1KBNA

Glutathione transferase mutant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
209
structure length
209
Chain Sequence
b'PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQASFADANLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Crystal Structure of Glutathione transferase mutant
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2001-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1kbnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1kbnA01
1YDKA 4PX1A 4XTSA 1YZXA 3I9V2 3HA9A 3DVWA 5DJLA 3EYTA 4EVMA 2YJ7A 3PPUA 3UMAA 5IMAA 4TR1A 2PPTA 5DJMA 5JWQB 4LMWA 1VRSD 4BA7A 4TW5A 1GSUA 5HR1A 3A2XA 2B5XA 4IS0A 4MPFA 1MDKA 2PWJA 1A24A 1XOBA 1ERVA 1HNCA 2PVQA 4YQVA 1M2BA 2AB6A 1SL2B 3LGCA 1T8EB 1T00A 2HI7A 1QMVA 3IRAA 1YEPA 3ZFLA 4IW9A 2GSQA 5G31A 2MZCA 1H4OA 4HQZA 3LXTA 4L5OA 3U6VA 3LYKA 2YWMA 4KE3A 3GSSA 3KJYA 5H5QA 2D2ZA 5J3RA 4I5QA 3IE3A 4V1Ap 3ISOA 2V6OA 3CYNA 2F8AA 3VPTA 3G7IA 1XW6A 1I9DA 1OAZA 3UEMA 1FVKA 4POKA 1HNBA 5IMFA 5IPHA 1Y6EA 5ECSA 2X99A 1Z7RA 1R5PA 3UL3A 1G7EA 2C0GA 4ZL7A 3FRCA 3EU3A 12GSA 2XBIA 5IMZA 3RAZA 5F05A 3FW2A 1MD3A 1F3AA 4E8HA 3KMOA 4XS1A 2FWGA 2VLUA 1NM3A 1K3LA 1AAZA 2PVOC 3KGKA 3K8NA 3OR5A 2H1BA 1PGTA 1PX7A 1URMA 2JU5A 2DBCA 5A5KA 1OE8A 1X9MB 5INYA 3UIWA 4KW6A 4ULXA 4NPBA 5JCGA 5ECQB 1M99A 5DAKB 1TRWA 4G10A 1OKDA 3LWAA 4WXTA 1X9WB 5IO0A 2B7KA 2VM2A 4NHZA 4YQMA 2VM1A 2K18A 4LA1A 4K7NA 3UARA 4WEYA 5D9XA 6GSVA 2IMIA 3O76A 2L6DA 3Q19A 6GSTA 2XBQA 1J0FA 1N8JA 5ECHB 3QOUA 1GUKA 3QAWA 5F0GA 4HUAA 4KUNA 4ZXGA 3GFKA 4BL7B 1X5CA 1T4ZA 5CNWA 1ERWA 1SKRB 4IBPA 2H6YA 3DWVA 2E2GA 3D6IA 4OCFA 1WOUA 3KD0A 2NBSA 4WBRD 1EZKA 1BYEA 2LRNA 3VFIA 1K0OA 2B6MA 2P5RA 5G5EA 4HEA2 1WIKA 2CVDA 2O89A 3TKSE 2NDOA 2H0IA 2DC5A 3TOUA 4JZQA 4AGSA 2YWNA 3IHQA 5H5SA 3DYRA 4L8EA 2FWEA 4L0WA 4O32A 16GSA 5ABRA 22GSA 2JSYA 2PUKC 4JRRA 2DJJA 4OCEA 2CZ3A 1YKCA 1BX9A 4NV5A 1S3DA 2MMOA 3HVXA 3TJJA 5D9WA 3CRUA 1J9BA 4EO3A 4OFMA 4XS4A 1TRSA 4HZ2A 1A23A 1PKZA 3ZREA 2MMAA 3KTBA 3P8WA 2G0FA 3QFBC 2RUFA 5KN3A 2NTOA 1WWJA 5G1KA 2HSMB 2LRCA 5HR0A 2FA4A 3DGQA 2AV4A 2CA8A 2A2RA 1EGOA 5IMVA 2Z9SA 1B4QA 4OWYA 4RUVA 1XCCA 4ML6A 2C0DA 1PA3A 2F8FA 5KN1A 3QD9A 2DLXA 4XS6A 4LMVA 1O8XA 2LNSA 4MDCA 3M9KA 4OO4A 1SL1B 1SJIA 2LRTA 2GT6A 3GRXA 1ERUA 2K6VA 1V40A 4POBA 3UBLA 18GSA 2O8VB 2C80A 4GQFA 4PQHA 2LJAA 1W89A 3ZTLA 1A8LA 1K3YA 4TRXA 1PRXA 2DIYA 2LJKA 1BJXA 2RM5A 1S3AA 4EKZA 1BG5A 2H74A 2OBIA 3KIJA 5ENUA 3QAVA 2R2JA 4HZ4A 1EEJA 1Q98A 6GSYA 1GWCA 4KNDA 3J7Yb 2PGTA 1VF3A 2H70A 5COHA 4X0XA 2N5BA 4EE0A 1V98A 1EV4A 1TK8B 1TJDA 2GQKA 3DMLA 3RHBA 2XHFA 4POMA 5IMDA 2C8UA 2AUVA 3KM6A 1TW9A 1GNWA 3FR9A 3QFAC 4AJ6A 4BL7A 1GNEA 3GSTA 1SK0A 2P31A 3C1SA 1M7TA 4OFNA 4J2FA 2HNLA 2RUEA 3ZMKA 3GH6A 1XVWA 2H73A 1F2EA 1TU8A 5HFGA 2KLXA 1B8XA 3I6AA 2OBKA 4KDXA 2CT6A 2C1YA 1O8WA 3P2AA 3H4KA 3F4SA 3HVVA 1C72A 1XW5A 2HZEA 3RPNA 2YCDA 3DRNA 4FYCA 3ZVJA 1FW1A 2JADA 1X0RA 2GQLA 2DJ3A 2VCZA 2HLSA 5LNKe 2H75A 2OKAA 3LJRA 5AISA 2VL9A 3CRTA 2JACA 3QMXA 5DQSA 2DMLA 2WGRA 4GWRA 4H86A 5D93A 2LKUA 4AJ7A 7GSSA 1F9MA 4IHUA 4ZB8A 5IOXA 4PUAA 1GUHA 4GF0A 1G6WA 2HSMA 4Q5RA 2FWFA 4V1Ag 2CVBA 3GMFA 4MK3A 3BCKA 1OC9A 4MCUA 1PSQA 4K0GA 2GLRA 2YJHA 3HXSA 2EIOA 2ZCTA 1OC8A 4G0IA 2DMMA 2AAWA 4JR4A 1OE7A 2HSYA 1TTZA 2JZTA 2P5QA 3ZMLA 2VL2C 3LEFA 2B3SA 5DQYA 1SKWB 1E2YA 2H0HA 1AC1A 3GKKA 3ERGA 2ES7A 3D4MA 3GL5A 3LYPA 1K0MA 5IM9A 4RQRA 1A2LA 1KBNA 4POLA 4BPYA 4RI6A 1N2AA 3EMXA 3IBHA 2N5FA 4WR5A 3PGTA 4CW9A 4X43A 3EMPA 3D22A 1JLWA 2GSRA 1QGVA 3HD5A 4L5LA 3G7YA 4G2EA 3W6GA 1WMJA 1GSYA 3RPPA 3HZ4A 3TKSC 4EDYA 1JZOA 1DBYA 1KNGA 4WETA 4XHMA 4IELA 2YZHA 1GRXA 4V2MA 3FR3A 2VLTA 3F4RA 4FO5A 2HZFA 1V58A 3DEXA 4WF5A 3LQ7A 2H71A 2N5AA 1ERTA 4F0CA 2M80A 4ECIA 1PKWA 3VWUA 3FZ4A 3GHAA 1X5EA 2VO4A 3TDGA 1TK5B 2H1DA 2E7PA 1K0AA 1FB0A 2YN1A 2CX4A 2YNXA 1ZZYA 3N5OA 11GSA 2HRNA 2A2SA 2H76A 2MBTA 1JZWA 4FH8A 2FHEA 5A4WA 3TRXA 4G19A 3KTLA 1SK2A 5ECRB 1RW1A 14GSA 3HJMA 2V41A 4ZIJA 2G2QA 2IPAA 3CMIA 2JSZA 4MJBA 4EL1A 4ISDA 2B1KA 3Q74A 3F6FA 1ZYQB 1WJKA 4KGIA 3IAM2 3IDVA 2DJ1A 4XS4B 3ZVJD 4K7OA 5ECNB 2XC2A 3TGZA 2XPDA 3MDKA 3ERFA 4GCIA 1DUGA 1NHOA 4GQCA 2C3NA 1EEMA 3GKXA 2ON5A 4I2UA 1AQVA 3D0ZA 3P7XA 4ZL8A 3GX0A 4KCEA 1GLPA 3F63A 4HJ2A 2HQTA 4N11A 4Q5FA 4WBJA 3GTUB 1XPVA 3CSHA 1TI3A 1GTIA 3KEBA 2MMNA 2VCWA 1Z3EA 1G0TA 3F3RA 2IJYA 1R5AA 2CX3A 2AJQB 1AQWA 3AY8A 3TJBA 4NMUA 1BEDA 5IQYA 2FY6A 4DSQA 1E6BA 3VWVA 5E59A 1T4YA 1O73A 1FOVA 4IQAA 2OE0A 5CP1A 1B4PA 1GTBA 4NAXA 4NWYA 4IP6A 5LD0A 4TXOB 5L71A 3IK9A 2QC7A 2WDUA 3BOAA 3U5RE 1ACVA 1U3AA 1EOHA 4ZBAA 4GTUA 2C3TA 1JLVA 3UAPA 4MPGA 4PNGA 4MZCA 2FCHA 2AHEA 3GNJA 5DALB 2GZYA 1FAAA 1YF1A 1Z6MA 1TDIA 5IO2A 1WE0A 1HNAA 4ID0A 1AUCA 1QK8A 3TB2A 1SENA 1YF0A 2VUPA 2YV7A 2HXKA 4KSOA 1ILOA 2LS5A 2CAQA 4KDUA 1T1VA 3HCZA 4ACSA 4GSNA 1WPIA 1VGLA 2OACA 1JZDA 2NVLA 3EWLA 4TN8A 1V2AA 3D4TA 5C04A 5DDLA 4NV2A 2X8HA 1OKTA 2FUG2 2CZ2A 3O6TA 4F0BA 2HZEB 2IMEA 3KCMA 1GTAA 1V57A 3KP8A 1GSDA 3C7MA 2J9HA 2RM6A 4XIHA 1PX6A 3IC8A 5ID2A 4KX4A 2H0GA 1MD4A 1XOAA 1A0FA 2GSSA 4E8EA 1SKSB 1TI1A 5JCUA 2VIMA 4QL7A 3H93A 1GH2A 5B6NA 2OADA 3EU4A 1NW2A 3APOA 4MH2A 3NZNA 4WF4A 1OC9B 10GSA 3MSZA 3F4TA 2P0GA 3EVIA 2EC4A 2HRKA 3GTUA 3GX8A 3L4NA 1ML6A 4QQ7A 2X8GA 1Z6NA 5H5RA 3CSIA 2H8LA 2L6CA 4V2LA 1SYRA 3IR4A 2YV9A 2F3MA 3IXRA 4K2DA 1YY7A 3KP9A 5HR3A 8GSSA 1YQ1A 5ECLB 3BJ5A 4MZWA 1YJ6A 2L57A 1F6MC 4ECJA 2O85A 1K0DA 4NXIA 2DJ2A 2OE1A 2TRXA 5GZZB 4TVEA 1RQMA 1GP1A 3ED3A 4AJ8A 3HDCA 1PD21 4TXOA 3J7Yk 3L9UA 3BD2A 3NIVA 4MMMA 1I5GA 2X8CA 3QCPA 5JWRB 3BBYA 1A0RP 1IYHA 1OC3A 2IL3A 1CQGA 1SD9A 5GAPD 3TRQA 4GSSA 2MMZA 3IA1A 4FYUA 4Q5NA 2YP6A 3HJOA 2L4QA 2IWTA 3GKNA 5DALA 1TRVA 1XXUA 1TXXA 2VL2A 2MYGA 4IVFA 1BAYA 5E4WA 2I4AA 5ECIB 1ZMAA 3VPQA 1W4VA 3APQA 5EVOA 5JWOB 2VD1A 1SU9A 4ZL9A 1XIYA 3DKSA 1FO5A 2WRTA 3KMNA 4RI7A 3KXOA 3FZAA 4DEJA 3SWLA 1JFUA 1GL8A 2GQMA 1R4WA 3TOTA 2LSTA 1AQXA 2JZRA 4TKYA 3LFLA 1ON4A 4OMVA 1T7PB 4MH3A 5G5FA 3ME8A 3A2WA 1Z9HA 6GSXA 5DCGA 1EP7A 5CRGA 2DIZA 3FY7A 1XWGA 4PXOA 2IMDA 4EC0A 5ELAA 1YKAA 4JU5A 4LL1B 4EDZA 2GTUA 4K7IA 3WYWA 1LBKA 1ST9A 4GSTA 4I8BA 3VK9A 3F8UA 2WCIA 1B9YC 3EE2A 3UVHA 1SJ6A 1V9WA 2H1GA 3WT2A 3EINA 3LSZA 2HRFA 3HKRA 4MF5A 3M0FA 1SYXA 5B8AA 2PERA 4YAPA 2H19A 4FIWA 3R2QA 3L9SA 4HQSA 1BQ7A 5FWGA 1ZL9A 2K8VA 2RLIA 1U3IA 2E2MA 2TRCP 2CV4A 1UVZA 4O92A 2H1AA 4EUYA 2YZUA 3E9JB 4JE1A 4FYBA 1U88A 3TJFA 1EP8A 1B48A 1XWBA 2R5GA 2KOKA 4Q5QA 4ZB9A 1PL1A 2H6ZA 3CTGA 4V2NA 3VI7A 5CAXA 2C3QA 2LQQA 4XCSA 5DBQA 1H75A 1EGRA 3M9JA 3P90A 4TXVA 4F2IA 3A3TA 5CRDA 3I43A 4MJEA 5D9VA 2VCQA 2ZUPA 1O6JA 4J57E 5EY6A 2VL3A 3ZIVA 4QL9A 1O7UA 1M2DA 3HYPA 1VF2A 3L0HA 2VAFA 5CREA 1QXHA 3HVSA 3MWHA 4K8MA 2R37A 1FB6A 1MTCA 5J41A 2X64A 3ERWA 9GSSA 5ECPB 1GUMA 1XFLA 5A4VA 5J4UA 1DSBA 2GVPA 3W8JA 1GSSA 3ZRDA 1T3BA 4PGTA 5GSTA 1A2JA 3GA4A 2I1UA 2F9SA 1F37A 1VF1A 4FQUA 4F9ZA 2QKEA 2PU9C 3HJPA 5G2ZA 2WULA 4ML1A 4MA9A 2O87A 3GUSA 1AW9A 2VCVA 1K0NA 1THXA 4RQXA 3UJ1A 4KDYA 1SJZA 4BWQA 5AIXA 2HE3A 4BVYB 1GLQA 1EWXA 3FK8A 5CYYA 2IMKA 4JEDA 4BVXA 1XWKA 1XW9A 1USBA 4GXZA 4MF6A 2XPEA 5HR2A 2IFQA 4IKHA 5ID2B 1SL0B 2R3XA 1OYJA 1TP9A 3HY2A 2EIQA 4KAEA 1UN2A 4IJ3A 4IGJA 2OJLA 1FG4A 5F07A 2WB9A 1WRYA 5IPGA 3TJGA 2YOIA 2FGXA 1X5DA 1B9XC 2FLSA 4N30A 2K9FA 6GSWA 4CDOA 2H30A 2KUCA 5EL8A 2V6KA 2HRKB 5B8BA 2B7JA 1XVQA 3Q6OA 4KCAA 4HDEA 5ECKB 1ZOFA 1MEKA 3CTFA 5IMCA 2YWIA 3GIXA 4PQ1A 1KEBA 3N9JA 3IPZA 5ECOB 3UOMA 2FD3A 1M9BA 1M2AA 2BJXA 3WGEA 5J9BA 5KEJA 1R26A 4K0NA 4USSA 1O81A 3TJKA 1UA5A 1PL2A 1LJRA 2WS2A 4X1UA 4LL4B 5J9CA 2VCXA 1AXDA 2JL4A 3I69A 2FWHA 5BMUA 3FZ9A 3PR8A 2LJRA 3ME7A 5KN2A 4DSSB 4YAVA 3M1GA 1THOA 2O7KA 4MLYA 1S3CA 3FYGA 2B5YA 2J23A 3QAGA 19GSA 4PURA 1ZGNA 1WP0A 1O85A 4I2TA 2WJUA 5F06A 1HYUA 3QR6A 5KN0A 1QQ2A 4MJAA 5D96A 3D21A 2GZPA 1X9SB 3ZITA 2I3YA 4LLRA 4Z7XA 1DE1A 3CSJA 3EC3A 13GSA 2YPMA 5GAND 4ZILA 3MNGA 2NPBA 3WGDA 4PTSA 1IYIA 3RDWA 3RHCA 3IK7A 2OA7A 2UZ8A 5ELGA 6GSUA 2H01A 2IN3A 2VCTA 3VLNA 3LXZA 1NHYA 4PUFC 1GTUA 4G0LA 1XBSA 4EF0A 4JBBA 2F51A 1UC7A 3F9UA 3WD6A 4BVYA 20GSA 3O3TA 4O7HA 2HSHA 2I9HA 3UVTA 1XZOA 3C8EA 2QGVA 4BWSA 2H6XA 2WZ9A 3HZ8A 2IIYA 5AGYA 4PQIA 2L5LA 5B7CA 5D8IA 4G9HA 4WR4A 5J5NA 2C0FA 4L0UA 2GS3A 5EPFA 4XRDA 3UBKA 1PQNA 1DE2A 1A8YA 3IC4A 2R4VA 3F3QA 3ZLPA 2A4VA 1EV9A 3QPMA 3IV4A 4HU9A 4D73B 2BTOT 3CXGA 2WFCA 2C4JA 3H1NA 2REMA 2GT5A 1FVJA 3DXBA 5HFIA 3KZQA 4P3YB 4TR4A 3US3A 3F6DA 5B6MA 2PMTA 3H8QA 5A4UA 3CBUA 4IJIA 2MBSA 4HJMA 5D9TA 2JZSA 2B5EA 2ALBA 2LUSA 2ZNMA 1GSFA 1QFNA 1JHBA 4IN0A 2IMFA 4AF2A 3M8NA 2B1LA 5ECMB 3C73A 2K8SA 1JZRA 3V1WA 5G1LA 2R6KA 5HFKA 2AYTA 1K3OA 1XWAA 4J56E 4K6XA 3PINA 2PN8A 1ZYEA 5CRWA 3GL3A 2QSIA 1FHEA 3PH9A 3SBCA 4KSMA 2DSAA 4MF7A 1TKDB 4N10A 1ZCPA 3FHKA 2EIRA 1OVNA 3F0IA 4MZBA 4DSSA 1U6TA 1M9AA 4KH7A 1QUWA 3G7JA 3Q18A 3TRPA 1GSQA 5GSSA 5CRHA 4KB3A 2HYXA 3L9VA 5HQPA 1RK4A 2HSNB 2PBJA 2L59A 4WKWA 3ZIJA 1Q4JA 4ECCA 3TCOA 3R3EA 4OFTA 3NOFA 5CO3A 3ZYWA 1Y25A 5DAKA 3A5WA 3S9FA 2GZZA 3WT1A 3HHVA 5F8BA 3FR6A 4IQ1A 2M72A 3GN3A 1K0BA 2L4CA 3FKFA 3TKPA 1MDJA 4HOJA 6GSSA 1SD8A 4ZBBA 2LEGA 4MJCA 1U87A 5FT3A 3FZ5A 2GSTA 5AIVA 1R7HA 3DIEA 2CAIA 5DCHA 3G9BA 4TOPA 1KTEA 1LU4A 2C0EA 1M0UA 4GLTA 2FA8A 4BVXB 3BCIA 4TR1B 4PNFA 1GSEA 2IFQB 1Z5YE 5IOWA 1F3BA 3WGXA 2HRAA 3E3EA 4ZB6A 4HS1A 3QDNA 1HD2A 3FEUA 1NSWA 3APSA 3TKSA 3LG6A 3C1RA 3DD3A 2KP1A 4EXJA 4N0ZA 3JCML 4F03A 4KF9A 4IP1A 3GH9A 4ECBA 2FNOA 5D73A 1TU7A 4DSRA 5AN1A 5C00A 2HT9A 4K9ZA 3C71A 2GGTA 5DVBA 3GYKA 1ABAA 5JCWA 2CVKA 4JR6A 1CQHA 4D73A 1GULA 4XRAA 3L78A 3EURA 1J08A 1PMTA 2LTKA 1EOGA 1SK1A 2CQ9A 1TRUA 2TIRA 1MDIA 3GV1A 5G30A 1TOFA 2OE3A 3H79A 1HQOA 3VURA 3KH9A 4I97A 2VD0A 1G7OA 1Z7PA 1VF4A 3MAKA 17GSA 3VI5A 2ON7A 2KP2A 1TK0B 2RIIA 3TUEA 4DVCA 2V32A 2E0QA 4OD7A 4NHWA 4ILFA 3W8SA 2GDRA 4GRFA 3RBTA 2YANA 5LCZA 4ZBDA 2DJ0A 4HU7A 3E0UA 4I6XA 2LV3A 2I81A 5FHIA 3A2VA 3DVXA 4MABA 2H66A 3TKRA 4TR3A 4TR0A 1A2MA 1AIUA 2V2GA 2L5OA 2BMXA 4F82A 4YQUA 3D5JA 4OO5A 1K0CA 2VOCA 2KHPA 3IOSA 4MP4A 3M3MA 2VLVA 3TKQA 1YEXA 4O5RA 5IIZA 2H72A 2V1MA 3LORA 4YH2A 4CHSA 4HI7A 2DJKA 3GKMA 4G0KA 1XWCA 2LNTA 3GURA 4K1FA 3ZZXA 3VWXA 3VWWA 3IAS2 3KH7A 3ZL5A 1PN9A 2M46A 2HFDA 2LQOA 2YWOA 4KA0A 4N0VA 3ZFBA 1G6YA
