5A5HB

The crystal structure of the gst-like domains complex of eprs c92sc105sc123s mutant-aimp2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
210
Chain Sequence
b'LGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title The Crystal Structure of the Gst-Like Domains Complex of Eprs C92Sc105Sc123S Mutant-Aimp2
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 64
structure length 210
sequence length 210
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
B PF18569 Thioredoxin_16 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a5hB00
5A5HA 5A1NA 5A5HB 4AKGA 4AI6A 5A34B 4AKIA 5A34A 4ZB7A 4AKHA 4W66A 5A1NB 5BMUB
chains in the Genus database with same CATH superfamily
3VPTA 3M1GA 4N3ZA 3LSZA 3WD6A 4BVXB 4JZQA 2IMIA 2HSNB 3G7JA 1E6BA 3IE3A 4BVYA 3KM6A 2ON7A 3C8EA 5AN1A 1EV4A 4MF5A 4IJIA 1V40A 4RI7A 3CRUA 4HI7A 5A4UA 1PA3A 9GSSA 1K0NA 3KXOA 5B7CA 4AKIA 3U6VA 3PGTA 13GSA 4Q5FA 1OE7A 3W8SA 7GSSA 3HKRA 3RGBC 3IK7A 1K0MA 5ELAA 1I1IP 3VURA 4QQ7A 2EFHA 1GNEA 3N5OA 3VI5A 4YH2A 2PERA 2CVDA 5DALB 5J4YA 4GTUA 4IGJA 3VK9A 6GSXA 2AAWA 1GLQA 3O76A 3UARA 2OT3A 1N2AA 1TU7A 2FNOA 1AQWA 3LFLA 1GTAA 5A1NB 1JLVA 2CZ3A 1GSDA 5DJLA 2GSQA 6GSUA 4LMWA 17GSA 5DJMA 3LXZA 2J9HA 4IVFA 5A5KA 4E8HA 2V6KA 2F3MA 2VCTA 2WW2A 4EDYA 2ON5A 1OYJA 3GURA 1PL1A 1SVOA 5A4VA 3MDKA 1GSUA 3FR6A 2O5VA 1B4PA 4KDYA 5F8BA 20GSA 1OKTA 4ID0A 4G19A 19GSA 4ZBAA 4I97A 4IELA 6GSWA 1EOHA 3CSHA 3IBHA 4ISDA 4K0NA 5F06A 5J40A 2A2RA 1GSEA 1GWCA 1U87A 4GCIA 3UVHA 4YAPA 1BYEA 4L5OA 3DD3A 5D9TA 4G0IA 5GSSA 4HZ2A 5BMUA 3TOTA 4IKHA 1K3YA 2HRKB 3KMOA 2WJUA 3GTUA 1M0UA 2WW0A 5AIXA 5A34B 3F6DA 5FT3A 1YY7A 2A2SA 1PL2A 3MAKA 2GSSA 2PGTA 4MPFA 2D2ZA 5F05A 2OACA 1Y1UA 3VWXA 2HSNA 4YAVA 2LJRA 5ECLB 1AQXA 1MD4A 3ERFA 2HSMB 5BMUB 1BAYA 1GSSA 1VF4A 3GUSA 5G5EA 1XW6A 3GTUB 3LG6A 3PPUA 3QAGA 1LBKA 1BG5A 3KMNA 4NHZA 3IC8A 1Y6EA 1FHEA 4G10A 2EFEA 1K0CA 4JBBA 5ECMB 5ECNB 1FW1A 1YEWC 4WR4A 3P90A 1K0OA 3TOUA 3ERGA 2WVYA 2R3XA 3TU3B 4L5LA 4ACSA 1PKWA 2EFCA 4NAXA 1GUHA 4DEJA 5DDLA 4AKHA 3VI7A 5IQYA 1EEMA 14GSA 5DALA 5FHIA 4MPGA 3FRCA 4HJ2A 1U3IA 4YQMA 1GTIA 1GSYA 1G6WA 3GSTA 5J5NA 1BG1A 18GSA 4F03A 2CAQA 4MZWA 5A1NA 4GSNA 3TGZA 5LD0A 5J4VA 3CSIA 1M99A 2WZSA 4YQVA 3Q19A 4JEDA 1MD3A 1M9AA 1GTUA 3R3EA 5A4WA 3Q74A 4J2FA 3GSSA 3ZFLA 4TOPA 4PI0C 4AGSA 3VPQA 4IW9A 2CA8A 2OADA 3L0HA 1VF3A 1R5AA 4ZB9A 3UBLA 1S4BP 3FY7A 1K0AA 3WYWA 4GDFA 1YKCA 4OFNA 2VCWA 3I6AA 1PMTA 3F6FA 1PX7A 1RK4A 1GULA 3UAPA 