3GTUB

Ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
224
structure length
224
Chain Sequence
SCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 224
sequence length 224
chains with identical sequence D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3gtuB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gtuB01
1GLPA 5IMVA 3HVXA 3QFAC 5IMAA 3L9VA 2L59A 3LJRA 1HYUA 3F4TA 4F0BA 3VWXA 4JE1A 2VLVA 3UVTA 1XW5A 2V6KA 4EKZA 1AQVA 4GF0A 4L0UA 4MLYA 3KH7A 1XWBA 4MJBA 4HU9A 1ERTA 5GSTA 4ZILA 2IMEA 16GSA 2IFQA 4ZBDA 4YQMA 2F3MA 3WD6A 5ID2B 3GYKA 5IOXA 5G1KA 4NHWA 3KXOA 3MSZA 3VWUA 3GN3A 2H74A 4F0CA 5GAND 1YY7A 4NPBA 2H1DA 3WT2A 3WGXA 4K0NA 3ZVJA 3GKNA 2QKEA 3E9JB 3TRXA 3VI7A 2DMMA 3GA4A 3LQ7A 4XS6A 5FWGA 2MMNA 4MDCA 1J9BA 4IP6A 1SYXA 1W89A 4KW6A 2X8GA 1EP7A 4NHZA 2HLSA 5CYYA 1QGVA 2HYXA 3L9SA 4AF2A 2DMLA 1FVKA 4ECBA 2VM2A 2LKUA 4N10A 1XWCA 1PX7A 2GQMA 5D93A 4POLA 1ML6A 5F05A 2PWJA 3IDVA 4OMVA 2LJRA 3R3EA 1GSFA 1K3LA 1WP0A 1JZWA 2O8VB 1TU7A 4J57E 2DJ0A 2IN3A 2WZ9A 5D9WA 4MJAA 5D73A 2ZUPA 1OC3A 22GSA 3RBTA 2GT6A 5JWQB 1I5GA 4BA7A 2JZRA 4CW9A 2ALBA 4MPFA 3HKRA 2XPDA 2L4CA 3WGDA 1U6TA 2LUSA 5CO3A 5JCUA 1PN9A 4I6XA 3ZVJD 5AISA 1R26A 3CSIA 5IMCA 2I4AA 1GTAA 3F3RA 1A23A 1M9BA 4KAEA 3GL5A 2YZUA 1Z9HA 2HRNA 4X0XA 3TOTA 2DIZA 2JZSA 4TXOA 4EXJA 3EMPA 1WPIA 1ZMAA 4NV2A 2HFDA 4D73A 3CXGA 5IO2A 3DWVA 5D8IA 5EVOA 3I43A 4HQZA 2FA8A 2E0QA 2C8UA 1LU4A 1B9XC 2J9HA 4BVYB 2JZTA 2VCXA 3TKPA 4HZ2A 1NHOA 1XIYA 4G0IA 3ME8A 4XTSA 2CZ2A 2B1LA 2RUFA 4EVMA 1DE1A 4GLTA 4XS4B 4AJ8A 2R37A 5CRHA 2OADA 1SK2A 4DSSA 2WB9A 5INYA 2CX3A 3TCOA 1C72A 1JLVA 4FIWA 5IM9A 1XW9A 2C80A 2FWEA 3ZLPA 4MF5A 1N2AA 1G7EA 4G9HA 3JCML 1NHYA 1Q98A 1OE8A 4PNGA 3APOA 4F9ZA 5CNWA 2OA7A 4ZBAA 1R4WA 1R5PA 3C71A 3L0HA 4KDXA 5JWOB 2PVQA 4CHSA 5GZZB 4DVCA 4Q5FA 1WRYA 1GUHA 2VUPA 3A5WA 2N5BA 3EU4A 4OCFA 5D9TA 1TRUA 1YDKA 2AUVA 3GX8A 2YWOA 4EF0A 5E4WA 2KHPA 3VI5A 1SL0B 2CV4A 4BWSA 3C8EA 2O89A 1BQ7A 3C7MA 3IE3A 4EO3A 3F63A 4PTSA 5ELAA 1X9MB 2FLSA 2K8VA 1A8YA 3GH9A 1O6JA 3VFIA 1AXDA 4IQAA 12GSA 1JZOA 1IYIA 1WWJA 3A3TA 2F8AA 2HT9A 3QPMA 4KE3A 1PRXA 4L8EA 2H75A 2ZCTA 4I8BA 3QAGA 4DEJA 1TP9A 1ZCPA 3BD2A 2HSNB 2F51A 2K8SA 1XBSA 3TRQA 1Z5YE 5GSSA 2R3XA 2XHFA 2V6OA 3KMNA 4MCUA 2H0HA 3LG6A 2C0DA 1PL2A 1Z6NA 1PA3A 1YZXA 2YP6A 4HOJA 4GSSA 4BL7B 4KDYA 1SD8A 18GSA 2OBIA 4WF5A 5ECKB 1USBA 3P90A 2GS3A 6GSXA 3IBHA 1BEDA 3HVVA 3HJPA 1X5CA 5J9BA 1PQNA 2FHEA 3LXTA 1XXUA 4EDYA 2PMTA 2X64A 3FR9A 4POBA 1MDJA 2H01A 1TK0B 2OJLA 2VO4A 4ID0A 1QK8A 2MMAA 3ZZXA 4ZB9A 1NM3A 3FZ5A 1PGTA 1M2BA 1PMTA 4ML6A 4OO4A 5F8BA 3GX0A 3A2WA 1VF1A 3D6IA 4N11A 5DBQA 1VF2A 1SJIA 2P5QA 2LQQA 3FHKA 3ED3A 3GNJA 6GSSA 2HZFA 2VL2A 5EY6A 3M8NA 3LSZA 1TW9A 3AY8A 2LNSA 5H5RA 3A2XA 3A2VA 3D5JA 4ZBBA 1GSQA 4BL7A 1V40A 5IQYA 1WJKA 4QL7A 3TJKA 1MDKA 5F0GA 1R5AA 4XHMA 1T3BA 2LJAA 1TJDA 2FD3A 2EIRA 1M7TA 2LV3A 4G0KA 4JZQA 4YQVA 1QMVA 1O73A 3GTUB 2OBKA 5DCHA 2WCIA 3IAM2 2YWMA 5ECHB 2LS5A 2GVPA 3GIXA 4EL1A 5LD0A 3GSTA 1GSYA 2VM1A 2GT5A 3KP9A 4IS0A 5COHA 3UVHA 4KB3A 2L6DA 3GKKA 4PXOA 1XVQA 1KEBA 3O76A 1FB0A 5B8BA 4BPYA 5CRWA 1FVJA 3QCPA 2DC5A 2MBSA 2H72A 1AAZA 2XBQA 2HSMA 3F9UA 4V1Ap 1A24A 3GUSA 2BTOT 4IJIA 1QFNA 1FOVA 4YH2A 3M3MA 5A4VA 2WS2A 2H76A 4E8EA 2IWTA 3TRPA 1GP1A 1TK5B 2WULA 3PINA 3RPPA 4MZCA 3OR5A 5AIXA 3TJBA 2C1YA 4POKA 3DMLA 2DSAA 5FHIA 2H8LA 1XOBA 1GLQA 3ERWA 2R5GA 1GUMA 3RPNA 4YQUA 2A2RA 2OACA 3IC8A 4PUAA 1GSSA 4LMWA 1Q4JA 2YANA 1WMJA 2XPEA 1H75A 1SYRA 1A2LA 2I81A 2VD0A 2P5RA 3NIVA 5CAXA 3KTBA 2KP2A 3UARA 4HUAA 4GQFA 1X9WB 2IFQB 3EU3A 1SL2B 4MJCA 1YF0A 5EL8A 3Q74A 4AJ7A 4MF7A 5KN2A 3W8SA 1LBKA 4IHUA 1M2AA 6GSUA 2GSRA 2E7PA 4XS1A 5ECLB 3FZ9A 1K0MA 2H0IA 1TKDB 2V1MA 4J56E 1W4VA 1ZGNA 4G10A 2B1KA 3ZL5A 1A0RP 3TKSE 1URMA 1T8EB 3H8QA 4DSQA 1TU8A 5ENUA 3D4TA 3LYKA 1XFLA 4JRRA 2FWGA 3VPQA 2VCWA 4ACSA 2PERA 1AQWA 1I9DA 3HZ8A 2YZHA 1OKDA 2GLRA 5G2ZA 2C3NA 2L57A 3CBUA 3MNGA 5DDLA 2B7KA 5G30A 1X0RA 2L4QA 3IC4A 1B9YC 2RIIA 2NDOA 1B48A 1XWGA 2HRFA 1ZZYA 5E59A 3QMXA 4GRFA 3EURA 2OKAA 2R6KA 4HQSA 2IMKA 1A2MA 2ZNMA 2XC2A 2H70A 1AIUA 3FR3A 1Z6MA 3DVXA 1BYEA 1O8WA 2QSIA 4KF9A 1VF4A 2CAQA 3Q18A 1UVZA 1NSWA 4PNFA 6GSYA 1Z3EA 4Q5NA 2D2ZA 5ECMB 2H1GA 3TJGA 1VRSD 2OE1A 2K6VA 3HYPA 4WBRD 1XW6A 3VLNA 4N0ZA 4FH8A 2DBCA 3TGZA 2A2SA 3KD0A 3LWAA 2AHEA 2O85A 2RLIA 3CRUA 1PL1A 4ILFA 4MF6A 1SK0A 4OD7A 2QGVA 4L5OA 2HQTA 4TXOB 3F8UA 1V58A 4KSMA 1OYJA 4ECIA 2IJYA 2J23A 4D73B 3GV1A 1JHBA 2V41A 5ABRA 4KCEA 1S3AA 2CZ3A 2HRKA 4HJ2A 1SKWB 2VLUA 1VF3A 3O3TA 8GSSA 3V1WA 1TTZA 1ILOA 2YWNA 4EC0A 2WDUA 4POMA 3H93A 5IMZA 2KP1A 2YN1A 5D9VA 4K1FA 2YOIA 5ECNB 1JLWA 2ON5A 1V98A 2HE3A 3PR8A 2PU9C 1SK1A 5DQYA 4DSSB 5ELGA 2IL3A 2QC7A 3P2AA 10GSA 3TJJA 1TRSA 2GZZA 3MDKA 1PKZA 3IK9A 2PBJA 4N30A 1GSDA 2IMDA 3DRNA 4IQ1A 5EPFA 1XWAA 5IPHA 2Z9SA 3WGEA 3HA9A 4IKHA 1OE7A 3HJOA 3KJYA 3APQA 2O7KA 2BMXA 3TKRA 3HZ4A 3NOFA 3G7JA 2G0FA 5ECRB 1SJ6A 4TR1A 2HI7A 4ZL8A 2MBTA 5ECSA 3HDCA 2VOCA 2HNLA 2B5XA 4TOPA 3F4SA 2LEGA 4K8MA 5DCGA 4TN8A 1A2JA 5IMFA 1ON4A 1EGRA 4RI6A 3TUEA 3K8NA 4IELA 1LJRA 3RAZA 1A0FA 4K2DA 3QD9A 3VK9A 2CX4A 4WR5A 2B5EA 2AYTA 5IOWA 5HFIA 2RM6A 1O85A 4WXTA 3N9JA 1U88A 1TXXA 5JCGA 2EIQA 4K9ZA 1EOGA 1EV9A 2M80A 3DIEA 3IR4A 4ZB6A 4IN0A 1EEMA 4ULXA 1IYHA 3J7Yb 1GH2A 2LQOA 1YKAA 2PPTA 2HZEA 5HFKA 1F2EA 4G2EA 5CRDA 2GZYA 3UIWA 4USSA 4IJ3A 5GAPD 1GWCA 2DJKA 3VWWA 1JZRA 2A4VA 2B3SA 5AIVA 2EIOA 3D21A 1XWKA 1AUCA 3GHAA 3R2QA 20GSA 5B8AA 3DKSA 2H0GA 4CDOA 4KUNA 4BWQA 1Y25A 1SD9A 19GSA 3G9BA 5DALA 3EC3A 4HZ4A 4PQHA 2WRTA 3GSSA 2C0FA 4TR0A 4GXZA 4ISDA 1UC7A 1K0CA 2L5OA 4O92A 4X43A 4J2FA 5BMUA 2R2JA 1A8LA 1EGOA 2V2GA 4BVXA 3C73A 4G0LA 1T00A 2LSTA 2CT6A 1U3IA 2XBIA 3J7Yk 3UBLA 3GH6A 3ERFA 5DVBA 4WF4A 3BOAA 1YEXA 4MZWA 1SKRB 4RQRA 5C00A 3O6TA 4K6XA 3CYNA 1HQOA 2AV4A 4MK3A 3PH9A 3S9FA 3KH9A 5ECPB 2B6MA 2O87A 4G19A 4FO5A 1RQMA 1X5DA 1MTCA 3KIJA 3ERGA 3HXSA 3W6GA 3ZITA 1K0AA 1K3YA 1XPVA 2LNTA 4HJMA 2TRCP 1K0DA 2HSMB 1UN2A 2B7JA 3FK8A 4K7OA 1B8XA 3HD5A 1F9MA 1J08A 2CVBA 4PUFC 1OC9A 3F3QA 3DEXA 3VURA 2C4JA 2IMFA 2K9FA 2PGTA 2C3QA 3GFKA 3CSHA 4KCAA 2YV9A 4EUYA 4OO5A 5KEJA 3UAPA 1V57A 2KOKA 2C0EA 1TRWA 4OFTA 3RDWA 3E0UA 1BAYA 2GQLA 2I9HA 5FT3A 4PGTA 4O5RA 4HI7A 1TDIA 2H6YA 2H30A 4OCEA 4TKYA 5IMDA 5G1LA 1GNWA 2H73A 4RUVA 1M9AA 2E2GA 1WOUA 1TI3A 2HRAA 1B4QA 4MH3A 3FKFA 1RK4A 2JSZA 3CTFA 4I97A 4PX1A 3GURA 3RHBA 3ZYWA 5J9CA 2P31A 4KGIA 3DVWA 5IIZA 1AW9A 4GSNA 3F0IA 3H4KA 2ON7A 3KMOA 2C3TA 3MWHA 3Q19A 5ECIB 1BX9A 4JR4A 1BJXA 4TW5A 1GULA 3KGKA 4V1Ag 1RW1A 1DSBA 1PSQA 2H66A 4XCSA 3DD3A 1SJZA 3ISOA 3CRTA 1GNEA 1YF1A 1T4YA 2FCHA 1OC8A 3TDGA 3HY2A 3IOSA 1V2AA 5HFGA 3LORA 4Q5QA 4WKWA 3APSA 1K0OA 5IPGA 1MD3A 3M9JA 3EVIA 5DAKA 4LA1A 2NPBA 4TXVA 3ZREA 4OWYA 4K7NA 1G0TA 2WFCA 3LGCA 3IPZA 1XCCA 2IIYA 2VLTA 4O7HA 1DBYA 1ZYEA 1ZL9A 2E2MA 1XOAA 2FWHA 1ACVA 3TKQA 1BG5A 1JZDA 4L5LA 4MMMA 2X8CA 4OFMA 5CREA 3U6VA 3D4MA 3P8WA 1G6YA 1GL8A 1Z7RA 5H5QA 4WR4A 1CQHA 1U3AA 5LNKe 3TKSC 1FW1A 5H5SA 3BCIA 5KN0A 3IRAA 3VWVA 2MMZA 4YAPA 2YCDA 4Q5RA 4MA9A 4RI7A 4OFNA 3LXZA 4AGSA 2NVLA 2DIYA 1CQGA 1MDIA 1GRXA 3M1GA 5B6NA 4HEA2 4FYCA 2HSYA 1SKSB 4WBJA 2P0GA 1YJ6A 2K18A 2VD1A 3ZRDA 1FG4A 4I2TA 4MZBA 2HRKB 4IBPA 4N0VA 4MPGA 1ABAA 4NXIA 3EE2A 3UBKA 2FUG2 3M0FA 5J41A 4GQCA 2JU5A 2L6CA 5L71A 3F6DA 3QOUA 1GSEA 4JU5A 2MZCA 2VL2C 5ECQB 2YJ7A 1WE0A 4TR3A 1X5EA 2LRCA 2VCTA 3UJ1A 3ZFBA 1F3AA 1FO5A 3IV4A 2PN8A 3L78A 3QFBC 4NWYA 1EZKA 3WT1A 4WETA 1O8XA 1Y6EA 4V2MA 2YPMA 3GMFA 5B7CA 3CMIA 4YAVA 1S3DA 1GSUA 9GSSA 3F4RA 2N5AA 3DYRA 2PUKC 4KA0A 3G7YA 2EC4A 1SENA 4HU7A 2CVDA 2VCQA 1XZOA 4F03A 4WEYA 1J0FA 3I9V2 1GTBA 3EWLA 2DJ2A 14GSA 1YKCA 2JL4A 3ZIJA 2AB6A 3Q6OA 1R7HA 1OAZA 1T1VA 6GSVA 3US3A 4NV5A 5C04A 2H1AA 4TR1B 1K0NA 2LTKA 5ID2A 3DGQA 4LL1B 4DSRA 2JSYA 2M46A 4ZB8A 1E6BA 2GQKA 3ZIVA 1KBNA 2JACA 3HCZA 4Z7XA 2CAIA 2GZPA 2B5YA 4TVEA 3VPTA 2GGTA 3BJ5A 2DJJA 4LL4B 1AQXA 3N5OA 4MP4A 5ECOB 3HVSA 4ZIJA 3CTGA 4JEDA 2FNOA 1HNBA 1B4PA 1ERUA 2TRXA 2H19A 2L5LA 4GTUA 3FZAA 1ERWA 3KTLA 17GSA 3QR6A 1O7UA 5J5NA 1OVNA 5CP1A 2DJ3A 4LLRA 2GSQA 4IGJA 1K0BA 1G6WA 4JBBA 4PQ1A 2GDRA 4I5QA 2CQ9A 2CA8A 3IK7A 3H79A 4ECJA 5HR3A 5HR2A 2HZEB 1QUWA 4P3YB 3TJFA 1EWXA 2X99A 2LRNA 4XRDA 3UEMA 3IHQA 3GKXA 2F8FA 2H1BA 4JR6A 2WJUA 3HHVA 7GSSA 3QAVA 4KDUA 4GSTA 1S3CA 4GWRA 1KNGA 4MABA 3UMAA 3TB2A 5LCZA 2C0GA 1H4OA 1M0UA 1U87A 5B6MA 5DALB 3ZFLA 4HDEA 3G7IA 2NTOA 4PQIA 3QAWA 5F06A 1TK8B 3LYPA 2HSHA 13GSA 3D0ZA 1E2YA 1ZOFA 4BVXB 1FHEA 3D22A 3LFLA 3PPUA 4F82A 3KEBA 1GUKA 3EYTA 2GSSA 4I2UA 4BVYA 5A4UA 2YWIA 1F6MC 1M99A 2OE0A 2BJXA 3UL3A 1EEJA 2TIRA 5HR0A 3WYWA 4XRAA 4O32A 4XS4A 2FWFA 5JWRB 4TRXA 1TRVA 1SU9A 3SWLA 1DUGA 1OKTA 2FA4A 1G7OA 1PD21 2VAFA 1OC9B 3W8JA 5HR1A 3BCKA 3IXRA 1V9WA 3FYGA 1K3OA 3TKSA 1JFUA 3FZ4A 3GL3A 1MD4A 5D9XA 1EOHA 3H1NA 3L9UA 1UA5A 2CVKA 4KX4A 2MYGA 2GTUA 2LJKA 1X9SB 2LRTA 4HS1A 3EMXA 3SBCA 2VL9A 2H6XA 3LEFA 2F9SA 3KZQA 3DXBA 3FR6A 1O81A 2AAWA 2VCVA 1TI1A 4E8HA 3CSJA 4KNDA 4QL9A 3BBYA 3FRCA 4AJ6A 2UZ8A 3I69A 5HQPA 4ECCA 2YV7A 3PGTA 4RQXA 5IO0A 4ZL9A 4V2NA 2VCZA 2FY6A 5AN1A 3P7XA 1F37A 3IA1A 5A4WA 2PVOC 2N5FA 6GSTA 2KUCA 2IMIA 2ES7A 2M72A 3ME7A 2IPAA 5KN1A 4FQUA 2NBSA 4NMUA 5CRGA 1HD2A 1N8JA 5J3RA 3FEUA 2KLXA 2RUEA 1ST9A 1FB6A 1DE2A 1F3BA 1VGLA 5G5EA 2X8HA 4QQ7A 2OE3A 4XIHA 2WGRA 4IP1A 1ERVA 4IVFA 1NW2A 4KH7A 3C1SA 3FW2A 2DLXA 3U5RE 4PURA 3HJMA 1KTEA 4X1UA 1QXHA 1QQ2A 5DAKB 4MJEA 5A5KA 3NZNA 4MH2A 3GKMA 4NAXA 1TOFA 5F07A 3KCMA 3ZMLA 1MEKA 1T7PB 5DJMA 1XVWA 1YQ1A 3EINA 4L0WA 4LMVA 4ZXGA 1YEPA 1WIKA 2H71A 2DJ1A 1PX6A 2G2QA 3C1RA 3ZTLA 1AC1A 4ML1A 4GCIA 1Z7PA 5AGYA 2JADA 5KN3A 3ZMKA 3QDNA 2FGXA 4FYUA 3I6AA 4KSOA 2REMA 2AJQB 3F6FA 2VL3A 1HNCA 3E3EA 1HNAA 11GSA 3UOMA 4FYBA 3IAS2 3GTUA 2HXKA 4TR4A 2V32A 1GTUA 4EE0A 2I3YA 2I1UA 3GRXA 1SL1B 3TOUA 3RHCA 1FAAA 2GSTA 5DQSA 3L4NA 3KP8A 4EDZA 4V2LA 5DJLA 4ZL7A 1EP8A 5G31A 4IW9A 4H86A 3M9KA 2MMOA 5G5FA 3FY7A 1ZYQB 4K7IA 1GTIA 1THOA 1THXA 4K0GA 2YJHA 2YNXA 2R4VA 3MAKA 1T4ZA 3KM6A 1PKWA 5D96A 2RM5A 1M2DA 1EV4A 6GSWA 5JCWA 2VIMA 2H6ZA 4F2IA 5J4UA
