3GTUB

Ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
224
structure length
224
Chain Sequence
SCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 224
sequence length 224
chains with identical sequence D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3gtuB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gtuB01
2B7KA 3KP9A 2DBCA 2GSSA 4XRAA 5J9BA 1HYUA 3A2XA 3CXGA 2FWFA 5AISA 2V6OA 2GQMA 4FH8A 2MBSA 4G10A 5DJLA 4L8EA 3DXBA 4HOJA 3BBYA 1XWCA 1JLVA 1EGRA 2JADA 5D73A 4POKA 4RQXA 2AJQB 3RDWA 2AUVA 2PGTA 2O85A 3ZMKA 4YQVA 5CAXA 2C0FA 1S3DA 4ECJA 4OMVA 3TJFA 1GULA 2HE3A 1TK5B 2L5LA 4PQ1A 2YPMA 4PTSA 3L9SA 3M0FA 4JR4A 1M0UA 3IAM2 2HQTA 1HNCA 1M99A 1K0CA 4PURA 5CRDA 1M2DA 1A2LA 1C72A 3JCML 2YNXA 1K0NA 4F03A 4GSSA 5D96A 2KHPA 1UA5A 4FYUA 4ZBAA 2TRXA 4HJ2A 1LJRA 3GSTA 2AV4A 3FZ4A 3IV4A 4JEDA 3VI7A 3GX0A 3TJGA 2AAWA 2X64A 3FYGA 4L0UA 1XWKA 5DALB 2FUG2 2HRKA 1B4QA 4K7NA 3CRTA 3D5JA 1TK8B 8GSSA 2BJXA 2L5OA 3TRXA 1DE2A 5BMUA 11GSA 3HDCA 4GTUA 3UAPA 5HFIA 4POMA 3GFKA 2VLVA 1GSQA 4K6XA 3HJPA 4WBRD 3GHAA 2TRCP 4HQZA 2XC2A 2ES7A 1XWAA 4TRXA 2FWHA 1NW2A 2LNTA 4V1Ag 1JFUA 1M2BA 2PN8A 3AY8A 1OE8A 4WKWA 5B6NA 4EVMA 5DJMA 2HRAA 3LSZA 2LEGA 2E0QA 20GSA 2FY6A 4K1FA 1SL1B 5L71A 3LXTA 2LRCA 2YZUA 2GT6A 2JU5A 3FY7A 4GCIA 5C00A 5B7CA 1ZYEA 5J3RA 5IO0A 5FT3A 2DJ3A 1YKAA 4XCSA 1HNAA 1WE0A 3MNGA 3ZL5A 1Q98A 1AAZA 3HD5A 1QFNA 1TI1A 5DALA 2HFDA 3F4SA 2GGTA 2FWEA 4XHMA 1T4YA 1OYJA 4I5QA 3IOSA 1ZL9A 3D22A 1GUMA 5JWRB 4G2EA 1SK1A 3I9V2 3ZRDA 4QL7A 4MH3A 1OKTA 1Z6MA 2YCDA 2H1GA 1X9MB 2H74A 3P90A 4ECBA 2AYTA 5D93A 1SL2B 4N30A 4WBJA 4MF6A 3C7MA 3ZIJA 4N0ZA 4POLA 1K0DA 3KJYA 3V1WA 4ZBBA 1X9SB 2QC7A 1VF3A 