5AIVA 3GH6A 1B8XA 2FHEA 4ZB8A 4O92A 2PVQA 4KDXA 3ZMKA 1GSQA 1PD21 1GTBA 1K0BA 3ZMLA 3DGQA 3ZFBA 3LXTA 5J41A 2R4VA 5EY6A 1TXUA 5F07A 1AQVA 3UBKA 4PQHA 2GDRA 3RFRC 1IYIA 1PN9A 1HNBA 2HRKA 3QAWA 5A34A 4FQUA 1K0DA 4PNFA 2YCDA 4USSA 4LMVA 2WVXA 3I69A 3NIVA 2C8UA 2WW1A 2GSTA 4E68A 3QAVA 1HQOA 3LJRA 1EOGA 4QMKA 3M8NA 1TU8A 3CHXC 4KDUA 5G5FA 4PTSA 2HSMA 2EFDA 2WRTA 5GZZB 1MTCA 1YJ6A 2WVXB 4PUAA 2VCXA 4Q5NA 2VCVA 2VKZG 3FR3A 4IBPA 3F63A 3FYGA 4IS0A 5ECRB 2VD0A 3IK9A 4F0BA 6GSVA 4EDZA 4NHWA 2WVZA 4EC0A 3LYPA 4ZBDA 8GSSA 1G7OA 4KF9A 2AB6A 4G0LA 1B48A 4IQAA 1PGTA 4FXYP 2UZ8A 2JL4A 3LYKA 1XW5A 4GF0A 2F8FA 6GSSA 1KBNA 1N25A 5LCZA 4MP4A 3AY8A 3R2QA 1SVMA 5AGYA 1Q4JA 4K0GA 2YV7A 5ECSA 22GSA 5DQSA 4BL7A 1EV9A 2N5FA 4W66A 4CHSA 1GSFA 3M3MA 1U88A 4AKGA 2PBJA 2DC5A 2CAIA 2GLRA 5JCUA 4Q5QA 2R6KA 4KGIA 1HNCA 5ELGA 4G9HA 5ECIB 3O3TA 1ML6A 4BL7B 1TW9A 2AHEA 4KH7A 1A0FA 1JLWA 5ECKB 4E8EA 4N0VA 1USBA 2NTOA 4PHZC 5D9XA 4ECCA 5A5HA 1GUKA 4AKXB 5JCWA 5AISA 1ZGNA 1LJRA 1YVLA 3KTLA 4GLTA 1V2AA 5EVOA 3LQ7A 4BVYB 1NHYA 5D9WA 1PX6A 3EINA 4PGTA 5ECQB 4ZB6A 4EXJA 2C4JA 2WDUA 2GSRA 1AXDA 4IQ1A 2DSAA 1K3OA 5A5HB 4EE0A 2O36A 2R5GA 2HNLA 5GSTA 3G7IA 2C3TA 2CZ2A 1Z9HA 2GTUA 4KAEA 3CRTA 1F3BA 1M9BA 5ECPB 1PKZA 1GNWA 1SVLA 1YDKA 4F0CA 3HJMA 2X64A 4HOJA 2C3NA 3P8WA 16GSA 4MF6A 2HRAA 3QR6A 4OFTA 3N9JA 1AW9A 1GUMA 3Q18A 1OE8A 2WS2A 2UV8G 5ECHB 4ZXGA 2HQTA 5DAKA 6GSTA 3FR9A 3GX0A 3EE2A 4L8EA 3KJYA 4PI2C 4RI6A 4PURA 12GSA 1BX9A 2H1LA 4PNGA 3VLNA 4PQIA 1F3AA 5FWGA 2C3QA 11GSA 1YQ1A 4ZBBA 4AI6A 1GLPA 5F0GA 4YQUA 1IYHA 5DAKB 3RBTA 4KSMA 2O3EA 4MDCA 2C80A 3CSJA 4WR5A 5EL8A 1VF2A 4ECBA 4KX4A 10GSA 1JZRA 4MF7A 5D73A 3SWLA 4KE3A 4G0KA 4MK3A 1TDIA 4ECJA 4O7HA 1DUGA 2VCQA 3IR4A 5ECOB 1C72A 2VO4A 5KEJA 4PX1A 1VF1A 2PMTA 2WW3A 4PXOA 1ZL9A 1G6YA 3HJOA 1K3LA 6GSYA 5J4UA 3H1NA 1UA5A 4GSTA 2IMKA 2WB9A 3D0ZA 5DCGA 4BVXA 4OMVA 1XWGA 3HMJG 2YV9A 5HFKA 2VD1A 4OFMA 4Q5RA 3M0FA 4GSSA 1F2EA 3CBUA 1XWKA 2VCZA 2OA7A 3BBYA 3CWGA 1HNAA 5J47A 4ECIA 1BF5A 3ISOA 3PR8A 5D9VA 4G01A 4ZB7A 4HZ4A 2IL3A
chains in the Genus database with same CATH topology