chains in the Genus database with same CATH superfamily
1GLPA 5IMVA 3HVXA 4AI6A 3QFAC 5IMAA 3L9VA 2L59A 3LJRA 1HYUA 3F4TA 4F0BA 3VWXA 4JE1A 2VLVA 3UVTA 1XW5A 2V6KA 4AKHA 4EKZA 1AQVA 4GF0A 4L0UA 4MLYA 3KH7A 1XWBA 4MJBA 4HU9A 1ERTA 5GSTA 4ZILA 2IMEA 4Z2TA 16GSA 2IFQA 4ZBDA 4YQMA 2F3MA 3WD6A 4AKIA 5ID2B 3GYKA 5IOXA 5G1KA 4NHWA 2QA2A 3KXOA 3MSZA 3VWUA 3GN3A 2H74A 4F0CA 5GAND 1YY7A 4NPBA 2H1DA 3WT2A 3WGXA 4K0NA 3TU3B 3ZVJA 3GKNA 2QKEA 3E9JB 3TRXA 3VI7A 2DMMA 3GA4A 3LQ7A 4XS6A 5FWGA 2MMNA 4MDCA 1J9BA 4IP6A 1SYXA 1W89A 4KW6A 2X8GA 1EP7A 4NHZA 2HLSA 5CYYA 1QGVA 2HYXA 3L9SA 4AF2A 2DMLA 1FVKA 4ECBA 2VM2A 2LKUA 4N10A 1XWCA 1PX7A 2GQMA 5D93A 4POLA 1ML6A 5F05A 2PWJA 3IDVA 4OMVA 2LJRA 3R3EA 1GSFA 1K3LA 1WP0A 1JZWA 2O8VB 1TU7A 4J57E 2DJ0A 2IN3A 2WZ9A 5D9WA 4MJAA 2WZSA 5D73A 2ZUPA 1OC3A 22GSA 3RBTA 2GT6A 5JWQB 1I5GA 4BA7A 2JZRA 4CW9A 2ALBA 4MPFA 3HKRA 2XPDA 2L4CA 3WGDA 1U6TA 2LUSA 5CO3A 5JCUA 1PN9A 4I6XA 3ZVJD 5AISA 1R26A 3CSIA 5IMCA 2I4AA 1GTAA 3F3RA 1A23A 1M9BA 4KAEA 3GL5A 2YZUA 1Z9HA 2HRNA 4X0XA 3TOTA 2O5VA 2DIZA 4N3ZA 2JZSA 4TXOA 4EXJA 3EMPA 1WPIA 4CY8A 2EFEA 4AKGA 1ZMAA 4NV2A 2HFDA 4D73A 3CXGA 5IO2A 3DWVA 5D8IA 5EVOA 3I43A 4HQZA 2FA8A 2E0QA 2C8UA 1LU4A 1B9XC 2J9HA 4BVYB 2JZTA 2VCXA 3TKPA 4HZ2A 1NHOA 1XIYA 4G0IA 3ME8A 4XTSA 2CZ2A 1XG8A 2B1LA 2RUFA 4EVMA 1DE1A 4GLTA 4G01A 4XS4B 4AJ8A 2R37A 5CRHA 2OADA 1SK2A 4DSSA 2WB9A 5INYA 2CX3A 3TCOA 1C72A 1JLVA 4FIWA 5IM9A 1XW9A 1ZYPA 2C80A 2FWEA 3ZLPA 4MF5A 1N2AA 1G7EA 4G9HA 3JCML 1NHYA 1Q98A 1OE8A 4PNGA 3APOA 4QMKA 4F9ZA 5CNWA 2OA7A 4ZBAA 1R4WA 1R5PA 3C71A 3L0HA 4KDXA 5JWOB 2PVQA 4CHSA 5GZZB 4DVCA 4Q5FA 1WRYA 1GUHA 2VUPA 3A5WA 2N5BA 3EU4A 4OCFA 5D9TA 1TRUA 1YDKA 2AUVA 3GX8A 2YWOA 4EF0A 5E4WA 2KHPA 3VI5A 1SL0B 2CV4A 4BWSA 3C8EA 2O89A 1BQ7A 3C7MA 3IE3A 4EO3A 3F63A 4PTSA 5ELAA 1X9MB 2FLSA 2K8VA 1A8YA 3GH9A 1O6JA 3VFIA 1AXDA 4IQAA 12GSA 1JZOA 1IYIA 1WWJA 3A3TA 2F8AA 2HT9A 3QPMA 4AKXB 4KE3A 1PRXA 4L8EA 2H75A 1PFOA 2ZCTA 4I8BA 3QAGA 4DEJA 1TP9A 1ZCPA 3BD2A 2HSNB 2F51A 2QA1A 2K8SA 1XBSA 3TRQA 1Z5YE 5GSSA 2R3XA 2XHFA 2V6OA 3KMNA 4MCUA 2H0HA 3LG6A 2C0DA 1PL2A 1Z6NA 1PA3A 1YZXA 2YP6A 4HOJA 4GSSA 4BL7B 4KDYA 1SD8A 18GSA 2OBIA 4WF5A 5ECKB 2X49A 1USBA 3P90A 2GS3A 1SVLA 6GSXA 3IBHA 1BEDA 3HVVA 3HJPA 1X5CA 5J9BA 1PQNA 2FHEA 3LXTA 1XXUA 4EDYA 2PMTA 2X64A 3FR9A 4POBA 1MDJA 2H01A 1TK0B 2OJLA 2UV8G 2VO4A 4ID0A 1QK8A 2MMAA 1TXUA 3ZZXA 4ZB9A 1NM3A 3FZ5A 1PGTA 1M2BA 1PMTA 4ML6A 4OO4A 5F8BA 3GX0A 3A2WA 3RGBC 1VF1A 3D6IA 4N11A 5DBQA 1VF2A 1SJIA 2P5QA 2LQQA 3FHKA 3ED3A 3GNJA 6GSSA 2HZFA 2VL2A 5EY6A 3M8NA 3LSZA 1TW9A 3AY8A 1M3JA 2LNSA 5H5RA 3A2XA 3A2VA 3D5JA 4ZBBA 1PN0A 1GSQA 4BL7A 1V40A 5IQYA 1WJKA 4QL7A 4E68A 3TJKA 1MDKA 5F0GA 1R5AA 4XHMA 1T3BA 2LJAA 1TJDA 2FD3A 2EIRA 1M7TA 2LV3A 4G0KA 4W66A 4JZQA 4YQVA 1QMVA 1O73A 3GTUB 2OBKA 5DCHA 2WCIA 3IAM2 2YWMA 5ECHB 2LS5A 2GVPA 3GIXA 2H1LA 4EL1A 5LD0A 3GSTA 1GSYA 2VM1A 2GT5A 3KP9A 4IS0A 5COHA 3UVHA 4KB3A 2L6DA 3GKKA 4PXOA 1XVQA 1KEBA 3O76A 1FB0A 5B8BA 4BPYA 5CRWA 1FVJA 3QCPA 2DC5A 2MBSA 2H72A 1AAZA 2XBQA 2HSMA 3F9UA 4V1Ap 1A24A 3GUSA 2BTOT 2OT3A 4IJIA 1QFNA 1FOVA 4YH2A 3M3MA 5A4VA 4K5RA 2WS2A 2H76A 4E8EA 2IWTA 4ZB7A 3TRPA 1GP1A 1TK5B 2WULA 3PINA 3RPPA 4MZCA 3OR5A 5AIXA 3TJBA 2C1YA 4POKA 3DMLA 2DSAA 5FHIA 2H8LA 1XOBA 1GLQA 3ERWA 2R5GA 1GUMA 3RPNA 4YQUA 2A2RA 2OACA 3IC8A 4PUAA 1GSSA 4LMWA 1Q4JA 2YANA 1WMJA 1S4BP 2XPEA 1H75A 1SYRA 1A2LA 2I81A 2VD0A 2P5RA 3NIVA 5CAXA 3KTBA 2KP2A 3UARA 3CWGA 4HUAA 4GQFA 1X9WB 2IFQB 3EU3A 1SL2B 4MJCA 1YF0A 5EL8A 3Q74A 4AJ7A 4MF7A 5KN2A 1N25A 4EIQA 3W8SA 1LBKA 4IHUA 1M2AA 6GSUA 2A2PA 2GSRA 2E7PA 4XS1A 3FZ9A 5ECLB 1K0MA 2H0IA 1TKDB 2V1MA 2DKIA 4J56E 1W4VA 1ZGNA 4G10A 2B1KA 5KOWA 3ZL5A 1A0RP 3TKSE 1URMA 1T8EB 3H8QA 4DSQA 1TU8A 5ENUA 3D4TA 3LYKA 1XFLA 4JRRA 2FWGA 4PI2C 3VPQA 2VCWA 4ACSA 2PERA 1AQWA 1I9DA 3HZ8A 2YZHA 1OKDA 2GLRA 5G2ZA 2C3NA 2L57A 3CBUA 3MNGA 5DDLA 2B7KA 5G30A 1X0RA 2L4QA 3IC4A 1B9YC 2RIIA 2NDOA 1B48A 1XWGA 2HRFA 1ZZYA 4X4JA 5E59A 3QMXA 4GRFA 3EURA 2OKAA 2R6KA 4HQSA 2IMKA 1A2MA 2ZNMA 2XC2A 2H70A 1AIUA 3FR3A 1Z6MA 3DVXA 1BYEA 1O8WA 2QSIA 4KF9A 2WVXA 1VF4A 2CAQA 3Q18A 1UVZA 1NSWA 4PNFA 2WW0A 6GSYA 1Z3EA 4Q5NA 2D2ZA 5ECMB 5A34A 2H1GA 3TJGA 1VRSD 2OE1A 2K6VA 3HYPA 4WBRD 1I1IP 1XW6A 3VLNA 4N0ZA 4FH8A 2DBCA 2VKZG 3TGZA 2A2SA 3KD0A 3LWAA 2AHEA 2O85A 2RLIA 3CRUA 1PL1A 4ILFA 4MF6A 1SK0A 4OD7A 2QGVA 4L5OA 2HQTA 4TXOB 3F8UA 1V58A 4KSMA 1OYJA 4ECIA 2IJYA 2J23A 4D73B 3GV1A 1JHBA 2V41A 5ABRA 4KCEA 4CY6A 1S3AA 2CZ3A 2HRKA 4HJ2A 1SKWB 2VLUA 1VF3A 3O3TA 8GSSA 3V1WA 1TTZA 1ILOA 2YWNA 4EC0A 2WDUA 4POMA 3H93A 5IMZA 2KP1A 2YN1A 5D9VA 4K1FA 2YOIA 5ECNB 1JLWA 2ON5A 1V98A 2HE3A 3PR8A 2PU9C 1SK1A 5DQYA 4DSSB 5ELGA 2IL3A 2QC7A 3P2AA 10GSA 3TJJA 1TRSA 2GZZA 3MDKA 1PKZA 3IK9A 2PBJA 5J4YA 4N30A 1GSDA 5J47A 2IMDA 3DRNA 4IQ1A 5EPFA 1XWAA 5IPHA 2Z9SA 3WGEA 4Z2RA 3HA9A 4IKHA 1OE7A 3HJOA 3KJYA 3APQA 2O7KA 2BMXA 3TKRA 4BIKA 3HZ4A 3NOFA 3G7JA 2G0FA 5ECRB 1SJ6A 4TR1A 2HI7A 4ZL8A 2MBTA 4FXYP 5ECSA 3HDCA 2VOCA 2HNLA 2B5XA 4TOPA 3F4SA 2LEGA 4K8MA 5DCGA 4TN8A 1A2JA 2EFHA 5IMFA 1ON4A 1EGRA 4RI6A 3TUEA 3K8NA 4IELA 1LJRA 3RAZA 1A0FA 4K2DA 3QD9A 3VK9A 2CX4A 4WR5A 2B5EA 2AYTA 5IOWA 5HFIA 2RM6A 1O85A 4WXTA 3N9JA 1U88A 1TXXA 5JCGA 2EIQA 5BMUB 4K9ZA 1EOGA 1EV9A 2M80A 3DIEA 3IR4A 4ZB6A 4IN0A 1EEMA 4ULXA 1IYHA 3J7Yb 1GH2A 2LQOA 1YKAA 2PPTA 2HZEA 5HFKA 1F2EA 4G2EA 5CRDA 2GZYA 3UIWA 4USSA 4IJ3A 1Y1UA 5GAPD 1GWCA 2DJKA 3VWWA 1JZRA 2A4VA 2R0PA 2B3SA 5AIVA 2EIOA 3D21A 1XWKA 1AUCA 3GHAA 3R2QA 20GSA 5B8AA 3DKSA 2H0GA 4CDOA 4KUNA 4BWQA 1Y25A 1SD9A 19GSA 3G9BA 5DALA 3EC3A 4HZ4A 4PQHA 2WRTA 3GSSA 2C0FA 4TR0A 4GXZA 4ISDA 1UC7A 1K0CA 2L5OA 4O92A 4X43A 4J2FA 5BMUA 2R2JA 1A8LA 3FMWA 1EGOA 2V2GA 4BVXA 3C73A 4G0LA 1T00A 4PHZC 2LSTA 2CT6A 1U3IA 2XBIA 4HSCX 3J7Yk 3UBLA 3GH6A 3ERFA 5DVBA 4WF4A 3BOAA 1YEXA 4MZWA 1SKRB 4RQRA 5C00A 3O6TA 4K6XA 3CYNA 1HQOA 2AV4A 4MK3A 3PH9A 3S9FA 3KH9A 5ECPB 2B6MA 2O87A 4G19A 4FO5A 1RQMA 1X5DA 1MTCA 3KIJA 3ERGA 3HXSA 4YKGA 3W6GA 3ZITA 1SVMA 1K0AA 1K3YA 1XPVA 2LNTA 4HJMA 2TRCP 1K0DA 5J4VA 2HSMB 1UN2A 2B7JA 3FK8A 4K7OA 1B8XA 3HD5A 1F9MA 1J08A 2CVBA 4PUFC 1OC9A 3F3QA 3DEXA 3VURA 2C4JA 2IMFA 2K9FA 2PGTA 2C3QA 3GFKA 3CSHA 4KCAA 2YV9A 4EUYA 4OO5A 5KEJA 3UAPA 1V57A 2KOKA 2C0EA 1TRWA 4OFTA 2R0GA 3RDWA 3E0UA 1BAYA 1YEWC 2GQLA 2I9HA 5FT3A 4PGTA 4O5RA 4HI7A 1TDIA 2H6YA 2H30A 4OCEA 4TKYA 5IMDA 5G1LA 1GNWA 3CQFA 2H73A 4RUVA 4Z2UA 1M9AA 2E2GA 1WOUA 1TI3A 2HRAA 1B4QA 4MH3A 3FKFA 1RK4A 2JSZA 3CTFA 4I97A 4PX1A 3GURA 3RHBA 3ZYWA 5J9CA 2P31A 4KGIA 3DVWA 5IIZA 1AW9A 4GSNA 3F0IA 3H4KA 2ON7A 3KMOA 2C3TA 3MWHA 2A4HA 3Q19A 5ECIB 1BX9A 4JR4A 1BJXA 2X4AA 4TW5A 1GULA 3KGKA 4V1Ag 1RW1A 1DSBA 1FOHA 1PSQA 2H66A 4XCSA 3DD3A 1SJZA 3ISOA 2O3EA 2EFCA 3CRTA 1GNEA 1YF1A 1T4YA 2FCHA 1OC8A 3TDGA 3HY2A 3IOSA 1V2AA 5HFGA 3LORA 4Q5QA 4WKWA 3APSA 1K0OA 5IPGA 1MD3A 3M9JA 3EVIA 5DAKA 4LA1A 2NPBA 1S3RA 3A5IA 4TXVA 3ZREA 4OWYA 4K7NA 1G0TA 2R0CA 2WFCA 3LGCA 3IPZA 1XCCA 2IIYA 4YKFA 2VLTA 4O7HA 1DBYA 1ZYEA 1ZL9A 2WVXB 2E2MA 1XOAA 2FWHA 1ACVA 3TKQA 1BG5A 1JZDA 4L5LA 5A5HA 4MMMA 2X8CA 5A34B 4OFMA 5CREA 3U6VA 3D4MA 3P8WA 1G6YA 1GL8A 1Z7RA 5H5QA 4WR4A 1CQHA 1U3AA 4O5UA 5LNKe 3TKSC 1FW1A 5H5SA 3BCIA 5KN0A 3IRAA 3VWVA 2MMZA 4YAPA 2YCDA 4Q5RA 4MA9A 4RI7A 4OFNA 3LXZA 4AGSA 2NVLA 2DIYA 1CQGA 1MDIA 1GRXA 3M1GA 5B6NA 4HEA2 4FYCA 2HSYA 1SKSB 4WBJA 2P0GA 1YJ6A 2K18A 2VD1A 3ZRDA 1FG4A 4I2TA 4MZBA 2HRKB 4IBPA 4N0VA 4MPGA 1ABAA 4NXIA 2WVYA 3EE2A 3UBKA 2FUG2 3M0FA 5J41A 4GQCA 2JU5A 2L6CA 5J40A 5L71A 3F6DA 3QOUA 1GSEA 4JU5A 2WW3A 2MZCA 5ECQB 2VL2C 2YJ7A 1WE0A 4TR3A 1X5EA 2LRCA 2VCTA 3UJ1A 3ZFBA 1F3AA 1FO5A 3IV4A 2PN8A 3L78A 3QFBC 2DKHA 4NWYA 1EZKA 3WT1A 3MIXA 4WETA 1BG1A 5A1NA 1O8XA 1Y6EA 4V2MA 2YPMA 3MYDA 3GMFA 5B7CA 3CMIA 4YAVA 1S3DA 1GSUA 9GSSA 3F4RA 3DYRA 2WW1A 2N5AA 2PUKC 4KA0A 3G7YA 3IHGA 2EC4A 4K5SA 1SENA 4HU7A 2CVDA 2VCQA 1XZOA 5KOXA 4F03A 4WEYA 1J0FA 3I9V2 1GTBA 3LW9A 3EWLA 2DJ2A 14GSA 1YKCA 2JL4A 3ZIJA 4ICYA 2AB6A 1R7HA 3Q6OA 1OAZA 1T1VA 6GSVA 3US3A 4NV5A 5C04A 3HVNA 2H1AA 2WVZA 4TR1B 1K0NA 2LTKA 5ID2A 3DGQA 4LL1B 4DSRA 2JSYA 2M46A 4ZB8A 1E6BA 2GQKA 3ZIVA 1KBNA 2JACA 3HCZA 4Z7XA 2CAIA 4EIPA 2GZPA 2B5YA 4TVEA 3VPTA 2GGTA 3BJ5A 2DJJA 4LL4B 1AQXA 3N5OA 4MP4A 5ECOB 3HVSA 4ZIJA 3CTGA 4JEDA 2FNOA 1HNBA 1B4PA 1BF5A 1ERUA 2TRXA 2H19A 2L5LA 4GTUA 3FZAA 1ERWA 3KTLA 17GSA 2WW2A 3QR6A 1O7UA 5J5NA 3EPTA 1OVNA 5CP1A 2DJ3A 4LLRA 2GSQA 4IGJA 1K0BA 1G6WA 4JBBA 4PQ1A 2GDRA 4I5QA 2CQ9A 2CA8A 3IK7A 3H79A 4ECJA 5HR3A 5HR2A 2HZEB 1QUWA 4P3YB 3TJFA 1EWXA 2X99A 2LRNA 4XRDA 3UEMA 3IHQA 3GKXA 2F8FA 2H1BA 4JR6A 2WJUA 3HHVA 7GSSA 3QAVA 4KDUA 4GSTA 1S3CA 4GWRA 1KNGA 4MABA 3UMAA 3TB2A 5LCZA 2C0GA 1H4OA 5BRTA 1M0UA 1U87A 5B6MA 5DALB 3ZFLA 4HDEA 3G7IA 2NTOA 4PQIA 3QAWA 5F06A 1TK8B 3LYPA 2HSHA 4GDFA 13GSA 3D0ZA 1E2YA 4MNNA 1ZOFA 4BVXB 1FHEA 3D22A 3LFLA 3PPUA 4F82A 3KEBA 1GUKA 3EYTA 2GSSA 4I2UA 4BVYA 5A4UA 2YWIA 1F6MC 1SVOA 1M99A 2OE0A 2BJXA 3UL3A 1EEJA 2TIRA 5HR0A 3WYWA 4XRAA 4O32A 4XS4A 2FWFA 5JWRB 4TRXA 1TRVA 1SU9A 3SWLA 1DUGA 1OKTA 2FA4A 1G7OA 1PD21 2VAFA 1OC9B 3W8JA 5HR1A 3BCKA 3IXRA 1V9WA 3FYGA 1K3OA 3TKSA 1JFUA 3FZ4A 3GL3A 1MD4A 5D9XA 4K2XA 3H1NA 1EOHA 3L9UA 1UA5A 2CVKA 4KX4A 2MYGA 2GTUA 2LJKA 1X9SB 2LRTA 4HS1A 1ZYNA 3EMXA 3SBCA 2VL9A 2H6XA 3LEFA 2F9SA 3KZQA 3DXBA 3FR6A 1O81A 2AAWA 2VCVA 1TI1A 4E8HA 3CSJA 4KNDA 4QL9A 3BBYA 3FRCA 4AJ6A 2UZ8A 3I69A 5HQPA 4ECCA 3CHXC 2YV7A 3PGTA 4RQXA 2HSNA 5IO0A 4ZL9A 4V2NA 2VCZA 2FY6A 5AN1A 3P7XA 1F37A 3IA1A 5A4WA 2PVOC 3RFRC 2N5FA 6GSTA 2KUCA 2IMIA 2ES7A 2M72A 3ME7A 2IPAA 4A5PA 5KN1A 4FQUA 4PI0C 2NBSA 4NMUA 5CRGA 1HD2A 1N8JA 5J3RA 3FEUA 2KLXA 2RUEA 1ST9A 1FB6A 1DE2A 1F3BA 1VGLA 5G5EA 2X8HA 4QQ7A 2OE3A 4XIHA 2WGRA 4IP1A 1ERVA 4IVFA 1NW2A 4KH7A 3C1SA 3FW2A 2DLXA 3U5RE 4PURA 3HJMA 1KTEA 4X1UA 1QXHA 1QQ2A 5DAKB 4MJEA 5A5KA 3NZNA 4MH2A 3GKMA 2EFDA 4NAXA 4O5QA 1TOFA 5F07A 3KCMA 3ZMLA 1MEKA 1T7PB 5DJMA 1XVWA 1YQ1A 3EINA 4L0WA 4LMVA 4ZXGA 1YEPA 1WIKA 2H71A 2DJ1A 1PX6A 5A5HB 2G2QA 3C1RA 3ZTLA 1AC1A 4ML1A 4GCIA 1Z7PA 5AGYA 2JADA 3HMJG 5KN3A 3ZMKA 3QDNA 2FGXA 4FYUA 3I6AA 4KSOA 1M3IA 2REMA 2AJQB 3F6FA 2VL3A 1HNCA 3E3EA 1HNAA 11GSA 3UOMA 4FYBA 3IAS2 3GTUA 2HXKA 4TR4A 2V32A 2O36A 1GTUA 4EE0A 2I3YA 2I1UA 3GRXA 1SL1B 3TOUA 3RHCA 1FAAA 2GSTA 5DQSA 3L4NA 3KP8A 4EDZA 4V2LA 5DJLA 4ZL7A 1EP8A 5G31A 4IW9A 4H86A 3M9KA 2MMOA 5G5FA 3FY7A 1ZYQB 4K7IA 1GTIA 1THOA 1THXA 4K0GA 2YJHA 2YNXA 2R4VA 3MAKA 1T4ZA 3KM6A 1PKWA 5D96A 2RM5A 1M2DA 1EV4A 5A1NB 6GSWA 5JCWA 2VIMA 1YVLA 2H6ZA 4F2IA 5J4UA
