3P8WA 4BL7A 4TVEA 2NBSA 1WIKA 5J9BA 2PVQA 3ZFLA 2VL2A 1GULA 1RQMA 5J4VA 4F9ZA 5IO2A 5J40A 3IR4A 2RM6A 1R5PA 2YWOA 2A2PA 3EU4A 4O32A 2DJ2A 1XG8A 3CQFA 2OKAA 2FWHA 2YJ7A 5EPFA 2HXKA 3CBUA 1ERTA 1SVOA 3NZNA 5G2ZA 4Q5RA 3KZQA 3HJOA 3LXTA 2IIYA 1OKDA 3BOAA 1DE1A 1ZYNA 3M9KA 4TXOB 3VWXA 2LJKA 3DD3A 1FOVA 2WULA 3F8UA 4MZCA 4JZQA 2WW1A 5JWQB 2YV9A 4POBA 4XIHA 3FZ4A 5DQYA 2MMOA 5CO3A 1AAZA 2DIYA 2ZCTA 1GSDA 3G7IA 1F9MA 4MMMA 3TKRA 1A2LA 1TTZA 1SL2B 2H30A 3C71A 2DJKA 2FWGA 1OC8A 4PUFC 5J41A 2PGTA 1G6YA 3F6DA 1M0UA 1RW1A 3ISOA 4XHMA 2NVLA 4FQUA 2E0QA 1SVMA 2KLXA 4AJ7A 4KF9A 4OFNA 3O76A 2G0FA 1B4PA 1SJ6A 3K8NA 1G6WA 3KEBA 2XBQA 4ECIA 1R7HA 3QPMA 5D96A 1T7PB 2JZSA 3P2AA 4MH2A 1YKCA 1BJXA 2WVYA 1Z6MA 1XWCA 3TDGA 1NW2A 2IL3A 2CZ3A 2B5YA 1EV9A 5D73A 4O92A
chains in the Genus database with same CATH topology
4CHSA 3M9JA 3EWLA 1PA3A 3A5WA 1TK5B 3HKRA 5DALB 5IIZA 2IMEA 1SU9A 1B4QA 4XTSA 3CSJA 4MZBA 1TOFA 1TKDB 3D5JA 5ECSA 1Z6NA 1BG5A 1ZOFA 4YQMA 1QMVA 4GSNA 3W8JA 5DALA 3ZLPA 1TU7A 3IXRA 2JL4A 2MMZA 3G9BA 2F9SA 3FR9A 4YAVA 3Q74A 1HYUA 3MWHA 3HVXA 1XW5A 2D2ZA 4G0IA 2B7JA 4HQSA 4KB3A 1FHEA 3ZMLA 4N30A 2EFCA 2YANA 4TKYA 1PX7A 2CAIA 2H70A 3IK7A 3H8QA 2C0EA 2RM5A 3C1SA 1M2AA 4PXOA 2K9FA 2VL3A 2VLVA 2YCDA 1QGVA 4L5LA 3HDCA 4YH2A 4F82A 1G7EA 2YP6A 1GH2A 1V40A 5KN2A 3CRUA 2DJJA 3D4MA 4PURA 4WBRD 1Y6EA 5AIVA 4PTSA 5D93A 4NWYA 2IMKA 1NHOA 3IOSA 3WGEA 2QKEA 1O8XA 3I9V2 4G0LA 3C73A 1MTCA 3RPNA 1B48A 1MD4A 5H5RA 1AXDA 5F05A 4ML1A 2OBKA 2NDOA 1I5GA 5H5SA 2M46A 4ZBDA 4DEJA 1SENA 4ICYA 4D73B 1GNWA 1U3IA 3GFKA 4X43A 3ZVJD 2MBSA 3DKSA 2CQ9A 3HY2A 1THXA 3HD5A 2X4AA 4XS6A 4TR4A 1SK0A 2TIRA 5A4UA 2L5OA 4HZ4A 3MNGA 2H1AA 3TJGA 1SJZA 6GSTA 4RUVA 4MLYA 3VLNA 3GKKA 1AIUA 1J08A 1THOA 2YJHA 1DUGA 3GL3A 2HYXA 5ELGA 3RBTA 5BMUB 2VAFA 5A1NB 2FLSA 4KCEA 2L4QA 4Q5QA 2PBJA 1LBKA 1IYIA 4O5QA 1N8JA 3KD0A 4FH8A 2FNOA 2R4VA 2K6VA 3UJ1A 1SL0B 3FR3A 2PU9C 1K0AA 5BMUA 2A2RA 3UEMA 1WE0A 3KMOA 1B9YC 3ZL5A 2AAWA 1EP8A 2DMMA 4IP6A 1BYEA 1G0TA 3ZFBA 2VUPA 3GKNA 1H75A 3LGCA 4XS1A 5LCZA 1PL1A 4E8HA 2FD3A 4O7HA 4CW9A 3SWLA 2PMTA 2KHPA 4KSOA 3V1WA 3LJRA 3QFBC 3IDVA 2PUKC 5J5NA 4KUNA 5EY6A 2H72A 2B3SA 4I8BA 3KP9A 2C1YA 3DRNA 1SKWB 1GWCA 2HZEB 3FZ9A 2B5EA 4WKWA 4L5OA 4WR5A 4WBJA 2HNLA 4PUAA 2QA1A 2JU5A 2WGRA 2YPMA 5D9TA 4ISDA 1JZDA 1PKWA 3IC4A 2VIMA 3NOFA 4JR6A 3KGKA 4IVFA 5KN0A 1TU8A 5DVBA 1JLVA 2HZEA 2DSAA 2V41A 1TK8B 2WJUA 1PX6A 4AKHA 2IPAA 1V2AA 1JHBA 1VF4A 3FHKA 1TW9A 3TRQA 1QQ2A 4L0WA 1JLWA 1PL2A 2CA8A 4PQHA 5E59A 1OAZA 3WGXA 3VI5A 3KTBA 3TKSC 5KN3A 1LU4A 5CP1A 2B1LA 5C00A 2F8FA 1WWJA 4DSRA 1M99A 4AI6A 1F2EA 5IMAA 4OWYA 1EOGA 3KJYA 2XHFA 1YZXA 2X8CA 1YQ1A 4DSQA 1T00A 2K8SA 3EE2A 4ECCA 2DKIA 3DMLA 2R37A 1DBYA 3E3EA 1E6BA 1V98A 2IMDA 1Z9HA 4TR0A 5DCHA 4G01A 2JZRA 4ZL9A 1R5AA 2LV3A 4N10A 2RUFA 5DBQA 2RIIA 4AJ6A 1XZOA 3HJPA 3LEFA 2IFQB 2GSQA 2V32A 4WF5A 3G7JA 2N5FA 4V1Ag 3ZYWA 2PWJA 1GSEA 4O5UA 5ECNB 3KH9A 4LA1A 2KP1A 2HSYA 1SK2A 2YOIA 5D8IA 1QK8A 1AQXA 4YKGA 1Z7RA 3GN3A 2LJAA 1UA5A 2NPBA 1GP1A 2FY6A 2N5AA 5ABRA 1KBNA 2GQLA 2C4JA 4HEA2 3C1RA 1GTBA 3GURA 4GXZA 4NMUA 2YN1A 3UARA 1T1VA 5ENUA 1K0OA 1PD21 4ZILA 2AYTA 2C0FA 2OBIA 1QXHA 3DYRA 2IWTA 1A0RP 3DVXA 5C04A 4NAXA 1OE8A 2VL9A 3J7Yk 4MJBA 4MF6A 5J9CA 5E4WA 1VRSD 1WPIA 3PGTA 4OO4A 4OCEA 5CREA 4IN0A 4HU9A 3EC3A 1ABAA 2HI7A 1B9XC 17GSA 4MPFA 2CVBA 3MSZA 3E0UA 3UL3A 1EGOA 1BF5A 1JZOA 2K8VA 4GSTA 2J23A 2L57A 3KM6A 3IK9A 1Y25A 6GSWA 4IQ1A 3E9JB 3A5IA 1HQOA 4KDXA 3IAM2 4FIWA 2H1GA 2YZHA 3UBLA 2QC7A 4FYCA 2IMFA 1DE2A 1OC9B 1ZMAA 3RDWA 1C72A 3FR6A 4OMVA 3APOA 1XFLA 2JZTA 1XW6A 4ZB9A 4F2IA 4NHWA 2VO4A 1OYJA 3FRCA 4WR4A 3TUEA 1A8LA 4K0NA 3WT2A 3TKPA 3MYDA 1X5CA 3UIWA 2H6ZA 3HJMA 1BG1A 1OC3A 1ILOA 2H74A 4TXOA 5IO0A 1G7OA 22GSA 3CTGA 1T8EB 3LFLA 4NXIA 1A8YA 1HD2A 3GX8A 2O85A 3QDNA 3H1NA 2VLUA 3ED3A 5EVOA 4DVCA 2VD1A 2O7KA 2GGTA 4AKGA 3J7Yb 4N0VA 2V6OA 3TU3B 4OO5A 4PNFA 3DGQA 3L78A 2HFDA 3ZTLA 4GCIA 5IQYA 3ZZXA 2AJQB 4HQZA 4MP4A 1XBSA 4EC0A 2L5LA 4GQFA 4PQIA 1V9WA 5CNWA 1SD8A 1PSQA 2HSMB 3HCZA 4GDFA 3U6VA 1ZCPA 3F4TA 4IJ3A 4MJEA 11GSA 2DJ0A 3GHAA 3US3A 4H86A 1MDKA 2P5RA 2HSNB 1ZZYA 2F3MA 1EP7A 1QFNA 2HSMA 1NHYA 3IE3A 3KMNA 1X9MB 4FO5A 1PQNA 1IYHA 3BBYA 1S3CA 5FT3A 3F3RA 4F0BA 5FWGA 1XOBA 2H1LA 2VM1A 5IMZA 3Q19A 5ECOB 1XWAA 1FVKA 3LWAA 1ST9A 4LMWA 1X0RA 2LJRA 2PVOC 1OE7A 2R2JA 2HRNA 2HT9A 4OFTA 3O6TA 4HJ2A 5DCGA 1PN0A 2FGXA 2VKZG 3BCIA 1ML6A 5AISA 3OR5A 4MF5A 5A34B 2VCWA 4K1FA 1XW9A 3IV4A 3WGDA 1WMJA 1R4WA 5G31A 1VF3A 5DAKB 4EDYA 3M1GA 1MDIA 3A2VA 2JACA 4CY6A 1PGTA 2H76A 1ZGNA 1ERWA 1MEKA 5A34A 4V1Ap 3ZMKA 2VCTA 2C8UA 4BA7A 3TRXA 3F4SA 4ID0A 1USBA 4JR4A 2HRKB 1GTIA 1ZYPA 1GL8A 2LQOA 4I5QA 1FVJA 1NSWA 3GV1A 4JBBA 1SK1A 2HRAA 2YZUA 1YEXA 3HA9A 4EDZA 3R2QA 2CAQA 2P31A 1K3OA 3H93A 2LRNA 4W66A 1CQGA 4BVYB 3TKQA 2C80A 1BAYA 3DEXA 1T4YA 1JFUA 2OE1A 4XS4B 1XXUA 3IHQA 1FOHA 2LRTA 2DC5A 3ERFA 3L0HA 4ZB8A 2RUEA 2VOCA 5IPGA 3KIJA 2XPDA 5F07A 1O6JA 1PRXA 1FG4A 5INYA 3QR6A 2ALBA 5HFKA 3GTUB 4ECJA 1A2MA 4F0CA 5KN1A 1NM3A 2AHEA 3EURA 4GF0A 4AKIA 4K0GA 2IJYA 3UVTA 3L9SA 3D21A 5B8BA 1GUMA 2WZ9A 2BJXA 2BTOT 3FYGA 2YWNA 5ECHB 4TR1B 3ME8A 1X5DA 3TOTA 1AQWA 1U3AA 2H0HA 2QA2A 2ZUPA 1GNEA 2C3QA 1K0BA 3R3EA 1SJIA 2DLXA 4D73A 3Q6OA 2JADA 4MZWA 4F03A 5GAND 3GH9A 2OE3A 1DSBA 2MBTA 3TKSA 4PNGA 5D9VA 5J3RA 1ON4A 4J57E 4BVXB 3U5RE 2C3TA 1ZL9A 3C7MA 3GKXA 1GLQA 3VK9A 2R0PA 5A1NA 2CZ2A 6GSYA 14GSA 3C8EA 2XPEA 12GSA 2I81A 1TRUA 3LQ7A 1YF1A 4BVXA 2ZNMA 3G7YA 3Q18A 4HJMA 1WP0A 5EL8A 5KOWA 2WB9A 2LQQA 3ZIJA 1UVZA 1XWBA 3BCKA 5JCWA 1YVLA 1GUKA 1K3YA 5L71A 3H4KA 4POLA 4QQ7A 4RQRA 2UZ8A 2X49A 4MA9A 2DBCA 1XCCA 4QL7A 4TXVA 4EKZA 4IHUA 5F06A 2EC4A 3VWWA 2VD0A 4IKHA 5ECMB 4E8EA 3BJ5A 2I1UA 4WEYA 4ECBA 3APQA 5IPHA 2P0GA 3I69A 1Z7PA 4LLRA 5G1LA 3FW2A 6GSUA 5DJMA 5GZZB 2CX4A 5JWRB 4G2EA 1X5EA 2TRCP 2EIOA 1V57A 2H1BA 2OA7A 3TJJA 2JSZA 2H75A 4RI6A 4DSSB 1TP9A 1U87A 5F8BA 4QL9A 5ECKB 3FKFA 4K5SA 2L6CA 3RHCA 4LMVA 5B6NA 5HR1A 5G1KA 5B8AA 2KP2A 1O85A 4MJAA 4DSSA 1F3AA 9GSSA 3GMFA 3HHVA 1W4VA 4K2DA 4TN8A 2GSRA 2VCZA 3LW9A 4GQCA 1X9SB 1FAAA 3EINA 3ME7A 2IN3A 2V6KA 4V2NA 1EWXA 5JCUA 4ZL7A 2HQTA 4WXTA 5F0GA 1KTEA 4X1UA 2EFDA 1TJDA 4Z2RA 4AGSA 4GTUA 3HVSA 1M9AA 3LG6A 2REMA 4ACSA 1FB0A 2DJ1A 3GH6A 1BQ7A 18GSA 4A5PA 1CQHA 3P7XA 1MDJA 2K18A 2E2MA 4AKXB 3EPTA 4ZBBA 5KEJA 1O7UA 2FWFA 2EFEA 2X8HA 3PINA 2IFQA 4K7NA 4IGJA 4NHZA 1F3BA 4E68A 1M2BA 3H79A 2LTKA 4JRRA 3DVWA 5HFGA 3FZAA 4EE0A 4RQXA 2GSSA 1GRXA 1TRWA 5GSTA 3TRPA 2OE0A 2TRXA 4HUAA 3S9FA 2H1DA 5ID2B 1I9DA 1SD9A 4TOPA 2PERA 4OD7A 4X4JA 1VF2A 5LNKe 4HDEA 3UMAA 5ECRB 1FB6A 3FK8A 1GSYA 4WF4A 3EU3A 5G30A 4K8MA 5JWOB 5ID2A 6GSVA 3VPQA 2OT3A 2JSYA 3RAZA 5J4YA 3TJBA 2YWIA 4BL7B 1YF0A 1WOUA 4ZB7A 2GT5A 5ECIB 1AC1A 1AUCA 3CSHA 1GTUA 2IMIA 4PGTA 3GSTA 3GIXA 2EIQA 20GSA 4L8EA 1PKZA 4KX4A 10GSA 3AY8A 1PMTA 1TXXA 2O89A 1M7TA 2O5VA 3CXGA 4IBPA 2MMAA 2CT6A 3O3TA 4ZXGA 2L59A 1ERUA 1EOHA 3IHGA 2GT6A 3NIVA 5B6MA 4Z2TA 1XVWA 2KUCA 2LUSA 1U6TA 3M3MA 1ACVA 4K5RA 3CWGA 1OC9A 4LL1B 1XWGA 6GSXA 5ECPB 4AJ8A 4MPGA 4BWQA 1LJRA 3IRAA 2R0GA 1TI3A 3VWVA 1XIYA 1HNAA 1OKTA 3ZRDA 