3VPTA 3M1GA 4N3ZA 3LSZA 3WD6A 4BVXB 4JZQA 2IMIA 2HSNB 3G7JA 1E6BA 3IE3A 4BVYA 3KM6A 2ON7A 3C8EA 5AN1A 1EV4A 4MF5A 4IJIA 1V40A 4RI7A 3CRUA 4HI7A 5A4UA 1PA3A 9GSSA 1K0NA 3KXOA 5B7CA 4AKIA 3U6VA 3PGTA 13GSA 4Q5FA 1OE7A 3W8SA 7GSSA 3HKRA 3IK7A 1K0MA 5ELAA 3VURA 4QQ7A 2EFHA 1GNEA 3N5OA 3VI5A 4YH2A 2PERA 2CVDA 5DALB 5J4YA 4GTUA 4IGJA 3VK9A 6GSXA 2AAWA 1GLQA 3O76A 3UARA 2OT3A 1N2AA 1TU7A 2FNOA 1AQWA 3LFLA 1GTAA 5A1NB 1JLVA 2CZ3A 1GSDA 5DJLA 2GSQA 6GSUA 4LMWA 17GSA 5DJMA 3LXZA 2J9HA 4IVFA 5A5KA 4E8HA 2V6KA 2F3MA 2VCTA 4EDYA 2ON5A 1OYJA 3GURA 1PL1A 1SVOA 5A4VA 3MDKA 1GSUA 3FR6A 2O5VA 1B4PA 4KDYA 5F8BA 20GSA 1OKTA 4ID0A 4G19A 19GSA 4ZBAA 4I97A 4IELA 6GSWA 1EOHA 3CSHA 3IBHA 4ISDA 4K0NA 5F06A 5J40A 2A2RA 1GSEA 1GWCA 1U87A 4GCIA 3UVHA 4YAPA 1BYEA 4L5OA 3DD3A 5D9TA 4G0IA 5GSSA 4HZ2A 5BMUA 3TOTA 4IKHA 1K3YA 2HRKB 3KMOA 2WJUA 3GTUA 1M0UA 5A34B 5AIXA 3F6DA 5FT3A 1YY7A 2A2SA 1PL2A 3MAKA 2GSSA 2PGTA 4MPFA 2D2ZA 5F05A 2OACA 1Y1UA 3VWXA 2HSNA 4YAVA 2LJRA 5ECLB 1AQXA 1MD4A 3ERFA 2HSMB 5BMUB 1BAYA 1GSSA 1VF4A 3GUSA 5G5EA 1XW6A 3GTUB 3LG6A 3PPUA 3QAGA 1LBKA 1BG5A 3KMNA 4NHZA 3IC8A 1Y6EA 1FHEA 4G10A 2EFEA 1K0CA 4JBBA 5ECMB 5ECNB 1FW1A 4WR4A 3P90A 1K0OA 3TOUA 3ERGA 2R3XA 3TU3B 4L5LA 4ACSA 1PKWA 2EFCA 4NAXA 1GUHA 4DEJA 5DDLA 4AKHA 3VI7A 5IQYA 1EEMA 14GSA 5DALA 5FHIA 4MPGA 3FRCA 4HJ2A 1U3IA 4YQMA 1GTIA 1GSYA 1G6WA 3GSTA 5J5NA 1BG1A 18GSA 4F03A 2CAQA 4MZWA 5A1NA 4GSNA 3TGZA 5LD0A 5J4VA 3CSIA 1M99A 4YQVA 3Q19A 4JEDA 1MD3A 1M9AA 1GTUA 3R3EA 5A4WA 3Q74A 4J2FA 3GSSA 3ZFLA 4TOPA 4AGSA 3VPQA 4IW9A 2CA8A 2OADA 3L0HA 1VF3A 1R5AA 4ZB9A 3UBLA 3FY7A 1K0AA 3WYWA 4GDFA 1YKCA 4OFNA 2VCWA 3I6AA 1PMTA 3F6FA 1PX7A 1RK4A 1GULA 3UAPA 5AIVA 3GH6A 1B8XA 2FHEA 4ZB8A 4O92A 2PVQA 4KDXA 3ZMKA 1GSQA 1PD21 1GTBA 1K0BA 3ZMLA 3DGQA 3ZFBA 3LXTA 5J41A 2R4VA 5EY6A 1TXUA 5F07A 1AQVA 3UBKA 4PQHA 2GDRA 1IYIA 1PN9A 1HNBA 2HRKA 3QAWA 5A34A 4FQUA 1K0DA 4PNFA 2YCDA 4USSA 4LMVA 3I69A 3NIVA 2C8UA 2GSTA 4E68A 3QAVA 1HQOA 3LJRA 1EOGA 4QMKA 3M8NA 1TU8A 4KDUA 5G5FA 4PTSA 2HSMA 2EFDA 2WRTA 5GZZB 1MTCA 1YJ6A 4PUAA 2VCXA 4Q5NA 2VCVA 2VKZG 3FR3A 4IBPA 3F63A 3FYGA 4IS0A 5ECRB 2VD0A 3IK9A 4F0BA 6GSVA 4EDZA 4NHWA 4EC0A 3LYPA 4ZBDA 8GSSA 1G7OA 4KF9A 2AB6A 4G0LA 1B48A 4IQAA 1PGTA 2UZ8A 2JL4A 3LYKA 1XW5A 4GF0A 2F8FA 6GSSA 1KBNA 1N25A 5LCZA 4MP4A 3AY8A 3R2QA 1SVMA 5AGYA 1Q4JA 4K0GA 2YV7A 5ECSA 22GSA 5DQSA 4BL7A 1EV9A 2N5FA 4W66A 4CHSA 1GSFA 3M3MA 1U88A 4AKGA 2PBJA 2DC5A 2CAIA 2GLRA 5JCUA 4Q5QA 2R6KA 4KGIA 1HNCA 5ELGA 4G9HA 5ECIB 3O3TA 1ML6A 4BL7B 1TW9A 2AHEA 4KH7A 1A0FA 1JLWA 5ECKB 4E8EA 4N0VA 1USBA 2NTOA 5D9XA 4ECCA 5A5HA 1GUKA 4AKXB 5JCWA 5AISA 1ZGNA 1LJRA 1YVLA 3KTLA 4GLTA 1V2AA 5EVOA 3LQ7A 4BVYB 1NHYA 5D9WA 1PX6A 3EINA 4PGTA 5ECQB 4ZB6A 4EXJA 2C4JA 2WDUA 2GSRA 1AXDA 4IQ1A 2DSAA 1K3OA 5A5HB 4EE0A 2R5GA 2HNLA 5GSTA 3G7IA 2C3TA 2CZ2A 1Z9HA 