3RBTA 4MZCA 2B3SA 1R4WA 1K3LA 3FK8A 2YANA 1XZOA 1V40A 5G5FA 1S3CA 3KD0A 3E0UA 4KDUA 1F3BA 2K6VA 3C1RA 1W4VA 4F0BA 2XPEA 2H66A 4V1Ap 1CQGA 3TUEA 3EE2A 4BVYB 1U87A 3FR3A 4IKHA 1XFLA 5B8BA 2H01A 2NBSA 3FR9A 3MWHA 1GTIA 3DVXA 2R6KA 2WJUA 1YJ6A 1J08A 1N2AA 3TKRA 4PNGA 3FKFA 3GTUB 4EC0A 2FA8A 2KUCA 3EC3A 1SKRB 1THOA 4MPFA 3KM6A 5FWGA 2ZUPA 1I9DA 1XVQA 1K3YA 2GTUA 4IP1A 1TK0B 3TRPA 3Q19A 1R5AA 4DEJA 3FEUA 2H75A 5D9VA 1DE1A 3UJ1A 4BWQA 3NZNA 4MCUA 4ML1A 2ZNMA 5DCHA 5ECHB 1TI3A 2F8AA 1ERUA 2YV9A 3O6TA 1AQVA 4IQAA 1AW9A 1WP0A 3GKMA 4NV2A 3HXSA 4ZB6A 4E8HA 4XRDA 2O7KA 1O73A 3TJJA 4RI6A 5ELGA 4NPBA 2GZZA 4KGIA 3ZVJD 3CSHA 4EXJA 2F3MA 3QPMA 5H5SA 5F06A 3IA1A 2WDUA 1ZCPA 3ED3A 1X5EA 3BOAA 2YWOA 3VLNA 2L6CA 2ZCTA 3D6IA 4JE1A 5FHIA 4HZ4A 1YY7A 1PKWA 2CAIA 3GN3A 3M3MA 5ECKB 1MD3A 2K9FA 4KUNA 5C04A 4DVCA 4BVYA 5GZZB 1GWCA 12GSA 1B8XA 4ULXA 3D4TA 2JACA 3KXOA 4J56E 4YH2A 1GSFA 2CA8A 1FB0A 2HNLA 1YF0A 3TCOA 4OCEA 5HR3A 2O89A 4O7HA 3MAKA 2GSQA 3SBCA 1NHOA 3VWWA 6GSSA 1S3AA 1A0RP 3QFAC 2OBKA 1JZWA 4CHSA 4FIWA 2B5EA 2HI7A 2WS2A 2BTOT 5KN0A 2KOKA 4EDZA 2LJKA 2NDOA 2VIMA 4L0WA 3KMOA 2PUKC 1O85A 4N0VA 1ST9A 2GSTA 5DCGA 1BJXA 3R3EA 2C8UA 3PGTA 4ZIJA 3EVIA 4K7IA 4WF4A 3L0HA 2VOCA 1Z7RA 1Z9HA 3G7YA 4MJCA 4NWYA 2OADA 1U3IA 4KDYA 1Z7PA 4IW9A 3TJBA 1XPVA 2DMMA 1F2EA 1TTZA 4FO5A 3F6FA 1U6TA 2EIOA 2VLUA 1V57A 2F9SA 4H86A 1TW9A 2OE0A 2R5GA 2OA7A 2H1AA 4F9ZA 4JBBA 3F6DA 4QL9A 2I81A 1IYIA 5IPHA 3WD6A 3HY2A 5DAKA 5ECSA 3IDVA 2QKEA 1DBYA 2DLXA 4MK3A 4KW6A 3I6AA 3F0IA 1OKDA 4WETA 3KIJA 5G30A 3WGDA 3H1NA 2HRFA 4ID0A 2RLIA 3ZREA 2DJKA 3LYKA 4MZWA 1T1VA 2DIYA 3VWVA 2OBIA 3RPNA 4JR6A 3U6VA 5DQSA 5CRGA 3J7Yb 3O3TA 3GA4A 3F8UA 3GV1A 