3QOUA 4QMKA 3EVIA 1F37A 2WCIA 2HSHA 3P90A 4MJCA 4V2MA 3I43A 4L0UA 2VCQA 4GWRA 4EIPA 1VGLA 2EIRA 4KSMA 2FUG2 5COHA 5DQSA 5CYYA 4ULXA 2H6YA 3PR8A 4X0XA 2DIZA 2Z9SA 2MMNA 2GS3A 3FY7A 4POMA 5IMDA 1F6MC 2WRTA 4KA0A 5HR2A 2H71A 2M72A 3EMXA 2VCXA 2DJ3A 1HNBA 2H66A 3WD6A 3GX0A 1T3BA 3KTLA 2O8VB 2PN8A 4V2LA 2H8LA 2GZZA 1UN2A 3IBHA 2WFCA 2MZCA 2YNXA 5IOWA 4NV5A 4Z7XA 3TGZA 1YEPA 4HOJA 2YWMA 3WT1A 4LL4B 1O81A 2AV4A 3TB2A 2LSTA 5G5FA 4MCUA 5FHIA 4YQVA 2A4VA 3TJFA 2J9HA 1GSFA 1A24A 3DXBA 2VL2C 1KNGA 3HVVA 4K9ZA 4XRAA 1T4ZA 3W6GA 2I3YA 3HYPA 5A4VA 2A2SA 1PN9A 1WRYA 4IELA 1ZYQB 2VLTA 2DMLA 1U88A 2HLSA 4YKFA 3VI7A 2HSNA 1K3LA 2GZYA 1A23A 2F8AA 7GSSA 3GUSA 1TRVA 2LKUA 3HMJG 4KW6A 2R6KA 4MK3A 4KDUA 4GRFA 2FWEA 2H73A 2LRCA 1EEMA 1B8XA 4CY8A 5CRDA 4P3YB 4XCSA 4HU7A 4Q5NA 4USSA 3UVHA 1JZRA 4O5RA 4ZB6A 4I97A 1K0MA 5IOXA 1YJ6A 5CRWA 1YY7A 1YKAA 2GZPA 3QAVA 4ILFA 2H6XA 1X9WB 3A2XA 2BMXA 2XBIA 2HZFA 2C0GA 1EEJA 5DAKA 1A2JA 2X64A 3L9VA 4IP1A 5BRTA 4G10A 3QAGA 3KP8A 5CRGA 3IA1A 5CAXA 1SVLA 1Q98A 3DWVA 1M2DA 2M80A 5ELAA 1J9BA 3A2WA 2HRKA 5J4UA 3CSIA 5HQPA 3QCPA 3CRTA 4TRXA 1ERVA 4IS0A 4Q5FA 1URMA 3QFAC 2R0CA 1TK0B 1Q4JA 1WJKA 3GA4A 2GQMA 2F51A 4FYUA 3TKSE 1H4OA 4WETA 4KAEA 4GLTA 1O8WA 3IC8A 4K7OA 5JCGA 5ECLB 4BVYA 1A0FA 3FZ5A 2FA8A 1R26A 4K7IA 4CDOA 2GSTA 3VFIA 3FEUA 5D9WA 4KDYA 2AUVA 1Z3EA 1TDIA 3D22A 4XS4A 4MABA 4KNDA 2QSIA 1XWKA 4K6XA 5ECQB 1QUWA 1BX9A 3I6AA 1HNCA 1K0NA 3D4TA 4EO3A 5GAPD 5B7CA 3M0FA 2E7PA 1TI1A 1VF1A 3VWUA 3GTUA 4EVMA 4XRDA 2HRFA 3F6FA 5GSSA 2DKHA 4Z2UA 2LNSA 3UOMA 2UV8G 2ES7A 3KCMA 5J47A 4I2UA 4PQ1A 2NTOA 3LYKA 2P5QA 5G5EA 4GSSA 1FO5A 4TR1A 5HR3A 4BWSA 2B5XA 2YV7A 2MYGA 1BEDA 4MH3A 3LSZA 4EL1A 3KXOA 1N25A 1EV4A 2R3XA 5A5KA 4N3ZA 4OFMA 4BPYA 2GDRA 1S3DA 3TCOA 1AQVA 3W8SA 2H01A 3F9UA 4HZ2A 3TOUA 5IMFA 3ZREA 4KH7A 2L6DA 2GVPA 3KH7A 3SBCA 2VCVA 4OCFA 4NV2A 4G0KA 3UBKA 2R5GA 1SKRB 2RLIA 2GLRA 2GTUA 4NPBA 5DJLA 3QD9A 2I9HA 4JU5A 3MAKA 5HFIA 1S3AA 3MIXA 1OVNA 2XC2A 3FMWA 3F0IA 3A3TA 4TW5A 2G2QA 2KOKA 2B6MA 1GSSA 2VM2A 3VPTA 4YAPA 3F63A 5IMCA 1XVQA 1TXUA 4G19A 3DIEA 3D0ZA 3LXZA 2CVDA 2LNTA 1GSQA 1O73A 4MDCA 4EIQA 5HR0A 1XPVA 1K0DA 2H0IA 3CTFA 3ERWA 4ZL8A 2FCHA 4N11A 2WDUA 3ERGA 5H5QA 4J2FA 1V58A 1Z5YE 4KE3A 2FHEA 4IQAA 1W89A 5DDLA 4JEDA 4J56E 4POKA 3ZIVA 1GSUA 4G9HA 2FA4A 1EZKA 2O87A 4TR3A 3L4NA 2I4AA 5D9XA 3L9UA 5AIXA 1RK4A 4RI7A 4EF0A 2PPTA 2OACA 2B1KA 2CVKA 4MF7A 3IAS2 4JE1A 1SYXA 1SYRA 5A4WA 2L4CA 5IM9A 1SL1B 4MNNA 19GSA 3HZ4A 1Y1UA 4KCAA 3CMIA 1N2AA 2AB6A 1SKSB 1J0FA 2B7KA 3RHBA 1AW9A 2V1MA 13GSA 2E2GA 3EMPA 3QMXA 3M8NA 3HXSA 3RPPA 3GRXA 2CX3A 2LS5A 4AF2A 5AGYA 2OJLA 4K2XA 3BD2A 2ON5A 1MD3A 4ZBAA 5A5HB 5IMVA 3GYKA 4ZIJA 3JCML 1XOAA 3VURA 3CYNA 3LYPA 1ZYEA 2V2GA 2H0GA 3APSA 3MDKA 2N5BA 1FW1A 2C3NA 2HE3A 3N5OA 3PH9A 5A5HA 1EGRA 2ON7A 5KOXA 3WYWA 1K0CA 4EUYA 3ZVJA 1GUHA 2C0DA 3N9JA 3F3QA 3GKMA 2CV4A 1GTAA 4N0ZA 3GNJA 4IW9A 2EFHA 1JZWA 3PPUA 4ML6A 4I2TA 1UC7A 4YQUA 3IPZA 2A4HA 1E2YA 2OADA 3ZITA 1KEBA 16GSA 1TRSA 2H19A 4PX1A 3GSSA 2GQKA 2LEGA 3QAWA 6GSSA 5CRHA 4EXJA 3TJKA 8GSSA 4IJIA 4I6XA 2X99A 4KGIA 4HS1A 3D6IA 2QGVA 5AN1A 3LORA 3EYTA 4FYBA 3UAPA 3HZ8A 3F4RA 1YDKA 5LD0A 2X8GA 3GL5A 1GLPA 4HI7A 2WS2A 1M9BA 3P8WA 4BL7A 4TVEA 2NBSA 1WIKA 5J9BA 2PVQA 3ZFLA 2VL2A 1GULA 1RQMA 5J4VA 4F9ZA 5IO2A 5J40A 3IR4A 2RM6A 1R5PA 2YWOA 2A2PA 3EU4A 4O32A 2DJ2A 2OKAA 2FWHA 2YJ7A 5EPFA 2HXKA 3CBUA 1ERTA 1SVOA 3NZNA 5G2ZA 4Q5RA 3KZQA 3HJOA 3LXTA 2IIYA 1OKDA 3BOAA 1DE1A 1ZYNA 3M9KA 4TXOB 3VWXA 2LJKA 3DD3A 1FOVA 2WULA 3F8UA 4MZCA 4JZQA 5JWQB 2YV9A 4POBA 4XIHA 3FZ4A 5DQYA 2MMOA 5CO3A 1AAZA 2DIYA 2ZCTA 1GSDA 3G7IA 1F9MA 4MMMA 3TKRA 1A2LA 1TTZA 1SL2B 2H30A 3C71A 2DJKA 2FWGA 1OC8A 4PUFC 5J41A 2PGTA 1G6YA 3F6DA 1M0UA 1RW1A 3ISOA 4XHMA 2NVLA 4FQUA 2E0QA 1SVMA 2KLXA 4AJ7A 4KF9A 4OFNA 3O76A 2G0FA 1B4PA 1SJ6A 3K8NA 1G6WA 3KEBA 2XBQA 4ECIA 1R7HA 3QPMA 5D96A 1T7PB 2JZSA 3P2AA 4MH2A 1YKCA 1BJXA 1Z6MA 1XWCA 3TDGA 1NW2A 2IL3A 2CZ3A 2B5YA 1EV9A 5D73A 4O92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHS A;  3M9J A;  3EWL A;  1PA3 A;  3A5W A;  1TK5 B;  3HKR A;  5DAL B;  5IIZ A;  2IME A;  1SU9 A;  1B4Q A;  4XTS A;  3CSJ A;  4MZB A;  1TOF A;  1TKD B;  3D5J A;  5ECS A;  1Z6N A;  1BG5 A;  1ZOF A;  4YQM A;  1QMV A;  4GSN A;  3W8J A;  5DAL A;  3ZLP A;  1TU7 A;  3IXR A;  2JL4 A;  2MMZ A;  3G9B A;  2F9S A;  3FR9 A;  4YAV A;  3Q74 A;  1HYU A;  3MWH A;  3HVX A;  1XW5 A;  2D2Z A;  4G0I A;  2B7J A;  4HQS A;  4KB3 A;  1FHE A;  3ZML A;  4N30 A;  2YAN A;  4TKY A;  1PX7 A;  2CAI A;  2H70 A;  3IK7 A;  3H8Q A;  2C0E A;  2RM5 A;  3C1S A;  1M2A A;  4PXO A;  2K9F A;  2VL3 A;  2VLV A;  2YCD A;  1QGV A;  4L5L A;  3HDC A;  4YH2 A;  4F82 A;  1G7E A;  2YP6 A;  1GH2 A;  1V40 A;  5KN2 A;  3CRU A;  2DJJ A;  3D4M A;  4PUR A;  4WBR D;  1Y6E A;  5AIV A;  4PTS A;  5D93 A;  4NWY A;  2IMK A;  1NHO A;  3IOS A;  3WGE A;  2QKE A;  1O8X A;  3I9V 2;  4G0L A;  3C73 A;  1MTC A;  3RPN A;  1B48 A;  1MD4 A;  5H5R A;  1AXD A;  5F05 A;  4ML1 A;  2OBK A;  2NDO A;  1I5G A;  5H5S A;  2M46 A;  4ZBD A;  4DEJ A;  1SEN A;  4D73 B;  1GNW A;  1U3I A;  3GFK A;  4X43 A;  3ZVJ D;  2MBS A;  3DKS A;  2CQ9 A;  3HY2 A;  1THX A;  3HD5 A;  4XS6 A;  4TR4 A;  1SK0 A;  2TIR A;  5A4U A;  2L5O A;  4HZ4 A;  3MNG A;  2H1A A;  3TJG A;  1SJZ A;  6GST A;  4RUV A;  4MLY A;  3VLN A;  3GKK A;  1AIU A;  1J08 A;  1THO A;  2YJH A;  1DUG A;  3GL3 A;  2HYX A;  5ELG A;  3RBT A;  2VAF A;  2FLS A;  4KCE A;  2L4Q A;  4Q5Q A;  2PBJ A;  1LBK A;  1IYI A;  1N8J A;  3KD0 A;  4FH8 A;  2FNO A;  2R4V A;  2K6V A;  3UJ1 A;  1SL0 B;  3FR3 A;  2PU9 C;  1K0A A;  5BMU A;  2A2R A;  3UEM A;  1WE0 A;  3KMO A;  1B9Y C;  3ZL5 A;  2AAW A;  1EP8 A;  2DMM A;  4IP6 A;  1BYE A;  1G0T A;  3ZFB A;  2VUP A;  3GKN A;  1H75 A;  3LGC A;  4XS1 A;  5LCZ A;  1PL1 A;  4E8H A;  2FD3 A;  4O7H A;  4CW9 A;  3SWL A;  2PMT A;  2KHP A;  4KSO A;  3V1W A;  3LJR A;  3QFB C;  3IDV A;  2PUK C;  5J5N A;  4KUN A;  5EY6 A;  2H72 A;  2B3S A;  4I8B A;  3KP9 A;  2C1Y A;  3DRN A;  1SKW B;  1GWC A;  2HZE B;  3FZ9 A;  2B5E A;  4WKW A;  4L5O A;  4WR5 A;  4WBJ A;  2HNL A;  4PUA A;  2JU5 A;  2WGR A;  2YPM A;  5D9T A;  4ISD A;  1JZD A;  1PKW A;  3IC4 A;  2VIM A;  3NOF A;  4JR6 A;  3KGK A;  4IVF A;  5KN0 A;  1TU8 A;  5DVB A;  1JLV A;  2HZE A;  2DSA A;  2V41 A;  1TK8 B;  2WJU A;  1PX6 A;  2IPA A;  1V2A A;  1JHB A;  1VF4 A;  3FHK A;  1TW9 A;  3TRQ A;  1QQ2 A;  4L0W A;  1JLW A;  1PL2 A;  2CA8 A;  4PQH A;  5E59 A;  1OAZ A;  3WGX A;  3VI5 A;  3KTB A;  3TKS C;  5KN3 A;  1LU4 A;  5CP1 A;  2B1L A;  5C00 A;  2F8F A;  1WWJ A;  4DSR A;  1M99 A;  1F2E A;  5IMA A;  4OWY A;  1EOG A;  3KJY A;  2XHF A;  1YZX A;  2X8C A;  1YQ1 A;  4DSQ A;  1T00 A;  2K8S A;  3EE2 A;  4ECC A;  3DML A;  2R37 A;  1DBY A;  3E3E A;  1E6B A;  1V98 A;  2IMD A;  1Z9H A;  4TR0 A;  5DCH A;  4ZL9 A;  2JZR A;  1R5A A;  2LV3 A;  4N10 A;  2RUF A;  5DBQ A;  2RII A;  4AJ6 A;  1XZO A;  3HJP A;  3LEF A;  2IFQ B;  2GSQ A;  2V32 A;  4WF5 A;  3G7J A;  2N5F A;  4V1A g;  3ZYW A;  2PWJ A;  1GSE A;  5ECN B;  3KH9 A;  4LA1 A;  2KP1 A;  2HSY A;  1SK2 A;  2YOI