1KBNA

Glutathione transferase mutant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQASFADANLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Crystal Structure of Glutathione transferase mutant
rcsb
source organism Homo sapiens
total genus 80
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2001-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1kbnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1kbnA01
1YJ6A 4OO4A 4HDEA 2OADA 4KSMA 5DALB 3HJOA 3KTLA 3KTBA 2C80A 3FKFA 2HYXA 3APOA 2LRTA 3VI7A 1T3BA 1KNGA 3CRTA 3KMOA 2RM6A 3EE2A 2K9FA 1OYJA 4YAPA 2H6YA 3E3EA 5IO2A 4LL4B 2ON7A 1V2AA 3CSIA 3TKRA 1N2AA 3I9V2 1B8XA 3L78A 1GSDA 3IK7A 3VI5A 3DYRA 4OFMA 4KE3A 1YY7A 3QAGA 2P0GA 5ECOB 4ECCA 3L0HA 3HZ8A 3A5WA 4TR4A 2F9SA 1Z3EA 2OBKA 4PQIA 5AISA 2DBCA 1THXA 3EMPA 1TRWA 1WJKA 3W8SA 4Q5FA 1Z6NA 1AW9A 4BL7A 2ZNMA 1SK1A 4MZCA 1EP8A 3ED3A 1YEPA 1S3CA 3CTFA 5ELGA 2HRAA 4XCSA 1Z7RA 3GKXA 1LBKA 1PX7A 4FYCA 4I5QA 3L9VA 1RW1A 1M2AA 4MABA 2O7KA 5ECRB 1ACVA 1AQVA 4PTSA 5ECMB 2FA4A 4BVYA 1M7TA 2K6VA 1TRVA 2H1GA 5CNWA 3ZL5A 5C00A 3FZ5A 1ERVA 2FA8A 3WGDA 4PUFC 1FVKA 1V40A 2H6XA 4CDOA 1QQ2A 3CXGA 3LJRA 4MJCA 4TR1B 4HZ4A 3UJ1A 5DQSA 3FZ9A 1UC7A 2JU5A 2VL2C 4IN0A 2IMFA 1NW2A 4WF4A 3C1RA 2XBIA 2L5OA 3TOUA 2H0HA 1QUWA 4HU7A 2VCQA 4EL1A 2GVPA 5GZZB 1R5PA 4K9ZA 2GGTA 2OACA 3PINA 5HFKA 2VD1A 1GH2A 1MDJA 1XVWA 1Y6EA 2L4QA 4Q5RA 2VLVA 2AV4A 3JCML 3APSA 2VIMA 5GAPD 2EIQA 4PNFA 4OD7A 1SJZA 5HQPA 3UMAA 2WDUA 1B9YC 5DJMA 3E9JB 2PERA 4QL7A 4IJ3A 3TUEA 1O8WA 3HDCA 3LG6A 3W8JA 1EV9A 2CX3A 2LRNA 2N5FA 5CRDA 2F51A 1FOVA 4O5RA 5ID2A 1VRSD 4F9ZA 2J9HA 4XIHA 3G7YA 2LQOA 3WT2A 4HU9A 3MNGA 3D4TA 1HD2A 4HJ2A 2HT9A 3FR6A 2O87A 3UVTA 4MJAA 2DMLA 4HOJA 2GDRA 4WBRD 3ZITA 2HSMB 3GX8A 1K0BA 2VCZA 1JZWA 5A4VA 3A2XA 2H72A 2CZ2A 4TVEA 3VWUA 4IHUA 4G0IA 3VK9A 2M80A 2C0FA 13GSA 4G0KA 4ZILA 9GSSA 2KLXA 2IFQA 2FHEA 2HSHA 1JHBA 2I3YA 1KTEA 4TRXA 3ERWA 4IQ1A 4G19A 2O8VB 4I2UA 1B4QA 4OCFA 2IPAA 3Q74A 2K8VA 2NPBA 1GSFA 5JCWA 4WF5A 5H5QA 1NSWA 5ABRA 6GSUA 3N9JA 2PMTA 2LUSA 1WIKA 1X9SB 1VF1A 2B6MA 3LSZA 2GT6A 3TKPA 3UARA 1HYUA 3J7Yb 4EO3A 5F0GA 5DVBA 3APQA 3ERGA 3US3A 3ZIJA 2LRCA 4E8EA 3J7Yk 4BWSA 3BOAA 1GP1A 4EKZA 1G7OA 4H86A 5CO3A 5IMDA 2H0GA 4NV2A 3FEUA 1TTZA 1WWJA 2JZRA 3W6GA 2VO4A 5ECSA 1GL8A 4MA9A 1EEJA 1F37A 4AGSA 1WPIA 2L59A 1AQWA 1AC1A 4BL7B 1AUCA 4GF0A 1V57A 1TRUA 1ZMAA 3VURA 3GH9A 1T7PB 1TDIA 4IQAA 2R5GA 1EGRA 1Z5YE 3GKKA 1MDKA 3OR5A 4NMUA 2K8SA 1EGOA 4MZWA 5F06A 3M0FA 3CSJA 3UAPA 1YEXA 5CAXA 2ON5A 2HQTA 4F0CA 5CYYA 3H93A 4GQFA 2IMKA 1U6TA 4BVYB 3F63A 2WS2A 2FUG2 3FW2A 1GUKA 1M2DA 2BMXA 1K3OA 1PGTA 2RLIA 2YJHA 2DJ1A 2BJXA 3F0IA 4KSOA 1F3BA 2PVQA 1RK4A 4ACSA 2CQ9A 2KOKA 2WCIA 1ERWA 4KNDA 5HR1A 3VWXA 5DCHA 3EMXA 3ERFA 2LSTA 2CT6A 5COHA 2MMOA 2GSQA 4TN8A 1K0AA 4JZQA 3D0ZA 4KDYA 1XW6A 1NM3A 1R5AA 2NDOA 3RPPA 3ZZXA 4NPBA 3ZYWA 3FHKA 2FLSA 4N0ZA 4JBBA 2WB9A 1GUHA 4ZBBA 5LD0A 3DIEA 4F2IA 2HNLA 4USSA 2IN3A 3ZIVA 3KM6A 1OVNA 2H01A 2GTUA 5ECNB 1X5CA 3DMLA 4JRRA 5G5EA 4MF6A 4PQHA 1THOA 4TXVA 3C1SA 3L4NA 3SWLA 3QFBC 3BD2A 5B6NA 2YJ7A 1SKSB 4MP4A 1G0TA 1F3AA 1YKCA 2QC7A 2TRCP 1S3DA 3ZLPA 5IMVA 4KDUA 4WEYA 1SD8A 5E4WA 3EURA 2G0FA 2JL4A 4PQ1A 4EXJA 4XTSA 1ZCPA 2HRNA 2YCDA 3GSTA 3KXOA 2CAIA 5D96A 1JZRA 1OC9A 3HKRA 3KH7A 4OO5A 5CP1A 3ZVJD 1A0RP 5ID2B 4ZB9A 4NHWA 3RPNA 1R26A 5ECPB 1ZYEA 5B8BA 4CHSA 4MF5A 1SJ6A 2GQKA 3QAVA 1O6JA 5FT3A 4FYBA 2AAWA 3IC8A 4G0LA 2VCTA 3ISOA 2B1LA 1O81A 1GSSA 2VOCA 3R3EA 5IIZA 3ME8A 5IMAA 2KUCA 3FZAA 2P5RA 2DIZA 2IFQB 4V2LA 2HZEA 1A8LA 3TKSA 2A4VA 1GNWA 3PGTA 3BJ5A 4BA7A 2CAQA 3VWWA 2LJKA 3BCKA 5AIVA 2DJ2A 3LWAA 2K18A 1ON4A 3WYWA 3TOTA 1EOGA 4Q5QA 3IDVA 1A2JA 2OKAA 2V32A 3H1NA 1XW5A 3FZ4A 4IBPA 2HE3A 2GT5A 1XOBA 16GSA 4FH8A 3LEFA 5INYA 1DE1A 4F82A 2OBIA 1FAAA 5J5NA 4Q5NA 2VL2A 2ZUPA 1GNEA 5JWRB 5J9CA 3FRCA 2YZHA 4JR6A 3EC3A 4J57E 2LJAA 3IC4A 4ZXGA 3TJJA 2B5XA 10GSA 2FWGA 2WGRA 4N10A 4F0BA 2KP1A 4F03A 5HR2A 1ABAA 2H1BA 1B48A 4L5OA 1GTAA 4IW9A 2R4VA 1Q98A 2D2ZA 1Z6MA 5HR3A 2GSRA 4TW5A 3QCPA 3TKSE 3DEXA 2A2SA 5F07A 5ECLB 5D8IA 5DJLA 1CQHA 1TK8B 1XZOA 1HNAA 1XIYA 5G30A 1URMA 1EV4A 3N5OA 3MDKA 2C0EA 3EU3A 5GSTA 4ISDA 3HJPA 2GQMA 1ZL9A 4MH3A 4AF2A 5A5KA 4KW6A 5HFIA 2WULA 12GSA 1ILOA 1M99A 5D9VA 4RI6A 1VF4A 4FO5A 2IL3A 2X99A 3HJMA 3C7MA 4DEJA 2V6KA 4EDYA 5HR0A 2WRTA 2H75A 5H5SA 1I5GA 4BVXA 3ZTLA 3GH6A 1QMVA 4GLTA 4V2MA 5E59A 1AXDA 3D4MA 2I81A 4ZIJA 5B8AA 2PBJA 1TXXA 5LCZA 5KN2A 4XRDA 1K0DA 3F4SA 1PD21 3IK9A 3EU4A 4NWYA 4YQVA 3GUSA 1TI3A 4AJ6A 3F8UA 3TRPA 3IAM2 1BG5A 4GSSA 1TK0B 1WOUA 2HRFA 1X9WB 1SL2B 2IJYA 2FD3A 4PURA 2V1MA 3IA1A 3CMIA 2PGTA 2LQQA 1ZGNA 2H74A 1AQXA 3CBUA 4RI7A 2VLUA 1XWAA 3VPTA 1MDIA 3CSHA 1Q4JA 4TOPA 4ZB6A 3E0UA 4N0VA 4L5LA 4POLA 1SYRA 1GWCA 3O3TA 2C3NA 4QQ7A 1U3IA 1GSQA 1V58A 1M2BA 2YANA 3I6AA 3GRXA 4I97A 2M72A 4LMWA 7GSSA 3HD5A 1OC9B 3L9UA 4K7OA 18GSA 3GX0A 1E2YA 4YH2A 2EC4A 4NHZA 5DCGA 1QFNA 3KEBA 5JWQB 3LQ7A 2WZ9A 4DSQA 2GQLA 3LFLA 2JSYA 1PMTA 1SJIA 4HS1A 2O85A 3GMFA 4JE1A 2CV4A 1BQ7A 1V9WA 4RQRA 3GL3A 1UN2A 1U88A 3F6FA 3R2QA 1XXUA 1YQ1A 3KIJA 5DBQA 2B5EA 1OAZA 1MTCA 3TCOA 4XRAA 1GUMA 4MJBA 3D21A 3Q6OA 2HZEB 2PWJA 4CW9A 4YQUA 4WBJA 4LL1B 2B7KA 4Z7XA 20GSA 3TKQA 2OE0A 1TU8A 3M9JA 4TKYA 4ZB8A 1O7UA 2DLXA 1YKAA 3H8QA 3L9SA 4N11A 3IV4A 2NBSA 14GSA 1FO5A 1F2EA 1ZOFA 1G6YA 3P90A 4O32A 3ZREA 1GSEA 4JEDA 4MDCA 1O8XA 3NZNA 4ZL8A 5EL8A 2LNTA 3LGCA 1Z7PA 1IYIA 4WR4A 1VF3A 5AIXA 1O73A 4IP1A 4ML1A 2DJKA 3TJBA 2HRKA 3PR8A 4DSRA 4XS1A 5FWGA 1SL0B 2GS3A 4POKA 1M0UA 5G5FA 3VLNA 3A2WA 5IM9A 1K0OA 2TIRA 2TRXA 4IKHA 3S9FA 2LNSA 4KCEA 4DSSA 5JCUA 5F8BA 3CYNA 4P3YB 4K2DA 1A24A 3HVSA 3F4TA 5FHIA 1T4YA 2FY6A 3ZFLA 2X8CA 2HZFA 4OCEA 3IXRA 2C4JA 2VL3A 5GSSA 1J08A 5ELAA 4EE0A 1KBNA 2MZCA 3IAS2 1SK2A 2EIOA 6GSWA 3IPZA 1BYEA 4PNGA 4NV5A 1J0FA 4IVFA 1PSQA 5AN1A 2FWEA 1BX9A 1MEKA 2LTKA 1IYHA 5CRWA 3I43A 4POMA 3DVXA 3GL5A 4GSTA 1W4VA 4K7NA 5BMUA 1JZOA 4BVXB 3QD9A 4WXTA 4TR1A 2NVLA 2VD0A 2PUKC 2YP6A 2LS5A 2I1UA 4MPFA 3FY7A 5IOWA 3GURA 2L6CA 3EYTA 1Y25A 1WE0A 4K7IA 2LV3A 4O7HA 1OKDA 1ZZYA 1DUGA 3M9KA 4XS6A 1VGLA 2DSAA 4ZBAA 2HI7A 3LYPA 4OMVA 3FR3A 1XWKA 2FWHA 2ZCTA 3M1GA 2MMZA 5D9XA 2C8UA 2PU9C 3KGKA 3GV1A 2FGXA 5IMCA 3RHBA 3ME7A 4MLYA 2XPEA 3A2VA 2BTOT 1GLPA 5DAKA 1EWXA 1MD3A 3V1WA 3VWVA 5D9WA 1JLVA 4KUNA 2C0DA 5LNKe 3QMXA 1T8EB 3MAKA 2REMA 2B7JA 2M46A 5C04A 1X9MB 1PL2A 3WGXA 1J9BA 2DIYA 2FWFA 5H5RA 2O89A 4KGIA 4OFTA 1A8YA 3NIVA 1X0RA 3KP8A 4PXOA 1SKRB 5IMFA 2GZPA 4MMMA 3TJGA 1SD9A 2H66A 11GSA 5IMZA 1OKTA 4KDXA 3MSZA 4YAVA 2EIRA 3M3MA 1PN9A 1XWBA 1H4OA 2V41A 3GKNA 2AJQB 2OA7A 3KJYA 2AYTA 3HCZA 5KN3A 3DKSA 1FVJA 5KN1A 3LXZA 4EDZA 1TOFA 1OE7A 2VCXA 5CRGA 4KCAA 5J41A 2IIYA 6GSXA 2H1DA 1K3LA 4IP6A 4GCIA 1YDKA 4EC0A 2AUVA 3HXSA 2L5LA 3SBCA 3HHVA 3F6DA 2YWOA 3P7XA 5EY6A 3A3TA 3GA4A 5G1LA 4JU5A 2CX4A 2MBSA 1TW9A 3QOUA 4GRFA 2R2JA 4DVCA 1XBSA 4MZBA 2I9HA 1A0FA 3GN3A 1TK5B 2HLSA 4EVMA 3H4KA 4IJIA 4HJMA 2JADA 2AB6A 2KHPA 2XBQA 2YOIA 2R3XA 2PN8A 3FR9A 4IGJA 3F3QA 3UEMA 4TR3A 2YWNA 4K6XA 3U5RE 5A4UA 1AIUA 1T1VA 4L8EA 2YZUA 5CREA 2B3SA 1G7EA 2YNXA 4TXOA 2IMDA 4XHMA 4PGTA 4FIWA 2WFCA 2OE1A 3VPQA 2LKUA 3LORA 1GSUA 1XWCA 3O76A 1TP9A 4X43A 5IQYA 4HZ2A 1W89A 3C73A 1DSBA 2HRKB 3KH9A 1FG4A 3DXBA 3IHQA 4HUAA 3TRXA 3QAWA 5B6MA 4N30A 4V1Ag 4MF7A 2R6KA 1PRXA 3EWLA 2H0IA 1TJDA 4DSSB 1USBA 3KP9A 2X8GA 2P5QA 2E0QA 3PH9A 5CRHA 1OC3A 2E2MA 2CA8A 1U3AA 3WGEA 2H1AA 1R7HA 2AHEA 3RDWA 5ECQB 2C3QA 3WD6A 1T00A 4OWYA 2H6ZA 1ERUA 4JR4A 3C8EA 1YF1A 2YWIA 2GZZA 4X0XA 1N8JA 3TRQA 3TKSC 4RUVA 4L0WA 4EUYA 3KD0A 4AJ8A 4KA0A 2VM2A 22GSA 2YV9A 1EZKA 1RQMA 1M9AA 5ECHB 2A2RA 1S3AA 1XPVA 4KH7A 3P8WA 3KCMA 6GSVA 5IPGA 2H8LA 3GKMA 3EINA 3ZRDA 1ZYQB 1SU9A 1EP7A 4G9HA 2JSZA 2H71A 4HQZA 3LXTA 2QKEA 3C71A 1A2LA 3H79A 3D6IA 3K8NA 2IWTA 2RM5A 1SYXA 3QPMA 1HNBA 1OE8A 2GSSA 3KMNA 2QSIA 4ECJA 2ES7A 2OE3A 1H75A 2OJLA 1ERTA 4ML6A 5G31A 1G6WA 3GSSA 5DDLA 6GSTA 2V6OA 1XW9A 2QGVA 5EPFA 2ALBA 4G10A 3D22A 5G1KA 3HZ4A 4WKWA 2VUPA 3DWVA 5D9TA 5DAKB 1JZDA 4X1UA 2DMMA 2JZTA 1Z9HA 1HQOA 1E6BA 4TR0A 3GYKA 3VFIA 2PVOC 1LU4A 4GXZA 3G9BA 4AJ7A 2YV7A 3G7JA 2GZYA 4FYUA 1DE2A 1NHYA 4HI7A 2MMNA 17GSA 5D93A 1XCCA 5JWOB 3GTUA 4I8BA 3UBKA 3TJKA 1A23A 1A2MA 1DBYA 1X5EA 2RUEA 3TJFA 1U87A 3WT1A 1QGVA 3FYGA 2NTOA 8GSSA 4WETA 1VF2A 4G2EA 4D73A 2H19A 3FK8A 1C72A 2H70A 5F05A 1PA3A 4ULXA 4HEA2 4YQMA 2E7PA 5GAND 4I6XA 3HA9A 2HSNB 2YWMA 2P31A 2L57A 4J56E 1X5DA 2DJ3A 3I69A 3F4RA 2GSTA 3GFKA 2B1KA 1XFLA 2N5AA 4XS4A 2CVBA 4GWRA 3RAZA 2VAFA 2J23A 4K8MA 1R4WA 3IR4A 19GSA 4QL9A 3ZFBA 1PX6A 2IMEA 3HY2A 2CZ3A 5DALA 2X64A 4PUAA 2LJRA 2DC5A 1BEDA 1UA5A 4NXIA 2I4AA 5G2ZA 1ST9A 5D73A 3EVIA 1K3YA 1JFUA 1KEBA 1GSYA 2VL9A 3MWHA 4E8HA 3DVWA 2UZ8A 2VLTA 4ILFA 5IPHA 4FQUA 4J2FA 1EEMA 4ZBDA 4KX4A 4O92A 1QXHA 3GIXA 2WJUA 2VCWA 1QK8A 2V2GA 1GTBA 3RBTA 1NHOA 1GTUA 1TU7A 3HVXA 5IO0A 1V98A 5EVOA 2XHFA 2RIIA 5J4UA 4KB3A 5JCGA 1M9BA 4PX1A 4TXOB 4IELA 3NOFA 4MK3A 1FB0A 1WP0A 2C0GA 3TDGA 2C1YA 3BBYA 1SL1B 2MYGA 3F9UA 2JACA 2Z9SA 3HYPA 1T4ZA 2H30A 4POBA 1I9DA 4K0GA 3UVHA 1SENA 2C3TA 2R37A 1PKWA 4MH2A 3CRUA 2X8HA 4RQXA 2FNOA 2JZSA 2CVDA 4ECIA 4MCUA 3GHAA 3PPUA 2E2GA 1GRXA 4ID0A 1FHEA 1XWGA 4EF0A 2VCVA 4K0NA 5DQYA 2MBTA 3Q18A 4GTUA 4WR5A 1JLWA 1F6MC 2GLRA 2IMIA 3M8NA 1GLQA 1GULA 2HSYA 1FB6A 3U6VA 5HFGA 5AGYA 2YPMA 1O85A 3IE3A 5ECIB 3IRAA 2CVKA 4ZL9A 3IOSA 2YN1A 1BJXA 2N5BA 2F3MA 3AY8A 2PPTA 3DRNA 3GNJA 3DGQA 1CQGA 4KF9A 1XVQA 1B9XC 2XC2A 1GTIA 3ZMKA 1F9MA 3RHCA 4BWQA 3BCIA 2LEGA 3ZVJA 1K0CA 1AAZA 3QDNA 1PKZA 1FW1A 3P2AA 3HVVA 3TB2A 3TGZA 3F3RA 1EOHA 3UIWA 2KP2A 2FCHA 3UOMA 1TRSA 3QFAC 5J9BA 1B4PA 3UBLA 4HQSA 4ECBA 2G2QA 2VM1A 4MJEA 1HNCA 1WRYA 1K0MA 3UL3A 2MMAA 1BAYA 2F8AA 3CTGA 1MD4A 4K1FA 2F8FA 4V2NA 3Q19A 3G7IA 5IOXA 4L0UA 2RUFA 3O6TA 3GTUB 4LMVA 1WMJA 2L6DA 5J3RA 2HXKA 4IS0A 2L4CA 4LLRA 2XPDA 1SK0A 4LA1A 1SKWB 3ZMLA 5KN0A 3D5JA 1TKDB 4V1Ap 3LYKA 6GSSA 4GSNA 1PL1A 1TI1A 5ENUA 4MPGA 6GSYA 2B5YA 4GQCA 2DJJA 2H76A 4BPYA 5A4WA 4D73B 1YZXA 5ECKB 2HSMA 4OFNA 3KZQA 4I2TA 1OC8A 2DJ0A 1UVZA 4KAEA 4NAXA 2H73A 1XOAA 2HFDA 1K0NA 5KEJA 3QR6A 4XS4B 5L71A 1LJRA 1ML6A 1YF0A 5B7CA 3IBHA 1PQNA 4ZL7A 3DD3A
