4GSTA

Reaction coordinate motion in an snar reaction catalyzed by glutathione transferase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Snapshots along the reaction coordinate of an SNAr reaction catalyzed by glutathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 76
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4gstA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gstA01
3N5OA 1FO5A 1A23A 2CA8A 5IQYA 4FO5A 2H6YA 4NWYA 5IO2A 1B4PA 2VL2A 4TR0A 1BQ7A 1J08A 1X9WB 3DEXA 2EIRA 3IOSA 1PRXA 5C04A 4MP4A 1GSSA 2GQLA 1K0DA 5IPGA 2K9FA 3A2XA 4EXJA 3F6DA 2PMTA 4JZQA 3HHVA 2PU9C 1V9WA 4KDUA 1TW9A 1EOGA 3QR6A 4X43A 5BMUA 4EO3A 1N8JA 2K6VA 2HQTA 5DALB 1LBKA 3QFBC 4I5QA 2L6DA 2VL3A 1GUHA 5G1KA 1ERUA 2YWNA 2H73A 2B7KA 2CAIA 1G6WA 4K0NA 1BAYA 2KOKA 3MNGA 2MBSA 2FA4A 1YKCA 2R6KA 5EVOA 2WB9A 1Z7RA 1T4ZA 2H0GA 4X1UA 1DE1A 4FYCA 4N0ZA 3PR8A 3TJFA 3DVWA 1RQMA 1YF0A 4JEDA 5F07A 3TOUA 1PL1A 3V1WA 2CZ2A 2HE3A 2OE3A 3TKQA 4PUFC 4TR1B 5DAKA 2H71A 4USSA 3ZMKA 5CREA 4MPFA 2OKAA 4HDEA 3ZZXA 4O5RA 1PKZA 3P2AA 1SKRB 3M9KA 2OE0A 3A2VA 1FHEA 5ENUA 4F82A 1SL0B 4D73B 3MDKA 1YEPA 4IELA 3QD9A 5COHA 3BCKA 3FHKA 4KCEA 1O8XA 4ZL7A 2TIRA 1V2AA 1PMTA 1K0BA 5ELGA 1MD4A 1TI3A 3C7MA 2PN8A 1K0OA 4XCSA 1T8EB 4EDYA 2QGVA 2XBQA 4GXZA 1T3BA 3TJJA 4TW5A 3ZVJA 2VAFA 4AJ8A 1ZYQB 1B8XA 5DCGA 4NV5A 3ZL5A 2F8FA 4GQFA 3TKSE 1USBA 2GT5A 5CRDA 4WR4A 5GSTA 3IAS2 4POBA 3HY2A 4ML6A 1THXA 4HU9A 1F6MC 2JSYA 1Z9HA 2FNOA 2PVOC 3ZRDA 4FIWA 3GH6A 3P90A 4OMVA 1GTAA 3D4TA 1A2MA 1SU9A 1FB6A 4HOJA 4OO4A 2DJKA 4V2MA 4ZBDA 4K7IA 11GSA 4MCUA 2YCDA 4IP6A 3EE2A 1GRXA 1K0NA 1Z7PA 3GH9A 2HRAA 3E3EA 3WGEA 3F4TA 4MF5A 3GKMA 1ERTA 2HSMB 2LUSA 5L71A 2VCZA 4CW9A 1V40A 3BOAA 4HU7A 2HSYA 1KEBA 1FOVA 1BG5A 1XFLA 3MWHA 1E6BA 5D9WA 3KMOA 3F3RA 3DGQA 5D9XA 4RI7A 4HJ2A 4ZBAA 2XBIA 2I81A 3GX8A 1VRSD 4KAEA 4BVYB 1FAAA 4EVMA 3GKXA 6GSUA 1Y6EA 3KM6A 1GWCA 3BBYA 1EGOA 3UEMA 1OE7A 5JWQB 1XCCA 3DMLA 2M72A 2AUVA 4NPBA 5ECOB 1SKWB 3PPUA 1A8LA 4MLYA 2LNTA 1UA5A 3DXBA 3US3A 2LJAA 1TXXA 1C72A 2K18A 1S3DA 1FW1A 2HNLA 3RAZA 1QMVA 2H1AA 2DJ0A 4MZCA 2L6CA 3VK9A 3TKPA 3ZTLA 4ZIJA 5ECNB 4MDCA 3FZ4A 4ECJA 3APQA 4TKYA 2X99A 4J57E 5D8IA 3TKRA 3RBTA 4ZL9A 2IMKA 1FG4A 1HNAA 2CV4A 1OAZA 2J23A 2IPAA 2VL2C 3A5WA 3UVHA 4ZB9A 1VGLA 3VLNA 5HR0A 3FR6A 5HFGA 4MJEA 5ABRA 1X9SB 2GSQA 1YY7A 3L9UA 1TTZA 3GKNA 1BYEA 3G7JA 4OCEA 3GNJA 2XC2A 1ZZYA 2YOIA 1R5AA 1AC1A 3L9VA 3U6VA 1O7UA 2H76A 1F2EA 1NSWA 2GZZA 4WR5A 3CSIA 2X8GA 3FZAA 3IAM2 1OKTA 2FWFA 1G6YA 3FYGA 4PTSA 3UOMA 2V6KA 1AAZA 3UIWA 2H19A 4WBRD 2H30A 3UL3A 4RUVA 2M80A 3SWLA 2AYTA 3FR3A 4ECIA 3APOA 5G31A 3IHQA 4IHUA 1SYXA 2RLIA 1SD9A 1EP7A 1GSUA 2GVPA 4OWYA 4OO5A 4EDZA 2IN3A 1K3YA 2IMDA 2YANA 2OBIA 3F4SA 3G7YA 3FKFA 3GSSA 1PQNA 1WMJA 3Q6OA 2G2QA 3GTUB 2VCXA 2IIYA 2L4CA 2O89A 1PA3A 1MEKA 1OC9A 2LJRA 3F6FA 5IMAA 5KN0A 4KB3A 1Z6NA 3H4KA 2EIQA 1M0UA 3W8JA 5B8AA 5H5SA 5KN1A 4IKHA 4CDOA 3KD0A 3UBLA 1XWBA 2VD0A 1TU7A 2MMOA 3HVXA 3IPZA 4K7OA 2C0DA 4K7NA 4V1Ag 4PXOA 3NZNA 2PVQA 1MTCA 2LQQA 2FGXA 1GSQA 2H0IA 3GMFA 4TR1A 5B7CA 2YWMA 4BA7A 3UAPA 3K8NA 1GTUA 3UVTA 1NHOA 1QK8A 2QSIA 2C8UA 4EE0A 4D73A 2RUFA 4AGSA 2GZPA 4NHZA 3DKSA 2NBSA 1SK0A 2VD1A 1URMA 1M99A 2O85A 4L0WA 2H74A 3F8UA 3DIEA 3DWVA 4NHWA 5A5KA 2JACA 1GL8A 3F0IA 5A4UA 4HJMA 3I69A 2DSAA 3TRXA 2H70A 12GSA 4PX1A 3VI5A 3BJ5A 2VOCA 3U5RE 2GSRA 1FVJA 3OR5A 4IGJA 1ACVA 3I6AA 16GSA 2B7JA 2MBTA 2KP1A 4I97A 9GSSA 1PX6A 4BL7B 2H72A 3KJYA 2LTKA 4MJAA 1SL2B 1NM3A 3LWAA 3RPPA 2O8VB 3P7XA 2C0EA 3KH7A 1A0FA 5JWOB 1XWAA 3ERWA 1F9MA 4KF9A 2RUEA 3ZIVA 1X0RA 6GSXA 3FW2A 4KSMA 2FCHA 2X8CA 2L5LA 2I1UA 1G0TA 3ZITA 1A24A 4JR4A 1ON4A 2C0GA 4QQ7A 2HFDA 2HSMA 6GSVA 2GTUA 4L5LA 4JU5A 2OBKA 1U87A 1YEXA 3HVSA 1WIKA 3EC3A 2VIMA 4HQSA 1T7PB 1K0MA 2QC7A 3WD6A 1SENA 2DIYA 3CSJA 2A2SA 2MZCA 1ABAA 4G9HA 5ELAA 5CP1A 4BWQA 1GSEA 4CHSA 1J9BA 1PD21 3EU3A 3FY7A 2H0HA 1S3AA 2NDOA 3F3QA 1JZRA 5J3RA 1T1VA 1I9DA 2XHFA 2OE1A 3VPQA 1A8YA 2M46A 5AGYA 4N11A 3DYRA 3HD5A 3KP8A 2DMMA 3IA1A 3HCZA 5HFKA 3D22A 1EWXA 1JHBA 3FR9A 3EU4A 3IDVA 3ME8A 2V2GA 4FH8A 2JZRA 4MH3A 2C80A 4POKA 3FZ9A 1EEJA 4I2TA 3ZIJA 2YWIA 22GSA 3GRXA 2LSTA 5J41A 3TDGA 1V98A 1M9BA 2NVLA 2VLVA 2EC4A 4IJ3A 3TKSA 3ME7A 2CVBA 5AN1A 1PGTA 4FYUA 2REMA 4KUNA 1F3BA 3VURA 3HYPA 1M2AA 10GSA 3QAGA 1YKAA 1X9MB 5HR2A 4LLRA 2O7KA 1QXHA 3KGKA 4ZL8A 3EVIA 5D73A 2PBJA 1TKDB 3PH9A 2ES7A 3I9V2 1TRWA 4ZB8A 2GDRA 4L8EA 1ERWA 2RM5A 1ZYEA 1X5CA 2IWTA 4KX4A 3HJPA 1EV4A 3GFKA 2I3YA 3VI7A 4XS4A 5IMZA 2DJ1A 4WKWA 2K8SA 4IBPA 4OD7A 4DVCA 2HZEB 4I2UA 1DUGA 2CX4A 1DE2A 4KCAA 3TCOA 3ZMLA 2N5FA 1CQHA 2IFQA 2YZHA 3M9JA 3QCPA 2TRCP 5E59A 2F9SA 5CNWA 5F8BA 4WXTA 2VM2A 3BD2A 6GSWA 2J9HA 3GIXA 4EKZA 2E7PA 3A2WA 3HZ4A 1YJ6A 1V58A 4O7HA 4IQ1A 4F2IA 4AF2A 1THOA 4YH2A 1KBNA 3LXTA 4ZBBA 3EINA 3UBKA 1BX9A 3AY8A 4LL1B 4OFTA 3MSZA 4ULXA 3QPMA 3ERGA 1Z6MA 3TJGA 1B4QA 3E0UA 5DJLA 1V57A 4EUYA 4IQAA 5D93A 3M3MA 3WYWA 1XWCA 2VCVA 2LKUA 2YPMA 3IK7A 4EL1A 1F37A 4GSSA 1OVNA 2HI7A 2IMIA 4Q5QA 2WS2A 3KP9A 3GUSA 4GSTA 5AIXA 3WGXA 2VM1A 2VLUA 4GQCA 4RQRA 1O8WA 4PNGA 4MZWA 4TXOA 2V32A 1GSDA 2E2GA 1XOAA 1TK8B 2JL4A 4POMA 3FZ5A 1U3AA 18GSA 2X8HA 5CRWA 4PURA 4K2DA 3A3TA 4KDYA 3EWLA 2LNSA 1OYJA 1K0AA 5G5FA 2G0FA 2N5AA 3J7Yb 5FT3A 4TXVA 5JWRB 1R4WA 1EEMA 5ECIB 1K3OA 1TRSA 5FWGA 2P31A 2LRTA 4OFNA 2KUCA 4Z7XA 2I4AA 1XOBA 2PUKC 1B9XC 4G0LA 4LMWA 4V2NA 4ACSA 1XVQA 1K0CA 2A2RA 3QOUA 6GSSA 4K1FA 5INYA 1WE0A 3H1NA 4MF7A 5AIVA 2LRCA 2AJQB 2YV7A 4XIHA 4JBBA 3BCIA 5J4UA 5D96A 5KEJA 1B9YC 1ZMAA 2WZ9A 3H8QA 3P8WA 4K9ZA 1IYHA 1GTBA 5ECLB 2ZNMA 4BL7A 1G7EA 1M9AA 5D9TA 2MMAA 3IK9A 3TB2A 17GSA 5IM9A 3KIJA 3DVXA 4QL7A 3FRCA 2H66A 1S3CA 2VUPA 1XVWA 4BWSA 2BJXA 4MZBA 5IMFA 2E2MA 2FLSA 4G10A 4XRAA 2B5YA 2ON7A 1PSQA 3VWVA 5CRGA 2JADA 5B6MA 2H6XA 1YQ1A 5ECKB 2DJJA 1X5EA 2H1DA 2JZTA 1BEDA 4GF0A 5IPHA 3HZ8A 1LU4A 3EMXA 2CX3A 5ID2B 2GSSA 1ERVA 4XS6A 1TRVA 3GHAA 4L5OA 5DALA 2A4VA 3HKRA 5C00A 1SL1B 5CRHA 3IXRA 1KTEA 3WT1A 3G7IA 1MDJA 3TUEA 1VF3A 1DSBA 2P0GA 2GQKA 2MMZA 2DMLA 4F0BA 4I6XA 1HYUA 1GTIA 5FHIA 1MDKA 4RQXA 2NPBA 4Q5FA 4NMUA 4G0IA 3GV1A 1R26A 1GSFA 4YQVA 8GSSA 1XW9A 3HDCA 5DDLA 2YJ7A 3FEUA 2L5OA 2IMFA 2OADA 5G2ZA 5F0GA 1LJRA 3HXSA 5ECHB 1AQXA 5LCZA 2KHPA 3HJMA 2CVDA 5CYYA 1WPIA 1B48A 1J0FA 4BVXB 1SJIA 4YQMA 1R5PA 5IO0A 3IE3A 2DIZA 1EOHA 3O3TA 4I8BA 2VO4A 1ILOA 2HRNA 2L4QA 1I5GA 3D6IA 4N10A 14GSA 5JCWA 4EF0A 4KNDA 3ZFBA 2CAQA 1ST9A 1TK0B 1JZOA 2VCQA 3IC4A 3CRUA 1AQVA 3CRTA 2FHEA 1XIYA 1Y25A 5G30A 5DCHA 3PGTA 3Q19A 20GSA 2GSTA 2L59A 3LQ7A 2GLRA 1TOFA 2PWJA 3H79A 2Z9SA 4XTSA 2VCTA 4YAVA 1U88A 5CO3A 2LJKA 5G1LA 2LS5A 1QQ2A 4KH7A 2DLXA 1SKSB 19GSA 4TRXA 2C4JA 3GURA 3IC8A 4OFMA 3QDNA 13GSA 1XWKA 2V1MA 1GLQA 2FUG2 3RHCA 1E2YA 2WCIA 1W4VA 3KCMA 1VF2A 1O6JA 1XW6A 2TRXA 4P3YB 3D4MA 1UVZA 2HLSA 1A2LA 2OJLA 3NIVA 3KH9A 4ECCA 1AQWA 5IOXA 5EPFA 4G2EA 5LD0A 4PGTA 2I9HA 1PL2A 1JZWA 1OE8A 4O92A 3KZQA 1FVKA 1HNBA 3W8SA 4TR4A 1X5DA 6GSYA 2LRNA 4PQ1A 5JCUA 2LEGA 4KW6A 1IYIA 4BVYA 3LG6A 3EYTA 5H5RA 5DQSA 2F51A 5JCGA 1OC9B 2FY6A 4YAPA 5GAPD 3HJOA 2HSNB 4TR3A 2E0QA 2HRKB 3QMXA 1XWGA 1H4OA 1JFUA 1SK2A 3ZVJD 2QKEA 4IN0A 1M2DA 3ZFLA 4MF6A 4X0XA 2IJYA 1TP9A 1WOUA 5A4WA 2F8AA 3VWWA 1O85A 1FB0A 1A0RP 2FWGA 2O87A 5J9BA 2LV3A 1SD8A 3GKKA 3ZYWA 2ZUPA 2HSHA 3IR4A 4J2FA 3IV4A 3L78A 5F06A 1ZGNA 1WJKA 4JE1A 4IVFA 3M0FA 5ECQB 2JSZA 2CVKA 5DJMA 4MABA 4Q5NA 2H01A 2V6OA 1O73A 5G5EA 2YJHA 2C3QA 3KTBA 3LFLA 3CXGA 3UMAA 4JRRA 1KNGA 4K6XA 5KN2A 3KEBA 2JU5A 4HS1A 3VWXA 3D21A 2L57A 2C1YA 1NW2A 5H5QA 1SK1A 2YN1A 3GYKA 1TJDA 4PQIA 3GX0A 1JLWA 2H8LA 3RDWA 4HEA2 2XPDA 1G7OA 1XW5A 4HI7A 3ED3A 3KTLA 2JZSA 4YQUA 4LMVA 3UARA 5HR1A 1GH2A 2VLTA 4POLA 3TGZA 2WGRA 3W6GA 1AUCA 4HQZA 5HFIA 1Z3EA 3LYKA 2AV4A 1GSYA 2P5QA 1UC7A 5J5NA 1HD2A 4WF5A 4DSSB 2VCWA 3TOTA 1U6TA 3L9SA 3C1SA 2GQMA 4ML1A 5B8BA 4N0VA 2HYXA 1OC3A 1XPVA 3C71A 4ILFA 4AJ7A 5LNKe 1PN9A 3PINA 3ISOA 2H1GA 2YWOA 4GLTA 2LQOA 4MH2A 1GUKA 1W89A 4GTUA 4G0KA 1JZDA 5ID2A 2EIOA 4ISDA 4TN8A 3GTUA 2CQ9A 2PERA 2BMXA 1GP1A 1MD3A 3HVVA 1TU8A 2NTOA 4XS1A 1AXDA 2VL9A 1ZL9A 3LYPA 1QGVA 2AAWA 4RI6A 2R4VA 4K0GA 2HT9A 3GA4A 4NV2A 2MYGA 3J7Yk 4Q5RA 4V2LA 5B6NA 1U3IA 3C1RA 3SBCA 2FA8A 2ALBA 4OCFA 4DSQA 4K8MA 3GL3A 2B1KA 2KLXA 2X64A 4DSRA 3VFIA 2MMNA 1RW1A 2B5XA 2DC5A 1T00A 3F63A 1A2JA 3NOFA 5ECRB 1DBYA 4WBJA 4F9ZA 1ZCPA 4WETA 3QAWA 3KXOA 2K8VA 5IIZA 4BVXA 1TDIA 4KA0A 4PUAA 7GSSA 2GS3A 3WGDA 4IW9A 1SJZA 1ML6A 1QUWA 4DEJA 1TI1A 4H86A 2WFCA 2PPTA 1TRUA 2R37A 4V1Ap 1GULA 2FWEA 5CAXA 3Q18A 4G19A 4HZ4A 5AISA 4ZXGA 1EV9A 2YZUA 3DRNA 5DAKB 2H75A 4O32A 3GN3A 3WT2A 5ECPB 3H93A 5HR3A 5DQYA 4EC0A 1T4YA 3CTFA 4AJ6A 4IS0A 3O6TA 1GUMA 4IJIA 4WF4A 2D2ZA 5IOWA 1Z5YE 4MJCA 3CBUA 2HXKA 3S9FA 1H75A 2HRFA 3UJ1A 1BJXA 6GSTA 3LXZA 2OACA 2AHEA 2WDUA 2FWHA 2WRTA 1YZXA 4XS4B 1CQGA 1OC8A 1VF4A 1PX7A 1M7TA 2H6ZA 3RPNA 5GZZB 1PKWA 3I43A 4XRDA 2IMEA 1EZKA 2F3MA 5ECMB 2YV9A 4FQUA 4PQHA 3CSHA 4MMMA 4F0CA 2N5BA 3TRQA 3F9UA 1MDIA 1R7HA 3TJBA 3MAKA 2GGTA 4TOPA 2IFQB 3QAVA 4LL4B 5DVBA 4N30A 1AIUA 3C73A 3LGCA 5DBQA 3C8EA 3LORA 2C0FA 3D5JA 1YDKA 3M1GA 1OKDA 3IBHA 1ZOFA 1WP0A 4IP1A 4BPYA 3GSTA 3M8NA 1O81A 4E8HA 2ZCTA 1HNCA 1XZOA 3LJRA 1YF1A 3IRAA 1Q4JA 5IMDA 4HZ2A 3TKSC 1QFNA 2CT6A 3JCML 1SYRA 2RM6A 2C3NA 3APSA 2BTOT 1HQOA 4F03A 4KSOA 3QFAC 4E8EA 1M2BA 3D0ZA 2DJ2A 4HUAA 4MPGA 4GCIA 4KGIA 3CYNA 3LSZA 3O76A 5D9VA 1WRYA 5A4VA 2HRKA 4GRFA 3N9JA 2KP2A 2AB6A 4PNFA 3HA9A 2UZ8A 1UN2A 3F4RA 1VF1A 3FK8A 4NXIA 2H1BA 4MK3A 1XXUA 4KE3A 2CZ3A 1F3AA 5ECSA 5EL8A 3CTGA 5J9CA 3ZREA 1AW9A 3G9BA 1NHYA 4TXOB 5EY6A 2FD3A 4L0UA 5F05A 3ZLPA 2P5RA 3GL5A 3VPTA 4WEYA 4J56E 2R2JA 4ID0A 2B5EA 2DJ3A 3L4NA 2V41A 1SJ6A 4XHMA 4MJBA 1JLVA 4FYBA 4JR6A 5GSSA 2B1LA 2RIIA 2R3XA 2IL3A 4LA1A 2HZEA 3EMPA 2ON5A 2XPEA 4ZILA 4MA9A 3EURA 1WWJA 4NAXA 5HQPA 3DD3A 2PGTA 2B6MA 3LEFA 4QL9A 2R5GA 1GLPA 4GWRA 2YNXA 2GT6A 1N2AA 4GSNA 3CMIA 4ZB6A 4TVEA 3TRPA 2HZFA 5GAND 2YP6A 1EP8A 3RHBA 2OA7A 5IMCA 2B3SA 2WULA 1GNWA 1Q98A 3VWUA 1RK4A 5KN3A 2DBCA 2WJUA 3Q74A 4DSSA 3L0HA 2GZYA 5E4WA 3E9JB 4ECBA 1XBSA 3TJKA 5IMVA 1TK5B 1K3LA 3ERFA 1EGRA 3R2QA 3R3EA 1GNEA 3KMNA 2C3TA 4KDXA