chains in the Genus database with same CATH topology
1GLPA 5IMVA 3HVXA 4AI6A 3QFAC 5IMAA 3L9VA 2L59A 3LJRA 1HYUA 3F4TA 4F0BA 3VWXA 4JE1A 2VLVA 3UVTA 1XW5A 2V6KA 4AKHA 4EKZA 1AQVA 4GF0A 4L0UA 4MLYA 3KH7A 1XWBA 4MJBA 4HU9A 1ERTA 5GSTA 4ZILA 2IMEA 4Z2TA 16GSA 2IFQA 4ZBDA 4YQMA 2F3MA 3WD6A 4AKIA 5ID2B 3GYKA 5IOXA 5G1KA 4NHWA 2QA2A 3KXOA 3MSZA 3VWUA 3GN3A 2H74A 4F0CA 5GAND 1YY7A 4NPBA 2H1DA 3WT2A 3WGXA 4K0NA 3TU3B 3ZVJA 3GKNA 2QKEA 3E9JB 3TRXA 3VI7A 2DMMA 3GA4A 3LQ7A 4XS6A 5FWGA 2MMNA 4MDCA 1J9BA 4IP6A 1SYXA 1W89A 4KW6A 2X8GA 1EP7A 4NHZA 2HLSA 5CYYA 1QGVA 2HYXA 3L9SA 4AF2A 2DMLA 1FVKA 4ECBA 2VM2A 2LKUA 4N10A 1XWCA 1PX7A 2GQMA 5D93A 4POLA 1ML6A 5F05A 2PWJA 3IDVA 4OMVA 2LJRA 3R3EA 1GSFA 1K3LA 1WP0A 1JZWA 2O8VB 1TU7A 4J57E 2DJ0A 2IN3A 2WZ9A 5D9WA 4MJAA 5D73A 2ZUPA 1OC3A 22GSA 3RBTA 2GT6A 5JWQB 1I5GA 4BA7A 2JZRA 4CW9A 2ALBA 4MPFA 3HKRA 2XPDA 2L4CA 3WGDA 1U6TA 2LUSA 5CO3A 5JCUA 1PN9A 4I6XA 3ZVJD 5AISA 1R26A 3CSIA 5IMCA 2I4AA 1GTAA 3F3RA 1A23A 1M9BA 4KAEA 3GL5A 2YZUA 1Z9HA 2HRNA 4X0XA 3TOTA 2O5VA 2DIZA 4N3ZA 2JZSA 4TXOA 4EXJA 3EMPA 1WPIA 4CY8A 2EFEA 4AKGA 1ZMAA 4NV2A 2HFDA 4D73A 3CXGA 5IO2A 3DWVA 5D8IA 5EVOA 3I43A 4HQZA 2FA8A 2E0QA 2C8UA 1LU4A 1B9XC 2J9HA 4BVYB 2JZTA 2VCXA 3TKPA 4HZ2A 1NHOA 1XIYA 4G0IA 3ME8A 4XTSA 2CZ2A 2B1LA 2RUFA 4EVMA 1DE1A 4GLTA 4G01A 4XS4B 4AJ8A 2R37A 5CRHA 2OADA 1SK2A 4DSSA 2WB9A 5INYA 2CX3A 3TCOA 1C72A 1JLVA 4FIWA 5IM9A 1XW9A 1ZYPA 2C80A 2FWEA 3ZLPA 4MF5A 1N2AA 1G7EA 4G9HA 3JCML 1NHYA 1Q98A 1OE8A 4PNGA 3APOA 4QMKA 4F9ZA 5CNWA 2OA7A 4ZBAA 1R4WA 1R5PA 3C71A 3L0HA 4KDXA 5JWOB 2PVQA 4CHSA 5GZZB 4DVCA 4Q5FA 1WRYA 1GUHA 2VUPA 3A5WA 2N5BA 3EU4A 4OCFA 5D9TA 1TRUA 1YDKA 2AUVA 3GX8A 2YWOA 4EF0A 5E4WA 2KHPA 3VI5A 1SL0B 2CV4A 4BWSA 3C8EA 2O89A 1BQ7A 3C7MA 3IE3A 4EO3A 3F63A 4PTSA 5ELAA 1X9MB 2FLSA 2K8VA 1A8YA 3GH9A 1O6JA 3VFIA 1AXDA 4IQAA 12GSA 1JZOA 1IYIA 1WWJA 3A3TA 2F8AA 2HT9A 3QPMA 4AKXB 4KE3A 1PRXA 4L8EA 2H75A 2ZCTA 4I8BA 3QAGA 4DEJA 1TP9A 1ZCPA 3BD2A 2HSNB 2F51A 2QA1A 2K8SA 1XBSA 3TRQA 1Z5YE 5GSSA 2R3XA 2XHFA 2V6OA 3KMNA 4MCUA 2H0HA 3LG6A 2C0DA 1PL2A 1Z6NA 1PA3A 1YZXA 2YP6A 4HOJA 4GSSA 4BL7B 4KDYA 1SD8A 18GSA 2OBIA 4WF5A 5ECKB 2X49A 1USBA 3P90A 2GS3A 1SVLA 6GSXA 3IBHA 1BEDA 3HVVA 3HJPA 1X5CA 5J9BA 1PQNA 2FHEA 3LXTA 1XXUA 4EDYA 2PMTA 2X64A 3FR9A 4POBA 1MDJA 2H01A 1TK0B 2OJLA 2UV8G 2VO4A 4ID0A 1QK8A 2MMAA 1TXUA 3ZZXA 4ZB9A 1NM3A 3FZ5A 1PGTA 1M2BA 1PMTA 4ML6A 4OO4A 5F8BA 3GX0A 3A2WA 1VF1A 3D6IA 4N11A 5DBQA 1VF2A 1SJIA 2P5QA 2LQQA 3FHKA 3ED3A 3GNJA 6GSSA 2HZFA 2VL2A 5EY6A 3M8NA 3LSZA 1TW9A 3AY8A 2LNSA 5H5RA 3A2XA 3A2VA 3D5JA 4ZBBA 1PN0A 1GSQA 4BL7A 1V40A 5IQYA 1WJKA 4QL7A 4E68A 3TJKA 1MDKA 5F0GA 1R5AA 4XHMA 1T3BA 2LJAA 1TJDA 2FD3A 2EIRA 1M7TA 2LV3A 4G0KA 4W66A 4JZQA 4YQVA 1QMVA 1O73A 3GTUB 2OBKA 5DCHA 2WCIA 3IAM2 2YWMA 5ECHB 2LS5A 2GVPA 3GIXA 2H1LA 4EL1A 5LD0A 3GSTA 1GSYA 2VM1A 2GT5A 3KP9A 4IS0A 5COHA 3UVHA 4KB3A 2L6DA 3GKKA 4PXOA 1XVQA 1KEBA 3O76A 1FB0A 5B8BA 4BPYA 5CRWA 1FVJA 3QCPA 2DC5A 2MBSA 2H72A 1AAZA 2XBQA 2HSMA 3F9UA 4V1Ap 1A24A 3GUSA 2BTOT 2OT3A 4IJIA 1QFNA 1FOVA 4YH2A 3M3MA 5A4VA 4K5RA 2WS2A 2H76A 4E8EA 2IWTA 4ZB7A 3TRPA 1GP1A 1TK5B 2WULA 3PINA 3RPPA 4MZCA 3OR5A 5AIXA 3TJBA 2C1YA 4POKA 3DMLA 2DSAA 5FHIA 2H8LA 1XOBA 1GLQA 3ERWA 2R5GA 1GUMA 3RPNA 4YQUA 2A2RA 2OACA 3IC8A 4PUAA 1GSSA 4LMWA 1Q4JA 2YANA 1WMJA 2XPEA 1H75A 1SYRA 1A2LA 2I81A 2VD0A 2P5RA 3NIVA 5CAXA 3KTBA 2KP2A 3UARA 3CWGA 4HUAA 4GQFA 1X9WB 2IFQB 3EU3A 1SL2B 4MJCA 1YF0A 5EL8A 3Q74A 4AJ7A 4MF7A 5KN2A 1N25A 4EIQA 3W8SA 1LBKA 4IHUA 1M2AA 6GSUA 2A2PA 2GSRA 2E7PA 4XS1A 3FZ9A 5ECLB 1K0MA 2H0IA 1TKDB 2V1MA 2DKIA 4J56E 1W4VA 1ZGNA 4G10A 2B1KA 5KOWA 3ZL5A 1A0RP 3TKSE 1URMA 1T8EB 3H8QA 4DSQA 1TU8A 5ENUA 3D4TA 3LYKA 1XFLA 4JRRA 2FWGA 3VPQA 2VCWA 4ACSA 2PERA 1AQWA 1I9DA 3HZ8A 2YZHA 1OKDA 2GLRA 5G2ZA 2C3NA 2L57A 3CBUA 3MNGA 5DDLA 2B7KA 5G30A 1X0RA 2L4QA 3IC4A 1B9YC 2RIIA 2NDOA 1B48A 1XWGA 2HRFA 1ZZYA 4X4JA 5E59A 3QMXA 4GRFA 3EURA 2OKAA 2R6KA 4HQSA 2IMKA 1A2MA 2ZNMA 2XC2A 2H70A 1AIUA 3FR3A 1Z6MA 3DVXA 1BYEA 1O8WA 2QSIA 4KF9A 1VF4A 2CAQA 3Q18A 1UVZA 1NSWA 4PNFA 6GSYA 1Z3EA 4Q5NA 2D2ZA 5ECMB 5A34A 2H1GA 3TJGA 1VRSD 2OE1A 2K6VA 3HYPA 4WBRD 1XW6A 3VLNA 4N0ZA 4FH8A 2DBCA 2VKZG 3TGZA 2A2SA 3KD0A 3LWAA 2AHEA 2O85A 2RLIA 3CRUA 1PL1A 4ILFA 4MF6A 1SK0A 4OD7A 2QGVA 4L5OA 2HQTA 4TXOB 3F8UA 1V58A 4KSMA 1OYJA 4ECIA 2IJYA 2J23A 4D73B 3GV1A 1JHBA 2V41A 5ABRA 4KCEA 4CY6A 1S3AA 2CZ3A 2HRKA 4HJ2A 1SKWB 2VLUA 1VF3A 3O3TA 8GSSA 3V1WA 1TTZA 1ILOA 2YWNA 4EC0A 2WDUA 4POMA 3H93A 5IMZA 2KP1A 2YN1A 5D9VA 4K1FA 2YOIA 5ECNB 1JLWA 2ON5A 1V98A 2HE3A 3PR8A 2PU9C 1SK1A 5DQYA 4DSSB 5ELGA 2IL3A 2QC7A 3P2AA 10GSA 3TJJA 1TRSA 2GZZA 3MDKA 1PKZA 3IK9A 2PBJA 5J4YA 4N30A 1GSDA 5J47A 2IMDA 3DRNA 4IQ1A 5EPFA 1XWAA 5IPHA 2Z9SA 3WGEA 4Z2RA 3HA9A 4IKHA 1OE7A 3HJOA 3KJYA 3APQA 2O7KA 2BMXA 3TKRA 3HZ4A 3NOFA 3G7JA 2G0FA 5ECRB 1SJ6A 4TR1A 2HI7A 4ZL8A 2MBTA 5ECSA 3HDCA 2VOCA 2HNLA 2B5XA 4TOPA 3F4SA 2LEGA 4K8MA 5DCGA 4TN8A 1A2JA 2EFHA 5IMFA 1ON4A 1EGRA 4RI6A 3TUEA 3K8NA 4IELA 1LJRA 3RAZA 1A0FA 4K2DA 3QD9A 3VK9A 2CX4A 4WR5A 2B5EA 2AYTA 5IOWA 5HFIA 2RM6A 1O85A 4WXTA 3N9JA 1U88A 1TXXA 5JCGA 2EIQA 5BMUB 4K9ZA 1EOGA 1EV9A 2M80A 3DIEA 3IR4A 4ZB6A 4IN0A 1EEMA 4ULXA 1IYHA 3J7Yb 1GH2A 2LQOA 1YKAA 2PPTA 2HZEA 5HFKA 1F2EA 4G2EA 5CRDA 2GZYA 3UIWA 4USSA 4IJ3A 1Y1UA 5GAPD 1GWCA 2DJKA 3VWWA 1JZRA 2A4VA 2R0PA 2B3SA 5AIVA 2EIOA 3D21A 1XWKA 1AUCA 3GHAA 3R2QA 20GSA 5B8AA 3DKSA 2H0GA 4CDOA 4KUNA 4BWQA 1Y25A 1SD9A 19GSA 3G9BA 5DALA 3EC3A 4HZ4A 4PQHA 2WRTA 3GSSA 2C0FA 4TR0A 4GXZA 4ISDA 1UC7A 1K0CA 2L5OA 4O92A 4X43A 4J2FA 5BMUA 2R2JA 1A8LA 3FMWA 1EGOA 2V2GA 4BVXA 3C73A 4G0LA 1T00A 2LSTA 2CT6A 1U3IA 2XBIA 3J7Yk 3UBLA 3GH6A 3ERFA 5DVBA 4WF4A 3BOAA 1YEXA 4MZWA 1SKRB 4RQRA 5C00A 3O6TA 4K6XA 3CYNA 1HQOA 2AV4A 4MK3A 3PH9A 3S9FA 3KH9A 5ECPB 2B6MA 2O87A 4G19A 4FO5A 1RQMA 1X5DA 1MTCA 3KIJA 3ERGA 3HXSA 4YKGA 3W6GA 3ZITA 1SVMA 1K0AA 1K3YA 1XPVA 2LNTA 4HJMA 2TRCP 1K0DA 5J4VA 2HSMB 1UN2A 2B7JA 3FK8A 4K7OA 1B8XA 3HD5A 1F9MA 1J08A 2CVBA 4PUFC 1OC9A 3F3QA 3DEXA 3VURA 2C4JA 2IMFA 2K9FA 2PGTA 2C3QA 3GFKA 3CSHA 4KCAA 2YV9A 4EUYA 4OO5A 5KEJA 3UAPA 1V57A 2KOKA 2C0EA 1TRWA 4OFTA 2R0GA 3RDWA 3E0UA 1BAYA 2GQLA 2I9HA 5FT3A 4PGTA 4O5RA 4HI7A 1TDIA 2H6YA 2H30A 4OCEA 4TKYA 5IMDA 5G1LA 1GNWA 2H73A 4RUVA 4Z2UA 1M9AA 2E2GA 1WOUA 1TI3A 2HRAA 1B4QA 4MH3A 3FKFA 1RK4A 2JSZA 3CTFA 4I97A 4PX1A 3GURA 3RHBA 3ZYWA 5J9CA 2P31A 4KGIA 3DVWA 5IIZA 1AW9A 4GSNA 3F0IA 3H4KA 2ON7A 3KMOA 2C3TA 3MWHA 2A4HA 3Q19A 5ECIB 1BX9A 4JR4A 1BJXA 2X4AA 4TW5A 1GULA 3KGKA 4V1Ag 1RW1A 1DSBA 1FOHA 1PSQA 2H66A 4XCSA 3DD3A 1SJZA 3ISOA 2EFCA 3CRTA 1GNEA 1YF1A 1T4YA 2FCHA 1OC8A 3TDGA 3HY2A 3IOSA 1V2AA 5HFGA 3LORA 4Q5QA 4WKWA 3APSA 1K0OA 5IPGA 1MD3A 3M9JA 3EVIA 5DAKA 4LA1A 2NPBA 3A5IA 4TXVA 3ZREA 4OWYA 4K7NA 1G0TA 2R0CA 2WFCA 3LGCA 3IPZA 1XCCA 2IIYA 4YKFA 2VLTA 4O7HA 1DBYA 1ZYEA 1ZL9A 2E2MA 1XOAA 2FWHA 1ACVA 3TKQA 1BG5A 1JZDA 4L5LA 5A5HA 4MMMA 2X8CA 5A34B 4OFMA 5CREA 3U6VA 3D4MA 3P8WA 1G6YA 1GL8A 1Z7RA 5H5QA 4WR4A 1CQHA 1U3AA 4O5UA 5LNKe 3TKSC 1FW1A 5H5SA 3BCIA 5KN0A 3IRAA 3VWVA 2MMZA 4YAPA 2YCDA 4Q5RA 4MA9A 4RI7A 4OFNA 3LXZA 4AGSA 2NVLA 2DIYA 1CQGA 1MDIA 1GRXA 3M1GA 5B6NA 4HEA2 4FYCA 2HSYA 1SKSB 4WBJA 2P0GA 1YJ6A 2K18A 2VD1A 3ZRDA 1FG4A 4I2TA 4MZBA 2HRKB 4IBPA 4N0VA 4MPGA 1ABAA 4NXIA 3EE2A 3UBKA 2FUG2 3M0FA 5J41A 4GQCA 2JU5A 2L6CA 5J40A 5L71A 3F6DA 3QOUA 1GSEA 4JU5A 2MZCA 2VL2C 5ECQB 2YJ7A 1WE0A 4TR3A 1X5EA 2LRCA 2VCTA 3UJ1A 3ZFBA 1F3AA 1FO5A 3IV4A 2PN8A 3L78A 3QFBC 2DKHA 4NWYA 1EZKA 3WT1A 3MIXA 4WETA 1BG1A 5A1NA 1O8XA 1Y6EA 4V2MA 2YPMA 3MYDA 3GMFA 5B7CA 3CMIA 4YAVA 1S3DA 1GSUA 9GSSA 3F4RA 2N5AA 3DYRA 2PUKC 4KA0A 3G7YA 3IHGA 2EC4A 4K5SA 1SENA 4HU7A 2CVDA 2VCQA 1XZOA 5KOXA 4F03A 4WEYA 1J0FA 3I9V2 1GTBA 3LW9A 3EWLA 2DJ2A 14GSA 1YKCA 2JL4A 3ZIJA 4ICYA 2AB6A 1R7HA 3Q6OA 1OAZA 1T1VA 6GSVA 3US3A 4NV5A 5C04A 2H1AA 4TR1B 1K0NA 2LTKA 5ID2A 3DGQA 4LL1B 4DSRA 2JSYA 2M46A 4ZB8A 1E6BA 2GQKA 3ZIVA 1KBNA 2JACA 3HCZA 4Z7XA 2CAIA 4EIPA 2GZPA 2B5YA 4TVEA 3VPTA 2GGTA 3BJ5A 2DJJA 4LL4B 1AQXA 3N5OA 4MP4A 5ECOB 3HVSA 4ZIJA 3CTGA 4JEDA 2FNOA 1HNBA 1B4PA 1BF5A 1ERUA 2TRXA 2H19A 2L5LA 4GTUA 3FZAA 1ERWA 3KTLA 17GSA 3QR6A 1O7UA 