5A5HB

The crystal structure of the gst-like domains complex of eprs c92sc105sc123s mutant-aimp2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
210
Chain Sequence
LGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title The Crystal Structure of the Gst-Like Domains Complex of Eprs C92Sc105Sc123S Mutant-Aimp2
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 64
structure length 210
sequence length 210
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
B PF18569 Thioredoxin_16 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a5hB00
5A1NB 4W66A 5A34B 5A5HA 4ZB7A 4AKGA 5A5HB 4AI6A 5A34A 5BMUB 4AKIA 4AKHA 5A1NA
chains in the Genus database with same CATH superfamily
5F06A 6GSYA 5J4UA 2R6KA 3ZFLA 1BAYA 1YKCA 3CRTA 3RFRC 3VPTA 4YQUA 1GSQA 3EINA 9GSSA 2X64A 2AB6A 3PGTA 4GSTA 1E6BA 6GSVA 2CA8A 2WS2A 2O36A 4G0IA 3FRCA 3ERFA 2NTOA 1TU8A 4E68A 4QQ7A 1AQXA 2WVYA 4IVFA 1EV4A 4HZ4A 1GLQA 3R3EA 5ECOB 2GSTA 5ECMB 1YVLA 3GSSA 4L8EA 1FW1A 3WD6A 4GCIA 2WW3A 4I97A 4KAEA 3O76A 4N0VA 4IQ1A 4IBPA 4Q5FA 1VF1A 4KF9A 5GSTA 2HSMB 5LCZA 3ZMKA 1K3OA 4PX1A 1G7OA 2OACA 1GUKA 4LMVA 5AIVA 4ZBAA 2IMKA 3P90A 4YQMA 1F3BA 1XW5A 4MP4A 2ON5A 1GWCA 1PMTA 5HFKA 4ZB7A 4QMKA 1GSEA 3ZFBA 3F63A 2VD1A 3H1NA 1Y6EA 5DCGA 4IKHA 1FHEA 20GSA 1V40A 1YJ6A 4FQUA 5ECHB 4G9HA 2EFDA 4RI7A 5D9TA 4RI6A 22GSA 5G5EA 4E8HA 3M3MA 2WJUA 1BYEA 1K3YA 1GUMA 5ECSA 2WVXB 2HRKB 1K3LA 4LMWA 4IJIA 10GSA 1U88A 2YV7A 5A1NA 2IL3A 4DEJA 4KGIA 2F3MA 4MF6A 1HNAA 1N25A 4MZWA 5ECNB 5IQYA 1ZL9A 5DDLA 16GSA 3MDKA 2WVZA 2WZSA 1LJRA 4G01A 4ECIA 1F2EA 4BVYB 17GSA 5ECLB 2WB9A 3GSTA 4J2FA 3GUSA 4KH7A 4O92A 4EXJA 3IR4A 4JZQA 3HKRA 1EEMA 4ZB6A 1K0CA 4EE0A 5GSSA 5G5FA 1G6YA 1Y1UA 4G0KA 3GH6A 1BG1A 5EY6A 2VCWA 1RK4A 4GF0A 2C3NA 1PKWA 4KDUA 1GTAA 5DAKA 1K0OA 1XWGA 3Q74A 2PERA 1YEWC 2GSRA 4PTSA 4ECCA 3HJMA 4MF7A 2AAWA 1M0UA 6GSUA 2C3QA 3Q19A 4KE3A 4AKHA 1K0NA 1XWKA 2FNOA 4K0GA 3FR9A 2PVQA 3VPQA 1K0BA 3IE3A 3G7IA 3TU3B 4KDXA 1M99A 1DUGA 2CAIA 3IK7A 5EVOA 2YV9A 1GULA 1VF4A 4MPGA 3L0HA 4IGJA 3I6AA 3PPUA 2C4JA 18GSA 3FYGA 3CWGA 3ISOA 6GSSA 4PUAA 4ECBA 2WRTA 2WW0A 4GDFA 4YH2A 3CRUA 2WW1A 3LG6A 4G0LA 3I69A 5A4UA 5JCWA 5FWGA 1JLVA 3BBYA 1N2AA 1SVMA 5FHIA 1PA3A 4G19A 4F03A 1K0DA 5GZZB 1XW6A 2J9HA 4EDZA 1PX6A 1HNCA 1Z9HA 3FR3A 2OT3A 2GLRA 4WR5A 4GSSA 11GSA 4ISDA 4AI6A 2AHEA 2R4VA 5J4YA 3CSJA 1PX7A 1GNWA 1YQ1A 5ECQB 5A1NB 4GTUA 3GX0A 1K0AA 1USBA 4O7HA 5A34A 4PNFA 4ZBBA 1PL2A 3KJYA 1OKTA 2DSAA 4Q5NA 