2GTUA 4KAEA 3CRTA 1F3BA 1M9BA 5ECPB 1PKZA 1GNWA 1SVLA 1YDKA 4F0CA 3HJMA 2X64A 4HOJA 2C3NA 3P8WA 16GSA 4MF6A 2HRAA 3QR6A 4OFTA 3N9JA 1AW9A 1GUMA 3Q18A 1OE8A 2WS2A 2UV8G 5ECHB 4ZXGA 2HQTA 5DAKA 6GSTA 3FR9A 3GX0A 3EE2A 4L8EA 3KJYA 4RI6A 4PURA 12GSA 1BX9A 2H1LA 4PNGA 3VLNA 4PQIA 1F3AA 5FWGA 2C3QA 11GSA 1YQ1A 4ZBBA 4AI6A 1GLPA 5F0GA 4YQUA 1IYHA 5DAKB 3RBTA 4KSMA 4MDCA 2C80A 3CSJA 4WR5A 5EL8A 1VF2A 4ECBA 4KX4A 10GSA 1JZRA 4MF7A 5D73A 3SWLA 4KE3A 4G0KA 4MK3A 1TDIA 4ECJA 4O7HA 1DUGA 2VCQA 3IR4A 5ECOB 1C72A 2VO4A 5KEJA 4PX1A 1VF1A 2PMTA 4PXOA 1ZL9A 1G6YA 3HJOA 1K3LA 6GSYA 5J4UA 3H1NA 1UA5A 4GSTA 2IMKA 2WB9A 3D0ZA 5DCGA 4BVXA 4OMVA 1XWGA 3HMJG 2YV9A 5HFKA 2VD1A 4OFMA 4Q5RA 3M0FA 4GSSA 1F2EA 3CBUA 1XWKA 2VCZA 2OA7A 3BBYA 3CWGA 1HNAA 5J47A 4ECIA 1BF5A 3ISOA 3PR8A 5D9VA 4G01A 4ZB7A 4HZ4A 2IL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A5H A;  5A1N A;  5A5H B;  4AKG A;  4AI6 A;  5A34 B;  4AKI A;  5A34 A;  4ZB7 A;  4AKH A;  4W66 A;  5A1N B;  5BMU B; 
#chains in the Genus database with same CATH topology
 3VPT A;  3M1G A;  4N3Z A;  3LSZ A;  3WD6 A;  4BVX B;  4JZQ A;  2IMI A;  2HSN B;  3G7J A;  1E6B A;  3IE3 A;  4BVY A;  3KM6 A;  2ON7 A;  3C8E A;  5AN1 A;  1EV4 A;  4MF5 A;  4IJI A;  1V40 A;  4RI7 A;  3CRU A;  4HI7 A;  5A4U A;  1PA3 A;  9GSS A;  1K0N A;  3KXO A;  5B7C A;  4AKI A;  3U6V A;  3PGT A;  13GS A;  4Q5F A;  1OE7 A;  3W8S A;  7GSS A;  3HKR A;  3RGB C;  3IK7 A;  1K0M A;  5ELA A;  1I1I P;  3VUR A;  4QQ7 A;  2EFH A;  1GNE A;  3N5O A;  3VI5 A;  4YH2 A;  2PER A;  2CVD A;  5DAL B;  5J4Y A;  4GTU A;  4IGJ A;  3VK9 A;  6GSX A;  2AAW A;  1GLQ A;  3O76 A;  3UAR A;  2OT3 A;  1N2A A;  1TU7 A;  2FNO A;  1AQW A;  3LFL A;  1GTA A;  5A1N B;  1JLV A;  2CZ3 A;  1GSD A;  5DJL A;  2GSQ A;  6GSU A;  4LMW A;  17GS A;  5DJM A;  3LXZ A;  2J9H A;  4IVF A;  5A5K A;  4E8H A;  2V6K A;  2F3M A;  2VCT A;  2WW2 A;  4EDY A;  2ON5 A;  1OYJ A;  3GUR A;  1PL1 A;  1SVO A;  5A4V A;  3MDK A;  1GSU A;  3FR6 A;  2O5V A;  1B4P A;  4KDY A;  5F8B A;  20GS A;  1OKT A;  4ID0 A;  4G19 A;  19GS A;  4ZBA A;  4I97 A;  4IEL A;  6GSW A;  1EOH A;  3CSH A;  3IBH A;  4ISD A;  4K0N A;  5F06 A;  5J40 A;  2A2R A;  1GSE A;  1GWC A;  1U87 A;  4GCI A;  3UVH A;  4YAP A;  1BYE A;  4L5O A;  3DD3 A;  5D9T A;  4G0I A;  5GSS A;  4HZ2 A;  5BMU A;  3TOT A;  4IKH A;  1K3Y A;  2HRK B;  3KMO A;  2WJU A;  3GTU A;  1M0U A;  2WW0 A;  5AIX A;  5A34 B;  3F6D A;  5FT3 A;  1YY7 A;  2A2S A;  1PL2 A;  