5J5NA 3EPTA 1OVNA 5CP1A 2DJ3A 4LLRA 2GSQA 4IGJA 1K0BA 1G6WA 4JBBA 4PQ1A 2GDRA 4I5QA 2CQ9A 2CA8A 3IK7A 3H79A 4ECJA 5HR3A 5HR2A 2HZEB 1QUWA 4P3YB 3TJFA 1EWXA 2X99A 2LRNA 4XRDA 3UEMA 3IHQA 3GKXA 2F8FA 2H1BA 4JR6A 2WJUA 3HHVA 7GSSA 3QAVA 4KDUA 4GSTA 1S3CA 4GWRA 1KNGA 4MABA 3UMAA 3TB2A 5LCZA 2C0GA 1H4OA 5BRTA 1M0UA 1U87A 5B6MA 5DALB 3ZFLA 4HDEA 3G7IA 2NTOA 4PQIA 3QAWA 5F06A 1TK8B 3LYPA 2HSHA 4GDFA 13GSA 3D0ZA 1E2YA 4MNNA 1ZOFA 4BVXB 1FHEA 3D22A 3LFLA 3PPUA 4F82A 3KEBA 1GUKA 3EYTA 2GSSA 4I2UA 4BVYA 5A4UA 2YWIA 1F6MC 1SVOA 1M99A 2OE0A 2BJXA 3UL3A 1EEJA 2TIRA 5HR0A 3WYWA 4XRAA 4O32A 4XS4A 2FWFA 5JWRB 4TRXA 1TRVA 1SU9A 3SWLA 1DUGA 1OKTA 2FA4A 1G7OA 1PD21 2VAFA 1OC9B 3W8JA 5HR1A 3BCKA 3IXRA 1V9WA 3FYGA 1K3OA 3TKSA 1JFUA 3FZ4A 3GL3A 1MD4A 5D9XA 4K2XA 1EOHA 3H1NA 3L9UA 1UA5A 2CVKA 4KX4A 2MYGA 2GTUA 2LJKA 1X9SB 2LRTA 4HS1A 1ZYNA 3EMXA 3SBCA 2VL9A 2H6XA 3LEFA 2F9SA 3KZQA 3DXBA 3FR6A 1O81A 2AAWA 2VCVA 1TI1A 4E8HA 3CSJA 4KNDA 4QL9A 3BBYA 3FRCA 4AJ6A 2UZ8A 3I69A 5HQPA 4ECCA 2YV7A 3PGTA 4RQXA 2HSNA 5IO0A 4ZL9A 4V2NA 2VCZA 2FY6A 5AN1A 3P7XA 1F37A 3IA1A 5A4WA 2PVOC 2N5FA 6GSTA 2KUCA 2IMIA 2ES7A 2M72A 3ME7A 2IPAA 4A5PA 5KN1A 4FQUA 2NBSA 4NMUA 5CRGA 1HD2A 1N8JA 5J3RA 3FEUA 2KLXA 2RUEA 1ST9A 1FB6A 1DE2A 1F3BA 1VGLA 5G5EA 2X8HA 4QQ7A 2OE3A 4XIHA 2WGRA 4IP1A 1ERVA 4IVFA 1NW2A 4KH7A 3C1SA 3FW2A 2DLXA 3U5RE 4PURA 3HJMA 1KTEA 4X1UA 1QXHA 1QQ2A 5DAKB 4MJEA 5A5KA 3NZNA 4MH2A 3GKMA 2EFDA 4NAXA 4O5QA 1TOFA 5F07A 3KCMA 3ZMLA 1MEKA 1T7PB 5DJMA 1XVWA 1YQ1A 3EINA 4L0WA 4LMVA 4ZXGA 1YEPA 1WIKA 2H71A 2DJ1A 1PX6A 5A5HB 2G2QA 3C1RA 3ZTLA 1AC1A 4ML1A 4GCIA 1Z7PA 5AGYA 2JADA 3HMJG 5KN3A 3ZMKA 3QDNA 2FGXA 4FYUA 3I6AA 4KSOA 2REMA 2AJQB 3F6FA 2VL3A 1HNCA 3E3EA 1HNAA 11GSA 3UOMA 4FYBA 3IAS2 3GTUA 2HXKA 4TR4A 2V32A 1GTUA 4EE0A 2I3YA 2I1UA 3GRXA 1SL1B 3TOUA 3RHCA 1FAAA 2GSTA 5DQSA 3L4NA 3KP8A 4EDZA 4V2LA 5DJLA 4ZL7A 1EP8A 5G31A 4IW9A 4H86A 3M9KA 2MMOA 5G5FA 3FY7A 1ZYQB 4K7IA 1GTIA 1THOA 1THXA 4K0GA 2YJHA 2YNXA 2R4VA 3MAKA 1T4ZA 3KM6A 1PKWA 5D96A 2RM5A 1M2DA 1EV4A 5A1NB 6GSWA 5JCWA 2VIMA 1YVLA 2H6ZA 4F2IA 5J4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GLP A;  5IMV A;  3HVX A;  3QFA C;  5IMA A;  3L9V A;  2L59 A;  3LJR A;  1HYU A;  3F4T A;  4F0B A;  3VWX A;  4JE1 A;  2VLV A;  3UVT A;  1XW5 A;  2V6K A;  4EKZ A;  1AQV A;  4GF0 A;  4L0U A;  4MLY A;  3KH7 A;  1XWB A;  4MJB A;  4HU9 A;  1ERT A;  5GST A;  4ZIL A;  2IME A;  16GS A;  2IFQ A;  4ZBD A;  4YQM A;  2F3M A;  3WD6 A;  5ID2 B;  3GYK A;  5IOX A;  5G1K A;  4NHW A;  3KXO A;  3MSZ A;  3VWU A;  3GN3 A;  2H74 A;  4F0C A;  5GAN D;  1YY7 A;  4NPB A;  2H1D A;  3WT2 A;  3WGX A;  4K0N A;  3ZVJ A;  3GKN A;  2QKE A;  3E9J B;  3TRX A;  3VI7 A;  2DMM A;  3GA4 A;  3LQ7 A;  4XS6 A;  5FWG A;  2MMN A;  4MDC A;  1J9B A;  4IP6 A;  1SYX A;  1W89 A;  4KW6 A;  2X8G A;  1EP7 A;  4NHZ A;  2HLS A;  5CYY A;  1QGV A;  2HYX A;  3L9S A;  4AF2 A;  2DML A;  1FVK A;  4ECB A;  2VM2 A;  2LKU A;  4N10 A;  1XWC A;  1PX7 A;  2GQM A;  5D93 A;  4POL A;  1ML6 A;  5F05 A;  2PWJ A;  3IDV A;  4OMV A;  2LJR A;  3R3E A;  1GSF A;  1K3L A;  1WP0 A;  1JZW A;  2O8V B;  1TU7 A;  4J57 E;  2DJ0 A;  2IN3 A;  2WZ9 A;  5D9W A;  4MJA A;  5D73 A;  2ZUP A;  1OC3 A;  22GS A;  3RBT A;  2GT6 A;  5JWQ B;  1I5G A;  4BA7 A;  2JZR A;  4CW9 A;  2ALB A;  4MPF A;  3HKR A;  2XPD A;  2L4C A;  3WGD A;  1U6T A;  2LUS A;  5CO3 A;  5JCU A;  1PN9 A;  4I6X A;  3ZVJ D;  5AIS A;  1R26 A;  3CSI A;  5IMC A;  2I4A A;  1GTA A;  3F3R A;  1A23 A;  1M9B A;  4KAE A;  3GL5 A;  2YZU A;  1Z9H A;  2HRN A;  4X0X A;  3TOT A;  2DIZ A;  2JZS A;  4TXO A;  4EXJ A;  3EMP A;  1WPI A;  1ZMA A;  4NV2 A;  2HFD A;  4D73 A;  3CXG A;  5IO2 A;  3DWV A;  5D8I A;  5EVO A;  3I43 A;  4HQZ A;  2FA8 A;  2E0Q A;  2C8U A;  1LU4 A;  1B9X C;  2J9H A;  4BVY B;  2JZT A;  2VCX A;  3TKP A;  4HZ2 A;  1NHO A;  1XIY A;  4G0I A;  3ME8 A;  4XTS A;  2CZ2 A;  2B1L A;  2RUF A;  4EVM A;  1DE1 A;  4GLT A;  4XS4 B;  4AJ8 A;  2R37 A;  5CRH A;  2OAD A;  1SK2 A;  4DSS A;  2WB9 A;  5INY A;  2CX3 A;  3TCO A;  1C72 A;  1JLV A;  4FIW A;  5IM9 A;  1XW9 A;  2C80 A;  2FWE A;  3ZLP A;  4MF5 A;  1N2A A;  1G7E A;  4G9H A;  3JCM L;  1NHY A;  1Q98 A;  1OE8 A;  4PNG A;  3APO A;  4F9Z A;  5CNW A;  2OA7 A;  4ZBA A;  1R4W A;  1R5P A;  3C71 A;  3L0H A;  4KDX A;  5JWO B;  2PVQ A;  4CHS A;  5GZZ B;  4DVC A;  4Q5F A;  1WRY A;  1GUH A;  2VUP A;  3A5W A;  2N5B A;  3EU4 A;  4OCF A;  5D9T A;  1TRU A;  1YDK A;  2AUV A;  3GX8 A;  2YWO A;  4EF0 A;  5E4W A;  2KHP A;  3VI5 A;  1SL0 B;  2CV4 A;  4BWS A;  3C8E A;  2O89 A;  1BQ7 A;  3C7M A;  3IE3 A;  4EO3 A;  3F63 A;  4PTS A;  5ELA A;  1X9M B;  2FLS A;  2K8V A;  1A8Y A;  3GH9 A;  1O6J A;  3VFI A;  1AXD A;  4IQA A;  12GS A;  1JZO A;  1IYI A;  1WWJ A;  3A3T A;  2F8A A;  2HT9 A;  3QPM A;  4KE3 A;  1PRX A;  4L8E A;  2H75 A;  2ZCT A;  4I8B A;  3QAG A;  4DEJ A;  1TP9 A;  1ZCP A;  3BD2 A;  2HSN B;  2F51 A;  2K8S A;  1XBS A;  3TRQ A;  1Z5Y E;  5GSS A;  2R3X A;  2XHF A;  2V6O A;  3KMN A;  4MCU A;  2H0H A;  3LG6 A;  2C0D A;  1PL2 A;  1Z6N A;  1PA3 A;  1YZX A;  2YP6 A;  4HOJ A;  4GSS A;  4BL7 B;  4KDY A;  1SD8 A;  18GS A;  2OBI A;  4WF5 A;  5ECK B;  1USB A;  3P90 A;  2GS3 A;  6GSX A;  3IBH A;  1BED A;  3HVV A;  3HJP A;  1X5C A;  5J9B A;  1PQN A;  2FHE A;  3LXT A;  1XXU A;  4EDY A;  2PMT A;  2X64 A;  3FR9 A;  4POB A;  1MDJ A;  2H01 A;  1TK0 B;  2OJL A;  2VO4 A;  4ID0 A;  1QK8 A;  2MMA A;  3ZZX A;  4ZB9 A;  1NM3 A;  3FZ5 A;  1PGT A;  1M2B A;  1PMT A;  4ML6 A;  4OO4 A;  5F8B A;  3GX0 A;  3A2W A;  1VF1 A;  3D6I A;  4N11 A;  5DBQ A;  1VF2 A;  1SJI A;  2P5Q A;  2LQQ A;  3FHK A;  3ED3 A;  3GNJ A;  6GSS A;  2HZF A;  2VL2 A;  5EY6 A;  3M8N A;  3LSZ A;  1TW9 A;  3AY8 A;  2LNS A;  5H5R A;  3A2X A;  3A2V A;  3D5J A;  4ZBB A;  1GSQ A;  4BL7 A;  1V40 A;  5IQY A;  1WJK A;  4QL7 A;  3TJK A;  1MDK A;  5F0G A;  1R5A A;  4XHM A;  1T3B A;  2LJA A;  1TJD A;  2FD3 A;  2EIR A;  1M7T A;  2LV3 A;  4G0K A;  4JZQ A;  4YQV A;  1QMV A;  1O73 A;  3GTU B;  2OBK A;  5DCH A;  2WCI A;  3IAM 2;  2YWM A;  5ECH B;  2LS5 A;  2GVP A;  3GIX A;  4EL1 A;  5LD0 A;  3GST A;  1GSY A;  2VM1 A;  2GT5 A;  3KP9 A;  4IS0 A;  5COH A;  3UVH A;  4KB3 A;  2L6D A;  3GKK A;  4PXO A;  1XVQ A;  1KEB A;  3O76 A;  1FB0 A;  5B8B A;  4BPY A;  5CRW A;  1FVJ A;  3QCP A;  2DC5 A;  2MBS A;  2H72 A;  1AAZ A;  2XBQ A;  2HSM A;  3F9U A;  4V1A p;  1A24 A;  3GUS A;  2BTO T;  4IJI A;  1QFN A;  1FOV A;  4YH2 A;  3M3M A;  5A4V A;  2WS2 A;  2H76 A;  4E8E A;  2IWT A;  3TRP A;  1GP1 A;  1TK5 B;  2WUL A;  3PIN A;  3RPP A;  4MZC A;  3OR5 A;  5AIX A;  3TJB A;  2C1Y A;  4POK A;  3DML A;  2DSA A;  5FHI A;  2H8L A;  1XOB A;  1GLQ A;  3ERW A;  2R5G A;  1GUM A;  3RPN A;  4YQU A;  2A2R A;  2OAC A;  3IC8 A;  4PUA A;  1GSS A;  4LMW A;  1Q4J A;  2YAN A;  1WMJ A;  2XPE A;  1H75 A;  1SYR A;  1A2L A;  2I81 A;  2VD0 A;  2P5R A;  3NIV A;  5CAX A;  3KTB A;  2KP2 A;  3UAR A;  4HUA A;  4GQF A;  1X9W B;  2IFQ B;  3EU3 A;  1SL2 B;  4MJC A;  1YF0 A;  5EL8 A;  3Q74 A;  4AJ7 A;  4MF7 A;  5KN2 A;  3W8S A;  1LBK A;  4IHU A;  1M2A A;  6GSU A;  2GSR A;  2E7P A;  4XS1 A;  5ECL B;  3FZ9 A;  1K0M A;  2H0I A;  1TKD B;  2V1M A;  4J56 E;  1W4V A;  1ZGN A;  4G10 A;  2B1K A;  3ZL5 A;  1A0R P;  3TKS E;  1URM A;  1T8E B;  3H8Q A;  4DSQ A;  1TU8 A;  5ENU A;  3D4T A;  3LYK A;  1XFL A;  4JRR A;  2FWG A;  3VPQ A;  2VCW A;  4ACS A;  2PER A;  1AQW A;  1I9D A;  3HZ8 A;  2YZH A;  1OKD A;  2GLR A;  5G2Z A;  2C3N A;  2L57 A;  3CBU A;  3MNG A;  5DDL A;  2B7K A;  5G30 A;  1X0R A;  2L4Q A;  3IC4 A;  1B9Y C;  2RII A;  2NDO A;  1B48 A;  1XWG A;  2HRF A;  1ZZY A;  5E59 A;  3QMX A;  4GRF A;  3EUR A;  2OKA A;  2R6K A;  4HQS A;  2IMK A;  1A2M A;  2ZNM A;  2XC2 A;  2H70 A;  1AIU A;  3FR3 A;  1Z6M A;  3DVX A;  1BYE A;  1O8W A;  2QSI A;  4KF9 A;  1VF4 A;  2CAQ A;  3Q18 A;  1UVZ A;  1NSW A;  4PNF A;  6GSY A;  1Z3E A;  4Q5N A;  2D2Z A;  5ECM B;  2H1G A;  3TJG A;  1VRS D;  2OE1 A;  2K6V A;  3HYP A;  4WBR D;  1XW6 A;  3VLN A;  4N0Z A;  4FH8 A;  2DBC A;  3TGZ A;  2A2S A;  3KD0 A;  3LWA A;  2AHE A;  2O85 A;  2RLI A;  3CRU A;  1PL1 A;  4ILF A;  4MF6 A;  1SK0 A;  4OD7 A;  2QGV A;  4L5O A;  2HQT A;  4TXO B;  3F8U A;  1V58 A;  4KSM A;  1OYJ A;  4ECI A;  2IJY A;  2J23 A;  4D73 B;  3GV1 A;  1JHB A;  2V41 A;  5ABR A;  4KCE A;  1S3A A;  2CZ3 A;  2HRK A;  4HJ2 A;  1SKW B;  2VLU A;  1VF3 A;  3O3T A;  8GSS A;  3V1W A;  1TTZ A;  1ILO A;  2YWN A;  4EC0 A;  2WDU A;  4POM A;  3H93 A;  5IMZ A;  2KP1 A;  2YN1 A;  5D9V A;  4K1F A;  2YOI A;  5ECN B;  1JLW A;  2ON5 A;  1V98 A;  2HE3 A;  3PR8 A;  2PU9 C;  1SK1 A;  5DQY A;  4DSS B;  5ELG A;  2IL3 A;  2QC7 A;  3P2A A;  10GS A;  3TJJ A;  1TRS A;  2GZZ A;  3MDK A;  1PKZ A;  3IK9 A;  2PBJ A;  4N30 A;  1GSD A;  2IMD A;  3DRN A;  4IQ1 A;  5EPF A;  1XWA A;  5IPH A;  2Z9S A;  3WGE A;  3HA9 A;  4IKH A;  1OE7 A;  3HJO A;  3KJY A;  3APQ A;  2O7K A;  2BMX A;  3TKR A;  3HZ4 A;  3NOF A;  3G7J A;  2G0F A;  5ECR B;  1SJ6 A;  4TR1 A;  2HI7 A;  4ZL8 A;  2MBT A;  5ECS A;  3HDC A;  2VOC A;  2HNL A;  2B5X A;  4TOP A;  3F4S A;  2LEG A;  4K8M A;  5DCG A;  4TN8 A;  1A2J A;  5IMF A;  1ON4 A;  1EGR A;  4RI6 A;  3TUE A;  3K8N A;  4IEL A;  1LJR A;  3RAZ A;  1A0F A;  4K2D A;  3QD9 A;  3VK9 A;  2CX4 A;  4WR5 A;  2B5E A;  2AYT A;  5IOW A;  5HFI A;  2RM6 A;  1O85 A;  4WXT A;  3N9J A;  1U88 A;  1TXX A;  5JCG A;  2EIQ A;  4K9Z A;  1EOG A;  1EV9 A;  2M80 A;  3DIE A;  3IR4 A;  4ZB6 A;  4IN0 A;  1EEM A;  4ULX A;  1IYH A;  3J7Y b;  1GH2 A;  2LQO A;  1YKA A;  2PPT A;  