chains in the Genus database with same CATH superfamily
1YDKA 4PX1A 4AI6A 1SVMA 4XTSA 1YZXA 3I9V2 2WZSA 3DVWA 5DJLA 3HA9A 3EYTA 4EVMA 2YJ7A 3PPUA 3UMAA 5IMAA 4TR1A 2PPTA 5DJMA 5JWQB 4LMWA 1VRSD 4BIKA 4BA7A 4TW5A 1GSUA 5HR1A 3A2XA 2B5XA 4IS0A 4MPFA 1MDKA 2PWJA 1A24A 1XOBA 1ERVA 1HNCA 2PVQA 4YQVA 1M2BA 4EIQA 2AB6A 1SL2B 3LGCA 1T8EB 1T00A 2HI7A 1QMVA 3IRAA 1YEPA 3ZFLA 4IW9A 2GSQA 5G31A 2MZCA 1H4OA 4HQZA 3LXTA 4L5OA 3U6VA 3LYKA 2YWMA 4KE3A 3GSSA 3KJYA 5H5QA 2D2ZA 5J3RA 4I5QA 3IE3A 4V1Ap 3ISOA 2V6OA 3CYNA 2F8AA 3VPTA 3G7IA 1XW6A 1I9DA 1OAZA 3UEMA 1FVKA 4POKA 3MYDA 1HNBA 5KOWA 5IMFA 5IPHA 1Y6EA 5ECSA 2X99A 1Z7RA 1R5PA 3UL3A 1G7EA 2C0GA 4ZL7A 3FRCA 3EU3A 12GSA 2XBIA 5IMZA 3RAZA 5F05A 3FW2A 1MD3A 1F3AA 4PI0C 4E8HA 3KMOA 4XS1A 2FWGA 2VLUA 1NM3A 1K3LA 1AAZA 2PVOC 3KGKA 3K8NA 3OR5A 2H1BA 1PGTA 1PX7A 1URMA 2JU5A 2DBCA 5A5KA 1OE8A 1X9MB 5INYA 3UIWA 4KW6A 4ULXA 4NPBA 5JCGA 5ECQB 1M99A 5DAKB 1TRWA 4G10A 1OKDA 3LWAA 4WXTA 1X9WB 5IO0A 2B7KA 2VM2A 1Y1UA 4NHZA 4YQMA 2VM1A 2K18A 4LA1A 4K7NA 3UARA 4WEYA 5D9XA 6GSVA 2IMIA 3O76A 2L6DA 3Q19A 5A34B 6GSTA 2XBQA 1J0FA 4MNNA 1N8JA 4A5PA 5ECHB 2O3EA 3QOUA 1GUKA 3QAWA 5F0GA 4HUAA 4KUNA 4ZXGA 2WVYA 3GFKA 4BL7B 1X5CA 1T4ZA 5CNWA 1ERWA 3CQFA 1SKRB 4IBPA 2H6YA 1PFOA 2E2GA 3D6IA 3DWVA 4OCFA 1WOUA 3KD0A 2NBSA 4WBRD 1EZKA 1BYEA 2LRNA 3VFIA 1K0OA 2B6MA 2P5RA 5G5EA 4HEA2 1WIKA 2CVDA 2O89A 3TKSE 2NDOA 2H0IA 2DC5A 3TOUA 2O36A 4JZQA 4AGSA 2YWNA 3IHQA 5H5SA 3DYRA 4L8EA 2FWEA 4L0WA 4O32A 16GSA 1BF5A 5ABRA 22GSA 2JSYA 2PUKC 4JRRA 2DJJA 4OCEA 2CZ3A 1YKCA 1BX9A 4NV5A 1S3DA 2MMOA 3HVXA 3TJJA 5D9WA 3CRUA 1J9BA 4EO3A 4OFMA 4XS4A 1TRSA 1M3JA 4HZ2A 1A23A 1PKZA 3ZREA 2MMAA 3KTBA 3P8WA 2G0FA 3QFBC 2RUFA 5KN3A 2NTOA 1WWJA 5G1KA 2HSMB 2LRCA 5HR0A 2DKIA 2FA4A 3DGQA 2AV4A 2CA8A 3RGBC 1SVLA 2A2RA 1EGOA 5IMVA 2Z9SA 1B4QA 4OWYA 4RUVA 1XCCA 4ML6A 2C0DA 1PA3A 2F8FA 5KN1A 3QD9A 2DLXA 4XS6A 4LMVA 1O8XA 2LNSA 4MDCA 3M9KA 4OO4A 1SL1B 1SJIA 2LRTA 5A5HA 2GT6A 3GRXA 1ERUA 2K6VA 3IHGA 1V40A 4POBA 3UBLA 18GSA 2O8VB 2C80A 4GQFA 4PQHA 2LJAA 1W89A 3ZTLA 1A8LA 1K3YA 4TRXA 1PRXA 2DIYA 2LJKA 1BJXA 2RM5A 1S3AA 4EKZA 1BG5A 2H74A 2OBIA 3KIJA 5ENUA 3QAVA 2R2JA 4HZ4A 1EEJA 1Q98A 6GSYA 1GWCA 4KNDA 4Z2UA 3J7Yb 2PGTA 1VF3A 2H70A 5COHA 4X0XA 2N5BA 4EE0A 1V98A 1EV4A 1TK8B 1TJDA 2A4HA 2GQKA 5A34A 3DMLA 3RHBA 2XHFA 4POMA 5IMDA 2C8UA 2AUVA 3KM6A 1TW9A 1GNWA 3FR9A 3QFAC 4AJ6A 4O5UA 4BL7A 1GNEA 3GSTA 1SK0A 2P31A 3C1SA 1M7TA 4OFNA 4J2FA 2HNLA 2RUEA 3ZMKA 3GH6A 1XVWA 2H73A 1F2EA 1TU8A 5HFGA 2KLXA 1B8XA 3I6AA 2OBKA 4KDXA 2CT6A 2R0GA 4W66A 2C1YA 1O8WA 3P2AA 3H4KA 3F4SA 3HVVA 1C72A 1XW5A 2HZEA 3RPNA 2YCDA 3DRNA 4FYCA 3ZVJA 1FW1A 2JADA 1X0RA 2GQLA 2DJ3A 2VCZA 2HLSA 5LNKe 2H75A 2OKAA 3LJRA 5AISA 2VL9A 3CRTA 2JACA 3QMXA 5DQSA 2DMLA 2WGRA 4GWRA 4H86A 5D93A 2LKUA 4AJ7A 7GSSA 1F9MA 4IHUA 4ZB8A 5KOXA 5IOXA 4PUAA 1GUHA 4GF0A 1G6WA 2HSMA 4Q5RA 2FWFA 4V1Ag 2CVBA 3GMFA 4MK3A 3BCKA 1OC9A 4MCUA 1PSQA 4K0GA 2GLRA 2YJHA 3HXSA 2EIOA 2ZCTA 1OC8A 4G0IA 2DMMA 2AAWA 4JR4A 1OE7A 2HSYA 1TTZA 3A5IA 2JZTA 2P5QA 3ZMLA 2VL2C 3LEFA 2B3SA 5DQYA 1SKWB 1E2YA 2H0HA 1AC1A 3GKKA 3ERGA 2ES7A 3D4MA 3GL5A 3LYPA 1K0MA 5IM9A 4RQRA 1A2LA 1KBNA 4POLA 2VKZG 4BPYA 4RI6A 1N2AA 3EMXA 3IBHA 2N5FA 4WR5A 3PGTA 4CW9A 4X43A 2DKHA 3EMPA 3D22A 1JLWA 2GSRA 1QGVA 3HD5A 4L5LA 3G7YA 4G2EA 3W6GA 1WMJA 1GSYA 3RPPA 3HZ4A 1XG8A 3TKSC 4EDYA 1JZOA 1DBYA 1KNGA 4FXYP 4WETA 4XHMA 4IELA 2YZHA 1GRXA 4V2MA 3FR3A 2VLTA 3F4RA 4FO5A 2HZFA 1V58A 3DEXA 4WF5A 3LQ7A 2H71A 2N5AA 1ERTA 4F0CA 2M80A 4ECIA 1PKWA 3VWUA 3FZ4A 3GHAA 1X5EA 2VO4A 3TDGA 1TK5B 2H1DA 2E7PA 1K0AA 1FB0A 2YN1A 2CX4A 2YNXA 1ZZYA 3N5OA 11GSA 2HRNA 2A2SA 2H76A 2MBTA 1JZWA 4FH8A 2FHEA 5A4WA 3TRXA 4G19A 3HMJG 3KTLA 1SK2A 5ECRB 1RW1A 14GSA 3HJMA 2V41A 4ZIJA 2G2QA 2IPAA 3CMIA 2JSZA 4MJBA 4EL1A 4ISDA 2B1KA 3Q74A 3F6FA 1ZYQB 1WJKA 4KGIA 3IAM2 3IDVA 4PHZC 2DJ1A 4XS4B 3ZVJD 4K7OA 5ECNB 2XC2A 3TGZA 2XPDA 3MDKA 3ERFA 4GCIA 4G01A 1DUGA 1NHOA 4GQCA 2C3NA 1EEMA 3GKXA 2ON5A 2R0PA 4I2UA 1AQVA 3D0ZA 1BG1A 3P7XA 4ZL8A 3GX0A 4KCEA 1GLPA 2OT3A 3F63A 4HJ2A 2HQTA 4N11A 4Q5FA 4WBJA 3GTUB 1XPVA 3CSHA 1TI3A 1GTIA 3KEBA 2MMNA 2VCWA 1Z3EA 1G0TA 3F3RA 2IJYA 1R5AA 2CX3A 2AJQB 1AQWA 3AY8A 3TJBA 4NMUA 1BEDA 4CY6A 5IQYA 2FY6A 4DSQA 2QA1A 1E6BA 3VWVA 5E59A 1T4YA 1O73A 5A5HB 4IQAA 1FOVA 2OE0A 5CP1A 1B4PA 1GTBA 4NAXA 4NWYA 4IP6A 5LD0A 4TXOB 5L71A 3IK9A 2WW3A 2QC7A 2WDUA 3BOAA 3U5RE 1ACVA 1U3AA 4O5QA 4AKIA 1EOHA 4ZBAA 4GTUA 2C3TA 1JLVA 3UAPA 4MPGA 4PNGA 4MZCA 2FCHA 2AHEA 3GNJA 5DALB 2GZYA 1FAAA 1YF1A 1Z6MA 1S4BP 1TDIA 5IO2A 1WE0A 1HNAA 4ID0A 1S3RA 1AUCA 1QK8A 3TB2A 1SENA 1YF0A 2VUPA 2YV7A 2HXKA 4KSOA 1ILOA 2LS5A 2CAQA 4KDUA 1T1VA 3HCZA 4ACSA 4GSNA 1WPIA 1VGLA 2OACA 1JZDA 2NVLA 3EWLA 4TN8A 1V2AA 3D4TA 5C04A 5DDLA 4NV2A 2X8HA 1OKTA 2FUG2 2CZ2A 3O6TA 4F0BA 4YKFA 2WW1A 2HZEB 2IMEA 3KCMA 1GTAA 1V57A 3KP8A 1GSDA 3C7MA 2J9HA 4ZB7A 2RM6A 4XIHA 1PX6A 3IC8A 5ID2A 4KX4A 2H0GA 1MD4A 1XOAA 1A0FA 2GSSA 4E8EA 1SKSB 1TI1A 5JCUA 2VIMA 4QL7A 3H93A 1GH2A 5B6NA 2OADA 4AKGA 3EU4A 1NW2A 3APOA 4MH2A 3NZNA 4WF4A 1OC9B 10GSA 3MSZA 3F4TA 2P0GA 3EVIA 2EC4A 2HRKA 3GTUA 3GX8A 3L4NA 1ML6A 4QQ7A 2X8GA 1Z6NA 5H5RA 3CSIA 2H8LA 2L6CA 2WW2A 4V2LA 1SYRA 3IR4A 2YV9A 2F3MA 3IXRA 4K2DA 1YY7A 3KP9A 5HR3A 8GSSA 1YQ1A 5ECLB 3BJ5A 4MZWA 1YJ6A 2L57A 1F6MC 4ECJA 2O85A 1K0DA 4NXIA 2DJ2A 1YVLA 2OE1A 2TRXA 5GZZB 4TVEA 1RQMA 1GP1A 3ED3A 4AJ8A 3HDCA 1PD21 4TXOA 3J7Yk 2UV8G 4E68A 3L9UA 3BD2A 3NIVA 4MMMA 1I5GA 2X8CA 3QCPA 5JWRB 3BBYA 1A0RP 1IYHA 3EPTA 1OC3A 2IL3A 1CQGA 1SD9A 5GAPD 3TRQA 4GSSA 3TU3B 5J4VA 2MMZA 3IA1A 4FYUA 4Q5NA 4YKGA 2YP6A 3HJOA 2L4QA 2IWTA 3GKNA 5DALA 1TRVA 1XXUA 1TXXA 2VL2A 2MYGA 4IVFA 1BAYA 5E4WA 2I4AA 5ECIB 1ZMAA 2X49A 3VPQA 1W4VA 3APQA 5EVOA 5JWOB 2VD1A 1SU9A 3FMWA 4ZL9A 1XIYA 3DKSA 1FO5A 2WRTA 3KMNA 4RI7A 4AKHA 3KXOA 3FZAA 4DEJA 3SWLA 1JFUA 1GL8A 2GQMA 1R4WA 3TOTA 2LSTA 1AQXA 2JZRA 4TKYA 3LFLA 1ON4A 4OMVA 5J47A 2EFEA 1T7PB 4MH3A 5G5FA 3ME8A 1SVOA 3A2WA 2A2PA 1Z9HA 6GSXA 5DCGA 1EP7A 5CRGA 2DIZA 3FY7A 1XWGA 4PXOA 2IMDA 4EC0A 5ELAA 1YKAA 4JU5A 4LL1B 4EDZA 2GTUA 4K7IA 3WYWA 1LBKA 1ST9A 4GSTA 4I8BA 3VK9A 3F8UA 2WCIA 1B9YC 3EE2A 3UVHA 1SJ6A 1V9WA 2H1GA 3WT2A 3EINA 3LSZA 2HRFA 3HKRA 4MF5A 3M0FA 1SYXA 5B8AA 2PERA 4PI2C 4YAPA 2H19A 4FIWA 3R2QA 3L9SA 4HQSA 1BQ7A 5FWGA 1ZL9A 2K8VA 2RLIA 1U3IA 2E2MA 2TRCP 2CV4A 1UVZA 4O92A 2H1AA 4EUYA 2YZUA 3E9JB 4JE1A 4FYBA 1U88A 3TJFA 1EP8A 1B48A 1XWBA 2R5GA 2KOKA 4Q5QA 4ZB9A 1PL1A 2H6ZA 3CTGA 4Z2RA 4V2NA 2EFDA 3VI7A 5CAXA 2C3QA 2LQQA 4XCSA 5DBQA 1H75A 1EGRA 3M9JA 3P90A 4TXVA 4F2IA 3A3TA 5CRDA 3I43A 4MJEA 5D9VA 2VCQA 2ZUPA 1O6JA 4J57E 5EY6A 2VL3A 3ZIVA 4QL9A 1O7UA 1M2DA 3HYPA 1VF2A 3L0HA 2VAFA 5CREA 1QXHA 3HVSA 3MWHA 4K8MA 2R37A 3CHXC 1FB6A 1MTCA 5J41A 2X64A 3ERWA 9GSSA 5ECPB 1GUMA 1XFLA 5A4VA 5J4UA 1DSBA 2GVPA 3W8JA 1GSSA 3ZRDA 1T3BA 4PGTA 5GSTA 1A2JA 1M3IA 2I1UA 3GA4A 2F9SA 1F37A 1VF1A 4FQUA 4F9ZA 2QKEA 2PU9C 3HJPA 5G2ZA 2WULA 4ML1A 4MA9A 2O87A 3GUSA 1AW9A 2VCVA 1K0NA 1THXA 4RQXA 3UJ1A 4KDYA 1SJZA 4BWQA 5AIXA 2HE3A 4BVYB 1GLQA 1EWXA 3FK8A 5CYYA 2R0CA 5J40A 2IMKA 4JEDA 4BVXA 1XWKA 1XW9A 1USBA 4GXZA 4MF6A 2XPEA 5HR2A 2IFQA 4IKHA 5ID2B 1SL0B 2R3XA 1OYJA 1TP9A 3HY2A 2EIQA 4KAEA 1UN2A 4IJ3A 4IGJA 2OJLA 1FG4A 5F07A 2WB9A 1WRYA 5IPGA 3HVNA 3TJGA 2YOIA 2FGXA 1X5DA 1B9XC 2FLSA 4N30A 2K9FA 6GSWA 4CDOA 2H30A 2KUCA 4GDFA 5EL8A 2V6KA 2HRKB 5B8BA 2B7JA 1XVQA 3Q6OA 2O5VA 2WVXA 4KCAA 4HDEA 5ECKB 1ZOFA 1MEKA 3CTFA 5IMCA 2YWIA 3GIXA 4PQ1A 1KEBA 3N9JA 3IPZA 5ECOB 3UOMA 2FD3A 1M9BA 1M2AA 2BJXA 3WGEA 5J9BA 5KEJA 1R26A 4K0NA 4USSA 1O81A 3TJKA 1UA5A 3LW9A 1PL2A 1LJRA 2WS2A 4X1UA 4LL4B 5J9CA 2VCXA 1AXDA 2JL4A 3I69A 2FWHA 5BMUA 3FZ9A 3PR8A 2LJRA 3ME7A 5J4YA 4HSCX 5KN2A 4DSSB 4YAVA 3M1GA 1THOA 2O7KA 4MLYA 1S3CA 3FYGA 2B5YA 2J23A 3QAGA 19GSA 4PURA 1ZGNA 1WP0A 1O85A 4I2TA 2WJUA 5F06A 1HYUA 3QR6A 5KN0A 1QQ2A 4MJAA 5D96A 3D21A 2GZPA 4CY8A 1X9SB 3ZITA 2I3YA 4LLRA 4Z7XA 1DE1A 3CSJA 3EC3A 13GSA 2YPMA 5GAND 4ZILA 3MNGA 2NPBA 3WGDA 4PTSA 2X4AA 1IYIA 3RDWA 3RHCA 3IK7A 2OA7A 2UZ8A 5ELGA 6GSUA 2H01A 2IN3A 2VCTA 3VLNA 3LXZA 1NHYA 4PUFC 1YEWC 1GTUA 4G0LA 1XBSA 4EF0A 4EIPA 4JBBA 2F51A 1UC7A 3F9UA 3WD6A 4BVYA 20GSA 3O3TA 2H1LA 4O7HA 2HSHA 2I9HA 3UVTA 1XZOA 2WVZA 3C8EA 2QGVA 4BWSA 2H6XA 2WZ9A 1ZYNA 1ZYPA 3HZ8A 2IIYA 5AGYA 4PQIA 2L5LA 5B7CA 4X4JA 5D8IA 4G9HA 4WR4A 5J5NA 4K2XA 2C0FA 4L0UA 2GS3A 5EPFA 4XRDA 3UBKA 1PQNA 1DE2A 1A8YA 3IC4A 1FOHA 2R4VA 3F3QA 3ZLPA 2A4VA 5A1NB 1EV9A 3QPMA 3IV4A 4HU9A 4D73B 2BTOT 3CXGA 2WFCA 2C4JA 3H1NA 2REMA 2GT5A 1FVJA 3DXBA 5HFIA 3KZQA 4P3YB 4TR4A 3US3A 3F6DA 5B6MA 2PMTA 3H8QA 5A4UA 3CBUA 4IJIA 3MIXA 2MBSA 5D9TA 2JZSA 2B5EA 2ALBA 2LUSA 4HJMA 2ZNMA 4AKXB 1GSFA 1QFNA 3CWGA 1JHBA 4IN0A 2IMFA 4AF2A 3M8NA 2B1LA 5ECMB 3C73A 2K8SA 1JZRA 3V1WA 4Z2TA 5G1LA 2R6KA 5HFKA 2AYTA 1K3OA 1XWAA 4J56E 4K6XA 3PINA 2PN8A 1ZYEA 5CRWA 3GL3A 2QSIA 1FHEA 1N25A 3PH9A 3SBCA 4KSMA 2DSAA 4MF7A 1TKDB 4N10A 5BRTA 1ZCPA 3FHKA 2EIRA 1OVNA 3F0IA 4MZBA 4DSSA 1U6TA 1M9AA 4KH7A 1QUWA 3G7JA 3Q18A 3TRPA 1GSQA 