chains in the Genus database with same CATH superfamily
1YJ6A 4OO4A 4HDEA 2OADA 4KSMA 5DALB 3HJOA 3KTLA 3KTBA 2C80A 3FKFA 2HYXA 3APOA 2LRTA 3VI7A 1T3BA 1KNGA 3CRTA 3KMOA 2RM6A 3EE2A 2K9FA 1OYJA 4YAPA 2H6YA 3E3EA 5IO2A 4LL4B 2ON7A 1V2AA 3CSIA 3TKRA 1N2AA 3HVNA 3I9V2 1B8XA 4GDFA 3L78A 1GSDA 3IK7A 3VI5A 3DYRA 4OFMA 4KE3A 1YY7A 3QAGA 2P0GA 5ECOB 4ECCA 3L0HA 3HZ8A 3A5WA 4TR4A 2F9SA 1Z3EA 2WVYA 2OBKA 4PQIA 5AISA 2DBCA 1THXA 3EMPA 1TRWA 1WJKA 1XG8A 3W8SA 4Q5FA 1Z6NA 1AW9A 4BL7A 2ZNMA 1SK1A 4MZCA 1EP8A 3ED3A 1YEPA 1S3CA 3CTFA 5ELGA 2HRAA 4XCSA 1Z7RA 3GKXA 4Z2RA 1LBKA 1PX7A 4FYCA 4I5QA 3L9VA 1RW1A 1M2AA 4MABA 2O7KA 5ECRB 1ACVA 1AQVA 4PTSA 5ECMB 2FA4A 4BVYA 1M7TA 2K6VA 1TRVA 2H1GA 5CNWA 4N3ZA 3ZL5A 5C00A 3FZ5A 1ERVA 2FA8A 3WGDA 4O5UA 4PUFC 1FVKA 1V40A 2H6XA 4CDOA 1QQ2A 3CXGA 3LJRA 4MJCA 4TR1B 4HZ4A 3UJ1A 4CY8A 5DQSA 3FZ9A 1UC7A 1FOHA 2JU5A 2VL2C 2IMFA 4IN0A 1NW2A 4WF4A 3C1RA 2EFCA 2XBIA 2L5OA 4FXYP 2QA2A 3TOUA 2H0HA 1QUWA 4YKGA 4HU7A 2VCQA 4EL1A 1I1IP 2GVPA 5GZZB 1R5PA 4K9ZA 2GGTA 3CHXC 2OACA 3PINA 5HFKA 2VD1A 1GH2A 1MDJA 1XVWA 1Y6EA 2L4QA 4Q5RA 2VLVA 4PI0C 2AV4A 3JCML 3APSA 2VIMA 5GAPD 2EIQA 4PNFA 4OD7A 1SJZA 5HQPA 3UMAA 2WDUA 1B9YC 5DJMA 3E9JB 2PERA 4QL7A 4IJ3A 3TUEA 4AKGA 1O8WA 3HDCA 3LG6A 3W8JA 1EV9A 2CX3A 2LRNA 2N5FA 5CRDA 2F51A 1FOVA 4O5RA 5ID2A 1VRSD 4F9ZA 2J9HA 4XIHA 3G7YA 2LQOA 3WT2A 4HU9A 3MNGA 3D4TA 1HD2A 4HJ2A 2HT9A 3FR6A 2O87A 3UVTA 2EFDA 4MJAA 2DMLA 4HOJA 2GDRA 4WBRD 3ZITA 2HSMB 3GX8A 1K0BA 2VCZA 1JZWA 5A4VA 3A2XA 2H72A 2CZ2A 4TVEA 3VWUA 4IHUA 4G0IA 3VK9A 2M80A 2C0FA 13GSA 4G0KA 4ZILA 9GSSA 2KLXA 2IFQA 2FHEA 2HSHA 1JHBA 2I3YA 1KTEA 4TRXA 3ERWA 4IQ1A 4G19A 2O8VB 4I2UA 1B4QA 4OCFA 2IPAA 3Q74A 2K8VA 2NPBA 1GSFA 5JCWA 4WF5A 5H5QA 1NSWA 5ABRA 4Z2UA 6GSUA 3N9JA 2PMTA 2LUSA 1WIKA 1X9SB 1VF1A 2B6MA 3LSZA 2GT6A 3TKPA 2WW0A 3UARA 1HYUA 3J7Yb 4EO3A 5F0GA 5DVBA 3APQA 3ERGA 3US3A 2O5VA 3ZIJA 2LRCA 4E8EA 3J7Yk 4BWSA 3BOAA 1GP1A 4EKZA 1G7OA 4H86A 5CO3A 5IMDA 2H0GA 4NV2A 3FEUA 1TTZA 1WWJA 4E68A 2JZRA 3W6GA 2VO4A 5ECSA 1GL8A 4MA9A 1EEJA 1F37A 4AGSA 1WPIA 2L59A 1AQWA 1AC1A 4BL7B 1AUCA 4GF0A 1V57A 1TRUA 1ZMAA 3VURA 3GH9A 1T7PB 1TDIA 4IQAA 2R5GA 1EGRA 1Z5YE 3GKKA 1MDKA 1PFOA 3OR5A 4NMUA 2K8SA 1EGOA 4MZWA 5F06A 3M0FA 3CSJA 3UAPA 1YEXA 5CAXA 2ON5A 2HQTA 4F0CA 5CYYA 3H93A 1M3IA 4GQFA 2IMKA 1U6TA 4BVYB 3F63A 2WS2A 2FUG2 3FW2A 1GUKA 1M2DA 2BMXA 1K3OA 1PGTA 2RLIA 2YJHA 2DJ1A 2BJXA 3F0IA 4KSOA 1F3BA 2PVQA 1RK4A 4ACSA 2CQ9A 2KOKA 2WCIA 1PN0A 1ERWA 4KNDA 5HR1A 3VWXA 5DCHA 3EMXA 3ERFA 2LSTA 2CT6A 5COHA 2MMOA 2GSQA 4TN8A 1K0AA 4JZQA 2R0CA 3D0ZA 4KDYA 1XW6A 1NM3A 1R5AA 2NDOA 3RPPA 3ZZXA 4NPBA 3ZYWA 3FHKA 2FLSA 4N0ZA 4JBBA 2WB9A 1GUHA 4MNNA 4ZBBA 5LD0A 3DIEA 4F2IA 4YKFA 2HNLA 1SVMA 4USSA 2IN3A 3ZIVA 3KM6A 1OVNA 2H01A 2GTUA 5ECNB 1X5CA 3DMLA 4JRRA 5G5EA 4MF6A 4PQHA 1THOA 4TXVA 3C1SA 3L4NA 3SWLA 3QFBC 3BD2A 5B6NA 2YJ7A 1SKSB 4MP4A 1G0TA 1F3AA 1YKCA 2QC7A 2TRCP 1S3DA 3ZLPA 5IMVA 4KDUA 4WEYA 1SD8A 5E4WA 3EURA 2G0FA 2JL4A 4PQ1A 4EXJA 4XTSA 1ZCPA 2HRNA 2YCDA 3GSTA 3KXOA 2CAIA 5D96A 1JZRA 1OC9A 3HKRA 3KH7A 4OO5A 5CP1A 3ZVJD 1A0RP 5ID2B 4ZB9A 4NHWA 3RPNA 1R26A 5ECPB 1ZYEA 5B8BA 4CHSA 4MF5A 1SJ6A 2GQKA 3QAVA 1O6JA 5FT3A 4FYBA 2AAWA 3IC8A 4G0LA 1S3RA 2VCTA 3ISOA 2B1LA 1O81A 1GSSA 2VOCA 3R3EA 4EIPA 5IIZA 3ME8A 1YEWC 5IMAA 2KUCA 3FZAA 2P5RA 2DIZA 2IFQB 4EIQA 4V2LA 2HZEA 1A8LA 3TKSA 5A5HA 2A4VA 1Y1UA 1GNWA 3PGTA 3BJ5A 4BA7A 2CAQA 4CY6A 3VWWA 2LJKA 3BCKA 5AIVA 2DJ2A 3LWAA 2K18A 1ON4A 3WYWA 3TOTA 1EOGA 4Q5QA 3IDVA 1A2JA 2OKAA 2V32A 3H1NA 3FZ4A 1XW5A 4IBPA 2HE3A 2GT5A 1XOBA 16GSA 4FH8A 3LEFA 5INYA 1DE1A 4F82A 2OBIA 1FAAA 5J5NA 4Q5NA 2VL2A 2ZUPA 1GNEA 5JWRB 5J9CA 3FRCA 2YZHA 4JR6A 3EC3A 4J57E 2O36A 2LJAA 2WVXA 3IC4A 4ZXGA 3TJJA 2B5XA 10GSA 2FWGA 2WGRA 1YVLA 4N10A 4F0BA 2KP1A 4F03A 5HR2A 1ABAA 4K5RA 2H1BA 1B48A 4L5OA 1GTAA 4IW9A 2R4VA 1Q98A 2D2ZA 1Z6MA 5HR3A 2GSRA 4TW5A 3QCPA 2EFEA 3TKSE 3DEXA 2A2SA 5F07A 5ECLB 5D8IA 3IHGA 5DJLA 1CQHA 1TK8B 1XZOA 1HNAA 1ZYPA 1XIYA 5G30A 1URMA 1EV4A 3N5OA 3MDKA 2C0EA 3EU3A 5GSTA 4ISDA 3HJPA 2GQMA 1ZL9A 4MH3A 4AF2A 5A5KA 4KW6A 5HFIA 2WULA 12GSA 1ILOA 1M99A 5D9VA 4RI6A 1VF4A 4FO5A 2IL3A 2X99A 3HJMA 3C7MA 4PHZC 4DEJA 2V6KA 4EDYA 1S4BP 5HR0A 2WRTA 2H75A 5H5SA 1I5GA 4BVXA 3ZTLA 3GH6A 1QMVA 4GLTA 3EPTA 4V2MA 5E59A 1AXDA 3D4MA 2EFHA 2I81A 4ZIJA 5B8AA 2PBJA 1TXXA 5LCZA 2X4AA 5KN2A 4XRDA 1K0DA 3F4SA 1PD21 3IK9A 3TU3B 3EU4A 4NWYA 4YQVA 3GUSA 1TI3A 4AJ6A 3F8UA 3TRPA 3IAM2 1BG5A 4GSSA 1TK0B 1WOUA 2HRFA 1X9WB 1SL2B 2IJYA 2FD3A 4PURA 2V1MA 3IA1A 3CMIA 2PGTA 2LQQA 1ZGNA 2H74A 1AQXA 3CBUA 5J40A 4RI7A 2VLUA 1XWAA 3VPTA 1MDIA 3CSHA 1Q4JA 4TOPA 4ZB6A 3E0UA 4N0VA 4L5LA 4POLA 1SYRA 1GWCA 3O3TA 2C3NA 4QQ7A 1SVLA 1U3IA 1GSQA 1V58A 1M2BA 2YANA 3I6AA 3GRXA 4I97A 5A34A 2M72A 4LMWA 7GSSA 3HD5A 1OC9B 3L9UA 4K7OA 18GSA 3GX0A 1E2YA 4YH2A 2EC4A 4NHZA 5DCGA 1QFNA 3KEBA 5JWQB 3LQ7A 2WZ9A 4DSQA 2GQLA 3LFLA 2JSYA 1PMTA 1SJIA 4HS1A 2O85A 3GMFA 4JE1A 3RFRC 4G01A 1BQ7A 2CV4A 1V9WA 4RQRA 3GL3A 1UN2A 1U88A 3F6FA 5J4YA 3R2QA 1XXUA 1YQ1A 3KIJA 5DBQA 2B5EA 1OAZA 1MTCA 3TCOA 4XRAA 1GUMA 4MJBA 3D21A 3Q6OA 2HZEB 2PWJA 5A5HB 4CW9A 4YQUA 4WBJA 4LL1B 2B7KA 4Z7XA 20GSA 2UV8G 3TKQA 2OE0A 1TU8A 3M9JA 4TKYA 4ZB8A 1O7UA 2DLXA 1YKAA 3H8QA 3L9SA 4N11A 3IV4A 2NBSA 14GSA 1FO5A 1F2EA 1ZOFA 1G6YA 3P90A 4O32A 3ZREA 2VKZG 1GSEA 4JEDA 4MDCA 1O8XA 3A5IA 3NZNA 4X4JA 4ZL8A 5EL8A 2LNTA 3LGCA 1Z7PA 2WVXB 1IYIA 4WR4A 1VF3A 5AIXA 1O73A 4IP1A 4ML1A 2DJKA 2WZSA 5A1NA 3TJBA 2HRKA 3PR8A 4DSRA 4XS1A 5FWGA 1SL0B 2GS3A 4POKA 1M0UA 5G5FA 3VLNA 3A2WA 5IM9A 1K0OA 2TIRA 4K5SA 2TRXA 4IKHA 3S9FA 2LNSA 4KCEA 4DSSA 5JCUA 5F8BA 3CYNA 4P3YB 4K2DA 1A24A 3HVSA 3F4TA 3CQFA 5FHIA 1T4YA 2FY6A 3ZFLA 2X8CA 2HZFA 4OCEA 3IXRA 2C4JA 2VL3A 5GSSA 1J08A 5ELAA 4EE0A 1KBNA 2MZCA 3IAS2 1SK2A 2EIOA 6GSWA 3IPZA 1BYEA 4PNGA 4NV5A 1J0FA 4IVFA 1PSQA 5AN1A 2FWEA 1BX9A 1MEKA 2LTKA 1IYHA 5CRWA 3I43A 4POMA 3DVXA 3GL5A 4GSTA 1W4VA 5KOXA 4K7NA 5BMUA 1JZOA 4BVXB 3QD9A 4WXTA 4TR1A 2NVLA 2VD0A 2PUKC 2YP6A 2LS5A 2I1UA 4MPFA 3FY7A 5IOWA 1N25A 3GURA 2L6CA 3EYTA 1Y25A 1WE0A 4K7IA 2LV3A 4O7HA 1OKDA 1ZZYA 1DUGA 3M9KA 4XS6A 1VGLA 3FMWA 2DSAA 4ZBAA 4Z2TA 2HI7A 2QA1A 3LYPA 4OMVA 3FR3A 1XWKA 2FWHA 2ZCTA 3M1GA 2MMZA 5D9XA 2C8UA 2PU9C 3KGKA 3GV1A 2FGXA 5IMCA 3RHBA 4AI6A 3ME7A 4MLYA 2XPEA 3A2VA 2BTOT 1GLPA 5DAKA 1EWXA 1MD3A 5J47A 3V1WA 3VWVA 5D9WA 1JLVA 4KUNA 2C0DA 5LNKe 3QMXA 1T8EB 3MAKA 2REMA 2B7JA 2M46A 5C04A 1X9MB 1PL2A 3WGXA 1J9BA 2DIYA 2FWFA 5H5RA 2O89A 4KGIA 4AKXB 4OFTA 1A8YA 3NIVA 1X0RA 5A34B 3KP8A 4PXOA 4W66A 1SKRB 5IMFA 2GZPA 4MMMA 3TJGA 1SD9A 2H66A 11GSA 5IMZA 1OKTA 4KDXA 3MSZA 4YAVA 2EIRA 3M3MA 1PN9A 1XWBA 1H4OA 2V41A 3GKNA 2HSNA 2AJQB 5J4VA 2OA7A 3KJYA 2AYTA 3HCZA 5KN3A 5KOWA 3DKSA 1FVJA 5KN1A 3LXZA 4EDZA 1TOFA 1OE7A 2VCXA 5CRGA 4KCAA 5J41A 2IIYA 1BG1A 6GSXA 2H1DA 1K3LA 4IP6A 4GCIA 1YDKA 4EC0A 2AUVA 3HXSA 2L5LA 3SBCA 3HHVA 3F6DA 4K2XA 2YWOA 3P7XA 5EY6A 3A3TA 3GA4A 5G1LA 4JU5A 2CX4A 2MBSA 1TW9A 3QOUA 4GRFA 2R2JA 4DVCA 1XBSA 4MZBA 2I9HA 1A0FA 3GN3A 1TK5B 3CWGA 2HLSA 4EVMA 3H4KA 4IJIA 4HJMA 2JADA 2AB6A 2KHPA 2XBQA 2YOIA 2R3XA 2PN8A 3FR9A 4IGJA 3F3QA 3UEMA 4TR3A 2YWNA 4HSCX 4K6XA 3U5RE 5A4UA 1AIUA 1T1VA 4L8EA 2YZUA 5CREA 2B3SA 1G7EA 2YNXA 4TXOA 2IMDA 4XHMA 4PGTA 4FIWA 2WFCA 2OE1A 3VPQA 2LKUA 3LORA 1GSUA 1SVOA 1XWCA 3O76A 1TP9A 4X43A 5IQYA 5A1NB 4HZ2A 1W89A 3C73A 1DSBA 2HRKB 3KH9A 1FG4A 3DXBA 3IHQA 4HUAA 3TRXA 3QAWA 5B6MA 4N30A 4V1Ag 4MF7A 4ZB7A 2R6KA 1PRXA 3EWLA 2H0IA 1TJDA 4DSSB 1USBA 3KP9A 2X8GA 2P5QA 2E0QA 3PH9A 5CRHA 1OC3A 2E2MA 2CA8A 1U3AA 3WGEA 2H1AA 1R7HA 2AHEA 2X49A 3RDWA 4A5PA 5ECQB 2C3QA 3WD6A 1T00A 4OWYA 2H6ZA 1BF5A 1ERUA 4JR4A 3C8EA 1YF1A 2YWIA 2GZZA 4X0XA 1N8JA 3TRQA 3TKSC 4RUVA 4L0WA 4EUYA 3KD0A 4AJ8A 4KA0A 2VM2A 22GSA 2YV9A 1EZKA 1RQMA 1M9AA 5ECHB 2A2RA 1S3AA 1XPVA 4KH7A 3P8WA 3KCMA 6GSVA 5IPGA 2H8LA 3GKMA 3EINA 3ZRDA 1ZYQB 1SU9A 1EP7A 4G9HA 2JSZA 2H71A 4HQZA 3LXTA 2QKEA 5BMUB 3C71A 1A2LA 3H79A 3D6IA 3K8NA 2IWTA 2RM5A 1SYXA 3QPMA 1HNBA 1OE8A 2GSSA 3KMNA 2QSIA 4ECJA 3HMJG 2ES7A 2OE3A 1H75A 2OJLA 1ERTA 4ML6A 2OT3A 5G31A 1G6WA 3GSSA 5DDLA 6GSTA 2V6OA 1XW9A 2QGVA 5EPFA 2ALBA 2DKIA 4G10A 3D22A 5G1KA 3HZ4A 4WKWA 2VUPA 3DWVA 5D9TA 5DAKB 1JZDA 4X1UA 2DMMA 2JZTA 1Z9HA 1HQOA 1E6BA 2WW1A 4TR0A 3GYKA 3VFIA 2PVOC 1LU4A 4GXZA 3G9BA 4AJ7A 2WW3A 2YV7A 3G7JA 2GZYA 4FYUA 1DE2A 1NHYA 4HI7A 2MMNA 17GSA 5D93A 1XCCA 5JWOB 2R0PA 3GTUA 4I8BA 3UBKA 3TJKA 1A23A 1A2MA 2H1LA 1DBYA 1X5EA 2RUEA 3TJFA 1U87A 3WT1A 1QGVA 1ZYNA 3FYGA 2NTOA 8GSSA 4WETA 1VF2A 4G2EA 4D73A 2H19A 3FK8A 1C72A 2H70A 5F05A 1PA3A 4ULXA 4HEA2 4YQMA 2E7PA 5GAND 4I6XA 3HA9A 3LW9A 2HSNB 2YWMA 2P31A 2L57A 4J56E 1X5DA 2DJ3A 2WW2A 3I69A 3F4RA 2GSTA 3GFKA 2B1KA 1XFLA 2N5AA 4XS4A 2CVBA 4GWRA 3RAZA 2VAFA 2J23A 4K8MA 1R4WA 3IR4A 19GSA 4QL9A 3ZFBA 1PX6A 2IMEA 3HY2A 3MYDA 2CZ3A 5DALA 4O5QA 2X64A 4PUAA 2LJRA 2DC5A 1BEDA 1UA5A 4NXIA 4BIKA 2I4AA 5G2ZA 2A2PA 1ST9A 5D73A 3EVIA 1K3YA 1JFUA 1KEBA 1GSYA 2VL9A 3MWHA 4E8HA 3DVWA 2UZ8A 2VLTA 4ILFA 1TXUA 5IPHA 4FQUA 4J2FA 1EEMA 4ZBDA 4KX4A 2O3EA 4O92A 