2HZE A;  5HFK A;  1F2E A;  4G2E A;  5CRD A;  2GZY A;  3UIW A;  4USS A;  4IJ3 A;  5GAP D;  1GWC A;  2DJK A;  3VWW A;  1JZR A;  2A4V A;  2B3S A;  5AIV A;  2EIO A;  3D21 A;  1XWK A;  1AUC A;  3GHA A;  3R2Q A;  20GS A;  5B8A A;  3DKS A;  2H0G A;  4CDO A;  4KUN A;  4BWQ A;  1Y25 A;  1SD9 A;  19GS A;  3G9B A;  5DAL A;  3EC3 A;  4HZ4 A;  4PQH A;  2WRT A;  3GSS A;  2C0F A;  4TR0 A;  4GXZ A;  4ISD A;  1UC7 A;  1K0C A;  2L5O A;  4O92 A;  4X43 A;  4J2F A;  5BMU A;  2R2J A;  1A8L A;  1EGO A;  2V2G A;  4BVX A;  3C73 A;  4G0L A;  1T00 A;  2LST A;  2CT6 A;  1U3I A;  2XBI A;  3J7Y k;  3UBL A;  3GH6 A;  3ERF A;  5DVB A;  4WF4 A;  3BOA A;  1YEX A;  4MZW A;  1SKR B;  4RQR A;  5C00 A;  3O6T A;  4K6X A;  3CYN A;  1HQO A;  2AV4 A;  4MK3 A;  3PH9 A;  3S9F A;  3KH9 A;  5ECP B;  2B6M A;  2O87 A;  4G19 A;  4FO5 A;  1RQM A;  1X5D A;  1MTC A;  3KIJ A;  3ERG A;  3HXS A;  3W6G A;  3ZIT A;  1K0A A;  1K3Y A;  1XPV A;  2LNT A;  4HJM A;  2TRC P;  1K0D A;  2HSM B;  1UN2 A;  2B7J A;  3FK8 A;  4K7O A;  1B8X A;  3HD5 A;  1F9M A;  1J08 A;  2CVB A;  4PUF C;  1OC9 A;  3F3Q A;  3DEX A;  3VUR A;  2C4J A;  2IMF A;  2K9F A;  2PGT A;  2C3Q A;  3GFK A;  3CSH A;  4KCA A;  2YV9 A;  4EUY A;  4OO5 A;  5KEJ A;  3UAP A;  1V57 A;  2KOK A;  2C0E A;  1TRW A;  4OFT A;  3RDW A;  3E0U A;  1BAY A;  2GQL A;  2I9H A;  5FT3 A;  4PGT A;  4O5R A;  4HI7 A;  1TDI A;  2H6Y A;  2H30 A;  4OCE A;  4TKY A;  5IMD A;  5G1L A;  1GNW A;  2H73 A;  4RUV A;  1M9A A;  2E2G A;  1WOU A;  1TI3 A;  2HRA A;  1B4Q A;  4MH3 A;  3FKF A;  1RK4 A;  2JSZ A;  3CTF A;  4I97 A;  4PX1 A;  3GUR A;  3RHB A;  3ZYW A;  5J9C A;  2P31 A;  4KGI A;  3DVW A;  5IIZ A;  1AW9 A;  4GSN A;  3F0I A;  3H4K A;  2ON7 A;  3KMO A;  2C3T A;  3MWH A;  3Q19 A;  5ECI B;  1BX9 A;  4JR4 A;  1BJX A;  4TW5 A;  1GUL A;  3KGK A;  4V1A g;  1RW1 A;  1DSB A;  1PSQ A;  2H66 A;  4XCS A;  3DD3 A;  1SJZ A;  3ISO A;  3CRT A;  1GNE A;  1YF1 A;  1T4Y A;  2FCH A;  1OC8 A;  3TDG A;  3HY2 A;  3IOS A;  1V2A A;  5HFG A;  3LOR A;  4Q5Q A;  4WKW A;  3APS A;  1K0O A;  5IPG A;  1MD3 A;  3M9J A;  3EVI A;  5DAK A;  4LA1 A;  2NPB A;  4TXV A;  3ZRE A;  4OWY A;  4K7N A;  1G0T A;  2WFC A;  3LGC A;  3IPZ A;  1XCC A;  2IIY A;  2VLT A;  4O7H A;  1DBY A;  1ZYE A;  1ZL9 A;  2E2M A;  1XOA A;  2FWH A;  1ACV A;  3TKQ A;  1BG5 A;  1JZD A;  4L5L A;  4MMM A;  2X8C A;  4OFM A;  5CRE A;  3U6V A;  3D4M A;  3P8W A;  1G6Y A;  1GL8 A;  1Z7R A;  5H5Q A;  4WR4 A;  1CQH A;  1U3A A;  5LNK e;  3TKS C;  1FW1 A;  5H5S A;  3BCI A;  5KN0 A;  3IRA A;  3VWV A;  2MMZ A;  4YAP A;  2YCD A;  4Q5R A;  4MA9 A;  4RI7 A;  4OFN A;  3LXZ A;  4AGS A;  2NVL A;  2DIY A;  1CQG A;  1MDI A;  1GRX A;  3M1G A;  5B6N A;  4HEA 2;  4FYC A;  2HSY A;  1SKS B;  4WBJ A;  2P0G A;  1YJ6 A;  2K18 A;  2VD1 A;  3ZRD A;  1FG4 A;  4I2T A;  4MZB A;  2HRK B;  4IBP A;  4N0V A;  4MPG A;  1ABA A;  4NXI A;  3EE2 A;  3UBK A;  2FUG 2;  3M0F A;  5J41 A;  4GQC A;  2JU5 A;  2L6C A;  5L71 A;  3F6D A;  3QOU A;  1GSE A;  4JU5 A;  2MZC A;  2VL2 C;  5ECQ B;  2YJ7 A;  1WE0 A;  4TR3 A;  1X5E A;  2LRC A;  2VCT A;  3UJ1 A;  3ZFB A;  1F3A A;  1FO5 A;  3IV4 A;  2PN8 A;  3L78 A;  3QFB C;  4NWY A;  1EZK A;  3WT1 A;  4WET A;  1O8X A;  1Y6E A;  4V2M A;  2YPM A;  3GMF A;  5B7C A;  3CMI A;  4YAV A;  1S3D A;  1GSU A;  9GSS A;  3F4R A;  2N5A A;  3DYR A;  2PUK C;  4KA0 A;  3G7Y A;  2EC4 A;  1SEN A;  4HU7 A;  2CVD A;  2VCQ A;  1XZO A;  4F03 A;  4WEY A;  1J0F A;  3I9V 2;  1GTB A;  3EWL A;  2DJ2 A;  14GS A;  1YKC A;  2JL4 A;  3ZIJ A;  2AB6 A;  3Q6O A;  1R7H A;  1OAZ A;  1T1V A;  6GSV A;  3US3 A;  4NV5 A;  5C04 A;  2H1A A;  4TR1 B;  1K0N A;  2LTK A;  5ID2 A;  3DGQ A;  4LL1 B;  4DSR A;  2JSY A;  2M46 A;  4ZB8 A;  1E6B A;  2GQK A;  3ZIV A;  1KBN A;  2JAC A;  3HCZ A;  4Z7X A;  2CAI A;  2GZP A;  2B5Y A;  4TVE A;  3VPT A;  2GGT A;  3BJ5 A;  2DJJ A;  4LL4 B;  1AQX A;  3N5O A;  4MP4 A;  5ECO B;  3HVS A;  4ZIJ A;  3CTG A;  4JED A;  2FNO A;  1HNB A;  1B4P A;  1ERU A;  2TRX A;  2H19 A;  2L5L A;  4GTU A;  3FZA A;  1ERW A;  3KTL A;  17GS A;  3QR6 A;  1O7U A;  5J5N A;  1OVN A;  5CP1 A;  2DJ3 A;  4LLR A;  2GSQ A;  4IGJ A;  1K0B A;  1G6W A;  4JBB A;  4PQ1 A;  2GDR A;  4I5Q A;  2CQ9 A;  2CA8 A;  3IK7 A;  3H79 A;  4ECJ A;  5HR3 A;  5HR2 A;  2HZE B;  1QUW A;  4P3Y B;  3TJF A;  1EWX A;  2X99 A;  2LRN A;  4XRD A;  3UEM A;  3IHQ A;  3GKX A;  2F8F A;  2H1B A;  4JR6 A;  2WJU A;  3HHV A;  7GSS A;  3QAV A;  4KDU A;  4GST A;  1S3C A;  4GWR A;  1KNG A;  4MAB A;  3UMA A;  3TB2 A;  5LCZ A;  2C0G A;  1H4O A;  1M0U A;  1U87 A;  5B6M A;  5DAL B;  3ZFL A;  4HDE A;  3G7I A;  2NTO A;  4PQI A;  3QAW A;  5F06 A;  1TK8 B;  3LYP A;  2HSH A;  13GS A;  3D0Z A;  1E2Y A;  1ZOF A;  4BVX B;  1FHE A;  3D22 A;  3LFL A;  3PPU A;  4F82 A;  3KEB A;  1GUK A;  3EYT A;  2GSS A;  4I2U A;  4BVY A;  5A4U A;  2YWI A;  1F6M C;  1M99 A;  2OE0 A;  2BJX A;  3UL3 A;  1EEJ A;  2TIR A;  5HR0 A;  3WYW A;  4XRA A;  4O32 A;  4XS4 A;  2FWF A;  5JWR B;  4TRX A;  1TRV A;  1SU9 A;  3SWL A;  1DUG A;  1OKT A;  2FA4 A;  1G7O A;  1PD2 1;  2VAF A;  1OC9 B;  3W8J A;  5HR1 A;  3BCK A;  3IXR A;  1V9W A;  3FYG A;  1K3O A;  3TKS A;  1JFU A;  3FZ4 A;  3GL3 A;  1MD4 A;  5D9X A;  1EOH A;  3H1N A;  3L9U A;  1UA5 A;  2CVK A;  4KX4 A;  2MYG A;  2GTU A;  2LJK A;  1X9S B;  2LRT A;  4HS1 A;  3EMX A;  3SBC A;  2VL9 A;  2H6X A;  3LEF A;  2F9S A;  3KZQ A;  3DXB A;  3FR6 A;  1O81 A;  2AAW A;  2VCV A;  1TI1 A;  4E8H A;  3CSJ A;  4KND A;  4QL9 A;  3BBY A;  3FRC A;  4AJ6 A;  2UZ8 A;  3I69 A;  5HQP A;  4ECC A;  2YV7 A;  3PGT A;  4RQX A;  5IO0 A;  4ZL9 A;  4V2N A;  2VCZ A;  2FY6 A;  5AN1 A;  3P7X A;  1F37 A;  3IA1 A;  5A4W A;  2PVO C;  2N5F A;  6GST A;  2KUC A;  2IMI A;  2ES7 A;  2M72 A;  3ME7 A;  2IPA A;  5KN1 A;  4FQU A;  2NBS A;  4NMU A;  5CRG A;  1HD2 A;  1N8J A;  5J3R A;  3FEU A;  2KLX A;  2RUE A;  1ST9 A;  1FB6 A;  1DE2 A;  1F3B A;  1VGL A;  5G5E A;  2X8H A;  4QQ7 A;  2OE3 A;  4XIH A;  2WGR A;  4IP1 A;  1ERV A;  4IVF A;  1NW2 A;  4KH7 A;  3C1S A;  3FW2 A;  2DLX A;  3U5R E;  4PUR A;  3HJM A;  1KTE A;  4X1U A;  1QXH A;  1QQ2 A;  5DAK B;  4MJE A;  5A5K A;  3NZN A;  4MH2 A;  3GKM A;  4NAX A;  1TOF A;  5F07 A;  3KCM A;  3ZML A;  1MEK A;  1T7P B;  5DJM A;  1XVW A;  1YQ1 A;  3EIN A;  4L0W A;  4LMV A;  4ZXG A;  1YEP A;  1WIK A;  2H71 A;  2DJ1 A;  1PX6 A;  2G2Q A;  3C1R A;  3ZTL A;  1AC1 A;  4ML1 A;  4GCI A;  1Z7P A;  5AGY A;  2JAD A;  5KN3 A;  3ZMK A;  3QDN A;  2FGX A;  4FYU A;  3I6A A;  4KSO A;  2REM A;  2AJQ B;  3F6F A;  2VL3 A;  1HNC A;  3E3E A;  1HNA A;  11GS A;  3UOM A;  4FYB A;  3IAS 2;  3GTU A;  2HXK A;  4TR4 A;  2V32 A;  1GTU A;  4EE0 A;  2I3Y A;  2I1U A;  3GRX A;  1SL1 B;  3TOU A;  3RHC A;  1FAA A;  2GST A;  5DQS A;  3L4N A;  3KP8 A;  4EDZ A;  4V2L A;  5DJL A;  4ZL7 A;  1EP8 A;  5G31 A;  4IW9 A;  4H86 A;  3M9K A;  2MMO A;  5G5F A;  3FY7 A;  1ZYQ B;  4K7I A;  1GTI A;  1THO A;  1THX A;  4K0G A;  2YJH A;  2YNX A;  2R4V A;  3MAK A;  1T4Z A;  3KM6 A;  1PKW A;  5D96 A;  2RM5 A;  1M2D A;  1EV4 A;  6GSW A;  5JCW A;  2VIM A;  2H6Z A;  4F2I A;  5J4U A; 
#chains in the Genus database with same CATH topology
 1GLP A;  5IMV A;  3HVX A;  4AI6 A;  3QFA C;  5IMA A;  3L9V A;  2L59 A;  3LJR A;  1HYU A;  3F4T A;  4F0B A;  3VWX A;  4JE1 A;  2VLV A;  3UVT A;  1XW5 A;  2V6K A;  4AKH A;  4EKZ A;  1AQV A;  4GF0 A;  4L0U A;  4MLY A;  3KH7 A;  1XWB A;  4MJB A;  4HU9 A;  1ERT A;  5GST A;  4ZIL A;  2IME A;  4Z2T A;  16GS A;  2IFQ A;  4ZBD A;  4YQM A;  2F3M A;  3WD6 A;  4AKI A;  5ID2 B;  3GYK A;  5IOX A;  5G1K A;  4NHW A;  2QA2 A;  3KXO A;  3MSZ A;  3VWU A;  3GN3 A;  2H74 A;  4F0C A;  5GAN D;  1YY7 A;  4NPB A;  2H1D A;  3WT2 A;  3WGX A;  4K0N A;  3TU3 B;  3ZVJ A;  3GKN A;  2QKE A;  3E9J B;  3TRX A;  3VI7 A;  2DMM A;  3GA4 A;  3LQ7 A;  4XS6 A;  5FWG A;  2MMN A;  4MDC A;  1J9B A;  4IP6 A;  1SYX A;  1W89 A;  4KW6 A;  2X8G A;  1EP7 A;  4NHZ A;  2HLS A;  5CYY A;  1QGV A;  2HYX A;  3L9S A;  4AF2 A;  2DML A;  1FVK A;  4ECB A;  2VM2 A;  2LKU A;  4N10 A;  1XWC A;  1PX7 A;  2GQM A;  5D93 A;  4POL A;  1ML6 A;  5F05 A;  2PWJ A;  3IDV A;  4OMV A;  2LJR A;  3R3E A;  1GSF A;  1K3L A;  1WP0 A;  1JZW A;  2O8V B;  1TU7 A;  4J57 E;  2DJ0 A;  2IN3 A;  2WZ9 A;  5D9W A;  4MJA A;  2WZS A;  5D73 A;  2ZUP A;  1OC3 A;  22GS A;  3RBT A;  2GT6 A;  5JWQ B;  1I5G A;  4BA7 A;  2JZR A;  4CW9 A;  2ALB A;  4MPF A;  3HKR A;  2XPD A;  2L4C A;  3WGD A;  1U6T A;  2LUS A;  5CO3 A;  5JCU A;  1PN9 A;  4I6X A;  3ZVJ D;  5AIS A;  1R26 A;  3CSI A;  5IMC A;  2I4A A;  1GTA A;  3F3R A;  1A23 A;  1M9B A;  4KAE A;  3GL5 A;  2YZU A;  1Z9H A;  2HRN A;  4X0X A;  3TOT A;  2O5V A;  2DIZ A;  4N3Z A;  2JZS A;  4TXO A;  4EXJ A;  3EMP A;  1WPI A;  4CY8 A;  2EFE A;  4AKG A;  1ZMA A;  4NV2 A;  2HFD A;  4D73 A;  3CXG A;  5IO2 A;  3DWV A;  5D8I A;  5EVO A;  3I43 A;  4HQZ A;  2FA8 A;  2E0Q A;  2C8U A;  1LU4 A;  1B9X C;  2J9H A;  4BVY B;  2JZT A;  2VCX A;  3TKP A;  4HZ2 A;  1NHO A;  1XIY A;  4G0I A;  3ME8 A;  4XTS A;  2CZ2 A;  1XG8 A;  2B1L A;  2RUF A;  4EVM A;  1DE1 A;  4GLT A;  4G01 A;  4XS4 B;  4AJ8 A;  2R37 A;  5CRH A;  2OAD A;  1SK2 A;  4DSS A;  2WB9 A;  5INY A;  2CX3 A;  3TCO A;  1C72 A;  1JLV A;  4FIW A;  5IM9 A;  1XW9 A;  1ZYP A;  2C80 A;  2FWE A;  3ZLP A;  4MF5 A;  1N2A A;  1G7E A;  4G9H A;  3JCM L;  1NHY A;  1Q98 A;  1OE8 A;  4PNG A;  3APO A;  4QMK A;  4F9Z A;  5CNW A;  2OA7 A;  4ZBA A;  1R4W A;  1R5P A;  3C71 A;  3L0H A;  4KDX A;  5JWO B;  2PVQ A;  4CHS A;  5GZZ B;  4DVC A;  4Q5F A;  1WRY A;  1GUH A;  2VUP A;  