5GSSA 5CRHA 4KB3A 2HYXA 3L9VA 5HQPA 1RK4A 2EFCA 2HSNB 2PBJA 2L59A 4WKWA 3ZIJA 1Q4JA 4ECCA 3TCOA 3R3EA 4OFTA 3NOFA 5CO3A 3ZYWA 1Y25A 4N3ZA 5DAKA 3A5WA 3S9FA 2GZZA 3WT1A 3HHVA 5F8BA 3FR6A 4IQ1A 2M72A 4K5SA 3GN3A 1K0BA 2EFHA 2L4CA 3FKFA 1MDJA 3TKPA 4HOJA 6GSSA 1SD8A 4ZBBA 2LEGA 4MJCA 1U87A 1TXUA 5FT3A 3FZ5A 2GSTA 5AIVA 1R7HA 3DIEA 2CAIA 5DCHA 3G9BA 4TOPA 1KTEA 1LU4A 2C0EA 1M0UA 4GLTA 2FA8A 4BVXB 3BCIA 4TR1B 4PNFA 1GSEA 2IFQB 1Z5YE 5IOWA 1F3BA 3WGXA 2HRAA 3E3EA 4ZB6A 4HS1A 3QDNA 1HD2A 3FEUA 1NSWA 3APSA 3TKSA 3LG6A 3C1RA 3DD3A 2KP1A 4EXJA 4N0ZA 3JCML 4F03A 4KF9A 4IP1A 3GH9A 4ECBA 2FNOA 5D73A 1TU7A 4DSRA 5AN1A 5C00A 2HT9A 1PN0A 4K9ZA 3C71A 5A1NA 2GGTA 5DVBA 2WVXB 3GYKA 1ABAA 5JCWA 2CVKA 4JR6A 4QMKA 1CQHA 4D73A 1GULA 4XRAA 3L78A 3EURA 1J08A 1PMTA 2LTKA 1EOGA 1SK1A 2CQ9A 1TRUA 2TIRA 1MDIA 3GV1A 5G30A 1TOFA 2OE3A 3H79A 2WW0A 1HQOA 3VURA 4K5RA 3KH9A 4I97A 2VD0A 1G7OA 1Z7PA 1VF4A 3MAKA 17GSA 5BMUB 3VI5A 2ON7A 2KP2A 1TK0B 2RIIA 3TUEA 4DVCA 2V32A 2E0QA 4OD7A 4NHWA 4ILFA 3W8SA 2GDRA 4GRFA 3RBTA 2YANA 5LCZA 4ZBDA 2DJ0A 4HU7A 3E0UA 4I6XA 2LV3A 2I81A 5FHIA 4ICYA 3A2VA 3DVXA 4MABA 2H66A 3TKRA 4TR3A 2QA2A 4TR0A 1A2MA 1AIUA 2V2GA 2L5OA 2BMXA 4F82A 4YQUA 2HSNA 3D5JA 4OO5A 1K0CA 2VOCA 2KHPA 3IOSA 4MP4A 3M3MA 2VLVA 3TKQA 1I1IP 1YEXA 4O5RA 5IIZA 2H72A 2V1MA 3LORA 4YH2A 4CHSA 4HI7A 3RFRC 2DJKA 3GKMA 4G0KA 1XWCA 2LNTA 3GURA 4K1FA 3ZZXA 3VWXA 3VWWA 3IAS2 3KH7A 3ZL5A 1PN9A 2M46A 2HFDA 2LQOA 2YWOA 4KA0A 4N0VA 3ZFBA 1G6YA
chains in the Genus database with same CATH topology
1YDKA 4PX1A 4AI6A 1SVMA 4XTSA 1YZXA 3I9V2 3HA9A 3DVWA 5DJLA 3EYTA 4EVMA 2YJ7A 3PPUA 3UMAA 5IMAA 4TR1A 2PPTA 5DJMA 5JWQB 4LMWA 1VRSD 4BA7A 4TW5A 1GSUA 5HR1A 3A2XA 2B5XA 4IS0A 4MPFA 1MDKA 2PWJA 1A24A 1XOBA 1ERVA 1HNCA 2PVQA 4YQVA 1M2BA 4EIQA 2AB6A 1SL2B 3LGCA 1T8EB 1T00A 2HI7A 1QMVA 3IRAA 1YEPA 3ZFLA 4IW9A 2GSQA 5G31A 2MZCA 1H4OA 4HQZA 3LXTA 4L5OA 3U6VA 3LYKA 2YWMA 4KE3A 3GSSA 3KJYA 5H5QA 2D2ZA 5J3RA 4I5QA 3IE3A 4V1Ap 3ISOA 2V6OA 3CYNA 2F8AA 3VPTA 3G7IA 1XW6A 1I9DA 1OAZA 3UEMA 1FVKA 4POKA 3MYDA 1HNBA 5KOWA 5IMFA 5IPHA 1Y6EA 5ECSA 2X99A 1Z7RA 1R5PA 3UL3A 1G7EA 2C0GA 4ZL7A 3FRCA 3EU3A 12GSA 2XBIA 5IMZA 3RAZA 5F05A 3FW2A 1MD3A 1F3AA 4E8HA 3KMOA 4XS1A 2FWGA 2VLUA 1NM3A 1K3LA 1AAZA 2PVOC 3KGKA 3K8NA 3OR5A 2H1BA 1PGTA 1PX7A 1URMA 2JU5A 2DBCA 5A5KA 1OE8A 1X9MB 5INYA 3UIWA 4KW6A 4ULXA 4NPBA 5JCGA 5ECQB 1M99A 5DAKB 1TRWA 4G10A 1OKDA 3LWAA 4WXTA 1X9WB 5IO0A 2B7KA 2VM2A 1Y1UA 4NHZA 4YQMA 2VM1A 2K18A 4LA1A 4K7NA 3UARA 4WEYA 5D9XA 6GSVA 2IMIA 3O76A 2L6DA 3Q19A 5A34B 6GSTA 2XBQA 1J0FA 4MNNA 1N8JA 4A5PA 5ECHB 3QOUA 1GUKA 3QAWA 5F0GA 4HUAA 4KUNA 4ZXGA 3GFKA 4BL7B 1X5CA 1T4ZA 5CNWA 1ERWA 1SKRB 4IBPA 2H6YA 3DWVA 2E2GA 3D6IA 4OCFA 1WOUA 3KD0A 2NBSA 4WBRD 1EZKA 1BYEA 2LRNA 3VFIA 1K0OA 2B6MA 2P5RA 5G5EA 4HEA2 1WIKA 2CVDA 2O89A 3TKSE 2NDOA 2H0IA 2DC5A 3TOUA 4JZQA 4AGSA 2YWNA 3IHQA 5H5SA 3DYRA 4L8EA 2FWEA 4L0WA 4O32A 16GSA 1BF5A 5ABRA 22GSA 2JSYA 2PUKC 4JRRA 2DJJA 4OCEA 2CZ3A 1YKCA 1BX9A 4NV5A 1S3DA 2MMOA 3HVXA 3TJJA 5D9WA 3CRUA 1J9BA 4EO3A 4OFMA 4XS4A 1TRSA 4HZ2A 1A23A 1PKZA 3ZREA 2MMAA 3KTBA 3P8WA 2G0FA 3QFBC 2RUFA 5KN3A 2NTOA 1WWJA 5G1KA 2HSMB 2LRCA 5HR0A 2DKIA 2FA4A 3DGQA 2AV4A 2CA8A 1SVLA 2A2RA 1EGOA 5IMVA 2Z9SA 1B4QA 4OWYA 4RUVA 1XCCA 4ML6A 2C0DA 1PA3A 2F8FA 5KN1A 3QD9A 2DLXA 4XS6A 4LMVA 1O8XA 2LNSA 4MDCA 3M9KA 4OO4A 1SL1B 1SJIA 2LRTA 5A5HA 2GT6A 3GRXA 1ERUA 2K6VA 3IHGA 1V40A 4POBA 3UBLA 18GSA 2O8VB 2C80A 4GQFA 4PQHA 2LJAA 1W89A 3ZTLA 1A8LA 1K3YA 4TRXA 1PRXA 2DIYA 2LJKA 1BJXA 2RM5A 1S3AA 4EKZA 1BG5A 2H74A 2OBIA 3KIJA 5ENUA 3QAVA 2R2JA 4HZ4A 1EEJA 1Q98A 6GSYA 1GWCA 4KNDA 4Z2UA 3J7Yb 2PGTA 1VF3A 2H70A 5COHA 4X0XA 2N5BA 4EE0A 1V98A 1EV4A 1TK8B 1TJDA 2A4HA 2GQKA 5A34A 3DMLA 3RHBA 2XHFA 4POMA 5IMDA 2C8UA 2AUVA 3KM6A 1TW9A 1GNWA 3FR9A 3QFAC 4AJ6A 4O5UA 4BL7A 1GNEA 3GSTA 1SK0A 2P31A 3C1SA 1M7TA 4OFNA 4J2FA 2HNLA 2RUEA 3ZMKA 3GH6A 1XVWA 2H73A 1F2EA 1TU8A 5HFGA 2KLXA 1B8XA 3I6AA 2OBKA 4KDXA 2CT6A 2R0GA 4W66A 2C1YA 1O8WA 3P2AA 3H4KA 3F4SA 3HVVA 1C72A 1XW5A 2HZEA 3RPNA 2YCDA 3DRNA 4FYCA 3ZVJA 1FW1A 2JADA 1X0RA 2GQLA 2DJ3A 2VCZA 2HLSA 5LNKe 2H75A 2OKAA 3LJRA 5AISA 2VL9A 3CRTA 2JACA 3QMXA 5DQSA 2DMLA 2WGRA 4GWRA 4H86A 5D93A 2LKUA 4AJ7A 7GSSA 1F9MA 4IHUA 4ZB8A 5KOXA 5IOXA 4PUAA 1GUHA 4GF0A 1G6WA 2HSMA 4Q5RA 2FWFA 4V1Ag 2CVBA 3GMFA 4MK3A 3BCKA 1OC9A 4MCUA 1PSQA 4K0GA 2GLRA 2YJHA 3HXSA 2EIOA 2ZCTA 1OC8A 4G0IA 2DMMA 2AAWA 4JR4A 1OE7A 2HSYA 1TTZA 3A5IA 2JZTA 2P5QA 3ZMLA 2VL2C 3LEFA 2B3SA 5DQYA 1SKWB 1E2YA 2H0HA 1AC1A 3GKKA 3ERGA 2ES7A 3D4MA 3GL5A 3LYPA 1K0MA 5IM9A 4RQRA 1A2LA 1KBNA 4POLA 2VKZG 4BPYA 4RI6A 1N2AA 3EMXA 3IBHA 2N5FA 4WR5A 3PGTA 4CW9A 4X43A 2DKHA 3EMPA 3D22A 1JLWA 2GSRA 1QGVA 3HD5A 4L5LA 3G7YA 4G2EA 3W6GA 1WMJA 1GSYA 3RPPA 3HZ4A 3TKSC 4EDYA 1JZOA 1DBYA 1KNGA 4WETA 4XHMA 4IELA 2YZHA 1GRXA 4V2MA 3FR3A 2VLTA 3F4RA 4FO5A 2HZFA 1V58A 3DEXA 4WF5A 3LQ7A 2H71A 2N5AA 1ERTA 4F0CA 2M80A 4ECIA 1PKWA 3VWUA 3FZ4A 3GHAA 1X5EA 2VO4A 3TDGA 1TK5B 2H1DA 2E7PA 1K0AA 1FB0A 2YN1A 2CX4A 2YNXA 1ZZYA 3N5OA 11GSA 2HRNA 2A2SA 2H76A 2MBTA 1JZWA 4FH8A 2FHEA 5A4WA 3TRXA 4G19A 3HMJG 3KTLA 1SK2A 5ECRB 1RW1A 14GSA 3HJMA 2V41A 4ZIJA 2G2QA 2IPAA 3CMIA 2JSZA 4MJBA 4EL1A 4ISDA 2B1KA 3Q74A 3F6FA 1ZYQB 1WJKA 4KGIA 3IAM2 3IDVA 2DJ1A 4XS4B 3ZVJD 4K7OA 5ECNB 2XC2A 3TGZA 2XPDA 3MDKA 3ERFA 4GCIA 4G01A 1DUGA 1NHOA 4GQCA 2C3NA 1EEMA 3GKXA 2ON5A 2R0PA 4I2UA 1AQVA 3D0ZA 1BG1A 3P7XA 4ZL8A 3GX0A 4KCEA 1GLPA 2OT3A 3F63A 4HJ2A 2HQTA 4N11A 4Q5FA 4WBJA 3GTUB 1XPVA 3CSHA 1TI3A 1GTIA 3KEBA 2MMNA 2VCWA 1Z3EA 1G0TA 3F3RA 2IJYA 1R5AA 2CX3A 2AJQB 1AQWA 3AY8A 3TJBA 4NMUA 1BEDA 4CY6A 5IQYA 2FY6A 4DSQA 2QA1A 1E6BA 3VWVA 5E59A 1T4YA 1O73A 5A5HB 4IQAA 1FOVA 2OE0A 5CP1A 1B4PA 1GTBA 4NAXA 4NWYA 4IP6A 5LD0A 4TXOB 5L71A 3IK9A 2QC7A 2WDUA 3BOAA 3U5RE 1ACVA 1U3AA 4O5QA 4AKIA 1EOHA 4ZBAA 4GTUA 2C3TA 1JLVA 3UAPA 4MPGA 4PNGA 4MZCA 2FCHA 2AHEA 3GNJA 5DALB 2GZYA 1FAAA 1YF1A 1Z6MA 1TDIA 5IO2A 1WE0A 1HNAA 4ID0A 1AUCA 1QK8A 3TB2A 1SENA 1YF0A 2VUPA 2YV7A 2HXKA 4KSOA 1ILOA 2LS5A 2CAQA 4KDUA 1T1VA 3HCZA 4ACSA 4GSNA 1WPIA 1VGLA 2OACA 1JZDA 2NVLA 3EWLA 4TN8A 1V2AA 3D4TA 5C04A 5DDLA 4NV2A 2X8HA 1OKTA 2FUG2 2CZ2A 3O6TA 4F0BA 4YKFA 2HZEB 2IMEA 3KCMA 1GTAA 1V57A 3KP8A 1GSDA 3C7MA 2J9HA 4ZB7A 2RM6A 4XIHA 1PX6A 3IC8A 5ID2A 4KX4A 2H0GA 1MD4A 1XOAA 1A0FA 2GSSA 4E8EA 1SKSB 1TI1A 5JCUA 2VIMA 4QL7A 3H93A 1GH2A 5B6NA 2OADA 4AKGA 3EU4A 1NW2A 3APOA 4MH2A 3NZNA 4WF4A 1OC9B 10GSA 3MSZA 3F4TA 2P0GA 3EVIA 2EC4A 2HRKA 3GTUA 3GX8A 3L4NA 1ML6A 4QQ7A 2X8GA 1Z6NA 5H5RA 3CSIA 2H8LA 2L6CA 4V2LA 1SYRA 3IR4A 2YV9A 2F3MA 3IXRA 4K2DA 1YY7A 3KP9A 5HR3A 8GSSA 1YQ1A 5ECLB 3BJ5A 4MZWA 1YJ6A 2L57A 1F6MC 4ECJA 2O85A 1K0DA 4NXIA 2DJ2A 1YVLA 2OE1A 2TRXA 5GZZB 4TVEA 1RQMA 1GP1A 3ED3A 4AJ8A 3HDCA 1PD21 4TXOA 3J7Yk 2UV8G 4E68A 3L9UA 3BD2A 3NIVA 4MMMA 1I5GA 2X8CA 3QCPA 5JWRB 3BBYA 1A0RP 1IYHA 3EPTA 1OC3A 2IL3A 1CQGA 1SD9A 5GAPD 3TRQA 4GSSA 3TU3B 5J4VA 2MMZA 3IA1A 4FYUA 4Q5NA 4YKGA 2YP6A 3HJOA 2L4QA 2IWTA 3GKNA 5DALA 1TRVA 1XXUA 1TXXA 2VL2A 2MYGA 4IVFA 1BAYA 5E4WA 2I4AA 5ECIB 1ZMAA 2X49A 3VPQA 1W4VA 3APQA 5EVOA 5JWOB 2VD1A 1SU9A 3FMWA 4ZL9A 1XIYA 3DKSA 1FO5A 2WRTA 3KMNA 4RI7A 4AKHA 3KXOA 3FZAA 4DEJA 3SWLA 1JFUA 1GL8A 2GQMA 1R4WA 3TOTA 2LSTA 1AQXA 2JZRA 4TKYA 3LFLA 1ON4A 4OMVA 5J47A 2EFEA 1T7PB 4MH3A 5G5FA 3ME8A 1SVOA 3A2WA 2A2PA 1Z9HA 6GSXA 5DCGA 1EP7A 5CRGA 2DIZA 3FY7A 1XWGA 4PXOA 2IMDA 4EC0A 5ELAA 1YKAA 4JU5A 4LL1B 4EDZA 2GTUA 4K7IA 3WYWA 1LBKA 1ST9A 4GSTA 4I8BA 3VK9A 3F8UA 2WCIA 1B9YC 3EE2A 3UVHA 1SJ6A 1V9WA 2H1GA 3WT2A 3EINA 3LSZA 2HRFA 3HKRA 4MF5A 3M0FA 1SYXA 5B8AA 2PERA 4YAPA 2H19A 4FIWA 3R2QA 3L9SA 4HQSA 1BQ7A 5FWGA 1ZL9A 2K8VA 2RLIA 1U3IA 2E2MA 2TRCP 2CV4A 1UVZA 4O92A 2H1AA 4EUYA 2YZUA 3E9JB 4JE1A 4FYBA 1U88A 3TJFA 1EP8A 1B48A 1XWBA 2R5GA 2KOKA 4Q5QA 4ZB9A 1PL1A 2H6ZA 3CTGA 4Z2RA 4V2NA 2EFDA 3VI7A 5CAXA 2C3QA 2LQQA 4XCSA 5DBQA 1H75A 1EGRA 3M9JA 3P90A 4TXVA 4F2IA 3A3TA 5CRDA 3I43A 4MJEA 5D9VA 2VCQA 2ZUPA 1O6JA 4J57E 5EY6A 2VL3A 3ZIVA 4QL9A 1O7UA 1M2DA 3HYPA 1VF2A 3L0HA 2VAFA 5CREA 1QXHA 3HVSA 3MWHA 4K8MA 2R37A 1FB6A 1MTCA 5J41A 2X64A 3ERWA 9GSSA 5ECPB 1GUMA 1XFLA 5A4VA 5J4UA 1DSBA 2GVPA 3W8JA 1GSSA 3ZRDA 1T3BA 4PGTA 5GSTA 1A2JA 3GA4A 2I1UA 2F9SA 1F37A 1VF1A 4FQUA 4F9ZA 2QKEA 2PU9C 3HJPA 5G2ZA 2WULA 4ML1A 4MA9A 2O87A 3GUSA 1AW9A 2VCVA 1K0NA 1THXA 4RQXA 3UJ1A 4KDYA 1SJZA 4BWQA 5AIXA 2HE3A 4BVYB 1GLQA 1EWXA 3FK8A 5CYYA 2R0CA 5J40A 2IMKA 4JEDA 4BVXA 1XWKA 1XW9A 1USBA 4GXZA 4MF6A 2XPEA 5HR2A 2IFQA 4IKHA 5ID2B 1SL0B 2R3XA 1OYJA 1TP9A 3HY2A 2EIQA 4KAEA 1UN2A 4IJ3A 4IGJA 2OJLA 1FG4A 5F07A 2WB9A 1WRYA 5IPGA 3TJGA 2YOIA 2FGXA 1X5DA 1B9XC 2FLSA 4N30A 2K9FA 6GSWA 4CDOA 2H30A 2KUCA 4GDFA 5EL8A 2V6KA 2HRKB 5B8BA 2B7JA 1XVQA 3Q6OA 2O5VA 4KCAA 4HDEA 5ECKB 1ZOFA 1MEKA 3CTFA 5IMCA 2YWIA 3GIXA 4PQ1A 1KEBA 3N9JA 3IPZA 5ECOB 3UOMA 2FD3A 1M9BA 1M2AA 2BJXA 3WGEA 5J9BA 5KEJA 1R26A 4K0NA 4USSA 1O81A 3TJKA 1UA5A 3LW9A 1PL2A 1LJRA 2WS2A 4X1UA 4LL4B 5J9CA 2VCXA 1AXDA 2JL4A 3I69A 2FWHA 5BMUA 3FZ9A 3PR8A 2LJRA 3ME7A 5J4YA 5KN2A 4DSSB 4YAVA 3M1GA 1THOA 2O7KA 4MLYA 1S3CA 3FYGA 2B5YA 2J23A 3QAGA 19GSA 4PURA 1ZGNA 1WP0A 1O85A 4I2TA 2WJUA 5F06A 1HYUA 3QR6A 5KN0A 1QQ2A 4MJAA 5D96A 3D21A 2GZPA 4CY8A 1X9SB 3ZITA 2I3YA 4LLRA 4Z7XA 1DE1A 3CSJA 3EC3A 13GSA 2YPMA 5GAND 4ZILA 3MNGA 2NPBA 3WGDA 4PTSA 2X4AA 1IYIA 3RDWA 3RHCA 3IK7A 2OA7A 2UZ8A 5ELGA 6GSUA 2H01A 2IN3A 2VCTA 3VLNA 3LXZA 1NHYA 4PUFC 1GTUA 4G0LA 1XBSA 4EF0A 4EIPA 4JBBA 2F51A 1UC7A 3F9UA 3WD6A 4BVYA 20GSA 3O3TA 2H1LA 4O7HA 2HSHA 2I9HA 3UVTA 1XZOA 3C8EA 2QGVA 4BWSA 2H6XA 2WZ9A 1ZYNA 1ZYPA 3HZ8A 2IIYA 