3UBLA 1ML6A 4PGTA 7GSSA 13GSA 5EL8A 3HJOA 4ZB8A 2H1LA 5D73A 3SWLA 3F6DA 1GTUA 2CZ2A 3QR6A 3KM6A 2DC5A 5ECPB 1AQVA 4WR4A 4AKIA 1B4PA 5BMUA 1U3IA 3VURA 1LBKA 1M9AA 5AN1A 5DAKB 4IW9A 5ECIB 12GSA 2VO4A 1JLWA 2OA7A 1PL1A 3CHXC 14GSA 2OADA 2PBJA 2GSQA 5FT3A 4EC0A 2C3TA 3LFLA 4ID0A 2VCTA 1TDIA 3UARA 1TXUA 2FHEA 5B7CA 1JZRA 2C8UA 3IC8A 4YQVA 3FR6A 3TOUA 1HNBA 2F8FA 2EFHA 3ERGA 3IK9A 1GLPA 1KBNA 5ECRB 4HJ2A 3KTLA 1GTIA 3M0FA 2PMTA 2ON7A 2IMIA 2HRAA 1AQWA 4W66A 5D9WA 5KEJA 5A5KA 2VCQA 4L5LA 1K0MA 4BL7A 3UVHA 1MD3A 2GDRA 4PQHA 4TOPA 4ZB9A 2EFCA 1IYIA 2UZ8A 4ACSA 4KDYA 4MDCA 1OE7A 6GSTA 1HQOA 2A2SA 5F07A 1AW9A 5AIXA 1ZGNA 3VWXA 1SVOA 1PKZA 3GTUA 1YY7A 1B48A 2O5VA 3PR8A 3LQ7A 2O3EA 5A4WA 1A0FA 1UA5A 5A5HA 4IS0A 2UV8G 3VI7A 19GSA 1GSFA 4K0NA 4OFMA 4KSMA 2WW2A 3N5OA 1GSDA 2HSNA 1TU7A 5ELAA 1BX9A 5LD0A 3UAPA 2GTUA 3DD3A 4GLTA 1GSYA 2VKZG 5A34B 1MTCA 1OYJA 4NAXA 5DJLA 4HOJA 3KMOA 4PURA 2HNLA 3CBUA 3DGQA 3LYKA 4BVXA 4GSNA 1GNEA 4JBBA 4BVYA 3C8EA 1EOHA 3LYPA 1PGTA 4N3ZA 5AISA 3EE2A 5J5NA 1BG5A 3MAKA 5BMUB 4KX4A 4PHZC 2CAQA 3VI5A 4NHZA 5DALA 5DQSA 1B8XA 1V2AA 3TOTA 5J47A 3RGBC 1IYHA 1SVLA 4ZBDA 3RBTA 1GSSA 5F05A 3TGZA 3QAVA 4Q5QA 3NIVA 2VCVA 3P8WA 1OE8A 4NHWA 4ZXGA 4EDYA 3M1GA 5F0GA 2VD0A 5J4VA 3VLNA 2A2RA 3KXOA 2PGTA 1G6WA 3UBKA 4IQAA 1M9BA 1GSUA 1S4BP 3ZMLA 3N9JA 3KMNA 6GSXA 8GSSA 4OMVA 4ECJA 1TW9A 3W8SA 5F8BA 1I1IP 4E8EA 1Q4JA 4BL7B 4G10A 2D2ZA 4PI0C 4USSA 2CVDA 2WDUA 2HQTA 2HSMA 5AGYA 3D0ZA 2R3XA 3G7JA 3U6VA 4AKGA 2JL4A 4HZ2A 5D9VA 2GSSA 4F0BA 5DJMA 3CSIA 1F3AA 4MPFA 2V6KA 2VCZA 1VF3A 4PQIA 1R5AA 5D9XA 3F6FA 4MF5A 3GTUB 2YCDA 4AGSA 3LXTA 5A5HB 4YAPA 4JEDA 1U87A 1PD21 3HMJG 3QAGA 2HSNB 3Q18A 1PN9A 5JCUA 4L5OA 2VCXA 4PI2C 1GUHA 4CHSA 3M8NA 3IBHA 2C80A 3O3TA 1EOGA 3CSHA 2LJRA 3QAWA 4PXOA 6GSWA 1VF2A 3VK9A 3WYWA 4HI7A 2WVXA 1MD4A 4BVXB 3LXZA 4F0CA 2HRKA 5A4VA 1EV9A 4Q5RA 4YAVA 4PNGA 4OFNA 1BF5A 1NHYA 1GTBA 4OFTA 3GURA 3R2QA 5ELGA 5J41A 4MK3A 1YDKA 2R5GA 1AXDA 3AY8A 2EFEA 2N5FA 1C72A 4IELA 5DALB 3FY7A 3LSZA 3LJRA 5ECKB 2CZ3A 4FXYP 5J40A 4AKXB
chains in the Genus database with same CATH topology