1QXHA 3GIXA 2WJUA 2VCWA 1QK8A 2V2GA 1GTBA 3RBTA 1NHOA 1GTUA 1TU7A 3HVXA 5IO0A 1V98A 5EVOA 2XHFA 2RIIA 5J4UA 4KB3A 1M3JA 5JCGA 1M9BA 4PX1A 4TXOB 4IELA 4MK3A 1FB0A 1WP0A 3NOFA 2C0GA 3TDGA 2C1YA 3BBYA 1SL1B 2MYGA 3F9UA 2JACA 2Z9SA 3HYPA 1T4ZA 2H30A 4POBA 1I9DA 4K0GA 3UVHA 1SENA 2C3TA 2R37A 1PKWA 3RGBC 4MH2A 3CRUA 2X8HA 4RQXA 2FNOA 2JZSA 2CVDA 4ECIA 4MCUA 3GHAA 3PPUA 3MIXA 2E2GA 1GRXA 4ID0A 1FHEA 1XWGA 4EF0A 2VCVA 4K0NA 5DQYA 2MBTA 3Q18A 4GTUA 4WR5A 1JLWA 1F6MC 2GLRA 2IMIA 3M8NA 1GLQA 1GULA 4AKHA 2HSYA 1FB6A 3U6VA 5HFGA 5AGYA 2YPMA 1O85A 3IE3A 5ECIB 4PI2C 4ICYA 3IRAA 4AKIA 2CVKA 4ZL9A 3IOSA 2YN1A 1BJXA 2N5BA 2A4HA 2F3MA 3AY8A 2PPTA 3DRNA 3GNJA 3DGQA 1CQGA 2DKHA 4KF9A 1XVQA 1B9XC 2XC2A 1GTIA 3ZMKA 1F9MA 3RHCA 4BWQA 3BCIA 2LEGA 3ZVJA 1K0CA 1AAZA 3QDNA 1PKZA 1FW1A 3P2AA 3HVVA 3TB2A 3TGZA 3F3RA 1EOHA 3UIWA 2KP2A 2FCHA 3UOMA 1TRSA 3QFAC 5J9BA 1B4PA 3UBLA 4HQSA 4ECBA 2G2QA 2VM1A 4MJEA 1HNCA 4QMKA 1WRYA 1K0MA 3UL3A 2MMAA 2R0GA 1BAYA 2F8AA 3CTGA 1MD4A 4K1FA 2F8FA 4V2NA 3Q19A 3G7IA 5IOXA 4L0UA 2RUFA 3O6TA 3GTUB 4LMVA 1WMJA 2L6DA 5J3RA 5BRTA 2HXKA 4IS0A 2L4CA 4LLRA 2XPDA 1SK0A 4LA1A 1SKWB 3ZMLA 5KN0A 3D5JA 1TKDB 4V1Ap 3LYKA 6GSSA 4GSNA 1PL1A 1TI1A 5ENUA 4MPGA 6GSYA 2B5YA 4GQCA 2DJJA 2H76A 4BPYA 5A4WA 4D73B 1YZXA 5ECKB 2HSMA 4OFNA 3KZQA 4I2TA 1OC8A 2DJ0A 1UVZA 4KAEA 4NAXA 2H73A 1XOAA 2HFDA 1K0NA 5KEJA 3QR6A 4XS4B 5L71A 1LJRA 1ML6A 1YF0A 5B7CA 2WVZA 3IBHA 1PQNA 4ZL7A 3DD3A
chains in the Genus database with same CATH topology
1YJ6A 4OO4A 4HDEA 2OADA 4KSMA 5DALB 3HJOA 3KTLA 3KTBA 2C80A 3FKFA 2HYXA 3APOA 2LRTA 3VI7A 1T3BA 1KNGA 3CRTA 3KMOA 2RM6A 3EE2A 2K9FA 1OYJA 4YAPA 2H6YA 3E3EA 5IO2A 4LL4B 2ON7A 1V2AA 3CSIA 3TKRA 1N2AA 3I9V2 1B8XA 4GDFA 3L78A 1GSDA 3IK7A 3VI5A 3DYRA 4OFMA 4KE3A 1YY7A 3QAGA 2P0GA 5ECOB 4ECCA 3L0HA 3HZ8A 3A5WA 4TR4A 2F9SA 1Z3EA 2OBKA 4PQIA 5AISA 2DBCA 1THXA 3EMPA 1TRWA 1WJKA 3W8SA 4Q5FA 1Z6NA 1AW9A 4BL7A 2ZNMA 1SK1A 4MZCA 1EP8A 3ED3A 1YEPA 1S3CA 3CTFA 5ELGA 2HRAA 4XCSA 1Z7RA 3GKXA 4Z2RA 1LBKA 1PX7A 4FYCA 4I5QA 3L9VA 1RW1A 1M2AA 4MABA 2O7KA 5ECRB 1ACVA 1AQVA 4PTSA 5ECMB 2FA4A 4BVYA 1M7TA 2K6VA 1TRVA 2H1GA 5CNWA 4N3ZA 3ZL5A 5C00A 3FZ5A 1ERVA 2FA8A 3WGDA 4O5UA 4PUFC 1FVKA 1V40A 2H6XA 4CDOA 1QQ2A 3CXGA 3LJRA 4MJCA 4TR1B 4HZ4A 3UJ1A 4CY8A 5DQSA 3FZ9A 1UC7A 1FOHA 2JU5A 2VL2C 2IMFA 4IN0A 1NW2A 4WF4A 3C1RA 2EFCA 2XBIA 2L5OA 2QA2A 3TOUA 2H0HA 1QUWA 4YKGA 4HU7A 2VCQA 4EL1A 2GVPA 5GZZB 1R5PA 4K9ZA 2GGTA 2OACA 3PINA 5HFKA 2VD1A 1GH2A 1MDJA 1XVWA 1Y6EA 2L4QA 4Q5RA 2VLVA 2AV4A 3JCML 3APSA 2VIMA 5GAPD 2EIQA 4PNFA 4OD7A 1SJZA 5HQPA 3UMAA 2WDUA 1B9YC 5DJMA 3E9JB 2PERA 4QL7A 4IJ3A 3TUEA 4AKGA 1O8WA 3HDCA 3LG6A 3W8JA 1EV9A 2CX3A 2LRNA 2N5FA 5CRDA 2F51A 1FOVA 4O5RA 5ID2A 1VRSD 4F9ZA 2J9HA 4XIHA 3G7YA 2LQOA 3WT2A 4HU9A 3MNGA 3D4TA 1HD2A 4HJ2A 2HT9A 3FR6A 2O87A 3UVTA 2EFDA 4MJAA 2DMLA 4HOJA 2GDRA 4WBRD 3ZITA 2HSMB 3GX8A 1K0BA 2VCZA 1JZWA 5A4VA 3A2XA 2H72A 2CZ2A 4TVEA 3VWUA 4IHUA 4G0IA 3VK9A 2M80A 2C0FA 13GSA 4G0KA 4ZILA 9GSSA 2KLXA 2IFQA 2FHEA 2HSHA 1JHBA 2I3YA 1KTEA 4TRXA 3ERWA 4IQ1A 4G19A 2O8VB 4I2UA 1B4QA 4OCFA 2IPAA 3Q74A 2K8VA 2NPBA 1GSFA 5JCWA 4WF5A 5H5QA 1NSWA 5ABRA 4Z2UA 6GSUA 3N9JA 2PMTA 2LUSA 1WIKA 1X9SB 1VF1A 2B6MA 3LSZA 2GT6A 3TKPA 3UARA 1HYUA 3J7Yb 4EO3A 5F0GA 5DVBA 3APQA 3ERGA 3US3A 2O5VA 3ZIJA 2LRCA 4E8EA 3J7Yk 4BWSA 3BOAA 1GP1A 4EKZA 1G7OA 4H86A 5CO3A 5IMDA 2H0GA 4NV2A 3FEUA 1TTZA 1WWJA 4E68A 2JZRA 3W6GA 2VO4A 5ECSA 1GL8A 4MA9A 1EEJA 1F37A 4AGSA 1WPIA 2L59A 1AQWA 1AC1A 4BL7B 1AUCA 4GF0A 1V57A 1TRUA 1ZMAA 3VURA 3GH9A 1T7PB 1TDIA 4IQAA 2R5GA 1EGRA 1Z5YE 3GKKA 1MDKA 3OR5A 4NMUA 2K8SA 1EGOA 4MZWA 5F06A 3M0FA 3CSJA 3UAPA 1YEXA 5CAXA 2ON5A 2HQTA 4F0CA 5CYYA 3H93A 4GQFA 2IMKA 1U6TA 4BVYB 3F63A 2WS2A 2FUG2 3FW2A 1GUKA 1M2DA 2BMXA 1K3OA 1PGTA 2RLIA 2YJHA 2DJ1A 2BJXA 3F0IA 4KSOA 1F3BA 2PVQA 1RK4A 4ACSA 2CQ9A 2KOKA 2WCIA 1PN0A 1ERWA 4KNDA 5HR1A 3VWXA 5DCHA 3EMXA 3ERFA 2LSTA 2CT6A 5COHA 2MMOA 2GSQA 4TN8A 1K0AA 4JZQA 2R0CA 3D0ZA 4KDYA 1XW6A 1NM3A 1R5AA 2NDOA 3RPPA 3ZZXA 4NPBA 3ZYWA 3FHKA 2FLSA 4N0ZA 4JBBA 2WB9A 1GUHA 4MNNA 4ZBBA 5LD0A 3DIEA 4F2IA 4YKFA 2HNLA 1SVMA 4USSA 2IN3A 3ZIVA 3KM6A 1OVNA 2H01A 2GTUA 5ECNB 1X5CA 3DMLA 4JRRA 5G5EA 4MF6A 4PQHA 1THOA 4TXVA 3C1SA 3L4NA 3SWLA 3QFBC 3BD2A 5B6NA 2YJ7A 1SKSB 4MP4A 1G0TA 1F3AA 1YKCA 2QC7A 2TRCP 1S3DA 3ZLPA 5IMVA 4KDUA 4WEYA 1SD8A 5E4WA 3EURA 2G0FA 2JL4A 4PQ1A 4EXJA 4XTSA 1ZCPA 2HRNA 2YCDA 3GSTA 3KXOA 2CAIA 5D96A 1JZRA 1OC9A 3HKRA 3KH7A 4OO5A 5CP1A 3ZVJD 1A0RP 5ID2B 4ZB9A 4NHWA 3RPNA 1R26A 5ECPB 1ZYEA 5B8BA 4CHSA 4MF5A 1SJ6A 2GQKA 3QAVA 1O6JA 5FT3A 4FYBA 2AAWA 3IC8A 4G0LA 2VCTA 3ISOA 2B1LA 1O81A 1GSSA 2VOCA 3R3EA 4EIPA 5IIZA 3ME8A 5IMAA 2KUCA 3FZAA 2P5RA 2DIZA 2IFQB 4EIQA 4V2LA 2HZEA 1A8LA 3TKSA 5A5HA 2A4VA 1Y1UA 1GNWA 3PGTA 3BJ5A 4BA7A 2CAQA 4CY6A 3VWWA 2LJKA 3BCKA 5AIVA 2DJ2A 3LWAA 2K18A 1ON4A 3WYWA 3TOTA 1EOGA 4Q5QA 3IDVA 1A2JA 2OKAA 2V32A 3H1NA 3FZ4A 1XW5A 4IBPA 2HE3A 2GT5A 1XOBA 16GSA 4FH8A 3LEFA 5INYA 1DE1A 4F82A 2OBIA 1FAAA 5J5NA 4Q5NA 2VL2A 2ZUPA 1GNEA 5JWRB 5J9CA 3FRCA 2YZHA 4JR6A 3EC3A 4J57E 2LJAA 3IC4A 4ZXGA 3TJJA 2B5XA 10GSA 2FWGA 2WGRA 1YVLA 4N10A 4F0BA 2KP1A 4F03A 5HR2A 1ABAA 4K5RA 2H1BA 1B48A 4L5OA 1GTAA 4IW9A 2R4VA 1Q98A 2D2ZA 1Z6MA 5HR3A 2GSRA 4TW5A 3QCPA 2EFEA 3TKSE 3DEXA 2A2SA 5F07A 5ECLB 5D8IA 3IHGA 5DJLA 1CQHA 1TK8B 1XZOA 1HNAA 1ZYPA 1XIYA 5G30A 1URMA 1EV4A 3N5OA 3MDKA 2C0EA 3EU3A 5GSTA 4ISDA 3HJPA 2GQMA 1ZL9A 4MH3A 4AF2A 5A5KA 4KW6A 5HFIA 2WULA 12GSA 1ILOA 1M99A 5D9VA 4RI6A 1VF4A 4FO5A 2IL3A 2X99A 3HJMA 3C7MA 4DEJA 2V6KA 4EDYA 5HR0A 2WRTA 2H75A 5H5SA 1I5GA 4BVXA 3ZTLA 3GH6A 1QMVA 4GLTA 3EPTA 4V2MA 5E59A 1AXDA 3D4MA 2EFHA 2I81A 4ZIJA 5B8AA 2PBJA 1TXXA 5LCZA 2X4AA 5KN2A 4XRDA 1K0DA 3F4SA 1PD21 3IK9A 3TU3B 3EU4A 4NWYA 4YQVA 3GUSA 1TI3A 4AJ6A 3F8UA 3TRPA 3IAM2 1BG5A 4GSSA 1TK0B 1WOUA 2HRFA 1X9WB 1SL2B 2IJYA 2FD3A 4PURA 2V1MA 3IA1A 3CMIA 2PGTA 2LQQA 1ZGNA 2H74A 1AQXA 3CBUA 5J40A 4RI7A 2VLUA 1XWAA 3VPTA 1MDIA 3CSHA 1Q4JA 4TOPA 4ZB6A 3E0UA 4N0VA 4L5LA 4POLA 1SYRA 1GWCA 3O3TA 2C3NA 4QQ7A 1SVLA 1U3IA 1GSQA 1V58A 1M2BA 2YANA 3I6AA 3GRXA 4I97A 5A34A 2M72A 4LMWA 7GSSA 3HD5A 1OC9B 3L9UA 4K7OA 18GSA 3GX0A 1E2YA 4YH2A 2EC4A 4NHZA 5DCGA 1QFNA 3KEBA 5JWQB 3LQ7A 2WZ9A 4DSQA 2GQLA 3LFLA 2JSYA 1PMTA 1SJIA 4HS1A 2O85A 3GMFA 4JE1A 4G01A 1BQ7A 2CV4A 1V9WA 4RQRA 3GL3A 1UN2A 1U88A 3F6FA 5J4YA 3R2QA 1XXUA 1YQ1A 3KIJA 5DBQA 2B5EA 1OAZA 1MTCA 3TCOA 4XRAA 1GUMA 4MJBA 3D21A 3Q6OA 2HZEB 2PWJA 5A5HB 4CW9A 4YQUA 4WBJA 4LL1B 2B7KA 4Z7XA 20GSA 2UV8G 3TKQA 2OE0A 1TU8A 3M9JA 4TKYA 4ZB8A 1O7UA 2DLXA 1YKAA 3H8QA 3L9SA 4N11A 3IV4A 2NBSA 14GSA 1FO5A 1F2EA 1ZOFA 1G6YA 3P90A 4O32A 3ZREA 2VKZG 1GSEA 4JEDA 4MDCA 1O8XA 3A5IA 3NZNA 4X4JA 4ZL8A 5EL8A 2LNTA 3LGCA 1Z7PA 1IYIA 4WR4A 1VF3A 5AIXA 1O73A 4IP1A 4ML1A 2DJKA 5A1NA 3TJBA 2HRKA 3PR8A 4DSRA 4XS1A 5FWGA 1SL0B 2GS3A 4POKA 1M0UA 5G5FA 3VLNA 3A2WA 5IM9A 1K0OA 2TIRA 4K5SA 2TRXA 4IKHA 3S9FA 2LNSA 4KCEA 4DSSA 5JCUA 5F8BA 3CYNA 4P3YB 4K2DA 1A24A 3HVSA 3F4TA 5FHIA 1T4YA 2FY6A 3ZFLA 2X8CA 2HZFA 4OCEA 3IXRA 2C4JA 2VL3A 5GSSA 1J08A 5ELAA 4EE0A 1KBNA 2MZCA 3IAS2 1SK2A 2EIOA 6GSWA 3IPZA 1BYEA 4PNGA 4NV5A 1J0FA 4IVFA 1PSQA 5AN1A 2FWEA 1BX9A 1MEKA 2LTKA 1IYHA 5CRWA 3I43A 4POMA 3DVXA 3GL5A 4GSTA 1W4VA 5KOXA 4K7NA 5BMUA 1JZOA 4BVXB 3QD9A 4WXTA 4TR1A 2NVLA 2VD0A 2PUKC 2YP6A 2LS5A 2I1UA 4MPFA 3FY7A 5IOWA 1N25A 3GURA 2L6CA 3EYTA 1Y25A 1WE0A 4K7IA 2LV3A 4O7HA 1OKDA 1ZZYA 1DUGA 3M9KA 4XS6A 1VGLA 3FMWA 2DSAA 4ZBAA 4Z2TA 2HI7A 2QA1A 3LYPA 4OMVA 3FR3A 1XWKA 2FWHA 2ZCTA 3M1GA 2MMZA 5D9XA 2C8UA 2PU9C 3KGKA 3GV1A 2FGXA 5IMCA 3RHBA 4AI6A 3ME7A 4MLYA 2XPEA 3A2VA 2BTOT 1GLPA 5DAKA 1EWXA 1MD3A 5J47A 3V1WA 3VWVA 5D9WA 1JLVA 4KUNA 2C0DA 5LNKe 3QMXA 1T8EB 3MAKA 2REMA 2B7JA 2M46A 5C04A 1X9MB 1PL2A 3WGXA 1J9BA 2DIYA 2FWFA 5H5RA 2O89A 4KGIA 4AKXB 4OFTA 1A8YA 3NIVA 1X0RA 5A34B 3KP8A 4PXOA 4W66A 1SKRB 5IMFA 2GZPA 4MMMA 3TJGA 1SD9A 2H66A 11GSA 5IMZA 1OKTA 4KDXA 3MSZA 4YAVA 2EIRA 3M3MA 1PN9A 1XWBA 1H4OA 2V41A 3GKNA 2HSNA 2AJQB 5J4VA 2OA7A 3KJYA 2AYTA 3HCZA 5KN3A 5KOWA 3DKSA 1FVJA 5KN1A 3LXZA 4EDZA 1TOFA 1OE7A 2VCXA 5CRGA 4KCAA 5J41A 2IIYA 1BG1A 6GSXA 2H1DA 1K3LA 4IP6A 4GCIA 1YDKA 4EC0A 2AUVA 3HXSA 2L5LA 3SBCA 3HHVA 3F6DA 4K2XA 2YWOA 3P7XA 5EY6A 3A3TA 3GA4A 5G1LA 4JU5A 2CX4A 2MBSA 1TW9A 3QOUA 4GRFA 2R2JA 4DVCA 1XBSA 4MZBA 2I9HA 1A0FA 3GN3A 1TK5B 3CWGA 2HLSA 4EVMA 3H4KA 4IJIA 4HJMA 2JADA 2AB6A 2KHPA 2XBQA 2YOIA 2R3XA 2PN8A 3FR9A 4IGJA 3F3QA 3UEMA 4TR3A 2YWNA 4K6XA 3U5RE 5A4UA 1AIUA 1T1VA 4L8EA 2YZUA 5CREA 2B3SA 1G7EA 2YNXA 4TXOA 2IMDA 4XHMA 4PGTA 4FIWA 2WFCA 2OE1A 3VPQA 2LKUA 3LORA 1GSUA 1SVOA 1XWCA 3O76A 1TP9A 4X43A 5IQYA 5A1NB 4HZ2A 1W89A 3C73A 1DSBA 2HRKB 3KH9A 1FG4A 3DXBA 3IHQA 4HUAA 3TRXA 3QAWA 5B6MA 4N30A 4V1Ag 4MF7A 4ZB7A 2R6KA 1PRXA 3EWLA 2H0IA 1TJDA 4DSSB 1USBA 3KP9A 2X8GA 2P5QA 2E0QA 3PH9A 5CRHA 1OC3A 2E2MA 2CA8A 1U3AA 3WGEA 2H1AA 1R7HA 2AHEA 2X49A 3RDWA 4A5PA 5ECQB 2C3QA 3WD6A 1T00A 4OWYA 2H6ZA 1BF5A 1ERUA 4JR4A 3C8EA 1YF1A 2YWIA 2GZZA 4X0XA 1N8JA 3TRQA 3TKSC 4RUVA 4L0WA 4EUYA 3KD0A 4AJ8A 4KA0A 2VM2A 22GSA 2YV9A 1EZKA 1RQMA 1M9AA 5ECHB 2A2RA 1S3AA 1XPVA 4KH7A 3P8WA 3KCMA 6GSVA 5IPGA 2H8LA 3GKMA 3EINA 3ZRDA 1ZYQB 1SU9A 1EP7A 4G9HA 2JSZA 2H71A 4HQZA 3LXTA 2QKEA 5BMUB 3C71A 1A2LA 3H79A 3D6IA 3K8NA 2IWTA 2RM5A 1SYXA 3QPMA 1HNBA 1OE8A 2GSSA 3KMNA 2QSIA 4ECJA 3HMJG 2ES7A 2OE3A 1H75A 2OJLA 1ERTA 4ML6A 2OT3A 5G31A 1G6WA 3GSSA 5DDLA 6GSTA 2V6OA 1XW9A 2QGVA 5EPFA 2ALBA 2DKIA 4G10A 3D22A 5G1KA 3HZ4A 4WKWA 2VUPA 3DWVA 5D9TA 5DAKB 1JZDA 4X1UA 2DMMA 2JZTA 1Z9HA 1HQOA 1E6BA 4TR0A 3GYKA 3VFIA 2PVOC 1LU4A 