3MAK A;  2GSS A;  2PGT A;  4MPF A;  2D2Z A;  5F05 A;  2OAC A;  1Y1U A;  3VWX A;  2HSN A;  4YAV A;  2LJR A;  5ECL B;  1AQX A;  1MD4 A;  3ERF A;  2HSM B;  5BMU B;  1BAY A;  1GSS A;  1VF4 A;  3GUS A;  5G5E A;  1XW6 A;  3GTU B;  3LG6 A;  3PPU A;  3QAG A;  1LBK A;  1BG5 A;  3KMN A;  4NHZ A;  3IC8 A;  1Y6E A;  1FHE A;  4G10 A;  2EFE A;  1K0C A;  4JBB A;  5ECM B;  5ECN B;  1FW1 A;  1YEW C;  4WR4 A;  3P90 A;  1K0O A;  3TOU A;  3ERG A;  2WVY A;  2R3X A;  3TU3 B;  4L5L A;  4ACS A;  1PKW A;  2EFC A;  4NAX A;  1GUH A;  4DEJ A;  5DDL A;  4AKH A;  3VI7 A;  5IQY A;  1EEM A;  14GS A;  5DAL A;  5FHI A;  4MPG A;  3FRC A;  4HJ2 A;  1U3I A;  4YQM A;  1GTI A;  1GSY A;  1G6W A;  3GST A;  5J5N A;  1BG1 A;  18GS A;  4F03 A;  2CAQ A;  4MZW A;  5A1N A;  4GSN A;  3TGZ A;  5LD0 A;  5J4V A;  3CSI A;  1M99 A;  2WZS A;  4YQV A;  3Q19 A;  4JED A;  1MD3 A;  1M9A A;  1GTU A;  3R3E A;  5A4W A;  3Q74 A;  4J2F A;  3GSS A;  3ZFL A;  4TOP A;  4PI0 C;  4AGS A;  3VPQ A;  4IW9 A;  2CA8 A;  2OAD A;  3L0H A;  1VF3 A;  1R5A A;  4ZB9 A;  3UBL A;  1S4B P;  3FY7 A;  1K0A A;  3WYW A;  4GDF A;  1YKC A;  4OFN A;  2VCW A;  3I6A A;  1PMT A;  3F6F A;  1PX7 A;  1RK4 A;  1GUL A;  3UAP A;  5AIV A;  3GH6 A;  1B8X A;  2FHE A;  4ZB8 A;  4O92 A;  2PVQ A;  4KDX A;  3ZMK A;  1GSQ A;  1PD2 1;  1GTB A;  1K0B A;  3ZML A;  3DGQ A;  3ZFB A;  3LXT A;  5J41 A;  2R4V A;  5EY6 A;  1TXU A;  5F07 A;  1AQV A;  3UBK A;  4PQH A;  2GDR A;  3RFR C;  1IYI A;  1PN9 A;  1HNB A;  2HRK A;  3QAW A;  5A34 A;  4FQU A;  1K0D A;  4PNF A;  2YCD A;  4USS A;  4LMV A;  2WVX A;  3I69 A;  3NIV A;  2C8U A;  2WW1 A;  2GST A;  4E68 A;  3QAV A;  1HQO A;  3LJR A;  1EOG A;  4QMK A;  3M8N A;  1TU8 A;  3CHX C;  4KDU A;  5G5F A;  4PTS A;  2HSM A;  2EFD A;  2WRT A;  5GZZ B;  1MTC A;  1YJ6 A;  2WVX B;  4PUA A;  2VCX A;  4Q5N A;  2VCV A;  2VKZ G;  3FR3 A;  4IBP A;  3F63 A;  3FYG A;  4IS0 A;  5ECR B;  2VD0 A;  3IK9 A;  4F0B A;  6GSV A;  4EDZ A;  4NHW A;  2WVZ A;  4EC0 A;  3LYP A;  4ZBD A;  8GSS A;  1G7O A;  4KF9 A;  2AB6 A;  4G0L A;  1B48 A;  4IQA A;  1PGT A;  4FXY P;  2UZ8 A;  2JL4 A;  3LYK A;  1XW5 A;  4GF0 A;  2F8F A;  6GSS A;  1KBN A;  1N25 A;  5LCZ A;  4MP4 A;  3AY8 A;  3R2Q A;  1SVM A;  5AGY A;  1Q4J A;  4K0G A;  2YV7 A;  5ECS A;  22GS A;  5DQS A;  4BL7 A;  1EV9 A;  2N5F A;  4W66 A;  4CHS A;  1GSF A;  3M3M A;  1U88 A;  4AKG A;  2PBJ A;  2DC5 A;  2CAI A;  2GLR A;  5JCU A;  4Q5Q A;  2R6K A;  4KGI A;  1HNC A;  5ELG A;  