5AGYA 4PQIA 2L5LA 5B7CA 4X4JA 5D8IA 4G9HA 4WR4A 5J5NA 4K2XA 2C0FA 4L0UA 2GS3A 5EPFA 4XRDA 3UBKA 1PQNA 1DE2A 1A8YA 3IC4A 1FOHA 2R4VA 3F3QA 3ZLPA 2A4VA 5A1NB 1EV9A 3QPMA 3IV4A 4HU9A 4D73B 2BTOT 3CXGA 2WFCA 2C4JA 3H1NA 2REMA 2GT5A 1FVJA 3DXBA 5HFIA 3KZQA 4P3YB 4TR4A 3US3A 3F6DA 5B6MA 2PMTA 3H8QA 5A4UA 3CBUA 4IJIA 3MIXA 2MBSA 5D9TA 2JZSA 2B5EA 2ALBA 2LUSA 4HJMA 2ZNMA 4AKXB 1GSFA 1QFNA 3CWGA 1JHBA 4IN0A 2IMFA 4AF2A 3M8NA 2B1LA 5ECMB 3C73A 2K8SA 1JZRA 3V1WA 4Z2TA 5G1LA 2R6KA 5HFKA 2AYTA 1K3OA 1XWAA 4J56E 4K6XA 3PINA 2PN8A 1ZYEA 5CRWA 3GL3A 2QSIA 1FHEA 1N25A 3PH9A 3SBCA 4KSMA 2DSAA 4MF7A 1TKDB 4N10A 5BRTA 1ZCPA 3FHKA 2EIRA 1OVNA 3F0IA 4MZBA 4DSSA 1U6TA 1M9AA 4KH7A 1QUWA 3G7JA 3Q18A 3TRPA 1GSQA 5GSSA 5CRHA 4KB3A 2HYXA 3L9VA 5HQPA 1RK4A 2EFCA 2HSNB 2PBJA 2L59A 4WKWA 3ZIJA 1Q4JA 4ECCA 3TCOA 3R3EA 4OFTA 3NOFA 5CO3A 3ZYWA 1Y25A 4N3ZA 5DAKA 3A5WA 3S9FA 2GZZA 3WT1A 3HHVA 5F8BA 3FR6A 4IQ1A 2M72A 4K5SA 3GN3A 1K0BA 2EFHA 2L4CA 3FKFA 1MDJA 3TKPA 4HOJA 6GSSA 1SD8A 4ZBBA 2LEGA 4MJCA 1U87A 1TXUA 5FT3A 3FZ5A 2GSTA 5AIVA 1R7HA 3DIEA 2CAIA 5DCHA 3G9BA 4TOPA 1KTEA 1LU4A 2C0EA 1M0UA 4GLTA 2FA8A 4BVXB 3BCIA 4TR1B 4PNFA 1GSEA 2IFQB 1Z5YE 5IOWA 1F3BA 3WGXA 2HRAA 3E3EA 4ZB6A 4HS1A 3QDNA 1HD2A 3FEUA 1NSWA 3APSA 3TKSA 3LG6A 3C1RA 3DD3A 2KP1A 4EXJA 4N0ZA 3JCML 4F03A 4KF9A 4IP1A 3GH9A 4ECBA 2FNOA 5D73A 1TU7A 4DSRA 5AN1A 5C00A 2HT9A 1PN0A 4K9ZA 3C71A 5A1NA 2GGTA 5DVBA 3GYKA 1ABAA 5JCWA 2CVKA 4JR6A 4QMKA 1CQHA 4D73A 1GULA 4XRAA 3L78A 3EURA 1J08A 1PMTA 2LTKA 1EOGA 1SK1A 2CQ9A 1TRUA 2TIRA 1MDIA 3GV1A 5G30A 1TOFA 2OE3A 3H79A 1HQOA 3VURA 4K5RA 3KH9A 4I97A 2VD0A 1G7OA 1Z7PA 1VF4A 3MAKA 17GSA 5BMUB 3VI5A 2ON7A 2KP2A 1TK0B 2RIIA 3TUEA 4DVCA 2V32A 2E0QA 4OD7A 4NHWA 4ILFA 3W8SA 2GDRA 4GRFA 3RBTA 2YANA 5LCZA 4ZBDA 2DJ0A 4HU7A 3E0UA 4I6XA 2LV3A 2I81A 5FHIA 4ICYA 3A2VA 3DVXA 4MABA 2H66A 3TKRA 4TR3A 2QA2A 4TR0A 1A2MA 1AIUA 2V2GA 2L5OA 2BMXA 4F82A 4YQUA 2HSNA 3D5JA 4OO5A 1K0CA 2VOCA 2KHPA 3IOSA 4MP4A 3M3MA 2VLVA 3TKQA 1YEXA 4O5RA 5IIZA 2H72A 2V1MA 3LORA 4YH2A 4CHSA 4HI7A 2DJKA 3GKMA 4G0KA 1XWCA 2LNTA 3GURA 4K1FA 3ZZXA 3VWXA 3VWWA 3IAS2 3KH7A 3ZL5A 1PN9A 2M46A 2HFDA 2LQOA 2YWOA 4KA0A 4N0VA 3ZFBA 1G6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDK A;  4PX1 A;  4XTS A;  1YZX A;  3I9V 2;  3HA9 A;  3DVW A;  5DJL A;  3EYT A;  4EVM A;  2YJ7 A;  3PPU A;  3UMA A;  5IMA A;  4TR1 A;  2PPT A;  5DJM A;  5JWQ B;  4LMW A;  1VRS D;  4BA7 A;  4TW5 A;  1GSU A;  5HR1 A;  3A2X A;  2B5X A;  4IS0 A;  4MPF A;  1MDK A;  2PWJ A;  1A24 A;  1XOB A;  1ERV A;  1HNC A;  2PVQ A;  4YQV A;  1M2B A;  2AB6 A;  1SL2 B;  3LGC A;  1T8E B;  1T00 A;  2HI7 A;  1QMV A;  3IRA A;  1YEP A;  3ZFL A;  4IW9 A;  2GSQ A;  5G31 A;  2MZC A;  1H4O A;  4HQZ A;  3LXT A;  4L5O A;  3U6V A;  3LYK A;  2YWM A;  4KE3 A;  3GSS A;  3KJY A;  5H5Q A;  2D2Z A;  5J3R A;  4I5Q A;  3IE3 A;  4V1A p;  3ISO A;  2V6O A;  3CYN A;  2F8A A;  3VPT A;  3G7I A;  1XW6 A;  1I9D A;  1OAZ A;  3UEM A;  1FVK A;  4POK A;  1HNB A;  5IMF A;  5IPH A;  1Y6E A;  5ECS A;  2X99 A;  1Z7R A;  1R5P A;  3UL3 A;  1G7E A;  2C0G A;  4ZL7 A;  3FRC A;  3EU3 A;  12GS A;  2XBI A;  5IMZ A;  3RAZ A;  5F05 A;  3FW2 A;  1MD3 A;  1F3A A;  4E8H A;  3KMO A;  4XS1 A;  2FWG A;  2VLU A;  1NM3 A;  1K3L A;  1AAZ A;  2PVO C;  3KGK A;  3K8N A;  3OR5 A;  2H1B A;  1PGT A;  1PX7 A;  1URM A;  2JU5 A;  2DBC A;  5A5K A;  1OE8 A;  1X9M B;  5INY A;  3UIW A;  4KW6 A;  4ULX A;  4NPB A;  5JCG A;  5ECQ B;  1M99 A;  5DAK B;  1TRW A;  4G10 A;  1OKD A;  3LWA A;  4WXT A;  1X9W B;  5IO0 A;  2B7K A;  2VM2 A;  4NHZ A;  4YQM A;  2VM1 A;  2K18 A;  4LA1 A;  4K7N A;  3UAR A;  4WEY A;  5D9X A;  6GSV A;  2IMI A;  3O76 A;  2L6D A;  3Q19 A;  6GST A;  2XBQ A;  1J0F A;  1N8J A;  5ECH B;  3QOU A;  1GUK A;  3QAW A;  5F0G A;  4HUA A;  4KUN A;  4ZXG A;  3GFK A;  4BL7 B;  1X5C A;  1T4Z A;  5CNW A;  1ERW A;  1SKR B;  4IBP A;  2H6Y A;  3DWV A;  2E2G A;  3D6I A;  4OCF A;  1WOU A;  3KD0 A;  2NBS A;  4WBR D;  1EZK A;  1BYE A;  2LRN A;  3VFI A;  1K0O A;  2B6M A;  2P5R A;  5G5E A;  4HEA 2;  1WIK A;  2CVD A;  2O89 A;  3TKS E;  2NDO A;  2H0I A;  2DC5 A;  3TOU A;  4JZQ A;  4AGS A;  2YWN A;  3IHQ A;  5H5S A;  3DYR A;  4L8E A;  2FWE A;  4L0W A;  4O32 A;  16GS A;  5ABR A;  22GS A;  2JSY A;  2PUK C;  4JRR A;  2DJJ A;  4OCE A;  2CZ3 A;  1YKC A;  1BX9 A;  4NV5 A;  1S3D A;  2MMO A;  3HVX A;  3TJJ A;  5D9W A;  3CRU A;  1J9B A;  4EO3 A;  4OFM A;  4XS4 A;  1TRS A;  4HZ2 A;  1A23 A;  1PKZ A;  3ZRE A;  2MMA A;  3KTB A;  3P8W A;  2G0F A;  3QFB C;  2RUF A;  5KN3 A;  2NTO A;  1WWJ A;  5G1K A;  2HSM B;  2LRC A;  5HR0 A;  2FA4 A;  3DGQ A;  2AV4 A;  2CA8 A;  2A2R A;  1EGO A;  5IMV A;  2Z9S A;  1B4Q A;  4OWY A;  4RUV A;  1XCC A;  4ML6 A;  2C0D A;  1PA3 A;  2F8F A;  5KN1 A;  3QD9 A;  2DLX A;  4XS6 A;  4LMV A;  1O8X A;  2LNS A;  4MDC A;  3M9K A;  4OO4 A;  1SL1 B;  1SJI A;  2LRT A;  2GT6 A;  3GRX A;  1ERU A;  2K6V A;  1V40 A;  4POB A;  3UBL A;  18GS A;  2O8V B;  2C80 A;  4GQF A;  4PQH A;  2LJA A;  1W89 A;  3ZTL A;  1A8L A;  1K3Y A;  4TRX A;  1PRX A;  2DIY A;  2LJK A;  1BJX A;  2RM5 A;  1S3A A;  4EKZ A;  1BG5 A;  2H74 A;  2OBI A;  3KIJ A;  5ENU A;  3QAV A;  2R2J A;  4HZ4 A;  1EEJ A;  1Q98 A;  6GSY A;  1GWC A;  4KND A;  3J7Y b;  2PGT A;  1VF3 A;  2H70 A;  5COH A;  4X0X A;  2N5B A;  4EE0 A;  1V98 A;  1EV4 A;  1TK8 B;  1TJD A;  2GQK A;  3DML A;  3RHB A;  2XHF A;  4POM A;  5IMD A;  2C8U A;  2AUV A;  3KM6 A;  1TW9 A;  1GNW A;  3FR9 A;  3QFA C;  4AJ6 A;  4BL7 A;  1GNE A;  3GST A;  1SK0 A;  2P31 A;  3C1S A;  1M7T A;  4OFN A;  4J2F A;  2HNL A;  2RUE A;  3ZMK A;  3GH6 A;  1XVW A;  2H73 A;  1F2E A;  1TU8 A;  5HFG A;  2KLX A;  1B8X A;  3I6A A;  2OBK A;  4KDX A;  2CT6 A;  2C1Y A;  1O8W A;  3P2A A;  3H4K A;  3F4S A;  3HVV A;  1C72 A;  1XW5 A;  2HZE A;  3RPN A;  2YCD A;  3DRN A;  4FYC A;  3ZVJ A;  1FW1 A;  2JAD A;  1X0R A;  2GQL A;  2DJ3 A;  2VCZ A;  2HLS A;  5LNK e;  2H75 A;  2OKA A;  3LJR A;  5AIS A;  2VL9 A;  3CRT A;  2JAC A;  3QMX A;  5DQS A;  2DML A;  2WGR A;  4GWR A;  4H86 A;  5D93 A;  2LKU A;  4AJ7 A;  7GSS A;  1F9M A;  4IHU A;  4ZB8 A;  5IOX A;  4PUA A;  1GUH A;  4GF0 A;  1G6W A;  2HSM A;  4Q5R A;  2FWF A;  4V1A g;  2CVB A;  3GMF A;  4MK3 A;  3BCK A;  1OC9 A;  4MCU A;  1PSQ A;  4K0G A;  2GLR A;  2YJH A;  3HXS A;  2EIO A;  2ZCT A;  1OC8 A;  4G0I A;  2DMM A;  2AAW A;  4JR4 A;  1OE7 A;  2HSY A;  1TTZ A;  2JZT A;  2P5Q A;  3ZML A;  2VL2 C;  3LEF A;  2B3S A;  5DQY A;  1SKW B;  1E2Y A;  2H0H A;  1AC1 A;  3GKK A;  3ERG A;  2ES7 A;  3D4M A;  3GL5 A;  3LYP A;  1K0M A;  5IM9 A;  4RQR A;  1A2L A;  1KBN A;  4POL A;  4BPY A;  4RI6 A;  1N2A A;  3EMX A;  3IBH A;  2N5F A;  4WR5 A;  3PGT A;  4CW9 A;  4X43 A;  3EMP A;  3D22 A;  1JLW A;  2GSR A;  1QGV A;  3HD5 A;  4L5L A;  3G7Y A;  4G2E A;  3W6G A;  1WMJ A;  1GSY A;  3RPP A;  3HZ4 A;  3TKS C;  4EDY A;  1JZO A;  1DBY A;  1KNG A;  4WET A;  4XHM A;  4IEL A;  2YZH A;  1GRX A;  4V2M A;  3FR3 A;  2VLT A;  3F4R A;  4FO5 A;  2HZF A;  1V58 A;  3DEX A;  4WF5 A;  3LQ7 A;  2H71 A;  2N5A A;  1ERT A;  4F0C A;  2M80 A;  4ECI A;  1PKW A;  3VWU A;  3FZ4 A;  3GHA A;  1X5E A;  2VO4 A;  3TDG A;  1TK5 B;  2H1D A;  2E7P A;  1K0A A;  1FB0 A;  2YN1 A;  2CX4 A;  2YNX A;  1ZZY A;  3N5O A;  11GS A;  2HRN A;  2A2S A;  2H76 A;  2MBT A;  1JZW A;  4FH8 A;  2FHE A;  5A4W A;  3TRX A;  4G19 A;  3KTL A;  1SK2 A;  5ECR B;  1RW1 A;  14GS A;  3HJM A;  2V41 A;  4ZIJ A;  2G2Q A;  2IPA A;  3CMI A;  2JSZ A;  4MJB A;  4EL1 A;  4ISD A;  2B1K A;  3Q74 A;  3F6F A;  1ZYQ B;  1WJK A;  4KGI A;  3IAM 2;  3IDV A;  2DJ1 A;  4XS4 B;  3ZVJ D;  4K7O A;  5ECN B;  2XC2 A;  3TGZ A;  2XPD A;  3MDK A;  3ERF A;  4GCI A;  1DUG A;  1NHO A;  4GQC A;  2C3N A;  1EEM A;  3GKX A;  2ON5 A;  4I2U A;  1AQV A;  3D0Z A;  3P7X A;  4ZL8 A;  3GX0 A;  4KCE A;  1GLP A;  3F63 A;  4HJ2 A;  2HQT A;  4N11 A;  4Q5F A;  4WBJ A;  3GTU B;  1XPV A;  3CSH A;  1TI3 A;  1GTI A;  3KEB A;  2MMN A;  2VCW A;  1Z3E A;  1G0T A;  3F3R A;  2IJY A;  1R5A A;  2CX3 A;  2AJQ B;  1AQW A;  3AY8 A;  3TJB A;  4NMU A;  1BED A;  5IQY A;  2FY6 A;  4DSQ A;  1E6B A;  3VWV A;  5E59 A;  1T4Y A;  1O73 A;  1FOV A;  4IQA A;  2OE0 A;  5CP1 A;  1B4P A;  1GTB A;  4NAX A;  4NWY A;  4IP6 A;  5LD0 A;  4TXO B;  5L71 A;  3IK9 A;  2QC7 A;  2WDU A;  3BOA A;  3U5R E;  1ACV A;  1U3A A;  1EOH A;  4ZBA A;  4GTU A;  2C3T A;  1JLV A;  3UAP A;  4MPG A;  4PNG A;  4MZC A;  2FCH A;  2AHE A;  3GNJ A;  5DAL B;  2GZY A;  1FAA A;  1YF1 A;  1Z6M A;  1TDI A;  5IO2 A;  1WE0 A;  1HNA A;  4ID0 A;  1AUC A;  1QK8 A;  3TB2 A;  1SEN A;  1YF0 A;  2VUP A;  2YV7 A;  2HXK A;  4KSO A;  1ILO A;  2LS5 A;  2CAQ A;  4KDU A;  1T1V A;  3HCZ A;  4ACS A;  4GSN A;  1WPI A;  1VGL A;  2OAC A;  1JZD A;  2NVL A;  3EWL A;  4TN8 A;  1V2A A;  3D4T A;  5C04 A;  5DDL A;  4NV2 A;  2X8H A;  1OKT A;  2FUG 2;  2CZ2 A;  3O6T A;  4F0B A;  2HZE B;  2IME A;  3KCM A;  1GTA A;  1V57 A;  3KP8 A;  1GSD A;  3C7M A;  2J9H A;  2RM6 A;  4XIH A;  1PX6 A;  3IC8 A;  5ID2 A;  4KX4 A;  2H0G A;  1MD4 A;  1XOA A;  1A0F A;  2GSS A;  4E8E A;  1SKS B;  1TI1 A;  5JCU A;  2VIM A;  4QL7 A;  3H93 A;  1GH2 A;  5B6N A;  2OAD A;  3EU4 A;  1NW2 A;  3APO A;  4MH2 A;  3NZN A;  4WF4 A;  1OC9 B;  10GS A;  3MSZ A;  3F4T A;  2P0G A;  3EVI A;  2EC4 A;  2HRK A;  3GTU A;  3GX8 A;  3L4N A;  1ML6 A;  4QQ7 A;  2X8G A;  1Z6N A;  5H5R A;  3CSI A;  2H8L A;  2L6C A;  4V2L A;  1SYR A;  3IR4 A;  2YV9 A;  2F3M A;  3IXR A;  4K2D A;  1YY7 A;  3KP9 A;  5HR3 A;  8GSS A;  1YQ1 A;  5ECL B;  3BJ5 A;  4MZW A;  1YJ6 A;  2L57 A;  1F6M C;  4ECJ A;  