4GXZA 3G9BA 4AJ7A 2YV7A 3G7JA 2GZYA 4FYUA 1DE2A 1NHYA 4HI7A 2MMNA 17GSA 5D93A 1XCCA 5JWOB 2R0PA 3GTUA 4I8BA 3UBKA 3TJKA 1A23A 1A2MA 2H1LA 1DBYA 1X5EA 2RUEA 3TJFA 1U87A 3WT1A 1QGVA 1ZYNA 3FYGA 2NTOA 8GSSA 4WETA 1VF2A 4G2EA 4D73A 2H19A 3FK8A 1C72A 2H70A 5F05A 1PA3A 4ULXA 4HEA2 4YQMA 2E7PA 5GAND 4I6XA 3HA9A 3LW9A 2HSNB 2YWMA 2P31A 2L57A 4J56E 1X5DA 2DJ3A 3I69A 3F4RA 2GSTA 3GFKA 2B1KA 1XFLA 2N5AA 4XS4A 2CVBA 4GWRA 3RAZA 2VAFA 2J23A 4K8MA 1R4WA 3IR4A 19GSA 4QL9A 3ZFBA 1PX6A 2IMEA 3HY2A 3MYDA 2CZ3A 5DALA 4O5QA 2X64A 4PUAA 2LJRA 2DC5A 1BEDA 1UA5A 4NXIA 2I4AA 5G2ZA 2A2PA 1ST9A 5D73A 3EVIA 1K3YA 1JFUA 1KEBA 1GSYA 2VL9A 3MWHA 4E8HA 3DVWA 2UZ8A 2VLTA 4ILFA 1TXUA 5IPHA 4FQUA 4J2FA 1EEMA 4ZBDA 4KX4A 4O92A 1QXHA 3GIXA 2WJUA 2VCWA 1QK8A 2V2GA 1GTBA 3RBTA 1NHOA 1GTUA 1TU7A 3HVXA 5IO0A 1V98A 5EVOA 2XHFA 2RIIA 5J4UA 4KB3A 5JCGA 1M9BA 4PX1A 4TXOB 4IELA 3NOFA 4MK3A 1FB0A 1WP0A 2C0GA 3TDGA 2C1YA 3BBYA 1SL1B 2MYGA 3F9UA 2JACA 2Z9SA 3HYPA 1T4ZA 2H30A 4POBA 1I9DA 4K0GA 3UVHA 1SENA 2C3TA 2R37A 1PKWA 4MH2A 3CRUA 2X8HA 4RQXA 2FNOA 2JZSA 2CVDA 4ECIA 4MCUA 3GHAA 3PPUA 3MIXA 2E2GA 1GRXA 4ID0A 1FHEA 1XWGA 4EF0A 2VCVA 4K0NA 5DQYA 2MBTA 3Q18A 4GTUA 4WR5A 1JLWA 1F6MC 2GLRA 2IMIA 3M8NA 1GLQA 1GULA 4AKHA 2HSYA 1FB6A 3U6VA 5HFGA 5AGYA 2YPMA 1O85A 3IE3A 5ECIB 4ICYA 3IRAA 4AKIA 2CVKA 4ZL9A 3IOSA 2YN1A 1BJXA 2N5BA 2A4HA 2F3MA 3AY8A 2PPTA 3DRNA 3GNJA 3DGQA 1CQGA 2DKHA 4KF9A 1XVQA 1B9XC 2XC2A 1GTIA 3ZMKA 1F9MA 3RHCA 4BWQA 3BCIA 2LEGA 3ZVJA 1K0CA 1AAZA 3QDNA 1PKZA 1FW1A 3P2AA 3HVVA 3TB2A 3TGZA 3F3RA 1EOHA 3UIWA 2KP2A 2FCHA 3UOMA 1TRSA 3QFAC 5J9BA 1B4PA 3UBLA 4HQSA 4ECBA 2G2QA 2VM1A 4MJEA 1HNCA 4QMKA 1WRYA 1K0MA 3UL3A 2MMAA 2R0GA 1BAYA 2F8AA 3CTGA 1MD4A 4K1FA 2F8FA 4V2NA 3Q19A 3G7IA 5IOXA 4L0UA 2RUFA 3O6TA 3GTUB 4LMVA 1WMJA 2L6DA 5J3RA 5BRTA 2HXKA 4IS0A 2L4CA 4LLRA 2XPDA 1SK0A 4LA1A 1SKWB 3ZMLA 5KN0A 3D5JA 1TKDB 4V1Ap 3LYKA 6GSSA 4GSNA 1PL1A 1TI1A 5ENUA 4MPGA 6GSYA 2B5YA 4GQCA 2DJJA 2H76A 4BPYA 5A4WA 4D73B 1YZXA 5ECKB 2HSMA 4OFNA 3KZQA 4I2TA 1OC8A 2DJ0A 1UVZA 4KAEA 4NAXA 2H73A 1XOAA 2HFDA 1K0NA 5KEJA 3QR6A 4XS4B 5L71A 1LJRA 1ML6A 1YF0A 5B7CA 3IBHA 1PQNA 4ZL7A 3DD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ6 A;  4OO4 A;  4HDE A;  2OAD A;  4KSM A;  5DAL B;  3HJO A;  3KTL A;  3KTB A;  2C80 A;  3FKF A;  2HYX A;  3APO A;  2LRT A;  3VI7 A;  1T3B A;  1KNG A;  3CRT A;  3KMO A;  2RM6 A;  3EE2 A;  2K9F A;  1OYJ A;  4YAP A;  2H6Y A;  3E3E A;  5IO2 A;  4LL4 B;  2ON7 A;  1V2A A;  3CSI A;  3TKR A;  1N2A A;  3I9V 2;  1B8X A;  3L78 A;  1GSD A;  3IK7 A;  3VI5 A;  3DYR A;  4OFM A;  4KE3 A;  1YY7 A;  3QAG A;  2P0G A;  5ECO B;  4ECC A;  3L0H A;  3HZ8 A;  3A5W A;  4TR4 A;  2F9S A;  1Z3E A;  2OBK A;  4PQI A;  5AIS A;  2DBC A;  1THX A;  3EMP A;  1TRW A;  1WJK A;  3W8S A;  4Q5F A;  1Z6N A;  1AW9 A;  4BL7 A;  2ZNM A;  1SK1 A;  4MZC A;  1EP8 A;  3ED3 A;  1YEP A;  1S3C A;  3CTF A;  5ELG A;  2HRA A;  4XCS A;  1Z7R A;  3GKX A;  1LBK A;  1PX7 A;  4FYC A;  4I5Q A;  3L9V A;  1RW1 A;  1M2A A;  4MAB A;  2O7K A;  5ECR B;  1ACV A;  1AQV A;  4PTS A;  5ECM B;  2FA4 A;  4BVY A;  1M7T A;  2K6V A;  1TRV A;  2H1G A;  5CNW A;  3ZL5 A;  5C00 A;  3FZ5 A;  1ERV A;  2FA8 A;  3WGD A;  4PUF C;  1FVK A;  1V40 A;  2H6X A;  4CDO A;  1QQ2 A;  3CXG A;  3LJR A;  4MJC A;  4TR1 B;  4HZ4 A;  3UJ1 A;  5DQS A;  3FZ9 A;  1UC7 A;  2JU5 A;  2VL2 C;  4IN0 A;  2IMF A;  1NW2 A;  4WF4 A;  3C1R A;  2XBI A;  2L5O A;  3TOU A;  2H0H A;  1QUW A;  4HU7 A;  2VCQ A;  4EL1 A;  2GVP A;  5GZZ B;  1R5P A;  4K9Z A;  2GGT A;  2OAC A;  3PIN A;  5HFK A;  2VD1 A;  1GH2 A;  1MDJ A;  1XVW A;  1Y6E A;  2L4Q A;  4Q5R A;  2VLV A;  2AV4 A;  3JCM L;  3APS A;  2VIM A;  5GAP D;  2EIQ A;  4PNF A;  4OD7 A;  1SJZ A;  5HQP A;  3UMA A;  2WDU A;  1B9Y C;  5DJM A;  3E9J B;  2PER A;  4QL7 A;  4IJ3 A;  3TUE A;  1O8W A;  3HDC A;  3LG6 A;  3W8J A;  1EV9 A;  2CX3 A;  2LRN A;  2N5F A;  5CRD A;  2F51 A;  1FOV A;  4O5R A;  5ID2 A;  1VRS D;  4F9Z A;  2J9H A;  4XIH A;  3G7Y A;  2LQO A;  3WT2 A;  4HU9 A;  3MNG A;  3D4T A;  1HD2 A;  4HJ2 A;  2HT9 A;  3FR6 A;  2O87 A;  3UVT A;  4MJA A;  2DML A;  4HOJ A;  2GDR A;  4WBR D;  3ZIT A;  2HSM B;  3GX8 A;  1K0B A;  2VCZ A;  1JZW A;  5A4V A;  3A2X A;  2H72 A;  2CZ2 A;  4TVE A;  3VWU A;  4IHU A;  4G0I A;  3VK9 A;  2M80 A;  2C0F A;  13GS A;  4G0K A;  4ZIL A;  9GSS A;  2KLX A;  2IFQ A;  2FHE A;  2HSH A;  1JHB A;  2I3Y A;  1KTE A;  4TRX A;  3ERW A;  4IQ1 A;  4G19 A;  2O8V B;  4I2U A;  1B4Q A;  4OCF A;  2IPA A;  3Q74 A;  2K8V A;  2NPB A;  1GSF A;  5JCW A;  4WF5 A;  5H5Q A;  1NSW A;  5ABR A;  6GSU A;  3N9J A;  2PMT A;  2LUS A;  1WIK A;  1X9S B;  1VF1 A;  2B6M A;  3LSZ A;  2GT6 A;  3TKP A;  3UAR A;  1HYU A;  3J7Y b;  4EO3 A;  5F0G A;  5DVB A;  3APQ A;  3ERG A;  3US3 A;  3ZIJ A;  2LRC A;  4E8E A;  3J7Y k;  4BWS A;  3BOA A;  1GP1 A;  4EKZ A;  1G7O A;  4H86 A;  5CO3 A;  5IMD A;  2H0G A;  4NV2 A;  3FEU A;  1TTZ A;  1WWJ A;  2JZR A;  3W6G A;  2VO4 A;  5ECS A;  1GL8 A;  4MA9 A;  1EEJ A;  1F37 A;  4AGS A;  1WPI A;  2L59 A;  1AQW A;  1AC1 A;  4BL7 B;  1AUC A;  4GF0 A;  1V57 A;  1TRU A;  1ZMA A;  3VUR A;  3GH9 A;  1T7P B;  1TDI A;  4IQA A;  2R5G A;  1EGR A;  1Z5Y E;  3GKK A;  1MDK A;  3OR5 A;  4NMU A;  2K8S A;  1EGO A;  4MZW A;  5F06 A;  3M0F A;  3CSJ A;  3UAP A;  1YEX A;  5CAX A;  2ON5 A;  2HQT A;  4F0C A;  5CYY A;  3H93 A;  4GQF A;  2IMK A;  1U6T A;  4BVY B;  3F63 A;  2WS2 A;  2FUG 2;  3FW2 A;  1GUK A;  1M2D A;  2BMX A;  1K3O A;  1PGT A;  2RLI A;  2YJH A;  2DJ1 A;  2BJX A;  3F0I A;  4KSO A;  1F3B A;  2PVQ A;  1RK4 A;  4ACS A;  2CQ9 A;  2KOK A;  2WCI A;  1ERW A;  4KND A;  5HR1 A;  3VWX A;  5DCH A;  3EMX A;  3ERF A;  2LST A;  2CT6 A;  5COH A;  2MMO A;  2GSQ A;  4TN8 A;  1K0A A;  4JZQ A;  3D0Z A;  4KDY A;  1XW6 A;  1NM3 A;  1R5A A;  2NDO A;  3RPP A;  3ZZX A;  4NPB A;  3ZYW A;  3FHK A;  2FLS A;  4N0Z A;  4JBB A;  2WB9 A;  1GUH A;  4ZBB A;  5LD0 A;  3DIE A;  4F2I A;  2HNL A;  4USS A;  2IN3 A;  3ZIV A;  3KM6 A;  1OVN A;  2H01 A;  2GTU A;  5ECN B;  1X5C A;  3DML A;  4JRR A;  5G5E A;  4MF6 A;  4PQH A;  1THO A;  4TXV A;  3C1S A;  3L4N A;  3SWL A;  3QFB C;  3BD2 A;  5B6N A;  2YJ7 A;  1SKS B;  4MP4 A;  1G0T A;  1F3A A;  1YKC A;  2QC7 A;  2TRC P;  1S3D A;  3ZLP A;  5IMV A;  4KDU A;  4WEY A;  1SD8 A;  5E4W A;  3EUR A;  2G0F A;  2JL4 A;  4PQ1 A;  4EXJ A;  4XTS A;  1ZCP A;  2HRN A;  2YCD A;  3GST A;  3KXO A;  2CAI A;  5D96 A;  1JZR A;  1OC9 A;  3HKR A;  3KH7 A;  4OO5 A;  5CP1 A;  3ZVJ D;  1A0R P;  5ID2 B;  4ZB9 A;  4NHW A;  3RPN A;  1R26 A;  5ECP B;  1ZYE A;  5B8B A;  4CHS A;  4MF5 A;  1SJ6 A;  2GQK A;  3QAV A;  1O6J A;  5FT3 A;  4FYB A;  2AAW A;  3IC8 A;  4G0L A;  2VCT A;  3ISO A;  2B1L A;  1O81 A;  1GSS A;  2VOC A;  3R3E A;  5IIZ A;  3ME8 A;  5IMA A;  2KUC A;  3FZA A;  2P5R A;  2DIZ A;  2IFQ B;  4V2L A;  2HZE A;  1A8L A;  3TKS A;  2A4V A;  1GNW A;  3PGT A;  3BJ5 A;  4BA7 A;  2CAQ A;  3VWW A;  2LJK A;  3BCK A;  5AIV A;  2DJ2 A;  3LWA A;  2K18 A;  1ON4 A;  3WYW A;  3TOT A;  1EOG A;  4Q5Q A;  3IDV A;  1A2J A;  2OKA A;  2V32 A;  3H1N A;  1XW5 A;  3FZ4 A;  4IBP A;  2HE3 A;  2GT5 A;  1XOB A;  16GS A;  4FH8 A;  3LEF A;  5INY A;  1DE1 A;  4F82 A;  2OBI A;  1FAA A;  5J5N A;  4Q5N A;  2VL2 A;  2ZUP A;  1GNE A;  5JWR B;  5J9C A;  3FRC A;  2YZH A;  4JR6 A;  3EC3 A;  4J57 E;  2LJA A;  3IC4 A;  4ZXG A;  3TJJ A;  2B5X A;  10GS A;  2FWG A;  2WGR A;  4N10 A;  4F0B A;  2KP1 A;  4F03 A;  5HR2 A;  1ABA A;  2H1B A;  1B48 A;  4L5O A;  1GTA A;  4IW9 A;  2R4V A;  1Q98 A;  2D2Z A;  1Z6M A;  5HR3 A;  2GSR A;  4TW5 A;  3QCP A;  3TKS E;  3DEX A;  2A2S A;  5F07 A;  5ECL B;  5D8I A;  5DJL A;  1CQH A;  1TK8 B;  1XZO A;  1HNA A;  1XIY A;  5G30 A;  1URM A;  1EV4 A;  3N5O A;  3MDK A;  2C0E A;  3EU3 A;  5GST A;  4ISD A;  3HJP A;  2GQM A;  1ZL9 A;  4MH3 A;  4AF2 A;  5A5K A;  4KW6 A;  5HFI A;  2WUL A;  12GS A;  1ILO A;  1M99 A;  5D9V A;  4RI6 A;  1VF4 A;  4FO5 A;  2IL3 A;  2X99 A;  3HJM A;  3C7M A;  4DEJ A;  2V6K A;  4EDY A;  5HR0 A;  2WRT A;  2H75 A;  5H5S A;  1I5G A;  4BVX A;  3ZTL A;  3GH6 A;  1QMV A;  4GLT A;  4V2M A;  5E59 A;  1AXD A;  3D4M A;  2I81 A;  4ZIJ A;  5B8A A;  2PBJ A;  1TXX A;  5LCZ A;  5KN2 A;  4XRD A;  1K0D A;  3F4S A;  1PD2 1;  3IK9 A;  3EU4 A;  4NWY A;  4YQV A;  3GUS A;  1TI3 A;  4AJ6 A;  3F8U A;  3TRP A;  3IAM 2;  1BG5 A;  4GSS A;  1TK0 B;  1WOU A;  2HRF A;  1X9W B;  1SL2 B;  2IJY A;  2FD3 A;  4PUR A;  2V1M A;  3IA1 A;  3CMI A;  2PGT A;  2LQQ A;  1ZGN A;  2H74 A;  1AQX A;  3CBU A;  4RI7 A;  2VLU A;  1XWA A;  3VPT A;  1MDI A;  3CSH A;  1Q4J A;  4TOP A;  4ZB6 A;  3E0U A;  4N0V A;  4L5L A;  4POL A;  1SYR A;  1GWC A;  3O3T A;  2C3N A;  4QQ7 A;  1U3I A;  1GSQ A;  1V58 A;  1M2B A;  2YAN A;  3I6A A;  3GRX A;  4I97 A;  2M72 A;  4LMW A;  7GSS A;  3HD5 A;  1OC9 B;  3L9U A;  4K7O A;  18GS A;  3GX0 A;  1E2Y A;  4YH2 A;  2EC4 A;  4NHZ A;  5DCG A;  1QFN A;  3KEB A;  5JWQ B;  3LQ7 A;  2WZ9 A;  4DSQ A;  2GQL A;  3LFL A;  2JSY A;  1PMT A;  1SJI A;  4HS1 A;  2O85 A;  3GMF A;  4JE1 A;  2CV4 A;  1BQ7 A;  1V9W A;  4RQR A;  3GL3 A;  1UN2 A;  1U88 A;  3F6F A;  3R2Q A;  1XXU A;  1YQ1 A;  3KIJ A;  5DBQ A;  2B5E A;  1OAZ A;  1MTC A;  3TCO A;  4XRA A;  1GUM A;  4MJB A;  3D21 A;  3Q6O A;  2HZE B;  2PWJ A;  4CW9 A;  4YQU A;  4WBJ A;  4LL1 B;  2B7K A;  4Z7X A;  20GS A;  3TKQ A;  2OE0 A;  1TU8 A;  3M9J A;  4TKY A;  4ZB8 A;  1O7U A;  2DLX A;  1YKA A;  3H8Q A;  3L9S A;  4N11 A;  3IV4 A;  2NBS A;  14GS A;  1FO5 A;  1F2E A;  1ZOF A;  1G6Y A;  3P90 A;  4O32 A;  3ZRE A;  1GSE A;  4JED A;  4MDC