chains in the Genus database with same CATH superfamily
3N5OA 1FO5A 1A23A 2CA8A 5IQYA 4FO5A 2R0PA 2H6YA 4NWYA 5IO2A 1B4PA 2VL2A 4TR0A 1BQ7A 1J08A 1X9WB 3DEXA 2EIRA 3IOSA 1PRXA 5C04A 4MP4A 1GSSA 2GQLA 1K0DA 5IPGA 2K9FA 3A2XA 4EXJA 3F6DA 2PMTA 4JZQA 3HHVA 2PU9C 2UV8G 1V9WA 4KDUA 1TW9A 1EOGA 3QR6A 4X43A 5BMUA 4EO3A 1N8JA 2K6VA 2HQTA 5DALB 1LBKA 3QFBC 4I5QA 2L6DA 2VL3A 1GUHA 5G1KA 1ERUA 2YWNA 2H73A 2B7KA 2CAIA 1G6WA 4K0NA 1BAYA 2KOKA 3MNGA 2MBSA 2FA4A 1YKCA 2R6KA 5EVOA 2WB9A 1Z7RA 1T4ZA 2H0GA 4X1UA 1DE1A 4FYCA 4N0ZA 3PR8A 3TJFA 3DVWA 1RQMA 1YF0A 4JEDA 5F07A 3TOUA 1PL1A 3V1WA 2CZ2A 2HE3A 2OE3A 3TKQA 4PUFC 4ICYA 4TR1B 5DAKA 2H71A 4USSA 2R0GA 4O5UA 3ZMKA 5CREA 4MPFA 2OKAA 4HDEA 3ZZXA 4O5RA 1PKZA 3P2AA 1SKRB 3M9KA 2OE0A 4Z2RA 3A2VA 1FHEA 5ENUA 4F82A 1SL0B 4D73B 3MDKA 1YEPA 4IELA 3QD9A 5COHA 3BCKA 3FHKA 4KCEA 1O8XA 4ZL7A 2TIRA 1V2AA 1PMTA 1K0BA 5ELGA 1MD4A 1TI3A 1YVLA 3C7MA 2PN8A 1K0OA 4XCSA 1T8EB 4EDYA 2QGVA 2XBQA 4GXZA 1T3BA 3TJJA 4TW5A 3ZVJA 2VAFA 4AJ8A 1ZYQB 1B8XA 5DCGA 4NV5A 3ZL5A 2F8FA 4GQFA 3TKSE 1USBA 2GT5A 5CRDA 4WR4A 5GSTA 4Z2TA 3IAS2 4POBA 3HY2A 4ML6A 1THXA 4HU9A 1F6MC 2JSYA 1Z9HA 2FNOA 2PVOC 3ZRDA 4FIWA 3GH6A 3P90A 4OMVA 1GTAA 3D4TA 1A2MA 1SU9A 1FB6A 4HOJA 4OO4A 2DJKA 4V2MA 4ZBDA 4K7IA 2WW2A 11GSA 4MCUA 2YCDA 4IP6A 3EE2A 1GRXA 1K0NA 1Z7PA 3GH9A 2HRAA 4AKXB 3E3EA 3WGEA 3F4TA 4MF5A 3GKMA 1ERTA 2HSMB 1ZYNA 2WW0A 2LUSA 5L71A 2VCZA 4CW9A 1V40A 3BOAA 4HU7A 2HSYA 1KEBA 1FOVA 1BG5A 1XFLA 3MWHA 1E6BA 5D9WA 3KMOA 3F3RA 3DGQA 5D9XA 4RI7A 4HJ2A 4ZBAA 2XBIA 2I81A 3GX8A 1VRSD 4KAEA 4BVYB 1FAAA 4EVMA 3GKXA 6GSUA 1Y6EA 3KM6A 3HVNA 1GWCA 3BBYA 1EGOA 3UEMA 5J4YA 1OE7A 4N3ZA 5JWQB 1XCCA 3DMLA 2M72A 2AUVA 4NPBA 5ECOB 1SKWB 3PPUA 4FXYP 1A8LA 4MLYA 2LNTA 1UA5A 3DXBA 3US3A 2LJAA 1TXXA 1C72A 2K18A 1S3DA 1FW1A 2HNLA 3RAZA 1QMVA 2H1AA 2DJ0A 4MZCA 2L6CA 3VK9A 3TKPA 3ZTLA 4ZIJA 5ECNB 4MDCA 3FZ4A 4ECJA 3APQA 4TKYA 2X99A 4J57E 5D8IA 3TKRA 3RBTA 4ZL9A 2IMKA 1FG4A 1HNAA 2CV4A 1TXUA 3FMWA 1OAZA 2J23A 2IPAA 2VL2C 3A5WA 3UVHA 4ZB9A 1VGLA 3VLNA 5HR0A 3FR6A 5HFGA 4MJEA 5ABRA 1X9SB 2GSQA 1YY7A 3L9UA 1TTZA 3GKNA 2WVXA 1BYEA 3G7JA 4OCEA 3GNJA 2XC2A 1ZZYA 2YOIA 1R5AA 1AC1A 3L9VA 3U6VA 1O7UA 2EFCA 2H76A 1F2EA 1NSWA 2GZZA 4WR5A 3CSIA 2X8GA 2O36A 3FZAA 3IAM2 1OKTA 2FWFA 1G6YA 3FYGA 3RFRC 4PTSA 3UOMA 3A5IA 2V6KA 1AAZA 3UIWA 2H19A 4WBRD 2H30A 3UL3A 4RUVA 2M80A 3SWLA 2AYTA 3FR3A 4ECIA 3APOA 5G31A 3IHQA 4IHUA 1SYXA 2RLIA 1SD9A 1EP7A 1GSUA 2GVPA 4OWYA 4OO5A 4EDZA 2IN3A 1K3YA 2IMDA 2YANA 2OBIA 3F4SA 3G7YA 3FKFA 3GSSA 1PQNA 1WMJA 3Q6OA 2G2QA 3GTUB 2VCXA 2IIYA 2L4CA 2O89A 1PA3A 1MEKA 1OC9A 5KOXA 2LJRA 3F6FA 5IMAA 5KN0A 4KB3A 1Z6NA 3H4KA 2EIQA 1M0UA 3W8JA 5B8AA 5H5SA 5KN1A 4IKHA 1BG1A 4CDOA 3KD0A 3UBLA 1XWBA 2VD0A 1TU7A 2WW1A 1I1IP 2VKZG 2EFHA 2MMOA 3HVXA 3IPZA 4K7OA 2C0DA 4K7NA 4V1Ag 4PXOA 3NZNA 2PVQA 1MTCA 2LQQA 2FGXA 1GSQA 2H0IA 3GMFA 4TR1A 5B7CA 4MNNA 2YWMA 4BA7A 2X49A 3UAPA 3K8NA 1GTUA 3UVTA 1NHOA 2O3EA 1QK8A 2QSIA 2C8UA 4EE0A 4D73A 2X4AA 2RUFA 4AGSA 2GZPA 4NHZA 3DKSA 2NBSA 1SK0A 2VD1A 1URMA 1M99A 2O85A 4L0WA 2H74A 3F8UA 3DIEA 3DWVA 4NHWA 5A5KA 2JACA 1GL8A 3F0IA 5A4UA 4HJMA 3I69A 2DSAA 3TRXA 2H70A 12GSA 4PX1A 3VI5A 3BJ5A 4QMKA 2VOCA 3U5RE 2GSRA 1FVJA 3OR5A 4IGJA 1ACVA 3I6AA 16GSA 2B7JA 2MBTA 2KP1A 4I97A 9GSSA 1PX6A 4BL7B 2H72A 3KJYA 2LTKA 4MJAA 1SL2B 2EFEA 1NM3A 3LWAA 2DKIA 3RPPA 2O8VB 3P7XA 2C0EA 3KH7A 1A0FA 5JWOB 2QA2A 1XWAA 3ERWA 1F9MA 4KF9A 2RUEA 3ZIVA 1X0RA 6GSXA 3FW2A 4KSMA 3MYDA 2FCHA 2X8CA 2L5LA 2I1UA 1G0TA 3ZITA 1A24A 4JR4A 1ON4A 1SVOA 2C0GA 4QQ7A 2HFDA 2HSMA 6GSVA 2GTUA 4L5LA 4JU5A 2OBKA 1U87A 1YEXA 3HVSA 1WIKA 3EC3A 2VIMA 4HQSA 1T7PB 1K0MA 2QC7A 3WD6A 1SENA 2DIYA 3CSJA 2A2SA 2MZCA 1ABAA 4G9HA 5ELAA 5CP1A 4BWQA 1GSEA 4CHSA 1J9BA 1PD21 3EU3A 5A34B 3FY7A 2H0HA 1S3AA 2NDOA 3F3QA 1JZRA 5J3RA 1T1VA 1I9DA 2XHFA 2OE1A 3VPQA 1A8YA 2M46A 5AGYA 4N11A 3DYRA 2A2PA 3HD5A 3KP8A 2DMMA 3IA1A 3HCZA 5HFKA 3D22A 1EWXA 1JHBA 3FR9A 3EU4A 3IDVA 3ME8A 2V2GA 4FH8A 2JZRA 4MH3A 2C80A 4POKA 3FZ9A 1EEJA 4I2TA 3ZIJA 3TU3B 4AKGA 2YWIA 22GSA 3GRXA 2LSTA 5J40A 5J41A 3TDGA 1V98A 1M9BA 2NVLA 2VLVA 2EC4A 4IJ3A 3TKSA 3ME7A 2CVBA 5AN1A 1PGTA 4FYUA 2REMA 4KUNA 1F3BA 3VURA 3HYPA 1M2AA 10GSA 3QAGA 1YKAA 1X9MB 4A5PA 5HR2A 4LLRA 2O7KA 1QXHA 3KGKA 4ZL8A 4YKFA 3EVIA 5D73A 2PBJA 1TKDB 3PH9A 2ES7A 2WVZA 3I9V2 1TRWA 4YKGA 4ZB8A 2R0CA 2GDRA 4L8EA 1ERWA 2RM5A 1ZYEA 1X5CA 2IWTA 4KX4A 3HJPA 1EV4A 3GFKA 2I3YA 3VI7A 4XS4A 5IMZA 2DJ1A 4K5SA 4WKWA 2K8SA 4IBPA 3RGBC 4OD7A 4DVCA 2HZEB 4AKHA 4I2UA 1DUGA 4PHZC 2CX4A 1DE2A 4KCAA 3TCOA 3ZMLA 2QA1A 2N5FA 1CQHA 2IFQA 2YZHA 3HMJG 3M9JA 3QCPA 2TRCP 5E59A 2F9SA 5CNWA 5F8BA 4WXTA 2VM2A 3BD2A 6GSWA 2J9HA 3GIXA 4EKZA 2E7PA 3A2WA 3HZ4A 1YJ6A 1V58A 4O7HA 4IQ1A 4F2IA 4AF2A 1THOA 4YH2A 1KBNA 3LXTA 4ZBBA 3EINA 3UBKA 1BX9A 3AY8A 4LL1B 4OFTA 3MSZA 4ULXA 3QPMA 3ERGA 1Z6MA 3TJGA 1B4QA 3E0UA 5DJLA 1V57A 4EUYA 5A5HB 4IQAA 5D93A 3M3MA 3WYWA 1XWCA 2VCVA 3CWGA 2LKUA 2YPMA 3IK7A 4EL1A 1F37A 4GSSA 1OVNA 2HI7A 2IMIA 4Q5QA 2WS2A 3KP9A 1N25A 3GUSA 4GSTA 5AIXA 3WGXA 4K2XA 5BMUB 2VM1A 2VLUA 4GQCA 4RQRA 1O8WA 4PNGA 4PI2C 4MZWA 4HSCX 4TXOA 2V32A 1GSDA 2E2GA 4CY6A 1XOAA 1TK8B 2JL4A 4POMA 3FZ5A 1U3AA 18GSA 2X8HA 5CRWA 4PURA 4K2DA 3A3TA 4KDYA 3EWLA 2LNSA 1OYJA 1K0AA 3CHXC 2O5VA 5G5FA 2G0FA 2N5AA 3J7Yb 5FT3A 4TXVA 5JWRB 1R4WA 1EEMA 5ECIB 1K3OA 1TRSA 5FWGA 2P31A 2LRTA 4OFNA 2KUCA 4Z7XA 2I4AA 1XOBA 2WZSA 2PUKC 1B9XC 4G0LA 4LMWA 4V2NA 4ACSA 1XVQA 1K0CA 2A2RA 3QOUA 6GSSA 4K1FA 5INYA 1WE0A 3H1NA 4MF7A 5AIVA 2LRCA 2AJQB 2YV7A 4XIHA 4JBBA 3BCIA 5J4UA 4PI0C 1PN0A 5D96A 5KEJA 1B9YC 1ZMAA 2WZ9A 3H8QA 1SVLA 3P8WA 4K9ZA 1IYHA 1GTBA 5ECLB 2ZNMA 4BL7A 1G7EA 1M9AA 5D9TA 2MMAA 3IK9A 3TB2A 17GSA 5IM9A 3KIJA 3DVXA 4QL7A 3FRCA 2H66A 1S3CA 2VUPA 1XVWA 4BWSA 2BJXA 4MZBA 5IMFA 2E2MA 2FLSA 4G10A 4XRAA 2B5YA 2ON7A 1PSQA 3VWVA 5CRGA 2JADA 5B6MA 2H6XA 1YQ1A 5ECKB 2DJJA 1X5EA 2H1DA 2JZTA 1BEDA 4GF0A 5IPHA 3HZ8A 1LU4A 3EMXA 2CX3A 5ID2B 2GSSA 1ERVA 4XS6A 1TRVA 3GHAA 4L5OA 5DALA 2A4VA 3HKRA 5C00A 1SL1B 5CRHA 3IXRA 1KTEA 3WT1A 3G7IA 5A34A 1MDJA 3TUEA 1VF3A 1DSBA 2P0GA 1PFOA 2GQKA 2MMZA 2DMLA 4F0BA 4I6XA 1HYUA 1GTIA 5FHIA 1MDKA 4RQXA 2NPBA 4Q5FA 4NMUA 4G0IA 3GV1A 1R26A 1GSFA 4YQVA 8GSSA 1XW9A 3HDCA 4O5QA 5DDLA 2YJ7A 3FEUA 4AKIA 2L5OA 2IMFA 2OADA 5G2ZA 5F0GA 1LJRA 3HXSA 5ECHB 1AQXA 5LCZA 2KHPA 3HJMA 2CVDA 5CYYA 1WPIA 1B48A 1J0FA 4BVXB 1SJIA 4YQMA 1R5PA 5IO0A 3IE3A 2DIZA 1EOHA 3O3TA 4I8BA 2VO4A 1ILOA 2HRNA 4CY8A 2L4QA 1I5GA 3D6IA 4N10A 14GSA 5JCWA 4EF0A 4KNDA 3ZFBA 2CAQA 1ST9A 1TK0B 1JZOA 2VCQA 3IC4A 3CRUA 1AQVA 3CRTA 2FHEA 1XIYA 1Y25A 5G30A 1S4BP 5DCHA 3PGTA 3Q19A 20GSA 2GSTA 2L59A 3LQ7A 2GLRA 4G01A 1TOFA 2PWJA 3H79A 2Z9SA 4XTSA 2VCTA 4YAVA 1U88A 4W66A 2LJKA 5CO3A 5G1LA 2LS5A 1QQ2A 4KH7A 2DLXA 1SKSB 19GSA 4TRXA 2C4JA 3GURA 3IC8A 4OFMA 3QDNA 13GSA 4AI6A 2WVXB 1XWKA 2V1MA 1GLQA 2FUG2 3RHCA 1E2YA 2WCIA 1W4VA 3KCMA 1VF2A 1O6JA 1XW6A 2TRXA 4P3YB 3D4MA 1UVZA 2HLSA 1A2LA 2OJLA 4BIKA 3NIVA 3KH9A 4ECCA 5A5HA 1XG8A 1AQWA 5IOXA 1SVMA 4E68A 5EPFA 4G2EA 5BRTA 5LD0A 4PGTA 2I9HA 1PL2A 1JZWA 1OE8A 4O92A 3KZQA 1FVKA 1HNBA 3W8SA 4TR4A 1X5DA 6GSYA 2LRNA 4PQ1A 5JCUA 2LEGA 4KW6A 1IYIA 4BVYA 2WVYA 3LG6A 3EYTA 5H5RA 5DQSA 4EIQA 2F51A 5JCGA 1OC9B 2FY6A 4YAPA 5GAPD 3HJOA 2HSNB 4TR3A 2DKHA 2E0QA 2HRKB 3QMXA 1XWGA 5J4VA 1JFUA 1H4OA 1SK2A 3ZVJD 2QKEA 4IN0A 1M2DA 3ZFLA 4MF6A 4X0XA 2IJYA 2WW3A 1TP9A 1WOUA 5A4WA 2F8AA 3VWWA 1O85A 1FB0A 1A0RP 2FWGA 2O87A 5J9BA 2LV3A 1SD8A 3GKKA 3ZYWA 2ZUPA 2HSHA 3IR4A 4J2FA 3IV4A 3L78A 5F06A 1ZGNA 1WJKA 4JE1A 4IVFA 3M0FA 5ECQB 2JSZA 2CVKA 5DJMA 4MABA 4Q5NA 2H01A 2V6OA 1O73A 5G5EA 2YJHA 2C3QA 3KTBA 3LFLA 3CXGA 3UMAA 4JRRA 1KNGA 4K6XA 1ZYPA 3KEBA 5KN2A 2JU5A 4HS1A 3VWXA 3D21A 2L57A 2C1YA 1NW2A 5H5QA 1SK1A 4GDFA 2YN1A 3GYKA 1TJDA 4PQIA 3GX0A 1JLWA 2H8LA 3RDWA 4HEA2 2XPDA 1G7OA 1XW5A 4HI7A 3ED3A 3KTLA 2JZSA 4YQUA 4LMVA 3UARA 5HR1A 1GH2A 2VLTA 4POLA 3TGZA 2WGRA 3W6GA 4EIPA 1AUCA 4HQZA 5HFIA 1Z3EA 3LYKA 2AV4A 1GSYA 2P5QA 1UC7A 5A1NB 5J5NA 1HD2A 4ZB7A 4WF5A 4DSSB 2VCWA 3TOTA 1U6TA 3L9SA 3C1SA 2GQMA 4ML1A 5B8BA 4N0VA 2HYXA 1OC3A 1XPVA 3C71A 4ILFA 3EPTA 4AJ7A 5LNKe 1PN9A 3PINA 3ISOA 2H1GA 2YWOA 4GLTA 2LQOA 4MH2A 1GUKA 1W89A 4GTUA 4G0KA 1JZDA 5ID2A 2EIOA 4ISDA 4TN8A 3GTUA 2CQ9A 2PERA 2BMXA 1GP1A 1MD3A 3HVVA 1S3RA 1TU8A 2NTOA 4XS1A 1AXDA 2VL9A 1ZL9A 3LYPA 1QGVA 2AAWA 4RI6A 2R4VA 4K0GA 2HT9A 3GA4A 4NV2A 2MYGA 3J7Yk 4Q5RA 4V2LA 5B6NA 1U3IA 3C1RA 3SBCA 2FA8A 2ALBA 4OCFA 4DSQA 4K8MA 3GL3A 2B1KA 2KLXA 2X64A 4DSRA 3VFIA 2MMNA 1RW1A 2B5XA 2DC5A 2EFDA 3MIXA 1T00A 3F63A 1A2JA 3NOFA 5ECRB 1DBYA 5KOWA 4WBJA 4F9ZA 1ZCPA 4WETA 3QAWA 3KXOA 2K8VA 5IIZA 4BVXA 1TDIA 4KA0A 4PUAA 1YEWC 7GSSA 2GS3A 3WGDA 4IW9A 1SJZA 1ML6A 1QUWA 4DEJA 1TI1A 4H86A 2WFCA 2PPTA 1TRUA 2R37A 4V1Ap 1GULA 2FWEA 5CAXA 3Q18A 4G19A 4HZ4A 5AISA 4ZXGA 1EV9A 2YZUA 3DRNA 5DAKB 2H75A 4O32A 3GN3A 3WT2A 5ECPB 3H93A 5HR3A 5DQYA 4EC0A 1T4YA 3CTFA 4AJ6A 4IS0A 3O6TA 1GUMA 4IJIA 4WF4A 2D2ZA 5IOWA 1Z5YE 4MJCA 3CBUA 2HXKA 3S9FA 1H75A 2HRFA 3UJ1A 1BJXA 6GSTA 3LXZA 2OACA 2AHEA 2WDUA 2FWHA 4Z2UA 2WRTA 1YZXA 4XS4B 1CQGA 1OC8A 1VF4A 1PX7A 1M7TA 2H6ZA 3RPNA 5GZZB 1PKWA 3I43A 4XRDA 2IMEA 1EZKA 2F3MA 5ECMB 2YV9A 4FQUA 1M3JA 4PQHA 3CSHA 4MMMA 4F0CA 2N5BA 3TRQA 3F9UA 1MDIA 1R7HA 3TJBA 3MAKA 2GGTA 4TOPA 2IFQB 3QAVA 4LL4B 5DVBA 4N30A 1AIUA 3C73A 3LGCA 5DBQA 3C8EA 3LORA 2C0FA 3D5JA 1YDKA 3M1GA 1OKDA 3IBHA 1ZOFA 1WP0A 4IP1A 4BPYA 3GSTA 3M8NA 1O81A 4X4JA 4E8HA 2ZCTA 1HNCA 1XZOA 3LJRA 2A4HA 1YF1A 3IRAA 1Q4JA 5IMDA 4HZ2A 3TKSC 1QFNA 2CT6A 3JCML 1SYRA 2RM6A 2C3NA 3APSA 2H1LA 2BTOT 1HQOA 3LW9A 4F03A 4KSOA 3QFAC 4E8EA 1M2BA 3D0ZA 2DJ2A 4HUAA 4MPGA 4GCIA 4KGIA 3CYNA 3LSZA 2HSNA 3O76A 5D9VA 1WRYA 5A4VA 2HRKA 4GRFA 3N9JA 2KP2A 2AB6A 4K5RA 4PNFA 3HA9A 2UZ8A 1UN2A 3CQFA 1VF1A 3F4RA 3FK8A 4NXIA 2H1BA 4MK3A 1XXUA 4KE3A 2CZ3A 1F3AA 5ECSA 5EL8A 3CTGA 5J9CA 1BF5A 3ZREA 1AW9A 3G9BA 1NHYA 4TXOB 5EY6A 2FD3A 4L0UA 5F05A 3ZLPA 1FOHA 2P5RA 3GL5A 3VPTA 4WEYA 4J56E 2R2JA 1Y1UA 4ID0A 2B5EA 2DJ3A 3L4NA 2V41A 1SJ6A 4XHMA 4MJBA 1JLVA 4FYBA 4JR6A 5GSSA 2B1LA 2RIIA 2R3XA 2IL3A 4LA1A 2HZEA 3EMPA 2ON5A 2XPEA 4ZILA 4MA9A 3EURA 1WWJA 4NAXA 5HQPA 3DD3A 2PGTA 2B6MA 3LEFA 4QL9A 2R5GA 1GLPA 4GWRA 2YNXA 2GT6A 1N2AA 4GSNA 3CMIA 4ZB6A 4TVEA 3TRPA 2HZFA 3IHGA 2YP6A 5GAND 1EP8A 5A1NA 3RHBA 2OA7A 5IMCA 2B3SA 2WULA 1GNWA 1Q98A 3VWUA 1RK4A 5KN3A 2DBCA 2WJUA 3Q74A 4DSSA 3L0HA 2GZYA 5E4WA 5J47A 3E9JB 4ECBA 2OT3A 1XBSA 1M3IA 3TJKA 5IMVA 1TK5B 1K3LA 3ERFA 1EGRA 3R2QA 3R3EA 1GNEA 3KMNA 2C3TA 4KDXA