A;  5D8I A;  1QK8 A;  1AQX A;  1Z7R A;  3GN3 A;  2LJA A;  1UA5 A;  2NPB A;  1GP1 A;  2FY6 A;  2N5A A;  5ABR A;  1KBN A;  2GQL A;  2C4J A;  4HEA 2;  3C1R A;  1GTB A;  3GUR A;  4GXZ A;  4NMU A;  2YN1 A;  3UAR A;  1T1V A;  5ENU A;  1K0O A;  1PD2 1;  4ZIL A;  2AYT A;  2C0F A;  2OBI A;  1QXH A;  3DYR A;  2IWT A;  1A0R P;  3DVX A;  5C04 A;  4NAX A;  1OE8 A;  2VL9 A;  3J7Y k;  4MJB A;  4MF6 A;  5J9C A;  5E4W A;  1VRS D;  1WPI A;  3PGT A;  4OO4 A;  4OCE A;  5CRE A;  4IN0 A;  4HU9 A;  3EC3 A;  1ABA A;  2HI7 A;  1B9X C;  17GS A;  4MPF A;  2CVB A;  3MSZ A;  3E0U A;  3UL3 A;  1EGO A;  1JZO A;  2K8V A;  4GST A;  2J23 A;  2L57 A;  3KM6 A;  3IK9 A;  1Y25 A;  6GSW A;  4IQ1 A;  3E9J B;  1HQO A;  4KDX A;  3IAM 2;  4FIW A;  2H1G A;  2YZH A;  3UBL A;  2QC7 A;  4FYC A;  2IMF A;  1DE2 A;  1OC9 B;  1ZMA A;  3RDW A;  1C72 A;  3FR6 A;  4OMV A;  3APO A;  1XFL A;  2JZT A;  1XW6 A;  4ZB9 A;  4F2I A;  4NHW A;  2VO4 A;  1OYJ A;  3FRC A;  4WR4 A;  3TUE A;  1A8L A;  4K0N A;  3WT2 A;  3TKP A;  1X5C A;  3UIW A;  2H6Z A;  3HJM A;  1OC3 A;  1ILO A;  2H74 A;  4TXO A;  5IO0 A;  1G7O A;  22GS A;  3CTG A;  1T8E B;  3LFL A;  4NXI A;  1A8Y A;  1HD2 A;  3GX8 A;  2O85 A;  3QDN A;  3H1N A;  2VLU A;  3ED3 A;  5EVO A;  4DVC A;  2VD1 A;  2O7K A;  2GGT A;  3J7Y b;  4N0V A;  2V6O A;  4OO5 A;  4PNF A;  3DGQ A;  3L78 A;  2HFD A;  3ZTL A;  4GCI A;  5IQY A;  3ZZX A;  2AJQ B;  4HQZ A;  4MP4 A;  1XBS A;  4EC0 A;  2L5L A;  4GQF A;  4PQI A;  1V9W A;  5CNW A;  1SD8 A;  1PSQ A;  2HSM B;  3HCZ A;  3U6V A;  1ZCP A;  3F4T A;  4IJ3 A;  4MJE A;  11GS A;  2DJ0 A;  3GHA A;  3US3 A;  4H86 A;  1MDK A;  2P5R A;  2HSN B;  1ZZY A;  2F3M A;  1EP7 A;  1QFN A;  2HSM A;  1NHY A;  3IE3 A;  3KMN A;  1X9M B;  4FO5 A;  1PQN A;  1IYH A;  3BBY A;  1S3C A;  5FT3 A;  3F3R A;  4F0B A;  5FWG A;  1XOB A;  2VM1 A;  5IMZ A;  3Q19 A;  5ECO B;  1XWA A;  1FVK A;  3LWA A;  1ST9 A;  4LMW A;  1X0R A;  2LJR A;  2PVO C;  1OE7 A;  2R2J A;  2HRN A;  2HT9 A;  4OFT A;  3O6T A;  4HJ2 A;  5DCG A;  2FGX A;  3BCI A;  1ML6 A;  5AIS A;  3OR5 A;  4MF5 A;  2VCW A;  4K1F A;  1XW9 A;  3IV4 A;  3WGD A;  1WMJ A;  1R4W A;  5G31 A;  1VF3 A;  5DAK B;  4EDY A;  3M1G A;  1MDI A;  3A2V A;  2JAC A;  1PGT A;  2H76 A;  1ZGN A;  1ERW A;  1MEK A;  4V1A p;  3ZMK A;  2VCT A;  2C8U A;  4BA7 A;  3TRX A;  3F4S A;  4ID0 A;  1USB A;  4JR4 A;  2HRK B;  1GTI A;  1GL8 A;  2LQO A;  4I5Q A;  1FVJ A;  1NSW A;  3GV1 A;  4JBB A;  1SK1 A;  2HRA A;  2YZU A;  1YEX A;  3HA9 A;  4EDZ A;  3R2Q A;  2CAQ A;  2P31 A;  1K3O A;  3H93 A;  2LRN A;  1CQG A;  4BVY B;  3TKQ A;  2C80 A;  1BAY A;  3DEX A;  1T4Y A;  1JFU A;  2OE1 A;  4XS4 B;  1XXU A;  3IHQ A;  2LRT A;  2DC5 A;  3ERF A;  3L0H A;  4ZB8 A;  2RUE A;  2VOC A;  5IPG A;  3KIJ A;  2XPD A;  5F07 A;  1O6J A;  1PRX A;  1FG4 A;  5INY A;  3QR6 A;  2ALB A;  5HFK A;  3GTU B;  4ECJ A;  1A2M A;  4F0C A;  5KN1 A;  1NM3 A;  2AHE A;  3EUR A;  4GF0 A;  4K0G A;  2IJY A;  3UVT A;  3L9S A;  3D21 A;  5B8B A;  1GUM A;  2WZ9 A;  2BJX A;  2BTO T;  3FYG A;  2YWN A;  5ECH B;  4TR1 B;  3ME8 A;  1X5D A;  3TOT A;  1AQW A;  1U3A A;  2H0H A;  2ZUP A;  1GNE A;  2C3Q A;  1K0B A;  3R3E A;  1SJI A;  2DLX A;  4D73 A;  3Q6O A;  2JAD A;  4MZW A;  4F03 A;  5GAN D;  3GH9 A;  2OE3 A;  1DSB A;  2MBT A;  3TKS A;  4PNG A;  5D9V A;  5J3R A;  1ON4 A;  4J57 E;  4BVX B;  3U5R E;  2C3T A;  1ZL9 A;  3C7M A;  3GKX A;  1GLQ A;  3VK9 A;  2CZ2 A;  6GSY A;  14GS A;  3C8E A;  2XPE A;  12GS A;  2I81 A;  1TRU A;  3LQ7 A;  1YF1 A;  4BVX A;  2ZNM A;  3G7Y A;  3Q18 A;  4HJM A;  1WP0 A;  5EL8 A;  2WB9 A;  2LQQ A;  3ZIJ A;  1UVZ A;  1XWB A;  3BCK A;  5JCW A;  1GUK A;  1K3Y A;  5L71 A;  3H4K A;  4POL A;  4QQ7 A;  4RQR A;  2UZ8 A;  4MA9 A;  2DBC A;  1XCC A;  4QL7 A;  4TXV A;  4EKZ A;  4IHU A;  5F06 A;  2EC4 A;  3VWW A;  2VD0 A;  4IKH A;  5ECM B;  4E8E A;  3BJ5 A;  2I1U A;  4WEY A;  4ECB A;  3APQ A;  5IPH A;  2P0G A;  3I69 A;  1Z7P A;  4LLR A;  5G1L A;  3FW2 A;  6GSU A;  5DJM A;  5GZZ B;  2CX4 A;  5JWR B;  4G2E A;  1X5E A;  2TRC P;  2EIO A;  1V57 A;  2H1B A;  2OA7 A;  3TJJ A;  2JSZ A;  2H75 A;  4RI6 A;  4DSS B;  1TP9 A;  1U87 A;  5F8B A;  4QL9 A;  5ECK B;  3FKF A;  2L6C A;  3RHC A;  4LMV A;  5B6N A;  5HR1 A;  5G1K A;  5B8A A;  2KP2 A;  1O85 A;  4MJA A;  4DSS A;  1F3A A;  9GSS A;  3GMF A;  3HHV A;  1W4V A;  4K2D A;  4TN8 A;  2GSR A;  2VCZ A;  4GQC A;  1X9S B;  1FAA A;  3EIN A;  3ME7 A;  2IN3 A;  2V6K A;  4V2N A;  1EWX A;  5JCU A;  4ZL7 A;  2HQT A;  4WXT A;  5F0G A;  1KTE A;  4X1U A;  1TJD A;  4AGS A;  4GTU A;  3HVS A;  1M9A A;  3LG6 A;  2REM A;  4ACS A;  1FB0 A;  2DJ1 A;  3GH6 A;  1BQ7 A;  18GS A;  1CQH A;  3P7X A;  1MDJ A;  2K18 A;  2E2M A;  4ZBB A;  5KEJ A;  1O7U A;  2FWF A;  2X8H A;  3PIN A;  2IFQ A;  4K7N A;  4IGJ A;  4NHZ A;  1F3B A;  3H79 A;  1M2B A;  2LTK A;  4JRR A;  3DVW A;  5HFG A;  3FZA A;  4EE0 A;  4RQX A;  2GSS A;  1GRX A;  1TRW A;  5GST A;  3TRP A;  2OE0 A;  2TRX A;  4HUA A;  3S9F A;  2H1D A;  5ID2 B;  1I9D A;  1SD9 A;  4TOP A;  2PER A;  4OD7 A;  1VF2 A;  5LNK e;  4HDE A;  3UMA A;  5ECR B;  1FB6 A;  3FK8 A;  1GSY A;  4WF4 A;  3EU3 A;  5G30 A;  4K8M A;  5JWO B;  5ID2 A;  6GSV A;  3VPQ A;  2JSY A;  3RAZ A;  3TJB A;  2YWI A;  4BL7 B;  1YF0 A;  1WOU A;  2GT5 A;  5ECI B;  1AC1 A;  1AUC A;  3CSH A;  1GTU A;  2IMI A;  4PGT A;  3GST A;  3GIX A;  2EIQ A;  20GS A;  4L8E A;  1PKZ A;  4KX4 A;  10GS A;  3AY8 A;  1PMT A;  1TXX A;  2O89 A;  1M7T A;  3CXG A;  4IBP A;  2MMA A;  2CT6 A;  3O3T A;  4ZXG A;  2L59 A;  1ERU A;  1EOH A;  2GT6 A;  3NIV A;  5B6M A;  1XVW A;  2KUC A;  2LUS A;  1U6T A;  3M3M A;  1ACV A;  1OC9 A;  4LL1 B;  1XWG A;  6GSX A;  5ECP B;  4AJ8 A;  4MPG A;  4BWQ A;  1LJR A;  3IRA A;  1TI3 A;  3VWV A;  1XIY A;  1HNA A;  1OKT A;  3ZRD A;  3QOU A;  3EVI A;  1F37 A;  2WCI A;  2HSH A;  3P90 A;  4MJC A;  4V2M A;  3I43 A;  4L0U A;  2VCQ A;  4GWR A;  1VGL A;  2EIR A;  4KSM A;  2FUG 2;  5COH A;  5DQS A;  5CYY A;  4ULX A;  2H6Y A;  3PR8 A;  4X0X A;  2DIZ A;  2Z9S A;  2MMN A;  2GS3 A;  3FY7 A;  4POM A;  5IMD A;  1F6M C;  2WRT A;  4KA0 A;  5HR2 A;  2H71 A;  2M72 A;  3EMX A;  2VCX A;  2DJ3 A;  1HNB A;  2H66 A;  3WD6 A;  3GX0 A;  1T3B A;  3KTL A;  2O8V B;  2PN8 A;  4V2L A;  2H8L A;  2GZZ A;  1UN2 A;  3IBH A;  2WFC A;  2MZC A;  2YNX A;  5IOW A;  4NV5 A;  4Z7X A;  3TGZ A;  1YEP A;  4HOJ A;  2YWM A;  3WT1 A;  4LL4 B;  1O81 A;  2AV4 A;  3TB2 A;  2LST A;  5G5F A;  4MCU A;  5FHI A;  4YQV A;  2A4V A;  3TJF A;  2J9H A;  1GSF A;  1A24 A;  3DXB A;  2VL2 C;  1KNG A;  3HVV A;  4K9Z A;  4XRA A;  1T4Z A;  3W6G A;  2I3Y A;  3HYP A;  5A4V A;  2A2S A;  1PN9 A;  1WRY A;  4IEL A;  1ZYQ B;  2VLT A;  2DML A;  1U88 A;  2HLS A;  3VI7 A;  2GZY A;  1K3L A;  1A23 A;  2F8A A;  7GSS A;  3GUS A;  1TRV A;  2LKU A;  4KW6 A;  2R6K A;  4MK3 A;  4KDU A;  4GRF A;  2FWE A;  2H73 A;  2LRC A;  1EEM A;  1B8X A;  5CRD A;  4P3Y B;  4XCS A;  4HU7 A;  4Q5N A;  4USS A;  3UVH A;  1JZR A;  4O5R A;  4ZB6 A;  4I97 A;  1K0M A;  5IOX A;  1YJ6 A;  5CRW A;  1YY7 A;  1YKA A;  2GZP A;  3QAV A;  4ILF A;  2H6X A;  1X9W B;  