1PX6A 5IMCA 2CVDA 3KTLA 2L59A 2X8GA 4F2IA 2ON7A 2P0GA 4MF7A 3EMPA 5KEJA 1Y25A 3KTBA 1G6YA 1AQWA 2L4CA 2DIZA 4K2DA 3DKSA 4PUAA 2KLXA 1G0TA 4BPYA 4MA9A 5KN1A 1PRXA 1GSEA 3US3A 1PL1A 1XCCA 2FLSA 3LWAA 1YZXA 4DSQA 5IMFA 2MMAA 3HVXA 3H93A 3W6GA 3C1SA 3DGQA 1XW6A 1XIYA 5ECQB 5IMVA 5EVOA 2X8CA 3U5RE 4XS4B 1T7PB 4MABA 2HRNA 3WYWA 1ABAA 4KE3A 4MP4A 1RW1A 4FQUA 3N9JA 4NHWA 1XWGA 3R2QA 3PPUA 2F8FA 3L9UA 4IBPA 2X8HA 2WGRA 1OAZA 4KAEA 2VCXA 2O8VB 2IJYA 4TVEA 1GP1A 1SK2A 1X9WB 2WFCA 5IOXA 5COHA 3WGXA 4V2LA 1O8XA 1USBA 2J23A 3QAWA 3QFBC 4X1UA 4O5RA 1SENA 3BJ5A 3GYKA 17GSA 1AQXA 1U88A 4IVFA 3UVTA 5KN3A 2EIQA 5F8BA 1GLQA 5IQYA 1PGTA 3GX8A 3Q74A 2N5FA 3IK7A 2JSYA 1GUHA 5EPFA 2E2GA 1SJZA 4TR1B 2QGVA 2AHEA 3EINA 5HFKA 1H4OA 3H4KA 3CSJA 2YN1A 1TKDB 3GKKA 3N5OA 2BMXA 3I43A 4MZBA 4KA0A 5A4WA 1EGOA 2Z9SA 5JCGA 1JZOA 4AJ8A 2FGXA 3UOMA 3TKSC 2H0GA 2H19A 4OD7A 4XS4A 1EWXA 5CRWA 2OACA 2HSHA 1E2YA 2VD1A 2VL2C 2V2GA 4MDCA 1WWJA 2FCHA 2M80A 5LNKe 1A0FA 1B9YC 1WRYA 1FG4A 1A8LA 3IBHA 4I2UA 4GXZA 3FR6A 2K8VA 4MLYA 3IE3A 2GT5A 5IMZA 3A2WA 4YAVA 4KSOA 1G7EA 2L4QA 3FZ5A 3Q6OA 4K7OA 4PGTA 1SJIA 1ZZYA 1F37A 5IPGA 1A8YA 1GSUA 1O81A 5F0GA 4MMMA 2WZ9A 3HVVA 1GSYA 2J9HA 1GH2A 5A5KA 1A24A 1TRVA 4EE0A 2RM6A 2H1BA 1N8JA 1OC3A 3ERFA 3F9UA 3EURA 4KH7A 2NTOA 2PVQA 1O7UA 3QCPA 1HNBA 6GSTA 2IMFA 1E6BA 3VWUA 4TR1A 1KEBA 2GS3A 5HR1A 4GLTA 5IOWA 1GTUA 4CW9A 4PQHA 1IYHA 5F07A 4OO4A 1THXA 1TRUA 1T00A 1ACVA 2L57A 2O87A 3HKRA 4ZB8A 2XPDA 1SYXA 4WR5A 3UL3A 1Z3EA 1PN9A 3DYRA 5IIZA 5IMAA 2OE3A 4ZL9A 1FO5A 1K0BA 1DUGA 4Q5NA 1WIKA 1WMJA 4HU9A 3KP8A 1YQ1A 1XWBA 2GZPA 4GQFA 1Y6EA 1DSBA 4LL1B 1ZYQB 5AIVA 2RUFA 4IS0A 2MMZA 3LORA 3ZIVA 2PERA 1OC9B 