3A5W A;  2N5B A;  3EU4 A;  4OCF A;  5D9T A;  1TRU A;  1YDK A;  2AUV A;  3GX8 A;  2YWO A;  4EF0 A;  5E4W A;  2KHP A;  3VI5 A;  1SL0 B;  2CV4 A;  4BWS A;  3C8E A;  2O89 A;  1BQ7 A;  3C7M A;  3IE3 A;  4EO3 A;  3F63 A;  4PTS A;  5ELA A;  1X9M B;  2FLS A;  2K8V A;  1A8Y A;  3GH9 A;  1O6J A;  3VFI A;  1AXD A;  4IQA A;  12GS A;  1JZO A;  1IYI A;  1WWJ A;  3A3T A;  2F8A A;  2HT9 A;  3QPM A;  4AKX B;  4KE3 A;  1PRX A;  4L8E A;  2H75 A;  1PFO A;  2ZCT A;  4I8B A;  3QAG A;  4DEJ A;  1TP9 A;  1ZCP A;  3BD2 A;  2HSN B;  2F51 A;  2QA1 A;  2K8S A;  1XBS A;  3TRQ A;  1Z5Y E;  5GSS A;  2R3X A;  2XHF A;  2V6O A;  3KMN A;  4MCU A;  2H0H A;  3LG6 A;  2C0D A;  1PL2 A;  1Z6N A;  1PA3 A;  1YZX A;  2YP6 A;  4HOJ A;  4GSS A;  4BL7 B;  4KDY A;  1SD8 A;  18GS A;  2OBI A;  4WF5 A;  5ECK B;  2X49 A;  1USB A;  3P90 A;  2GS3 A;  1SVL A;  6GSX A;  3IBH A;  1BED A;  3HVV A;  3HJP A;  1X5C A;  5J9B A;  1PQN A;  2FHE A;  3LXT A;  1XXU A;  4EDY A;  2PMT A;  2X64 A;  3FR9 A;  4POB A;  1MDJ A;  2H01 A;  1TK0 B;  2OJL A;  2UV8 G;  2VO4 A;  4ID0 A;  1QK8 A;  2MMA A;  1TXU A;  3ZZX A;  4ZB9 A;  1NM3 A;  3FZ5 A;  1PGT A;  1M2B A;  1PMT A;  4ML6 A;  4OO4 A;  5F8B A;  3GX0 A;  3A2W A;  3RGB C;  1VF1 A;  3D6I A;  4N11 A;  5DBQ A;  1VF2 A;  1SJI A;  2P5Q A;  2LQQ A;  3FHK A;  3ED3 A;  3GNJ A;  6GSS A;  2HZF A;  2VL2 A;  5EY6 A;  3M8N A;  3LSZ A;  1TW9 A;  3AY8 A;  1M3J A;  2LNS A;  5H5R A;  3A2X A;  3A2V A;  3D5J A;  4ZBB A;  1PN0 A;  1GSQ A;  4BL7 A;  1V40 A;  5IQY A;  1WJK A;  4QL7 A;  4E68 A;  3TJK A;  1MDK A;  5F0G A;  1R5A A;  4XHM A;  1T3B A;  2LJA A;  1TJD A;  2FD3 A;  2EIR A;  1M7T A;  2LV3 A;  4G0K A;  4W66 A;  4JZQ A;  4YQV A;  1QMV A;  1O73 A;  3GTU B;  2OBK A;  5DCH A;  2WCI A;  3IAM 2;  2YWM A;  5ECH B;  2LS5 A;  2GVP A;  3GIX A;  2H1L A;  4EL1 A;  5LD0 A;  3GST A;  1GSY A;  2VM1 A;  2GT5 A;  3KP9 A;  4IS0 A;  5COH A;  3UVH A;  4KB3 A;  2L6D A;  3GKK A;  4PXO A;  1XVQ A;  1KEB A;  3O76 A;  1FB0 A;  5B8B A;  4BPY A;  5CRW A;  1FVJ A;  3QCP A;  2DC5 A;  2MBS A;  2H72 A;  1AAZ A;  2XBQ A;  2HSM A;  3F9U A;  4V1A p;  1A24 A;  3GUS A;  2BTO T;  2OT3 A;  4IJI A;  1QFN A;  1FOV A;  4YH2 A;  3M3M A;  5A4V A;  4K5R A;  2WS2 A;  2H76 A;  4E8E A;  2IWT A;  4ZB7 A;  3TRP A;  1GP1 A;  1TK5 B;  2WUL A;  3PIN A;  3RPP A;  4MZC A;  3OR5 A;  5AIX A;  3TJB A;  2C1Y A;  4POK A;  3DML A;  2DSA A;  5FHI A;  2H8L A;  1XOB A;  1GLQ A;  3ERW A;  2R5G A;  1GUM A;  3RPN A;  4YQU A;  2A2R A;  2OAC A;  3IC8 A;  4PUA A;  1GSS A;  4LMW A;  1Q4J A;  2YAN A;  1WMJ A;  1S4B P;  2XPE A;  1H75 A;  1SYR A;  1A2L A;  2I81 A;  2VD0 A;  2P5R A;  3NIV A;  5CAX A;  3KTB A;  2KP2 A;  3UAR A;  3CWG A;  4HUA A;  4GQF A;  1X9W B;  2IFQ B;  3EU3 A;  1SL2 B;  4MJC A;  1YF0 A;  5EL8 A;  3Q74 A;  4AJ7 A;  4MF7 A;  5KN2 A;  1N25 A;  4EIQ A;  3W8S A;  1LBK A;  4IHU A;  1M2A A;  6GSU A;  2A2P A;  2GSR A;  2E7P A;  4XS1 A;  3FZ9 A;  5ECL B;  1K0M A;  2H0I A;  1TKD B;  2V1M A;  2DKI A;  4J56 E;  1W4V A;  1ZGN A;  4G10 A;  2B1K A;  5KOW A;  3ZL5 A;  1A0R P;  3TKS E;  1URM A;  1T8E B;  3H8Q A;  4DSQ A;  1TU8 A;  5ENU A;  3D4T A;  3LYK A;  1XFL A;  4JRR A;  2FWG A;  4PI2 C;  3VPQ A;  2VCW A;  4ACS A;  2PER A;  1AQW A;  1I9D A;  3HZ8 A;  2YZH A;  1OKD A;  2GLR A;  5G2Z A;  2C3N A;  2L57 A;  3CBU A;  3MNG A;  5DDL A;  2B7K A;  5G30 A;  1X0R A;  2L4Q A;  3IC4 A;  1B9Y C;  2RII A;  2NDO A;  1B48 A;  1XWG A;  2HRF A;  1ZZY A;  4X4J A;  5E59 A;  3QMX A;  4GRF A;  3EUR A;  2OKA A;  2R6K A;  4HQS A;  2IMK A;  1A2M A;  2ZNM A;  2XC2 A;  2H70 A;  1AIU A;  3FR3 A;  1Z6M A;  3DVX A;  1BYE A;  1O8W A;  2QSI A;  4KF9 A;  2WVX A;  1VF4 A;  2CAQ A;  3Q18 A;  1UVZ A;  1NSW A;  4PNF A;  2WW0 A;  6GSY A;  1Z3E A;  4Q5N A;  2D2Z A;  5ECM B;  5A34 A;  2H1G A;  3TJG A;  1VRS D;  2OE1 A;  2K6V A;  3HYP A;  4WBR D;  1I1I P;  1XW6 A;  3VLN A;  4N0Z A;  4FH8 A;  2DBC A;  2VKZ G;  3TGZ A;  2A2S A;  3KD0 A;  3LWA A;  2AHE A;  2O85 A;  2RLI A;  3CRU A;  1PL1 A;  4ILF A;  4MF6 A;  1SK0 A;  4OD7 A;  2QGV A;  4L5O A;  2HQT A;  4TXO B;  3F8U A;  1V58 A;  4KSM A;  1OYJ A;  4ECI A;  2IJY A;  2J23 A;  4D73 B;  3GV1 A;  1JHB A;  2V41 A;  5ABR A;  4KCE A;  4CY6 A;  1S3A A;  2CZ3 A;  2HRK A;  4HJ2 A;  1SKW B;  2VLU A;  1VF3 A;  3O3T A;  8GSS A;  3V1W A;  1TTZ A;  1ILO A;  2YWN A;  4EC0 A;  2WDU A;  4POM A;  3H93 A;  5IMZ A;  2KP1 A;  2YN1 A;  5D9V A;  4K1F A;  2YOI A;  5ECN B;  1JLW A;  2ON5 A;  1V98 A;  2HE3 A;  3PR8 A;  2PU9 C;  1SK1 A;  5DQY A;  4DSS B;  5ELG A;  2IL3 A;  2QC7 A;  3P2A A;  10GS A;  3TJJ A;  1TRS A;  2GZZ A;  3MDK A;  1PKZ A;  3IK9 A;  2PBJ A;  5J4Y A;  4N30 A;  1GSD A;  5J47 A;  2IMD A;  3DRN A;  4IQ1 A;  5EPF A;  1XWA A;  5IPH A;  2Z9S A;  3WGE A;  4Z2R A;  3HA9 A;  4IKH A;  1OE7 A;  3HJO A;  3KJY A;  3APQ A;  2O7K A;  2BMX A;  3TKR A;  4BIK A;  3HZ4 A;  3NOF A;  3G7J A;  2G0F A;  5ECR B;  1SJ6 A;  4TR1 A;  2HI7 A;  4ZL8 A;  2MBT A;  4FXY P;  5ECS A;  3HDC A;  2VOC A;  2HNL A;  2B5X A;  4TOP A;  3F4S A;  2LEG A;  4K8M A;  5DCG A;  4TN8 A;  1A2J A;  2EFH A;  5IMF A;  1ON4 A;  1EGR A;  4RI6 A;  3TUE A;  3K8N A;  4IEL A;  1LJR A;  3RAZ A;  1A0F A;  4K2D A;  3QD9 A;  3VK9 A;  2CX4 A;  4WR5 A;  2B5E A;  2AYT A;  5IOW A;  5HFI A;  2RM6 A;  1O85 A;  4WXT A;  3N9J A;  1U88 A;  1TXX A;  5JCG A;  2EIQ A;  5BMU B;  4K9Z A;  1EOG A;  1EV9 A;  2M80 A;  3DIE A;  3IR4 A;  4ZB6 A;  4IN0 A;  1EEM A;  4ULX A;  1IYH A;  3J7Y b;  1GH2 A;  2LQO A;  1YKA A;  2PPT A;  2HZE A;  5HFK A;  1F2E A;  4G2E A;  5CRD A;  2GZY A;  3UIW A;  4USS A;  4IJ3 A;  1Y1U A;  5GAP D;  1GWC A;  2DJK A;  3VWW A;  1JZR A;  2A4V A;  2R0P A;  2B3S A;  5AIV A;  2EIO A;  3D21 A;  1XWK A;  1AUC A;  3GHA A;  3R2Q A;  20GS A;  5B8A A;  3DKS A;  2H0G A;  4CDO A;  4KUN A;  4BWQ A;  1Y25 A;  1SD9 A;  19GS A;  3G9B A;  5DAL A;  3EC3 A;  4HZ4 A;  4PQH A;  2WRT A;  3GSS A;  2C0F A;  4TR0 A;  4GXZ A;  4ISD A;  1UC7 A;  1K0C A;  2L5O A;  4O92 A;  4X43 A;  4J2F A;  5BMU A;  2R2J A;  1A8L A;  3FMW A;  1EGO A;  2V2G A;  4BVX A;  3C73 A;  4G0L A;  1T00 A;  4PHZ C;  2LST A;  2CT6 A;  1U3I A;  2XBI A;  4HSC X;  3J7Y k;  3UBL A;  3GH6 A;  3ERF A;  5DVB A;  4WF4 A;  3BOA A;  1YEX A;  4MZW A;  1SKR B;  4RQR A;  5C00 A;  3O6T A;  4K6X A;  3CYN A;  1HQO A;  2AV4 A;  4MK3 A;  3PH9 A;  3S9F A;  3KH9 A;  5ECP B;  2B6M A;  2O87 A;  4G19 A;  4FO5 A;  1RQM A;  1X5D A;  1MTC A;  3KIJ A;  3ERG A;  3HXS A;  4YKG A;  3W6G A;  3ZIT A;  1SVM A;  1K0A A;  1K3Y A;  1XPV A;  2LNT A;  4HJM A;  2TRC P;  1K0D A;  5J4V A;  2HSM B;  1UN2 A;  2B7J A;  3FK8 A;  4K7O A;  1B8X A;  3HD5 A;  1F9M A;  1J08 A;  2CVB A;  4PUF C;  1OC9 A;  3F3Q A;  3DEX A;  3VUR A;  2C4J A;  2IMF A;  2K9F A;  2PGT A;  2C3Q A;  3GFK A;  3CSH A;  4KCA A;  2YV9 A;  4EUY A;  4OO5 A;  5KEJ A;  3UAP A;  1V57 A;  2KOK A;  2C0E A;  1TRW A;  4OFT A;  2R0G A;  3RDW A;  3E0U A;  1BAY A;  1YEW C;  2GQL A;  2I9H A;  5FT3 A;  4PGT A;  4O5R A;  4HI7 A;  1TDI A;  2H6Y A;  2H30 A;  4OCE A;  4TKY A;  5IMD A;  5G1L A;  1GNW A;  3CQF A;  2H73 A;  4RUV A;  4Z2U A;  1M9A A;  2E2G A;  1WOU A;  1TI3 A;  2HRA A;  1B4Q A;  4MH3 A;  3FKF A;  1RK4 A;  2JSZ A;  3CTF A;  4I97 A;  4PX1 A;  3GUR A;  3RHB A;  3ZYW A;  5J9C A;  2P31 A;  4KGI A;  3DVW A;  5IIZ A;  1AW9 A;  4GSN A;  3F0I A;  3H4K A;  2ON7 A;  3KMO A;  2C3T A;  3MWH A;  2A4H A;  3Q19 A;  5ECI B;  1BX9 A;  4JR4 A;  1BJX A;  2X4A A;  4TW5 A;  1GUL A;  3KGK A;  4V1A g;  1RW1 A;  1DSB A;  1FOH A;  1PSQ A;  2H66 A;  4XCS A;  3DD3 A;  1SJZ A;  3ISO A;  2O3E A;  2EFC A;  3CRT A;  1GNE A;  1YF1 A;  1T4Y A;  2FCH A;  1OC8 A;  3TDG A;  3HY2 A;  3IOS A;  1V2A A;  5HFG A;  3LOR A;  4Q5Q A;  4WKW A;  3APS A;  1K0O A;  5IPG A;  1MD3 A;  3M9J A;  3EVI A;  5DAK A;  4LA1 A;  2NPB A;  1S3R A;  3A5I A;  4TXV A;  3ZRE A;  4OWY A;  4K7N A;  1G0T A;  2R0C A;  2WFC A;  3LGC A;  3IPZ A;  1XCC A;  2IIY A;  4YKF A;  2VLT A;  4O7H A;  1DBY A;  1ZYE A;  1ZL9 A;  2WVX B;  2E2M A;  1XOA A;  2FWH A;  1ACV A;  3TKQ A;  1BG5 A;  1JZD A;  4L5L A;  5A5H A;  4MMM A;  2X8C A;  5A34 B;  4OFM A;  5CRE A;  3U6V A;  3D4M A;  3P8W A;  1G6Y A;  1GL8 A;  1Z7R A;  5H5Q A;  4WR4 A;  1CQH A;  1U3A A;  4O5U A;  5LNK e;  3TKS C;  1FW1 A;  5H5S A;  3BCI A;  5KN0 A;  3IRA A;  3VWV A;  2MMZ A;  4YAP A;  2YCD A;  4Q5R A;  4MA9 A;  4RI7 A;  4OFN A;  3LXZ A;  4AGS A;  2NVL A;  2DIY A;  1CQG A;  1MDI A;  1GRX A;  3M1G A;  5B6N A;  4HEA 2;  4FYC A;  2HSY A;  1SKS B;  4WBJ A;  2P0G A;  1YJ6 A;  2K18 A;  2VD1 A;  3ZRD A;  1FG4 A;  4I2T A;  4MZB A;  2HRK B;  4IBP A;  4N0V A;  4MPG A;  1ABA A;  4NXI A;  2WVY A;  3EE2 A;  3UBK A;  2FUG 2;  3M0F A;  5J41 A;  4GQC A;  2JU5 A;  2L6C A;  5J40 A;  5L71 A;  3F6D A;  3QOU A;  1GSE A;  4JU5 A;  2WW3 A;  2MZC A;  5ECQ B;  2VL2 C;  2YJ7 A;  1WE0 A;  4TR3 A;  1X5E A;  2LRC A;  2VCT A;  3UJ1 A;  3ZFB A;  1F3A A;  1FO5 A;  3IV4 A;  2PN8 A;  3L78 A;  3QFB C;  2DKH A;  4NWY A;  1EZK A;  3WT1 A;  3MIX A;  4WET A;  1BG1 A;  5A1N A;  1O8X A;  1Y6E A;  4V2M A;  2YPM A;  3MYD A;  3GMF A;  5B7C A;  3CMI A;  4YAV A;  1S3D A;  1GSU A;  9GSS A;  3F4R A;  3DYR A;  2WW1 A;  2N5A A;  2PUK C;  4KA0 A;  3G7Y A;  3IHG A;  2EC4 A;  4K5S A;  1SEN A;  4HU7 A;  2CVD A;  2VCQ A;  1XZO A;  5KOX A;  4F03 A;  4WEY A;  1J0F A;  3I9V 2;  1GTB A;  3LW9 A;  3EWL A;  2DJ2 A;  14GS A;  1YKC A;  2JL4 A;  3ZIJ A;  4ICY A;  2AB6 A;  1R7H A;  3Q6O A;  1OAZ A;  1T1V A;  6GSV A;  3US3 A;  4NV5 A;  5C04 A;  3HVN A;  2H1A A;  2WVZ A;  4TR1 B;  1K0N A;  2LTK