3A2X A;  2BMX A;  2XBI A;  2HZF A;  2C0G A;  1EEJ A;  5DAK A;  1A2J A;  2X64 A;  3L9V A;  4IP1 A;  4G10 A;  3QAG A;  3KP8 A;  5CRG A;  3IA1 A;  5CAX A;  1Q98 A;  3DWV A;  1M2D A;  2M80 A;  5ELA A;  1J9B A;  3A2W A;  2HRK A;  5J4U A;  3CSI A;  5HQP A;  3QCP A;  3CRT A;  4TRX A;  1ERV A;  4IS0 A;  4Q5F A;  1URM A;  3QFA C;  1TK0 B;  1Q4J A;  1WJK A;  3GA4 A;  2GQM A;  2F51 A;  4FYU A;  3TKS E;  1H4O A;  4WET A;  4KAE A;  4GLT A;  1O8W A;  3IC8 A;  4K7O A;  5JCG A;  5ECL B;  4BVY A;  1A0F A;  3FZ5 A;  2FA8 A;  1R26 A;  4K7I A;  4CDO A;  2GST A;  3VFI A;  3FEU A;  5D9W A;  4KDY A;  2AUV A;  1Z3E A;  1TDI A;  3D22 A;  4XS4 A;  4MAB A;  4KND A;  2QSI A;  1XWK A;  4K6X A;  5ECQ B;  1QUW A;  1BX9 A;  3I6A A;  1HNC A;  1K0N A;  3D4T A;  4EO3 A;  5GAP D;  5B7C A;  3M0F A;  2E7P A;  1TI1 A;  1VF1 A;  3VWU A;  3GTU A;  4EVM A;  4XRD A;  2HRF A;  3F6F A;  5GSS A;  2LNS A;  3UOM A;  2ES7 A;  3KCM A;  4I2U A;  4PQ1 A;  2NTO A;  3LYK A;  2P5Q A;  5G5E A;  4GSS A;  1FO5 A;  4TR1 A;  5HR3 A;  4BWS A;  2B5X A;  2YV7 A;  2MYG A;  1BED A;  4MH3 A;  3LSZ A;  4EL1 A;  3KXO A;  1EV4 A;  2R3X A;  5A5K A;  4OFM A;  4BPY A;  2GDR A;  1S3D A;  3TCO A;  1AQV A;  3W8S A;  2H01 A;  3F9U A;  4HZ2 A;  3TOU A;  5IMF A;  3ZRE A;  4KH7 A;  2L6D A;  2GVP A;  3KH7 A;  3SBC A;  2VCV A;  4OCF A;  4NV2 A;  4G0K A;  3UBK A;  2R5G A;  1SKR B;  2RLI A;  2GLR A;  2GTU A;  4NPB A;  5DJL A;  3QD9 A;  2I9H A;  4JU5 A;  3MAK A;  5HFI A;  1S3A A;  1OVN A;  2XC2 A;  3F0I A;  3A3T A;  4TW5 A;  2G2Q A;  2KOK A;  2B6M A;  1GSS A;  2VM2 A;  3VPT A;  4YAP A;  3F63 A;  5IMC A;  1XVQ A;  4G19 A;  3DIE A;  3D0Z A;  3LXZ A;  2CVD A;  2LNT A;  1GSQ A;  1O73 A;  4MDC A;  5HR0 A;  1XPV A;  1K0D A;  2H0I A;  3CTF A;  3ERW A;  4ZL8 A;  2FCH A;  4N11 A;  2WDU A;  3ERG A;  5H5Q A;  4J2F A;  1V58 A;  1Z5Y E;  4KE3 A;  2FHE A;  4IQA A;  1W89 A;  5DDL A;  4JED A;  4J56 E;  4POK A;  3ZIV A;  1GSU A;  4G9H A;  2FA4 A;  1EZK A;  2O87 A;  4TR3 A;  3L4N A;  2I4A A;  5D9X A;  3L9U A;  5AIX A;  1RK4 A;  4RI7 A;  4EF0 A;  2PPT A;  2OAC A;  2B1K A;  2CVK A;  4MF7 A;  3IAS 2;  4JE1 A;  1SYX A;  1SYR A;  5A4W A;  2L4C A;  5IM9 A;  1SL1 B;  19GS A;  3HZ4 A;  4KCA A;  3CMI A;  1N2A A;  2AB6 A;  1SKS B;  1J0F A;  2B7K A;  3RHB A;  1AW9 A;  2V1M A;  13GS A;  2E2G A;  3EMP A;  3QMX A;  3M8N A;  3HXS A;  3RPP A;  3GRX A;  2CX3 A;  2LS5 A;  4AF2 A;  5AGY A;  2OJL A;  3BD2 A;  2ON5 A;  1MD3 A;  4ZBA A;  5IMV A;  3GYK A;  4ZIJ A;  3JCM L;  1XOA A;  3VUR A;  3CYN A;  3LYP A;  1ZYE A;  2V2G A;  2H0G A;  3APS A;  3MDK A;  2N5B A;  1FW1 A;  2C3N A;  2HE3 A;  3N5O A;  3PH9 A;  1EGR A;  2ON7 A;  3WYW A;  1K0C A;  4EUY A;  3ZVJ A;  1GUH A;  2C0D A;  3N9J A;  3F3Q A;  3GKM A;  2CV4 A;  1GTA A;  4N0Z A;  3GNJ A;  4IW9 A;  1JZW A;  3PPU A;  4ML6 A;  4I2T A;  1UC7 A;  4YQU A;  3IPZ A;  1E2Y A;  2OAD A;  3ZIT A;  1KEB A;  16GS A;  1TRS A;  2H19 A;  4PX1 A;  3GSS A;  2GQK A;  2LEG A;  3QAW A;  6GSS A;  5CRH A;  4EXJ A;  3TJK A;  8GSS A;  4IJI A;  4I6X A;  2X99 A;  4KGI A;  4HS1 A;  3D6I A;  2QGV A;  5AN1 A;  3LOR A;  3EYT A;  4FYB A;  3UAP A;  3HZ8 A;  3F4R A;  1YDK A;  5LD0 A;  2X8G A;  3GL5 A;  1GLP A;  4HI7 A;  2WS2 A;  1M9B A;  3P8W A;  4BL7 A;  4TVE A;  2NBS A;  1WIK A;  5J9B A;  2PVQ A;  3ZFL A;  2VL2 A;  1GUL A;  1RQM A;  4F9Z A;  5IO2 A;  3IR4 A;  2RM6 A;  1R5P A;  2YWO A;  3EU4 A;  4O32 A;  2DJ2 A;  2OKA A;  2FWH A;  2YJ7 A;  5EPF A;  2HXK A;  3CBU A;  1ERT A;  3NZN A;  5G2Z A;  4Q5R A;  3KZQ A;  3HJO A;  3LXT A;  2IIY A;  1OKD A;  3BOA A;  1DE1 A;  3M9K A;  4TXO B;  3VWX A;  2LJK A;  3DD3 A;  1FOV A;  2WUL A;  3F8U A;  4MZC A;  4JZQ A;  5JWQ B;  2YV9 A;  4POB A;  4XIH A;  3FZ4 A;  5DQY A;  2MMO A;  5CO3 A;  1AAZ A;  2DIY A;  2ZCT A;  1GSD A;  3G7I A;  1F9M A;  4MMM A;  3TKR A;  1A2L A;  1TTZ A;  1SL2 B;  2H30 A;  3C71 A;  2DJK A;  2FWG A;  1OC8 A;  4PUF C;  5J41 A;  2PGT A;  1G6Y A;  3F6D A;  1M0U A;  1RW1 A;  3ISO A;  4XHM A;  2NVL A;  4FQU A;  2E0Q A;  2KLX A;  4AJ7 A;  4KF9 A;  4OFN A;  3O76 A;  2G0F A;  1B4P A;  1SJ6 A;  3K8N A;  1G6W A;  3KEB A;  2XBQ A;  4ECI A;  1R7H A;  3QPM A;  5D96 A;  1T7P B;  2JZS A;  3P2A A;  4MH2 A;  1YKC A;  1BJX A;  1Z6M A;  1XWC A;  3TDG A;  1NW2 A;  2IL3 A;  2CZ3 A;  2B5Y A;  1EV9 A;  5D73 A;  4O92 A; 
#chains in the Genus database with same CATH topology
 4CHS A;  3M9J A;  3EWL A;  1PA3 A;  3A5W A;  1TK5 B;  3HKR A;  5DAL B;  5IIZ A;  2IME A;  1SU9 A;  1B4Q A;  4XTS A;  3CSJ A;  4MZB A;  1TOF A;  1TKD B;  3D5J A;  5ECS A;  1Z6N A;  1BG5 A;  1ZOF A;  4YQM A;  1QMV A;  4GSN A;  3W8J A;  5DAL A;  3ZLP A;  1TU7 A;  3IXR A;  2JL4 A;  2MMZ A;  3G9B A;  2F9S A;  3FR9 A;  4YAV A;  3Q74 A;  1HYU A;  3MWH A;  3HVX A;  1XW5 A;  2D2Z A;  4G0I A;  2B7J A;  4HQS A;  4KB3 A;  1FHE A;  3ZML A;  4N30 A;  2EFC A;  2YAN A;  4TKY A;  1PX7 A;  2CAI A;  2H70 A;  1S4B P;  3IK7 A;  3H8Q A;  2C0E A;  2RM5 A;  3C1S A;  4BIK A;  1M2A A;  4PXO A;  2K9F A;  2VL3 A;  2VLV A;  2YCD A;  1QGV A;  4L5L A;  3HDC A;  4YH2 A;  4F82 A;  1G7E A;  2YP6 A;  1GH2 A;  1V40 A;  5KN2 A;  3CRU A;  2DJJ A;  3D4M A;  4PUR A;  4WBR D;  1Y6E A;  5AIV A;  4PTS A;  5D93 A;  4NWY A;  2IMK A;  1NHO A;  3IOS A;  3WGE A;  2QKE A;  1O8X A;  3I9V 2;  4G0L A;  3C73 A;  1MTC A;  3RPN A;  1B48 A;  1MD4 A;  5H5R A;  1AXD A;  5F05 A;  4ML1 A;  2OBK A;  2NDO A;  1I5G A;  5H5S A;  2M46 A;  4ZBD A;  4DEJ A;  1SEN A;  4ICY A;  4D73 B;  1GNW A;  1U3I A;  3GFK A;  4X43 A;  3ZVJ D;  2MBS A;  3DKS A;  2CQ9 A;  3HY2 A;  1THX A;  3HD5 A;  2X4A A;  4XS6 A;  4TR4 A;  1SK0 A;  2TIR A;  5A4U A;  2L5O A;  4HZ4 A;  3MNG A;  2H1A A;  3TJG A;  1SJZ A;  6GST A;  4RUV A;  4MLY A;  3VLN A;  3GKK A;  1AIU A;  1J08 A;  1THO A;  2YJH A;  1DUG A;  3GL3 A;  2HYX A;  5ELG A;  3RBT A;  5BMU B;  2VAF A;  5A1N B;  2FLS A;  4KCE A;  2L4Q A;  4Q5Q A;  2PBJ A;  1LBK A;  1IYI A;  4O5Q A;  1N8J A;  3KD0 A;  4FH8 A;  2FNO A;  2R4V A;  2K6V A;  3UJ1 A;  1SL0 B;  3FR3 A;  2PU9 C;  1K0A A;  5BMU A;  2A2R A;  3UEM A;  1WE0 A;  3KMO A;  1B9Y C;  3ZL5 A;  2AAW A;  1EP8 A;  2DMM A;  4IP6 A;  1BYE A;  1G0T A;  3ZFB A;  2VUP A;  3GKN A;  1H75 A;  3LGC A;  4XS1 A;  5LCZ A;  1PL1 A;  4E8H A;  2FD3 A;  4O7H A;  4CW9 A;  3SWL A;  2PMT A;  2KHP A;  4KSO A;  3V1W A;  3LJR A;  3QFB C;  3IDV A;  2PUK C;  5J5N A;  4KUN A;  5EY6 A;  2H72 A;  2B3S A;  4I8B A;  3KP9 A;  2C1Y A;  3DRN A;  1SKW B;  1GWC A;  2HZE B;  3FZ9 A;  2B5E A;  4WKW A;  4L5O A;  4WR5 A;  4WBJ A;  2HNL A;  4PUA A;  2QA1 A;  2JU5 A;  2WGR A;  2YPM A;  5D9T A;  4ISD A;  1JZD A;  1PKW A;  3IC4 A;  2VIM A;  3NOF A;  4JR6 A;  3KGK A;  4IVF A;  5KN0 A;  1TU8 A;  5DVB A;  1JLV A;  2HZE A;  2DSA A;  2V41 A;  1TK8 B;  2WJU A;  1PX6 A;  4AKH A;  2IPA A;  1V2A A;  1JHB A;  1VF4 A;  3FHK A;  1TW9 A;  3TRQ A;  1QQ2 A;  4L0W A;  1JLW A;  1PL2 A;  2CA8 A;  4PQH A;  5E59 A;  1OAZ A;  3WGX A;  3VI5 A;  3KTB A;  3TKS C;  5KN3 A;  1LU4 A;  5CP1 A;  2B1L A;  5C00 A;  4PI2 C;  2F8F A;  1WWJ A;  4DSR A;  1M99 A;  4AI6 A;  1F2E A;  