5F06A 6GSYA 5J4UA 2R6KA 3ZFLA 1BAYA 1YKCA 3CRTA 3VPTA 4YQUA 1GSQA 3EINA 9GSSA 2X64A 2AB6A 3PGTA 4GSTA 1E6BA 6GSVA 2CA8A 2WS2A 4G0IA 3FRCA 3ERFA 2NTOA 1TU8A 4E68A 4QQ7A 1AQXA 4IVFA 1EV4A 4HZ4A 1GLQA 3R3EA 5ECOB 2GSTA 5ECMB 1YVLA 3GSSA 4L8EA 1FW1A 3WD6A 4GCIA 4I97A 4KAEA 3O76A 4N0VA 4IQ1A 4IBPA 4Q5FA 1VF1A 4KF9A 5GSTA 2HSMB 5LCZA 3ZMKA 1K3OA 4PX1A 1G7OA 2OACA 1GUKA 4LMVA 5AIVA 4ZBAA 2IMKA 3P90A 4YQMA 1F3BA 1XW5A 4MP4A 2ON5A 1GWCA 1PMTA 5HFKA 4ZB7A 4QMKA 1GSEA 3ZFBA 3F63A 2VD1A 3H1NA 1Y6EA 5DCGA 4IKHA 1FHEA 20GSA 1V40A 1YJ6A 4FQUA 5ECHB 4G9HA 2EFDA 4RI7A 5D9TA 4RI6A 22GSA 5G5EA 4E8HA 3M3MA 2WJUA 1BYEA 1K3YA 1GUMA 5ECSA 2HRKB 1K3LA 4LMWA 4IJIA 10GSA 1U88A 2YV7A 5A1NA 2IL3A 4DEJA 4KGIA 2F3MA 4MF6A 1HNAA 1N25A 4MZWA 5ECNB 5IQYA 1ZL9A 5DDLA 16GSA 3MDKA 1LJRA 4G01A 4ECIA 1F2EA 4BVYB 17GSA 5ECLB 2WB9A 3GSTA 4J2FA 3GUSA 4KH7A 4O92A 4EXJA 3IR4A 4JZQA 3HKRA 1EEMA 4ZB6A 1K0CA 4EE0A 5GSSA 5G5FA 1G6YA 1Y1UA 4G0KA 3GH6A 1BG1A 5EY6A 2VCWA 1RK4A 4GF0A 2C3NA 1PKWA 4KDUA 1GTAA 5DAKA 1K0OA 1XWGA 3Q74A 2PERA 2GSRA 4PTSA 4ECCA 3HJMA 4MF7A 2AAWA 1M0UA 6GSUA 2C3QA 3Q19A 4KE3A 4AKHA 1K0NA 1XWKA 2FNOA 4K0GA 3FR9A 2PVQA 3VPQA 1K0BA 3IE3A 3G7IA 3TU3B 4KDXA 1M99A 1DUGA 2CAIA 3IK7A 5EVOA 2YV9A 1GULA 1VF4A 4MPGA 3L0HA 4IGJA 3I6AA 3PPUA 2C4JA 18GSA 3FYGA 3CWGA 3ISOA 6GSSA 4PUAA 4ECBA 2WRTA 4GDFA 4YH2A 3CRUA 3LG6A 4G0LA 3I69A 5A4UA 5JCWA 5FWGA 1JLVA 3BBYA 1N2AA 1SVMA 5FHIA 1PA3A 4G19A 4F03A 1K0DA 5GZZB 1XW6A 2J9HA 4EDZA 1PX6A 1HNCA 1Z9HA 3FR3A 2OT3A 2GLRA 4WR5A 4GSSA 11GSA 4ISDA 4AI6A 2AHEA 2R4VA 5J4YA 3CSJA 1PX7A 1GNWA 1YQ1A 5ECQB 5A1NB 4GTUA 3GX0A 1K0AA 1USBA 4O7HA 5A34A 4PNFA 4ZBBA 1PL2A 3KJYA 1OKTA 2DSAA 4Q5NA 3UBLA 1ML6A 4PGTA 7GSSA 13GSA 5EL8A 3HJOA 4ZB8A 2H1LA 5D73A 3SWLA 3F6DA 1GTUA 2CZ2A 3QR6A 3KM6A 2DC5A 5ECPB 1AQVA 4WR4A 4AKIA 1B4PA 5BMUA 1U3IA 3VURA 1LBKA 1M9AA 5AN1A 5DAKB 4IW9A 5ECIB 12GSA 2VO4A 1JLWA 2OA7A 1PL1A 14GSA 2OADA 2PBJA 2GSQA 5FT3A 4EC0A 2C3TA 3LFLA 4ID0A 2VCTA 1TDIA 3UARA 1TXUA 2FHEA 5B7CA 1JZRA 2C8UA 3IC8A 4YQVA 3FR6A 3TOUA 1HNBA 2F8FA 2EFHA 3ERGA 3IK9A 1GLPA 1KBNA 5ECRB 4HJ2A 3KTLA 1GTIA 3M0FA 2PMTA 2ON7A 2IMIA 2HRAA 1AQWA 4W66A 5D9WA 5KEJA 5A5KA 2VCQA 4L5LA 1K0MA 4BL7A 3UVHA 1MD3A 2GDRA 4PQHA 4TOPA 4ZB9A 2EFCA 1IYIA 2UZ8A 4ACSA 4KDYA 4MDCA 1OE7A 6GSTA 1HQOA 2A2SA 5F07A 1AW9A 5AIXA 1ZGNA 3VWXA 1SVOA 1PKZA 3GTUA 1YY7A 1B48A 2O5VA 3PR8A 3LQ7A 5A4WA 1A0FA 1UA5A 5A5HA 4IS0A 2UV8G 3VI7A 19GSA 1GSFA 4K0NA 4OFMA 4KSMA 3N5OA 1GSDA 2HSNA 1TU7A 5ELAA 1BX9A 5LD0A 3UAPA 2GTUA 3DD3A 4GLTA 1GSYA 2VKZG 5A34B 1MTCA 1OYJA 4NAXA 5DJLA 4HOJA 3KMOA 4PURA 2HNLA 3CBUA 3DGQA 3LYKA 4BVXA 4GSNA 1GNEA 4JBBA 4BVYA 3C8EA 1EOHA 3LYPA 1PGTA 4N3ZA 5AISA 3EE2A 5J5NA 1BG5A 3MAKA 5BMUB 4KX4A 2CAQA 3VI5A 4NHZA 5DALA 5DQSA 1B8XA 1V2AA 3TOTA 5J47A 1IYHA 1SVLA 4ZBDA 3RBTA 1GSSA 5F05A 3TGZA 3QAVA 4Q5QA 3NIVA 