chains in the Genus database with same CATH topology
3N5OA 1FO5A 1A23A 2CA8A 5IQYA 4FO5A 2R0PA 2H6YA 4NWYA 5IO2A 1B4PA 2VL2A 4TR0A 1BQ7A 1J08A 1X9WB 3DEXA 2EIRA 3IOSA 1PRXA 5C04A 4MP4A 1GSSA 2GQLA 1K0DA 5IPGA 2K9FA 3A2XA 4EXJA 3F6DA 2PMTA 4JZQA 3HHVA 2PU9C 2UV8G 1V9WA 4KDUA 1TW9A 1EOGA 3QR6A 4X43A 5BMUA 4EO3A 1N8JA 2K6VA 2HQTA 5DALB 1LBKA 3QFBC 4I5QA 2L6DA 2VL3A 1GUHA 5G1KA 1ERUA 2YWNA 2H73A 2B7KA 2CAIA 1G6WA 4K0NA 1BAYA 2KOKA 3MNGA 2MBSA 2FA4A 1YKCA 2R6KA 5EVOA 2WB9A 1Z7RA 1T4ZA 2H0GA 4X1UA 1DE1A 4FYCA 4N0ZA 3PR8A 3TJFA 3DVWA 1RQMA 1YF0A 4JEDA 5F07A 3TOUA 1PL1A 3V1WA 2CZ2A 2HE3A 2OE3A 3TKQA 4PUFC 4ICYA 4TR1B 5DAKA 2H71A 4USSA 2R0GA 4O5UA 3ZMKA 5CREA 4MPFA 2OKAA 4HDEA 3ZZXA 4O5RA 1PKZA 3P2AA 1SKRB 3M9KA 2OE0A 4Z2RA 3A2VA 1FHEA 5ENUA 4F82A 1SL0B 4D73B 3MDKA 1YEPA 4IELA 3QD9A 5COHA 3BCKA 3FHKA 4KCEA 1O8XA 4ZL7A 2TIRA 1V2AA 1PMTA 1K0BA 5ELGA 1MD4A 1TI3A 1YVLA 3C7MA 2PN8A 1K0OA 4XCSA 1T8EB 4EDYA 2QGVA 2XBQA 4GXZA 1T3BA 3TJJA 4TW5A 3ZVJA 2VAFA 4AJ8A 1ZYQB 1B8XA 5DCGA 4NV5A 3ZL5A 2F8FA 4GQFA 3TKSE 1USBA 2GT5A 5CRDA 4WR4A 5GSTA 4Z2TA 3IAS2 4POBA 3HY2A 4ML6A 1THXA 4HU9A 1F6MC 2JSYA 1Z9HA 2FNOA 2PVOC 3ZRDA 4FIWA 3GH6A 3P90A 4OMVA 1GTAA 3D4TA 1A2MA 1SU9A 1FB6A 4HOJA 4OO4A 2DJKA 4V2MA 4ZBDA 4K7IA 11GSA 4MCUA 2YCDA 4IP6A 3EE2A 1GRXA 1K0NA 1Z7PA 3GH9A 2HRAA 4AKXB 3E3EA 3WGEA 3F4TA 4MF5A 3GKMA 1ERTA 2HSMB 1ZYNA 2LUSA 5L71A 2VCZA 4CW9A 1V40A 3BOAA 4HU7A 2HSYA 1KEBA 1FOVA 1BG5A 1XFLA 3MWHA 1E6BA 5D9WA 3KMOA 3F3RA 3DGQA 5D9XA 4RI7A 4HJ2A 4ZBAA 2XBIA 2I81A 3GX8A 1VRSD 4KAEA 4BVYB 1FAAA 4EVMA 3GKXA 6GSUA 1Y6EA 3KM6A 1GWCA 3BBYA 1EGOA 3UEMA 5J4YA 1OE7A 4N3ZA 5JWQB 1XCCA 3DMLA 2M72A 2AUVA 4NPBA 5ECOB 1SKWB 3PPUA 1A8LA 4MLYA 2LNTA 1UA5A 3DXBA 3US3A 2LJAA 1TXXA 1C72A 2K18A 1S3DA 1FW1A 2HNLA 3RAZA 1QMVA 2H1AA 2DJ0A 4MZCA 2L6CA 3VK9A 3TKPA 3ZTLA 4ZIJA 5ECNB 4MDCA 3FZ4A 4ECJA 3APQA 4TKYA 2X99A 4J57E 5D8IA 3TKRA 3RBTA 4ZL9A 2IMKA 1FG4A 1HNAA 2CV4A 1TXUA 3FMWA 1OAZA 2J23A 2IPAA 2VL2C 3A5WA 3UVHA 4ZB9A 1VGLA 3VLNA 5HR0A 3FR6A 5HFGA 4MJEA 5ABRA 1X9SB 2GSQA 1YY7A 3L9UA 1TTZA 3GKNA 1BYEA 3G7JA 4OCEA 3GNJA 2XC2A 1ZZYA 2YOIA 1R5AA 1AC1A 3L9VA 3U6VA 1O7UA 2EFCA 2H76A 1F2EA 1NSWA 2GZZA 4WR5A 3CSIA 2X8GA 3FZAA 3IAM2 1OKTA 2FWFA 1G6YA 3FYGA 4PTSA 3UOMA 3A5IA 2V6KA 1AAZA 3UIWA 2H19A 4WBRD 2H30A 3UL3A 4RUVA 2M80A 3SWLA 2AYTA 3FR3A 4ECIA 3APOA 5G31A 3IHQA 4IHUA 1SYXA 2RLIA 1SD9A 1EP7A 1GSUA 2GVPA 4OWYA 4OO5A 4EDZA 2IN3A 1K3YA 2IMDA 2YANA 2OBIA 3F4SA 3G7YA 3FKFA 3GSSA 1PQNA 1WMJA 3Q6OA 2G2QA 3GTUB 2VCXA 2IIYA 2L4CA 2O89A 1PA3A 1MEKA 1OC9A 5KOXA 2LJRA 3F6FA 5IMAA 5KN0A 4KB3A 1Z6NA 3H4KA 2EIQA 1M0UA 3W8JA 5B8AA 5H5SA 5KN1A 4IKHA 1BG1A 4CDOA 3KD0A 3UBLA 1XWBA 2VD0A 1TU7A 2VKZG 2EFHA 2MMOA 3HVXA 3IPZA 4K7OA 2C0DA 4K7NA 4V1Ag 4PXOA 3NZNA 2PVQA 1MTCA 2LQQA 2FGXA 1GSQA 2H0IA 3GMFA 4TR1A 5B7CA 4MNNA 2YWMA 4BA7A 2X49A 3UAPA 3K8NA 1GTUA 3UVTA 1NHOA 1QK8A 2QSIA 2C8UA 4EE0A 4D73A 2X4AA 2RUFA 4AGSA 2GZPA 4NHZA 3DKSA 2NBSA 1SK0A 2VD1A 1URMA 1M99A 2O85A 4L0WA 2H74A 3F8UA 3DIEA 3DWVA 4NHWA 5A5KA 2JACA 1GL8A 3F0IA 5A4UA 4HJMA 3I69A 2DSAA 3TRXA 2H70A 12GSA 4PX1A 3VI5A 3BJ5A 4QMKA 2VOCA 3U5RE 2GSRA 1FVJA 3OR5A 4IGJA 1ACVA 3I6AA 16GSA 2B7JA 2MBTA 2KP1A 4I97A 9GSSA 1PX6A 4BL7B 2H72A 3KJYA 2LTKA 4MJAA 1SL2B 2EFEA 1NM3A 3LWAA 2DKIA 3RPPA 2O8VB 3P7XA 2C0EA 3KH7A 1A0FA 5JWOB 2QA2A 1XWAA 3ERWA 1F9MA 4KF9A 2RUEA 3ZIVA 1X0RA 6GSXA 3FW2A 4KSMA 3MYDA 2FCHA 2X8CA 2L5LA 2I1UA 1G0TA 3ZITA 1A24A 4JR4A 1ON4A 1SVOA 2C0GA 4QQ7A 2HFDA 2HSMA 6GSVA 2GTUA 4L5LA 4JU5A 2OBKA 1U87A 1YEXA 3HVSA 1WIKA 3EC3A 2VIMA 4HQSA 1T7PB 1K0MA 2QC7A 3WD6A 1SENA 2DIYA 3CSJA 2A2SA 2MZCA 1ABAA 4G9HA 5ELAA 5CP1A 4BWQA 1GSEA 4CHSA 1J9BA 1PD21 3EU3A 5A34B 3FY7A 2H0HA 1S3AA 2NDOA 3F3QA 1JZRA 5J3RA 1T1VA 1I9DA 2XHFA 2OE1A 3VPQA 1A8YA 2M46A 5AGYA 4N11A 3DYRA 2A2PA 3HD5A 3KP8A 2DMMA 3IA1A 3HCZA 5HFKA 3D22A 1EWXA 1JHBA 3FR9A 3EU4A 3IDVA 3ME8A 2V2GA 4FH8A 2JZRA 4MH3A 2C80A 4POKA 3FZ9A 1EEJA 4I2TA 3ZIJA 3TU3B 4AKGA 2YWIA 22GSA 3GRXA 2LSTA 5J40A 5J41A 3TDGA 1V98A 1M9BA 2NVLA 2VLVA 2EC4A 4IJ3A 3TKSA 3ME7A 2CVBA 5AN1A 1PGTA 4FYUA 2REMA 4KUNA 1F3BA 3VURA 3HYPA 1M2AA 10GSA 3QAGA 1YKAA 1X9MB 4A5PA 5HR2A 4LLRA 2O7KA 1QXHA 3KGKA 4ZL8A 4YKFA 3EVIA 5D73A 2PBJA 1TKDB 3PH9A 2ES7A 3I9V2 1TRWA 4YKGA 4ZB8A 2R0CA 2GDRA 4L8EA 1ERWA 2RM5A 1ZYEA 1X5CA 2IWTA 4KX4A 3HJPA 1EV4A 3GFKA 2I3YA 3VI7A 4XS4A 5IMZA 2DJ1A 4K5SA 4WKWA 2K8SA 4IBPA 4OD7A 4DVCA 2HZEB 4AKHA 4I2UA 1DUGA 2CX4A 1DE2A 4KCAA 3TCOA 3ZMLA 2QA1A 2N5FA 1CQHA 2IFQA 2YZHA 3HMJG 3M9JA 3QCPA 2TRCP 5E59A 2F9SA 5CNWA 5F8BA 4WXTA 2VM2A 3BD2A 6GSWA 2J9HA 3GIXA 4EKZA 2E7PA 3A2WA 3HZ4A 1YJ6A 1V58A 4O7HA 4IQ1A 4F2IA 4AF2A 1THOA 4YH2A 1KBNA 3LXTA 4ZBBA 3EINA 3UBKA 1BX9A 3AY8A 4LL1B 4OFTA 3MSZA 4ULXA 3QPMA 3ERGA 1Z6MA 3TJGA 1B4QA 3E0UA 5DJLA 1V57A 4EUYA 5A5HB 4IQAA 5D93A 3M3MA 3WYWA 1XWCA 2VCVA 3CWGA 2LKUA 2YPMA 3IK7A 4EL1A 1F37A 4GSSA 1OVNA 2HI7A 2IMIA 4Q5QA 2WS2A 3KP9A 1N25A 3GUSA 4GSTA 5AIXA 3WGXA 4K2XA 5BMUB 2VM1A 2VLUA 4GQCA 4RQRA 1O8WA 4PNGA 4MZWA 4TXOA 2V32A 1GSDA 2E2GA 4CY6A 1XOAA 1TK8B 2JL4A 4POMA 3FZ5A 1U3AA 18GSA 2X8HA 5CRWA 4PURA 4K2DA 3A3TA 4KDYA 3EWLA 2LNSA 1OYJA 1K0AA 2O5VA 5G5FA 2G0FA 2N5AA 3J7Yb 5FT3A 4TXVA 5JWRB 1R4WA 1EEMA 5ECIB 1K3OA 1TRSA 5FWGA 2P31A 2LRTA 4OFNA 2KUCA 4Z7XA 2I4AA 1XOBA 2PUKC 1B9XC 4G0LA 4LMWA 4V2NA 4ACSA 1XVQA 1K0CA 2A2RA 3QOUA 6GSSA 4K1FA 5INYA 1WE0A 3H1NA 4MF7A 5AIVA 2LRCA 2AJQB 2YV7A 4XIHA 4JBBA 3BCIA 5J4UA 1PN0A 5D96A 5KEJA 1B9YC 1ZMAA 2WZ9A 3H8QA 1SVLA 3P8WA 4K9ZA 1IYHA 1GTBA 5ECLB 2ZNMA 4BL7A 1G7EA 1M9AA 5D9TA 2MMAA 3IK9A 3TB2A 17GSA 5IM9A 3KIJA 3DVXA 4QL7A 3FRCA 2H66A 1S3CA 2VUPA 1XVWA 4BWSA 2BJXA 4MZBA 5IMFA 2E2MA 2FLSA 4G10A 4XRAA 2B5YA 2ON7A 1PSQA 3VWVA 5CRGA 2JADA 5B6MA 2H6XA 1YQ1A 5ECKB 2DJJA 1X5EA 2H1DA 2JZTA 1BEDA 4GF0A 5IPHA 3HZ8A 1LU4A 3EMXA 2CX3A 5ID2B 2GSSA 1ERVA 4XS6A 1TRVA 3GHAA 4L5OA 5DALA 2A4VA 3HKRA 5C00A 1SL1B 5CRHA 3IXRA 1KTEA 3WT1A 3G7IA 5A34A 1MDJA 3TUEA 1VF3A 1DSBA 2P0GA 2GQKA 2MMZA 2DMLA 4F0BA 4I6XA 1HYUA 1GTIA 5FHIA 1MDKA 4RQXA 2NPBA 4Q5FA 4NMUA 4G0IA 3GV1A 1R26A 1GSFA 4YQVA 8GSSA 1XW9A 3HDCA 4O5QA 5DDLA 2YJ7A 3FEUA 4AKIA 2L5OA 2IMFA 2OADA 5G2ZA 5F0GA 1LJRA 3HXSA 5ECHB 1AQXA 5LCZA 2KHPA 3HJMA 2CVDA 5CYYA 1WPIA 1B48A 1J0FA 4BVXB 1SJIA 4YQMA 1R5PA 5IO0A 3IE3A 2DIZA 1EOHA 3O3TA 4I8BA 2VO4A 1ILOA 2HRNA 4CY8A 2L4QA 1I5GA 3D6IA 4N10A 14GSA 5JCWA 4EF0A 4KNDA 3ZFBA 2CAQA 1ST9A 1TK0B 1JZOA 2VCQA 3IC4A 3CRUA 1AQVA 3CRTA 2FHEA 1XIYA 1Y25A 5G30A 5DCHA 3PGTA 3Q19A 20GSA 2GSTA 2L59A 3LQ7A 2GLRA 4G01A 1TOFA 2PWJA 3H79A 2Z9SA 4XTSA 2VCTA 4YAVA 1U88A 4W66A 2LJKA 5CO3A 5G1LA 2LS5A 1QQ2A 4KH7A 2DLXA 1SKSB 19GSA 4TRXA 2C4JA 3GURA 3IC8A 4OFMA 3QDNA 13GSA 4AI6A 1XWKA 2V1MA 1GLQA 2FUG2 3RHCA 1E2YA 2WCIA 1W4VA 3KCMA 1VF2A 1O6JA 1XW6A 2TRXA 4P3YB 3D4MA 1UVZA 2HLSA 1A2LA 2OJLA 3NIVA 3KH9A 4ECCA 5A5HA 1AQWA 5IOXA 1SVMA 4E68A 5EPFA 4G2EA 5BRTA 5LD0A 4PGTA 2I9HA 1PL2A 1JZWA 1OE8A 4O92A 3KZQA 1FVKA 1HNBA 3W8SA 4TR4A 1X5DA 6GSYA 2LRNA 4PQ1A 5JCUA 2LEGA 4KW6A 1IYIA 4BVYA 3LG6A 3EYTA 5H5RA 5DQSA 4EIQA 2F51A 5JCGA 1OC9B 2FY6A 4YAPA 5GAPD 3HJOA 2HSNB 4TR3A 2DKHA 2E0QA 2HRKB 3QMXA 1XWGA 5J4VA 1JFUA 1H4OA 1SK2A 3ZVJD 2QKEA 4IN0A 1M2DA 3ZFLA 4MF6A 4X0XA 2IJYA 1TP9A 1WOUA 5A4WA 2F8AA 3VWWA 1O85A 1FB0A 1A0RP 2FWGA 2O87A 5J9BA 2LV3A 1SD8A 3GKKA 3ZYWA 2ZUPA 2HSHA 3IR4A 4J2FA 3IV4A 3L78A 5F06A 1ZGNA 1WJKA 4JE1A 4IVFA 3M0FA 5ECQB 2JSZA 2CVKA 5DJMA 4MABA 4Q5NA 2H01A 2V6OA 1O73A 5G5EA 2YJHA 2C3QA 3KTBA 3LFLA 3CXGA 3UMAA 4JRRA 1KNGA 4K6XA 1ZYPA 3KEBA 5KN2A 2JU5A 4HS1A 3VWXA 3D21A 2L57A 2C1YA 1NW2A 5H5QA 1SK1A 4GDFA 2YN1A 3GYKA 1TJDA 4PQIA 3GX0A 1JLWA 2H8LA 3RDWA 4HEA2 2XPDA 1G7OA 1XW5A 4HI7A 3ED3A 3KTLA 2JZSA 4YQUA 4LMVA 3UARA 5HR1A 1GH2A 2VLTA 4POLA 3TGZA 2WGRA 3W6GA 4EIPA 1AUCA 4HQZA 5HFIA 1Z3EA 3LYKA 2AV4A 1GSYA 2P5QA 1UC7A 5A1NB 5J5NA 1HD2A 4ZB7A 4WF5A 4DSSB 2VCWA 3TOTA 1U6TA 3L9SA 3C1SA 2GQMA 4ML1A 5B8BA 4N0VA 2HYXA 1OC3A 1XPVA 3C71A 4ILFA 3EPTA 4AJ7A 5LNKe 1PN9A 3PINA 3ISOA 2H1GA 2YWOA 4GLTA 2LQOA 4MH2A 1GUKA 1W89A 4GTUA 4G0KA 1JZDA 5ID2A 2EIOA 4ISDA 4TN8A 3GTUA 2CQ9A 2PERA 2BMXA 1GP1A 1MD3A 3HVVA 1TU8A 2NTOA 4XS1A 1AXDA 2VL9A 1ZL9A 