5IMA A;  4OWY A;  1EOG A;  3KJY A;  2XHF A;  1YZX A;  2X8C A;  1YQ1 A;  4DSQ A;  1T00 A;  2K8S A;  3EE2 A;  4ECC A;  2DKI A;  3DML A;  2R37 A;  1DBY A;  3HVN A;  3E3E A;  1E6B A;  1V98 A;  2IMD A;  1Z9H A;  4TR0 A;  5DCH A;  4G01 A;  2JZR A;  4ZL9 A;  1R5A A;  2LV3 A;  4N10 A;  2RUF A;  5DBQ A;  2RII A;  4AJ6 A;  1XZO A;  3HJP A;  3LEF A;  2IFQ B;  2GSQ A;  2V32 A;  4WF5 A;  3G7J A;  2N5F A;  4V1A g;  3ZYW A;  2PWJ A;  1GSE A;  4O5U A;  5ECN B;  3KH9 A;  4LA1 A;  2WW0 A;  2KP1 A;  2HSY A;  1SK2 A;  2YOI A;  5D8I A;  1QK8 A;  1AQX A;  4YKG A;  1Z7R A;  3GN3 A;  2LJA A;  1UA5 A;  2NPB A;  1GP1 A;  2FY6 A;  2N5A A;  5ABR A;  1KBN A;  2GQL A;  2C4J A;  4HEA 2;  3C1R A;  1GTB A;  3GUR A;  4GXZ A;  2O36 A;  4NMU A;  2YN1 A;  3UAR A;  1T1V A;  5ENU A;  1K0O A;  1PD2 1;  4ZIL A;  2AYT A;  2C0F A;  2OBI A;  1QXH A;  3DYR A;  2IWT A;  1A0R P;  3DVX A;  5C04 A;  4NAX A;  1OE8 A;  2VL9 A;  3J7Y k;  4MJB A;  4MF6 A;  5J9C A;  5E4W A;  1VRS D;  1WPI A;  3PGT A;  4OO4 A;  4OCE A;  5CRE A;  4IN0 A;  4HU9 A;  3EC3 A;  1ABA A;  2HI7 A;  1B9X C;  17GS A;  4MPF A;  2CVB A;  3MSZ A;  3E0U A;  3UL3 A;  1EGO A;  1BF5 A;  1JZO A;  2K8V A;  4GST A;  2J23 A;  2L57 A;  3KM6 A;  3IK9 A;  1Y25 A;  6GSW A;  4IQ1 A;  3E9J B;  3A5I A;  1HQO A;  4KDX A;  1M3J A;  3IAM 2;  4FIW A;  2H1G A;  2YZH A;  3UBL A;  2QC7 A;  4FYC A;  2IMF A;  1DE2 A;  1OC9 B;  1ZMA A;  3RDW A;  1C72 A;  3FR6 A;  4OMV A;  3APO A;  1XFL A;  2JZT A;  1XW6 A;  4ZB9 A;  4F2I A;  4NHW A;  2VO4 A;  1OYJ A;  3FRC A;  4WR4 A;  3TUE A;  1A8L A;  4K0N A;  3WT2 A;  3TKP A;  3MYD A;  1X5C A;  3UIW A;  2H6Z A;  3HJM A;  1BG1 A;  1OC3 A;  1ILO A;  2H74 A;  4TXO A;  5IO0 A;  1G7O A;  22GS A;  3CTG A;  1T8E B;  3LFL A;  4NXI A;  1A8Y A;  1HD2 A;  3GX8 A;  1S3R A;  2O85 A;  3QDN A;  3H1N A;  2VLU A;  3ED3 A;  5EVO A;  4DVC A;  2VD1 A;  2O7K A;  2GGT A;  4AKG A;  3J7Y b;  4N0V A;  2V6O A;  3TU3 B;  4OO5 A;  4PNF A;  3DGQ A;  3L78 A;  2HFD A;  3ZTL A;  4GCI A;  5IQY A;  3ZZX A;  2AJQ B;  4HQZ A;  4MP4 A;  1XBS A;  4EC0 A;  2L5L A;  4GQF A;  4PQI A;  1V9W A;  5CNW A;  1SD8 A;  1PSQ A;  2HSM B;  3HCZ A;  4GDF A;  3U6V A;  1ZCP A;  3F4T A;  4IJ3 A;  4MJE A;  11GS A;  2DJ0 A;  3GHA A;  3US3 A;  4H86 A;  1MDK A;  2P5R A;  2HSN B;  1ZZY A;  2F3M A;  1EP7 A;  1QFN A;  2HSM A;  1NHY A;  3IE3 A;  3KMN A;  1X9M B;  4FO5 A;  1PQN A;  1IYH A;  3BBY A;  1S3C A;  5FT3 A;  3F3R A;  4F0B A;  5FWG A;  1XOB A;  2H1L A;  2VM1 A;  5IMZ A;  3Q19 A;  5ECO B;  1XWA A;  1FVK A;  3LWA A;  1ST9 A;  4LMW A;  1X0R A;  2LJR A;  2PVO C;  1OE7 A;  2R2J A;  2HRN A;  1PFO A;  2HT9 A;  4OFT A;  3O6T A;  4HJ2 A;  5DCG A;  1PN0 A;  2FGX A;  2VKZ G;  3BCI A;  1ML6 A;  5AIS A;  3OR5 A;  4MF5 A;  5A34 B;  2VCW A;  4K1F A;  1XW9 A;  3IV4 A;  3WGD A;  1WMJ A;  1R4W A;  5G31 A;  1VF3 A;  5DAK B;  4EDY A;  3M1G A;  1MDI A;  3A2V A;  2JAC A;  4CY6 A;  1PGT A;  2H76 A;  1ZGN A;  1ERW A;  1MEK A;  5A34 A;  4V1A p;  3ZMK A;  2VCT A;  2C8U A;  4BA7 A;  3TRX A;  3F4S A;  4ID0 A;  1USB A;  4JR4 A;  2HRK B;  1GTI A;  1ZYP A;  1GL8 A;  2LQO A;  4I5Q A;  1FVJ A;  1NSW A;  3GV1 A;  4JBB A;  1SK1 A;  2HRA A;  2YZU A;  1YEX A;  3HA9 A;  4EDZ A;  3R2Q A;  2CAQ A;  2P31 A;  1K3O A;  3H93 A;  2LRN A;  4W66 A;  1CQG A;  4BVY B;  3TKQ A;  2C80 A;  1BAY A;  3DEX A;  1T4Y A;  1JFU A;  2OE1 A;  4XS4 B;  1XXU A;  3IHQ A;  1FOH A;  2LRT A;  2DC5 A;  3ERF A;  3L0H A;  4ZB8 A;  2RUE A;  2VOC A;  5IPG A;  2WZS A;  3KIJ A;  2XPD A;  5F07 A;  1O6J A;  1PRX A;  1FG4 A;  5INY A;  2WW3 A;  3QR6 A;  2ALB A;  5HFK A;  3GTU B;  4ECJ A;  1A2M A;  4F0C A;  5KN1 A;  1NM3 A;  2AHE A;  3EUR A;  4GF0 A;  4AKI A;  4K0G A;  2IJY A;  1M3I A;  3UVT A;  3L9S A;  3D21 A;  5B8B A;  1GUM A;  2WZ9 A;  2BJX A;  2BTO T;  3FYG A;  2YWN A;  5ECH B;  4TR1 B;  3ME8 A;  1X5D A;  3TOT A;  1AQW A;  1U3A A;  2H0H A;  2QA2 A;  2ZUP A;  1GNE A;  2C3Q A;  1K0B A;  3R3E A;  1SJI A;  2DLX A;  4D73 A;  3Q6O A;  2JAD A;  4MZW A;  4F03 A;  5GAN D;  3GH9 A;  2OE3 A;  1DSB A;  2MBT A;  3TKS A;  4PNG A;  5D9V A;  5J3R A;  1ON4 A;  4J57 E;  4BVX B;  3U5R E;  2C3T A;  1ZL9 A;  3C7M A;  3GKX A;  1GLQ A;  3VK9 A;  2R0P A;  5A1N A;  2CZ2 A;  6GSY A;  14GS A;  3C8E A;  2XPE A;  12GS A;  2I81 A;  1TRU A;  3LQ7 A;  1YF1 A;  4BVX A;  2ZNM A;  3G7Y A;  3Q18 A;  4HJM A;  1WP0 A;  5EL8 A;  5KOW A;  2WB9 A;  2LQQ A;  3ZIJ A;  1UVZ A;  1XWB A;  3BCK A;  5JCW A;  1YVL A;  1GUK A;  1K3Y A;  5L71 A;  3H4K A;  4POL A;  4QQ7 A;  4RQR A;  2UZ8 A;  2X49 A;  4MA9 A;  2DBC A;  1XCC A;  4QL7 A;  4TXV A;  4EKZ A;  4IHU A;  5F06 A;  2EC4 A;  3VWW A;  2VD0 A;  4IKH A;  5ECM B;  4E8E A;  3BJ5 A;  2I1U A;  4WEY A;  4ECB A;  3APQ A;  5IPH A;  2P0G A;  3I69 A;  1Z7P A;  4LLR A;  5G1L A;  3FW2 A;  6GSU A;  5DJM A;  5GZZ B;  2CX4 A;  5JWR B;  4G2E A;  1X5E A;  2TRC P;  2EIO A;  1V57 A;  2H1B A;  2OA7 A;  3TJJ A;  2JSZ A;  2H75 A;  4RI6 A;  4DSS B;  1TP9 A;  2O3E A;  1U87 A;  5F8B A;  4QL9 A;  5ECK B;  3FKF A;  4K5S A;  2L6C A;  3RHC A;  4LMV A;  5B6N A;  5HR1 A;  5G1K A;  5B8A A;  2KP2 A;  1O85 A;  4MJA A;  4DSS A;  1F3A A;  9GSS A;  3GMF A;  3HHV A;  1W4V A;  4K2D A;  4TN8 A;  2GSR A;  2VCZ A;  3LW9 A;  4GQC A;  1X9S B;  1FAA A;  3EIN A;  3ME7 A;  2IN3 A;  2V6K A;  4V2N A;  1EWX A;  5JCU A;  4ZL7 A;  2HQT A;  4WXT A;  5F0G A;  1KTE A;  4X1U A;  2EFD A;  1TJD A;  4Z2R A;  4AGS A;  4GTU A;  3HVS A;  1M9A A;  3LG6 A;  2REM A;  4ACS A;  1FB0 A;  2DJ1 A;  3GH6 A;  1BQ7 A;  18GS A;  4A5P A;  1CQH A;  3P7X A;  1MDJ A;  2K18 A;  2E2M A;  4AKX B;  3EPT A;  4ZBB A;  5KEJ A;  1O7U A;  2FWF A;  2EFE A;  2X8H A;  3PIN A;  2IFQ A;  4K7N A;  4IGJ A;  4NHZ A;  1F3B A;  4E68 A;  1M2B A;  3H79 A;  2LTK A;  4JRR A;  3DVW A;  5HFG A;  3FZA A;  4EE0 A;  4RQX A;  2GSS A;  1GRX A;  1TRW A;  5GST A;  3TRP A;  2OE0 A;  2TRX A;  4HUA A;  3S9F A;  2H1D A;  5ID2 B;  1I9D A;  1SD9 A;  4TOP A;  2PER A;  4OD7 A;  4X4J A;  1VF2 A;  5LNK e;  4HDE A;  3UMA A;  5ECR B;  1FB6 A;  3FK8 A;  1GSY A;  4WF4 A;  3EU3 A;  5G30 A;  4K8M A;  5JWO B;  5ID2 A;  6GSV A;  3VPQ A;  2OT3 A;  2JSY A;  3RAZ A;  5J4Y A;  3TJB A;  2YWI A;  4BL7 B;  1YF0 A;  1WOU A;  4ZB7 A;  2GT5 A;  5ECI B;  1AC1 A;  1AUC A;  3CSH A;  1GTU A;  2IMI A;  4PGT A;  3GST A;  3GIX A;  2EIQ A;  20GS A;  4L8E A;  1PKZ A;  4KX4 A;  10GS A;  3AY8 A;  1PMT A;  1TXX A;  2O89 A;  1M7T A;  2O5V A;  3CXG A;  4IBP A;  2MMA A;  2CT6 A;  3O3T A;  4ZXG A;  2L59 A;  1ERU A;  1EOH A;  3IHG A;  2GT6 A;  3NIV A;  5B6M A;  4Z2T A;  1XVW A;  2KUC A;  2LUS A;  1U6T A;  3M3M A;  1ACV A;  4K5R A;  3CWG A;  1OC9 A;  4LL1 B;  1XWG A;  6GSX A;  5ECP B;  4AJ8 A;  4MPG A;  4HSC X;  4BWQ A;  1LJR A;  3IRA A;  2R0G A;  1TI3 A;  3VWV A;  1XIY A;  1HNA A;  1OKT A;  3ZRD A;  3QOU A;  4QMK A;  3EVI A;  1F37 A;  2WCI A;  2HSH A;  3P90 A;  4MJC A;  4V2M A;  3I43 A;  4L0U A;  2VCQ A;  4GWR A;  4EIP A;  1VGL A;  2EIR A;  4KSM A;  2FUG 2;  5COH A;  5DQS A;  5CYY A;  4ULX A;  2H6Y A;  3PR8 A;  4X0X A;  2DIZ A;  2Z9S A;  2MMN A;  2GS3 A;  3FY7 