3ZLPA 4O92A 1CQHA 1FVKA 2I3YA 4D73B 2LQOA 2IMDA 2FWGA 2H73A 3TDGA 2EIRA 3QOUA 1KTEA 5ECMB 3CTGA 4BWSA 1QQ2A 3DVWA 1TRSA 2L6DA 1QK8A 2GDRA 2FNOA 3G9BA 4TXOB 5DBQA 3TB2A 2B1LA 3TOTA 2YWIA 4PNFA 3BD2A 3HJOA 1FOVA 4OFTA 1F9MA 5J41A 3QD9A 4K0GA 3VK9A 4BA7A 2HSMB 3IC4A 1OVNA 2B5XA 3IHQA 4YQMA 3VFIA 5HQPA 2V6KA 1VRSD 2B6MA 2MBTA 1JLWA 3PR8A 5A4UA 4HUAA 4N10A 4EDYA 2HZFA 4RUVA 4KCAA 2YOIA 4MH2A 1QUWA 1G7OA 1T3BA 5IM9A 2C3QA 1GNWA 1BEDA 2N5AA 3W8JA 4TR4A 3KH9A 2H76A 5ID2B 2IMEA 1SD9A 2GZYA 4OFNA 2C4JA 2ALBA 1GTBA 2H6ZA 13GSA 3GSSA 2N5BA 3GIXA 2HXKA 2VAFA 4GF0A 1OC9A 3E9JB 2H6XA 3LYPA 1XXUA 4BL7B 3ZITA 3LG6A 5JWOB 5DQYA 4KB3A 1R5PA 3HJMA 2IN3A 3CYNA 4WXTA 5HR2A 3P2AA 4ACSA 3C8EA 5AIXA 2HLSA 4TXOA 3HHVA 4HJMA 4V2MA 5ECRB 3LGCA 4Q5RA 2IIYA 4J57E 1BX9A 2OKAA 2LSTA 4K0NA 4TR0A 1NSWA 5G5EA 2CVKA 3GURA 1ERWA 1T4ZA 3L4NA 3VURA 2DJ0A 3KZQA 4TW5A 3UMAA 3NOFA 2HSMA 2H0HA 6GSUA 1EOGA 5IMDA 2REMA 3GTUA 2XHFA 4N11A 3CMIA 2G0FA 1XVWA 3HA9A 3RPPA 2IL3A 2DSAA 5ENUA 1QXHA 4FYCA 4K8MA 1URMA 4L5LA 2LTKA 3UIWA 3A5WA 2R3XA 4KX4A 2E2MA 4HU7A 2MZCA 3CSIA 3VPTA 1W89A 1MDJA 1GSDA 4XTSA 3WT1A 3W8SA 14GSA 4OWYA 1GRXA 1ERVA 3UBKA 4ISDA 4TN8A 3HVSA 2TIRA 3ZYWA 2LKUA 5DDLA 3ZFBA 4BL7A 2A4VA 1JZRA 2E7PA 5ECOB 3LEFA 4CDOA 5ABRA 4F0CA 4MJEA 5D9WA 3KMNA 3Q18A 2I9HA 1EOHA 3ME7A 5H5RA 2F51A 4ZL8A 1TU7A 2VCVA 2VCWA 1XW9A 4NXIA 4GSTA 2LNSA 1XBSA 3ME8A 2VM1A 2YZHA 5AN1A 1RQMA 1TXXA 1ZOFA 2H6YA 1V58A 4I97A 4F82A 3QAVA 1EEJA 3DIEA 4NMUA 3HZ4A 3EMXA 2P5QA 5G1KA 3IPZA 4DSRA 2M72A 4MJBA 1J9BA 3M1GA 5GSSA 1PSQA 4FYBA 2B5YA 2C0GA 3TKQA 4L5OA 3DEXA 2LUSA 1AC1A 5JCUA 3TKSE 3L9VA 2G2QA 2ON5A 4AJ6A 1I5GA 5LCZA 2LJRA 5E59A 4KDXA 6GSWA 1QMVA 