2VCVA 3P8WA 1OE8A 4NHWA 4ZXGA 4EDYA 3M1GA 5F0GA 2VD0A 5J4VA 3VLNA 2A2RA 3KXOA 2PGTA 1G6WA 3UBKA 4IQAA 1M9BA 1GSUA 3ZMLA 3N9JA 3KMNA 6GSXA 8GSSA 4OMVA 4ECJA 1TW9A 3W8SA 5F8BA 4E8EA 1Q4JA 4BL7B 4G10A 2D2ZA 4USSA 2CVDA 2WDUA 2HQTA 2HSMA 5AGYA 3D0ZA 2R3XA 3G7JA 3U6VA 4AKGA 2JL4A 4HZ2A 5D9VA 2GSSA 4F0BA 5DJMA 3CSIA 1F3AA 4MPFA 2V6KA 2VCZA 1VF3A 4PQIA 1R5AA 5D9XA 3F6FA 4MF5A 3GTUB 2YCDA 4AGSA 3LXTA 5A5HB 4YAPA 4JEDA 1U87A 1PD21 3HMJG 3QAGA 2HSNB 3Q18A 1PN9A 5JCUA 4L5OA 2VCXA 1GUHA 4CHSA 3M8NA 3IBHA 2C80A 3O3TA 1EOGA 3CSHA 2LJRA 3QAWA 4PXOA 6GSWA 1VF2A 3VK9A 3WYWA 4HI7A 4BVXB 1MD4A 3LXZA 4F0CA 2HRKA 5A4VA 1EV9A 4Q5RA 4YAVA 4PNGA 4OFNA 1BF5A 1NHYA 1GTBA 4OFTA 3GURA 3R2QA 5ELGA 5J41A 4MK3A 1YDKA 2R5GA 1AXDA 3AY8A 2EFEA 2N5FA 1C72A 4IELA 5DALB 3FY7A 3LSZA 3LJRA 5ECKB 2CZ3A 5J40A 4AKXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1N B;  4W66 A;  5A34 B;  5A5H A;  4ZB7 A;  4AKG A;  5A5H B;  4AI6 A;  5A34 A;  5BMU B;  4AKI A;  4AKH A;  5A1N A; 
#chains in the Genus database with same CATH topology
 5F06 A;  6GSY A;  5J4U A;  2R6K A;  3ZFL A;  1BAY A;  1YKC A;  3CRT A;  3RFR C;  3VPT A;  4YQU A;  1GSQ A;  3EIN A;  9GSS A;  2X64 A;  2AB6 A;  3PGT A;  4GST A;  1E6B A;  6GSV A;  2CA8 A;  2WS2 A;  2O36 A;  4G0I A;  3FRC A;  3ERF A;  2NTO A;  1TU8 A;  4E68 A;  4QQ7 A;  1AQX A;  2WVY A;  4IVF A;  1EV4 A;  4HZ4 A;  1GLQ A;  3R3E A;  5ECO B;  2GST A;  5ECM B;  1YVL A;  3GSS A;  4L8E A;  1FW1 A;  3WD6 A;  4GCI A;  2WW3 A;  4I97 A;  4KAE A;  3O76 A;  4N0V A;  4IQ1 A;  4IBP A;  4Q5F A;  1VF1 A;  4KF9 A;  5GST A;  2HSM B;  5LCZ A;  3ZMK A;  1K3O A;  4PX1 A;  1G7O A;  2OAC A;  1GUK A;  4LMV A;  5AIV A;  4ZBA A;  2IMK A;  3P90 A;  4YQM A;  1F3B A;  1XW5 A;  4MP4 A;  2ON5 A;  1GWC A;  1PMT A;  5HFK A;  4ZB7 A;  4QMK A;  1GSE A;  3ZFB A;  3F63 A;  2VD1 A;  3H1N A;  1Y6E A;  5DCG A;  4IKH A;  1FHE A;  20GS A;  1V40 A;  1YJ6 A;  4FQU A;  5ECH B;  4G9H A;  2EFD A;  4RI7 A;  5D9T A;  4RI6 A;  22GS A;  5G5E A;  4E8H A;  3M3M A;  2WJU A;  1BYE A;  1K3Y A;  1GUM A;  5ECS A;  2WVX B;  2HRK B;  1K3L A;  4LMW A;  4IJI A;  10GS A;  1U88 A;  2YV7 A;  5A1N A;  2IL3 A;  4DEJ A;  4KGI A;  2F3M A;  4MF6 A;  1HNA A;  1N25 A;  4MZW A;  5ECN B;  5IQY A;  1ZL9 A;  5DDL A;  16GS A;  3MDK A;  2WVZ A;  2WZS A;  1LJR A;  4G01 A;  4ECI A;  1F2E A;  4BVY B;  17GS A;  5ECL B;  2WB9 A;  3GST A;  4J2F A;  3GUS A;  4KH7 A;  4O92 A;  4EXJ A;  3IR4 A;  4JZQ A;  3HKR A;  