A;  4POM A;  5IMD A;  1F6M C;  2WRT A;  4KA0 A;  5HR2 A;  2H71 A;  2M72 A;  3EMX A;  2VCX A;  2DJ3 A;  1HNB A;  2H66 A;  3WD6 A;  3GX0 A;  1T3B A;  3KTL A;  2O8V B;  2PN8 A;  4V2L A;  2H8L A;  2GZZ A;  1UN2 A;  3IBH A;  2WFC A;  2MZC A;  2YNX A;  5IOW A;  4NV5 A;  4Z7X A;  3TGZ A;  1YEP A;  4HOJ A;  2YWM A;  3WT1 A;  4LL4 B;  1O81 A;  2AV4 A;  3TB2 A;  2LST A;  5G5F A;  4MCU A;  5FHI A;  4YQV A;  2A4V A;  3TJF A;  2J9H A;  1GSF A;  1A24 A;  3DXB A;  2VL2 C;  1KNG A;  3HVV A;  4K9Z A;  4XRA A;  1T4Z A;  3W6G A;  2I3Y A;  3HYP A;  5A4V A;  2A2S A;  1PN9 A;  1WRY A;  4IEL A;  1ZYQ B;  2VLT A;  2DML A;  1U88 A;  2HLS A;  4YKF A;  3VI7 A;  4FXY P;  2HSN A;  1K3L A;  2GZY A;  1A23 A;  2F8A A;  7GSS A;  3GUS A;  1TRV A;  2LKU A;  3HMJ G;  4KW6 A;  2R6K A;  4MK3 A;  4KDU A;  4GRF A;  4PI0 C;  2FWE A;  2H73 A;  2LRC A;  1EEM A;  1B8X A;  4CY8 A;  5CRD A;  4P3Y B;  4XCS A;  4HU7 A;  4Q5N A;  4USS A;  3UVH A;  1JZR A;  4O5R A;  4ZB6 A;  4I97 A;  1K0M A;  5IOX A;  1YJ6 A;  5CRW A;  1YY7 A;  1YKA A;  2GZP A;  3QAV A;  4ILF A;  2H6X A;  1X9W B;  3A2X A;  2BMX A;  2XBI A;  2HZF A;  2C0G A;  1EEJ A;  5DAK A;  1A2J A;  2X64 A;  3L9V A;  4IP1 A;  5BRT A;  4G10 A;  3QAG A;  3KP8 A;  5CRG A;  3IA1 A;  5CAX A;  1SVL A;  1Q98 A;  3DWV A;  1M2D A;  2M80 A;  5ELA A;  1J9B A;  3A2W A;  2HRK A;  5J4U A;  3CSI A;  5HQP A;  3QCP A;  3CRT A;  4TRX A;  1ERV A;  4IS0 A;  4Q5F A;  1URM A;  3QFA C;  2R0C A;  1TK0 B;  1Q4J A;  1WJK A;  3GA4 A;  2GQM A;  2F51 A;  4FYU A;  3TKS E;  1H4O A;  4WET A;  4KAE A;  4GLT A;  1O8W A;  3IC8 A;  4K7O A;  5JCG A;  5ECL B;  4BVY A;  1A0F A;  3FZ5 A;  2FA8 A;  1R26 A;  4K7I A;  4CDO A;  2GST A;  3VFI A;  3FEU A;  5D9W A;  4KDY A;  2AUV A;  1Z3E A;  1TDI A;  3D22 A;  4XS4 A;  4MAB A;  4KND A;  2QSI A;  1XWK A;  4K6X A;  5ECQ B;  1QUW A;  3RFR C;  1BX9 A;  3I6A A;  1HNC A;  1K0N A;  3D4T A;  4EO3 A;  5GAP D;  5B7C A;  3M0F A;  2E7P A;  1TI1 A;  1VF1 A;  3VWU A;  3GTU A;  4EVM A;  4XRD A;  2HRF A;  3F6F A;  5GSS A;  2DKH A;  4Z2U A;  2LNS A;  3UOM A;  2UV8 G;  2ES7 A;  3KCM A;  5J47 A;  4I2U A;  4PQ1 A;  2NTO A;  3LYK A;  2P5Q A;  5G5E A;  4GSS A;  1FO5 A;  4TR1 A;  5HR3 A;  4BWS A;  2B5X A;  2YV7 A;  2MYG A;  1BED A;  4MH3 A;  3LSZ A;  4EL1 A;  3KXO A;  1N25 A;  1EV4 A;  2R3X A;  5A5K A;  4N3Z A;  4OFM A;  4BPY A;  2GDR A;  1S3D A;  3TCO A;  1AQV A;  3W8S A;  2H01 A;  3F9U A;  4HZ2 A;  3TOU A;  5IMF A;  3ZRE A;  4KH7 A;  2L6D A;  2GVP A;  3KH7 A;  3SBC A;  2VCV A;  4OCF A;  4NV2 A;  4G0K A;  3UBK A;  2R5G A;  1SKR B;  2RLI A;  2GLR A;  2GTU A;  4NPB A;  5DJL A;  3QD9 A;  2I9H A;  4JU5 A;  3MAK A;  5HFI A;  1S3A A;  3MIX A;  1OVN A;  2XC2 A;  3FMW A;  3F0I A;  3A3T A;  4TW5 A;  2G2Q A;  2KOK A;  2B6M A;  3RGB C;  1GSS A;  2VM2 A;  3VPT A;  4YAP A;  3F63 A;  5IMC A;  1XVQ A;  1TXU A;  4G19 A;  3DIE A;  3D0Z A;  3LXZ A;  2CVD A;  2LNT A;  1GSQ A;  1O73 A;  4MDC A;  4EIQ A;  5HR0 A;  1XPV A;  1K0D A;  2H0I A;  3CTF A;  3ERW A;  4ZL8 A;  2FCH A;  4N11 A;  2WDU A;  3ERG A;  3CHX C;  5H5Q A;  1YEW C;  4J2F A;  1V58 A;  1Z5Y E;  4KE3 A;  2FHE A;  4IQA A;  1W89 A;  5DDL A;  4JED A;  4J56 E;  4POK A;  3ZIV A;  1GSU A;  4G9H A;  2FA4 A;  1EZK A;  2O87 A;  4TR3 A;  3L4N A;  2I4A A;  5D9X A;  3L9U A;  5AIX A;  1RK4 A;  4RI7 A;  4EF0 A;  2PPT A;  2OAC A;  2B1K A;  2CVK A;  4MF7 A;  3IAS 2;  4JE1 A;  1SYX A;  1SYR A;  5A4W A;  2L4C A;  5IM9 A;  1SL1 B;  4MNN A;  19GS A;  3HZ4 A;  4PHZ C;  1Y1U A;  4KCA A;  3CMI A;  1N2A A;  2AB6 A;  1SKS B;  1J0F A;  2B7K A;  3RHB A;  1AW9 A;  2V1M A;  13GS A;  2E2G A;  3EMP A;  3QMX A;  3M8N A;  3HXS A;  3RPP A;  3GRX A;  2CX3 A;  2LS5 A;  4AF2 A;  5AGY A;  2OJL A;  4K2X A;  3BD2 A;  2ON5 A;  1MD3 A;  4ZBA A;  2WVX B;  5A5H B;  2WVZ A;  5IMV A;  3GYK A;  4ZIJ A;  3JCM L;  1XOA A;  3VUR A;  3CYN A;  3LYP A;  1ZYE A;  2V2G A;  2H0G A;  3APS A;  3MDK A;  2N5B A;  1FW1 A;  2C3N A;  2HE3 A;  3N5O A;  2WVX A;  3PH9 A;  5A5H A;  1EGR A;  2ON7 A;  5KOX A;  3WYW A;  1K0C A;  1I1I P;  4EUY A;  3ZVJ A;  1GUH A;  2C0D A;  3N9J A;  3F3Q A;  3GKM A;  2CV4 A;  1GTA A;  4N0Z A;  3GNJ A;  4IW9 A;  2EFH A;  1JZW A;  3PPU A;  4ML6 A;  4I2T A;  1UC7 A;  4YQU A;  3IPZ A;  2A4H A;  1E2Y A;  2OAD A;  3ZIT A;  1KEB A;  16GS A;  1TRS A;  2H19 A;  4PX1 A;  3GSS A;  2GQK A;  2LEG A;  3QAW A;  6GSS A;  5CRH A;  4EXJ A;  3TJK A;  8GSS A;  4IJI A;  4I6X A;  2X99 A;  4KGI A;  4HS1 A;  3D6I A;  2QGV A;  5AN1 A;  3LOR A;  3EYT A;  4FYB A;  3UAP A;  3HZ8 A;  3F4R A;  2WW2 A;  1YDK A;  5LD0 A;  2X8G A;  3GL5 A;  1GLP A;  4HI7 A;  2WS2 A;  1M9B A;  3P8W A;  4BL7 A;  4TVE A;  2NBS A;  1WIK A;  5J9B A;  2PVQ A;  3ZFL A;  2VL2 A;  1GUL A;  1RQM A;  5J4V A;  4F9Z A;  5IO2 A;  5J40 A;  3IR4 A;  2RM6 A;  1R5P A;  2YWO A;  2A2P A;  3EU4 A;  4O32 A;  2DJ2 A;  1XG8 A;  3CQF A;  2OKA A;  2FWH A;  2YJ7 A;  5EPF A;  2HXK A;  3CBU A;  1ERT A;  1SVO A;  3NZN A;  5G2Z A;  4Q5R A;  3KZQ A;  3HJO A;  3LXT A;  2IIY A;  1OKD A;  3BOA A;  1DE1 A;  1ZYN A;  3M9K A;  4TXO B;  3VWX A;  2LJK A;  3DD3 A;  1FOV A;  2WUL A;  3F8U A;  4MZC A;  4JZQ A;  2WW1 A;  5JWQ B;  2YV9 A;  4POB A;  4XIH A;  3FZ4 A;  5DQY A;  2MMO A;  5CO3 A;  1AAZ A;  2DIY A;  2ZCT A;  1GSD A;  3G7I A;  1F9M A;  4MMM A;  3TKR A;  1A2L A;  1TTZ A;  1SL2 B;  2H30 A;  3C71 A;  2DJK A;  2FWG A;  1OC8 A;  4PUF C;  5J41 A;  2PGT A;  1G6Y A;  3F6D A;  1M0U A;  1RW1 A;  3ISO A;  4XHM A;  2NVL A;  4FQU A;  2E0Q A;  1SVM A;  2KLX A;  4AJ7 A;  4KF9 A;  4OFN A;  3O76 A;  2G0F A;  1B4P A;  1SJ6 A;  3K8N A;  1G6W A;  3KEB A;  2XBQ A;  4ECI A;  1R7H A;  3QPM A;  5D96 A;  1T7P B;  2JZS A;  3P2A A;  4MH2 A;  1YKC A;  1BJX A;  2WVY A;  1Z6M A;  1XWC A;  3TDG A;  1NW2 A;  2IL3 A;  2CZ3 A;  2B5Y A;  1EV9 A;  5D73 A;  4O92 A; 
#chains in the Genus database with same CATH homology
 4CHS A;  3M9J A;  3EWL A;  1PA3 A;  3A5W A;  1TK5 B;  3HKR A;  5DAL B;  5IIZ A;  2IME A;  1SU9 A;  1B4Q A;  4XTS A;  3CSJ A;  4MZB A;  1TOF A;  1TKD B;  3D5J A;  5ECS A;  1Z6N A;  1BG5 A;  1ZOF A;  4YQM A;  1QMV A;  4GSN A;  3W8J A;  5DAL A;  3ZLP A;  1TU7 A;  3IXR A;  2JL4 A;  2MMZ A;  3G9B A;  2F9S A;  3FR9 A;  4YAV A;  3Q74 A;  1HYU A;  3MWH A;  3HVX A;  1XW5 A;  2D2Z A;  4G0I A;  2B7J A;  4HQS A;  4KB3 A;  1FHE A;  3ZML A;  4N30 A;  2EFC A;  2YAN A;  4TKY A;  1PX7 A;  2CAI A;  2H70 A;  3IK7 A;  3H8Q A;  2C0E A;  2RM5 A;  3C1S A;  1M2A A;  4PXO A;  2K9F A;  2VL3 A;  2VLV A;  2YCD A;  1QGV A;  4L5L A;  3HDC A;  4YH2 A;  4F82 A;  1G7E A;  2YP6 A;  1GH2 A;  1V40 A;  5KN2 A;  3CRU A;  2DJJ A;  3D4M A;  4PUR A;  4WBR D;  1Y6E A;  5AIV A;  4PTS A;  5D93 A;  4NWY A;  2IMK A;  1NHO A;  3IOS A;  3WGE A;  2QKE A;  1O8X A;  3I9V 2;  4G0L A;  3C73 A;  1MTC A;  3RPN A;  1B48 A;  1MD4 A;  5H5R A;  1AXD A;  5F05 A;  4ML1 A;  2OBK A;  2NDO A;  1I5G A;  5H5S A;  2M46 A;  4ZBD A;  4DEJ A;  1SEN A;  4ICY A;  4D73 B;  1GNW A;  1U3I A;  3GFK A;  4X43 A;  3ZVJ D;  2MBS A;  3DKS A;  2CQ9 A;  3HY2 A;  1THX A;  3HD5 A;  2X4A A;  4XS6 A;  4TR4 A;  