5ECNB 3CRUA 3LFLA 2QSIA 5J5NA 1YDKA 1PX7A 4ZB9A 3DD3A 4LLRA 4TKYA 1KBNA 4NV5A 5CYYA 3D4MA 1OC8A 5ECIB 5A4VA 2WCIA 2HSNB 3HYPA 4IN0A 4JZQA 3EYTA 1VGLA 4KNDA 1H75A 2D2ZA 5AGYA 3HZ8A 4G0IA 5GAPD 5GSTA 3E3EA 1HQOA 1WOUA 3I69A 2EC4A 1UC7A 3TJKA 3EWLA 2DJJA 2C0DA 1YKCA 3A3TA 4ZXGA 1WPIA 1ILOA 5B8AA 6GSVA 2P5RA 3TRQA 3GRXA 3RHBA 1TDIA 4GRFA 1SKSB 4MPGA 1XOBA 1MD4A 2LS5A 1YEPA 5IO2A 3A2VA 16GSA 1GLPA 1K0OA 4PQIA 1ZGNA 2NVLA 2HYXA 5ECPB 1SYRA 1R26A 2IFQB 1MEKA 1BG5A 3IK9A 5CNWA 1WJKA 4GQCA 2HSYA 2B1KA 3ISOA 2GQLA 1PQNA 2IPAA 3CBUA 1U3AA 1K0AA 6GSXA 2GVPA 3TKPA 2LRNA 2CVBA 1BYEA 1FAAA 2H72A 2LV3A 2YJ7A 4I6XA 5D8IA 4IELA 4MF5A 3KCMA 3QMXA 5G2ZA 1PMTA 1A2MA 1NHYA 2JL4A 1ZMAA 1MTCA 2NPBA 2VUPA 4EO3A 2C80A 4HS1A 4G19A 5GAND 3QAGA 3RAZA 3F4TA 2JZRA 3EU4A 1G6WA 1X0RA 5ECLB 5CRHA 3HCZA 4XIHA 2CX4A 2B7JA 3TOUA 2H71A 5CP1A 4IJIA 5E4WA 3FZ9A 3LJRA 3GKNA 3ZTLA 3IR4A 4LMVA 3TGZA 2CAQA 1FHEA 5HFGA 2LQQA 3LQ7A 5JCWA 3GL3A 4YAPA 2LRTA 2YV7A 1SD8A 1LU4A 5INYA 4IJ3A 2IFQA 3C71A 3ZMLA 4JRRA 2WULA 1MDIA 3M9JA 1M9AA 3KH7A 2YWNA 3SWLA 3GL5A 2IMIA 2K18A 1K3OA 1EV9A 3RHCA 4HI7A 3GUSA 2UZ8A 5EY6A 4XS1A 1SKWB 3GKXA 1F3AA 1GNEA 4HQSA 5LD0A 2PVOC 3PINA 4USSA 1PKZA 3K8NA 3GNJA 2VCZA 2VL3A 18GSA 3QR6A 4TR3A 3H8QA 4G0LA 3S9FA 3WGEA 2DJ2A 1K0MA 5J9CA 4GWRA 4ILFA 3D0ZA 2RM5A 4HDEA 3F3RA 2PWJA 2V1MA 3ZVJA 2IWTA 4EL1A 2CZ3A 2H0IA 1VF1A 1ERTA 3EU3A 4RI7A 2OJLA 2DJ1A 3QDNA 2GSRA 7GSSA 4Z7XA 2R4VA 2H1DA 1R7HA 3FHKA 4J2FA 3BCIA 5ELAA 3APSA 2JZTA 2MMOA 3UBLA 4EKZA 3VWXA 2FA4A 3IAS2 3KGKA 1X5CA 1OE7A 2CZ2A 4YQUA 4ZBDA 4ML6A 4ZL7A 2VCQA 4OCFA 4LA1A 1VF4A 1V98A 2C3TA 3UEMA 1FW1A 3PH9A 3H79A 4KCEA 2RUEA 2C3NA 2XBIA 4PUFC 1TU8A 3F3QA 4AF2A 