A;  1O8X A;  3NZN A;  4ZL8 A;  5EL8 A;  2LNT A;  3LGC A;  1Z7P A;  1IYI A;  4WR4 A;  1VF3 A;  5AIX A;  1O73 A;  4IP1 A;  4ML1 A;  2DJK A;  3TJB A;  2HRK A;  3PR8 A;  4DSR A;  4XS1 A;  5FWG A;  1SL0 B;  2GS3 A;  4POK A;  1M0U A;  5G5F A;  3VLN A;  3A2W A;  5IM9 A;  1K0O A;  2TIR A;  2TRX A;  4IKH A;  3S9F A;  2LNS A;  4KCE A;  4DSS A;  5JCU A;  5F8B A;  3CYN A;  4P3Y B;  4K2D A;  1A24 A;  3HVS A;  3F4T A;  5FHI A;  1T4Y A;  2FY6 A;  3ZFL A;  2X8C A;  2HZF A;  4OCE A;  3IXR A;  2C4J A;  2VL3 A;  5GSS A;  1J08 A;  5ELA A;  4EE0 A;  1KBN A;  2MZC A;  3IAS 2;  1SK2 A;  2EIO A;  6GSW A;  3IPZ A;  1BYE A;  4PNG A;  4NV5 A;  1J0F A;  4IVF A;  1PSQ A;  5AN1 A;  2FWE A;  1BX9 A;  1MEK A;  2LTK A;  1IYH A;  5CRW A;  3I43 A;  4POM A;  3DVX A;  3GL5 A;  4GST A;  1W4V A;  4K7N A;  5BMU A;  1JZO A;  4BVX B;  3QD9 A;  4WXT A;  4TR1 A;  2NVL A;  2VD0 A;  2PUK C;  2YP6 A;  2LS5 A;  2I1U A;  4MPF A;  3FY7 A;  5IOW A;  3GUR A;  2L6C A;  3EYT A;  1Y25 A;  1WE0 A;  4K7I A;  2LV3 A;  4O7H A;  1OKD A;  1ZZY A;  1DUG A;  3M9K A;  4XS6 A;  1VGL A;  2DSA A;  4ZBA A;  2HI7 A;  3LYP A;  4OMV A;  3FR3 A;  1XWK A;  2FWH A;  2ZCT A;  3M1G A;  2MMZ A;  5D9X A;  2C8U A;  2PU9 C;  3KGK A;  3GV1 A;  2FGX A;  5IMC A;  3RHB A;  3ME7 A;  4MLY A;  2XPE A;  3A2V A;  2BTO T;  1GLP A;  5DAK A;  1EWX A;  1MD3 A;  3V1W A;  3VWV A;  5D9W A;  1JLV A;  4KUN A;  2C0D A;  5LNK e;  3QMX A;  1T8E B;  3MAK A;  2REM A;  2B7J A;  2M46 A;  5C04 A;  1X9M B;  1PL2 A;  3WGX A;  1J9B A;  2DIY A;  2FWF A;  5H5R A;  2O89 A;  4KGI A;  4OFT A;  1A8Y A;  3NIV A;  1X0R A;  3KP8 A;  4PXO A;  1SKR B;  5IMF A;  2GZP A;  4MMM A;  3TJG A;  1SD9 A;  2H66 A;  11GS A;  5IMZ A;  1OKT A;  4KDX A;  3MSZ A;  4YAV A;  2EIR A;  3M3M A;  1PN9 A;  1XWB A;  1H4O A;  2V41 A;  3GKN A;  2AJQ B;  2OA7 A;  3KJY A;  2AYT A;  3HCZ A;  5KN3 A;  3DKS A;  1FVJ A;  5KN1 A;  3LXZ A;  4EDZ A;  1TOF A;  1OE7 A;  2VCX A;  5CRG A;  4KCA A;  5J41 A;  2IIY A;  6GSX A;  2H1D A;  1K3L A;  4IP6 A;  4GCI A;  1YDK A;  4EC0 A;  2AUV A;  3HXS A;  2L5L A;  3SBC A;  3HHV A;  3F6D A;  2YWO A;  3P7X A;  5EY6 A;  3A3T A;  3GA4 A;  5G1L A;  4JU5 A;  2CX4 A;  2MBS A;  1TW9 A;  3QOU A;  4GRF A;  2R2J A;  4DVC A;  1XBS A;  4MZB A;  2I9H A;  1A0F A;  3GN3 A;  1TK5 B;  2HLS A;  4EVM A;  3H4K A;  4IJI A;  4HJM A;  2JAD A;  2AB6 A;  2KHP A;  2XBQ A;  2YOI A;  2R3X A;  2PN8 A;  3FR9 A;  4IGJ A;  3F3Q A;  3UEM A;  4TR3 A;  2YWN A;  4K6X A;  3U5R E;  5A4U A;  1AIU A;  1T1V A;  4L8E A;  2YZU A;  5CRE A;  2B3S A;  1G7E A;  2YNX A;  4TXO A;  2IMD A;  4XHM A;  4PGT A;  4FIW A;  2WFC A;  2OE1 A;  3VPQ A;  2LKU A;  3LOR A;  1GSU A;  1XWC A;  3O76 A;  1TP9 A;  4X43 A;  5IQY A;  4HZ2 A;  1W89 A;  3C73 A;  1DSB A;  2HRK B;  3KH9 A;  1FG4 A;  3DXB A;  3IHQ A;  4HUA A;  3TRX A;  3QAW A;  5B6M A;  4N30 A;  4V1A g;  4MF7 A;  2R6K A;  1PRX A;  3EWL A;  2H0I A;  1TJD A;  4DSS B;  1USB A;  3KP9 A;  2X8G A;  2P5Q A;  2E0Q A;  3PH9 A;  5CRH A;  1OC3 A;  2E2M A;  2CA8 A;  1U3A A;  3WGE A;  2H1A A;  1R7H A;  2AHE A;  3RDW A;  5ECQ B;  2C3Q A;  3WD6 A;  1T00 A;  4OWY A;  2H6Z A;  1ERU A;  4JR4 A;  3C8E A;  1YF1 A;  2YWI A;  2GZZ A;  4X0X A;  1N8J A;  3TRQ A;  3TKS C;  4RUV A;  4L0W A;  4EUY A;  3KD0 A;  4AJ8 A;  4KA0 A;  2VM2 A;  22GS A;  2YV9 A;  1EZK A;  1RQM A;  1M9A A;  5ECH B;  2A2R A;  1S3A A;  1XPV A;  4KH7 A;  3P8W A;  3KCM A;  6GSV A;  5IPG A;  2H8L A;  3GKM A;  3EIN A;  3ZRD A;  1ZYQ B;  1SU9 A;  1EP7 A;  4G9H A;  2JSZ A;  2H71 A;  4HQZ A;  3LXT A;  2QKE A;  3C71 A;  1A2L A;  3H79 A;  3D6I A;  3K8N A;  2IWT A;  2RM5 A;  1SYX A;  3QPM A;  1HNB A;  1OE8 A;  2GSS A;  3KMN A;  2QSI A;  4ECJ A;  2ES7 A;  2OE3 A;  1H75 A;  2OJL A;  1ERT A;  4ML6 A;  5G31 A;  1G6W A;  3GSS A;  5DDL A;  6GST A;  2V6O A;  1XW9 A;  2QGV A;  5EPF A;  2ALB A;  4G10 A;  3D22 A;  5G1K A;  3HZ4 A;  4WKW A;  2VUP A;  3DWV A;  5D9T A;  5DAK B;  1JZD A;  4X1U A;  2DMM A;  2JZT A;  1Z9H A;  1HQO A;  1E6B A;  4TR0 A;  3GYK A;  3VFI A;  2PVO C;  1LU4 A;  4GXZ A;  3G9B A;  4AJ7 A;  2YV7 A;  3G7J A;  2GZY A;  4FYU A;  1DE2 A;  1NHY A;  4HI7 A;  2MMN A;  17GS A;  5D93 A;  1XCC A;  5JWO B;  3GTU A;  4I8B A;  3UBK A;  3TJK A;  1A23 A;  1A2M A;  1DBY A;  1X5E A;  2RUE A;  3TJF A;  1U87 A;  3WT1 A;  1QGV A;  3FYG A;  2NTO A;  8GSS A;  4WET A;  1VF2 A;  4G2E A;  4D73 A;  2H19 A;  3FK8 A;  1C72 A;  2H70 A;  5F05 A;  1PA3 A;  4ULX A;  4HEA 2;  4YQM A;  2E7P A;  5GAN D;  4I6X A;  3HA9 A;  2HSN B;  2YWM A;  2P31 A;  2L57 A;  4J56 E;  1X5D A;  2DJ3 A;  3I69 A;  3F4R A;  2GST A;  3GFK A;  2B1K A;  1XFL A;  2N5A A;  4XS4 A;  2CVB A;  4GWR A;  3RAZ A;  2VAF A;  2J23 A;  4K8M A;  1R4W A;  3IR4 A;  19GS A;  4QL9 A;  3ZFB A;  1PX6 A;  2IME A;  3HY2 A;  2CZ3 A;  5DAL A;  2X64 A;  4PUA A;  2LJR A;  2DC5 A;  1BED A;  1UA5 A;  4NXI A;  2I4A A;  5G2Z A;  1ST9 A;  5D73 A;  3EVI A;  1K3Y A;  1JFU A;  1KEB A;  1GSY A;  2VL9 A;  3MWH A;  4E8H A;  3DVW A;  2UZ8 A;  2VLT A;  4ILF A;  5IPH A;  4FQU A;  4J2F A;  1EEM A;  4ZBD A;  4KX4 A;  4O92 A;  1QXH A;  3GIX A;  2WJU A;  2VCW A;  1QK8 A;  2V2G A;  1GTB A;  3RBT A;  1NHO A;  1GTU A;  1TU7 A;  3HVX A;  5IO0 A;  1V98 A;  5EVO A;  2XHF A;  2RII A;  5J4U A;  4KB3 A;  5JCG A;  1M9B A;  4PX1 A;  4TXO B;  4IEL A;  3NOF A;  4MK3 A;  1FB0 A;  1WP0 A;  2C0G A;  3TDG A;  2C1Y A;  3BBY A;  1SL1 B;  2MYG A;  3F9U A;  2JAC A;  2Z9S A;  3HYP A;  1T4Z A;  2H30 A;  4POB A;  1I9D A;  4K0G A;  3UVH A;  1SEN A;  2C3T A;  2R37 A;  1PKW A;  4MH2 A;  3CRU A;  2X8H A;  4RQX A;  2FNO A;  2JZS A;  2CVD A;  4ECI A;  4MCU A;  3GHA A;  3PPU A;  2E2G A;  1GRX A;  4ID0 A;  1FHE A;  1XWG A;  4EF0 A;  2VCV A;  4K0N A;  5DQY A;  2MBT A;  3Q18 A;  4GTU A;  4WR5 A;  1JLW A;  1F6M C;  2GLR A;  2IMI A;  3M8N A;  1GLQ A;  1GUL A;  2HSY A;  1FB6 A;  3U6V A;  5HFG A;  5AGY A;  2YPM A;  1O85 A;  3IE3 A;  5ECI B;  3IRA A;  2CVK A;  4ZL9 A;  3IOS A;  2YN1 A;  1BJX A;  2N5B A;  2F3M A;  3AY8 A;  2PPT A;  3DRN A;  3GNJ A;  3DGQ A;  1CQG A;  4KF9 A;  1XVQ A;  1B9X C;  2XC2 A;  1GTI A;  3ZMK A;  1F9M A;  3RHC A;  4BWQ A;  3BCI A;  2LEG A;  3ZVJ A;  1K0C A;  1AAZ A;  3QDN A;  1PKZ A;  1FW1 A;  3P2A A;  3HVV A;  3TB2 A;  3TGZ A;  3F3R A;  1EOH A;  3UIW A;  2KP2 A;  2FCH A;  3UOM A;  1TRS A;  3QFA C;  5J9B A;  1B4P A;  3UBL A;  4HQS A;  4ECB A;  2G2Q A;  2VM1 A;  4MJE A;  1HNC A;  1WRY A;  1K0M A;  3UL3 A;  2MMA A;  1BAY A;  2F8A A;  3CTG A;  1MD4 A;  4K1F A;  2F8F A;  4V2N A;  3Q19 A;  3G7I A;  5IOX A;  4L0U A;  2RUF A;  3O6T A;  3GTU B;  4LMV A;  1WMJ A;  2L6D A;  5J3R A;  2HXK A;  4IS0 A;  2L4C A;  4LLR A;  2XPD A;  1SK0 A;  4LA1 A;  1SKW B;  3ZML A;  5KN0 A;  3D5J A;  1TKD B;  4V1A p;  3LYK A;  6GSS A;  4GSN A;  1PL1 A;  1TI1 A;  5ENU A;  4MPG A;  6GSY A;  2B5Y A;  4GQC A;  2DJJ A;  2H76 A;  4BPY A;  5A4W A;  4D73 B;  1YZX A;  5ECK B;  2HSM A;  4OFN A;  3KZQ A;  4I2T A;  1OC8 A;  2DJ0 A;  1UVZ A;  4KAE A;  4NAX A;  2H73 A;  1XOA A;  2HFD A;  1K0N A;  5KEJ A;  3QR6 A;  4XS4 B;  5L71 A;  1LJR A;  1ML6 A;  1YF0 A;  5B7C A;  3IBH A;  1PQN A;  4ZL7 A;  3DD3 A; 
#chains in the Genus database with same CATH topology
 1YJ6 A;  4OO4 A;  4HDE A;  2OAD A;  4KSM A;  5DAL B;  3HJO A;  3KTL A;  3KTB A;  2C80 A;  3FKF A;  2HYX A;  3APO A;  2LRT A;  3VI7 A;  1T3B A;  1KNG A;  3CRT A;  3KMO A;  2RM6 A;  3EE2 A;  2K9F A;  1OYJ A;  4YAP A;  2H6Y A;  3E3E A;  5IO2 A;  4LL4 B;  2ON7 A;  1V2A A;  3CSI A;  3TKR A;  1N2A A;  3HVN A;  3I9V 2;  1B8X A;  4GDF A;  3L78 A;  1GSD A;  3IK7 A;  3VI5 A;  3DYR A;  4OFM A;  4KE3 A;  1YY7 A;  3QAG A;  2P0G A;  5ECO B;  4ECC A;  3L0H A;  3HZ8 A;  3A5W A;  4TR4 A;  2F9S A;  1Z3E A;  2WVY A;  2OBK A;  4PQI A;  5AIS A;  2DBC A;  1THX A;  3EMP A;  1TRW A;  1WJK A;  1XG8 A;  3W8S A;  4Q5F A;  1Z6N A;  1AW9 A;  4BL7 A;  2ZNM A;  1SK1 A;  4MZC A;  1EP8 A;  3ED3 A;  1YEP A;  1S3C A;  3CTF A;  5ELG A;  2HRA A;  4XCS A;  1Z7R A;  3GKX A;  4Z2R A;  1LBK A;  1PX7 A;  4FYC A;  4I5Q A;  3L9V A;  1RW1 A;  1M2A A;  4MAB A;  2O7K A;  5ECR B;  1ACV A;  1AQV A;  4PTS A;  5ECM B;  2FA4 A;  4BVY A;  1M7T A;  2K6V A;  1TRV A;  2H1G A;  5CNW A;  4N3Z A;  3ZL5 A;  5C00 A;  3FZ5 A;  1ERV A;  2FA8 A;  3WGD A;  4O5U A;  4PUF C;  1FVK A;  1V40 A;  2H6X A;  4CDO A;  1QQ2 A;  3CXG A;  3LJR A;  4MJC A;  4TR1 B;  4HZ4 A;  3UJ1 A;  4CY8 A;  5DQS A;  3FZ9 A;  1UC7 A;  1FOH A;  2JU5 A;  2VL2 C;  2IMF A;  4IN0 A;  1NW2 A;  4WF4 A;  3C1R A;  2EFC A;  2XBI A;  2L5O A;  4FXY P;  2QA2 A;  3TOU A;  2H0H A;  1QUW A;  4YKG A;  4HU7 A;  2VCQ A;  4EL1 A;  1I1I P;  2GVP A;  5GZZ B;  1R5P A;  4K9Z A;  2GGT A;  3CHX C;  2OAC A;  3PIN A;  5HFK A;  2VD1 A;  1GH2 A;  1MDJ A;  1XVW A;  1Y6E A;  2L4Q A;  4Q5R A;  2VLV A;  4PI0 C;  2AV4 A;  3JCM L;  3APS A;  2VIM A;  5GAP D;  2EIQ A;  4PNF A;  4OD7 A;  1SJZ A;  5HQP A;  3UMA A;  2WDU A;  1B9Y C;  5DJM A;  3E9J B;  2PER A;  4QL7 A;  4IJ3 A;  3TUE A;  4AKG A;  1O8W A;  3HDC A;  3LG6 A;  3W8J A;  1EV9 A;  2CX3 A;  2LRN A;  2N5F A;  5CRD A;  2F51 A;  1FOV A;  4O5R A;  5ID2 A;  1VRS D;  4F9Z A;  2J9H A;  4XIH A;  3G7Y A;  2LQO A;  3WT2 A;  4HU9 A;  3MNG A;  3D4T A;  1HD2 A;  4HJ2 A;  2HT9 A;  3FR6 A;  2O87 A;  3UVT A;  2EFD A;  4MJA A;  2DML A;  4HOJ A;  2GDR A;  4WBR D;  3ZIT A;  2HSM B;  3GX8 A;  1K0B A;  2VCZ A;  1JZW A;  5A4V A;  3A2X A;  2H72 A;  2CZ2 A;  4TVE A;  3VWU A;  4IHU A;  4G0I A;  3VK9 A;  2M80 A;  2C0F A;  13GS A;  4G0K A;  4ZIL A;  9GSS A;  2KLX A;  2IFQ A;  2FHE A;  2HSH A;  1JHB A;  