1SK0 A;  2TIR A;  5A4U A;  2L5O A;  4HZ4 A;  3MNG A;  2H1A A;  3TJG A;  1SJZ A;  6GST A;  4RUV A;  4MLY A;  3VLN A;  3GKK A;  1AIU A;  1J08 A;  1THO A;  2YJH A;  1DUG A;  3GL3 A;  2HYX A;  5ELG A;  3RBT A;  5BMU B;  2VAF A;  5A1N B;  2FLS A;  4KCE A;  2L4Q A;  4Q5Q A;  2PBJ A;  1LBK A;  1IYI A;  4O5Q A;  1N8J A;  3KD0 A;  4FH8 A;  2FNO A;  2R4V A;  2K6V A;  3UJ1 A;  1SL0 B;  3FR3 A;  2PU9 C;  1K0A A;  5BMU A;  2A2R A;  3UEM A;  1WE0 A;  3KMO A;  1B9Y C;  3ZL5 A;  2AAW A;  1EP8 A;  2DMM A;  4IP6 A;  1BYE A;  1G0T A;  3ZFB A;  2VUP A;  3GKN A;  1H75 A;  3LGC A;  4XS1 A;  5LCZ A;  1PL1 A;  4E8H A;  2FD3 A;  4O7H A;  4CW9 A;  3SWL A;  2PMT A;  2KHP A;  4KSO A;  3V1W A;  3LJR A;  3QFB C;  3IDV A;  2PUK C;  5J5N A;  4KUN A;  5EY6 A;  2H72 A;  2B3S A;  4I8B A;  3KP9 A;  2C1Y A;  3DRN A;  1SKW B;  1GWC A;  2HZE B;  3FZ9 A;  2B5E A;  4WKW A;  4L5O A;  4WR5 A;  4WBJ A;  2HNL A;  4PUA A;  2QA1 A;  2JU5 A;  2WGR A;  2YPM A;  5D9T A;  4ISD A;  1JZD A;  1PKW A;  3IC4 A;  2VIM A;  3NOF A;  4JR6 A;  3KGK A;  4IVF A;  5KN0 A;  1TU8 A;  5DVB A;  1JLV A;  2HZE A;  2DSA A;  2V41 A;  1TK8 B;  2WJU A;  1PX6 A;  4AKH A;  2IPA A;  1V2A A;  1JHB A;  1VF4 A;  3FHK A;  1TW9 A;  3TRQ A;  1QQ2 A;  4L0W A;  1JLW A;  1PL2 A;  2CA8 A;  4PQH A;  5E59 A;  1OAZ A;  3WGX A;  3VI5 A;  3KTB A;  3TKS C;  5KN3 A;  1LU4 A;  5CP1 A;  2B1L A;  5C00 A;  2F8F A;  1WWJ A;  4DSR A;  1M99 A;  4AI6 A;  1F2E A;  5IMA A;  4OWY A;  1EOG A;  3KJY A;  2XHF A;  1YZX A;  2X8C A;  1YQ1 A;  4DSQ A;  1T00 A;  2K8S A;  3EE2 A;  4ECC A;  2DKI A;  3DML A;  2R37 A;  1DBY A;  3E3E A;  1E6B A;  1V98 A;  2IMD A;  1Z9H A;  4TR0 A;  5DCH A;  4G01 A;  2JZR A;  4ZL9 A;  1R5A A;  2LV3 A;  4N10 A;  2RUF A;  5DBQ A;  2RII A;  4AJ6 A;  1XZO A;  3HJP A;  3LEF A;  2IFQ B;  2GSQ A;  2V32 A;  4WF5 A;  3G7J A;  2N5F A;  4V1A g;  3ZYW A;  2PWJ A;  1GSE A;  4O5U A;  5ECN B;  3KH9 A;  4LA1 A;  2KP1 A;  2HSY A;  1SK2 A;  2YOI A;  5D8I A;  1QK8 A;  1AQX A;  4YKG A;  1Z7R A;  3GN3 A;  2LJA A;  1UA5 A;  2NPB A;  1GP1 A;  2FY6 A;  2N5A A;  5ABR A;  1KBN A;  2GQL A;  2C4J A;  4HEA 2;  3C1R A;  1GTB A;  3GUR A;  4GXZ A;  4NMU A;  2YN1 A;  3UAR A;  1T1V A;  5ENU A;  1K0O A;  1PD2 1;  4ZIL A;  2AYT A;  2C0F A;  2OBI A;  1QXH A;  3DYR A;  2IWT A;  1A0R P;  3DVX A;  5C04 A;  4NAX A;  1OE8 A;  2VL9 A;  3J7Y k;  4MJB A;  4MF6 A;  5J9C A;  5E4W A;  1VRS D;  1WPI A;  3PGT A;  4OO4 A;  4OCE A;  5CRE A;  4IN0 A;  4HU9 A;  3EC3 A;  1ABA A;  2HI7 A;  1B9X C;  17GS A;  4MPF A;  2CVB A;  3MSZ A;  3E0U A;  3UL3 A;  1EGO A;  1BF5 A;  1JZO A;  2K8V A;  4GST A;  2J23 A;  2L57 A;  3KM6 A;  3IK9 A;  1Y25 A;  6GSW A;  4IQ1 A;  3E9J B;  3A5I A;  1HQO A;  4KDX A;  3IAM 2;  4FIW A;  2H1G A;  2YZH A;  3UBL A;  2QC7 A;  4FYC A;  2IMF A;  1DE2 A;  1OC9 B;  1ZMA A;  3RDW A;  1C72 A;  3FR6 A;  4OMV A;  3APO A;  1XFL A;  2JZT A;  1XW6 A;  4ZB9 A;  4F2I A;  4NHW A;  2VO4 A;  1OYJ A;  3FRC A;  4WR4 A;  3TUE A;  1A8L A;  4K0N A;  3WT2 A;  3TKP A;  3MYD A;  1X5C A;  3UIW A;  2H6Z A;  3HJM A;  1BG1 A;  1OC3 A;  1ILO A;  2H74 A;  4TXO A;  5IO0 A;  1G7O A;  22GS A;  3CTG A;  1T8E B;  3LFL A;  4NXI A;  1A8Y A;  1HD2 A;  3GX8 A;  2O85 A;  3QDN A;  3H1N A;  2VLU A;  3ED3 A;  5EVO A;  4DVC A;  2VD1 A;  2O7K A;  2GGT A;  4AKG A;  3J7Y b;  4N0V A;  2V6O A;  3TU3 B;  4OO5 A;  4PNF A;  3DGQ A;  3L78 A;  2HFD A;  3ZTL A;  4GCI A;  5IQY A;  3ZZX A;  2AJQ B;  4HQZ A;  4MP4 A;  1XBS A;  4EC0 A;  2L5L A;  4GQF A;  4PQI A;  1V9W A;  5CNW A;  1SD8 A;  1PSQ A;  2HSM B;  3HCZ A;  4GDF A;  3U6V A;  1ZCP A;  3F4T A;  4IJ3 A;  4MJE A;  11GS A;  2DJ0 A;  3GHA A;  3US3 A;  4H86 A;  1MDK A;  2P5R A;  2HSN B;  1ZZY A;  2F3M A;  1EP7 A;  1QFN A;  2HSM A;  1NHY A;  3IE3 A;  3KMN A;  1X9M B;  4FO5 A;  1PQN A;  1IYH A;  3BBY A;  1S3C A;  5FT3 A;  3F3R A;  4F0B A;  5FWG A;  1XOB A;  2H1L A;  2VM1 A;  5IMZ A;  3Q19 A;  5ECO B;  1XWA A;  1FVK A;  3LWA A;  1ST9 A;  4LMW A;  1X0R A;  2LJR A;  2PVO C;  1OE7 A;  2R2J A;  2HRN A;  2HT9 A;  4OFT A;  3O6T A;  4HJ2 A;  5DCG A;  1PN0 A;  2FGX A;  2VKZ G;  3BCI A;  1ML6 A;  5AIS A;  3OR5 A;  4MF5 A;  5A34 B;  2VCW A;  4K1F A;  1XW9 A;  3IV4 A;  3WGD A;  1WMJ A;  1R4W A;  5G31 A;  1VF3 A;  5DAK B;  4EDY A;  3M1G A;  1MDI A;  3A2V A;  2JAC A;  4CY6 A;  1PGT A;  2H76 A;  1ZGN A;  1ERW A;  1MEK A;  5A34 A;  4V1A p;  3ZMK A;  2VCT A;  2C8U A;  4BA7 A;  3TRX A;  3F4S A;  4ID0 A;  1USB A;  4JR4 A;  2HRK B;  1GTI A;  1ZYP A;  1GL8 A;  2LQO A;  4I5Q A;  1FVJ A;  1NSW A;  3GV1 A;  4JBB A;  1SK1 A;  2HRA A;  2YZU A;  1YEX A;  3HA9 A;  4EDZ A;  3R2Q A;  2CAQ A;  2P31 A;  1K3O A;  3H93 A;  2LRN A;  4W66 A;  1CQG A;  4BVY B;  3TKQ A;  2C80 A;  1BAY A;  3DEX A;  1T4Y A;  1JFU A;  2OE1 A;  4XS4 B;  1XXU A;  3IHQ A;  1FOH A;  2LRT A;  2DC5 A;  3ERF A;  3L0H A;  4ZB8 A;  2RUE A;  2VOC A;  5IPG A;  3KIJ A;  2XPD A;  5F07 A;  1O6J A;  1PRX A;  1FG4 A;  5INY A;  3QR6 A;  2ALB A;  5HFK A;  3GTU B;  4ECJ A;  1A2M A;  4F0C A;  5KN1 A;  1NM3 A;  2AHE A;  3EUR A;  4GF0 A;  4AKI A;  4K0G A;  2IJY A;  3UVT A;  3L9S A;  3D21 A;  5B8B A;  1GUM A;  2WZ9 A;  2BJX A;  2BTO T;  3FYG A;  2YWN A;  5ECH B;  4TR1 B;  3ME8 A;  1X5D A;  3TOT A;  1AQW A;  1U3A A;  2H0H A;  2QA2 A;  2ZUP A;  1GNE A;  2C3Q A;  1K0B A;  3R3E A;  1SJI A;  2DLX A;  4D73 A;  3Q6O A;  2JAD A;  4MZW A;  4F03 A;  5GAN D;  3GH9 A;  2OE3 A;  1DSB A;  2MBT A;  3TKS A;  4PNG A;  5D9V A;  5J3R A;  1ON4 A;  4J57 E;  4BVX B;  3U5R E;  2C3T A;  1ZL9 A;  3C7M A;  3GKX A;  1GLQ A;  3VK9 A;  2R0P A;  5A1N A;  2CZ2 A;  6GSY A;  14GS A;  3C8E A;  2XPE A;  12GS A;  2I81 A;  1TRU A;  3LQ7 A;  1YF1 A;  4BVX A;  2ZNM A;  3G7Y A;  3Q18 A;  4HJM A;  1WP0 A;  5EL8 A;  5KOW A;  2WB9 A;  2LQQ A;  3ZIJ A;  1UVZ A;  1XWB A;  3BCK A;  5JCW A;  1YVL A;  1GUK A;  1K3Y A;  5L71 A;  3H4K A;  4POL A;  4QQ7 A;  4RQR A;  2UZ8 A;  2X49 A;  4MA9 A;  2DBC A;  1XCC A;  4QL7 A;  4TXV A;  4EKZ A;  4IHU A;  5F06 A;  2EC4 A;  3VWW A;  2VD0 A;  4IKH A;  5ECM B;  4E8E A;  3BJ5 A;  2I1U A;  4WEY A;  4ECB A;  3APQ A;  5IPH A;  2P0G A;  3I69 A;  1Z7P A;  4LLR A;  5G1L A;  3FW2 A;  6GSU A;  5DJM A;  5GZZ B;  2CX4 A;  5JWR B;  4G2E A;  1X5E A;  2TRC P;  2EIO A;  1V57 A;  2H1B A;  2OA7 A;  3TJJ A;  2JSZ A;  2H75 A;  4RI6 A;  4DSS B;  1TP9 A;  1U87 A;  5F8B A;  4QL9 A;  5ECK B;  3FKF A;  4K5S A;  2L6C A;  3RHC A;  4LMV A;  5B6N A;  5HR1 A;  5G1K A;  5B8A A;  2KP2 A;  1O85 A;  4MJA A;  4DSS A;  1F3A A;  9GSS A;  3GMF A;  3HHV A;  1W4V A;  4K2D A;  4TN8 A;  2GSR A;  2VCZ A;  3LW9 A;  4GQC A;  1X9S B;  1FAA A;  3EIN A;  3ME7 A;  2IN3 A;  2V6K A;  4V2N A;  1EWX A;  5JCU A;  4ZL7 A;  2HQT A;  4WXT A;  5F0G A;  1KTE A;  4X1U A;  2EFD A;  1TJD A;  4Z2R A;  4AGS A;  4GTU A;  3HVS A;  1M9A A;  3LG6 A;  2REM A;  4ACS A;  1FB0 A;  2DJ1 A;  3GH6 A;  1BQ7 A;  18GS A;  4A5P A;  1CQH A;  3P7X A;  1MDJ A;  2K18 A;  2E2M A;  4AKX B;  3EPT A;  4ZBB A;  5KEJ A;  1O7U A;  2FWF A;  2EFE A;  2X8H A;  3PIN A;  2IFQ A;  4K7N A;  4IGJ A;  4NHZ A;  1F3B A;  