A;  5ID2 A;  3DGQ A;  4LL1 B;  4DSR A;  2JSY A;  2M46 A;  4ZB8 A;  1E6B A;  2GQK A;  3ZIV A;  1KBN A;  2JAC A;  3HCZ A;  4Z7X A;  2CAI A;  4EIP A;  2GZP A;  2B5Y A;  4TVE A;  3VPT A;  2GGT A;  3BJ5 A;  2DJJ A;  4LL4 B;  1AQX A;  3N5O A;  4MP4 A;  5ECO B;  3HVS A;  4ZIJ A;  3CTG A;  4JED A;  2FNO A;  1HNB A;  1B4P A;  1BF5 A;  1ERU A;  2TRX A;  2H19 A;  2L5L A;  4GTU A;  3FZA A;  1ERW A;  3KTL A;  17GS A;  2WW2 A;  3QR6 A;  1O7U A;  5J5N A;  3EPT A;  1OVN A;  5CP1 A;  2DJ3 A;  4LLR A;  2GSQ A;  4IGJ A;  1K0B A;  1G6W A;  4JBB A;  4PQ1 A;  2GDR A;  4I5Q A;  2CQ9 A;  2CA8 A;  3IK7 A;  3H79 A;  4ECJ A;  5HR3 A;  5HR2 A;  2HZE B;  1QUW A;  4P3Y B;  3TJF A;  1EWX A;  2X99 A;  2LRN A;  4XRD A;  3UEM A;  3IHQ A;  3GKX A;  2F8F A;  2H1B A;  4JR6 A;  2WJU A;  3HHV A;  7GSS A;  3QAV A;  4KDU A;  4GST A;  1S3C A;  4GWR A;  1KNG A;  4MAB A;  3UMA A;  3TB2 A;  5LCZ A;  2C0G A;  1H4O A;  5BRT A;  1M0U A;  1U87 A;  5B6M A;  5DAL B;  3ZFL A;  4HDE A;  3G7I A;  2NTO A;  4PQI A;  3QAW A;  5F06 A;  1TK8 B;  3LYP A;  2HSH A;  4GDF A;  13GS A;  3D0Z A;  1E2Y A;  4MNN A;  1ZOF A;  4BVX B;  1FHE A;  3D22 A;  3LFL A;  3PPU A;  4F82 A;  3KEB A;  1GUK A;  3EYT A;  2GSS A;  4I2U A;  4BVY A;  5A4U A;  2YWI A;  1F6M C;  1SVO A;  1M99 A;  2OE0 A;  2BJX A;  3UL3 A;  1EEJ A;  2TIR A;  5HR0 A;  3WYW A;  4XRA A;  4O32 A;  4XS4 A;  2FWF A;  5JWR B;  4TRX A;  1TRV A;  1SU9 A;  3SWL A;  1DUG A;  1OKT A;  2FA4 A;  1G7O A;  1PD2 1;  2VAF A;  1OC9 B;  3W8J A;  5HR1 A;  3BCK A;  3IXR A;  1V9W A;  3FYG A;  1K3O A;  3TKS A;  1JFU A;  3FZ4 A;  3GL3 A;  1MD4 A;  5D9X A;  4K2X A;  3H1N A;  1EOH A;  3L9U A;  1UA5 A;  2CVK A;  4KX4 A;  2MYG A;  2GTU A;  2LJK A;  1X9S B;  2LRT A;  4HS1 A;  1ZYN A;  3EMX A;  3SBC A;  2VL9 A;  2H6X A;  3LEF A;  2F9S A;  3KZQ A;  3DXB A;  3FR6 A;  1O81 A;  2AAW A;  2VCV A;  1TI1 A;  4E8H A;  3CSJ A;  4KND A;  4QL9 A;  3BBY A;  3FRC A;  4AJ6 A;  2UZ8 A;  3I69 A;  5HQP A;  4ECC A;  3CHX C;  2YV7 A;  3PGT A;  4RQX A;  2HSN A;  5IO0 A;  4ZL9 A;  4V2N A;  2VCZ A;  2FY6 A;  5AN1 A;  3P7X A;  1F37 A;  3IA1 A;  5A4W A;  2PVO C;  3RFR C;  2N5F A;  6GST A;  2KUC A;  2IMI A;  2ES7 A;  2M72 A;  3ME7 A;  2IPA A;  4A5P A;  5KN1 A;  4FQU A;  4PI0 C;  2NBS A;  4NMU A;  5CRG A;  1HD2 A;  1N8J A;  5J3R A;  3FEU A;  2KLX A;  2RUE A;  1ST9 A;  1FB6 A;  1DE2 A;  1F3B A;  1VGL A;  5G5E A;  2X8H A;  4QQ7 A;  2OE3 A;  4XIH A;  2WGR A;  4IP1 A;  1ERV A;  4IVF A;  1NW2 A;  4KH7 A;  3C1S A;  3FW2 A;  2DLX A;  3U5R E;  4PUR A;  3HJM A;  1KTE A;  4X1U A;  1QXH A;  1QQ2 A;  5DAK B;  4MJE A;  5A5K A;  3NZN A;  4MH2 A;  3GKM A;  2EFD A;  4NAX A;  4O5Q A;  1TOF A;  5F07 A;  3KCM A;  3ZML A;  1MEK A;  1T7P B;  5DJM A;  1XVW A;  1YQ1 A;  3EIN A;  4L0W A;  4LMV A;  4ZXG A;  1YEP A;  1WIK A;  2H71 A;  2DJ1 A;  1PX6 A;  5A5H B;  2G2Q A;  3C1R A;  3ZTL A;  1AC1 A;  4ML1 A;  4GCI A;  1Z7P A;  5AGY A;  2JAD A;  3HMJ G;  5KN3 A;  3ZMK A;  3QDN A;  2FGX A;  4FYU A;  3I6A A;  4KSO A;  1M3I A;  2REM A;  2AJQ B;  3F6F A;  2VL3 A;  1HNC A;  3E3E A;  1HNA A;  11GS A;  3UOM A;  4FYB A;  3IAS 2;  3GTU A;  2HXK A;  4TR4 A;  2V32 A;  2O36 A;  1GTU A;  4EE0 A;  2I3Y A;  2I1U A;  3GRX A;  1SL1 B;  3TOU A;  3RHC A;  1FAA A;  2GST A;  5DQS A;  3L4N A;  3KP8 A;  4EDZ A;  4V2L A;  5DJL A;  4ZL7 A;  1EP8 A;  5G31 A;  4IW9 A;  4H86 A;  3M9K A;  2MMO A;  5G5F A;  3FY7 A;  1ZYQ B;  4K7I A;  1GTI A;  1THO A;  1THX A;  4K0G A;  2YJH A;  2YNX A;  2R4V A;  3MAK A;  1T4Z A;  3KM6 A;  1PKW A;  5D96 A;  2RM5 A;  1M2D A;  1EV4 A;  5A1N B;  6GSW A;  5JCW A;  2VIM A;  1YVL A;  2H6Z A;  4F2I A;  5J4U A; 
#chains in the Genus database with same CATH homology
 1GLP A;  5IMV A;  3HVX A;  4AI6 A;  3QFA C;  5IMA A;  3L9V A;  2L59 A;  3LJR A;  1HYU A;  3F4T A;  4F0B A;  3VWX A;  4JE1 A;  2VLV A;  3UVT A;  1XW5 A;  2V6K A;  4AKH A;  4EKZ A;  1AQV A;  4GF0 A;  4L0U A;  4MLY A;  3KH7 A;  1XWB A;  4MJB A;  4HU9 A;  1ERT A;  5GST A;  4ZIL A;  2IME A;  4Z2T A;  16GS A;  2IFQ A;  4ZBD A;  4YQM A;  2F3M A;  3WD6 A;  4AKI A;  5ID2 B;  3GYK A;  5IOX A;  5G1K A;  4NHW A;  2QA2 A;  3KXO A;  3MSZ A;  3VWU A;  3GN3 A;  2H74 A;  4F0C A;  5GAN D;  1YY7 A;  4NPB A;  2H1D A;  3WT2 A;  3WGX A;  4K0N A;  3TU3 B;  3ZVJ A;  3GKN A;  2QKE A;  3E9J B;  3TRX A;  3VI7 A;  2DMM A;  3GA4 A;  3LQ7 A;  4XS6 A;  5FWG A;  2MMN A;  4MDC A;  1J9B A;  4IP6 A;  1SYX A;  1W89 A;  4KW6 A;  2X8G A;  1EP7 A;  4NHZ A;  2HLS A;  5CYY A;  1QGV A;  2HYX A;  3L9S A;  4AF2 A;  2DML A;  1FVK A;  4ECB A;  2VM2 A;  2LKU A;  4N10 A;  1XWC A;  1PX7 A;  2GQM A;  5D93 A;  4POL A;  1ML6 A;  5F05 A;  2PWJ A;  3IDV A;  4OMV A;  2LJR A;  3R3E A;  1GSF A;  1K3L A;  1WP0 A;  1JZW A;  2O8V B;  1TU7 A;  4J57 E;  2DJ0 A;  2IN3 A;  2WZ9 A;  5D9W A;  4MJA A;  5D73 A;  2ZUP A;  1OC3 A;  22GS A;  3RBT A;  2GT6 A;  5JWQ B;  1I5G A;  4BA7 A;  2JZR A;  4CW9 A;  2ALB A;  4MPF A;  3HKR A;  2XPD A;  2L4C A;  3WGD A;  1U6T A;  2LUS A;  5CO3 A;  5JCU A;  1PN9 A;  4I6X A;  3ZVJ D;  5AIS A;  1R26 A;  3CSI A;  5IMC A;  2I4A A;  1GTA A;  3F3R A;  1A23 A;  1M9B A;  4KAE A;  3GL5 A;  2YZU A;  1Z9H A;  2HRN A;  4X0X A;  3TOT A;  2O5V A;  2DIZ A;  4N3Z A;  2JZS A;  4TXO A;  4EXJ A;  3EMP A;  1WPI A;  4CY8 A;  2EFE A;  4AKG A;  1ZMA A;  4NV2 A;  2HFD A;  4D73 A;  3CXG A;  5IO2 A;  3DWV A;  5D8I A;  5EVO A;  3I43 A;  4HQZ A;  2FA8 A;  2E0Q A;  2C8U A;  1LU4 A;  1B9X C;  2J9H A;  4BVY B;  2JZT A;  2VCX A;  3TKP A;  4HZ2 A;  1NHO A;  1XIY A;  4G0I A;  3ME8 A;  4XTS A;  2CZ2 A;  2B1L A;  2RUF A;  4EVM A;  1DE1 A;  4GLT A;  4G01 A;  4XS4 B;  4AJ8 A;  2R37 A;  5CRH A;  2OAD A;  1SK2 A;  4DSS A;  2WB9 A;  5INY A;  2CX3 A;  3TCO A;  1C72 A;  1JLV A;  4FIW A;  5IM9 A;  1XW9 A;  1ZYP A;  2C80 A;  2FWE A;  3ZLP A;  4MF5 A;  1N2A A;  1G7E A;  4G9H A;  3JCM L;  1NHY A;  1Q98 A;  1OE8 A;  4PNG A;  3APO A;  4QMK A;  4F9Z A;  5CNW A;  2OA7 A;  4ZBA A;  1R4W A;  1R5P A;  3C71 A;  3L0H A;  4KDX A;  5JWO B;  2PVQ A;  4CHS A;  5GZZ B;  4DVC A;  4Q5F A;  1WRY A;  1GUH A;  2VUP A;  3A5W A;  2N5B A;  3EU4 A;  4OCF A;  5D9T A;  1TRU A;  1YDK A;  2AUV A;  3GX8 A;  2YWO A;  4EF0 A;  5E4W A;  2KHP A;  3VI5 A;  1SL0 B;  2CV4 A;  4BWS A;  3C8E A;  2O89 A;  1BQ7 A;  3C7M A;  3IE3 A;  4EO3 A;  3F63 A;  4PTS A;  5ELA A;  1X9M B;  2FLS A;  2K8V A;  1A8Y A;  3GH9 A;  1O6J A;  3VFI A;  1AXD A;  4IQA A;  12GS A;  1JZO A;  1IYI A;  1WWJ A;  3A3T A;  2F8A A;  2HT9 A;  3QPM A;  4AKX B;  4KE3 A;  1PRX A;  4L8E A;  2H75 A;  2ZCT A;  4I8B A;  3QAG A;  4DEJ A;  1TP9 A;  1ZCP A;  3BD2 A;  2HSN B;  2F51 A;  2QA1 A;  2K8S A;  1XBS A;  3TRQ A;  1Z5Y E;  5GSS A;  2R3X A;  2XHF A;  2V6O A;  3KMN A;  4MCU A;  2H0H A;  3LG6 A;  2C0D A;  1PL2 A;  1Z6N A;  1PA3 A;  1YZX A;  2YP6 A;  4HOJ A;  4GSS A;  4BL7 B;  4KDY A;  1SD8 A;  18GS A;  2OBI A;  4WF5 A;  5ECK B;  2X49 A;  1USB A;  3P90 A;  2GS3 A;  1SVL A;  6GSX A;  3IBH A;  1BED A;  3HVV A;  3HJP A;  1X5C A;  5J9B A;  1PQN A;  2FHE A;  3LXT A;  1XXU A;  4EDY A;  2PMT A;  2X64 A;  3FR9 A;  4POB A;  1MDJ A;  2H01 A;  1TK0 B;  2OJL A;  2UV8 G;  2VO4 A;  4ID0 A;  1QK8 A;  2MMA A;  1TXU A;  3ZZX A;  4ZB9 A;  1NM3 A;  3FZ5 A;  1PGT A;  1M2B A;  1PMT A;  4ML6 A;  4OO4 A;  5F8B A;  3GX0 A;  3A2W A;  1VF1 A;  3D6I A;  4N11 A;  5DBQ A;  1VF2 A;  1SJI A;  2P5Q A;  2LQQ A;  3FHK A;  3ED3 A;  3GNJ A;  6GSS A;  2HZF A;  2VL2 A;  5EY6 A;  3M8N A;  3LSZ A;  1TW9 A;  3AY8 A;  2LNS A;  5H5R A;  3A2X A;  3A2V A;  3D5J A;  4ZBB A;  1PN0 A;  1GSQ A;  4BL7 A;  1V40 A;  5IQY A;  1WJK A;  4QL7 A;  4E68 A;  3TJK A;  1MDK A;  5F0G A;  1R5A A;  4XHM A;  1T3B A;  2LJA A;  1TJD A;  2FD3 A;  2EIR A;  1M7T A;  2LV3 A;  4G0K A;  4W66 A;  4JZQ A;  4YQV A;  1QMV A;  1O73 A;  3GTU B;  2OBK A;  5DCH A;  2WCI A;  3IAM 2;  2YWM A;  5ECH B;  2LS5 A;  2GVP A;  3GIX A;  2H1L A;  4EL1 A;  5LD0 A;  3GST A;  1GSY A;  2VM1 A;  2GT5 A;  3KP9 A;  4IS0 A;  5COH A;  3UVH A;  4KB3 A;  2L6D A;  3GKK A;  4PXO A;  1XVQ A;  1KEB A;  3O76 A;  1FB0 A;  5B8B A;  4BPY A;  5CRW A;  1FVJ A;  3QCP A;  2DC5 A;  2MBS A;  2H72 A;  1AAZ A;  2XBQ A;  2HSM A;  3F9U A;  4V1A p;  1A24 A;  3GUS A;  2BTO T;  2OT3 A;  4IJI A;  1QFN A;  1FOV A;  4YH2 A;  3M3M A;  5A4V A;  4K5R A;  2WS2 A;  2H76 A;  4E8E A;  2IWT A;  4ZB7 A;  3TRP A;  1GP1 A;  1TK5 B;  2WUL A;  3PIN A;  3RPP A;  4MZC A;  3OR5 A;  5AIX A;  3TJB A;  2C1Y A;  4POK A;  3DML A;  2DSA A;  5FHI A;  2H8L A;  1XOB A;  1GLQ A;  3ERW A;  2R5G A;  1GUM A;  3RPN A;  4YQU A;  2A2R A;  2OAC A;  3IC8 A;  4PUA A;  1GSS A;  4LMW A;  1Q4J A;  2YAN A;  1WMJ A;  2XPE A;  1H75 A;  1SYR A;  1A2L A;  2I81 A;  2VD0 A;  2P5R A;  3NIV A;  5CAX A;  3KTB A;  2KP2 A;  3UAR A;  3CWG A;  4HUA A;  4GQF A;  1X9W B;  2IFQ B;  3EU3 A;  1SL2 B;  4MJC A;  1YF0 A;  5EL8 A;  3Q74 A;  4AJ7 A;  4MF7 A;  5KN2 A;  1N25 A;  4EIQ A;  3W8S A;  1LBK A;  4IHU A;  1M2A A;  6GSU A;  2A2P A;  2GSR A;  2E7P A;  4XS1 A;  3FZ9 A;  5ECL B;  1K0M A;  2H0I A;  1TKD B;  2V1M A;  2DKI A;  4J56 E;  1W4V A;  1ZGN A;  4G10 A;  2B1K A;  5KOW A;  3ZL5 A;  1A0R P;  3TKS E;  1URM A;  1T8E B;  3H8Q A;  4DSQ A;  1TU8 A;  5ENU A;  3D4T A;  3LYK A;  1XFL A;  4JRR A;  2FWG A;  3VPQ A;  2VCW A;  4ACS A;  2PER A;  1AQW A;  1I9D A;  3HZ8 A;  2YZH A;  1OKD A;  2GLR A;  5G2Z A;  2C3N A;  2L57 A;  3CBU A;  3MNG A;  5DDL A;  2B7K A;  5G30 A;  1X0R A;  2L4Q A;  3IC4 A;  1B9Y C;  2RII A;  2NDO A;  1B48 A;  1XWG A;  2HRF A;  1ZZY A;  4X4J A;  5E59 A;  3QMX A;  4GRF