4G9H A;  5ECI B;  3O3T A;  1ML6 A;  4BL7 B;  1TW9 A;  2AHE A;  4KH7 A;  1A0F A;  1JLW A;  5ECK B;  4E8E A;  4N0V A;  1USB A;  2NTO A;  4PHZ C;  5D9X A;  4ECC A;  5A5H A;  1GUK A;  4AKX B;  5JCW A;  5AIS A;  1ZGN A;  1LJR A;  1YVL A;  3KTL A;  4GLT A;  1V2A A;  5EVO A;  3LQ7 A;  4BVY B;  1NHY A;  5D9W A;  1PX6 A;  3EIN A;  4PGT A;  5ECQ B;  4ZB6 A;  4EXJ A;  2C4J A;  2WDU A;  2GSR A;  1AXD A;  4IQ1 A;  2DSA A;  1K3O A;  5A5H B;  4EE0 A;  2O36 A;  2R5G A;  2HNL A;  5GST A;  3G7I A;  2C3T A;  2CZ2 A;  1Z9H A;  2GTU A;  4KAE A;  3CRT A;  1F3B A;  1M9B A;  5ECP B;  1PKZ A;  1GNW A;  1SVL A;  1YDK A;  4F0C A;  3HJM A;  2X64 A;  4HOJ A;  2C3N A;  3P8W A;  16GS A;  4MF6 A;  2HRA A;  3QR6 A;  4OFT A;  3N9J A;  1AW9 A;  1GUM A;  3Q18 A;  1OE8 A;  2WS2 A;  2UV8 G;  5ECH B;  4ZXG A;  2HQT A;  5DAK A;  6GST A;  3FR9 A;  3GX0 A;  3EE2 A;  4L8E A;  3KJY A;  4PI2 C;  4RI6 A;  4PUR A;  12GS A;  1BX9 A;  2H1L A;  4PNG A;  3VLN A;  4PQI A;  1F3A A;  5FWG A;  2C3Q A;  11GS A;  1YQ1 A;  4ZBB A;  4AI6 A;  1GLP A;  5F0G A;  4YQU A;  1IYH A;  5DAK B;  3RBT A;  4KSM A;  2O3E A;  4MDC A;  2C80 A;  3CSJ A;  4WR5 A;  5EL8 A;  1VF2 A;  4ECB A;  4KX4 A;  10GS A;  1JZR A;  4MF7 A;  5D73 A;  3SWL A;  4KE3 A;  4G0K A;  4MK3 A;  1TDI A;  4ECJ A;  4O7H A;  1DUG A;  2VCQ A;  3IR4 A;  5ECO B;  1C72 A;  2VO4 A;  5KEJ A;  4PX1 A;  1VF1 A;  2PMT A;  2WW3 A;  4PXO A;  1ZL9 A;  1G6Y A;  3HJO A;  1K3L A;  6GSY A;  5J4U A;  3H1N A;  1UA5 A;  4GST A;  2IMK A;  2WB9 A;  3D0Z A;  5DCG A;  4BVX A;  4OMV A;  1XWG A;  3HMJ G;  2YV9 A;  5HFK A;  2VD1 A;  4OFM A;  4Q5R A;  3M0F A;  4GSS A;  1F2E A;  3CBU A;  1XWK A;  2VCZ A;  2OA7 A;  3BBY A;  3CWG A;  1HNA A;  5J47 A;  4ECI A;  1BF5 A;  3ISO A;  3PR8 A;  5D9V A;  4G01 A;  4ZB7 A;  4HZ4 A;  2IL3 A; 
#chains in the Genus database with same CATH homology
 3VPT A;  3M1G A;  4N3Z A;  3LSZ A;  3WD6 A;  4BVX B;  4JZQ A;  2IMI A;  2HSN B;  3G7J A;  1E6B A;  3IE3 A;  4BVY A;  3KM6 A;  2ON7 A;  3C8E A;  5AN1 A;  1EV4 A;  4MF5 A;  4IJI A;  1V40 A;  4RI7 A;  3CRU A;  4HI7 A;  5A4U A;  1PA3 A;  9GSS A;  1K0N A;  3KXO A;  5B7C A;  4AKI A;  3U6V A;  3PGT A;  13GS A;  4Q5F A;  1OE7 A;  3W8S A;  7GSS A;  3HKR A;  3IK7 A;  1K0M A;  5ELA A;  3VUR A;  4QQ7 A;  2EFH A;  1GNE A;  3N5O A;  3VI5 A;  4YH2 A;  2PER A;  2CVD A;  5DAL B;  5J4Y A;  4GTU A;  4IGJ A;  3VK9 A;  6GSX A;  2AAW A;  1GLQ A;  3O76 A;  3UAR A;  2OT3 A;  1N2A A;  1TU7 A;  