3LYPA 1QGVA 2AAWA 4RI6A 2R4VA 4K0GA 2HT9A 3GA4A 4NV2A 2MYGA 3J7Yk 4Q5RA 4V2LA 5B6NA 1U3IA 3C1RA 3SBCA 2FA8A 2ALBA 4OCFA 4DSQA 4K8MA 3GL3A 2B1KA 2KLXA 2X64A 4DSRA 3VFIA 2MMNA 1RW1A 2B5XA 2DC5A 2EFDA 3MIXA 1T00A 3F63A 1A2JA 3NOFA 5ECRB 1DBYA 5KOWA 4WBJA 4F9ZA 1ZCPA 4WETA 3QAWA 3KXOA 2K8VA 5IIZA 4BVXA 1TDIA 4KA0A 4PUAA 7GSSA 2GS3A 3WGDA 4IW9A 1SJZA 1ML6A 1QUWA 4DEJA 1TI1A 4H86A 2WFCA 2PPTA 1TRUA 2R37A 4V1Ap 1GULA 2FWEA 5CAXA 3Q18A 4G19A 4HZ4A 5AISA 4ZXGA 1EV9A 2YZUA 3DRNA 5DAKB 2H75A 4O32A 3GN3A 3WT2A 5ECPB 3H93A 5HR3A 5DQYA 4EC0A 1T4YA 3CTFA 4AJ6A 4IS0A 3O6TA 1GUMA 4IJIA 4WF4A 2D2ZA 5IOWA 1Z5YE 4MJCA 3CBUA 2HXKA 3S9FA 1H75A 2HRFA 3UJ1A 1BJXA 6GSTA 3LXZA 2OACA 2AHEA 2WDUA 2FWHA 4Z2UA 2WRTA 1YZXA 4XS4B 1CQGA 1OC8A 1VF4A 1PX7A 1M7TA 2H6ZA 3RPNA 5GZZB 1PKWA 3I43A 4XRDA 2IMEA 1EZKA 2F3MA 5ECMB 2YV9A 4FQUA 4PQHA 3CSHA 4MMMA 4F0CA 2N5BA 3TRQA 3F9UA 1MDIA 1R7HA 3TJBA 3MAKA 2GGTA 4TOPA 2IFQB 3QAVA 4LL4B 5DVBA 4N30A 1AIUA 3C73A 3LGCA 5DBQA 3C8EA 3LORA 2C0FA 3D5JA 1YDKA 3M1GA 1OKDA 3IBHA 1ZOFA 1WP0A 4IP1A 4BPYA 3GSTA 3M8NA 1O81A 4X4JA 4E8HA 2ZCTA 1HNCA 1XZOA 3LJRA 2A4HA 1YF1A 3IRAA 1Q4JA 5IMDA 4HZ2A 3TKSC 1QFNA 2CT6A 3JCML 1SYRA 2RM6A 2C3NA 3APSA 2H1LA 2BTOT 1HQOA 3LW9A 4F03A 4KSOA 3QFAC 4E8EA 1M2BA 3D0ZA 2DJ2A 4HUAA 4MPGA 4GCIA 4KGIA 3CYNA 3LSZA 2HSNA 3O76A 5D9VA 1WRYA 5A4VA 2HRKA 4GRFA 3N9JA 2KP2A 2AB6A 4K5RA 4PNFA 3HA9A 2UZ8A 1UN2A 3F4RA 1VF1A 3FK8A 4NXIA 2H1BA 4MK3A 1XXUA 4KE3A 2CZ3A 1F3AA 5ECSA 5EL8A 3CTGA 5J9CA 1BF5A 3ZREA 1AW9A 3G9BA 1NHYA 4TXOB 5EY6A 2FD3A 4L0UA 5F05A 3ZLPA 1FOHA 2P5RA 3GL5A 3VPTA 4WEYA 4J56E 2R2JA 1Y1UA 4ID0A 2B5EA 2DJ3A 3L4NA 2V41A 1SJ6A 4XHMA 4MJBA 1JLVA 4FYBA 4JR6A 5GSSA 2B1LA 2RIIA 2R3XA 2IL3A 4LA1A 2HZEA 3EMPA 2ON5A 2XPEA 4ZILA 4MA9A 3EURA 1WWJA 4NAXA 5HQPA 3DD3A 2PGTA 2B6MA 3LEFA 4QL9A 2R5GA 1GLPA 4GWRA 2YNXA 2GT6A 1N2AA 4GSNA 3CMIA 4ZB6A 4TVEA 3TRPA 2HZFA 3IHGA 2YP6A 5GAND 1EP8A 5A1NA 3RHBA 2OA7A 5IMCA 2B3SA 2WULA 1GNWA 1Q98A 3VWUA 1RK4A 5KN3A 2DBCA 2WJUA 3Q74A 4DSSA 3L0HA 2GZYA 5E4WA 5J47A 3E9JB 4ECBA 2OT3A 1XBSA 3TJKA 5IMVA 1TK5B 1K3LA 3ERFA 1EGRA 3R2QA 3R3EA 1GNEA 3KMNA 2C3TA 4KDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5O A;  1FO5 A;  1A23 A;  2CA8 A;  5IQY A;  4FO5 A;  2H6Y A;  4NWY A;  5IO2 A;  1B4P A;  2VL2 A;  4TR0 A;  1BQ7 A;  1J08 A;  1X9W B;  3DEX A;  2EIR A;  3IOS A;  1PRX A;  5C04 A;  4MP4 A;  1GSS A;  2GQL A;  1K0D A;  5IPG A;  2K9F A;  3A2X A;  4EXJ A;  3F6D A;  2PMT A;  4JZQ A;  3HHV A;  2PU9 C;  1V9W A;  4KDU A;  1TW9 A;  1EOG A;  3QR6 A;  4X43 A;  5BMU A;  4EO3 A;  1N8J A;  2K6V A;  2HQT A;  5DAL B;  1LBK A;  3QFB C;  4I5Q A;  2L6D A;  2VL3 A;  1GUH A;  5G1K A;  1ERU A;  2YWN A;  2H73 A;  2B7K A;  2CAI A;  1G6W A;  4K0N A;  1BAY A;  2KOK A;  3MNG A;  2MBS A;  2FA4 A;  1YKC A;  2R6K A;  5EVO A;  2WB9 A;  1Z7R A;  1T4Z A;  2H0G A;  4X1U A;  1DE1 A;  4FYC A;  4N0Z A;  3PR8 A;  3TJF A;  3DVW A;  1RQM A;  1YF0 A;  4JED A;  5F07 A;  3TOU A;  1PL1 A;  3V1W A;  2CZ2 A;  2HE3 A;  2OE3 A;  3TKQ A;  4PUF C;  4TR1 B;  5DAK A;  2H71 A;  4USS A;  3ZMK A;  5CRE A;  4MPF A;  2OKA A;  4HDE A;  3ZZX A;  4O5R A;  1PKZ A;  3P2A A;  1SKR B;  3M9K A;  2OE0 A;  3A2V A;  1FHE A;  5ENU A;  4F82 A;  1SL0 B;  4D73 B;  3MDK A;  1YEP A;  4IEL A;  3QD9 A;  5COH A;  3BCK A;  3FHK A;  4KCE A;  1O8X A;  4ZL7 A;  2TIR A;  1V2A A;  1PMT A;  1K0B A;  5ELG A;  1MD4 A;  1TI3 A;  3C7M A;  2PN8 A;  1K0O A;  4XCS A;  1T8E B;  4EDY A;  2QGV A;  2XBQ A;  4GXZ A;  1T3B A;  3TJJ A;  4TW5 A;  3ZVJ A;  2VAF A;  4AJ8 A;  1ZYQ B;  1B8X A;  5DCG A;  4NV5 A;  3ZL5 A;  2F8F A;  4GQF A;  3TKS E;  1USB A;  2GT5 A;  5CRD A;  4WR4 A;  5GST A;  3IAS 2;  4POB A;  3HY2 A;  4ML6 A;  1THX A;  4HU9 A;  1F6M C;  2JSY A;  1Z9H A;  2FNO A;  2PVO C;  3ZRD A;  4FIW A;  3GH6 A;  3P90 A;  4OMV A;  1GTA A;  3D4T A;  1A2M A;  1SU9 A;  1FB6 A;  4HOJ A;  4OO4 A;  2DJK A;  4V2M A;  4ZBD A;  4K7I A;  11GS A;  4MCU A;  2YCD A;  4IP6 A;  3EE2 A;  1GRX A;  1K0N A;  1Z7P A;  3GH9 A;  2HRA A;  3E3E A;  3WGE A;  3F4T A;  4MF5 A;  3GKM A;  1ERT A;  2HSM B;  2LUS A;  5L71 A;  2VCZ A;  4CW9 A;  1V40 A;  3BOA A;  4HU7 A;  2HSY A;  1KEB A;  1FOV A;  1BG5 A;  1XFL A;  3MWH A;  1E6B A;  5D9W A;  3KMO A;  3F3R A;  3DGQ A;  5D9X A;  4RI7 A;  4HJ2 A;  4ZBA A;  2XBI A;  2I81 A;  3GX8 A;  1VRS D;  4KAE A;  4BVY B;  1FAA A;  4EVM A;  3GKX A;  6GSU A;  1Y6E A;  3KM6 A;  1GWC A;  3BBY A;  1EGO A;  3UEM A;  1OE7 A;  5JWQ B;  1XCC A;  3DML A;  2M72 A;  2AUV A;  4NPB A;  5ECO B;  1SKW B;  3PPU A;  1A8L A;  4MLY A;  2LNT A;  1UA5 A;  3DXB A;  3US3 A;  2LJA A;  1TXX A;  1C72 A;  2K18 A;  1S3D A;  1FW1 A;  2HNL A;  3RAZ A;  1QMV A;  2H1A A;  2DJ0 A;  4MZC A;  2L6C A;  3VK9 A;  3TKP A;  3ZTL A;  4ZIJ A;  5ECN B;  4MDC A;  3FZ4 A;  4ECJ A;  3APQ A;  4TKY A;  2X99 A;  4J57 E;  5D8I A;  3TKR A;  3RBT A;  4ZL9 A;  2IMK A;  1FG4 A;  1HNA A;  2CV4 A;  1OAZ A;  2J23 A;  2IPA A;  2VL2 C;  3A5W A;  3UVH A;  4ZB9 A;  1VGL A;  3VLN A;  5HR0 A;  3FR6 A;  5HFG A;  4MJE A;  5ABR A;  1X9S B;  2GSQ A;  1YY7 A;  3L9U A;  1TTZ A;  3GKN A;  1BYE A;  3G7J A;  4OCE A;  3GNJ A;  2XC2 A;  1ZZY A;  2YOI A;  1R5A A;  1AC1 A;  3L9V A;  3U6V A;  1O7U A;  2H76 A;  1F2E A;  1NSW A;  2GZZ A;  4WR5 A;  3CSI A;  2X8G A;  3FZA A;  3IAM 2;  1OKT A;  2FWF A;  1G6Y A;  3FYG A;  4PTS A;  3UOM A;  2V6K A;  1AAZ A;  3UIW A;  2H19 A;  4WBR D;  2H30 A;  3UL3 A;  4RUV A;  2M80 A;  3SWL A;  2AYT A;  3FR3 A;  4ECI A;  3APO A;  5G31 A;  3IHQ A;  4IHU A;  1SYX A;  2RLI A;  1SD9 A;  1EP7 A;  1GSU A;  2GVP A;  4OWY A;  4OO5 A;  4EDZ A;  2IN3 A;  1K3Y A;  2IMD A;  2YAN A;  2OBI A;  3F4S A;  3G7Y A;  3FKF A;  3GSS A;  1PQN A;  1WMJ A;  3Q6O A;  2G2Q A;  3GTU B;  2VCX A;  2IIY A;  2L4C A;  2O89 A;  1PA3 A;  1MEK A;  1OC9 A;  2LJR A;  3F6F A;  5IMA A;  5KN0 A;  4KB3 A;  1Z6N A;  3H4K A;  2EIQ A;  1M0U A;  3W8J A;  5B8A A;  5H5S A;  5KN1 A;  4IKH A;  4CDO A;  3KD0 A;  3UBL A;  1XWB A;  2VD0 A;  1TU7 A;  2MMO A;  3HVX A;  3IPZ A;  4K7O A;  2C0D A;  4K7N A;  4V1A g;  4PXO A;  3NZN A;  2PVQ A;  1MTC A;  2LQQ A;  2FGX A;  1GSQ A;  2H0I A;  3GMF A;  4TR1 A;  5B7C A;  2YWM A;  4BA7 A;  3UAP A;  3K8N A;  1GTU A;  3UVT A;  1NHO A;  1QK8 A;  2QSI A;  2C8U A;  4EE0 A;  4D73 A;  2RUF A;  4AGS A;  2GZP A;  4NHZ A;  3DKS A;  2NBS A;  1SK0 A;  2VD1 A;  1URM A;  1M99 A;  2O85 A;  4L0W A;  2H74 A;  3F8U A;  3DIE A;  3DWV A;  4NHW A;  5A5K A;  2JAC A;  1GL8 A;  3F0I A;  5A4U A;  4HJM A;  3I69 A;  2DSA A;  3TRX A;  2H70 A;  12GS A;  4PX1 A;  3VI5 A;  3BJ5 A;  2VOC A;  3U5R E;  2GSR A;  1FVJ A;  3OR5 A;  4IGJ A;  1ACV A;  3I6A A;  16GS A;  2B7J A;  2MBT A;  2KP1 A;  4I97 A;  9GSS A;  1PX6 A;  4BL7 B;  2H72 A;  3KJY A;  2LTK A;  4MJA A;  1SL2 B;  1NM3 A;  3LWA A;  3RPP A;  2O8V B;  3P7X A;  2C0E A;  3KH7 A;  1A0F A;  5JWO B;  1XWA A;  3ERW A;  1F9M A;  4KF9 A;  2RUE A;  3ZIV A;  1X0R A;  6GSX A;  3FW2 A;  4KSM A;  2FCH A;  2X8C A;  2L5L A;  2I1U A;  1G0T A;  3ZIT A;  1A24 A;  4JR4 A;  1ON4 A;  2C0G A;  4QQ7 A;  2HFD A;  2HSM A;  6GSV A;  2GTU A;  4L5L A;  4JU5 A;  2OBK A;  1U87 A;  1YEX A;  3HVS A;  1WIK A;  3EC3 A;  2VIM A;  4HQS A;  1T7P B;  1K0M A;  2QC7 A;  3WD6 A;  1SEN A;  2DIY A;  3CSJ A;  2A2S A;  2MZC A;  1ABA A;  4G9H A;  5ELA A;  5CP1 A;  4BWQ A;  1GSE A;  4CHS A;  1J9B A;  1PD2 1;  3EU3 A;  3FY7 A;  2H0H A;  1S3A A;  2NDO A;  3F3Q A;  1JZR A;  5J3R A;  1T1V A;  1I9D A;  2XHF A;  2OE1 A;  3VPQ A;  1A8Y A;  2M46 A;  5AGY A;  4N11 A;  3DYR A;  3HD5 A;  3KP8 A;  2DMM A;  3IA1 A;  3HCZ A;  5HFK A;  3D22 A;  1EWX A;  1JHB A;  3FR9 A;  3EU4 A;  3IDV A;  3ME8 A;  2V2G A;  4FH8 A;  2JZR A;  4MH3 A;  2C80 A;  4POK A;  3FZ9 A;  1EEJ A;  4I2T A;  3ZIJ A;  2YWI A;  22GS A;  3GRX A;  2LST A;  5J41 A;  3TDG A;  1V98 A;  1M9B A;  2NVL A;  2VLV A;  2EC4 A;  4IJ3 A;  3TKS A;  3ME7 A;  2CVB A;  5AN1 A;  1PGT A;  4FYU A;  2REM A;  4KUN A;  1F3B A;  3VUR A;  3HYP A;  1M2A A;  10GS A;  3QAG A;  1YKA A;  1X9M B;  5HR2 A;  4LLR A;  2O7K A;  1QXH A;  3KGK A;  4ZL8 A;  3EVI A;  5D73 A;  2PBJ A;  1TKD B;  3PH9 A;  2ES7 A;  3I9V 2;  1TRW A;  4ZB8 A;  2GDR A;  4L8E A;  1ERW A;  2RM5 A;  1ZYE A;  1X5C A;  2IWT A;  4KX4 A;  3HJP A;  1EV4 A;  3GFK A;  2I3Y A;  3VI7 A;  4XS4 A;  5IMZ A;  2DJ1 A;  4WKW A;  2K8S A;  4IBP A;  4OD7 A;  4DVC A;  2HZE B;  4I2U A;  1DUG A;  2CX4 A;  1DE2 A;  4KCA A;  3TCO A;  3ZML A;  2N5F A;  1CQH A;  2IFQ A;  2YZH A;  3M9J A;  3QCP A;  2TRC P;  5E59 A;  2F9S A;  5CNW A;  5F8B A;  4WXT A;  2VM2 A;  3BD2 A;  6GSW A;  2J9H A;  3GIX A;  4EKZ A;  2E7P A;  3A2W A;  3HZ4 A;  1YJ6 A;  1V58 A;  4O7H A;  4IQ1 A;  4F2I A;  4AF2 A;  1THO A;  4YH2 A;  1KBN A;  3LXT A;  4ZBB A;  3EIN A;  3UBK A;  1BX9 A;  3AY8 A;  4LL1 B;  4OFT A;  3MSZ A;  4ULX A;  3QPM A;  3ERG A;  1Z6M A;  3TJG A;  1B4Q A;  3E0U A;  5DJL A;  1V57 A;  4EUY A;  4IQA A;  5D93 A;  3M3M A;  3WYW A;  1XWC A;  2VCV A;  2LKU A;  2YPM A;  3IK7 A;  4EL1 A;  1F37 A;  4GSS A;  1OVN A;  2HI7 A;  2IMI A;  4Q5Q A;  2WS2 A;  3KP9 A;  3GUS A;  4GST A;  5AIX A;  3WGX A;  2VM1 A;  2VLU A;  4GQC A;  4RQR A;  1O8W A;  4PNG A;  4MZW A;  4TXO A;  2V32 A;  1GSD A;  2E2G A;  1XOA A;  1TK8 B;  2JL4 A;  4POM A;  3FZ5 A;  1U3A A;  18GS A;  2X8H A;  5CRW A;  4PUR A;  4K2D A;  3A3T A;  4KDY A;  3EWL A;  2LNS A;  1OYJ A;  1K0A A;  5G5F A;  2G0F A;  2N5A A;  3J7Y b;  5FT3 A;  4TXV A;  5JWR B;  1R4W A;  1EEM A;  5ECI B;  1K3O A;  1TRS A;  5FWG A;  2P31 A;  2LRT A;  4OFN A;  2KUC A;  4Z7X A;  2I4A A;  1XOB