1EEM A;  4ZB6 A;  1K0C A;  4EE0 A;  5GSS A;  5G5F A;  1G6Y A;  1Y1U A;  4G0K A;  3GH6 A;  1BG1 A;  5EY6 A;  2VCW A;  1RK4 A;  4GF0 A;  2C3N A;  1PKW A;  4KDU A;  1GTA A;  5DAK A;  1K0O A;  1XWG A;  3Q74 A;  2PER A;  1YEW C;  2GSR A;  4PTS A;  4ECC A;  3HJM A;  4MF7 A;  2AAW A;  1M0U A;  6GSU A;  2C3Q A;  3Q19 A;  4KE3 A;  4AKH A;  1K0N A;  1XWK A;  2FNO A;  4K0G A;  3FR9 A;  2PVQ A;  3VPQ A;  1K0B A;  3IE3 A;  3G7I A;  3TU3 B;  4KDX A;  1M99 A;  1DUG A;  2CAI A;  3IK7 A;  5EVO A;  2YV9 A;  1GUL A;  1VF4 A;  4MPG A;  3L0H A;  4IGJ A;  3I6A A;  3PPU A;  2C4J A;  18GS A;  3FYG A;  3CWG A;  3ISO A;  6GSS A;  4PUA A;  4ECB A;  2WRT A;  2WW0 A;  4GDF A;  4YH2 A;  3CRU A;  2WW1 A;  3LG6 A;  4G0L A;  3I69 A;  5A4U A;  5JCW A;  5FWG A;  1JLV A;  3BBY A;  1N2A A;  1SVM A;  5FHI A;  1PA3 A;  4G19 A;  4F03 A;  1K0D A;  5GZZ B;  1XW6 A;  2J9H A;  4EDZ A;  1PX6 A;  1HNC A;  1Z9H A;  3FR3 A;  2OT3 A;  2GLR A;  4WR5 A;  4GSS A;  11GS A;  4ISD A;  4AI6 A;  2AHE A;  2R4V A;  5J4Y A;  3CSJ A;  1PX7 A;  1GNW A;  1YQ1 A;  5ECQ B;  5A1N B;  4GTU A;  3GX0 A;  1K0A A;  1USB A;  4O7H A;  5A34 A;  4PNF A;  4ZBB A;  1PL2 A;  3KJY A;  1OKT A;  2DSA A;  4Q5N A;  3UBL A;  1ML6 A;  4PGT A;  7GSS A;  13GS A;  5EL8 A;  3HJO A;  4ZB8 A;  2H1L A;  5D73 A;  3SWL A;  3F6D A;  1GTU A;  2CZ2 A;  3QR6 A;  3KM6 A;  2DC5 A;  5ECP B;  1AQV A;  4WR4 A;  4AKI A;  1B4P A;  5BMU A;  1U3I A;  3VUR A;  1LBK A;  1M9A A;  5AN1 A;  5DAK B;  4IW9 A;  5ECI B;  12GS A;  2VO4 A;  1JLW A;  2OA7 A;  1PL1 A;  3CHX C;  14GS A;  2OAD A;  2PBJ A;  2GSQ A;  5FT3 A;  4EC0 A;  2C3T A;  3LFL A;  4ID0 A;  2VCT A;  1TDI A;  3UAR A;  1TXU A;  2FHE A;  5B7C A;  1JZR A;  2C8U A;  3IC8 A;  4YQV A;  3FR6 A;  3TOU A;  1HNB A;  2F8F A;  2EFH A;  3ERG A;  3IK9 A;  1GLP A;  1KBN A;  5ECR B;  4HJ2 A;  3KTL A;  1GTI A;  3M0F A;  2PMT A;  2ON7 A;  2IMI A;  2HRA A;  1AQW A;  4W66 A;  5D9W A;  5KEJ A;  5A5K A;  2VCQ A;  4L5L A;  1K0M A;  4BL7 A;  3UVH A;  1MD3 A;  2GDR A;  4PQH A;  4TOP A;  4ZB9 A;  2EFC A;  1IYI A;  2UZ8 A;  4ACS A;  4KDY A;  4MDC A;  1OE7 A;  6GST A;  1HQO A;  2A2S A;  5F07 A;  1AW9 A;  5AIX A;  1ZGN A;  3VWX A;  1SVO A;  1PKZ A;  3GTU A;  1YY7 A;  1B48 A;  2O5V A;  3PR8 A;  3LQ7 A;  2O3E A;  5A4W A;  1A0F A;  1UA5 A;  5A5H A;  4IS0 A;  2UV8 G;  3VI7 A;  19GS A;  1GSF A;  4K0N A;  4OFM A;  4KSM A;  2WW2 A;  3N5O A;  1GSD A;  2HSN A;  1TU7 A;  5ELA A;  1BX9 A;  5LD0 A;  3UAP A;  