5G31A 4WF5A 4ECCA 1B48A 1GSSA 1YEXA 4ECIA 1AUCA 3L78A 2H70A 2VM2A 5D9TA 4O32A 4OFMA 2VCTA 3IRAA 4G0KA 3P7XA 2GQKA 2R2JA 1ML6A 3ERWA 3MDKA 2RIIA 3GH9A 3M8NA 1EZKA 4TXVA 4POBA 2VL9A 1RK4A 2IMKA 4D73A 2M46A 1AXDA 19GSA 3P8WA 1M9BA 1JZDA 5J4UA 2PU9C 2CQ9A 22GSA 4KF9A 2XBQA 4V2NA 2HZEB 1FB6A 2DC5A 4I2TA 2YWMA 5B6MA 4NHZA 4IHUA 1XOAA 5CO3A 4LMWA 1M7TA 2PBJA 1T8EB 1QGVA 1F6MC 1MDKA 1FVJA 1YF1A 4DSSB 1UN2A 3DMLA 3DWVA 1TRWA 4EF0A 1J0FA 1HD2A 4WEYA 5DAKB 2A2RA 2R37A 3J7Yk 5EL8A 3APQA 1A2JA 2VD0A 3F63A 1ON4A 4X43A 1PA3A 1Z5YE 3ERGA 3VI5A 1BQ7A 4EUYA 4X0XA 4HEA2 3GH6A 2H30A 5ID2A 1TJDA 1B4PA 1SU9A 3FW2A 1PL2A 5H5QA 2VLTA 2H8LA 4HZ2A 4IGJA 4PX1A 2HT9A 1SJ6A 2LJAA 2CT6A 3WT2A 1Z6NA 1TOFA 4XS6A 1GL8A 2YP6A 4G9HA 3CTFA 3MSZA 2KP2A 5G1LA 5F05A 3VPQA 4TOPA 4Q5QA 5D9XA 3KEBA 2MMNA 3FZAA 2DMLA 4KSMA 1A23A 5HR0A 2JSZA 2C0EA 2HZEA 2P31A 2KP1A 2CV4A 3GMFA 4IQ1A 3C73A 4IP6A 3D21A 4PXOA 4P3YB 1O6JA 4RQRA 4BVXB 1BAYA 1PD21 2JZSA 1XW5A 1O8WA 2I4AA 1B9XC 4DSSA 2GLRA 1VF2A 3IC8A 1JHBA 4AGSA 5KN2A 4ZILA 3LXZA 2YJHA 3ZZXA 2VO4A 2V41A 1M2AA 4MJAA 4GSNA 2X99A 2V32A 3IXRA 4WR4A 4NAXA 5DVBA 2FHEA 1TP9A 5CREA 6GSYA 3APOA 3NIVA 1UVZA 10GSA 3BCKA 1EP7A 4E8EA 1EEMA 1KNGA 5JWQB 3G7JA 2WRTA 2AB6A 1GUKA 1Q4JA 1V2AA 1X5DA 1SL0B 2C1YA 3OR5A 1GTAA 1LBKA 2PMTA 4K9ZA 4QQ7A 1NM3A 3F4RA 3ZFLA 9GSSA 1V9WA 2MYGA 4AJ7A 1AIUA 1SK0A 3UVHA 2K8SA 3DRNA 2FD3A 3UARA 3M9KA 2CX3A 4LL4B 2A2SA 3TKSA 4BVXA 4I8BA 3FRCA 4Q5FA 3O76A 2HRKB 2PPTA 1EP8A 2I1UA 4OO5A 2OE1A 1EV4A 2WB9A 4JU5A 2VL2A 3G7IA
chains in the Genus database with same CATH superfamily