2FNO A;  1AQW A;  3LFL A;  1GTA A;  5A1N B;  1JLV A;  2CZ3 A;  1GSD A;  5DJL A;  2GSQ A;  6GSU A;  4LMW A;  17GS A;  5DJM A;  3LXZ A;  2J9H A;  4IVF A;  5A5K A;  4E8H A;  2V6K A;  2F3M A;  2VCT A;  4EDY A;  2ON5 A;  1OYJ A;  3GUR A;  1PL1 A;  1SVO A;  5A4V A;  3MDK A;  1GSU A;  3FR6 A;  2O5V A;  1B4P A;  4KDY A;  5F8B A;  20GS A;  1OKT A;  4ID0 A;  4G19 A;  19GS A;  4ZBA A;  4I97 A;  4IEL A;  6GSW A;  1EOH A;  3CSH A;  3IBH A;  4ISD A;  4K0N A;  5F06 A;  5J40 A;  2A2R A;  1GSE A;  1GWC A;  1U87 A;  4GCI A;  3UVH A;  4YAP A;  1BYE A;  4L5O A;  3DD3 A;  5D9T A;  4G0I A;  5GSS A;  4HZ2 A;  5BMU A;  3TOT A;  4IKH A;  1K3Y A;  2HRK B;  3KMO A;  2WJU A;  3GTU A;  1M0U A;  5A34 B;  5AIX A;  3F6D A;  5FT3 A;  1YY7 A;  2A2S A;  1PL2 A;  3MAK A;  2GSS A;  2PGT A;  4MPF A;  2D2Z A;  5F05 A;  2OAC A;  1Y1U A;  3VWX A;  2HSN A;  4YAV A;  2LJR A;  5ECL B;  1AQX A;  1MD4 A;  3ERF A;  2HSM B;  5BMU B;  1BAY A;  1GSS A;  1VF4 A;  3GUS A;  5G5E A;  1XW6 A;  3GTU B;  3LG6 A;  3PPU A;  3QAG A;  1LBK A;  1BG5 A;  3KMN A;  4NHZ A;  3IC8 A;  1Y6E A;  1FHE A;  4G10 A;  2EFE A;  1K0C A;  4JBB A;  5ECM B;  5ECN B;  1FW1 A;  4WR4 A;  3P90 A;  1K0O A;  3TOU A;  3ERG A;  2R3X A;  3TU3 B;  4L5L A;  4ACS A;  1PKW A;  2EFC A;  4NAX A;  1GUH A;  4DEJ A;  5DDL A;  4AKH A;  3VI7 A;  5IQY A;  1EEM A;  14GS A;  5DAL A;  5FHI A;  4MPG A;  3FRC A;  4HJ2 A;  1U3I A;  4YQM A;  1GTI A;  1GSY A;  1G6W A;  3GST A;  5J5N A;  1BG1 A;  18GS A;  4F03 A;  2CAQ A;  4MZW A;  5A1N A;  4GSN A;  3TGZ A;  5LD0 A;  5J4V A;  3CSI A;  1M99 A;  4YQV A;  3Q19 A;  4JED A;  1MD3 A;  1M9A A;  1GTU A;  3R3E A;  5A4W A;  3Q74 A;  4J2F A;  3GSS A;  3ZFL A;  4TOP A;  4AGS A;  3VPQ A;  4IW9 A;  2CA8 A;  2OAD A;  3L0H A;  1VF3 A;  1R5A A;  4ZB9 A;  3UBL A;  3FY7 A;  1K0A A;  3WYW A;  4GDF A;  1YKC A;  4OFN A;  2VCW A;  3I6A A;  1PMT A;  3F6F A;  1PX7 A;  1RK4 A;  1GUL A;  3UAP A;  5AIV A;  3GH6 A;  1B8X A;  2FHE A;  4ZB8 A;  4O92 A;  2PVQ A;  4KDX A;  3ZMK A;  1GSQ A;  1PD2 1;  1GTB A;  1K0B A;  3ZML A;  3DGQ A;  3ZFB A;  3LXT A;  5J41 A;  2R4V A;  5EY6 A;  1TXU A;  5F07 A;  1AQV A;  3UBK A;  4PQH A;  2GDR A;  1IYI A;  1PN9 A;  1HNB A;  2HRK A;  3QAW A;  5A34 A;  4FQU A;  1K0D A;  4PNF A;  2YCD A;  4USS A;  4LMV A;  3I69 A;  3NIV A;  2C8U A;  2GST A;  4E68 A;  3QAV A;  1HQO A;  3LJR A;  1EOG A;  4QMK A;  3M8N A;  1TU8 A;  4KDU A;  5G5F A;  4PTS A;  2HSM A;  2EFD A;  2WRT A;  5GZZ B;  1MTC