2O85 A;  1K0D A;  4NXI A;  2DJ2 A;  2OE1 A;  2TRX A;  5GZZ B;  4TVE A;  1RQM A;  1GP1 A;  3ED3 A;  4AJ8 A;  3HDC A;  1PD2 1;  4TXO A;  3J7Y k;  3L9U A;  3BD2 A;  3NIV A;  4MMM A;  1I5G A;  2X8C A;  3QCP A;  5JWR B;  3BBY A;  1A0R P;  1IYH A;  1OC3 A;  2IL3 A;  1CQG A;  1SD9 A;  5GAP D;  3TRQ A;  4GSS A;  2MMZ A;  3IA1 A;  4FYU A;  4Q5N A;  2YP6 A;  3HJO A;  2L4Q A;  2IWT A;  3GKN A;  5DAL A;  1TRV A;  1XXU A;  1TXX A;  2VL2 A;  2MYG A;  4IVF A;  1BAY A;  5E4W A;  2I4A A;  5ECI B;  1ZMA A;  3VPQ A;  1W4V A;  3APQ A;  5EVO A;  5JWO B;  2VD1 A;  1SU9 A;  4ZL9 A;  1XIY A;  3DKS A;  1FO5 A;  2WRT A;  3KMN A;  4RI7 A;  3KXO A;  3FZA A;  4DEJ A;  3SWL A;  1JFU A;  1GL8 A;  2GQM A;  1R4W A;  3TOT A;  2LST A;  1AQX A;  2JZR A;  4TKY A;  3LFL A;  1ON4 A;  4OMV A;  1T7P B;  4MH3 A;  5G5F A;  3ME8 A;  3A2W A;  1Z9H A;  6GSX A;  5DCG A;  1EP7 A;  5CRG A;  2DIZ A;  3FY7 A;  1XWG A;  4PXO A;  2IMD A;  4EC0 A;  5ELA A;  1YKA A;  4JU5 A;  4LL1 B;  4EDZ A;  2GTU A;  4K7I A;  3WYW A;  1LBK A;  1ST9 A;  4GST A;  4I8B A;  3VK9 A;  3F8U A;  2WCI A;  1B9Y C;  3EE2 A;  3UVH A;  1SJ6 A;  1V9W A;  2H1G A;  3WT2 A;  3EIN A;  3LSZ A;  2HRF A;  3HKR A;  4MF5 A;  3M0F A;  1SYX A;  5B8A A;  2PER A;  4YAP A;  2H19 A;  4FIW A;  3R2Q A;  3L9S A;  4HQS A;  1BQ7 A;  5FWG A;  1ZL9 A;  2K8V A;  2RLI A;  1U3I A;  2E2M A;  2TRC P;  2CV4 A;  1UVZ A;  4O92 A;  2H1A A;  4EUY A;  2YZU A;  3E9J B;  4JE1 A;  4FYB A;  1U88 A;  3TJF A;  1EP8 A;  1B48 A;  1XWB A;  2R5G A;  2KOK A;  4Q5Q A;  4ZB9 A;  1PL1 A;  2H6Z A;  3CTG A;  4V2N A;  3VI7 A;  5CAX A;  2C3Q A;  2LQQ A;  4XCS A;  5DBQ A;  1H75 A;  1EGR A;  3M9J A;  3P90 A;  4TXV A;  4F2I A;  3A3T A;  5CRD A;  3I43 A;  4MJE A;  5D9V A;  2VCQ A;  2ZUP A;  1O6J A;  4J57 E;  5EY6 A;  2VL3 A;  3ZIV A;  4QL9 A;  1O7U A;  1M2D A;  3HYP A;  1VF2 A;  3L0H A;  2VAF A;  5CRE A;  1QXH A;  3HVS A;  3MWH A;  4K8M A;  2R37 A;  1FB6 A;  1MTC A;  5J41 A;  2X64 A;  3ERW A;  9GSS A;  5ECP B;  1GUM A;  1XFL A;  5A4V A;  5J4U A;  1DSB A;  2GVP A;  3W8J A;  1GSS A;  3ZRD A;  1T3B A;  4PGT A;  5GST A;  1A2J A;  3GA4 A;  2I1U A;  2F9S A;  1F37 A;  1VF1 A;  4FQU A;  4F9Z A;  2QKE A;  2PU9 C;  3HJP A;  5G2Z A;  2WUL A;  4ML1 A;  4MA9 A;  2O87 A;  3GUS A;  1AW9 A;  2VCV A;  1K0N A;  1THX A;  4RQX A;  3UJ1 A;  4KDY A;  1SJZ A;  4BWQ A;  5AIX A;  2HE3 A;  4BVY B;  1GLQ A;  1EWX A;  3FK8 A;  5CYY A;  2IMK A;  4JED A;  4BVX A;  1XWK A;  1XW9 A;  1USB A;  4GXZ A;  4MF6 A;  2XPE A;  5HR2 A;  2IFQ A;  4IKH A;  5ID2 B;  1SL0 B;  2R3X A;  1OYJ A;  1TP9 A;  3HY2 A;  2EIQ A;  4KAE A;  1UN2 A;  4IJ3 A;  4IGJ A;  2OJL A;  1FG4 A;  5F07 A;  2WB9 A;  1WRY A;  5IPG A;  3TJG A;  2YOI A;  2FGX A;  1X5D A;  1B9X C;  2FLS A;  4N30 A;  2K9F A;  6GSW A;  4CDO A;  2H30 A;  2KUC A;  5EL8 A;  2V6K A;  2HRK B;  5B8B A;  2B7J A;  1XVQ A;  3Q6O A;  4KCA A;  4HDE A;  5ECK B;  1ZOF A;  1MEK A;  3CTF A;  5IMC A;  2YWI A;  3GIX A;  4PQ1 A;  1KEB A;  3N9J A;  3IPZ A;  5ECO B;  3UOM A;  2FD3 A;  1M9B A;  1M2A A;  2BJX A;  3WGE A;  5J9B A;  5KEJ A;  1R26 A;  4K0N A;  4USS A;  1O81 A;  3TJK A;  1UA5 A;  1PL2 A;  1LJR A;  2WS2 A;  4X1U A;  4LL4 B;  5J9C A;  2VCX A;  1AXD A;  2JL4 A;  3I69 A;  2FWH A;  5BMU A;  3FZ9 A;  3PR8 A;  2LJR A;  3ME7 A;  5KN2 A;  4DSS B;  4YAV A;  3M1G A;  1THO A;  2O7K A;  4MLY A;  1S3C A;  3FYG A;  2B5Y A;  2J23 A;  3QAG A;  19GS A;  4PUR A;  1ZGN A;  1WP0 A;  1O85 A;  4I2T A;  2WJU A;  5F06 A;  1HYU A;  3QR6 A;  5KN0 A;  1QQ2 A;  4MJA A;  5D96 A;  3D21 A;  2GZP A;  1X9S B;  3ZIT A;  2I3Y A;  4LLR A;  4Z7X A;  1DE1 A;  3CSJ A;  3EC3 A;  13GS A;  2YPM A;  5GAN D;  4ZIL A;  3MNG A;  2NPB A;  3WGD A;  4PTS A;  1IYI A;  3RDW A;  3RHC A;  3IK7 A;  2OA7 A;  2UZ8 A;  5ELG A;  6GSU A;  2H01 A;  2IN3 A;  2VCT A;  3VLN A;  3LXZ A;  1NHY A;  4PUF C;  1GTU A;  4G0L A;  1XBS A;  4EF0 A;  4JBB A;  2F51 A;  1UC7 A;  3F9U A;  3WD6 A;  4BVY A;  20GS A;  3O3T A;  4O7H A;  2HSH A;  2I9H A;  3UVT A;  1XZO A;  3C8E A;  2QGV A;  4BWS A;  2H6X A;  2WZ9 A;  3HZ8 A;  2IIY A;  5AGY A;  4PQI A;  2L5L A;  5B7C A;  5D8I A;  4G9H A;  4WR4 A;  5J5N A;  2C0F A;  4L0U A;  2GS3 A;  5EPF A;  4XRD A;  3UBK A;  1PQN A;  1DE2 A;  1A8Y A;  3IC4 A;  2R4V A;  3F3Q A;  3ZLP A;  2A4V A;  1EV9 A;  3QPM A;  3IV4 A;  4HU9 A;  4D73 B;  2BTO T;  3CXG A;  2WFC A;  2C4J A;  3H1N A;  2REM A;  2GT5 A;  1FVJ A;  3DXB A;  5HFI A;  3KZQ A;  4P3Y B;  4TR4 A;  3US3 A;  3F6D A;  5B6M A;  2PMT A;  3H8Q A;  5A4U A;  3CBU A;  4IJI A;  2MBS A;  4HJM A;  5D9T A;  2JZS A;  2B5E A;  2ALB A;  2LUS A;  2ZNM A;  1GSF A;  1QFN A;  1JHB A;  4IN0 A;  2IMF A;  4AF2 A;  3M8N A;  2B1L A;  5ECM B;  3C73 A;  2K8S A;  1JZR A;  3V1W A;  5G1L A;  2R6K A;  5HFK A;  2AYT A;  1K3O A;  1XWA A;  4J56 E;  4K6X A;  3PIN A;  2PN8 A;  1ZYE A;  5CRW A;  3GL3 A;  2QSI A;  1FHE A;  3PH9 A;  3SBC A;  4KSM A;  2DSA A;  4MF7 A;  1TKD B;  4N10 A;  1ZCP A;  3FHK A;  2EIR A;  1OVN A;  3F0I A;  4MZB A;  4DSS A;  1U6T A;  1M9A A;  4KH7 A;  1QUW A;  3G7J A;  3Q18 A;  3TRP A;  1GSQ A;  5GSS A;  5CRH A;  4KB3 A;  2HYX A;  3L9V A;  5HQP A;  1RK4 A;  2HSN B;  2PBJ A;  2L59 A;  4WKW A;  3ZIJ A;  1Q4J A;  4ECC A;  3TCO A;  3R3E A;  4OFT A;  3NOF A;  5CO3 A;  3ZYW A;  1Y25 A;  5DAK A;  3A5W A;  3S9F A;  2GZZ A;  3WT1 A;  3HHV A;  5F8B A;  3FR6 A;  4IQ1 A;  2M72 A;  3GN3 A;  1K0B A;  2L4C A;  3FKF A;  3TKP A;  1MDJ A;  4HOJ A;  6GSS A;  1SD8 A;  4ZBB A;  2LEG A;  4MJC A;  1U87 A;  5FT3 A;  3FZ5 A;  2GST A;  5AIV A;  1R7H A;  3DIE A;  2CAI A;  5DCH A;  3G9B A;  4TOP A;  1KTE A;  1LU4 A;  2C0E A;  1M0U A;  4GLT A;  2FA8 A;  4BVX B;  3BCI A;  4TR1 B;  4PNF A;  1GSE A;  2IFQ B;  1Z5Y E;  5IOW A;  1F3B A;  3WGX A;  2HRA A;  3E3E A;  4ZB6 A;  4HS1 A;  3QDN A;  1HD2 A;  3FEU A;  1NSW A;  3APS A;  3TKS A;  3LG6 A;  3C1R A;  3DD3 A;  2KP1 A;  4EXJ A;  4N0Z A;  3JCM L;  4F03 A;  4KF9 A;  4IP1 A;  3GH9 A;  4ECB A;  2FNO A;  5D73 A;  1TU7 A;  4DSR A;  5AN1 A;  5C00 A;  2HT9 A;  4K9Z A;  3C71 A;  2GGT A;  5DVB A;  3GYK A;  1ABA A;  5JCW A;  2CVK A;  4JR6 A;  1CQH A;  4D73 A;  1GUL A;  4XRA A;  3L78 A;  3EUR A;  1J08 A;  1PMT A;  2LTK A;  1EOG A;  1SK1 A;  2CQ9 A;  1TRU A;  2TIR A;  1MDI A;  3GV1 A;  5G30 A;  1TOF A;  2OE3 A;  3H79 A;  1HQO A;  3VUR A;  3KH9 A;  4I97 A;  2VD0 A;  1G7O A;  1Z7P A;  1VF4 A;  3MAK A;  17GS A;  3VI5 A;  2ON7 A;  2KP2 A;  1TK0 B;  2RII A;  3TUE A;  4DVC A;  2V32 A;  2E0Q A;  4OD7 A;  4NHW A;  4ILF A;  3W8S A;  2GDR A;  4GRF A;  3RBT A;  2YAN A;  5LCZ A;  4ZBD A;  2DJ0 A;  4HU7 A;  3E0U A;  4I6X A;  2LV3 A;  2I81 A;  5FHI A;  3A2V A;  3DVX A;  4MAB A;  2H66 A;  3TKR A;  4TR3 A;  4TR0 A;  1A2M A;  1AIU A;  2V2G A;  2L5O A;  2BMX A;  4F82 A;  4YQU A;  3D5J A;  4OO5 A;  1K0C A;  2VOC A;  2KHP A;  3IOS A;  4MP4 A;  3M3M A;  2VLV A;  3TKQ A;  1YEX A;  4O5R A;  5IIZ A;  2H72 A;  2V1M A;  3LOR A;  4YH2 A;  4CHS A;  4HI7 A;  2DJK A;  3GKM A;  4G0K A;  1XWC A;  2LNT A;  3GUR A;  4K1F A;  3ZZX A;  3VWX A;  3VWW A;  3IAS 2;  3KH7 A;  3ZL5 A;  1PN9 A;  2M46 A;  2HFD A;  2LQO A;  2YWO A;  4KA0 A;  4N0V A;  3ZFB A;  1G6Y A; 
#chains in the Genus database with same CATH topology
 1YDK A;  4PX1 A;  4AI6 A;  1SVM A;  4XTS A;  1YZX A;  3I9V 2;  2WZS A;  3DVW A;  5DJL A;  3HA9 A;  3EYT A;  4EVM A;  2YJ7 A;  3PPU A;  3UMA A;  5IMA A;  4TR1 A;  2PPT A;  5DJM A;  5JWQ B;  4LMW A;  1VRS D;  4BIK A;  4BA7 A;  4TW5 A;  1GSU A;  5HR1 A;  3A2X A;  2B5X A;  4IS0 A;  4MPF A;  1MDK A;  2PWJ A;  1A24 A;  1XOB A;  1ERV A;  1HNC A;  2PVQ A;  4YQV A;  1M2B A;  4EIQ A;  2AB6 A;  1SL2 B;  3LGC A;  1T8E B;  1T00 A;  2HI7 A;  1QMV A;  3IRA A;  1YEP A;  3ZFL A;  4IW9 A;  2GSQ A;  5G31 A;  2MZC A;  1H4O A;  4HQZ A;  3LXT A;  4L5O A;  3U6V A;  3LYK A;  2YWM A;  4KE3 A;  3GSS A;  3KJY A;  5H5Q A;  2D2Z A;  5J3R A;  4I5Q A;  3IE3 A;  4V1A p;  3ISO A;  2V6O A;  3CYN A;  2F8A A;  3VPT A;  3G7I A;  1XW6 A;  1I9D A;  1OAZ A;  3UEM A;  1FVK A;  4POK A;  3MYD A;  1HNB A;  5KOW A;  5IMF A;  5IPH A;  1Y6E A;  5ECS A;  2X99 A;  1Z7R A;  1R5P A;  3UL3 A;  1G7E A;  2C0G A;  4ZL7 A;  3FRC A;  3EU3 A;  12GS A;  2XBI A;  5IMZ A;  3RAZ A;  5F05 A;  3FW2 A;  1MD3 A;  1F3A A;  4PI0 C;  4E8H A;  3KMO A;  4XS1 A;  2FWG A;  2VLU A;  1NM3 A;  1K3L A;  1AAZ A;  2PVO C;  3KGK A;  3K8N A;  3OR5 A;  2H1B A;  1PGT A;  1PX7 A;  1URM A;  2JU5 A;  2DBC A;  5A5K A;  1OE8 A;  1X9M B;  5INY A;  3UIW A;  4KW6 A;  4ULX A;  4NPB A;  5JCG A;  5ECQ B;  1M99 A;  5DAK B;  1TRW A;  4G10 A;  1OKD A;  3LWA A;  4WXT A;  1X9W B;  5IO0 A;  2B7K A;  2VM2 A;  1Y1U A;  4NHZ A;  4YQM A;  2VM1 A;  2K18 A;  4LA1 A;  4K7N A;  3UAR A;  4WEY A;  5D9X A;  6GSV A;  2IMI A;  3O76 A;  2L6D A;  3Q19 A;  5A34 B;  6GST A;  2XBQ A;  1J0F A;  4MNN A;  1N8J A;  4A5P A;  5ECH B;  2O3E A;  3QOU A;  1GUK A;  3QAW A;  5F0G A;  4HUA A;  4KUN A;  4ZXG A;  2WVY A;  3GFK A;  4BL7 B;  1X5C A;  1T4Z A;  5CNW A;  1ERW A;  3CQF A;  1SKR B;  4IBP A;  2H6Y A;  1PFO A;  2E2G A;  3D6I A;  3DWV A;  4OCF A;  1WOU A;  3KD0 A;  2NBS A;  4WBR D;  1EZK A;  1BYE A;  2LRN A;  3VFI A;  1K0O A;  2B6M A;  2P5R A;  5G5E A;  4HEA 2;  1WIK A;  2CVD A;  2O89 A;  3TKS E;  2NDO A;  2H0I A;  2DC5 A;  3TOU A;  2O36 A;  4JZQ A;  4AGS A;  2YWN A;  3IHQ A;  5H5S A;  3DYR A;  4L8E A;  2FWE A;  4L0W A;  4O32 A;  16GS A;  1BF5 A;  5ABR A;  22GS A;  2JSY A;  2PUK C;  4JRR A;  2DJJ A;  4OCE A;  2CZ3 A;  1YKC A;  1BX9 A;  4NV5 A;  1S3D A;  2MMO A;  3HVX A;  3TJJ A;  5D9W A;  3CRU A;  1J9B A;  