2B7KA 3KP9A 2DBCA 2GSSA 4XRAA 5BMUB 5J9BA 1HYUA 3A2XA 3CXGA 2FWFA 5AISA 2V6OA 2GQMA 4FH8A 2MBSA 4G10A 5DJLA 4L8EA 3DXBA 4HOJA 3BBYA 1XWCA 1JLVA 1EGRA 2JADA 5D73A 4POKA 4RQXA 2AJQB 3RDWA 2AUVA 2PGTA 2O85A 3ZMKA 4YQVA 5CAXA 2C0FA 1S3DA 4ECJA 4OMVA 3TJFA 1GULA 2HE3A 1TK5B 2L5LA 4PQ1A 2YPMA 4PTSA 3L9SA 3M0FA 4JR4A 1M0UA 3IAM2 2HQTA 1HNCA 1M99A 1K0CA 4PURA 3A5IA 5CRDA 2WVXB 1M2DA 1A2LA 1C72A 5A1NA 3JCML 2YNXA 1K0NA 4F03A 4GSSA 5D96A 2KHPA 1UA5A 4FYUA 4ZBAA 2TRXA 4HJ2A 1LJRA 3GSTA 2AV4A 3FZ4A 3IV4A 4JEDA 3VI7A 3GX0A 3TJGA 2AAWA 2X64A 3FYGA 4L0UA 1XWKA 5DALB 2FUG2 2VKZG 2HRKA 1B4QA 4K7NA 3CRTA 3D5JA 1TK8B 8GSSA 2BJXA 2L5OA 3TRXA 1DE2A 5BMUA 11GSA 3HDCA 4GTUA 3UAPA 3MIXA 5HFIA 4POMA 3GFKA 2VLVA 1GSQA 4K6XA 3HJPA 4WBRD 3GHAA 2TRCP 4HQZA 2XC2A 2ES7A 1XWAA 4TRXA 2FWHA 1NW2A 2LNTA 4V1Ag 1JFUA 1M2BA 2PN8A 3AY8A 1OE8A 4WKWA 5B6NA 4EVMA 5DJMA 2HRAA 3LSZA 2LEGA 2E0QA 20GSA 2FY6A 4K1FA 1SL1B 2WVXA 5L71A 3LXTA 2LRCA 2YZUA 2GT6A 5KOXA 2JU5A 3FY7A 4GCIA 5C00A 5B7CA 1ZYEA 5J3RA 5IO0A 5FT3A 3HVNA 2DJ3A 1YKAA 4XCSA 1HNAA 1WE0A 3MNGA 3ZL5A 1Q98A 1AAZA 3HD5A 1QFNA 1TI1A 5DALA 2HFDA 3F4SA 2GGTA 2FWEA 4XHMA 1T4YA 1OYJA 4I5QA 3IOSA 1ZL9A 3D22A 1GUMA 5JWRB 4G2EA 1SK1A 3I9V2 3ZRDA 4QL7A 4MH3A 1OKTA 1Z6MA 2YCDA 2H1GA 1X9MB 2H74A 3P90A 4ECBA 2AYTA 5D93A 1SL2B 4N30A 4WBJA 4MF6A 3C7MA 3ZIJA 4N0ZA 4POLA 1K0DA 3KJYA 3V1WA 4ZBBA 1X9SB 2QC7A 1VF3A 3RBTA 4MZCA 2B3SA 1R4WA 1K3LA 3FK8A 2YANA 1XZOA 1V40A 5G5FA 1S3CA 3KD0A 1TXUA 3E0UA 4KDUA 1F3BA 2K6VA 3C1RA 1W4VA 4F0BA 2XPEA 2H66A 4V1Ap 1CQGA 3TUEA 2OT3A 3EE2A 5KOWA 4BVYB 1U87A 3FR3A 4IKHA 1XFLA 5B8BA 2H01A 2NBSA 3FR9A 3MWHA 1GTIA 3DVXA 2R6KA 2WJUA 1YJ6A 1J08A 1N2AA 3TKRA 4PNGA 3FKFA 3GTUB 4EC0A 2FA8A 2KUCA 3EC3A 1SKRB 1THOA 4MPFA 3KM6A 5FWGA 2ZUPA 1I9DA 1XVQA 1K3YA 