A;  2PUK C;  1B9X C;  4G0L A;  4LMW A;  4V2N A;  4ACS A;  1XVQ A;  1K0C A;  2A2R A;  3QOU A;  6GSS A;  4K1F A;  5INY A;  1WE0 A;  3H1N A;  4MF7 A;  5AIV A;  2LRC A;  2AJQ B;  2YV7 A;  4XIH A;  4JBB A;  3BCI A;  5J4U A;  5D96 A;  5KEJ A;  1B9Y C;  1ZMA A;  2WZ9 A;  3H8Q A;  3P8W A;  4K9Z A;  1IYH A;  1GTB A;  5ECL B;  2ZNM A;  4BL7 A;  1G7E A;  1M9A A;  5D9T A;  2MMA A;  3IK9 A;  3TB2 A;  17GS A;  5IM9 A;  3KIJ A;  3DVX A;  4QL7 A;  3FRC A;  2H66 A;  1S3C A;  2VUP A;  1XVW A;  4BWS A;  2BJX A;  4MZB A;  5IMF A;  2E2M A;  2FLS A;  4G10 A;  4XRA A;  2B5Y A;  2ON7 A;  1PSQ A;  3VWV A;  5CRG A;  2JAD A;  5B6M A;  2H6X A;  1YQ1 A;  5ECK B;  2DJJ A;  1X5E A;  2H1D A;  2JZT A;  1BED A;  4GF0 A;  5IPH A;  3HZ8 A;  1LU4 A;  3EMX A;  2CX3 A;  5ID2 B;  2GSS A;  1ERV A;  4XS6 A;  1TRV A;  3GHA A;  4L5O A;  5DAL A;  2A4V A;  3HKR A;  5C00 A;  1SL1 B;  5CRH A;  3IXR A;  1KTE A;  3WT1 A;  3G7I A;  1MDJ A;  3TUE A;  1VF3 A;  1DSB A;  2P0G A;  2GQK A;  2MMZ A;  2DML A;  4F0B A;  4I6X A;  1HYU A;  1GTI A;  5FHI A;  1MDK A;  4RQX A;  2NPB A;  4Q5F A;  4NMU A;  4G0I A;  3GV1 A;  1R26 A;  1GSF A;  4YQV A;  8GSS A;  1XW9 A;  3HDC A;  5DDL A;  2YJ7 A;  3FEU A;  2L5O A;  2IMF A;  2OAD A;  5G2Z A;  5F0G A;  1LJR A;  3HXS A;  5ECH B;  1AQX A;  5LCZ A;  2KHP A;  3HJM A;  2CVD A;  5CYY A;  1WPI A;  1B48 A;  1J0F A;  4BVX B;  1SJI A;  4YQM A;  1R5P A;  5IO0 A;  3IE3 A;  2DIZ A;  1EOH A;  3O3T A;  4I8B A;  2VO4 A;  1ILO A;  2HRN A;  2L4Q A;  1I5G A;  3D6I A;  4N10 A;  14GS A;  5JCW A;  4EF0 A;  4KND A;  3ZFB A;  2CAQ A;  1ST9 A;  1TK0 B;  1JZO A;  2VCQ A;  3IC4 A;  3CRU A;  1AQV A;  3CRT A;  2FHE A;  1XIY A;  1Y25 A;  5G30 A;  5DCH A;  3PGT A;  3Q19 A;  20GS A;  2GST A;  2L59 A;  3LQ7 A;  2GLR A;  1TOF A;  2PWJ A;  3H79 A;  2Z9S A;  4XTS A;  2VCT A;  4YAV A;  1U88 A;  5CO3 A;  2LJK A;  5G1L A;  2LS5 A;  1QQ2 A;  4KH7 A;  2DLX A;  1SKS B;  19GS A;  4TRX A;  2C4J A;  3GUR A;  3IC8 A;  4OFM A;  3QDN A;  13GS A;  1XWK A;  2V1M A;  1GLQ A;  2FUG 2;  3RHC A;  1E2Y A;  2WCI A;  1W4V A;  3KCM A;  1VF2 A;  1O6J A;  1XW6 A;  2TRX A;  4P3Y B;  3D4M A;  1UVZ A;  2HLS A;  1A2L A;  2OJL A;  3NIV A;  3KH9 A;  4ECC A;  1AQW A;  5IOX A;  5EPF A;  4G2E A;  5LD0 A;  4PGT A;  2I9H A;  1PL2 A;  1JZW A;  1OE8 A;  4O92 A;  3KZQ A;  1FVK A;  1HNB A;  3W8S A;  4TR4 A;  1X5D A;  6GSY A;  2LRN A;  4PQ1 A;  5JCU A;  2LEG A;  4KW6 A;  1IYI A;  4BVY A;  3LG6 A;  3EYT A;  5H5R A;  5DQS A;  2F51 A;  5JCG A;  1OC9 B;  2FY6 A;  4YAP A;  5GAP D;  3HJO A;  2HSN B;  4TR3 A;  2E0Q A;  2HRK B;  3QMX A;  1XWG A;  1H4O A;  1JFU A;  1SK2 A;  3ZVJ D;  2QKE A;  4IN0 A;  1M2D A;  3ZFL A;  4MF6 A;  4X0X A;  2IJY A;  1TP9 A;  1WOU A;  5A4W A;  2F8A A;  3VWW A;  1O85 A;  1FB0 A;  1A0R P;  2FWG A;  2O87 A;  5J9B A;  2LV3 A;  1SD8 A;  3GKK A;  3ZYW A;  2ZUP A;  2HSH A;  3IR4 A;  4J2F A;  3IV4 A;  3L78 A;  5F06 A;  1ZGN A;  1WJK A;  4JE1 A;  4IVF A;  3M0F A;  5ECQ B;  2JSZ A;  2CVK A;  5DJM A;  4MAB A;  4Q5N A;  2H01 A;  2V6O A;  1O73 A;  5G5E A;  2YJH A;  2C3Q A;  3KTB A;  3LFL A;  3CXG A;  3UMA A;  4JRR A;  1KNG A;  4K6X A;  5KN2 A;  3KEB A;  2JU5 A;  4HS1 A;  3VWX A;  3D21 A;  2L57 A;  2C1Y A;  1NW2 A;  5H5Q A;  1SK1 A;  2YN1 A;  3GYK A;  1TJD A;  4PQI A;  3GX0 A;  1JLW A;  2H8L A;  3RDW A;  4HEA 2;  2XPD A;  1G7O A;  1XW5 A;  4HI7 A;  3ED3 A;  3KTL A;  2JZS A;  4YQU A;  4LMV A;  3UAR A;  5HR1 A;  1GH2 A;  2VLT A;  4POL A;  3TGZ A;  2WGR A;  3W6G A;  1AUC A;  4HQZ A;  5HFI A;  1Z3E A;  3LYK A;  2AV4 A;  1GSY A;  2P5Q A;  1UC7 A;  5J5N A;  1HD2 A;  4WF5 A;  4DSS B;  2VCW A;  3TOT A;  1U6T A;  3L9S A;  3C1S A;  2GQM A;  4ML1 A;  5B8B A;  4N0V A;  2HYX A;  1OC3 A;  1XPV A;  3C71 A;  4ILF A;  4AJ7 A;  5LNK e;  1PN9 A;  3PIN A;  3ISO A;  2H1G A;  2YWO A;  4GLT A;  2LQO A;  4MH2 A;  1GUK A;  1W89 A;  4GTU A;  4G0K A;  1JZD A;  5ID2 A;  2EIO A;  4ISD A;  4TN8 A;  3GTU A;  2CQ9 A;  2PER A;  2BMX A;  1GP1 A;  1MD3 A;  3HVV A;  1TU8 A;  2NTO A;  4XS1 A;  1AXD A;  2VL9 A;  1ZL9 A;  3LYP A;  1QGV A;  2AAW A;  4RI6 A;  2R4V A;  4K0G A;  2HT9 A;  3GA4 A;  4NV2 A;  2MYG A;  3J7Y k;  4Q5R A;  4V2L A;  5B6N A;  1U3I A;  3C1R A;  3SBC A;  2FA8 A;  2ALB A;  4OCF A;  4DSQ A;  4K8M A;  3GL3 A;  2B1K A;  2KLX A;  2X64 A;  4DSR A;  3VFI A;  2MMN A;  1RW1 A;  2B5X A;  2DC5 A;  1T00 A;  3F63 A;  1A2J A;  3NOF A;  5ECR B;  1DBY A;  4WBJ A;  4F9Z A;  1ZCP A;  4WET A;  3QAW A;  3KXO A;  2K8V A;  5IIZ A;  4BVX A;  1TDI A;  4KA0 A;  4PUA A;  7GSS A;  2GS3 A;  3WGD A;  4IW9 A;  1SJZ A;  1ML6 A;  1QUW A;  4DEJ A;  1TI1 A;  4H86 A;  2WFC A;  2PPT A;  1TRU A;  2R37 A;  4V1A p;  1GUL A;  2FWE A;  5CAX A;  3Q18 A;  4G19 A;  4HZ4 A;  5AIS A;  4ZXG A;  1EV9 A;  2YZU A;  3DRN A;  5DAK B;  2H75 A;  4O32 A;  3GN3 A;  3WT2 A;  5ECP B;  3H93 A;  5HR3 A;  5DQY A;  4EC0 A;  1T4Y A;  3CTF A;  4AJ6 A;  4IS0 A;  3O6T A;  1GUM A;  4IJI A;  4WF4 A;  2D2Z A;  5IOW A;  1Z5Y E;  4MJC A;  3CBU A;  2HXK A;  3S9F A;  1H75 A;  2HRF A;  3UJ1 A;  1BJX A;  6GST A;  3LXZ A;  2OAC A;  2AHE A;  2WDU A;  2FWH A;  2WRT A;  1YZX A;  4XS4 B;  1CQG A;  1OC8 A;  1VF4 A;  1PX7 A;  1M7T A;  2H6Z A;  3RPN A;  5GZZ B;  1PKW A;  3I43 A;  4XRD A;  2IME A;  1EZK A;  2F3M A;  5ECM B;  2YV9 A;  4FQU A;  4PQH A;  3CSH A;  4MMM A;  4F0C A;  2N5B A;  3TRQ A;  3F9U A;  1MDI A;  1R7H A;  3TJB A;  3MAK A;  2GGT A;  4TOP A;  2IFQ B;  3QAV A;  4LL4 B;  5DVB A;  4N30 A;  1AIU A;  3C73 A;  3LGC A;  5DBQ A;  3C8E A;  3LOR A;  2C0F A;  3D5J A;  1YDK A;  3M1G A;  1OKD A;  3IBH A;  1ZOF A;  1WP0 A;  4IP1 A;  4BPY A;  3GST A;  3M8N A;  1O81 A;  4E8H A;  2ZCT A;  1HNC A;  1XZO A;  3LJR A;  1YF1 A;  3IRA A;  1Q4J A;  5IMD A;  4HZ2 A;  3TKS C;  1QFN A;  2CT6 A;  3JCM L;  1SYR A;  2RM6 A;  2C3N A;  3APS A;  2BTO T;  1HQO A;  4F03 A;  4KSO A;  3QFA C;  4E8E A;  1M2B A;  3D0Z A;  2DJ2 A;  4HUA A;  4MPG A;  4GCI A;  4KGI A;  3CYN A;  3LSZ A;  3O76 A;  5D9V A;  1WRY A;  5A4V A;  2HRK A;  4GRF A;  3N9J A;  2KP2 A;  2AB6 A;  4PNF A;  3HA9 A;  2UZ8 A;  1UN2 A;  3F4R A;  1VF1 A;  3FK8 A;  4NXI A;  2H1B A;  4MK3 A;  1XXU A;  4KE3 A;  2CZ3 A;  1F3A A;  5ECS A;  5EL8 A;  3CTG A;  5J9C A;  3ZRE A;  1AW9 A;  3G9B A;  1NHY A;  4TXO B;  5EY6 A;  2FD3 A;  4L0U A;  5F05 A;  3ZLP A;  2P5R A;  3GL5 A;  3VPT A;  4WEY A;  4J56 E;  2R2J A;  4ID0 A;  2B5E A;  2DJ3 A;  3L4N A;  2V41 A;  1SJ6 A;  4XHM A;  4MJB A;  1JLV A;  4FYB A;  4JR6 A;  5GSS A;  2B1L A;  2RII A;  2R3X A;  2IL3 A;  4LA1 A;  2HZE A;  3EMP A;  2ON5 A;  2XPE A;  4ZIL A;  4MA9 A;  3EUR A;  1WWJ A;  4NAX A;  5HQP A;  3DD3 A;  2PGT A;  2B6M A;  3LEF A;  4QL9 A;  2R5G A;  1GLP A;  4GWR A;  2YNX A;  2GT6 A;  1N2A A;  4GSN A;  3CMI A;  4ZB6 A;  4TVE A;  3TRP A;  2HZF A;  5GAN D;  2YP6 A;  1EP8 A;  3RHB A;  2OA7 A;  5IMC A;  2B3S A;  2WUL A;  1GNW A;  1Q98 A;  3VWU A;  1RK4 A;  5KN3 A;  2DBC A;  2WJU A;  3Q74 A;  4DSS A;  3L0H A;  2GZY A;  5E4W A;  3E9J B;  4ECB A;  1XBS A;  3TJK A;  5IMV A;  1TK5 B;  1K3L A;  3ERF A;  1EGR A;  3R2Q A;  3R3E A;  1GNE A;  3KMN A;  2C3T A;  4KDX A; 
#chains in the Genus database with same CATH topology
 3N5O A;  1FO5 A;  1A23 A;  2CA8 A;  5IQY A;  4FO5 A;  2R0P A;  2H6Y A;  4NWY A;  5IO2 A;  1B4P A;  2VL2 A;  4TR0 A;  1BQ7 A;  1J08 A;  1X9W B;  3DEX A;  2EIR A;  3IOS A;  1PRX A;  5C04 A;  4MP4 A;  1GSS A;  2GQL A;  1K0D A;  5IPG A;  2K9F A;  3A2X A;  4EXJ A;  3F6D A;  2PMT A;  4JZQ A;  3HHV A;  2PU9 C;  2UV8 G;  1V9W A;  4KDU A;  1TW9 A;  1EOG A;  3QR6 A;  4X43 A;  5BMU A;  4EO3 A;  1N8J A;  2K6V A;  2HQT A;  5DAL B;  1LBK A;  3QFB C;  4I5Q A;  2L6D A;  2VL3 A;  1GUH A;  5G1K A;  1ERU A;  2YWN A;  2H73 A;  2B7K A;  2CAI A;  1G6W A;  4K0N A;  1BAY A;  2KOK A;  3MNG A;  2MBS A;  2FA4 A;  1YKC A;  2R6K A;  5EVO A;  2WB9 A;  1Z7R A;  1T4Z A;  2H0G A;  4X1U A;  1DE1 A;  4FYC A;  4N0Z A;  3PR8 A;  3TJF A;  3DVW A;  1RQM A;  1YF0 A;  4JED A;  5F07 A;  3TOU A;  1PL1 A;  3V1W A;  2CZ2 A;  2HE3 A;  2OE3 A;  3TKQ A;  4PUF C;  4ICY A;  4TR1 B;  5DAK A;  2H71 A;  4USS A;  2R0G A;  4O5U A;  3ZMK A;  5CRE A;  4MPF A;  2OKA A;  4HDE A;  3ZZX A;  4O5R A;  1PKZ A;  3P2A A;  1SKR B;  3M9K A;  2OE0 A;  4Z2R A;  3A2V A;  1FHE A;  5ENU A;  4F82 A;  1SL0 B;  4D73 B;  3MDK A;  1YEP A;  4IEL A;  3QD9 A;  5COH A;  3BCK A;  3FHK A;  4KCE A;  1O8X A;  4ZL7 A;  2TIR A;  1V2A A;  1PMT A;  1K0B A;  5ELG A;  1MD4 A;  1TI3 A;  1YVL A;  3C7M A;  2PN8 A;  1K0O A;  4XCS A;  1T8E B;  4EDY A;  2QGV A;  2XBQ A;  4GXZ A;  1T3B A;  3TJJ A;  4TW5 A;  3ZVJ A;  2VAF A;  4AJ8 A;  1ZYQ B;  1B8X A;  5DCG A;  4NV5 A;  3ZL5 A;  2F8F A;  4GQF A;  3TKS E;  1USB A;  2GT5 A;  5CRD A;  4WR4 A;  5GST A;  4Z2T A;  3IAS 2;  4POB A;  3HY2 A;  4ML6 A;  1THX A;  4HU9 A;  1F6M C;  2JSY A;  1Z9H A;  2FNO A;  2PVO C;  3ZRD A;  4FIW A;  3GH6 A;  3P90 A;  4OMV A;  1GTA A;  3D4T A;  1A2M A;  1SU9 A;  1FB6 A;  4HOJ A;  4OO4 A;  2DJK A;  4V2M A;  4ZBD A;  4K7I A;  2WW2 A;  11GS A;  4MCU A;  2YCD A;  4IP6 A;  3EE2 A;  1GRX A;  1K0N A;  1Z7P A;  3GH9 A;  2HRA A;  4AKX B;  3E3E A;  3WGE A;  3F4T A;  4MF5 A;  3GKM A;  1ERT A;  2HSM B;  1ZYN A;  2WW0 A;  2LUS A;  5L71 A;  2VCZ A;  4CW9 A;  1V40 A;  3BOA A;  4HU7 A;  2HSY A;  1KEB A;  1FOV A;  1BG5 A;  1XFL A;  3MWH A;  1E6B A;  5D9W A;  3KMO A;  3F3R A;  3DGQ A;  5D9X A;  4RI7 A;  4HJ2 A;  4ZBA A;  2XBI A;  2I81 A;  3GX8 A;  1VRS D;  4KAE A;  4BVY B;  1FAA A;  4EVM A;  3GKX A;  6GSU A;  1Y6E A;  3KM6 A;  3HVN A;  1GWC A;  3BBY A;  1EGO