A;  3EUR A;  2OKA A;  2R6K A;  4HQS A;  2IMK A;  1A2M A;  2ZNM A;  2XC2 A;  2H70 A;  1AIU A;  3FR3 A;  1Z6M A;  3DVX A;  1BYE A;  1O8W A;  2QSI A;  4KF9 A;  1VF4 A;  2CAQ A;  3Q18 A;  1UVZ A;  1NSW A;  4PNF A;  6GSY A;  1Z3E A;  4Q5N A;  2D2Z A;  5ECM B;  5A34 A;  2H1G A;  3TJG A;  1VRS D;  2OE1 A;  2K6V A;  3HYP A;  4WBR D;  1XW6 A;  3VLN A;  4N0Z A;  4FH8 A;  2DBC A;  2VKZ G;  3TGZ A;  2A2S A;  3KD0 A;  3LWA A;  2AHE A;  2O85 A;  2RLI A;  3CRU A;  1PL1 A;  4ILF A;  4MF6 A;  1SK0 A;  4OD7 A;  2QGV A;  4L5O A;  2HQT A;  4TXO B;  3F8U A;  1V58 A;  4KSM A;  1OYJ A;  4ECI A;  2IJY A;  2J23 A;  4D73 B;  3GV1 A;  1JHB A;  2V41 A;  5ABR A;  4KCE A;  4CY6 A;  1S3A A;  2CZ3 A;  2HRK A;  4HJ2 A;  1SKW B;  2VLU A;  1VF3 A;  3O3T A;  8GSS A;  3V1W A;  1TTZ A;  1ILO A;  2YWN A;  4EC0 A;  2WDU A;  4POM A;  3H93 A;  5IMZ A;  2KP1 A;  2YN1 A;  5D9V A;  4K1F A;  2YOI A;  5ECN B;  1JLW A;  2ON5 A;  1V98 A;  2HE3 A;  3PR8 A;  2PU9 C;  1SK1 A;  5DQY A;  4DSS B;  5ELG A;  2IL3 A;  2QC7 A;  3P2A A;  10GS A;  3TJJ A;  1TRS A;  2GZZ A;  3MDK A;  1PKZ A;  3IK9 A;  2PBJ A;  5J4Y A;  4N30 A;  1GSD A;  5J47 A;  2IMD A;  3DRN A;  4IQ1 A;  5EPF A;  1XWA A;  5IPH A;  2Z9S A;  3WGE A;  4Z2R A;  3HA9 A;  4IKH A;  1OE7 A;  3HJO A;  3KJY A;  3APQ A;  2O7K A;  2BMX A;  3TKR A;  3HZ4 A;  3NOF A;  3G7J A;  2G0F A;  5ECR B;  1SJ6 A;  4TR1 A;  2HI7 A;  4ZL8 A;  2MBT A;  5ECS A;  3HDC A;  2VOC A;  2HNL A;  2B5X A;  4TOP A;  3F4S A;  2LEG A;  4K8M A;  5DCG A;  4TN8 A;  1A2J A;  2EFH A;  5IMF A;  1ON4 A;  1EGR A;  4RI6 A;  3TUE A;  3K8N A;  4IEL A;  1LJR A;  3RAZ A;  1A0F A;  4K2D A;  3QD9 A;  3VK9 A;  2CX4 A;  4WR5 A;  2B5E A;  2AYT A;  5IOW A;  5HFI A;  2RM6 A;  1O85 A;  4WXT A;  3N9J A;  1U88 A;  1TXX A;  5JCG A;  2EIQ A;  5BMU B;  4K9Z A;  1EOG A;  1EV9 A;  2M80 A;  3DIE A;  3IR4 A;  4ZB6 A;  4IN0 A;  1EEM A;  4ULX A;  1IYH A;  3J7Y b;  1GH2 A;  2LQO A;  1YKA A;  2PPT A;  2HZE A;  5HFK A;  1F2E A;  4G2E A;  5CRD A;  2GZY A;  3UIW A;  4USS A;  4IJ3 A;  1Y1U A;  5GAP D;  1GWC A;  2DJK A;  3VWW A;  1JZR A;  2A4V A;  2R0P A;  2B3S A;  5AIV A;  2EIO A;  3D21 A;  1XWK A;  1AUC A;  3GHA A;  3R2Q A;  20GS A;  5B8A A;  3DKS A;  2H0G A;  4CDO A;  4KUN A;  4BWQ A;  1Y25 A;  1SD9 A;  19GS A;  3G9B A;  5DAL A;  3EC3 A;  4HZ4 A;  4PQH A;  2WRT A;  3GSS A;  2C0F A;  4TR0 A;  4GXZ A;  4ISD A;  1UC7 A;  1K0C A;  2L5O A;  4O92 A;  4X43 A;  4J2F A;  5BMU A;  2R2J A;  1A8L A;  3FMW A;  1EGO A;  2V2G A;  4BVX A;  3C73 A;  4G0L A;  1T00 A;  2LST A;  2CT6 A;  1U3I A;  2XBI A;  3J7Y k;  3UBL A;  3GH6 A;  3ERF A;  5DVB A;  4WF4 A;  3BOA A;  1YEX A;  4MZW A;  1SKR B;  4RQR A;  5C00 A;  3O6T A;  4K6X A;  3CYN A;  1HQO A;  2AV4 A;  4MK3 A;  3PH9 A;  3S9F A;  3KH9 A;  5ECP B;  2B6M A;  2O87 A;  4G19 A;  4FO5 A;  1RQM A;  1X5D A;  1MTC A;  3KIJ A;  3ERG A;  3HXS A;  4YKG A;  3W6G A;  3ZIT A;  1SVM A;  1K0A A;  1K3Y A;  1XPV A;  2LNT A;  4HJM A;  2TRC P;  1K0D A;  5J4V A;  2HSM B;  1UN2 A;  2B7J A;  3FK8 A;  4K7O A;  1B8X A;  3HD5 A;  1F9M A;  1J08 A;  2CVB A;  4PUF C;  1OC9 A;  3F3Q A;  3DEX A;  3VUR A;  2C4J A;  2IMF A;  2K9F A;  2PGT A;  2C3Q A;  3GFK A;  3CSH A;  4KCA A;  2YV9 A;  4EUY A;  4OO5 A;  5KEJ A;  3UAP A;  1V57 A;  2KOK A;  2C0E A;  1TRW A;  4OFT A;  2R0G A;  3RDW A;  3E0U A;  1BAY A;  2GQL A;  2I9H A;  5FT3 A;  4PGT A;  4O5R A;  4HI7 A;  1TDI A;  2H6Y A;  2H30 A;  4OCE A;  4TKY A;  5IMD A;  5G1L A;  1GNW A;  2H73 A;  4RUV A;  4Z2U A;  1M9A A;  2E2G A;  1WOU A;  1TI3 A;  2HRA A;  1B4Q A;  4MH3 A;  3FKF A;  1RK4 A;  2JSZ A;  3CTF A;  4I97 A;  4PX1 A;  3GUR A;  3RHB A;  3ZYW A;  5J9C A;  2P31 A;  4KGI A;  3DVW A;  5IIZ A;  1AW9 A;  4GSN A;  3F0I A;  3H4K A;  2ON7 A;  3KMO A;  2C3T A;  3MWH A;  2A4H A;  3Q19 A;  5ECI B;  1BX9 A;  4JR4 A;  1BJX A;  2X4A A;  4TW5 A;  1GUL A;  3KGK A;  4V1A g;  1RW1 A;  1DSB A;  1FOH A;  1PSQ A;  2H66 A;  4XCS A;  3DD3 A;  1SJZ A;  3ISO A;  2EFC A;  3CRT A;  1GNE A;  1YF1 A;  1T4Y A;  2FCH A;  1OC8 A;  3TDG A;  3HY2 A;  3IOS A;  1V2A A;  5HFG A;  3LOR A;  4Q5Q A;  4WKW A;  3APS A;  1K0O A;  5IPG A;  1MD3 A;  3M9J A;  3EVI A;  5DAK A;  4LA1 A;  2NPB A;  3A5I A;  4TXV A;  3ZRE A;  4OWY A;  4K7N A;  1G0T A;  2R0C A;  2WFC A;  3LGC A;  3IPZ A;  1XCC A;  2IIY A;  4YKF A;  2VLT A;  4O7H A;  1DBY A;  1ZYE A;  1ZL9 A;  2E2M A;  1XOA A;  2FWH A;  1ACV A;  3TKQ A;  1BG5 A;  1JZD A;  4L5L A;  5A5H A;  4MMM A;  2X8C A;  5A34 B;  4OFM A;  5CRE A;  3U6V A;  3D4M A;  3P8W A;  1G6Y A;  1GL8 A;  1Z7R A;  5H5Q A;  4WR4 A;  1CQH A;  1U3A A;  4O5U A;  5LNK e;  3TKS C;  1FW1 A;  5H5S A;  3BCI A;  5KN0 A;  3IRA A;  3VWV A;  2MMZ A;  4YAP A;  2YCD A;  4Q5R A;  4MA9 A;  4RI7 A;  4OFN A;  3LXZ A;  4AGS A;  2NVL A;  2DIY A;  1CQG A;  1MDI A;  1GRX A;  3M1G A;  5B6N A;  4HEA 2;  4FYC A;  2HSY A;  1SKS B;  4WBJ A;  2P0G A;  1YJ6 A;  2K18 A;  2VD1 A;  3ZRD A;  1FG4 A;  4I2T A;  4MZB A;  2HRK B;  4IBP A;  4N0V A;  4MPG A;  1ABA A;  4NXI A;  3EE2 A;  3UBK A;  2FUG 2;  3M0F A;  5J41 A;  4GQC A;  2JU5 A;  2L6C A;  5J40 A;  5L71 A;  3F6D A;  3QOU A;  1GSE A;  4JU5 A;  2MZC A;  2VL2 C;  5ECQ B;  2YJ7 A;  1WE0 A;  4TR3 A;  1X5E A;  2LRC A;  2VCT A;  3UJ1 A;  3ZFB A;  1F3A A;  1FO5 A;  3IV4 A;  2PN8 A;  3L78 A;  3QFB C;  2DKH A;  4NWY A;  1EZK A;  3WT1 A;  3MIX A;  4WET A;  1BG1 A;  5A1N A;  1O8X A;  1Y6E A;  4V2M A;  2YPM A;  3MYD A;  3GMF A;  5B7C A;  3CMI A;  4YAV A;  1S3D A;  1GSU A;  9GSS A;  3F4R A;  2N5A A;  3DYR A;  2PUK C;  4KA0 A;  3G7Y A;  3IHG A;  2EC4 A;  4K5S A;  1SEN A;  4HU7 A;  2CVD A;  2VCQ A;  1XZO A;  5KOX A;  4F03 A;  4WEY A;  1J0F A;  3I9V 2;  1GTB A;  3LW9 A;  3EWL A;  2DJ2 A;  14GS A;  1YKC A;  2JL4 A;  3ZIJ A;  4ICY A;  2AB6 A;  1R7H A;  3Q6O A;  1OAZ A;  1T1V A;  6GSV A;  3US3 A;  4NV5 A;  5C04 A;  2H1A A;  4TR1 B;  1K0N A;  2LTK A;  5ID2 A;  3DGQ A;  4LL1 B;  4DSR A;  2JSY A;  2M46 A;  4ZB8 A;  1E6B A;  2GQK A;  3ZIV A;  1KBN A;  2JAC A;  3HCZ A;  4Z7X A;  2CAI A;  4EIP A;  2GZP A;  2B5Y A;  4TVE A;  3VPT A;  2GGT A;  3BJ5 A;  2DJJ A;  4LL4 B;  1AQX A;  3N5O A;  4MP4 A;  5ECO B;  3HVS A;  4ZIJ A;  3CTG A;  4JED A;  2FNO A;  1HNB A;  1B4P A;  1BF5 A;  1ERU A;  2TRX A;  2H19 A;  2L5L A;  4GTU A;  3FZA A;  1ERW A;  3KTL A;  17GS A;  3QR6 A;  1O7U A;  5J5N A;  3EPT A;  1OVN A;  5CP1 A;  2DJ3 A;  4LLR A;  2GSQ A;  4IGJ A;  1K0B A;  1G6W A;  4JBB A;  4PQ1 A;  2GDR A;  4I5Q A;  2CQ9 A;  2CA8 A;  3IK7 A;  3H79 A;  4ECJ A;  5HR3 A;  5HR2 A;  2HZE B;  1QUW A;  4P3Y B;  3TJF A;  1EWX A;  2X99 A;  2LRN A;  4XRD A;  3UEM A;  3IHQ A;  3GKX A;  2F8F A;  2H1B A;  4JR6 A;  2WJU A;  3HHV A;  7GSS A;  3QAV A;  4KDU A;  4GST A;  1S3C A;  4GWR A;  1KNG A;  4MAB A;  3UMA A;  3TB2 A;  5LCZ A;  2C0G A;  1H4O A;  5BRT A;  1M0U A;  1U87 A;  5B6M A;  5DAL B;  3ZFL A;  4HDE A;  3G7I A;  2NTO A;  4PQI A;  3QAW A;  5F06 A;  1TK8 B;  3LYP A;  2HSH A;  4GDF A;  13GS A;  3D0Z A;  1E2Y A;  4MNN A;  1ZOF A;  4BVX B;  1FHE A;  3D22 A;  3LFL A;  3PPU A;  4F82 A;  3KEB A;  1GUK A;  3EYT A;  2GSS A;  4I2U A;  4BVY A;  5A4U A;  2YWI A;  1F6M C;  1SVO A;  1M99 A;  2OE0 A;  2BJX A;  3UL3 A;  1EEJ A;  2TIR A;  5HR0 A;  3WYW A;  4XRA A;  4O32 A;  4XS4 A;  2FWF A;  5JWR B;  4TRX A;  1TRV A;  1SU9 A;  3SWL A;  1DUG A;  1OKT A;  2FA4 A;  1G7O A;  1PD2 1;  2VAF A;  1OC9 B;  3W8J A;  5HR1 A;  3BCK A;  3IXR A;  1V9W A;  3FYG A;  1K3O A;  3TKS A;  1JFU A;  3FZ4 A;  3GL3 A;  1MD4 A;  5D9X A;  4K2X A;  1EOH A;  3H1N A;  3L9U A;  1UA5 A;  2CVK A;  4KX4 A;  2MYG A;  2GTU A;  2LJK A;  1X9S B;  2LRT A;  4HS1 A;  1ZYN A;  3EMX A;  3SBC A;  2VL9 A;  2H6X A;  3LEF A;  2F9S A;  3KZQ A;  3DXB A;  3FR6 A;  1O81 A;  2AAW A;  2VCV A;  1TI1 A;  4E8H A;  3CSJ A;  4KND A;  4QL9 A;  3BBY A;  3FRC A;  4AJ6 A;  2UZ8 A;  3I69 A;  5HQP A;  4ECC A;  2YV7 A;  3PGT A;  4RQX A;  2HSN A;  5IO0 A;  4ZL9 A;  4V2N A;  2VCZ A;  2FY6 A;  5AN1 A;  3P7X A;  1F37 A;  3IA1 A;  5A4W A;  2PVO C;  2N5F A;  6GST A;  2KUC A;  2IMI A;  2ES7 A;  2M72 A;  3ME7 A;  2IPA A;  4A5P A;  5KN1 A;  4FQU A;  2NBS A;  4NMU A;  5CRG A;  1HD2 A;  1N8J A;  5J3R A;  3FEU A;  2KLX A;  2RUE A;  1ST9 A;  1FB6 A;  1DE2 A;  1F3B A;  1VGL A;  5G5E A;  2X8H A;  4QQ7 A;  2OE3 A;  4XIH A;  2WGR A;  4IP1 A;  1ERV A;  4IVF A;  1NW2 A;  4KH7 A;  3C1S A;  3FW2 A;  2DLX A;  3U5R E;  4PUR A;  3HJM A;  1KTE A;  4X1U A;  1QXH A;  1QQ2 A;  5DAK B;  4MJE A;  5A5K A;  3NZN A;  4MH2 A;  3GKM A;  2EFD A;  4NAX A;  4O5Q A;  1TOF A;  5F07 A;  3KCM A;  3ZML A;  1MEK A;  1T7P B;  5DJM A;  1XVW A;  1YQ1 A;  3EIN A;  4L0W A;  4LMV A;  4ZXG A;  1YEP A;  1WIK A;  2H71 A;  2DJ1 A;  1PX6 A;  5A5H B;  2G2Q A;  3C1R A;  3ZTL A;  1AC1 A;  4ML1 A;  4GCI A;  1Z7P A;  5AGY A;  2JAD A;  3HMJ G;  5KN3 A;  3ZMK A;  3QDN A;  2FGX A;  4FYU A;  3I6A A;  4KSO A;  2REM A;  2AJQ B;  3F6F A;  2VL3 A;  1HNC A;  3E3E A;  1HNA A;  11GS A;  3UOM A;  4FYB A;  3IAS 2;  3GTU A;  2HXK A;  4TR4 A;  2V32 A;  1GTU A;  4EE0 A;  2I3Y A;  2I1U A;  3GRX A;  1SL1 B;  3TOU A;  3RHC A;  1FAA A;  2GST A;  5DQS A;  3L4N A;  3KP8 A;  4EDZ A;  4V2L A;  5DJL A;  4ZL7 A;  1EP8 A;  5G31 A;  4IW9 A;  4H86 A;  3M9K A;  2MMO A;  5G5F A;  3FY7 A;  1ZYQ B;  4K7I A;  1GTI A;  1THO A;  1THX A;  4K0G A;  2YJH A;  2YNX A;  2R4V A;  3MAK A;  1T4Z A;  3KM6 A;  1PKW A;  5D96 A;  2RM5 A;  1M2D A;  1EV4 A;  5A1N B;  6GSW A;  5JCW A;  2VIM A;  1YVL A;  2H6Z A;  4F2I A;  5J4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...