2I3Y A;  1KTE A;  4TRX A;  3ERW A;  4IQ1 A;  4G19 A;  2O8V B;  4I2U A;  1B4Q A;  4OCF A;  2IPA A;  3Q74 A;  2K8V A;  2NPB A;  1GSF A;  5JCW A;  4WF5 A;  5H5Q A;  1NSW A;  5ABR A;  4Z2U A;  6GSU A;  3N9J A;  2PMT A;  2LUS A;  1WIK A;  1X9S B;  1VF1 A;  2B6M A;  3LSZ A;  2GT6 A;  3TKP A;  2WW0 A;  3UAR A;  1HYU A;  3J7Y b;  4EO3 A;  5F0G A;  5DVB A;  3APQ A;  3ERG A;  3US3 A;  2O5V A;  3ZIJ A;  2LRC A;  4E8E A;  3J7Y k;  4BWS A;  3BOA A;  1GP1 A;  4EKZ A;  1G7O A;  4H86 A;  5CO3 A;  5IMD A;  2H0G A;  4NV2 A;  3FEU A;  1TTZ A;  1WWJ A;  4E68 A;  2JZR A;  3W6G A;  2VO4 A;  5ECS A;  1GL8 A;  4MA9 A;  1EEJ A;  1F37 A;  4AGS A;  1WPI A;  2L59 A;  1AQW A;  1AC1 A;  4BL7 B;  1AUC A;  4GF0 A;  1V57 A;  1TRU A;  1ZMA A;  3VUR A;  3GH9 A;  1T7P B;  1TDI A;  4IQA A;  2R5G A;  1EGR A;  1Z5Y E;  3GKK A;  1MDK A;  1PFO A;  3OR5 A;  4NMU A;  2K8S A;  1EGO A;  4MZW A;  5F06 A;  3M0F A;  3CSJ A;  3UAP A;  1YEX A;  5CAX A;  2ON5 A;  2HQT A;  4F0C A;  5CYY A;  3H93 A;  1M3I A;  4GQF A;  2IMK A;  1U6T A;  4BVY B;  3F63 A;  2WS2 A;  2FUG 2;  3FW2 A;  1GUK A;  1M2D A;  2BMX A;  1K3O A;  1PGT A;  2RLI A;  2YJH A;  2DJ1 A;  2BJX A;  3F0I A;  4KSO A;  1F3B A;  2PVQ A;  1RK4 A;  4ACS A;  2CQ9 A;  2KOK A;  2WCI A;  1PN0 A;  1ERW A;  4KND A;  5HR1 A;  3VWX A;  5DCH A;  3EMX A;  3ERF A;  2LST A;  2CT6 A;  5COH A;  2MMO A;  2GSQ A;  4TN8 A;  1K0A A;  4JZQ A;  2R0C A;  3D0Z A;  4KDY A;  1XW6 A;  1NM3 A;  1R5A A;  2NDO A;  3RPP A;  3ZZX A;  4NPB A;  3ZYW A;  3FHK A;  2FLS A;  4N0Z A;  4JBB A;  2WB9 A;  1GUH A;  4MNN A;  4ZBB A;  5LD0 A;  3DIE A;  4F2I A;  4YKF A;  2HNL A;  1SVM A;  4USS A;  2IN3 A;  3ZIV A;  3KM6 A;  1OVN A;  2H01 A;  2GTU A;  5ECN B;  1X5C A;  3DML A;  4JRR A;  5G5E A;  4MF6 A;  4PQH A;  1THO A;  4TXV A;  3C1S A;  3L4N A;  3SWL A;  3QFB C;  3BD2 A;  5B6N A;  2YJ7 A;  1SKS B;  4MP4 A;  1G0T A;  1F3A A;  1YKC A;  2QC7 A;  2TRC P;  1S3D A;  3ZLP A;  5IMV A;  4KDU A;  4WEY A;  1SD8 A;  5E4W A;  3EUR A;  2G0F A;  2JL4 A;  4PQ1 A;  4EXJ A;  4XTS A;  1ZCP A;  2HRN A;  2YCD A;  3GST A;  3KXO A;  2CAI A;  5D96 A;  1JZR A;  1OC9 A;  3HKR A;  3KH7 A;  4OO5 A;  5CP1 A;  3ZVJ D;  1A0R P;  5ID2 B;  4ZB9 A;  4NHW A;  3RPN A;  1R26 A;  5ECP B;  1ZYE A;  5B8B A;  4CHS A;  4MF5 A;  1SJ6 A;  2GQK A;  3QAV A;  1O6J A;  5FT3 A;  4FYB A;  2AAW A;  3IC8 A;  4G0L A;  1S3R A;  2VCT A;  3ISO A;  2B1L A;  1O81 A;  1GSS A;  2VOC A;  3R3E A;  4EIP A;  5IIZ A;  3ME8 A;  1YEW C;  5IMA A;  2KUC A;  3FZA A;  2P5R A;  2DIZ A;  2IFQ B;  4EIQ A;  4V2L A;  2HZE A;  1A8L A;  3TKS A;  5A5H A;  2A4V A;  1Y1U A;  1GNW A;  3PGT A;  3BJ5 A;  4BA7 A;  2CAQ A;  4CY6 A;  3VWW A;  2LJK A;  3BCK A;  5AIV A;  2DJ2 A;  3LWA A;  2K18 A;  1ON4 A;  3WYW A;  3TOT A;  1EOG A;  4Q5Q A;  3IDV A;  1A2J A;  2OKA A;  2V32 A;  3H1N A;  3FZ4 A;  1XW5 A;  4IBP A;  2HE3 A;  2GT5 A;  1XOB A;  16GS A;  4FH8 A;  3LEF A;  5INY A;  1DE1 A;  4F82 A;  2OBI A;  1FAA A;  5J5N A;  4Q5N A;  2VL2 A;  2ZUP A;  1GNE A;  5JWR B;  5J9C A;  3FRC A;  2YZH A;  4JR6 A;  3EC3 A;  4J57 E;  2O36 A;  2LJA A;  2WVX A;  3IC4 A;  4ZXG A;  3TJJ A;  2B5X A;  10GS A;  2FWG A;  2WGR A;  1YVL A;  4N10 A;  4F0B A;  2KP1 A;  4F03 A;  5HR2 A;  1ABA A;  4K5R A;  2H1B A;  1B48 A;  4L5O A;  1GTA A;  4IW9 A;  2R4V A;  1Q98 A;  2D2Z A;  1Z6M A;  5HR3 A;  2GSR A;  4TW5 A;  3QCP A;  2EFE A;  3TKS E;  3DEX A;  2A2S A;  5F07 A;  5ECL B;  5D8I A;  3IHG A;  5DJL A;  1CQH A;  1TK8 B;  1XZO A;  1HNA A;  1ZYP A;  1XIY A;  5G30 A;  1URM A;  1EV4 A;  3N5O A;  3MDK A;  2C0E A;  3EU3 A;  5GST A;  4ISD A;  3HJP A;  2GQM A;  1ZL9 A;  4MH3 A;  4AF2 A;  5A5K A;  4KW6 A;  5HFI A;  2WUL A;  12GS A;  1ILO A;  1M99 A;  5D9V A;  4RI6 A;  1VF4 A;  4FO5 A;  2IL3 A;  2X99 A;  3HJM A;  3C7M A;  4PHZ C;  4DEJ A;  2V6K A;  4EDY A;  1S4B P;  5HR0 A;  2WRT A;  2H75 A;  5H5S A;  1I5G A;  4BVX A;  3ZTL A;  3GH6 A;  1QMV A;  4GLT A;  3EPT A;  4V2M A;  5E59 A;  1AXD A;  3D4M A;  2EFH A;  2I81 A;  4ZIJ A;  5B8A A;  2PBJ A;  1TXX A;  5LCZ A;  2X4A A;  5KN2 A;  4XRD A;  1K0D A;  3F4S A;  1PD2 1;  3IK9 A;  3TU3 B;  3EU4 A;  4NWY A;  4YQV A;  3GUS A;  1TI3 A;  4AJ6 A;  3F8U A;  3TRP A;  3IAM 2;  1BG5 A;  4GSS A;  1TK0 B;  1WOU A;  2HRF A;  1X9W B;  1SL2 B;  2IJY A;  2FD3 A;  4PUR A;  2V1M A;  3IA1 A;  3CMI A;  2PGT A;  2LQQ A;  1ZGN A;  2H74 A;  1AQX A;  3CBU A;  5J40 A;  4RI7 A;  2VLU A;  1XWA A;  3VPT A;  1MDI A;  3CSH A;  1Q4J A;  4TOP A;  4ZB6 A;  3E0U A;  4N0V A;  4L5L A;  4POL A;  1SYR A;  1GWC A;  3O3T A;  2C3N A;  4QQ7 A;  1SVL A;  1U3I A;  1GSQ A;  1V58 A;  1M2B A;  2YAN A;  3I6A A;  3GRX A;  4I97 A;  5A34 A;  2M72 A;  4LMW A;  7GSS A;  3HD5 A;  1OC9 B;  3L9U A;  4K7O A;  18GS A;  3GX0 A;  1E2Y A;  4YH2 A;  2EC4 A;  4NHZ A;  5DCG A;  1QFN A;  3KEB A;  5JWQ B;  3LQ7 A;  2WZ9 A;  4DSQ A;  2GQL A;  3LFL A;  2JSY A;  1PMT A;  1SJI A;  4HS1 A;  2O85 A;  3GMF A;  4JE1 A;  3RFR C;  4G01 A;  1BQ7 A;  2CV4 A;  1V9W A;  4RQR A;  3GL3 A;  1UN2 A;  1U88 A;  3F6F A;  5J4Y A;  3R2Q A;  1XXU A;  1YQ1 A;  3KIJ A;  5DBQ A;  2B5E A;  1OAZ A;  1MTC A;  3TCO A;  4XRA A;  1GUM A;  4MJB A;  3D21 A;  3Q6O A;  2HZE B;  2PWJ A;  5A5H B;  4CW9 A;  4YQU A;  4WBJ A;  4LL1 B;  2B7K A;  4Z7X A;  20GS A;  2UV8 G;  3TKQ A;  2OE0 A;  1TU8 A;  3M9J A;  4TKY A;  4ZB8 A;  1O7U A;  2DLX A;  1YKA A;  3H8Q A;  3L9S A;  4N11 A;  3IV4 A;  2NBS A;  14GS A;  1FO5 A;  1F2E A;  1ZOF A;  1G6Y A;  3P90 A;  4O32 A;  3ZRE A;  2VKZ G;  1GSE A;  4JED A;  4MDC A;  1O8X A;  3A5I A;  3NZN A;  4X4J A;  4ZL8 A;  5EL8 A;  2LNT A;  3LGC A;  1Z7P A;  2WVX B;  1IYI A;  4WR4 A;  1VF3 A;  5AIX A;  1O73 A;  4IP1 A;  4ML1 A;  2DJK A;  2WZS A;  5A1N A;  3TJB A;  2HRK A;  3PR8 A;  4DSR A;  4XS1 A;  5FWG A;  1SL0 B;  2GS3 A;  4POK A;  1M0U A;  5G5F A;  3VLN A;  3A2W A;  5IM9 A;  1K0O A;  2TIR A;  4K5S A;  2TRX A;  4IKH A;  3S9F A;  2LNS A;  4KCE A;  4DSS A;  5JCU A;  5F8B A;  3CYN A;  4P3Y B;  4K2D A;  1A24 A;  3HVS A;  3F4T A;  3CQF A;  5FHI A;  1T4Y A;  2FY6 A;  3ZFL A;  2X8C A;  2HZF A;  4OCE A;  3IXR A;  2C4J A;  2VL3 A;  5GSS A;  1J08 A;  5ELA A;  4EE0 A;  1KBN A;  2MZC A;  3IAS 2;  1SK2 A;  2EIO A;  6GSW A;  3IPZ A;  1BYE A;  4PNG A;  4NV5 A;  1J0F A;  4IVF A;  1PSQ A;  5AN1 A;  2FWE A;  1BX9 A;  1MEK A;  2LTK A;  1IYH A;  5CRW A;  3I43 A;  4POM A;  3DVX A;  3GL5 A;  4GST A;  1W4V A;  5KOX A;  4K7N A;  5BMU A;  1JZO A;  4BVX B;  3QD9 A;  4WXT A;  4TR1 A;  2NVL A;  2VD0 A;  2PUK C;  2YP6 A;  2LS5 A;  2I1U A;  4MPF A;  3FY7 A;  5IOW A;  1N25 A;  3GUR A;  2L6C A;  3EYT A;  1Y25 A;  1WE0 A;  4K7I A;  2LV3 A;  4O7H A;  1OKD A;  1ZZY A;  1DUG A;  3M9K A;  4XS6 A;  1VGL A;  3FMW A;  2DSA A;  4ZBA A;  4Z2T A;  2HI7 A;  2QA1 A;  3LYP A;  4OMV A;  3FR3 A;  1XWK A;  2FWH A;  2ZCT A;  3M1G A;  2MMZ A;  5D9X A;  2C8U A;  2PU9 C;  3KGK A;  3GV1 A;  2FGX A;  5IMC A;  3RHB A;  4AI6 A;  3ME7 A;  4MLY A;  2XPE A;  3A2V A;  2BTO T;  1GLP A;  5DAK A;  1EWX A;  1MD3 A;  5J47 A;  3V1W A;  3VWV A;  5D9W A;  1JLV A;  4KUN A;  2C0D A;  5LNK e;  3QMX A;  1T8E B;  3MAK A;  2REM A;  2B7J A;  2M46 A;  5C04 A;  1X9M B;  1PL2 A;  3WGX A;  1J9B A;  2DIY A;  2FWF A;  5H5R A;  2O89 A;  4KGI A;  4AKX B;  4OFT A;  1A8Y A;  3NIV A;  1X0R A;  5A34 B;  3KP8 A;  4PXO A;  4W66 A;  1SKR B;  5IMF A;  2GZP A;  4MMM A;  3TJG A;  1SD9 A;  2H66 A;  11GS A;  5IMZ A;  1OKT A;  4KDX A;  3MSZ A;  4YAV A;  2EIR A;  3M3M A;  1PN9 A;  1XWB A;  1H4O A;  2V41 A;  3GKN A;  2HSN A;  2AJQ B;  5J4V A;  2OA7 A;  3KJY A;  2AYT A;  3HCZ A;  5KN3 A;  5KOW A;  3DKS A;  1FVJ A;  5KN1 A;  3LXZ A;  4EDZ A;  1TOF A;  1OE7 A;  2VCX A;  5CRG A;  4KCA A;  5J41 A;  2IIY A;  1BG1 A;  6GSX A;  2H1D A;  1K3L A;  4IP6 A;  4GCI A;  1YDK A;  4EC0 A;  2AUV A;  3HXS A;  2L5L A;  3SBC A;  3HHV A;  3F6D A;  4K2X A;  2YWO A;  3P7X A;  5EY6 A;  3A3T A;  3GA4 A;  5G1L A;  4JU5 A;  2CX4 A;  2MBS A;  1TW9 A;  3QOU A;  4GRF A;  2R2J A;  4DVC A;  1XBS A;  4MZB A;  2I9H A;  1A0F A;  3GN3 A;  1TK5 B;  3CWG A;  2HLS A;  4EVM A;  3H4K A;  4IJI A;  4HJM A;  2JAD A;  2AB6 A;  2KHP A;  2XBQ A;  2YOI A;  2R3X A;  2PN8 A;  3FR9 A;  4IGJ A;  3F3Q A;  3UEM A;  4TR3 A;  2YWN A;  4HSC X;  4K6X A;  3U5R E;  5A4U A;  1AIU A;  1T1V A;  4L8E A;  2YZU A;  5CRE A;  2B3S A;  1G7E A;  2YNX A;  4TXO A;  2IMD A;  4XHM A;  4PGT A;  4FIW A;  2WFC A;  2OE1 A;  3VPQ A;  2LKU A;  3LOR A;  1GSU A;  1SVO A;  1XWC A;  3O76 A;  1TP9 A;  4X43 A;  5IQY A;  5A1N B;  4HZ2 A;  1W89 A;  3C73 A;  1DSB A;  2HRK B;  3KH9 A;  1FG4 A;  3DXB A;  3IHQ A;  4HUA A;  3TRX A;  3QAW A;  5B6M A;  4N30 A;  4V1A g;  4MF7 A;  4ZB7 A;  2R6K A;  1PRX A;  3EWL A;  2H0I A;  1TJD A;  4DSS B;  1USB A;  3KP9 A;  2X8G A;  2P5Q A;  2E0Q A;  3PH9 A;  5CRH A;  1OC3 A;  2E2M A;  2CA8 A;  1U3A A;  3WGE A;  2H1A A;  1R7H A;  2AHE A;  2X49 A;  3RDW A;  4A5P A;  5ECQ B;  2C3Q A;  3WD6 A;  1T00 A;  4OWY A;  2H6Z A;  1BF5 A;  1ERU A;  4JR4 A;  3C8E A;  1YF1 A;  2YWI A;  2GZZ A;  4X0X A;  1N8J A;  3TRQ A;  3TKS C;  4RUV A;  4L0W A;  4EUY A;  3KD0 A;  4AJ8 A;  4KA0 A;  2VM2 A;  22GS A;  2YV9 A;  1EZK A;  1RQM A;  1M9A A;  5ECH B;  2A2R A;  1S3A A;  1XPV A;  4KH7 A;  3P8W A;  3KCM A;  6GSV A;  5IPG A;  2H8L A;  3GKM A;  3EIN A;  3ZRD A;  1ZYQ B;  1SU9 A;  1EP7 A;  4G9H A;  2JSZ A;  2H71 A;  4HQZ A;  3LXT A;  2QKE A;  5BMU B;  3C71 A;  1A2L A;  3H79 A;  3D6I A;  3K8N A;  2IWT A;  2RM5 A;  1SYX A;  3QPM A;  1HNB A;  1OE8 A;  2GSS A;  3KMN A;  2QSI A;  4ECJ A;  3HMJ G;  2ES7 A;  2OE3 