4EO3 A;  4OFM A;  4XS4 A;  1TRS A;  1M3J A;  4HZ2 A;  1A23 A;  1PKZ A;  3ZRE A;  2MMA A;  3KTB A;  3P8W A;  2G0F A;  3QFB C;  2RUF A;  5KN3 A;  2NTO A;  1WWJ A;  5G1K A;  2HSM B;  2LRC A;  5HR0 A;  2DKI A;  2FA4 A;  3DGQ A;  2AV4 A;  2CA8 A;  3RGB C;  1SVL A;  2A2R A;  1EGO A;  5IMV A;  2Z9S A;  1B4Q A;  4OWY A;  4RUV A;  1XCC A;  4ML6 A;  2C0D A;  1PA3 A;  2F8F A;  5KN1 A;  3QD9 A;  2DLX A;  4XS6 A;  4LMV A;  1O8X A;  2LNS A;  4MDC A;  3M9K A;  4OO4 A;  1SL1 B;  1SJI A;  2LRT A;  5A5H A;  2GT6 A;  3GRX A;  1ERU A;  2K6V A;  3IHG A;  1V40 A;  4POB A;  3UBL A;  18GS A;  2O8V B;  2C80 A;  4GQF A;  4PQH A;  2LJA A;  1W89 A;  3ZTL A;  1A8L A;  1K3Y A;  4TRX A;  1PRX A;  2DIY A;  2LJK A;  1BJX A;  2RM5 A;  1S3A A;  4EKZ A;  1BG5 A;  2H74 A;  2OBI A;  3KIJ A;  5ENU A;  3QAV A;  2R2J A;  4HZ4 A;  1EEJ A;  1Q98 A;  6GSY A;  1GWC A;  4KND A;  4Z2U A;  3J7Y b;  2PGT A;  1VF3 A;  2H70 A;  5COH A;  4X0X A;  2N5B A;  4EE0 A;  1V98 A;  1EV4 A;  1TK8 B;  1TJD A;  2A4H A;  2GQK A;  5A34 A;  3DML A;  3RHB A;  2XHF A;  4POM A;  5IMD A;  2C8U A;  2AUV A;  3KM6 A;  1TW9 A;  1GNW A;  3FR9 A;  3QFA C;  4AJ6 A;  4O5U A;  4BL7 A;  1GNE A;  3GST A;  1SK0 A;  2P31 A;  3C1S A;  1M7T A;  4OFN A;  4J2F A;  2HNL A;  2RUE A;  3ZMK A;  3GH6 A;  1XVW A;  2H73 A;  1F2E A;  1TU8 A;  5HFG A;  2KLX A;  1B8X A;  3I6A A;  2OBK A;  4KDX A;  2CT6 A;  2R0G A;  4W66 A;  2C1Y A;  1O8W A;  3P2A A;  3H4K A;  3F4S A;  3HVV A;  1C72 A;  1XW5 A;  2HZE A;  3RPN A;  2YCD A;  3DRN A;  4FYC A;  3ZVJ A;  1FW1 A;  2JAD A;  1X0R A;  2GQL A;  2DJ3 A;  2VCZ A;  2HLS A;  5LNK e;  2H75 A;  2OKA A;  3LJR A;  5AIS A;  2VL9 A;  3CRT A;  2JAC A;  3QMX A;  5DQS A;  2DML A;  2WGR A;  4GWR A;  4H86 A;  5D93 A;  2LKU A;  4AJ7 A;  7GSS A;  1F9M A;  4IHU A;  4ZB8 A;  5KOX A;  5IOX A;  4PUA A;  1GUH A;  4GF0 A;  1G6W A;  2HSM A;  4Q5R A;  2FWF A;  4V1A g;  2CVB A;  3GMF A;  4MK3 A;  3BCK A;  1OC9 A;  4MCU A;  1PSQ A;  4K0G A;  2GLR A;  2YJH A;  3HXS A;  2EIO A;  2ZCT A;  1OC8 A;  4G0I A;  2DMM A;  2AAW A;  4JR4 A;  1OE7 A;  2HSY A;  1TTZ A;  3A5I A;  2JZT A;  2P5Q A;  3ZML A;  2VL2 C;  3LEF A;  2B3S A;  5DQY A;  1SKW B;  1E2Y A;  2H0H A;  1AC1 A;  3GKK A;  3ERG A;  2ES7 A;  3D4M A;  3GL5 A;  3LYP A;  1K0M A;  5IM9 A;  4RQR A;  1A2L A;  1KBN A;  4POL A;  2VKZ G;  4BPY A;  4RI6 A;  1N2A A;  3EMX A;  3IBH A;  2N5F A;  4WR5 A;  3PGT A;  4CW9 A;  4X43 A;  2DKH A;  3EMP A;  3D22 A;  1JLW A;  2GSR A;  1QGV A;  3HD5 A;  4L5L A;  3G7Y A;  4G2E A;  3W6G A;  1WMJ A;  1GSY A;  3RPP A;  3HZ4 A;  1XG8 A;  3TKS C;  4EDY A;  1JZO A;  1DBY A;  1KNG A;  4FXY P;  4WET A;  4XHM A;  4IEL A;  2YZH A;  1GRX A;  4V2M A;  3FR3 A;  2VLT A;  3F4R A;  4FO5 A;  2HZF A;  1V58 A;  3DEX A;  4WF5 A;  3LQ7 A;  2H71 A;  2N5A A;  1ERT A;  4F0C A;  2M80 A;  4ECI A;  1PKW A;  3VWU A;  3FZ4 A;  3GHA A;  1X5E A;  2VO4 A;  3TDG A;  1TK5 B;  2H1D A;  2E7P A;  1K0A A;  1FB0 A;  2YN1 A;  2CX4 A;  2YNX A;  1ZZY A;  3N5O A;  11GS A;  2HRN A;  2A2S A;  2H76 A;  2MBT A;  1JZW A;  4FH8 A;  2FHE A;  5A4W A;  3TRX A;  4G19 A;  3HMJ G;  3KTL A;  1SK2 A;  5ECR B;  1RW1 A;  14GS A;  3HJM A;  2V41 A;  4ZIJ A;  2G2Q A;  2IPA A;  3CMI A;  2JSZ A;  4MJB A;  4EL1 A;  4ISD A;  2B1K A;  3Q74 A;  3F6F A;  1ZYQ B;  1WJK A;  4KGI A;  3IAM 2;  3IDV A;  4PHZ C;  2DJ1 A;  4XS4 B;  3ZVJ D;  4K7O A;  5ECN B;  2XC2 A;  3TGZ A;  2XPD A;  3MDK A;  3ERF A;  4GCI A;  4G01 A;  1DUG A;  1NHO A;  4GQC A;  2C3N A;  1EEM A;  3GKX A;  2ON5 A;  2R0P A;  4I2U A;  1AQV A;  3D0Z A;  1BG1 A;  3P7X A;  4ZL8 A;  3GX0 A;  4KCE A;  1GLP A;  2OT3 A;  3F63 A;  4HJ2 A;  2HQT A;  4N11 A;  4Q5F A;  4WBJ A;  3GTU B;  1XPV A;  3CSH A;  1TI3 A;  1GTI A;  3KEB A;  2MMN A;  2VCW A;  1Z3E A;  1G0T A;  3F3R A;  2IJY A;  1R5A A;  2CX3 A;  2AJQ B;  1AQW A;  3AY8 A;  3TJB A;  4NMU A;  1BED A;  4CY6 A;  5IQY A;  2FY6 A;  4DSQ A;  2QA1 A;  1E6B A;  3VWV A;  5E59 A;  1T4Y A;  1O73 A;  5A5H B;  4IQA A;  1FOV A;  2OE0 A;  5CP1 A;  1B4P A;  1GTB A;  4NAX A;  4NWY A;  4IP6 A;  5LD0 A;  4TXO B;  5L71 A;  3IK9 A;  2WW3 A;  2QC7 A;  2WDU A;  3BOA A;  3U5R E;  1ACV A;  1U3A A;  4O5Q A;  4AKI A;  1EOH A;  4ZBA A;  4GTU A;  2C3T A;  1JLV A;  3UAP A;  4MPG A;  4PNG A;  4MZC A;  2FCH A;  2AHE A;  3GNJ A;  5DAL B;  2GZY A;  1FAA A;  1YF1 A;  1Z6M A;  1S4B P;  1TDI A;  5IO2 A;  1WE0 A;  1HNA A;  4ID0 A;  1S3R A;  1AUC A;  1QK8 A;  3TB2 A;  1SEN A;  1YF0 A;  2VUP A;  2YV7 A;  2HXK A;  4KSO A;  1ILO A;  2LS5 A;  2CAQ A;  4KDU A;  1T1V A;  3HCZ A;  4ACS A;  4GSN A;  1WPI A;  1VGL A;  2OAC A;  1JZD A;  2NVL A;  3EWL A;  4TN8 A;  1V2A A;  3D4T A;  5C04 A;  5DDL A;  4NV2 A;  2X8H A;  1OKT A;  2FUG 2;  2CZ2 A;  3O6T A;  4F0B A;  4YKF A;  2WW1 A;  2HZE B;  2IME A;  3KCM A;  1GTA A;  1V57 A;  3KP8 A;  1GSD A;  3C7M A;  2J9H A;  4ZB7 A;  2RM6 A;  4XIH A;  1PX6 A;  3IC8 A;  5ID2 A;  4KX4 A;  2H0G A;  1MD4 A;  1XOA A;  1A0F A;  2GSS A;  4E8E A;  1SKS B;  1TI1 A;  5JCU A;  2VIM A;  4QL7 A;  3H93 A;  1GH2 A;  5B6N A;  2OAD A;  4AKG A;  3EU4 A;  1NW2 A;  3APO A;  4MH2 A;  3NZN A;  4WF4 A;  1OC9 B;  10GS A;  3MSZ A;  3F4T A;  2P0G A;  3EVI A;  2EC4 A;  2HRK A;  3GTU A;  3GX8 A;  3L4N A;  1ML6 A;  4QQ7 A;  2X8G A;  1Z6N A;  5H5R A;  3CSI A;  2H8L A;  2L6C A;  2WW2 A;  4V2L A;  1SYR A;  3IR4 A;  2YV9 A;  2F3M A;  3IXR A;  4K2D A;  1YY7 A;  3KP9 A;  5HR3 A;  8GSS A;  1YQ1 A;  5ECL B;  3BJ5 A;  4MZW A;  1YJ6 A;  2L57 A;  1F6M C;  4ECJ A;  2O85 A;  1K0D A;  4NXI A;  2DJ2 A;  1YVL A;  2OE1 A;  2TRX A;  5GZZ B;  4TVE A;  1RQM A;  1GP1 A;  3ED3 A;  4AJ8 A;  3HDC A;  1PD2 1;  4TXO A;  3J7Y k;  2UV8 G;  4E68 A;  3L9U A;  3BD2 A;  3NIV A;  4MMM A;  1I5G A;  2X8C A;  3QCP A;  5JWR B;  3BBY A;  1A0R P;  1IYH A;  3EPT A;  1OC3 A;  2IL3 A;  1CQG A;  1SD9 A;  5GAP D;  3TRQ A;  4GSS A;  3TU3 B;  5J4V A;  2MMZ A;  3IA1 A;  4FYU A;  4Q5N A;  4YKG A;  2YP6 A;  3HJO A;  2L4Q A;  2IWT A;  3GKN A;  5DAL A;  1TRV A;  1XXU A;  1TXX A;  2VL2 A;  2MYG A;  4IVF A;  1BAY A;  5E4W A;  2I4A A;  5ECI B;  1ZMA A;  2X49 A;  3VPQ A;  1W4V A;  3APQ A;  5EVO A;  5JWO B;  2VD1 A;  1SU9 A;  3FMW A;  4ZL9 A;  1XIY A;  3DKS A;  1FO5 A;  2WRT A;  3KMN A;  4RI7 A;  4AKH A;  3KXO A;  3FZA A;  4DEJ A;  3SWL A;  1JFU A;  1GL8 A;  2GQM A;  1R4W A;  3TOT A;  2LST A;  1AQX A;  2JZR A;  4TKY A;  3LFL A;  1ON4 A;  4OMV A;  5J47 A;  2EFE A;  1T7P B;  4MH3 A;  5G5F A;  3ME8 A;  1SVO A;  3A2W A;  2A2P A;  1Z9H A;  6GSX A;  5DCG A;  1EP7 A;  5CRG A;  2DIZ A;  3FY7 A;  1XWG A;  4PXO A;  2IMD A;  4EC0 A;  5ELA A;  1YKA A;  4JU5 A;  4LL1 B;  4EDZ A;  2GTU A;  4K7I A;  3WYW A;  1LBK A;  1ST9 A;  4GST A;  4I8B A;  3VK9 A;  3F8U A;  2WCI A;  1B9Y C;  3EE2 A;  3UVH A;  1SJ6 A;  1V9W A;  2H1G A;  3WT2 A;  3EIN A;  3LSZ A;  2HRF A;  3HKR A;  4MF5 A;  3M0F A;  1SYX A;  5B8A A;  2PER A;  4PI2 C;  4YAP A;  2H19 A;  4FIW A;  3R2Q A;  3L9S A;  4HQS A;  1BQ7 A;  5FWG A;  1ZL9 A;  2K8V A;  2RLI A;  1U3I A;  2E2M A;  2TRC P;  2CV4 A;  1UVZ A;  4O92 A;  2H1A A;  4EUY A;  2YZU A;  3E9J B;  4JE1 A;  4FYB A;  1U88 A;  3TJF A;  1EP8 A;  1B48 A;  1XWB A;  2R5G A;  2KOK A;  4Q5Q A;  4ZB9 A;  1PL1 A;  2H6Z A;  3CTG A;  4Z2R A;  4V2N A;  2EFD A;  3VI7 A;  5CAX A;  2C3Q A;  2LQQ A;  4XCS A;  5DBQ A;  1H75 A;  1EGR A;  3M9J A;  3P90 A;  4TXV A;  4F2I A;  3A3T A;  5CRD A;  3I43 A;  4MJE A;  5D9V A;  2VCQ A;  2ZUP A;  1O6J A;  4J57 E;  5EY6 A;  2VL3 A;  3ZIV A;  4QL9 A;  1O7U A;  1M2D A;  3HYP A;  1VF2 A;  3L0H A;  2VAF A;  5CRE A;  1QXH A;  3HVS A;  3MWH A;  4K8M A;  2R37 A;  3CHX C;  1FB6 A;  1MTC A;  5J41 A;  2X64 A;  3ERW A;  9GSS A;  5ECP B;  1GUM A;  1XFL A;  5A4V A;  5J4U A;  1DSB A;  2GVP A;  3W8J A;  1GSS A;  3ZRD A;  1T3B A;  4PGT A;  5GST A;  1A2J A;  1M3I A;  2I1U A;  3GA4 A;  2F9S A;  1F37 A;  1VF1 A;  4FQU A;  4F9Z A;  2QKE A;  2PU9 C;  3HJP A;  5G2Z A;  2WUL A;  4ML1 A;  4MA9 A;  2O87 A;  3GUS A;  1AW9 A;  2VCV A;  1K0N A;  1THX A;  4RQX A;  3UJ1 A;  4KDY A;  1SJZ A;  4BWQ A;  5AIX A;  2HE3 A;  4BVY B;  1GLQ A;  1EWX A;  3FK8 A;  5CYY A;  2R0C A;  5J40 A;  2IMK A;  4JED A;  4BVX A;  1XWK A;  1XW9 A;  1USB A;  4GXZ A;  4MF6 A;  2XPE A;  5HR2 A;  2IFQ A;  4IKH A;  5ID2 B;  1SL0 B;  2R3X A;  1OYJ A;  1TP9 A;  3HY2 A;  2EIQ A;  4KAE A;  1UN2 A;  4IJ3 A;  4IGJ A;  2OJL A;  1FG4 A;  5F07 A;  2WB9 A;  1WRY A;  5IPG A;  3HVN A;  3TJG A;  2YOI A;  2FGX A;  1X5D A;  1B9X C;  2FLS A;  4N30 A;  2K9F A;  6GSW A;  4CDO A;  2H30 A;  2KUC A;  4GDF A;  5EL8 A;  2V6K A;  2HRK B;  5B8B A;  2B7J A;  1XVQ A;  3Q6O A;  2O5V A;  2WVX A;  4KCA A;  4HDE A;  5ECK B;  1ZOF A;  1MEK A;  3CTF A;  5IMC A;  2YWI A;  3GIX A;  4PQ1 A;  1KEB A;  3N9J A;  3IPZ A;  5ECO B;  3UOM A;  2FD3 A;  1M9B A;  1M2A A;  2BJX A;  3WGE A;  5J9B A;  5KEJ A;  1R26 A;  4K0N A;  4USS A;  1O81 A;  3TJK A;  1UA5 A;  3LW9 A;  1PL2 A;  1LJR A;  2WS2 A;  4X1U A;  4LL4 B;  5J9C A;  2VCX A;  1AXD A;  2JL4 A;  3I69 A;  2FWH A;  5BMU A;  3FZ9 A;  3PR8 A;  2LJR A;  3ME7 A;  5J4Y A;  4HSC X;  5KN2 A;  4DSS B;  4YAV A;  3M1G A;  1THO A;  2O7K A;  4MLY A;  1S3C A;  3FYG A;  2B5Y A;  2J23 A;  3QAG A;  19GS A;  4PUR A;  1ZGN A;  1WP0 A;  1O85 A;  4I2T A;  2WJU A;  5F06 A;  1HYU A;  3QR6 A;  5KN0 A;  1QQ2 A;  4MJA A;  5D96 A;  3D21 A;  2GZP A;  4CY8 A;  1X9S B;  3ZIT A;  2I3Y A;  4LLR A;  4Z7X A;  1DE1 A;  3CSJ A;  3EC3 A;  13GS A;  2YPM A;  5GAN D;  4ZIL A;  3MNG A;  2NPB A;  3WGD A;  4PTS A;  2X4A A;  1IYI A;  3RDW A;  3RHC A;  3IK7 A;  2OA7 A;  2UZ8 A;  