A;  3UEM A;  5J4Y A;  1OE7 A;  4N3Z A;  5JWQ B;  1XCC A;  3DML A;  2M72 A;  2AUV A;  4NPB A;  5ECO B;  1SKW B;  3PPU A;  4FXY P;  1A8L A;  4MLY A;  2LNT A;  1UA5 A;  3DXB A;  3US3 A;  2LJA A;  1TXX A;  1C72 A;  2K18 A;  1S3D A;  1FW1 A;  2HNL A;  3RAZ A;  1QMV A;  2H1A A;  2DJ0 A;  4MZC A;  2L6C A;  3VK9 A;  3TKP A;  3ZTL A;  4ZIJ A;  5ECN B;  4MDC A;  3FZ4 A;  4ECJ A;  3APQ A;  4TKY A;  2X99 A;  4J57 E;  5D8I A;  3TKR A;  3RBT A;  4ZL9 A;  2IMK A;  1FG4 A;  1HNA A;  2CV4 A;  1TXU A;  3FMW A;  1OAZ A;  2J23 A;  2IPA A;  2VL2 C;  3A5W A;  3UVH A;  4ZB9 A;  1VGL A;  3VLN A;  5HR0 A;  3FR6 A;  5HFG A;  4MJE A;  5ABR A;  1X9S B;  2GSQ A;  1YY7 A;  3L9U A;  1TTZ A;  3GKN A;  2WVX A;  1BYE A;  3G7J A;  4OCE A;  3GNJ A;  2XC2 A;  1ZZY A;  2YOI A;  1R5A A;  1AC1 A;  3L9V A;  3U6V A;  1O7U A;  2EFC A;  2H76 A;  1F2E A;  1NSW A;  2GZZ A;  4WR5 A;  3CSI A;  2X8G A;  2O36 A;  3FZA A;  3IAM 2;  1OKT A;  2FWF A;  1G6Y A;  3FYG A;  3RFR C;  4PTS A;  3UOM A;  3A5I A;  2V6K A;  1AAZ A;  3UIW A;  2H19 A;  4WBR D;  2H30 A;  3UL3 A;  4RUV A;  2M80 A;  3SWL A;  2AYT A;  3FR3 A;  4ECI A;  3APO A;  5G31 A;  3IHQ A;  4IHU A;  1SYX A;  2RLI A;  1SD9 A;  1EP7 A;  1GSU A;  2GVP A;  4OWY A;  4OO5 A;  4EDZ A;  2IN3 A;  1K3Y A;  2IMD A;  2YAN A;  2OBI A;  3F4S A;  3G7Y A;  3FKF A;  3GSS A;  1PQN A;  1WMJ A;  3Q6O A;  2G2Q A;  3GTU B;  2VCX A;  2IIY A;  2L4C A;  2O89 A;  1PA3 A;  1MEK A;  1OC9 A;  5KOX A;  2LJR A;  3F6F A;  5IMA A;  5KN0 A;  4KB3 A;  1Z6N A;  3H4K A;  2EIQ A;  1M0U A;  3W8J A;  5B8A A;  5H5S A;  5KN1 A;  4IKH A;  1BG1 A;  4CDO A;  3KD0 A;  3UBL A;  1XWB A;  2VD0 A;  1TU7 A;  2WW1 A;  1I1I P;  2VKZ G;  2EFH A;  2MMO A;  3HVX A;  3IPZ A;  4K7O A;  2C0D A;  4K7N A;  4V1A g;  4PXO A;  3NZN A;  2PVQ A;  1MTC A;  2LQQ A;  2FGX A;  1GSQ A;  2H0I A;  3GMF A;  4TR1 A;  5B7C A;  4MNN A;  2YWM A;  4BA7 A;  2X49 A;  3UAP A;  3K8N A;  1GTU A;  3UVT A;  1NHO A;  2O3E A;  1QK8 A;  2QSI A;  2C8U A;  4EE0 A;  4D73 A;  2X4A A;  2RUF A;  4AGS A;  2GZP A;  4NHZ A;  3DKS A;  2NBS A;  1SK0 A;  2VD1 A;  1URM A;  1M99 A;  2O85 A;  4L0W A;  2H74 A;  3F8U A;  3DIE A;  3DWV A;  4NHW A;  5A5K A;  2JAC A;  1GL8 A;  3F0I A;  5A4U A;  4HJM A;  3I69 A;  2DSA A;  3TRX A;  2H70 A;  12GS A;  4PX1 A;  3VI5 A;  3BJ5 A;  4QMK A;  2VOC A;  3U5R E;  2GSR A;  1FVJ A;  3OR5 A;  4IGJ A;  1ACV A;  3I6A A;  16GS A;  2B7J A;  2MBT A;  2KP1 A;  4I97 A;  9GSS A;  1PX6 A;  4BL7 B;  2H72 A;  3KJY A;  2LTK A;  4MJA A;  1SL2 B;  2EFE A;  1NM3 A;  3LWA A;  2DKI A;  3RPP A;  2O8V B;  3P7X A;  2C0E A;  3KH7 A;  1A0F A;  5JWO B;  2QA2 A;  1XWA A;  3ERW A;  1F9M A;  4KF9 A;  2RUE A;  3ZIV A;  1X0R A;  6GSX A;  3FW2 A;  4KSM A;  3MYD A;  2FCH A;  2X8C A;  2L5L A;  2I1U A;  1G0T A;  3ZIT A;  1A24 A;  4JR4 A;  1ON4 A;  1SVO A;  2C0G A;  4QQ7 A;  2HFD A;  2HSM A;  6GSV A;  2GTU A;  4L5L A;  4JU5 A;  2OBK A;  1U87 A;  1YEX A;  3HVS A;  1WIK A;  3EC3 A;  2VIM A;  4HQS A;  1T7P B;  1K0M A;  2QC7 A;  3WD6 A;  1SEN A;  2DIY A;  3CSJ A;  2A2S A;  2MZC A;  1ABA A;  4G9H A;  5ELA A;  5CP1 A;  4BWQ A;  1GSE A;  4CHS A;  1J9B A;  1PD2 1;  3EU3 A;  5A34 B;  3FY7 A;  2H0H A;  1S3A A;  2NDO A;  3F3Q A;  1JZR A;  5J3R A;  1T1V A;  1I9D A;  2XHF A;  2OE1 A;  3VPQ A;  1A8Y A;  2M46 A;  5AGY A;  4N11 A;  3DYR A;  2A2P A;  3HD5 A;  3KP8 A;  2DMM A;  3IA1 A;  3HCZ A;  5HFK A;  3D22 A;  1EWX A;  1JHB A;  3FR9 A;  3EU4 A;  3IDV A;  3ME8 A;  2V2G A;  4FH8 A;  2JZR A;  4MH3 A;  2C80 A;  4POK A;  3FZ9 A;  1EEJ A;  4I2T A;  3ZIJ A;  3TU3 B;  4AKG A;  2YWI A;  22GS A;  3GRX A;  2LST A;  5J40 A;  5J41 A;  3TDG A;  1V98 A;  1M9B A;  2NVL A;  2VLV A;  2EC4 A;  4IJ3 A;  3TKS A;  3ME7 A;  2CVB A;  5AN1 A;  1PGT A;  4FYU A;  2REM A;  4KUN A;  1F3B A;  3VUR A;  3HYP A;  1M2A A;  10GS A;  3QAG A;  1YKA A;  1X9M B;  4A5P A;  5HR2 A;  4LLR A;  2O7K A;  1QXH A;  3KGK A;  4ZL8 A;  4YKF A;  3EVI A;  5D73 A;  2PBJ A;  1TKD B;  3PH9 A;  2ES7 A;  2WVZ A;  3I9V 2;  1TRW A;  4YKG A;  4ZB8 A;  2R0C A;  2GDR A;  4L8E A;  1ERW A;  2RM5 A;  1ZYE A;  1X5C A;  2IWT A;  4KX4 A;  3HJP A;  1EV4 A;  3GFK A;  2I3Y A;  3VI7 A;  4XS4 A;  5IMZ A;  2DJ1 A;  4K5S A;  4WKW A;  2K8S A;  4IBP A;  3RGB C;  4OD7 A;  4DVC A;  2HZE B;  4AKH A;  4I2U A;  1DUG A;  4PHZ C;  2CX4 A;  1DE2 A;  4KCA A;  3TCO A;  3ZML A;  2QA1 A;  2N5F A;  1CQH A;  2IFQ A;  2YZH A;  3HMJ G;  3M9J A;  3QCP A;  2TRC P;  5E59 A;  2F9S A;  5CNW A;  5F8B A;  4WXT A;  2VM2 A;  3BD2 A;  6GSW A;  2J9H A;  3GIX A;  4EKZ A;  2E7P A;  3A2W A;  3HZ4 A;  1YJ6 A;  1V58 A;  4O7H A;  4IQ1 A;  4F2I A;  4AF2 A;  1THO A;  4YH2 A;  1KBN A;  3LXT A;  4ZBB A;  3EIN A;  3UBK A;  1BX9 A;  3AY8 A;  4LL1 B;  4OFT A;  3MSZ A;  4ULX A;  3QPM A;  3ERG A;  1Z6M A;  3TJG A;  1B4Q A;  3E0U A;  5DJL A;  1V57 A;  4EUY A;  5A5H B;  4IQA A;  5D93 A;  3M3M A;  3WYW A;  1XWC A;  2VCV A;  3CWG A;  2LKU A;  2YPM A;  3IK7 A;  4EL1 A;  1F37 A;  4GSS A;  1OVN A;  2HI7 A;  2IMI A;  4Q5Q A;  2WS2 A;  3KP9 A;  1N25 A;  3GUS A;  4GST A;  5AIX A;  3WGX A;  4K2X A;  5BMU B;  2VM1 A;  2VLU A;  4GQC A;  4RQR A;  1O8W A;  4PNG A;  4PI2 C;  4MZW A;  4HSC X;  4TXO A;  2V32 A;  1GSD A;  2E2G A;  4CY6 A;  1XOA A;  1TK8 B;  2JL4 A;  4POM A;  3FZ5 A;  1U3A A;  18GS A;  2X8H A;  5CRW A;  4PUR A;  4K2D A;  3A3T A;  4KDY A;  3EWL A;  2LNS A;  1OYJ A;  1K0A A;  3CHX C;  2O5V A;  5G5F A;  2G0F A;  2N5A A;  3J7Y b;  5FT3 A;  4TXV A;  5JWR B;  1R4W A;  1EEM A;  5ECI B;  1K3O A;  1TRS A;  5FWG A;  2P31 A;  2LRT A;  4OFN A;  2KUC A;  4Z7X A;  2I4A A;  1XOB A;  2WZS A;  2PUK C;  1B9X C;  4G0L A;  4LMW A;  4V2N A;  4ACS A;  1XVQ A;  1K0C A;  2A2R A;  3QOU A;  6GSS A;  4K1F A;  5INY A;  1WE0 A;  3H1N A;  4MF7 A;  5AIV A;  2LRC A;  2AJQ B;  2YV7 A;  4XIH A;  4JBB A;  3BCI A;  5J4U A;  4PI0 C;  1PN0 A;  5D96 A;  5KEJ A;  1B9Y C;  1ZMA A;  2WZ9 A;  3H8Q A;  1SVL A;  3P8W A;  4K9Z A;  1IYH A;  1GTB A;  5ECL B;  2ZNM A;  4BL7 A;  1G7E A;  1M9A A;  5D9T A;  2MMA A;  3IK9 A;  3TB2 A;  17GS A;  5IM9 A;  3KIJ A;  3DVX A;  4QL7 A;  3FRC A;  2H66 A;  1S3C A;  2VUP A;  1XVW A;  4BWS A;  2BJX A;  4MZB A;  5IMF A;  2E2M A;  2FLS A;  4G10 A;  4XRA A;  2B5Y A;  2ON7 A;  1PSQ A;  3VWV A;  5CRG A;  2JAD A;  5B6M A;  2H6X A;  1YQ1 A;  5ECK B;  2DJJ A;  1X5E A;  2H1D A;  2JZT A;  1BED A;  4GF0 A;  5IPH A;  3HZ8 A;  1LU4 A;  3EMX A;  2CX3 A;  5ID2 B;  2GSS A;  1ERV A;  4XS6 A;  1TRV A;  3GHA A;  4L5O A;  5DAL A;  2A4V A;  3HKR A;  5C00 A;  1SL1 B;  5CRH A;  3IXR A;  1KTE A;  3WT1 A;  3G7I A;  5A34 A;  1MDJ A;  3TUE A;  1VF3 A;  1DSB A;  2P0G A;  1PFO A;  2GQK A;  2MMZ A;  2DML A;  4F0B A;  4I6X A;  1HYU A;  1GTI A;  5FHI A;  1MDK A;  4RQX A;  2NPB A;  4Q5F A;  4NMU A;  4G0I A;  3GV1 A;  1R26 A;  1GSF A;  4YQV A;  8GSS A;  1XW9 A;  3HDC A;  4O5Q A;  5DDL A;  2YJ7 A;  3FEU A;  4AKI A;  2L5O A;  2IMF A;  2OAD A;  5G2Z A;  5F0G A;  1LJR A;  3HXS A;  5ECH B;  1AQX A;  5LCZ A;  2KHP A;  3HJM A;  2CVD A;  5CYY A;  1WPI A;  1B48 A;  1J0F A;  4BVX B;  1SJI A;  4YQM A;  1R5P A;  5IO0 A;  3IE3 A;  2DIZ A;  1EOH A;  3O3T A;  4I8B A;  2VO4 A;  1ILO A;  2HRN A;  4CY8 A;  2L4Q A;  1I5G A;  3D6I A;  4N10 A;  14GS A;  5JCW A;  4EF0 A;  4KND A;  3ZFB A;  2CAQ A;  1ST9 A;  1TK0 B;  1JZO A;  2VCQ A;  3IC4 A;  3CRU A;  1AQV A;  3CRT A;  2FHE A;  1XIY A;  1Y25 A;  5G30 A;  1S4B P;  5DCH A;  3PGT A;  3Q19 A;  20GS A;  2GST A;  2L59 A;  3LQ7 A;  2GLR A;  4G01 A;  1TOF A;  2PWJ A;  3H79 A;  2Z9S A;  4XTS A;  2VCT A;  4YAV A;  1U88 A;  4W66 A;  2LJK A;  5CO3 A;  5G1L A;  2LS5 A;  1QQ2 A;  4KH7 A;  2DLX A;  1SKS B;  19GS A;  4TRX A;  2C4J A;  3GUR A;  3IC8 A;  4OFM A;  3QDN A;  13GS A;  4AI6 A;  2WVX B;  1XWK A;  2V1M A;  1GLQ A;  2FUG 2;  3RHC A;  1E2Y A;  2WCI A;  1W4V A;  3KCM A;  1VF2 A;  1O6J A;  1XW6 A;  2TRX A;  4P3Y B;  3D4M A;  1UVZ A;  2HLS A;  1A2L A;  2OJL A;  4BIK A;  3NIV A;  3KH9 A;  4ECC A;  5A5H A;  1XG8 A;  1AQW A;  5IOX A;  1SVM A;  4E68 A;  5EPF A;  4G2E A;  5BRT A;  5LD0 A;  4PGT A;  2I9H A;  1PL2 A;  1JZW A;  1OE8 A;  4O92 A;  3KZQ A;  1FVK A;  1HNB A;  3W8S A;  4TR4 A;  1X5D A;  6GSY A;  2LRN A;  4PQ1 A;  5JCU A;  2LEG A;  4KW6 A;  1IYI A;  4BVY A;  2WVY A;  3LG6 A;  3EYT A;  5H5R A;  5DQS A;  4EIQ A;  2F51 A;  5JCG A;  1OC9 B;  2FY6 A;  4YAP A;  5GAP D;  3HJO A;  2HSN B;  4TR3 A;  2DKH A;  2E0Q A;  2HRK B;  3QMX A;  1XWG A;  5J4V A;  1JFU A;  1H4O A;  1SK2 A;  3ZVJ D;  2QKE A;  4IN0 A;  1M2D A;  3ZFL A;  4MF6 A;  4X0X A;  2IJY A;  2WW3 A;  1TP9 A;  1WOU A;  5A4W A;  2F8A A;  3VWW A;  1O85 A;  1FB0 A;  1A0R P;  2FWG A;  2O87 A;  5J9B A;  2LV3 A;  1SD8 A;  3GKK A;  3ZYW A;  2ZUP A;  2HSH A;  3IR4 A;  4J2F A;  3IV4 A;  3L78 A;  5F06 A;  1ZGN A;  1WJK A;  4JE1 A;  4IVF A;  3M0F A;  5ECQ B;  2JSZ A;  2CVK A;  5DJM A;  4MAB A;  4Q5N A;  2H01 A;  2V6O A;  1O73 A;  5G5E A;  2YJH A;  2C3Q A;  3KTB A;  3LFL A;  3CXG A;  3UMA A;  4JRR A;  1KNG A;  4K6X A;  1ZYP A;  3KEB A;  5KN2 A;  2JU5 A;  4HS1 A;  3VWX A;  3D21 A;  2L57 A;  2C1Y A;  1NW2 A;  5H5Q A;  1SK1 A;  4GDF A;  2YN1 A;  3GYK A;  1TJD A;  4PQI A;  3GX0 A;  1JLW A;  2H8L A;  3RDW A;  4HEA 2;  2XPD A;  1G7O A;  1XW5 A;  4HI7 A;  3ED3 A;  3KTL A;  2JZS A;  4YQU A;  4LMV A;  3UAR A;  5HR1 A;  1GH2 A;  2VLT A;  4POL A;  3TGZ A;  2WGR A;  3W6G A;  4EIP A;  1AUC A;  4HQZ A;  5HFI A;  1Z3E A;  3LYK A;  2AV4 A;  1GSY A;  2P5Q A;  1UC7 A;  5A1N B;  5J5N A;  1HD2 A;  4ZB7 A;  4WF5 A;  4DSS B;  2VCW A;  3TOT A;  1U6T A;  3L9S