2GTU A;  3DD3 A;  4GLT A;  1GSY A;  2VKZ G;  5A34 B;  1MTC A;  1OYJ A;  4NAX A;  5DJL A;  4HOJ A;  3KMO A;  4PUR A;  2HNL A;  3CBU A;  3DGQ A;  3LYK A;  4BVX A;  4GSN A;  1GNE A;  4JBB A;  4BVY A;  3C8E A;  1EOH A;  3LYP A;  1PGT A;  4N3Z A;  5AIS A;  3EE2 A;  5J5N A;  1BG5 A;  3MAK A;  5BMU B;  4KX4 A;  4PHZ C;  2CAQ A;  3VI5 A;  4NHZ A;  5DAL A;  5DQS A;  1B8X A;  1V2A A;  3TOT A;  5J47 A;  3RGB C;  1IYH A;  1SVL A;  4ZBD A;  3RBT A;  1GSS A;  5F05 A;  3TGZ A;  3QAV A;  4Q5Q A;  3NIV A;  2VCV A;  3P8W A;  1OE8 A;  4NHW A;  4ZXG A;  4EDY A;  3M1G A;  5F0G A;  2VD0 A;  5J4V A;  3VLN A;  2A2R A;  3KXO A;  2PGT A;  1G6W A;  3UBK A;  4IQA A;  1M9B A;  1GSU A;  1S4B P;  3ZML A;  3N9J A;  3KMN A;  6GSX A;  8GSS A;  4OMV A;  4ECJ A;  1TW9 A;  3W8S A;  5F8B A;  1I1I P;  4E8E A;  1Q4J A;  4BL7 B;  4G10 A;  2D2Z A;  4PI0 C;  4USS A;  2CVD A;  2WDU A;  2HQT A;  2HSM A;  5AGY A;  3D0Z A;  2R3X A;  3G7J A;  3U6V A;  4AKG A;  2JL4 A;  4HZ2 A;  5D9V A;  2GSS A;  4F0B A;  5DJM A;  3CSI A;  1F3A A;  4MPF A;  2V6K A;  2VCZ A;  1VF3 A;  4PQI A;  1R5A A;  5D9X A;  3F6F A;  4MF5 A;  3GTU B;  2YCD A;  4AGS A;  3LXT A;  5A5H B;  4YAP A;  4JED A;  1U87 A;  1PD2 1;  3HMJ G;  3QAG A;  2HSN B;  3Q18 A;  1PN9 A;  5JCU A;  4L5O A;  2VCX A;  4PI2 C;  1GUH A;  4CHS A;  3M8N A;  3IBH A;  2C80 A;  3O3T A;  1EOG A;  3CSH A;  2LJR A;  3QAW A;  4PXO A;  6GSW A;  1VF2 A;  3VK9 A;  3WYW A;  4HI7 A;  2WVX A;  1MD4 A;  4BVX B;  3LXZ A;  4F0C A;  2HRK A;  5A4V A;  1EV9 A;  4Q5R A;  4YAV A;  4PNG A;  4OFN A;  1BF5 A;  1NHY A;  1GTB A;  4OFT A;  3GUR A;  3R2Q A;  5ELG A;  5J41 A;  4MK3 A;  1YDK A;  2R5G A;  1AXD A;  3AY8 A;  2EFE A;  2N5F A;  1C72 A;  4IEL A;  5DAL B;  3FY7 A;  3LSZ A;  3LJR A;  5ECK B;  2CZ3 A;  4FXY P;  5J40 A;  4AKX B; 
#chains in the Genus database with same CATH homology
 5F06 A;  6GSY A;  5J4U A;  2R6K A;  3ZFL A;  1BAY A;  1YKC A;  3CRT A;  3VPT A;  4YQU A;  1GSQ A;  3EIN A;  9GSS A;  2X64 A;  2AB6 A;  3PGT A;  4GST A;  1E6B A;  6GSV A;  2CA8 A;  2WS2 A;  4G0I A;  3FRC A;  3ERF A;  2NTO A;  1TU8 A;  4E68 A;  4QQ7 A;  1AQX A;  4IVF A;  1EV4 A;  4HZ4 A;  1GLQ A;  3R3E A;  5ECO B;  2GST A;  5ECM B;  1YVL A;  3GSS A;  4L8E A;  1FW1 A;  3WD6 A;  4GCI A;  4I97 A;  4KAE A;  3O76 A;  4N0V A;  4IQ1 A;  4IBP A;  4Q5F A;  1VF1 A;  4KF9 A;  5GST A;  2HSM B;  5LCZ A;  3ZMK A;  1K3O A;  4PX1 A;  1G7O A;  2OAC A;  1GUK A;  4LMV A;  5AIV A;  4ZBA A;  2IMK