4E68 A;  1M2B A;  3H79 A;  2LTK A;  4JRR A;  3DVW A;  5HFG A;  3FZA A;  4EE0 A;  4RQX A;  2GSS A;  1GRX A;  1TRW A;  5GST A;  3TRP A;  2OE0 A;  2TRX A;  4HUA A;  3S9F A;  2H1D A;  5ID2 B;  1I9D A;  1SD9 A;  4TOP A;  2PER A;  4OD7 A;  4X4J A;  1VF2 A;  5LNK e;  4HDE A;  3UMA A;  5ECR B;  1FB6 A;  3FK8 A;  1GSY A;  4WF4 A;  3EU3 A;  5G30 A;  4K8M A;  5JWO B;  5ID2 A;  6GSV A;  3VPQ A;  2OT3 A;  2JSY A;  3RAZ A;  5J4Y A;  3TJB A;  2YWI A;  4BL7 B;  1YF0 A;  1WOU A;  4ZB7 A;  2GT5 A;  5ECI B;  1AC1 A;  1AUC A;  3CSH A;  1GTU A;  2IMI A;  4PGT A;  3GST A;  3GIX A;  2EIQ A;  20GS A;  4L8E A;  1PKZ A;  4KX4 A;  10GS A;  3AY8 A;  1PMT A;  1TXX A;  2O89 A;  1M7T A;  2O5V A;  3CXG A;  4IBP A;  2MMA A;  2CT6 A;  3O3T A;  4ZXG A;  2L59 A;  1ERU A;  1EOH A;  3IHG A;  2GT6 A;  3NIV A;  5B6M A;  4Z2T A;  1XVW A;  2KUC A;  2LUS A;  1U6T A;  3M3M A;  1ACV A;  4K5R A;  3CWG A;  1OC9 A;  4LL1 B;  1XWG A;  6GSX A;  5ECP B;  4AJ8 A;  4MPG A;  4BWQ A;  1LJR A;  3IRA A;  2R0G A;  1TI3 A;  3VWV A;  1XIY A;  1HNA A;  1OKT A;  3ZRD A;  3QOU A;  4QMK A;  3EVI A;  1F37 A;  2WCI A;  2HSH A;  3P90 A;  4MJC A;  4V2M A;  3I43 A;  4L0U A;  2VCQ A;  4GWR A;  4EIP A;  1VGL A;  2EIR A;  4KSM A;  2FUG 2;  5COH A;  5DQS A;  5CYY A;  4ULX A;  2H6Y A;  3PR8 A;  4X0X A;  2DIZ A;  2Z9S A;  2MMN A;  2GS3 A;  3FY7 A;  4POM A;  5IMD A;  1F6M C;  2WRT A;  4KA0 A;  5HR2 A;  2H71 A;  2M72 A;  3EMX A;  2VCX A;  2DJ3 A;  1HNB A;  2H66 A;  3WD6 A;  3GX0 A;  1T3B A;  3KTL A;  2O8V B;  2PN8 A;  4V2L A;  2H8L A;  2GZZ A;  1UN2 A;  3IBH A;  2WFC A;  2MZC A;  2YNX A;  5IOW A;  4NV5 A;  4Z7X A;  3TGZ A;  1YEP A;  4HOJ A;  2YWM A;  3WT1 A;  4LL4 B;  1O81 A;  2AV4 A;  3TB2 A;  2LST A;  5G5F A;  4MCU A;  5FHI A;  4YQV A;  2A4V A;  3TJF A;  2J9H A;  1GSF A;  1A24 A;  3DXB A;  2VL2 C;  1KNG A;  3HVV A;  4K9Z A;  4XRA A;  1T4Z A;  3W6G A;  2I3Y A;  3HYP A;  5A4V A;  2A2S A;  1PN9 A;  1WRY A;  4IEL A;  1ZYQ B;  2VLT A;  2DML A;  1U88 A;  2HLS A;  4YKF A;  3VI7 A;  2HSN A;  1K3L A;  2GZY A;  1A23 A;  2F8A A;  7GSS A;  3GUS A;  1TRV A;  2LKU A;  3HMJ G;  4KW6 A;  2R6K A;  4MK3 A;  4KDU A;  4GRF A;  2FWE A;  2H73 A;  2LRC A;  1EEM A;  1B8X A;  4CY8 A;  5CRD A;  4P3Y B;  4XCS A;  4HU7 A;  4Q5N A;  4USS A;  3UVH A;  1JZR A;  4O5R A;  4ZB6 A;  4I97 A;  1K0M A;  5IOX A;  1YJ6 A;  5CRW A;  1YY7 A;  1YKA A;  2GZP A;  3QAV A;  4ILF A;  2H6X A;  1X9W B;  3A2X A;  2BMX A;  2XBI A;  2HZF A;  2C0G A;  1EEJ A;  5DAK A;  1A2J A;  2X64 A;  3L9V A;  4IP1 A;  5BRT A;  4G10 A;  3QAG A;  3KP8 A;  5CRG A;  3IA1 A;  5CAX A;  1SVL A;  1Q98 A;  3DWV A;  1M2D A;  2M80 A;  5ELA A;  1J9B A;  3A2W A;  2HRK A;  5J4U A;  3CSI A;  5HQP A;  3QCP A;  3CRT A;  4TRX A;  1ERV A;  4IS0 A;  4Q5F A;  1URM A;  3QFA C;  2R0C A;  1TK0 B;  1Q4J A;  1WJK A;  3GA4 A;  2GQM A;  2F51 A;  4FYU A;  3TKS E;  1H4O A;  4WET A;  4KAE A;  4GLT A;  1O8W A;  3IC8 A;  4K7O A;  5JCG A;  5ECL B;  4BVY A;  1A0F A;  3FZ5 A;  2FA8 A;  1R26 A;  4K7I A;  4CDO A;  2GST A;  3VFI A;  3FEU A;  5D9W A;  4KDY A;  2AUV A;  1Z3E A;  1TDI A;  3D22 A;  4XS4 A;  4MAB A;  4KND A;  2QSI A;  1XWK A;  4K6X A;  5ECQ B;  1QUW A;  1BX9 A;  3I6A A;  1HNC A;  1K0N A;  3D4T A;  4EO3 A;  5GAP D;  5B7C A;  3M0F A;  2E7P A;  1TI1 A;  1VF1 A;  3VWU A;  3GTU A;  4EVM A;  4XRD A;  2HRF A;  3F6F A;  5GSS A;  2DKH A;  4Z2U A;  2LNS A;  3UOM A;  2UV8 G;  2ES7 A;  3KCM A;  5J47 A;  4I2U A;  4PQ1 A;  2NTO A;  3LYK A;  2P5Q A;  5G5E A;  4GSS A;  1FO5 A;  4TR1 A;  5HR3 A;  4BWS A;  2B5X A;  2YV7 A;  2MYG A;  1BED A;  4MH3 A;  3LSZ A;  4EL1 A;  3KXO A;  1N25 A;  1EV4 A;  2R3X A;  5A5K A;  4N3Z A;  4OFM A;  4BPY A;  2GDR A;  1S3D A;  3TCO A;  1AQV A;  3W8S A;  2H01 A;  3F9U A;  4HZ2 A;  3TOU A;  5IMF A;  3ZRE A;  4KH7 A;  2L6D A;  2GVP A;  3KH7 A;  3SBC A;  2VCV A;  4OCF A;  4NV2 A;  4G0K A;  3UBK A;  2R5G A;  1SKR B;  2RLI A;  2GLR A;  2GTU A;  4NPB A;  5DJL A;  3QD9 A;  2I9H A;  4JU5 A;  3MAK A;  5HFI A;  1S3A A;  3MIX A;  1OVN A;  2XC2 A;  3FMW A;  3F0I A;  3A3T A;  4TW5 A;  2G2Q A;  2KOK A;  2B6M A;  1GSS A;  2VM2 A;  3VPT A;  4YAP A;  3F63 A;  5IMC A;  1XVQ A;  1TXU A;  4G19 A;  3DIE A;  3D0Z A;  3LXZ A;  2CVD A;  2LNT A;  1GSQ A;  1O73 A;  4MDC A;  4EIQ A;  5HR0 A;  1XPV A;  1K0D A;  2H0I A;  3CTF A;  3ERW A;  4ZL8 A;  2FCH A;  4N11 A;  2WDU A;  3ERG A;  5H5Q A;  4J2F A;  1V58 A;  1Z5Y E;  4KE3 A;  2FHE A;  4IQA A;  1W89 A;  5DDL A;  4JED A;  4J56 E;  4POK A;  3ZIV A;  1GSU A;  4G9H A;  2FA4 A;  1EZK A;  2O87 A;  4TR3 A;  3L4N A;  2I4A A;  5D9X A;  3L9U A;  5AIX A;  1RK4 A;  4RI7 A;  4EF0 A;  2PPT A;  2OAC A;  2B1K A;  2CVK A;  4MF7 A;  3IAS 2;  4JE1 A;  1SYX A;  1SYR A;  5A4W A;  2L4C A;  5IM9 A;  1SL1 B;  4MNN A;  19GS A;  3HZ4 A;  1Y1U A;  4KCA A;  3CMI A;  1N2A A;  2AB6 A;  1SKS B;  1J0F A;  2B7K A;  3RHB A;  1AW9 A;  2V1M A;  13GS A;  2E2G A;  3EMP A;  3QMX A;  3M8N A;  3HXS A;  3RPP A;  3GRX A;  2CX3 A;  2LS5 A;  4AF2 A;  5AGY A;  2OJL A;  4K2X A;  3BD2 A;  2ON5 A;  1MD3 A;  4ZBA A;  5A5H B;  5IMV A;  3GYK A;  4ZIJ A;  3JCM L;  1XOA A;  3VUR A;  3CYN A;  3LYP A;  1ZYE A;  2V2G A;  2H0G A;  3APS A;  3MDK A;  2N5B A;  1FW1 A;  2C3N A;  2HE3 A;  3N5O A;  3PH9 A;  5A5H A;  1EGR A;  2ON7 A;  5KOX A;  3WYW A;  1K0C A;  4EUY A;  3ZVJ A;  1GUH A;  2C0D A;  3N9J A;  3F3Q A;  3GKM A;  2CV4 A;  1GTA A;  4N0Z A;  3GNJ A;  4IW9 A;  2EFH A;  1JZW A;  3PPU A;  4ML6 A;  4I2T A;  1UC7 A;  4YQU A;  3IPZ A;  2A4H A;  1E2Y A;  2OAD A;  3ZIT A;  1KEB A;  16GS A;  1TRS A;  2H19 A;  4PX1 A;  3GSS A;  2GQK A;  2LEG A;  3QAW A;  6GSS A;  5CRH A;  4EXJ A;  3TJK A;  8GSS A;  4IJI A;  4I6X A;  2X99 A;  4KGI A;  4HS1 A;  3D6I A;  2QGV A;  5AN1 A;  3LOR A;  3EYT A;  4FYB A;  3UAP A;  3HZ8 A;  3F4R A;  1YDK A;  5LD0 A;  2X8G A;  3GL5 A;  1GLP A;  4HI7 A;  2WS2 A;  1M9B A;  3P8W A;  4BL7 A;  4TVE A;  2NBS A;  1WIK A;  5J9B A;  2PVQ A;  3ZFL A;  2VL2 A;  1GUL A;  1RQM A;  5J4V A;  4F9Z A;  5IO2 A;  5J40 A;  3IR4 A;  2RM6 A;  1R5P A;  2YWO A;  2A2P A;  3EU4 A;  4O32 A;  2DJ2 A;  2OKA A;  2FWH A;  2YJ7 A;  5EPF A;  2HXK A;  3CBU A;  1ERT A;  1SVO A;  3NZN A;  5G2Z A;  4Q5R A;  3KZQ A;  3HJO A;  3LXT A;  2IIY A;  1OKD A;  3BOA A;  1DE1 A;  1ZYN A;  3M9K A;  4TXO B;  3VWX A;  2LJK A;  3DD3 A;  1FOV A;  2WUL A;  3F8U A;  4MZC A;  4JZQ A;  5JWQ B;  2YV9 A;  4POB A;  4XIH A;  3FZ4 A;  5DQY A;  2MMO A;  5CO3 A;  1AAZ A;  2DIY A;  2ZCT A;  1GSD A;  3G7I A;  1F9M A;  4MMM A;  3TKR A;  1A2L A;  1TTZ A;  1SL2 B;  2H30 A;  3C71 A;  2DJK A;  2FWG A;  1OC8 A;  4PUF C;  5J41 A;  2PGT A;  1G6Y A;  3F6D A;  1M0U A;  1RW1 A;  3ISO A;  4XHM A;  2NVL A;  4FQU A;  2E0Q A;  1SVM A;  2KLX A;  4AJ7 A;  4KF9 A;  4OFN A;  3O76 A;  2G0F A;  1B4P A;  1SJ6 A;  3K8N A;  1G6W A;  3KEB A;  2XBQ A;  4ECI A;  1R7H A;  3QPM A;  5D96 A;  1T7P B;  2JZS A;  3P2A A;  4MH2 A;  1YKC A;  1BJX A;  1Z6M A;  1XWC A;  3TDG A;  1NW2 A;  2IL3 A;  2CZ3 A;  2B5Y A;  1EV9 A;  5D73 A;  4O92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...