A;  3C1S A;  2GQM A;  4ML1 A;  5B8B A;  4N0V A;  2HYX A;  1OC3 A;  1XPV A;  3C71 A;  4ILF A;  3EPT A;  4AJ7 A;  5LNK e;  1PN9 A;  3PIN A;  3ISO A;  2H1G A;  2YWO A;  4GLT A;  2LQO A;  4MH2 A;  1GUK A;  1W89 A;  4GTU A;  4G0K A;  1JZD A;  5ID2 A;  2EIO A;  4ISD A;  4TN8 A;  3GTU A;  2CQ9 A;  2PER A;  2BMX A;  1GP1 A;  1MD3 A;  3HVV A;  1S3R A;  1TU8 A;  2NTO A;  4XS1 A;  1AXD A;  2VL9 A;  1ZL9 A;  3LYP A;  1QGV A;  2AAW A;  4RI6 A;  2R4V A;  4K0G A;  2HT9 A;  3GA4 A;  4NV2 A;  2MYG A;  3J7Y k;  4Q5R A;  4V2L A;  5B6N A;  1U3I A;  3C1R A;  3SBC A;  2FA8 A;  2ALB A;  4OCF A;  4DSQ A;  4K8M A;  3GL3 A;  2B1K A;  2KLX A;  2X64 A;  4DSR A;  3VFI A;  2MMN A;  1RW1 A;  2B5X A;  2DC5 A;  2EFD A;  3MIX A;  1T00 A;  3F63 A;  1A2J A;  3NOF A;  5ECR B;  1DBY A;  5KOW A;  4WBJ A;  4F9Z A;  1ZCP A;  4WET A;  3QAW A;  3KXO A;  2K8V A;  5IIZ A;  4BVX A;  1TDI A;  4KA0 A;  4PUA A;  1YEW C;  7GSS A;  2GS3 A;  3WGD A;  4IW9 A;  1SJZ A;  1ML6 A;  1QUW A;  4DEJ A;  1TI1 A;  4H86 A;  2WFC A;  2PPT A;  1TRU A;  2R37 A;  4V1A p;  1GUL A;  2FWE A;  5CAX A;  3Q18 A;  4G19 A;  4HZ4 A;  5AIS A;  4ZXG A;  1EV9 A;  2YZU A;  3DRN A;  5DAK B;  2H75 A;  4O32 A;  3GN3 A;  3WT2 A;  5ECP B;  3H93 A;  5HR3 A;  5DQY A;  4EC0 A;  1T4Y A;  3CTF A;  4AJ6 A;  4IS0 A;  3O6T A;  1GUM A;  4IJI A;  4WF4 A;  2D2Z A;  5IOW A;  1Z5Y E;  4MJC A;  3CBU A;  2HXK A;  3S9F A;  1H75 A;  2HRF A;  3UJ1 A;  1BJX A;  6GST A;  3LXZ A;  2OAC A;  2AHE A;  2WDU A;  2FWH A;  4Z2U A;  2WRT A;  1YZX A;  4XS4 B;  1CQG A;  1OC8 A;  1VF4 A;  1PX7 A;  1M7T A;  2H6Z A;  3RPN A;  5GZZ B;  1PKW A;  3I43 A;  4XRD A;  2IME A;  1EZK A;  2F3M A;  5ECM B;  2YV9 A;  4FQU A;  1M3J A;  4PQH A;  3CSH A;  4MMM A;  4F0C A;  2N5B A;  3TRQ A;  3F9U A;  1MDI A;  1R7H A;  3TJB A;  3MAK A;  2GGT A;  4TOP A;  2IFQ B;  3QAV A;  4LL4 B;  5DVB A;  4N30 A;  1AIU A;  3C73 A;  3LGC A;  5DBQ A;  3C8E A;  3LOR A;  2C0F A;  3D5J A;  1YDK A;  3M1G A;  1OKD A;  3IBH A;  1ZOF A;  1WP0 A;  4IP1 A;  4BPY A;  3GST A;  3M8N A;  1O81 A;  4X4J A;  4E8H A;  2ZCT A;  1HNC A;  1XZO A;  3LJR A;  2A4H A;  1YF1 A;  3IRA A;  1Q4J A;  5IMD A;  4HZ2 A;  3TKS C;  1QFN A;  2CT6 A;  3JCM L;  1SYR A;  2RM6 A;  2C3N A;  3APS A;  2H1L A;  2BTO T;  1HQO A;  3LW9 A;  4F03 A;  4KSO A;  3QFA C;  4E8E A;  1M2B A;  3D0Z A;  2DJ2 A;  4HUA A;  4MPG A;  4GCI A;  4KGI A;  3CYN A;  3LSZ A;  2HSN A;  3O76 A;  5D9V A;  1WRY A;  5A4V A;  2HRK A;  4GRF A;  3N9J A;  2KP2 A;  2AB6 A;  4K5R A;  4PNF A;  3HA9 A;  2UZ8 A;  1UN2 A;  3CQF A;  1VF1 A;  3F4R A;  3FK8 A;  4NXI A;  2H1B A;  4MK3 A;  1XXU A;  4KE3 A;  2CZ3 A;  1F3A A;  5ECS A;  5EL8 A;  3CTG A;  5J9C A;  1BF5 A;  3ZRE A;  1AW9 A;  3G9B A;  1NHY A;  4TXO B;  5EY6 A;  2FD3 A;  4L0U A;  5F05 A;  3ZLP A;  1FOH A;  2P5R A;  3GL5 A;  3VPT A;  4WEY A;  4J56 E;  2R2J A;  1Y1U A;  4ID0 A;  2B5E A;  2DJ3 A;  3L4N A;  2V41 A;  1SJ6 A;  4XHM A;  4MJB A;  1JLV A;  4FYB A;  4JR6 A;  5GSS A;  2B1L A;  2RII A;  2R3X A;  2IL3 A;  4LA1 A;  2HZE A;  3EMP A;  2ON5 A;  2XPE A;  4ZIL A;  4MA9 A;  3EUR A;  1WWJ A;  4NAX A;  5HQP A;  3DD3 A;  2PGT A;  2B6M A;  3LEF A;  4QL9 A;  2R5G A;  1GLP A;  4GWR A;  2YNX A;  2GT6 A;  1N2A A;  4GSN A;  3CMI A;  4ZB6 A;  4TVE A;  3TRP A;  2HZF A;  3IHG A;  2YP6 A;  5GAN D;  1EP8 A;  5A1N A;  3RHB A;  2OA7 A;  5IMC A;  2B3S A;  2WUL A;  1GNW A;  1Q98 A;  3VWU A;  1RK4 A;  5KN3 A;  2DBC A;  2WJU A;  3Q74 A;  4DSS A;  3L0H A;  2GZY A;  5E4W A;  5J47 A;  3E9J B;  4ECB A;  2OT3 A;  1XBS A;  1M3I A;  3TJK A;  5IMV A;  1TK5 B;  1K3L A;  3ERF A;  1EGR A;  3R2Q A;  3R3E A;  1GNE A;  3KMN A;  2C3T A;  4KDX A; 
#chains in the Genus database with same CATH homology
 3N5O A;  1FO5 A;  1A23 A;  2CA8 A;  5IQY A;  4FO5 A;  2R0P A;  2H6Y A;  4NWY A;  5IO2 A;  1B4P A;  2VL2 A;  4TR0 A;  1BQ7 A;  1J08 A;  1X9W B;  3DEX A;  2EIR A;  3IOS A;  1PRX A;  5C04 A;  4MP4 A;  1GSS A;  2GQL A;  1K0D A;  5IPG A;  2K9F A;  3A2X A;  4EXJ A;  3F6D A;  2PMT A;  4JZQ A;  3HHV A;  2PU9 C;  2UV8 G;  1V9W A;  4KDU A;  1TW9 A;  1EOG A;  3QR6 A;  4X43 A;  5BMU A;  4EO3 A;  1N8J A;  2K6V A;  2HQT A;  5DAL B;  1LBK A;  3QFB C;  4I5Q A;  2L6D A;  2VL3 A;  1GUH A;  5G1K A;  1ERU A;  2YWN A;  2H73 A;  2B7K A;  2CAI A;  1G6W A;  4K0N A;  1BAY A;  2KOK A;  3MNG A;  2MBS A;  2FA4 A;  1YKC A;  2R6K A;  5EVO A;  2WB9 A;  1Z7R A;  1T4Z A;  2H0G A;  4X1U A;  1DE1 A;  4FYC A;  4N0Z A;  3PR8 A;  3TJF A;  3DVW A;  1RQM A;  1YF0 A;  4JED A;  5F07 A;  3TOU A;  1PL1 A;  3V1W A;  2CZ2 A;  2HE3 A;  2OE3 A;  3TKQ A;  4PUF C;  4ICY A;  4TR1 B;  5DAK A;  2H71 A;  4USS A;  2R0G A;  4O5U A;  3ZMK A;  5CRE A;  4MPF A;  2OKA A;  4HDE A;  3ZZX A;  4O5R A;  1PKZ A;  3P2A A;  1SKR B;  3M9K A;  2OE0 A;  4Z2R A;  3A2V A;  1FHE A;  5ENU A;  4F82 A;  1SL0 B;  4D73 B;  3MDK A;  1YEP A;  4IEL A;  3QD9 A;  5COH A;  3BCK A;  3FHK A;  4KCE A;  1O8X A;  4ZL7 A;  2TIR A;  1V2A A;  1PMT A;  1K0B A;  5ELG A;  1MD4 A;  1TI3 A;  1YVL A;  3C7M A;  2PN8 A;  1K0O A;  4XCS A;  1T8E B;  4EDY A;  2QGV A;  2XBQ A;  4GXZ A;  1T3B A;  3TJJ A;  4TW5 A;  3ZVJ A;  2VAF A;  4AJ8 A;  1ZYQ B;  1B8X A;  5DCG A;  4NV5 A;  3ZL5 A;  2F8F A;  4GQF A;  3TKS E;  1USB A;  2GT5 A;  5CRD A;  4WR4 A;  5GST A;  4Z2T A;  3IAS 2;  4POB A;  3HY2 A;  4ML6 A;  1THX A;  4HU9 A;  1F6M C;  2JSY A;  1Z9H A;  2FNO A;  2PVO C;  3ZRD A;  4FIW A;  3GH6 A;  3P90 A;  4OMV A;  1GTA A;  3D4T A;  1A2M A;  1SU9 A;  1FB6 A;  4HOJ A;  4OO4 A;  2DJK A;  4V2M A;  4ZBD A;  4K7I A;  11GS A;  4MCU A;  2YCD A;  4IP6 A;  3EE2 A;  1GRX A;  1K0N A;  1Z7P A;  3GH9 A;  2HRA A;  4AKX B;  3E3E A;  3WGE A;  3F4T A;  4MF5 A;  3GKM A;  1ERT A;  2HSM B;  1ZYN A;  2LUS A;  5L71 A;  2VCZ A;  4CW9 A;  1V40 A;  3BOA A;  4HU7 A;  2HSY A;  1KEB A;  1FOV A;  1BG5 A;  1XFL A;  3MWH A;  1E6B A;  5D9W A;  3KMO A;  3F3R A;  3DGQ A;  5D9X A;  4RI7 A;  4HJ2 A;  4ZBA A;  2XBI A;  2I81 A;  3GX8 A;  1VRS D;  4KAE A;  4BVY B;  1FAA A;  4EVM A;  3GKX A;  6GSU A;  1Y6E A;  3KM6 A;  1GWC A;  3BBY A;  1EGO A;  3UEM A;  5J4Y A;  1OE7 A;  4N3Z A;  5JWQ B;  1XCC A;  3DML A;  2M72 A;  2AUV A;  4NPB A;  5ECO B;  1SKW B;  3PPU A;  1A8L A;  4MLY A;  2LNT A;  1UA5 A;  3DXB A;  3US3 A;  2LJA A;  1TXX A;  1C72 A;  2K18 A;  1S3D A;  1FW1 A;  2HNL A;  3RAZ A;  1QMV A;  2H1A A;  2DJ0 A;  4MZC A;  2L6C A;  3VK9 A;  3TKP A;  3ZTL A;  4ZIJ A;  5ECN B;  4MDC A;  3FZ4 A;  4ECJ A;  3APQ A;  4TKY A;  2X99 A;  4J57 E;  5D8I A;  3TKR A;  3RBT A;  4ZL9 A;  2IMK A;  1FG4 A;  1HNA A;  2CV4 A;  1TXU A;  3FMW A;  1OAZ A;  2J23 A;  2IPA A;  2VL2 C;  3A5W A;  3UVH A;  4ZB9 A;  1VGL A;  3VLN A;  5HR0 A;  3FR6 A;  5HFG A;  4MJE A;  5ABR A;  1X9S B;  2GSQ A;  1YY7 A;  3L9U A;  1TTZ A;  3GKN A;  1BYE A;  3G7J A;  4OCE A;  3GNJ A;  2XC2 A;  1ZZY A;  2YOI A;  1R5A A;  1AC1 A;  3L9V A;  3U6V A;  1O7U A;  2EFC A;  2H76 A;  1F2E A;  1NSW A;  2GZZ A;  4WR5 A;  3CSI A;  2X8G A;  3FZA A;  3IAM 2;  1OKT A;  2FWF A;  1G6Y A;  3FYG A;  4PTS A;  3UOM A;  3A5I A;  2V6K A;  1AAZ A;  3UIW A;  2H19 A;  4WBR D;  2H30 A;  3UL3 A;  4RUV A;  2M80 A;  3SWL A;  2AYT A;  3FR3 A;  4ECI A;  3APO A;  5G31 A;  3IHQ A;  4IHU A;  1SYX A;  2RLI A;  1SD9 A;  1EP7 A;  1GSU A;  2GVP A;  4OWY A;  4OO5 A;  4EDZ A;  2IN3 A;  1K3Y A;  2IMD A;  2YAN A;  2OBI A;  3F4S A;  3G7Y A;  3FKF A;  3GSS A;  1PQN A;  1WMJ A;  3Q6O A;  2G2Q A;  3GTU B;  2VCX A;  2IIY A;  2L4C A;  2O89 A;  1PA3 A;  1MEK A;  1OC9 A;  5KOX A;  2LJR A;  3F6F A;  5IMA A;  5KN0 A;  4KB3 A;  1Z6N A;  3H4K A;  2EIQ A;  1M0U A;  3W8J A;  5B8A A;  5H5S A;  5KN1 A;  4IKH A;  1BG1 A;  4CDO A;  3KD0 A;  3UBL A;  1XWB A;  2VD0 A;  1TU7 A;  2VKZ G;  2EFH A;  2MMO A;  3HVX A;  3IPZ A;  4K7O A;  2C0D A;  4K7N A;  4V1A g;  4PXO A;  3NZN A;  2PVQ A;  1MTC A;  2LQQ A;  2FGX A;  1GSQ A;  2H0I A;  3GMF A;  4TR1 A;  5B7C A;  4MNN A;  2YWM A;  4BA7 A;  2X49 A;  3UAP A;  3K8N A;  1GTU A;  3UVT A;  1NHO A;  1QK8 A;  2QSI A;  2C8U A;  4EE0 A;  4D73 A;  2X4A A;  2RUF A;  4AGS A;  2GZP A;  4NHZ A;  3DKS A;  2NBS A;  1SK0 A;  2VD1 A;  1URM A;  1M99 A;  2O85 A;  4L0W A;  2H74 A;  3F8U A;  3DIE A;  3DWV A;  4NHW A;  5A5K A;  2JAC A;  1GL8 A;  3F0I A;  5A4U A;  4HJM A;  3I69 A;  2DSA A;  3TRX A;  2H70 A;  12GS A;  4PX1 A;  3VI5 A;  3BJ5 A;  4QMK A;  2VOC A;  3U5R E;  2GSR A;  1FVJ A;  3OR5 A;  4IGJ A;  1ACV A;  3I6A A;  16GS A;  2B7J A;  2MBT A;  2KP1 A;  4I97 A;  9GSS A;  1PX6 A;  4BL7 B;  2H72 A;  3KJY A;  2LTK A;  4MJA A;  1SL2 B;  2EFE A;  1NM3 A;  3LWA A;  2DKI A;  3RPP A;  2O8V B;  3P7X A;  2C0E A;  3KH7 A;  1A0F A;  5JWO B;  2QA2 A;  1XWA A;  3ERW A;  1F9M A;  4KF9 A;  2RUE A;  3ZIV A;  1X0R A;  6GSX A;  3FW2 A;  4KSM A;  3MYD A;  2FCH A;  2X8C A;  2L5L A;  2I1U A;  1G0T A;  3ZIT A;  1A24 A;  4JR4 A;  1ON4 A;  1SVO A;  2C0G A;  4QQ7 A;  2HFD A;  2HSM A;  6GSV A;  2GTU A;  4L5L A;  4JU5 A;  2OBK A;  1U87 A;  1YEX A;  3HVS A;  1WIK A;  3EC3 A;  2VIM A;  4HQS A;  1T7P B;  1K0M A;  2QC7 A;  3WD6 A;  1SEN A;  2DIY A;  3CSJ A;  2A2S A;  2MZC A;  1ABA A;  4G9H A;  5ELA A;  5CP1 A;  4BWQ A;  1GSE A;  4CHS A;  1J9B A;  1PD2 1;  3EU3 A;  5A34 B;  3FY7 A;  2H0H A;  1S3A A;  2NDO A;  3F3Q A;  1JZR A;  5J3R A;  1T1V A;  1I9D A;  2XHF A;  2OE1 A;  3VPQ A;  1A8Y A;  2M46 A;  5AGY A;  4N11 A;  3DYR A;  2A2P A;  3HD5 A;  3KP8 A;  2DMM A;  3IA1 A;  3HCZ A;  5HFK A;  3D22 A;  1EWX A;  1JHB A;  3FR9 A;  3EU4 A;  3IDV A;  3ME8 A;  2V2G A;  4FH8 A;  2JZR A;  4MH3 A;  2C80 A;  4POK A;  3FZ9 