A;  3P90 A;  4YQM A;  1F3B A;  1XW5 A;  4MP4 A;  2ON5 A;  1GWC A;  1PMT A;  5HFK A;  4ZB7 A;  4QMK A;  1GSE A;  3ZFB A;  3F63 A;  2VD1 A;  3H1N A;  1Y6E A;  5DCG A;  4IKH A;  1FHE A;  20GS A;  1V40 A;  1YJ6 A;  4FQU A;  5ECH B;  4G9H A;  2EFD A;  4RI7 A;  5D9T A;  4RI6 A;  22GS A;  5G5E A;  4E8H A;  3M3M A;  2WJU A;  1BYE A;  1K3Y A;  1GUM A;  5ECS A;  2HRK B;  1K3L A;  4LMW A;  4IJI A;  10GS A;  1U88 A;  2YV7 A;  5A1N A;  2IL3 A;  4DEJ A;  4KGI A;  2F3M A;  4MF6 A;  1HNA A;  1N25 A;  4MZW A;  5ECN B;  5IQY A;  1ZL9 A;  5DDL A;  16GS A;  3MDK A;  1LJR A;  4G01 A;  4ECI A;  1F2E A;  4BVY B;  17GS A;  5ECL B;  2WB9 A;  3GST A;  4J2F A;  3GUS A;  4KH7 A;  4O92 A;  4EXJ A;  3IR4 A;  4JZQ A;  3HKR A;  1EEM A;  4ZB6 A;  1K0C A;  4EE0 A;  5GSS A;  5G5F A;  1G6Y A;  1Y1U A;  4G0K A;  3GH6 A;  1BG1 A;  5EY6 A;  2VCW A;  1RK4 A;  4GF0 A;  2C3N A;  1PKW A;  4KDU A;  1GTA A;  5DAK A;  1K0O A;  1XWG A;  3Q74 A;  2PER A;  2GSR A;  4PTS A;  4ECC A;  3HJM A;  4MF7 A;  2AAW A;  1M0U A;  6GSU A;  2C3Q A;  3Q19 A;  4KE3 A;  4AKH A;  1K0N A;  1XWK A;  2FNO A;  4K0G A;  3FR9 A;  2PVQ A;  3VPQ A;  1K0B A;  3IE3 A;  3G7I A;  3TU3 B;  4KDX A;  1M99 A;  1DUG A;  2CAI A;  3IK7 A;  5EVO A;  2YV9 A;  1GUL A;  1VF4 A;  4MPG A;  3L0H A;  4IGJ A;  3I6A A;  3PPU A;  2C4J A;  18GS A;  3FYG A;  3CWG A;  3ISO A;  6GSS A;  4PUA A;  4ECB A;  2WRT A;  4GDF A;  4YH2 A;  3CRU A;  3LG6 A;  4G0L A;  3I69 A;  5A4U A;  5JCW A;  5FWG A;  1JLV A;  3BBY A;  1N2A A;  1SVM A;  5FHI A;  1PA3 A;  4G19 A;  4F03 A;  1K0D A;  5GZZ B;  1XW6 A;  2J9H A;  4EDZ A;  1PX6 A;  1HNC A;  1Z9H A;  3FR3 A;  2OT3 A;  2GLR A;  4WR5 A;  4GSS A;  11GS A;  4ISD A;  4AI6 A;  2AHE A;  2R4V A;  5J4Y A;  3CSJ A;  1PX7 A;  1GNW A;  1YQ1 A;  5ECQ B;  5A1N B;  4GTU A;  3GX0 A;  1K0A A;  1USB A;  4O7H A;  5A34 A;  4PNF A;  4ZBB A;  1PL2 A;  3KJY A;  1OKT A;  2DSA A;  4Q5N A;  3UBL A;  1ML6 A;  4PGT A;  7GSS A;  13GS A;  5EL8 A;  3HJO A;  4ZB8 A;  2H1L A;  5D73 A;  3SWL A;  3F6D A;  1GTU A;  2CZ2 A;  3QR6 A;  3KM6 A;  2DC5 A;  5ECP B;  1AQV A;  4WR4 A;  4AKI A;  1B4P A;  5BMU A;  1U3I A;  3VUR A;  1LBK A;  1M9A A;  5AN1 A;  5DAK B;  4IW9 A;  5ECI B;  12GS A;  2VO4 A;  1JLW A;  2OA7 A;  1PL1 A;  14GS A;  2OAD A;  2PBJ A;  2GSQ A;  5FT3 A;  4EC0 A;  2C3T A;  3LFL A;  4ID0 A;  2VCT A;  1TDI A;  3UAR A;  1TXU A;  2FHE A;  5B7C A;  1JZR A;  2C8U A;  3IC8 A;  4YQV A;  3FR6 A;  3TOU A;  1HNB A;  2F8F