5ELG A;  6GSU A;  2H01 A;  2IN3 A;  2VCT A;  3VLN A;  3LXZ A;  1NHY A;  4PUF C;  1YEW C;  1GTU A;  4G0L A;  1XBS A;  4EF0 A;  4EIP A;  4JBB A;  2F51 A;  1UC7 A;  3F9U A;  3WD6 A;  4BVY A;  20GS A;  3O3T A;  2H1L A;  4O7H A;  2HSH A;  2I9H A;  3UVT A;  1XZO A;  2WVZ A;  3C8E A;  2QGV A;  4BWS A;  2H6X A;  2WZ9 A;  1ZYN A;  1ZYP A;  3HZ8 A;  2IIY A;  5AGY A;  4PQI A;  2L5L A;  5B7C A;  4X4J A;  5D8I A;  4G9H A;  4WR4 A;  5J5N A;  4K2X A;  2C0F A;  4L0U A;  2GS3 A;  5EPF A;  4XRD A;  3UBK A;  1PQN A;  1DE2 A;  1A8Y A;  3IC4 A;  1FOH A;  2R4V A;  3F3Q A;  3ZLP A;  2A4V A;  5A1N B;  1EV9 A;  3QPM A;  3IV4 A;  4HU9 A;  4D73 B;  2BTO T;  3CXG A;  2WFC A;  2C4J A;  3H1N A;  2REM A;  2GT5 A;  1FVJ A;  3DXB A;  5HFI A;  3KZQ A;  4P3Y B;  4TR4 A;  3US3 A;  3F6D A;  5B6M A;  2PMT A;  3H8Q A;  5A4U A;  3CBU A;  4IJI A;  3MIX A;  2MBS A;  5D9T A;  2JZS A;  2B5E A;  2ALB A;  2LUS A;  4HJM A;  2ZNM A;  4AKX B;  1GSF A;  1QFN A;  3CWG A;  1JHB A;  4IN0 A;  2IMF A;  4AF2 A;  3M8N A;  2B1L A;  5ECM B;  3C73 A;  2K8S A;  1JZR A;  3V1W A;  4Z2T A;  5G1L A;  2R6K A;  5HFK A;  2AYT A;  1K3O A;  1XWA A;  4J56 E;  4K6X A;  3PIN A;  2PN8 A;  1ZYE A;  5CRW A;  3GL3 A;  2QSI A;  1FHE A;  1N25 A;  3PH9 A;  3SBC A;  4KSM A;  2DSA A;  4MF7 A;  1TKD B;  4N10 A;  5BRT A;  1ZCP A;  3FHK A;  2EIR A;  1OVN A;  3F0I A;  4MZB A;  4DSS A;  1U6T A;  1M9A A;  4KH7 A;  1QUW A;  3G7J A;  3Q18 A;  3TRP A;  1GSQ A;  5GSS A;  5CRH A;  4KB3 A;  2HYX A;  3L9V A;  5HQP A;  1RK4 A;  2EFC A;  2HSN B;  2PBJ A;  2L59 A;  4WKW A;  3ZIJ A;  1Q4J A;  4ECC A;  3TCO A;  3R3E A;  4OFT A;  3NOF A;  5CO3 A;  3ZYW A;  1Y25 A;  4N3Z A;  5DAK A;  3A5W A;  3S9F A;  2GZZ A;  3WT1 A;  3HHV A;  5F8B A;  3FR6 A;  4IQ1 A;  2M72 A;  4K5S A;  3GN3 A;  1K0B A;  2EFH A;  2L4C A;  3FKF A;  1MDJ A;  3TKP A;  4HOJ A;  6GSS A;  1SD8 A;  4ZBB A;  2LEG A;  4MJC A;  1U87 A;  1TXU A;  5FT3 A;  3FZ5 A;  2GST A;  5AIV A;  1R7H A;  3DIE A;  2CAI A;  5DCH A;  3G9B A;  4TOP A;  1KTE A;  1LU4 A;  2C0E A;  1M0U A;  4GLT A;  2FA8 A;  4BVX B;  3BCI A;  4TR1 B;  4PNF A;  1GSE A;  2IFQ B;  1Z5Y E;  5IOW A;  1F3B A;  3WGX A;  2HRA A;  3E3E A;  4ZB6 A;  4HS1 A;  3QDN A;  1HD2 A;  3FEU A;  1NSW A;  3APS A;  3TKS A;  3LG6 A;  3C1R A;  3DD3 A;  2KP1 A;  4EXJ A;  4N0Z A;  3JCM L;  4F03 A;  4KF9 A;  4IP1 A;  3GH9 A;  4ECB A;  2FNO A;  5D73 A;  1TU7 A;  4DSR A;  5AN1 A;  5C00 A;  2HT9 A;  1PN0 A;  4K9Z A;  3C71 A;  5A1N A;  2GGT A;  5DVB A;  2WVX B;  3GYK A;  1ABA A;  5JCW A;  2CVK A;  4JR6 A;  4QMK A;  1CQH A;  4D73 A;  1GUL A;  4XRA A;  3L78 A;  3EUR A;  1J08 A;  1PMT A;  2LTK A;  1EOG A;  1SK1 A;  2CQ9 A;  1TRU A;  2TIR A;  1MDI A;  3GV1 A;  5G30 A;  1TOF A;  2OE3 A;  3H79 A;  2WW0 A;  1HQO A;  3VUR A;  4K5R A;  3KH9 A;  4I97 A;  2VD0 A;  1G7O A;  1Z7P A;  1VF4 A;  3MAK A;  17GS A;  5BMU B;  3VI5 A;  2ON7 A;  2KP2 A;  1TK0 B;  2RII A;  3TUE A;  4DVC A;  2V32 A;  2E0Q A;  4OD7 A;  4NHW A;  4ILF A;  3W8S A;  2GDR A;  4GRF A;  3RBT A;  2YAN A;  5LCZ A;  4ZBD A;  2DJ0 A;  4HU7 A;  3E0U A;  4I6X A;  2LV3 A;  2I81 A;  5FHI A;  4ICY A;  3A2V A;  3DVX A;  4MAB A;  2H66 A;  3TKR A;  4TR3 A;  2QA2 A;  4TR0 A;  1A2M A;  1AIU A;  2V2G A;  2L5O A;  2BMX A;  4F82 A;  4YQU A;  2HSN A;  3D5J A;  4OO5 A;  1K0C A;  2VOC A;  2KHP A;  3IOS A;  4MP4 A;  3M3M A;  2VLV A;  3TKQ A;  1I1I P;  1YEX A;  4O5R A;  5IIZ A;  2H72 A;  2V1M A;  3LOR A;  4YH2 A;  4CHS A;  4HI7 A;  3RFR C;  2DJK A;  3GKM A;  4G0K A;  1XWC A;  2LNT A;  3GUR A;  4K1F A;  3ZZX A;  3VWX A;  3VWW A;  3IAS 2;  3KH7 A;  3ZL5 A;  1PN9 A;  2M46 A;  2HFD A;  2LQO A;  2YWO A;  4KA0 A;  4N0V A;  3ZFB A;  1G6Y A; 
#chains in the Genus database with same CATH homology
 1YDK A;  4PX1 A;  4AI6 A;  1SVM A;  4XTS A;  1YZX A;  3I9V 2;  3HA9 A;  3DVW A;  5DJL A;  3EYT A;  4EVM A;  2YJ7 A;  3PPU A;  3UMA A;  5IMA A;  4TR1 A;  2PPT A;  5DJM A;  5JWQ B;  4LMW A;  1VRS D;  4BA7 A;  4TW5 A;  1GSU A;  5HR1 A;  3A2X A;  2B5X A;  4IS0 A;  4MPF A;  1MDK A;  2PWJ A;  1A24 A;  1XOB A;  1ERV A;  1HNC A;  2PVQ A;  4YQV A;  1M2B A;  4EIQ A;  2AB6 A;  1SL2 B;  3LGC A;  1T8E B;  1T00 A;  2HI7 A;  1QMV A;  3IRA A;  1YEP A;  3ZFL A;  4IW9 A;  2GSQ A;  5G31 A;  2MZC A;  1H4O A;  4HQZ A;  3LXT A;  4L5O A;  3U6V A;  3LYK A;  2YWM A;  4KE3 A;  3GSS A;  3KJY A;  5H5Q A;  2D2Z A;  5J3R A;  4I5Q A;  3IE3 A;  4V1A p;  3ISO A;  2V6O A;  3CYN A;  2F8A A;  3VPT A;  3G7I A;  1XW6 A;  1I9D A;  1OAZ A;  3UEM A;  1FVK A;  4POK A;  3MYD A;  1HNB A;  5KOW A;  5IMF A;  5IPH A;  1Y6E A;  5ECS A;  2X99 A;  1Z7R A;  1R5P A;  3UL3 A;  1G7E A;  2C0G A;  4ZL7 A;  3FRC A;  3EU3 A;  12GS A;  2XBI A;  5IMZ A;  3RAZ A;  5F05 A;  3FW2 A;  1MD3 A;  1F3A A;  4E8H A;  3KMO A;  4XS1 A;  2FWG A;  2VLU A;  1NM3 A;  1K3L A;  1AAZ A;  2PVO C;  3KGK A;  3K8N A;  3OR5 A;  2H1B A;  1PGT A;  1PX7 A;  1URM A;  2JU5 A;  2DBC A;  5A5K A;  1OE8 A;  1X9M B;  5INY A;  3UIW A;  4KW6 A;  4ULX A;  4NPB A;  5JCG A;  5ECQ B;  1M99 A;  5DAK B;  1TRW A;  4G10 A;  1OKD A;  3LWA A;  4WXT A;  1X9W B;  5IO0 A;  2B7K A;  2VM2 A;  1Y1U A;  4NHZ A;  4YQM A;  2VM1 A;  2K18 A;  4LA1 A;  4K7N A;  3UAR A;  4WEY A;  5D9X A;  6GSV A;  2IMI A;  3O76 A;  2L6D A;  3Q19 A;  5A34 B;  6GST A;  2XBQ A;  1J0F A;  4MNN A;  1N8J A;  4A5P A;  5ECH B;  3QOU A;  1GUK A;  3QAW A;  5F0G A;  4HUA A;  4KUN A;  4ZXG A;  3GFK A;  4BL7 B;  1X5C A;  1T4Z A;  5CNW A;  1ERW A;  1SKR B;  4IBP A;  2H6Y A;  3DWV A;  2E2G A;  3D6I A;  4OCF A;  1WOU A;  3KD0 A;  2NBS A;  4WBR D;  1EZK A;  1BYE A;  2LRN A;  3VFI A;  1K0O A;  2B6M A;  2P5R A;  5G5E A;  4HEA 2;  1WIK A;  2CVD A;  2O89 A;  3TKS E;  2NDO A;  2H0I A;  2DC5 A;  3TOU A;  4JZQ A;  4AGS A;  2YWN A;  3IHQ A;  5H5S A;  3DYR A;  4L8E A;  2FWE A;  4L0W A;  4O32 A;  16GS A;  1BF5 A;  5ABR A;  22GS A;  2JSY A;  2PUK C;  4JRR A;  2DJJ A;  4OCE A;  2CZ3 A;  1YKC A;  1BX9 A;  4NV5 A;  1S3D A;  2MMO A;  3HVX A;  3TJJ A;  5D9W A;  3CRU A;  1J9B A;  4EO3 A;  4OFM A;  4XS4 A;  1TRS A;  4HZ2 A;  1A23 A;  1PKZ A;  3ZRE A;  2MMA A;  3KTB A;  3P8W A;  2G0F A;  3QFB C;  2RUF A;  5KN3 A;  2NTO A;  1WWJ A;  5G1K A;  2HSM B;  2LRC A;  5HR0 A;  2DKI A;  2FA4 A;  3DGQ A;  2AV4 A;  2CA8 A;  1SVL A;  2A2R A;  1EGO A;  5IMV A;  2Z9S A;  1B4Q A;  4OWY A;  4RUV A;  1XCC A;  4ML6 A;  2C0D A;  1PA3 A;  2F8F A;  5KN1 A;  3QD9 A;  2DLX A;  4XS6 A;  4LMV A;  1O8X A;  2LNS A;  4MDC A;  3M9K A;  4OO4 A;  1SL1 B;  1SJI A;  2LRT A;  5A5H A;  2GT6 A;  3GRX A;  1ERU A;  2K6V A;  3IHG A;  1V40 A;  4POB A;  3UBL A;  18GS A;  2O8V B;  2C80 A;  4GQF A;  4PQH A;  2LJA A;  1W89 A;  3ZTL A;  1A8L A;  1K3Y A;  4TRX A;  1PRX A;  2DIY A;  2LJK A;  1BJX A;  2RM5 A;  1S3A A;  4EKZ A;  1BG5 A;  2H74 A;  2OBI A;  3KIJ A;  5ENU A;  3QAV A;  2R2J A;  4HZ4 A;  1EEJ A;  1Q98 A;  6GSY A;  1GWC A;  4KND A;  4Z2U A;  3J7Y b;  2PGT A;  1VF3 A;  2H70 A;  5COH A;  4X0X A;  2N5B A;  4EE0 A;  1V98 A;  1EV4 A;  1TK8 B;  1TJD A;  2A4H A;  2GQK A;  5A34 A;  3DML A;  3RHB A;  2XHF A;  4POM A;  5IMD A;  2C8U A;  2AUV A;  3KM6 A;  1TW9 A;  1GNW A;  3FR9 A;  3QFA C;  4AJ6 A;  4O5U A;  4BL7 A;  1GNE A;  3GST A;  1SK0 A;  2P31 A;  3C1S A;  1M7T A;  4OFN A;  4J2F A;  2HNL A;  2RUE A;  3ZMK A;  3GH6 A;  1XVW A;  2H73 A;  1F2E A;  1TU8 A;  5HFG A;  2KLX A;  1B8X A;  3I6A A;  2OBK A;  4KDX A;  2CT6 A;  2R0G A;  4W66 A;  2C1Y A;  1O8W A;  3P2A A;  3H4K A;  3F4S A;  3HVV A;  1C72 A;  1XW5 A;  2HZE A;  3RPN A;  2YCD A;  3DRN A;  4FYC A;  3ZVJ A;  1FW1 A;  2JAD A;  1X0R A;  2GQL A;  2DJ3 A;  2VCZ A;  2HLS A;  5LNK e;  2H75 A;  2OKA A;  3LJR A;  5AIS A;  2VL9 A;  3CRT A;  2JAC A;  3QMX A;  5DQS A;  2DML A;  2WGR A;  4GWR A;  4H86 A;  5D93 A;  2LKU A;  4AJ7 A;  7GSS A;  1F9M A;  4IHU A;  4ZB8 A;  5KOX A;  5IOX A;  4PUA A;  1GUH A;  4GF0 A;  1G6W A;  2HSM A;  4Q5R A;  2FWF A;  4V1A g;  2CVB A;  3GMF A;  4MK3 A;  3BCK A;  1OC9 A;  4MCU A;  1PSQ A;  4K0G A;  2GLR A;  2YJH A;  3HXS A;  2EIO A;  2ZCT A;  1OC8 A;  4G0I A;  2DMM A;  2AAW A;  4JR4 A;  1OE7 A;  2HSY A;  1TTZ A;  3A5I A;  2JZT A;  2P5Q A;  3ZML A;  2VL2 C;  3LEF A;  2B3S A;  5DQY A;  1SKW B;  1E2Y A;  2H0H A;  1AC1 A;  3GKK A;  3ERG A;  2ES7 A;  3D4M A;  3GL5 A;  3LYP A;  1K0M A;  5IM9 A;  4RQR A;  1A2L A;  1KBN A;  4POL A;  2VKZ G;  4BPY A;  4RI6 A;  1N2A A;  3EMX A;  3IBH A;  2N5F A;  4WR5 A;  3PGT A;  4CW9 A;  4X43 A;  2DKH A;  3EMP A;  3D22 A;  1JLW A;  2GSR A;  1QGV A;  3HD5 A;  4L5L A;  3G7Y A;  4G2E A;  3W6G A;  1WMJ A;  1GSY A;  3RPP A;  3HZ4 A;  3TKS C;  4EDY A;  1JZO A;  1DBY A;  1KNG A;  4WET A;  4XHM A;  4IEL A;  2YZH A;  1GRX A;  4V2M A;  3FR3 A;  2VLT A;  3F4R A;  4FO5 A;  2HZF A;  1V58 A;  3DEX A;  4WF5 A;  3LQ7 A;  2H71 A;  2N5A A;  1ERT A;  4F0C A;  2M80 A;  4ECI A;  1PKW A;  3VWU A;  3FZ4 A;  3GHA A;  1X5E A;  2VO4 A;  3TDG A;  1TK5 B;  2H1D A;  2E7P A;  1K0A A;  1FB0 A;  2YN1 A;  2CX4 A;  2YNX A;  1ZZY A;  3N5O A;  11GS A;  2HRN A;  2A2S A;  2H76 A;  2MBT A;  1JZW A;  4FH8 A;  2FHE A;  5A4W A;  3TRX A;  4G19 A;  3HMJ G;  3KTL A;  1SK2 A;  5ECR B;  1RW1 A;  14GS A;  3HJM A;  2V41 A;  4ZIJ A;  2G2Q A;  2IPA A;  3CMI A;  2JSZ A;  4MJB A;  4EL1 A;  4ISD A;  2B1K A;  3Q74 A;  3F6F A;  1ZYQ B;  1WJK A;  4KGI A;  3IAM 2;  3IDV A;  2DJ1 A;  4XS4 B;  3ZVJ D;  4K7O A;  5ECN B;  2XC2 A;  3TGZ A;  2XPD A;  3MDK A;  3ERF A;  4GCI A;  4G01 A;  1DUG A;  1NHO A;  4GQC A;  2C3N A;  1EEM A;  3GKX A;  2ON5 A;  2R0P A;  4I2U A;  1AQV A;  3D0Z A;  1BG1 A;  3P7X A;  4ZL8 