A;  1EEJ A;  4I2T A;  3ZIJ A;  3TU3 B;  4AKG A;  2YWI A;  22GS A;  3GRX A;  2LST A;  5J40 A;  5J41 A;  3TDG A;  1V98 A;  1M9B A;  2NVL A;  2VLV A;  2EC4 A;  4IJ3 A;  3TKS A;  3ME7 A;  2CVB A;  5AN1 A;  1PGT A;  4FYU A;  2REM A;  4KUN A;  1F3B A;  3VUR A;  3HYP A;  1M2A A;  10GS A;  3QAG A;  1YKA A;  1X9M B;  4A5P A;  5HR2 A;  4LLR A;  2O7K A;  1QXH A;  3KGK A;  4ZL8 A;  4YKF A;  3EVI A;  5D73 A;  2PBJ A;  1TKD B;  3PH9 A;  2ES7 A;  3I9V 2;  1TRW A;  4YKG A;  4ZB8 A;  2R0C A;  2GDR A;  4L8E A;  1ERW A;  2RM5 A;  1ZYE A;  1X5C A;  2IWT A;  4KX4 A;  3HJP A;  1EV4 A;  3GFK A;  2I3Y A;  3VI7 A;  4XS4 A;  5IMZ A;  2DJ1 A;  4K5S A;  4WKW A;  2K8S A;  4IBP A;  4OD7 A;  4DVC A;  2HZE B;  4AKH A;  4I2U A;  1DUG A;  2CX4 A;  1DE2 A;  4KCA A;  3TCO A;  3ZML A;  2QA1 A;  2N5F A;  1CQH A;  2IFQ A;  2YZH A;  3HMJ G;  3M9J A;  3QCP A;  2TRC P;  5E59 A;  2F9S A;  5CNW A;  5F8B A;  4WXT A;  2VM2 A;  3BD2 A;  6GSW A;  2J9H A;  3GIX A;  4EKZ A;  2E7P A;  3A2W A;  3HZ4 A;  1YJ6 A;  1V58 A;  4O7H A;  4IQ1 A;  4F2I A;  4AF2 A;  1THO A;  4YH2 A;  1KBN A;  3LXT A;  4ZBB A;  3EIN A;  3UBK A;  1BX9 A;  3AY8 A;  4LL1 B;  4OFT A;  3MSZ A;  4ULX A;  3QPM A;  3ERG A;  1Z6M A;  3TJG A;  1B4Q A;  3E0U A;  5DJL A;  1V57 A;  4EUY A;  5A5H B;  4IQA A;  5D93 A;  3M3M A;  3WYW A;  1XWC A;  2VCV A;  3CWG A;  2LKU A;  2YPM A;  3IK7 A;  4EL1 A;  1F37 A;  4GSS A;  1OVN A;  2HI7 A;  2IMI A;  4Q5Q A;  2WS2 A;  3KP9 A;  1N25 A;  3GUS A;  4GST A;  5AIX A;  3WGX A;  4K2X A;  5BMU B;  2VM1 A;  2VLU A;  4GQC A;  4RQR A;  1O8W A;  4PNG A;  4MZW A;  4TXO A;  2V32 A;  1GSD A;  2E2G A;  4CY6 A;  1XOA A;  1TK8 B;  2JL4 A;  4POM A;  3FZ5 A;  1U3A A;  18GS A;  2X8H A;  5CRW A;  4PUR A;  4K2D A;  3A3T A;  4KDY A;  3EWL A;  2LNS A;  1OYJ A;  1K0A A;  2O5V A;  5G5F A;  2G0F A;  2N5A A;  3J7Y b;  5FT3 A;  4TXV A;  5JWR B;  1R4W A;  1EEM A;  5ECI B;  1K3O A;  1TRS A;  5FWG A;  2P31 A;  2LRT A;  4OFN A;  2KUC A;  4Z7X A;  2I4A A;  1XOB A;  2PUK C;  1B9X C;  4G0L A;  4LMW A;  4V2N A;  4ACS A;  1XVQ A;  1K0C A;  2A2R A;  3QOU A;  6GSS A;  4K1F A;  5INY A;  1WE0 A;  3H1N A;  4MF7 A;  5AIV A;  2LRC A;  2AJQ B;  2YV7 A;  4XIH A;  4JBB A;  3BCI A;  5J4U A;  1PN0 A;  5D96 A;  5KEJ A;  1B9Y C;  1ZMA A;  2WZ9 A;  3H8Q A;  1SVL A;  3P8W A;  4K9Z A;  1IYH A;  1GTB A;  5ECL B;  2ZNM A;  4BL7 A;  1G7E A;  1M9A A;  5D9T A;  2MMA A;  3IK9 A;  3TB2 A;  17GS A;  5IM9 A;  3KIJ A;  3DVX A;  4QL7 A;  3FRC A;  2H66 A;  1S3C A;  2VUP A;  1XVW A;  4BWS A;  2BJX A;  4MZB A;  5IMF A;  2E2M A;  2FLS A;  4G10 A;  4XRA A;  2B5Y A;  2ON7 A;  1PSQ A;  3VWV A;  5CRG A;  2JAD A;  5B6M A;  2H6X A;  1YQ1 A;  5ECK B;  2DJJ A;  1X5E A;  2H1D A;  2JZT A;  1BED A;  4GF0 A;  5IPH A;  3HZ8 A;  1LU4 A;  3EMX A;  2CX3 A;  5ID2 B;  2GSS A;  1ERV A;  4XS6 A;  1TRV A;  3GHA A;  4L5O A;  5DAL A;  2A4V A;  3HKR A;  5C00 A;  1SL1 B;  5CRH A;  3IXR A;  1KTE A;  3WT1 A;  3G7I A;  5A34 A;  1MDJ A;  3TUE A;  1VF3 A;  1DSB A;  2P0G A;  2GQK A;  2MMZ A;  2DML A;  4F0B A;  4I6X A;  1HYU A;  1GTI A;  5FHI A;  1MDK A;  4RQX A;  2NPB A;  4Q5F A;  4NMU A;  4G0I A;  3GV1 A;  1R26 A;  1GSF A;  4YQV A;  8GSS A;  1XW9 A;  3HDC A;  4O5Q A;  5DDL A;  2YJ7 A;  3FEU A;  4AKI A;  2L5O A;  2IMF A;  2OAD A;  5G2Z A;  5F0G A;  1LJR A;  3HXS A;  5ECH B;  1AQX A;  5LCZ A;  2KHP A;  3HJM A;  2CVD A;  5CYY A;  1WPI A;  1B48 A;  1J0F A;  4BVX B;  1SJI A;  4YQM A;  1R5P A;  5IO0 A;  3IE3 A;  2DIZ A;  1EOH A;  3O3T A;  4I8B A;  2VO4 A;  1ILO A;  2HRN A;  4CY8 A;  2L4Q A;  1I5G A;  3D6I A;  4N10 A;  14GS A;  5JCW A;  4EF0 A;  4KND A;  3ZFB A;  2CAQ A;  1ST9 A;  1TK0 B;  1JZO A;  2VCQ A;  3IC4 A;  3CRU A;  1AQV A;  3CRT A;  2FHE A;  1XIY A;  1Y25 A;  5G30 A;  5DCH A;  3PGT A;  3Q19 A;  20GS A;  2GST A;  2L59 A;  3LQ7 A;  2GLR A;  4G01 A;  1TOF A;  2PWJ A;  3H79 A;  2Z9S A;  4XTS A;  2VCT A;  4YAV A;  1U88 A;  4W66 A;  2LJK A;  5CO3 A;  5G1L A;  2LS5 A;  1QQ2 A;  4KH7 A;  2DLX A;  1SKS B;  19GS A;  4TRX A;  2C4J A;  3GUR A;  3IC8 A;  4OFM A;  3QDN A;  13GS A;  4AI6 A;  1XWK A;  2V1M A;  1GLQ A;  2FUG 2;  3RHC A;  1E2Y A;  2WCI A;  1W4V A;  3KCM A;  1VF2 A;  1O6J A;  1XW6 A;  2TRX A;  4P3Y B;  3D4M A;  1UVZ A;  2HLS A;  1A2L A;  2OJL A;  3NIV A;  3KH9 A;  4ECC A;  5A5H A;  1AQW A;  5IOX A;  1SVM A;  4E68 A;  5EPF A;  4G2E A;  5BRT A;  5LD0 A;  4PGT A;  2I9H A;  1PL2 A;  1JZW A;  1OE8 A;  4O92 A;  3KZQ A;  1FVK A;  1HNB A;  3W8S A;  4TR4 A;  1X5D A;  6GSY A;  2LRN A;  4PQ1 A;  5JCU A;  2LEG A;  4KW6 A;  1IYI A;  4BVY A;  3LG6 A;  3EYT A;  5H5R A;  5DQS A;  4EIQ A;  2F51 A;  5JCG A;  1OC9 B;  2FY6 A;  4YAP A;  5GAP D;  3HJO A;  2HSN B;  4TR3 A;  2DKH A;  2E0Q A;  2HRK B;  3QMX A;  1XWG A;  5J4V A;  1JFU A;  1H4O A;  1SK2 A;  3ZVJ D;  2QKE A;  4IN0 A;  1M2D A;  3ZFL A;  4MF6 A;  4X0X A;  2IJY A;  1TP9 A;  1WOU A;  5A4W A;  2F8A A;  3VWW A;  1O85 A;  1FB0 A;  1A0R P;  2FWG A;  2O87 A;  5J9B A;  2LV3 A;  1SD8 A;  3GKK A;  3ZYW A;  2ZUP A;  2HSH A;  3IR4 A;  4J2F A;  3IV4 A;  3L78 A;  5F06 A;  1ZGN A;  1WJK A;  4JE1 A;  4IVF A;  3M0F A;  5ECQ B;  2JSZ A;  2CVK A;  5DJM A;  4MAB A;  4Q5N A;  2H01 A;  2V6O A;  1O73 A;  5G5E A;  2YJH A;  2C3Q A;  3KTB A;  3LFL A;  3CXG A;  3UMA A;  4JRR A;  1KNG A;  4K6X A;  1ZYP A;  3KEB A;  5KN2 A;  2JU5 A;  4HS1 A;  3VWX A;  3D21 A;  2L57 A;  2C1Y A;  1NW2 A;  5H5Q A;  1SK1 A;  4GDF A;  2YN1 A;  3GYK A;  1TJD A;  4PQI A;  3GX0 A;  1JLW A;  2H8L A;  3RDW A;  4HEA 2;  2XPD A;  1G7O A;  1XW5 A;  4HI7 A;  3ED3 A;  3KTL A;  2JZS A;  4YQU A;  4LMV A;  3UAR A;  5HR1 A;  1GH2 A;  2VLT A;  4POL A;  3TGZ A;  2WGR A;  3W6G A;  4EIP A;  1AUC A;  4HQZ A;  5HFI A;  1Z3E A;  3LYK A;  2AV4 A;  1GSY A;  2P5Q A;  1UC7 A;  5A1N B;  5J5N A;  1HD2 A;  4ZB7 A;  4WF5 A;  4DSS B;  2VCW A;  3TOT A;  1U6T A;  3L9S A;  3C1S A;  2GQM A;  4ML1 A;  5B8B A;  4N0V A;  2HYX A;  1OC3 A;  1XPV A;  3C71 A;  4ILF A;  3EPT A;  4AJ7 A;  5LNK e;  1PN9 A;  3PIN A;  3ISO A;  2H1G A;  2YWO A;  4GLT A;  2LQO A;  4MH2 A;  1GUK A;  1W89 A;  4GTU A;  4G0K A;  1JZD A;  5ID2 A;  2EIO A;  4ISD A;  4TN8 A;  3GTU A;  2CQ9 A;  2PER A;  2BMX A;  1GP1 A;  1MD3 A;  3HVV A;  1TU8 A;  2NTO A;  4XS1 A;  1AXD A;  2VL9 A;  1ZL9 A;  3LYP A;  1QGV A;  2AAW A;  4RI6 A;  2R4V A;  4K0G A;  2HT9 A;  3GA4 A;  4NV2 A;  2MYG A;  3J7Y k;  4Q5R A;  4V2L A;  5B6N A;  1U3I A;  3C1R A;  3SBC A;  2FA8 A;  2ALB A;  4OCF A;  4DSQ A;  4K8M A;  3GL3 A;  2B1K A;  2KLX A;  2X64 A;  4DSR A;  3VFI A;  2MMN A;  1RW1 A;  2B5X A;  2DC5 A;  2EFD A;  3MIX A;  1T00 A;  3F63 A;  1A2J A;  3NOF A;  5ECR B;  1DBY A;  5KOW A;  4WBJ A;  4F9Z A;  1ZCP A;  4WET A;  3QAW A;  3KXO A;  2K8V A;  5IIZ A;  4BVX A;  1TDI A;  4KA0 A;  4PUA A;  7GSS A;  2GS3 A;  3WGD A;  4IW9 A;  1SJZ A;  1ML6 A;  1QUW A;  4DEJ A;  1TI1 A;  4H86 A;  2WFC A;  2PPT A;  1TRU A;  2R37 A;  4V1A p;  1GUL A;  2FWE A;  5CAX A;  3Q18 A;  4G19 A;  4HZ4 A;  5AIS A;  4ZXG A;  1EV9 A;  2YZU A;  3DRN A;  5DAK B;  2H75 A;  4O32 A;  3GN3 A;  3WT2 A;  5ECP B;  3H93 A;  5HR3 A;  5DQY A;  4EC0 A;  1T4Y A;  3CTF A;  4AJ6 A;  4IS0 A;  3O6T A;  1GUM A;  4IJI A;  4WF4 A;  2D2Z A;  5IOW A;  1Z5Y E;  4MJC A;  3CBU A;  2HXK A;  3S9F A;  1H75 A;  2HRF A;  3UJ1 A;  1BJX A;  6GST A;  3LXZ A;  2OAC A;  2AHE A;  2WDU A;  2FWH A;  4Z2U A;  2WRT A;  1YZX A;  4XS4 B;  1CQG A;  1OC8 A;  1VF4 A;  1PX7 A;  1M7T A;  2H6Z A;  3RPN A;  5GZZ B;  1PKW A;  3I43 A;  4XRD A;  2IME A;  1EZK A;  2F3M A;  5ECM B;  2YV9 A;  4FQU A;  4PQH A;  3CSH A;  4MMM A;  4F0C A;  2N5B A;  3TRQ A;  3F9U A;  1MDI A;  1R7H A;  3TJB A;  3MAK A;  2GGT A;  4TOP A;  2IFQ B;  3QAV A;  4LL4 B;  5DVB A;  4N30 A;  1AIU A;  3C73 A;  3LGC A;  5DBQ A;  3C8E A;  3LOR A;  2C0F A;  3D5J A;  1YDK A;  3M1G A;  1OKD A;  3IBH A;  1ZOF A;  1WP0 A;  4IP1 A;  4BPY A;  3GST A;  3M8N A;  1O81 A;  4X4J A;  4E8H A;  2ZCT A;  1HNC A;  1XZO A;  3LJR A;  2A4H A;  1YF1 A;  3IRA A;  1Q4J A;  5IMD A;  4HZ2 A;  3TKS C;  1QFN A;  2CT6 A;  3JCM L;  1SYR A;  2RM6 A;  2C3N A;  3APS A;  2H1L A;  2BTO T;  1HQO A;  3LW9 A;  4F03 A;  4KSO A;  3QFA C;  4E8E A;  1M2B A;  3D0Z A;  2DJ2 A;  4HUA A;  4MPG A;  4GCI A;  4KGI A;  3CYN A;  3LSZ A;  2HSN A;  3O76 A;  5D9V A;  1WRY A;  5A4V A;  2HRK A;  4GRF A;  3N9J A;  2KP2 A;  2AB6 A;  4K5R A;  4PNF A;  3HA9 A;  2UZ8 A;  1UN2 A;  3F4R A;  1VF1 A;  3FK8 A;  4NXI A;  2H1B A;  4MK3 A;  1XXU A;  4KE3 A;  2CZ3 A;  1F3A A;  5ECS A;  5EL8 A;  3CTG A;  5J9C A;  1BF5 A;  3ZRE A;  1AW9 A;  3G9B A;  1NHY A;  4TXO B;  5EY6 A;  2FD3 A;  4L0U A;  5F05 A;  3ZLP A;  1FOH A;  2P5R A;  3GL5 A;  3VPT A;  4WEY A;  4J56 E;  2R2J A;  1Y1U A;  4ID0 A;  2B5E A;  2DJ3 A;  3L4N A;  2V41 A;  1SJ6 A;  4XHM A;  4MJB A;  1JLV A;  4FYB A;  4JR6 A;  5GSS A;  2B1L A;  2RII A;  2R3X A;  2IL3 A;  4LA1 A;  2HZE A;  3EMP A;  2ON5 A;  2XPE A;  4ZIL A;  4MA9 A;  3EUR A;  1WWJ A;  4NAX A;  5HQP A;  3DD3 A;  2PGT A;  2B6M A;  3LEF A;  4QL9 A;  2R5G A;  1GLP A;  4GWR A;  2YNX A;  2GT6 A;  1N2A A;  4GSN A;  3CMI A;  4ZB6 A;  4TVE A;  3TRP A;  2HZF A;  3IHG A;  2YP6 A;  5GAN D;  1EP8 A;  5A1N A;  3RHB A;  2OA7 A;  5IMC A;  2B3S A;  2WUL A;  1GNW A;  1Q98 A;  3VWU A;  1RK4 A;  5KN3 A;  2DBC A;  2WJU A;  3Q74 A;  4DSS A;  3L0H A;  2GZY A;  5E4W A;  5J47 A;  3E9J B;  4ECB A;  2OT3 A;  1XBS A;  3TJK A;  5IMV A;  1TK5 B;  1K3L A;  3ERF A;  1EGR A;  3R2Q A;  3R3E A;  1GNE A;  3KMN A;  2C3T A;  4KDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...