A;  1YJ6 A;  4PUA A;  2VCX A;  4Q5N A;  2VCV A;  2VKZ G;  3FR3 A;  4IBP A;  3F63 A;  3FYG A;  4IS0 A;  5ECR B;  2VD0 A;  3IK9 A;  4F0B A;  6GSV A;  4EDZ A;  4NHW A;  4EC0 A;  3LYP A;  4ZBD A;  8GSS A;  1G7O A;  4KF9 A;  2AB6 A;  4G0L A;  1B48 A;  4IQA A;  1PGT A;  2UZ8 A;  2JL4 A;  3LYK A;  1XW5 A;  4GF0 A;  2F8F A;  6GSS A;  1KBN A;  1N25 A;  5LCZ A;  4MP4 A;  3AY8 A;  3R2Q A;  1SVM A;  5AGY A;  1Q4J A;  4K0G A;  2YV7 A;  5ECS A;  22GS A;  5DQS A;  4BL7 A;  1EV9 A;  2N5F A;  4W66 A;  4CHS A;  1GSF A;  3M3M A;  1U88 A;  4AKG A;  2PBJ A;  2DC5 A;  2CAI A;  2GLR A;  5JCU A;  4Q5Q A;  2R6K A;  4KGI A;  1HNC A;  5ELG A;  4G9H A;  5ECI B;  3O3T A;  1ML6 A;  4BL7 B;  1TW9 A;  2AHE A;  4KH7 A;  1A0F A;  1JLW A;  5ECK B;  4E8E A;  4N0V A;  1USB A;  2NTO A;  5D9X A;  4ECC A;  5A5H A;  1GUK A;  4AKX B;  5JCW A;  5AIS A;  1ZGN A;  1LJR A;  1YVL A;  3KTL A;  4GLT A;  1V2A A;  5EVO A;  3LQ7 A;  4BVY B;  1NHY A;  5D9W A;  1PX6 A;  3EIN A;  4PGT A;  5ECQ B;  4ZB6 A;  4EXJ A;  2C4J A;  2WDU A;  2GSR A;  1AXD A;  4IQ1 A;  2DSA A;  1K3O A;  5A5H B;  4EE0 A;  2R5G A;  2HNL A;  5GST A;  3G7I A;  2C3T A;  2CZ2 A;  1Z9H A;  2GTU A;  4KAE A;  3CRT A;  1F3B A;  1M9B A;  5ECP B;  1PKZ A;  1GNW A;  1SVL A;  1YDK A;  4F0C A;  3HJM A;  2X64 A;  4HOJ A;  2C3N A;  3P8W A;  16GS A;  4MF6 A;  2HRA A;  3QR6 A;  4OFT A;  3N9J A;  1AW9 A;  1GUM A;  3Q18 A;  1OE8 A;  2WS2 A;  2UV8 G;  5ECH B;  4ZXG A;  2HQT A;  5DAK A;  6GST A;  3FR9 A;  3GX0 A;  3EE2 A;  4L8E A;  3KJY A;  4RI6 A;  4PUR A;  12GS A;  1BX9 A;  2H1L A;  4PNG A;  3VLN A;  4PQI A;  1F3A A;  5FWG A;  2C3Q A;  11GS A;  1YQ1 A;  4ZBB A;  4AI6 A;  1GLP A;  5F0G A;  4YQU A;  1IYH A;  5DAK B;  3RBT A;  4KSM A;  4MDC A;  2C80 A;  3CSJ A;  4WR5 A;  5EL8 A;  1VF2 A;  4ECB A;  4KX4 A;  10GS A;  1JZR A;  4MF7 A;  5D73 A;  3SWL A;  4KE3 A;  4G0K A;  4MK3 A;  1TDI A;  4ECJ A;  4O7H A;  1DUG A;  2VCQ A;  3IR4 A;  5ECO B;  1C72 A;  2VO4 A;  5KEJ A;  4PX1 A;  1VF1 A;  2PMT A;  4PXO A;  1ZL9 A;  1G6Y A;  3HJO A;  1K3L A;  6GSY A;  5J4U A;  3H1N A;  1UA5 A;  4GST A;  2IMK A;  2WB9 A;  3D0Z A;  5DCG A;  4BVX A;  4OMV A;  1XWG A;  3HMJ G;  2YV9 A;  5HFK A;  2VD1 A;  4OFM A;  4Q5R A;  3M0F A;  4GSS A;  1F2E A;  3CBU A;  1XWK A;  2VCZ A;  2OA7 A;  3BBY A;  3CWG A;  1HNA A;  5J47 A;  4ECI A;  1BF5 A;  3ISO A;  3PR8 A;  5D9V A;  4G01 A;  4ZB7 A;  4HZ4 A;  2IL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...