A;  3GX0 A;  4KCE A;  1GLP A;  2OT3 A;  3F63 A;  4HJ2 A;  2HQT A;  4N11 A;  4Q5F A;  4WBJ A;  3GTU B;  1XPV A;  3CSH A;  1TI3 A;  1GTI A;  3KEB A;  2MMN A;  2VCW A;  1Z3E A;  1G0T A;  3F3R A;  2IJY A;  1R5A A;  2CX3 A;  2AJQ B;  1AQW A;  3AY8 A;  3TJB A;  4NMU A;  1BED A;  4CY6 A;  5IQY A;  2FY6 A;  4DSQ A;  2QA1 A;  1E6B A;  3VWV A;  5E59 A;  1T4Y A;  1O73 A;  5A5H B;  4IQA A;  1FOV A;  2OE0 A;  5CP1 A;  1B4P A;  1GTB A;  4NAX A;  4NWY A;  4IP6 A;  5LD0 A;  4TXO B;  5L71 A;  3IK9 A;  2QC7 A;  2WDU A;  3BOA A;  3U5R E;  1ACV A;  1U3A A;  4O5Q A;  4AKI A;  1EOH A;  4ZBA A;  4GTU A;  2C3T A;  1JLV A;  3UAP A;  4MPG A;  4PNG A;  4MZC A;  2FCH A;  2AHE A;  3GNJ A;  5DAL B;  2GZY A;  1FAA A;  1YF1 A;  1Z6M A;  1TDI A;  5IO2 A;  1WE0 A;  1HNA A;  4ID0 A;  1AUC A;  1QK8 A;  3TB2 A;  1SEN A;  1YF0 A;  2VUP A;  2YV7 A;  2HXK A;  4KSO A;  1ILO A;  2LS5 A;  2CAQ A;  4KDU A;  1T1V A;  3HCZ A;  4ACS A;  4GSN A;  1WPI A;  1VGL A;  2OAC A;  1JZD A;  2NVL A;  3EWL A;  4TN8 A;  1V2A A;  3D4T A;  5C04 A;  5DDL A;  4NV2 A;  2X8H A;  1OKT A;  2FUG 2;  2CZ2 A;  3O6T A;  4F0B A;  4YKF A;  2HZE B;  2IME A;  3KCM A;  1GTA A;  1V57 A;  3KP8 A;  1GSD A;  3C7M A;  2J9H A;  4ZB7 A;  2RM6 A;  4XIH A;  1PX6 A;  3IC8 A;  5ID2 A;  4KX4 A;  2H0G A;  1MD4 A;  1XOA A;  1A0F A;  2GSS A;  4E8E A;  1SKS B;  1TI1 A;  5JCU A;  2VIM A;  4QL7 A;  3H93 A;  1GH2 A;  5B6N A;  2OAD A;  4AKG A;  3EU4 A;  1NW2 A;  3APO A;  4MH2 A;  3NZN A;  4WF4 A;  1OC9 B;  10GS A;  3MSZ A;  3F4T A;  2P0G A;  3EVI A;  2EC4 A;  2HRK A;  3GTU A;  3GX8 A;  3L4N A;  1ML6 A;  4QQ7 A;  2X8G A;  1Z6N A;  5H5R A;  3CSI A;  2H8L A;  2L6C A;  4V2L A;  1SYR A;  3IR4 A;  2YV9 A;  2F3M A;  3IXR A;  4K2D A;  1YY7 A;  3KP9 A;  5HR3 A;  8GSS A;  1YQ1 A;  5ECL B;  3BJ5 A;  4MZW A;  1YJ6 A;  2L57 A;  1F6M C;  4ECJ A;  2O85 A;  1K0D A;  4NXI A;  2DJ2 A;  1YVL A;  2OE1 A;  2TRX A;  5GZZ B;  4TVE A;  1RQM A;  1GP1 A;  3ED3 A;  4AJ8 A;  3HDC A;  1PD2 1;  4TXO A;  3J7Y k;  2UV8 G;  4E68 A;  3L9U A;  3BD2 A;  3NIV A;  4MMM A;  1I5G A;  2X8C A;  3QCP A;  5JWR B;  3BBY A;  1A0R P;  1IYH A;  3EPT A;  1OC3 A;  2IL3 A;  1CQG A;  1SD9 A;  5GAP D;  3TRQ A;  4GSS A;  3TU3 B;  5J4V A;  2MMZ A;  3IA1 A;  4FYU A;  4Q5N A;  4YKG A;  2YP6 A;  3HJO A;  2L4Q A;  2IWT A;  3GKN A;  5DAL A;  1TRV A;  1XXU A;  1TXX A;  2VL2 A;  2MYG A;  4IVF A;  1BAY A;  5E4W A;  2I4A A;  5ECI B;  1ZMA A;  2X49 A;  3VPQ A;  1W4V A;  3APQ A;  5EVO A;  5JWO B;  2VD1 A;  1SU9 A;  3FMW A;  4ZL9 A;  1XIY A;  3DKS A;  1FO5 A;  2WRT A;  3KMN A;  4RI7 A;  4AKH A;  3KXO A;  3FZA A;  4DEJ A;  3SWL A;  1JFU A;  1GL8 A;  2GQM A;  1R4W A;  3TOT A;  2LST A;  1AQX A;  2JZR A;  4TKY A;  3LFL A;  1ON4 A;  4OMV A;  5J47 A;  2EFE A;  1T7P B;  4MH3 A;  5G5F A;  3ME8 A;  1SVO A;  3A2W A;  2A2P A;  1Z9H A;  6GSX A;  5DCG A;  1EP7 A;  5CRG A;  2DIZ A;  3FY7 A;  1XWG A;  4PXO A;  2IMD A;  4EC0 A;  5ELA A;  1YKA A;  4JU5 A;  4LL1 B;  4EDZ A;  2GTU A;  4K7I A;  3WYW A;  1LBK A;  1ST9 A;  4GST A;  4I8B A;  3VK9 A;  3F8U A;  2WCI A;  1B9Y C;  3EE2 A;  3UVH A;  1SJ6 A;  1V9W A;  2H1G A;  3WT2 A;  3EIN A;  3LSZ A;  2HRF A;  3HKR A;  4MF5 A;  3M0F A;  1SYX A;  5B8A A;  2PER A;  4YAP A;  2H19 A;  4FIW A;  3R2Q A;  3L9S A;  4HQS A;  1BQ7 A;  5FWG A;  1ZL9 A;  2K8V A;  2RLI A;  1U3I A;  2E2M A;  2TRC P;  2CV4 A;  1UVZ A;  4O92 A;  2H1A A;  4EUY A;  2YZU A;  3E9J B;  4JE1 A;  4FYB A;  1U88 A;  3TJF A;  1EP8 A;  1B48 A;  1XWB A;  2R5G A;  2KOK A;  4Q5Q A;  4ZB9 A;  1PL1 A;  2H6Z A;  3CTG A;  4Z2R A;  4V2N A;  2EFD A;  3VI7 A;  5CAX A;  2C3Q A;  2LQQ A;  4XCS A;  5DBQ A;  1H75 A;  1EGR A;  3M9J A;  3P90 A;  4TXV A;  4F2I A;  3A3T A;  5CRD A;  3I43 A;  4MJE A;  5D9V A;  2VCQ A;  2ZUP A;  1O6J A;  4J57 E;  5EY6 A;  2VL3 A;  3ZIV A;  4QL9 A;  1O7U A;  1M2D A;  3HYP A;  1VF2 A;  3L0H A;  2VAF A;  5CRE A;  1QXH A;  3HVS A;  3MWH A;  4K8M A;  2R37 A;  1FB6 A;  1MTC A;  5J41 A;  2X64 A;  3ERW A;  9GSS A;  5ECP B;  1GUM A;  1XFL A;  5A4V A;  5J4U A;  1DSB A;  2GVP A;  3W8J A;  1GSS A;  3ZRD A;  1T3B A;  4PGT A;  5GST A;  1A2J A;  3GA4 A;  2I1U A;  2F9S A;  1F37 A;  1VF1 A;  4FQU A;  4F9Z A;  2QKE A;  2PU9 C;  3HJP A;  5G2Z A;  2WUL A;  4ML1 A;  4MA9 A;  2O87 A;  3GUS A;  1AW9 A;  2VCV A;  1K0N A;  1THX A;  4RQX A;  3UJ1 A;  4KDY A;  1SJZ A;  4BWQ A;  5AIX A;  2HE3 A;  4BVY B;  1GLQ A;  1EWX A;  3FK8 A;  5CYY A;  2R0C A;  5J40 A;  2IMK A;  4JED A;  4BVX A;  1XWK A;  1XW9 A;  1USB A;  4GXZ A;  4MF6 A;  2XPE A;  5HR2 A;  2IFQ A;  4IKH A;  5ID2 B;  1SL0 B;  2R3X A;  1OYJ A;  1TP9 A;  3HY2 A;  2EIQ A;  4KAE A;  1UN2 A;  4IJ3 A;  4IGJ A;  2OJL A;  1FG4 A;  5F07 A;  2WB9 A;  1WRY A;  5IPG A;  3TJG A;  2YOI A;  2FGX A;  1X5D A;  1B9X C;  2FLS A;  4N30 A;  2K9F A;  6GSW A;  4CDO A;  2H30 A;  2KUC A;  4GDF A;  5EL8 A;  2V6K A;  2HRK B;  5B8B A;  2B7J A;  1XVQ A;  3Q6O A;  2O5V A;  4KCA A;  4HDE A;  5ECK B;  1ZOF A;  1MEK A;  3CTF A;  5IMC A;  2YWI A;  3GIX A;  4PQ1 A;  1KEB A;  3N9J A;  3IPZ A;  5ECO B;  3UOM A;  2FD3 A;  1M9B A;  1M2A A;  2BJX A;  3WGE A;  5J9B A;  5KEJ A;  1R26 A;  4K0N A;  4USS A;  1O81 A;  3TJK A;  1UA5 A;  3LW9 A;  1PL2 A;  1LJR A;  2WS2 A;  4X1U A;  4LL4 B;  5J9C A;  2VCX A;  1AXD A;  2JL4 A;  3I69 A;  2FWH A;  5BMU A;  3FZ9 A;  3PR8 A;  2LJR A;  3ME7 A;  5J4Y A;  5KN2 A;  4DSS B;  4YAV A;  3M1G A;  1THO A;  2O7K A;  4MLY A;  1S3C A;  3FYG A;  2B5Y A;  2J23 A;  3QAG A;  19GS A;  4PUR A;  1ZGN A;  1WP0 A;  1O85 A;  4I2T A;  2WJU A;  5F06 A;  1HYU A;  3QR6 A;  5KN0 A;  1QQ2 A;  4MJA A;  5D96 A;  3D21 A;  2GZP A;  4CY8 A;  1X9S B;  3ZIT A;  2I3Y A;  4LLR A;  4Z7X A;  1DE1 A;  3CSJ A;  3EC3 A;  13GS A;  2YPM A;  5GAN D;  4ZIL A;  3MNG A;  2NPB A;  3WGD A;  4PTS A;  2X4A A;  1IYI A;  3RDW A;  3RHC A;  3IK7 A;  2OA7 A;  2UZ8 A;  5ELG A;  6GSU A;  2H01 A;  2IN3 A;  2VCT A;  3VLN A;  3LXZ A;  1NHY A;  4PUF C;  1GTU A;  4G0L A;  1XBS A;  4EF0 A;  4EIP A;  4JBB A;  2F51 A;  1UC7 A;  3F9U A;  3WD6 A;  4BVY A;  20GS A;  3O3T A;  2H1L A;  4O7H A;  2HSH A;  2I9H A;  3UVT A;  1XZO A;  3C8E A;  2QGV A;  4BWS A;  2H6X A;  2WZ9 A;  1ZYN A;  1ZYP A;  3HZ8 A;  2IIY A;  5AGY A;  4PQI A;  2L5L A;  5B7C A;  4X4J A;  5D8I A;  4G9H A;  4WR4 A;  5J5N A;  4K2X A;  2C0F A;  4L0U A;  2GS3 A;  5EPF A;  4XRD A;  3UBK A;  1PQN A;  1DE2 A;  1A8Y A;  3IC4 A;  1FOH A;  2R4V A;  3F3Q A;  3ZLP A;  2A4V A;  5A1N B;  1EV9 A;  3QPM A;  3IV4 A;  4HU9 A;  4D73 B;  2BTO T;  3CXG A;  2WFC A;  2C4J A;  3H1N A;  2REM A;  2GT5 A;  1FVJ A;  3DXB A;  5HFI A;  3KZQ A;  4P3Y B;  4TR4 A;  3US3 A;  3F6D A;  5B6M A;  2PMT A;  3H8Q A;  5A4U A;  3CBU A;  4IJI A;  3MIX A;  2MBS A;  5D9T A;  2JZS A;  2B5E A;  2ALB A;  2LUS A;  4HJM A;  2ZNM A;  4AKX B;  1GSF A;  1QFN A;  3CWG A;  1JHB A;  4IN0 A;  2IMF A;  4AF2 A;  3M8N A;  2B1L A;  5ECM B;  3C73 A;  2K8S A;  1JZR A;  3V1W A;  4Z2T A;  5G1L A;  2R6K A;  5HFK A;  2AYT A;  1K3O A;  1XWA A;  4J56 E;  4K6X A;  3PIN A;  2PN8 A;  1ZYE A;  5CRW A;  3GL3 A;  2QSI A;  1FHE A;  1N25 A;  3PH9 A;  3SBC A;  4KSM A;  2DSA A;  4MF7 A;  1TKD B;  4N10 A;  5BRT A;  1ZCP A;  3FHK A;  2EIR A;  1OVN A;  3F0I A;  4MZB A;  4DSS A;  1U6T A;  1M9A A;  4KH7 A;  1QUW A;  3G7J A;  3Q18 A;  3TRP A;  1GSQ A;  5GSS A;  5CRH A;  4KB3 A;  2HYX A;  3L9V A;  5HQP A;  1RK4 A;  2EFC A;  2HSN B;  2PBJ A;  2L59 A;  4WKW A;  3ZIJ A;  1Q4J A;  4ECC A;  3TCO A;  3R3E A;  4OFT A;  3NOF A;  5CO3 A;  3ZYW A;  1Y25 A;  4N3Z A;  5DAK A;  3A5W A;  3S9F A;  2GZZ A;  3WT1 A;  3HHV A;  5F8B A;  3FR6 A;  4IQ1 A;  2M72 A;  4K5S A;  3GN3 A;  1K0B A;  2EFH A;  2L4C A;  3FKF A;  1MDJ A;  3TKP A;  4HOJ A;  6GSS A;  1SD8 A;  4ZBB A;  2LEG A;  4MJC A;  1U87 A;  1TXU A;  5FT3 A;  3FZ5 A;  2GST A;  5AIV A;  1R7H A;  3DIE A;  2CAI A;  5DCH A;  3G9B A;  4TOP A;  1KTE A;  1LU4 A;  2C0E A;  1M0U A;  4GLT A;  2FA8 A;  4BVX B;  3BCI A;  4TR1 B;  4PNF A;  1GSE A;  2IFQ B;  1Z5Y E;  5IOW A;  1F3B A;  3WGX A;  2HRA A;  3E3E A;  4ZB6 A;  4HS1 A;  3QDN A;  1HD2 A;  3FEU A;  1NSW A;  3APS A;  3TKS A;  3LG6 A;  3C1R A;  3DD3 A;  2KP1 A;  4EXJ A;  4N0Z A;  3JCM L;  4F03 A;  4KF9 A;  4IP1 A;  3GH9 A;  4ECB A;  2FNO A;  5D73 A;  1TU7 A;  4DSR A;  5AN1 A;  5C00 A;  2HT9 A;  1PN0 A;  4K9Z A;  3C71 A;  5A1N A;  2GGT A;  5DVB A;  3GYK A;  1ABA A;  5JCW A;  2CVK A;  4JR6 A;  4QMK A;  1CQH A;  4D73 A;  1GUL A;  4XRA A;  3L78 A;  3EUR A;  1J08 A;  1PMT A;  2LTK A;  1EOG A;  1SK1 A;  2CQ9 A;  1TRU A;  2TIR A;  1MDI A;  3GV1 A;  5G30 A;  1TOF A;  2OE3 A;  3H79 A;  1HQO A;  3VUR A;  4K5R A;  3KH9 A;  4I97 A;  2VD0 A;  1G7O A;  1Z7P A;  1VF4 A;  3MAK A;  17GS A;  5BMU B;  3VI5 A;  2ON7 A;  2KP2 A;  1TK0 B;  2RII A;  3TUE A;  4DVC A;  2V32 A;  2E0Q A;  4OD7 A;  4NHW A;  4ILF A;  3W8S A;  2GDR A;  4GRF A;  3RBT A;  2YAN A;  5LCZ A;  4ZBD A;  2DJ0 A;  4HU7 A;  3E0U A;  4I6X A;  2LV3 A;  2I81 A;  5FHI A;  4ICY A;  3A2V A;  3DVX A;  4MAB A;  2H66 A;  3TKR A;  4TR3 A;  2QA2 A;  4TR0 A;  1A2M A;  1AIU A;  2V2G A;  2L5O A;  2BMX A;  4F82 A;  4YQU A;  2HSN A;  3D5J A;  4OO5 A;  1K0C A;  2VOC A;  2KHP A;  3IOS A;  4MP4 A;  3M3M A;  2VLV A;  3TKQ A;  1YEX A;  4O5R A;  5IIZ A;  2H72 A;  2V1M A;  3LOR A;  4YH2 A;  4CHS A;  4HI7 A;  2DJK A;  3GKM A;  4G0K A;  1XWC A;  2LNT A;  3GUR A;  4K1F A;  3ZZX A;  3VWX A;  3VWW A;  3IAS 2;  3KH7 A;  3ZL5 A;  1PN9 A;  2M46 A;  2HFD A;  2LQO A;  2YWO A;  4KA0 A;  4N0V A;  3ZFB A;  1G6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...