A;  2EFH A;  3ERG A;  3IK9 A;  1GLP A;  1KBN A;  5ECR B;  4HJ2 A;  3KTL A;  1GTI A;  3M0F A;  2PMT A;  2ON7 A;  2IMI A;  2HRA A;  1AQW A;  4W66 A;  5D9W A;  5KEJ A;  5A5K A;  2VCQ A;  4L5L A;  1K0M A;  4BL7 A;  3UVH A;  1MD3 A;  2GDR A;  4PQH A;  4TOP A;  4ZB9 A;  2EFC A;  1IYI A;  2UZ8 A;  4ACS A;  4KDY A;  4MDC A;  1OE7 A;  6GST A;  1HQO A;  2A2S A;  5F07 A;  1AW9 A;  5AIX A;  1ZGN A;  3VWX A;  1SVO A;  1PKZ A;  3GTU A;  1YY7 A;  1B48 A;  2O5V A;  3PR8 A;  3LQ7 A;  5A4W A;  1A0F A;  1UA5 A;  5A5H A;  4IS0 A;  2UV8 G;  3VI7 A;  19GS A;  1GSF A;  4K0N A;  4OFM A;  4KSM A;  3N5O A;  1GSD A;  2HSN A;  1TU7 A;  5ELA A;  1BX9 A;  5LD0 A;  3UAP A;  2GTU A;  3DD3 A;  4GLT A;  1GSY A;  2VKZ G;  5A34 B;  1MTC A;  1OYJ A;  4NAX A;  5DJL A;  4HOJ A;  3KMO A;  4PUR A;  2HNL A;  3CBU A;  3DGQ A;  3LYK A;  4BVX A;  4GSN A;  1GNE A;  4JBB A;  4BVY A;  3C8E A;  1EOH A;  3LYP A;  1PGT A;  4N3Z A;  5AIS A;  3EE2 A;  5J5N A;  1BG5 A;  3MAK A;  5BMU B;  4KX4 A;  2CAQ A;  3VI5 A;  4NHZ A;  5DAL A;  5DQS A;  1B8X A;  1V2A A;  3TOT A;  5J47 A;  1IYH A;  1SVL A;  4ZBD A;  3RBT A;  1GSS A;  5F05 A;  3TGZ A;  3QAV A;  4Q5Q A;  3NIV A;  2VCV A;  3P8W A;  1OE8 A;  4NHW A;  4ZXG A;  4EDY A;  3M1G A;  5F0G A;  2VD0 A;  5J4V A;  3VLN A;  2A2R A;  3KXO A;  2PGT A;  1G6W A;  3UBK A;  4IQA A;  1M9B A;  1GSU A;  3ZML A;  3N9J A;  3KMN A;  6GSX A;  8GSS A;  4OMV A;  4ECJ A;  1TW9 A;  3W8S A;  5F8B A;  4E8E A;  1Q4J A;  4BL7 B;  4G10 A;  2D2Z A;  4USS A;  2CVD A;  2WDU A;  2HQT A;  2HSM A;  5AGY A;  3D0Z A;  2R3X A;  3G7J A;  3U6V A;  4AKG A;  2JL4 A;  4HZ2 A;  5D9V A;  2GSS A;  4F0B A;  5DJM A;  3CSI A;  1F3A A;  4MPF A;  2V6K A;  2VCZ A;  1VF3 A;  4PQI A;  1R5A A;  5D9X A;  3F6F A;  4MF5 A;  3GTU B;  2YCD A;  4AGS A;  3LXT A;  5A5H B;  4YAP A;  4JED A;  1U87 A;  1PD2 1;  3HMJ G;  3QAG A;  2HSN B;  3Q18 A;  1PN9 A;  5JCU A;  4L5O A;  2VCX A;  1GUH A;  4CHS A;  3M8N A;  3IBH A;  2C80 A;  3O3T A;  1EOG A;  3CSH A;  2LJR A;  3QAW A;  4PXO A;  6GSW A;  1VF2 A;  3VK9 A;  3WYW A;  4HI7 A;  4BVX B;  1MD4 A;  3LXZ A;  4F0C A;  2HRK A;  5A4V A;  1EV9 A;  4Q5R A;  4YAV A;  4PNG A;  4OFN A;  1BF5 A;  1NHY A;  1GTB A;  4OFT A;  3GUR A;  3R2Q A;  5ELG A;  5J41 A;  4MK3 A;  1YDK A;  2R5G A;  1AXD A;  3AY8 A;  2EFE A;  2N5F A;  1C72 A;  4IEL A;  5DAL B;  3FY7 A;  3LSZ A;  3LJR A;  5ECK B;  2CZ3 A;  5J40 A;  4AKX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...