A;  1H75 A;  2OJL A;  1ERT A;  4ML6 A;  2OT3 A;  5G31 A;  1G6W A;  3GSS A;  5DDL A;  6GST A;  2V6O A;  1XW9 A;  2QGV A;  5EPF A;  2ALB A;  2DKI A;  4G10 A;  3D22 A;  5G1K A;  3HZ4 A;  4WKW A;  2VUP A;  3DWV A;  5D9T A;  5DAK B;  1JZD A;  4X1U A;  2DMM A;  2JZT A;  1Z9H A;  1HQO A;  1E6B A;  2WW1 A;  4TR0 A;  3GYK A;  3VFI A;  2PVO C;  1LU4 A;  4GXZ A;  3G9B A;  4AJ7 A;  2WW3 A;  2YV7 A;  3G7J A;  2GZY A;  4FYU A;  1DE2 A;  1NHY A;  4HI7 A;  2MMN A;  17GS A;  5D93 A;  1XCC A;  5JWO B;  2R0P A;  3GTU A;  4I8B A;  3UBK A;  3TJK A;  1A23 A;  1A2M A;  2H1L A;  1DBY A;  1X5E A;  2RUE A;  3TJF A;  1U87 A;  3WT1 A;  1QGV A;  1ZYN A;  3FYG A;  2NTO A;  8GSS A;  4WET A;  1VF2 A;  4G2E A;  4D73 A;  2H19 A;  3FK8 A;  1C72 A;  2H70 A;  5F05 A;  1PA3 A;  4ULX A;  4HEA 2;  4YQM A;  2E7P A;  5GAN D;  4I6X A;  3HA9 A;  3LW9 A;  2HSN B;  2YWM A;  2P31 A;  2L57 A;  4J56 E;  1X5D A;  2DJ3 A;  2WW2 A;  3I69 A;  3F4R A;  2GST A;  3GFK A;  2B1K A;  1XFL A;  2N5A A;  4XS4 A;  2CVB A;  4GWR A;  3RAZ A;  2VAF A;  2J23 A;  4K8M A;  1R4W A;  3IR4 A;  19GS A;  4QL9 A;  3ZFB A;  1PX6 A;  2IME A;  3HY2 A;  3MYD A;  2CZ3 A;  5DAL A;  4O5Q A;  2X64 A;  4PUA A;  2LJR A;  2DC5 A;  1BED A;  1UA5 A;  4NXI A;  4BIK A;  2I4A A;  5G2Z A;  2A2P A;  1ST9 A;  5D73 A;  3EVI A;  1K3Y A;  1JFU A;  1KEB A;  1GSY A;  2VL9 A;  3MWH A;  4E8H A;  3DVW A;  2UZ8 A;  2VLT A;  4ILF A;  1TXU A;  5IPH A;  4FQU A;  4J2F A;  1EEM A;  4ZBD A;  4KX4 A;  2O3E A;  4O92 A;  1QXH A;  3GIX A;  2WJU A;  2VCW A;  1QK8 A;  2V2G A;  1GTB A;  3RBT A;  1NHO A;  1GTU A;  1TU7 A;  3HVX A;  5IO0 A;  1V98 A;  5EVO A;  2XHF A;  2RII A;  5J4U A;  4KB3 A;  1M3J A;  5JCG A;  1M9B A;  4PX1 A;  4TXO B;  4IEL A;  4MK3 A;  1FB0 A;  1WP0 A;  3NOF A;  2C0G A;  3TDG A;  2C1Y A;  3BBY A;  1SL1 B;  2MYG A;  3F9U A;  2JAC A;  2Z9S A;  3HYP A;  1T4Z A;  2H30 A;  4POB A;  1I9D A;  4K0G A;  3UVH A;  1SEN A;  2C3T A;  2R37 A;  1PKW A;  3RGB C;  4MH2 A;  3CRU A;  2X8H A;  4RQX A;  2FNO A;  2JZS A;  2CVD A;  4ECI A;  4MCU A;  3GHA A;  3PPU A;  3MIX A;  2E2G A;  1GRX A;  4ID0 A;  1FHE A;  1XWG A;  4EF0 A;  2VCV A;  4K0N A;  5DQY A;  2MBT A;  3Q18 A;  4GTU A;  4WR5 A;  1JLW A;  1F6M C;  2GLR A;  2IMI A;  3M8N A;  1GLQ A;  1GUL A;  4AKH A;  2HSY A;  1FB6 A;  3U6V A;  5HFG A;  5AGY A;  2YPM A;  1O85 A;  3IE3 A;  5ECI B;  4PI2 C;  4ICY A;  3IRA A;  4AKI A;  2CVK A;  4ZL9 A;  3IOS A;  2YN1 A;  1BJX A;  2N5B A;  2A4H A;  2F3M A;  3AY8 A;  2PPT A;  3DRN A;  3GNJ A;  3DGQ A;  1CQG A;  2DKH A;  4KF9 A;  1XVQ A;  1B9X C;  2XC2 A;  1GTI A;  3ZMK A;  1F9M A;  3RHC A;  4BWQ A;  3BCI A;  2LEG A;  3ZVJ A;  1K0C A;  1AAZ A;  3QDN A;  1PKZ A;  1FW1 A;  3P2A A;  3HVV A;  3TB2 A;  3TGZ A;  3F3R A;  1EOH A;  3UIW A;  2KP2 A;  2FCH A;  3UOM A;  1TRS A;  3QFA C;  5J9B A;  1B4P A;  3UBL A;  4HQS A;  4ECB A;  2G2Q A;  2VM1 A;  4MJE A;  1HNC A;  4QMK A;  1WRY A;  1K0M A;  3UL3 A;  2MMA A;  2R0G A;  1BAY A;  2F8A A;  3CTG A;  1MD4 A;  4K1F A;  2F8F A;  4V2N A;  3Q19 A;  3G7I A;  5IOX A;  4L0U A;  2RUF A;  3O6T A;  3GTU B;  4LMV A;  1WMJ A;  2L6D A;  5J3R A;  5BRT A;  2HXK A;  4IS0 A;  2L4C A;  4LLR A;  2XPD A;  1SK0 A;  4LA1 A;  1SKW B;  3ZML A;  5KN0 A;  3D5J A;  1TKD B;  4V1A p;  3LYK A;  6GSS A;  4GSN A;  1PL1 A;  1TI1 A;  5ENU A;  4MPG A;  6GSY A;  2B5Y A;  4GQC A;  2DJJ A;  2H76 A;  4BPY A;  5A4W A;  4D73 B;  1YZX A;  5ECK B;  2HSM A;  4OFN A;  3KZQ A;  4I2T A;  1OC8 A;  2DJ0 A;  1UVZ A;  4KAE A;  4NAX A;  2H73 A;  1XOA A;  2HFD A;  1K0N A;  5KEJ A;  3QR6 A;  4XS4 B;  5L71 A;  1LJR A;  1ML6 A;  1YF0 A;  5B7C A;  2WVZ A;  3IBH A;  1PQN A;  4ZL7 A;  3DD3 A; 
#chains in the Genus database with same CATH homology
 1YJ6 A;  4OO4 A;  4HDE A;  2OAD A;  4KSM A;  5DAL B;  3HJO A;  3KTL A;  3KTB A;  2C80 A;  3FKF A;  2HYX A;  3APO A;  2LRT A;  3VI7 A;  1T3B A;  1KNG A;  3CRT A;  3KMO A;  2RM6 A;  3EE2 A;  2K9F A;  1OYJ A;  4YAP A;  2H6Y A;  3E3E A;  5IO2 A;  4LL4 B;  2ON7 A;  1V2A A;  3CSI A;  3TKR A;  1N2A A;  3I9V 2;  1B8X A;  4GDF A;  3L78 A;  1GSD A;  3IK7 A;  3VI5 A;  3DYR A;  4OFM A;  4KE3 A;  1YY7 A;  3QAG A;  2P0G A;  5ECO B;  4ECC A;  3L0H A;  3HZ8 A;  3A5W A;  4TR4 A;  2F9S A;  1Z3E A;  2OBK A;  4PQI A;  5AIS A;  2DBC A;  1THX A;  3EMP A;  1TRW A;  1WJK A;  3W8S A;  4Q5F A;  1Z6N A;  1AW9 A;  4BL7 A;  2ZNM A;  1SK1 A;  4MZC A;  1EP8 A;  3ED3 A;  1YEP A;  1S3C A;  3CTF A;  5ELG A;  2HRA A;  4XCS A;  1Z7R A;  3GKX A;  4Z2R A;  1LBK A;  1PX7 A;  4FYC A;  4I5Q A;  3L9V A;  1RW1 A;  1M2A A;  4MAB A;  2O7K A;  5ECR B;  1ACV A;  1AQV A;  4PTS A;  5ECM B;  2FA4 A;  4BVY A;  1M7T A;  2K6V A;  1TRV A;  2H1G A;  5CNW A;  4N3Z A;  3ZL5 A;  5C00 A;  3FZ5 A;  1ERV A;  2FA8 A;  3WGD A;  4O5U A;  4PUF C;  1FVK A;  1V40 A;  2H6X A;  4CDO A;  1QQ2 A;  3CXG A;  3LJR A;  4MJC A;  4TR1 B;  4HZ4 A;  3UJ1 A;  4CY8 A;  5DQS A;  3FZ9 A;  1UC7 A;  1FOH A;  2JU5 A;  2VL2 C;  2IMF A;  4IN0 A;  1NW2 A;  4WF4 A;  3C1R A;  2EFC A;  2XBI A;  2L5O A;  2QA2 A;  3TOU A;  2H0H A;  1QUW A;  4YKG A;  4HU7 A;  2VCQ A;  4EL1 A;  2GVP A;  5GZZ B;  1R5P A;  4K9Z A;  2GGT A;  2OAC A;  3PIN A;  5HFK A;  2VD1 A;  1GH2 A;  1MDJ A;  1XVW A;  1Y6E A;  2L4Q A;  4Q5R A;  2VLV A;  2AV4 A;  3JCM L;  3APS A;  2VIM A;  5GAP D;  2EIQ A;  4PNF A;  4OD7 A;  1SJZ A;  5HQP A;  3UMA A;  2WDU A;  1B9Y C;  5DJM A;  3E9J B;  2PER A;  4QL7 A;  4IJ3 A;  3TUE A;  4AKG A;  1O8W A;  3HDC A;  3LG6 A;  3W8J A;  1EV9 A;  2CX3 A;  2LRN A;  2N5F A;  5CRD A;  2F51 A;  1FOV A;  4O5R A;  5ID2 A;  1VRS D;  4F9Z A;  2J9H A;  4XIH A;  3G7Y A;  2LQO A;  3WT2 A;  4HU9 A;  3MNG A;  3D4T A;  1HD2 A;  4HJ2 A;  2HT9 A;  3FR6 A;  2O87 A;  3UVT A;  2EFD A;  4MJA A;  2DML A;  4HOJ A;  2GDR A;  4WBR D;  3ZIT A;  2HSM B;  3GX8 A;  1K0B A;  2VCZ A;  1JZW A;  5A4V A;  3A2X A;  2H72 A;  2CZ2 A;  4TVE A;  3VWU A;  4IHU A;  4G0I A;  3VK9 A;  2M80 A;  2C0F A;  13GS A;  4G0K A;  4ZIL A;  9GSS A;  2KLX A;  2IFQ A;  2FHE A;  2HSH A;  1JHB A;  2I3Y A;  1KTE A;  4TRX A;  3ERW A;  4IQ1 A;  4G19 A;  2O8V B;  4I2U A;  1B4Q A;  4OCF A;  2IPA A;  3Q74 A;  2K8V A;  2NPB A;  1GSF A;  5JCW A;  4WF5 A;  5H5Q A;  1NSW A;  5ABR A;  4Z2U A;  6GSU A;  3N9J A;  2PMT A;  2LUS A;  1WIK A;  1X9S B;  1VF1 A;  2B6M A;  3LSZ A;  2GT6 A;  3TKP A;  3UAR A;  1HYU A;  3J7Y b;  4EO3 A;  5F0G A;  5DVB A;  3APQ A;  3ERG A;  3US3 A;  2O5V A;  3ZIJ A;  2LRC A;  4E8E A;  3J7Y k;  4BWS A;  3BOA A;  1GP1 A;  4EKZ A;  1G7O A;  4H86 A;  5CO3 A;  5IMD A;  2H0G A;  4NV2 A;  3FEU A;  1TTZ A;  1WWJ A;  4E68 A;  2JZR A;  3W6G A;  2VO4 A;  5ECS A;  1GL8 A;  4MA9 A;  1EEJ A;  1F37 A;  4AGS A;  1WPI A;  2L59 A;  1AQW A;  1AC1 A;  4BL7 B;  1AUC A;  4GF0 A;  1V57 A;  1TRU A;  1ZMA A;  3VUR A;  3GH9 A;  1T7P B;  1TDI A;  4IQA A;  2R5G A;  1EGR A;  1Z5Y E;  3GKK A;  1MDK A;  3OR5 A;  4NMU A;  2K8S A;  1EGO A;  4MZW A;  5F06 A;  3M0F A;  3CSJ A;  3UAP A;  1YEX A;  5CAX A;  2ON5 A;  2HQT A;  4F0C A;  5CYY A;  3H93 A;  4GQF A;  2IMK A;  1U6T A;  4BVY B;  3F63 A;  2WS2 A;  2FUG 2;  3FW2 A;  1GUK A;  1M2D A;  2BMX A;  1K3O A;  1PGT A;  2RLI A;  2YJH A;  2DJ1 A;  2BJX A;  3F0I A;  4KSO A;  1F3B A;  2PVQ A;  1RK4 A;  4ACS A;  2CQ9 A;  2KOK A;  2WCI A;  1PN0 A;  1ERW A;  4KND A;  5HR1 A;  3VWX A;  5DCH A;  3EMX A;  3ERF A;  2LST A;  2CT6 A;  5COH A;  2MMO A;  2GSQ A;  4TN8 A;  1K0A A;  4JZQ A;  2R0C A;  3D0Z A;  4KDY A;  1XW6 A;  1NM3 A;  1R5A A;  2NDO A;  3RPP A;  3ZZX A;  4NPB A;  3ZYW A;  3FHK A;  2FLS A;  4N0Z A;  4JBB A;  2WB9 A;  1GUH A;  4MNN A;  4ZBB A;  5LD0 A;  3DIE A;  4F2I A;  4YKF A;  2HNL A;  1SVM A;  4USS A;  2IN3 A;  3ZIV A;  3KM6 A;  1OVN A;  2H01 A;  2GTU A;  5ECN B;  1X5C A;  3DML A;  4JRR A;  5G5E A;  4MF6 A;  4PQH A;  1THO A;  4TXV A;  3C1S A;  3L4N A;  3SWL A;  3QFB C;  3BD2 A;  5B6N A;  2YJ7 A;  1SKS B;  4MP4 A;  1G0T A;  1F3A A;  1YKC A;  2QC7 A;  2TRC P;  1S3D A;  3ZLP A;  5IMV A;  4KDU A;  4WEY A;  1SD8 A;  5E4W A;  3EUR A;  2G0F A;  2JL4 A;  4PQ1 A;  4EXJ A;  4XTS A;  1ZCP A;  2HRN A;  2YCD A;  3GST A;  3KXO A;  2CAI A;  5D96 A;  1JZR A;  1OC9 A;  3HKR A;  3KH7 A;  4OO5 A;  5CP1 A;  3ZVJ D;  1A0R P;  5ID2 B;  4ZB9 A;  4NHW A;  3RPN A;  1R26 A;  5ECP B;  1ZYE A;  5B8B A;  4CHS A;  4MF5 A;  1SJ6 A;  2GQK A;  3QAV A;  1O6J A;  5FT3 A;  4FYB A;  2AAW A;  3IC8 A;  4G0L A;  2VCT A;  3ISO A;  2B1L A;  1O81 A;  1GSS A;  2VOC A;  3R3E A;  4EIP A;  5IIZ A;  3ME8 A;  5IMA A;  2KUC A;  3FZA A;  2P5R A;  2DIZ A;  2IFQ B;  4EIQ A;  4V2L A;  2HZE A;  1A8L A;  3TKS A;  5A5H A;  2A4V A;  1Y1U A;  1GNW A;  3PGT A;  3BJ5 A;  4BA7 A;  2CAQ A;  4CY6 A;  3VWW A;  2LJK A;  3BCK A;  5AIV A;  2DJ2 A;  3LWA A;  2K18 A;  1ON4 A;  3WYW A;  3TOT A;  1EOG A;  4Q5Q A;  3IDV A;  1A2J A;  2OKA A;  2V32 A;  3H1N A;  3FZ4 A;  1XW5 A;  4IBP A;  2HE3 A;  2GT5 A;  1XOB A;  16GS A;  4FH8 A;  3LEF A;  5INY A;  1DE1 A;  4F82 A;  2OBI A;  1FAA A;  5J5N A;  4Q5N A;  2VL2 A;  2ZUP A;  1GNE A;  5JWR B;  5J9C A;  3FRC A;  2YZH A;  4JR6 A;  3EC3 A;  4J57 E;  2LJA A;  3IC4 A;  4ZXG A;  3TJJ A;  2B5X A;  10GS A;  2FWG A;  2WGR A;  1YVL A;  4N10 A;  4F0B A;  2KP1 A;  4F03 A;  5HR2 A;  1ABA A;  4K5R A;  2H1B A;  1B48 A;  4L5O A;  1GTA A;  4IW9 A;  2R4V A;  1Q98 A;  2D2Z A;  1Z6M A;  5HR3 A;  2GSR A;  4TW5 A;  3QCP A;  2EFE A;  3TKS E;  3DEX A;  2A2S A;  5F07 A;  5ECL B;  5D8I A;  3IHG A;  5DJL A;  1CQH A;  1TK8 B;  1XZO A;  1HNA A;  1ZYP A;  1XIY A;  5G30 A;  1URM A;  1EV4 A;  3N5O A;  3MDK A;  2C0E A;  3EU3 A;  5GST A;  4ISD A;  3HJP A;  2GQM A;  1ZL9 A;  4MH3 A;  4AF2 A;  5A5K A;  4KW6 A;  5HFI A;  2WUL A;  12GS A;  1ILO A;  1M99 A;  5D9V A;  4RI6 A;  1VF4 A;  4FO5 A;  2IL3 A;  2X99 A;  3HJM A;  3C7M A;  4DEJ A;  2V6K A;  4EDY A;  5HR0 A;  2WRT A;  2H75 A;  5H5S A;  1I5G A;  4BVX A;  3ZTL A;  3GH6 A;  1QMV A;  4GLT A;  3EPT A;  4V2M A;  5E59 A;  1AXD A;  3D4M A;  2EFH A;  2I81 A;  4ZIJ A;  5B8A A;  2PBJ A;  1TXX A;  5LCZ A;  2X4A A;  5KN2 A;  4XRD A;  1K0D A;  3F4S A;  1PD2 1;  3IK9 A;  3TU3 B;  3EU4 A;  4NWY A;  4YQV A;  3GUS A;  1TI3 A;  4AJ6 A;  3F8U A;  3TRP A;  3IAM 2;  1BG5 A;  4GSS A;  1TK0 B;  1WOU A;  2HRF A;  1X9W B;  1SL2 B;  2IJY A;  2FD3 A;  4PUR A;  2V1M A;  3IA1 A;  3CMI A;  2PGT A;  2LQQ A;  1ZGN A;  2H74 A;  1AQX A;  3CBU A;  5J40 A;  4RI7 A;  2VLU A;  1XWA A;  3VPT A;  1MDI A;  3CSH A;  1Q4J A;  4TOP A;  4ZB6 A;  3E0U A;  4N0V A;  4L5L A;  4POL A;  1SYR A;  1GWC A;  3O3T A;  2C3N A;  4QQ7 A;  1SVL A;  1U3I A;  1GSQ A;  1V58 A;  1M2B A;  2YAN A;  3I6A A;  3GRX A;  4I97 A;  5A34 A;  2M72 A;  4LMW A;  7GSS A;  3HD5 A;  1OC9 B;  3L9U A;  4K7O A;  18GS A;  3GX0 A;  1E2Y A;  4YH2 A;  2EC4 A;  4NHZ A;  5DCG A;  1QFN A;  3KEB A;  5JWQ B;  3LQ7 A;  2WZ9 A;  4DSQ A;  2GQL A;  3LFL A;  2JSY A;  1PMT A;  1SJI A;  4HS1 A;  2O85 A;  3GMF A;  4JE1 A;  4G01 A;  1BQ7 A;  2CV4 A;  1V9W A;  4RQR A;  3GL3 A;  1UN2 A;  1U88 A;  3F6F A;  5J4Y A;  3R2Q A;  1XXU A;  1YQ1 A;  3KIJ A;  5DBQ A;  2B5E A;  1OAZ A;  1MTC A;  3TCO A;  4XRA A;  1GUM A;  4MJB A;  3D21 A;  3Q6O A;  2HZE B;  2PWJ A;  5A5H B;  4CW9 A;  4YQU A;  4WBJ A;  4LL1 B;  2B7K A;  4Z7X A;  20GS A;  2UV8 G;  3TKQ A;  2OE0 A;  1TU8 A;  3M9J A;  4TKY A;  4ZB8 A;  1O7U A;  2DLX A;  1YKA A;  3H8Q A;  3L9S A;  4N11 A;  3IV4 A;  2NBS A;  14GS A;  1FO5 A;  1F2E A;  1ZOF A;  1G6Y A;  3P90 A;  4O32 A;  3ZRE A;  2VKZ G;  1GSE A;  4JED A;  4MDC A;  1O8X A;  3A5I A;  3NZN A;  4X4J A;  4ZL8 A;  5EL8 A;  2LNT A;  3LGC A;  1Z7P A;  1IYI A;  4WR4 A;  1VF3 A;  5AIX A;  1O73 A;  4IP1 A;  4ML1 A;  2DJK A;  5A1N A;  3TJB A;  2HRK A;  3PR8 A;  4DSR A;  4XS1 A;  5FWG A;  1SL0 B;  2GS3 A;  4POK A;  1M0U A;  5G5F A;  3VLN A;  3A2W A;  5IM9 A;  1K0O A;  2TIR A;  4K5S A;  2TRX A;  4IKH A;  3S9F A;  2LNS A;  4KCE A;  4DSS A;  5JCU A;  5F8B A;  3CYN A;  4P3Y B;  4K2D A;  1A24 A;  3HVS A;  3F4T A;  5FHI A;  1T4Y A;  2FY6 A;  3ZFL A;  2X8C A;  2HZF A;  4OCE A;  3IXR A;  2C4J A;  2VL3 A;  5GSS A;  1J08 A;  5ELA A;  4EE0 A;  1KBN A;  2MZC A;  3IAS 2;  1SK2 A;  2EIO A;  6GSW A;  3IPZ A;  1BYE A;  4PNG A;  4NV5 A;  1J0F A;  4IVF A;  1PSQ A;  5AN1 A;  2FWE A;  1BX9 A;  1MEK A;  2LTK A;  1IYH A;  5CRW A;  3I43 A;  4POM A;  3DVX A;  3GL5 A;  4GST A;  1W4V A;  5KOX A;  4K7N A;  5BMU A;  1JZO A;  4BVX B;  3QD9 A;  4WXT A;  4TR1 A;  2NVL A;  2VD0 A;  2PUK C;  2YP6 A;  2LS5 A;  2I1U A;  4MPF A;  3FY7 A;  5IOW A;  1N25 A;  3GUR A;  2L6C A;  3EYT A;  1Y25 A;  1WE0 A;  4K7I A;  2LV3 A;  4O7H A;  1OKD A;  1ZZY A;  1DUG A;  3M9K A;  4XS6 A;  1VGL A;  3FMW A;  2DSA A;  4ZBA A;  4Z2T A;  2HI7 A;  2QA1 A;  3LYP A;  4OMV A;  3FR3 A;  1XWK A;  2FWH A;  2ZCT A;  3M1G A;  2MMZ A;  5D9X A;  2C8U A;  2PU9 C;  3KGK A;  3GV1 A;  2FGX A;  5IMC A;  3RHB A;  4AI6 A;  3ME7 A;  4MLY A;  2XPE A;  3A2V A;  2BTO T;  1GLP A;  5DAK A;  1EWX A;  1MD3 A;  5J47 A;  3V1W A;  3VWV A;  5D9W A;  1JLV A;  4KUN A;  2C0D A;  5LNK e;  3QMX A;  1T8E B;  3MAK A;  2REM A;  2B7J A;  2M46 A;  5C04 A;  1X9M B;  1PL2 A;  3WGX A;  1J9B A;  2DIY A;  2FWF A;  5H5R A;  2O89 A;  4KGI A;  4AKX B;  4OFT A;  1A8Y A;  3NIV A;  1X0R A;  5A34 B;  3KP8 A;  4PXO A;  4W66 A;  1SKR B;  5IMF A;  2GZP A;  4MMM A;  3TJG A;  1SD9 A;  2H66 A;  11GS A;  5IMZ A;  1OKT A;  4KDX A;  3MSZ A;  4YAV A;  2EIR A;  3M3M A;  1PN9 A;  1XWB A;  1H4O A;  2V41 A;  3GKN A;  2HSN A;  2AJQ B;  5J4V A;  2OA7 A;  3KJY A;  2AYT A;  3HCZ A;  5KN3 A;  5KOW A;  3DKS A;  1FVJ A;  5KN1 A;  3LXZ A;  4EDZ A;  1TOF A;  1OE7 A;  2VCX A;  5CRG A;  4KCA A;  5J41 A;  2IIY A;  1BG1 A;  6GSX A;  2H1D A;  1K3L A;  4IP6 A;  4GCI A;  1YDK A;  4EC0 A;  2AUV A;  3HXS A;  2L5L A;  3SBC A;  3HHV A;  3F6D A;  4K2X A;  2YWO A;  3P7X A;  5EY6 A;  3A3T A;  3GA4 A;  5G1L A;  4JU5 A;  2CX4 A;  2MBS A;  1TW9 A;  3QOU A;  4GRF A;  2R2J A;  4DVC A;  1XBS A;  4MZB A;  2I9H A;  1A0F A;  3GN3 A;  1TK5 B;  3CWG A;  2HLS A;  4EVM A;  3H4K A;  4IJI A;  4HJM A;  2JAD A;  2AB6 A;  2KHP A;  2XBQ A;  2YOI A;  2R3X A;  2PN8 A;  3FR9 A;  4IGJ A;  3F3Q A;  3UEM A;  4TR3 A;  2YWN A;  4K6X A;  3U5R E;  5A4U A;  1AIU A;  1T1V A;  4L8E A;  2YZU A;  5CRE A;  2B3S A;  1G7E A;  2YNX A;  4TXO A;  2IMD A;  4XHM A;  4PGT A;  4FIW A;  2WFC A;  2OE1 A;  3VPQ A;  2LKU A;  3LOR A;  1GSU A;  1SVO A;  1XWC A;  3O76 A;  1TP9 A;  4X43 A;  5IQY A;  5A1N B;  4HZ2 A;  1W89 A;  3C73 A;  1DSB A;  2HRK B;  3KH9 A;  1FG4 A;  3DXB A;  3IHQ A;  4HUA A;  3TRX A;  3QAW A;  5B6M A;  4N30 A;  4V1A g;  4MF7 A;  4ZB7 A;  2R6K A;  1PRX A;  3EWL A;  2H0I A;  1TJD A;  4DSS B;  1USB A;  3KP9 A;  2X8G A;  2P5Q A;  2E0Q A;  3PH9 A;  5CRH A;  1OC3 A;  2E2M A;  2CA8 A;  1U3A A;  3WGE A;  2H1A A;  1R7H A;  2AHE A;  2X49 A;  3RDW A;  4A5P A;  5ECQ B;  2C3Q A;  3WD6 A;  1T00 A;  4OWY A;  2H6Z A;  1BF5 A;  1ERU A;  4JR4 A;  3C8E A;  1YF1 A;  2YWI A;  2GZZ A;  4X0X A;  1N8J A;  3TRQ A;  3TKS C;  4RUV A;  4L0W A;  4EUY A;  3KD0 A;  4AJ8 A;  4KA0 A;  2VM2 A;  22GS A;  2YV9 A;  1EZK A;  1RQM A;  1M9A A;  5ECH B;  2A2R A;  1S3A A;  1XPV A;  4KH7 A;  3P8W A;  3KCM A;  6GSV A;  5IPG A;  2H8L A;  3GKM A;  3EIN A;  3ZRD A;  1ZYQ B;  1SU9 A;  1EP7 A;  4G9H A;  2JSZ A;  2H71 A;  4HQZ A;  3LXT A;  2QKE A;  5BMU B;  3C71 A;  1A2L A;  3H79 A;  3D6I A;  3K8N A;  2IWT A;  2RM5 A;  1SYX A;  3QPM A;  1HNB A;  1OE8 A;  2GSS A;  3KMN A;  2QSI A;  4ECJ A;  3HMJ G;  2ES7 A;  2OE3 A;  1H75 A;  2OJL A;  1ERT A;  4ML6 A;  2OT3 A;  5G31 A;  1G6W A;  3GSS A;  5DDL A;  6GST A;  2V6O A;  1XW9 A;  2QGV A;  5EPF A;  2ALB A;  2DKI A;  4G10 A;  3D22 A;  5G1K A;  3HZ4 A;  4WKW A;  2VUP A;  3DWV A;  5D9T A;  5DAK B;  1JZD A;  4X1U A;  2DMM A;  2JZT A;  1Z9H A;  1HQO A;  1E6B A;  4TR0 A;  3GYK A;  3VFI A;  2PVO C;  1LU4 A;  4GXZ A;  3G9B A;  4AJ7 A;  2YV7 A;  3G7J A;  2GZY A;  4FYU A;  1DE2 A;  1NHY A;  4HI7 A;  2MMN A;  17GS A;  5D93 A;  1XCC A;  5JWO B;  2R0P A;  3GTU A;  4I8B A;  3UBK A;  3TJK A;  1A23 A;  1A2M A;  2H1L A;  1DBY A;  1X5E A;  2RUE A;  3TJF A;  1U87 A;  3WT1 A;  1QGV A;  1ZYN A;  3FYG A;  2NTO A;  8GSS A;  4WET A;  1VF2 A;  4G2E A;  4D73 A;  2H19 A;  3FK8 A;  1C72 A;  2H70 A;  5F05 A;  1PA3 A;  4ULX A;  4HEA 2;  4YQM A;  2E7P A;  5GAN D;  4I6X A;  3HA9 A;  3LW9 A;  2HSN B;  2YWM A;  2P31 A;  2L57 A;  4J56 E;  1X5D A;  2DJ3 A;  3I69 A;  3F4R A;  2GST A;  3GFK A;  2B1K A;  1XFL A;  2N5A A;  4XS4 A;  2CVB A;  4GWR A;  3RAZ A;  2VAF A;  2J23 A;  4K8M A;  1R4W A;  3IR4 A;  19GS A;  4QL9 A;  3ZFB A;  1PX6 A;  2IME A;  3HY2 A;  3MYD A;  2CZ3 A;  5DAL A;  4O5Q A;  2X64 A;  4PUA A;  2LJR A;  2DC5 A;  1BED A;  1UA5 A;  4NXI A;  2I4A A;  5G2Z A;  2A2P A;  1ST9 A;  5D73 A;  3EVI A;  1K3Y A;  1JFU A;  1KEB A;  1GSY A;  2VL9 A;  3MWH A;  4E8H A;  3DVW A;  2UZ8 A;  2VLT A;  4ILF A;  1TXU A;  5IPH A;  4FQU A;  4J2F A;  1EEM A;  4ZBD A;  4KX4 A;  4O92 A;  1QXH A;  3GIX A;  2WJU A;  2VCW A;  1QK8 A;  2V2G A;  1GTB A;  3RBT A;  1NHO A;  1GTU A;  1TU7 A;  3HVX A;  5IO0 A;  1V98 A;  5EVO A;  2XHF A;  2RII A;  5J4U A;  4KB3 A;  5JCG A;  1M9B A;  4PX1 A;  4TXO B;  4IEL A;  3NOF A;  4MK3 A;  1FB0 A;  1WP0 A;  2C0G A;  3TDG A;  2C1Y A;  3BBY A;  1SL1 B;  2MYG A;  3F9U A;  2JAC A;  2Z9S A;  3HYP A;  1T4Z A;  2H30 A;  4POB A;  1I9D A;  4K0G A;  3UVH A;  1SEN A;  2C3T A;  2R37 A;  1PKW A;  4MH2 A;  3CRU A;  2X8H A;  4RQX A;  2FNO A;  2JZS A;  2CVD A;  4ECI A;  4MCU A;  3GHA A;  3PPU A;  3MIX A;  2E2G A;  1GRX A;  4ID0 A;  1FHE A;  1XWG A;  4EF0 A;  2VCV A;  4K0N A;  5DQY A;  2MBT A;  3Q18 A;  4GTU A;  4WR5 A;  1JLW A;  1F6M C;  2GLR A;  2IMI A;  3M8N A;  1GLQ A;  1GUL A;  4AKH A;  2HSY A;  1FB6 A;  3U6V A;  5HFG A;  5AGY A;  2YPM A;  1O85 A;  3IE3 A;  5ECI B;  4ICY A;  3IRA A;  4AKI A;  2CVK A;  4ZL9 A;  3IOS A;  2YN1 A;  1BJX A;  2N5B A;  2A4H A;  2F3M A;  3AY8 A;  2PPT A;  3DRN A;  3GNJ A;  3DGQ A;  1CQG A;  2DKH A;  4KF9 A;  1XVQ A;  1B9X C;  2XC2 A;  1GTI A;  3ZMK A;  1F9M A;  3RHC A;  4BWQ A;  3BCI A;  2LEG A;  3ZVJ A;  1K0C A;  1AAZ A;  3QDN A;  1PKZ A;  1FW1 A;  3P2A A;  3HVV A;  3TB2 A;  3TGZ A;  3F3R A;  1EOH A;  3UIW A;  2KP2 A;  2FCH A;  3UOM A;  1TRS A;  3QFA C;  5J9B A;  1B4P A;  3UBL A;  4HQS A;  4ECB A;  2G2Q A;  2VM1 A;  4MJE A;  1HNC A;  4QMK A;  1WRY A;  1K0M A;  3UL3 A;  2MMA A;  2R0G A;  1BAY A;  2F8A A;  3CTG A;  1MD4 A;  4K1F A;  2F8F A;  4V2N A;  3Q19 A;  3G7I A;  5IOX A;  4L0U A;  2RUF A;  3O6T A;  3GTU B;  4LMV A;  1WMJ A;  2L6D A;  5J3R A;  5BRT A;  2HXK A;  4IS0 A;  2L4C A;  4LLR A;  2XPD A;  1SK0 A;  4LA1 A;  1SKW B;  3ZML A;  5KN0 A;  3D5J A;  1TKD B;  4V1A p;  3LYK A;  6GSS A;  4GSN A;  1PL1 A;  1TI1 A;  5ENU A;  4MPG A;  6GSY A;  2B5Y A;  4GQC A;  2DJJ A;  2H76 A;  4BPY A;  5A4W A;  4D73 B;  1YZX A;  5ECK B;  2HSM A;  4OFN A;  3KZQ A;  4I2T A;  1OC8 A;  2DJ0 A;  1UVZ A;  4KAE A;  4NAX A;  2H73 A;  1XOA A;  2HFD A;  1K0N A;  5KEJ A;  3QR6 A;  4XS4 B;  5L71 A;  1LJR A;  1ML6 A;  1YF0 A;  5B7C A;  3IBH A;  1PQN A;  4ZL7 A;  3DD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...