2GTUA 4IP1A 1N25A 1TK0B 3TRPA 3Q19A 1R5AA 4DEJA 3FEUA 2H75A 5D9VA 1DE1A 3UJ1A 4BWQA 3NZNA 4MCUA 4ML1A 2ZNMA 5DCHA 5ECHB 1TI3A 2F8AA 1ERUA 2YV9A 3O6TA 1AQVA 4IQAA 1AW9A 1WP0A 3GKMA 4PI0C 5J4YA 4NV2A 3HXSA 4ZB6A 4E8HA 4XRDA 2O7KA 1O73A 3TJJA 4RI6A 5ELGA 4NPBA 2GZZA 4KGIA 3ZVJD 3CSHA 4EXJA 3EPTA 2F3MA 3QPMA 5H5SA 5F06A 3IA1A 2WDUA 1ZCPA 3ED3A 1X5EA 3BOAA 2YWOA 3VLNA 2L6CA 2ZCTA 3D6IA 4JE1A 5FHIA 4HZ4A 1YY7A 1PKWA 2CAIA 3GN3A 3M3MA 1YEWC 5ECKB 1MD3A 2K9FA 4KUNA 5C04A 4DVCA 4BVYA 5GZZB 1GWCA 12GSA 1B8XA 4ULXA 3D4TA 2JACA 3KXOA 4J56E 4YH2A 1GSFA 2CA8A 1FB0A 2HNLA 1YF0A 3TCOA 4OCEA 5HR3A 2O89A 4O7HA 3MAKA 2GSQA 3SBCA 1NHOA 3VWWA 6GSSA 1S3AA 1A0RP 3QFAC 2OBKA 1JZWA 4CHSA 4FIWA 2B5EA 2HI7A 2WS2A 2BTOT 5KN0A 2KOKA 4EDZA 2LJKA 2NDOA 2VIMA 4L0WA 3KMOA 2PUKC 1O85A 4N0VA 1ST9A 1S4BP 2GSTA 5DCGA 1BJXA 3R3EA 2C8UA 3PGTA 4ZIJA 3EVIA 4K7IA 4WF4A 3L0HA 2VOCA 1Z7RA 1Z9HA 3G7YA 4MJCA 4NWYA 2OADA 1U3IA 4KDYA 1Z7PA 2X4AA 4IW9A 3TJBA 1XPVA 2DMMA 1F2EA 1TTZA 4FO5A 3F6FA 1U6TA 2EIOA 2VLUA 1V57A 4QMKA 2F9SA 4H86A 1TW9A 2OE0A 2R5GA 2OA7A 2H1AA 4F9ZA 4JBBA 3F6DA 4QL9A 2I81A 2WW0A 1IYIA 5IPHA 3WD6A 2A2PA 4MNNA 3HY2A 5DAKA 5ECSA 3IDVA 1SVOA 2QKEA 1DBYA 2DLXA 4MK3A 4KW6A 3I6AA 3F0IA 2EFHA 1OKDA 4WETA 3KIJA 5G30A 3WGDA 3H1NA 2HRFA 4ID0A 2RLIA 3ZREA 2DJKA 3LYKA 4MZWA 1T1VA 2DIYA 3VWVA 2OBIA 3RPNA 4JR6A 3U6VA 4ZB7A 4K5SA 5DQSA 5CRGA 3J7Yb 3O3TA 3GA4A 3F8UA 3GV1A 1PX6A 5IMCA 2CVDA 3KTLA 2L59A 2X8GA 4F2IA 2ON7A 2P0GA 4MF7A 3EMPA 2WVYA 5KEJA 1Y25A 3KTBA 1G6YA 4AKHA 1AQWA 2L4CA 2DIZA 4K2DA 1PN0A 3DKSA 4PUAA 2KLXA 1G0TA 4BPYA 4MA9A 5KN1A 1PRXA 1GSEA 3US3A 1PL1A 1XCCA 2FLSA 3LWAA 3FMWA 1YZXA 4DSQA 5IMFA 2MMAA 3HVXA 3H93A 3W6GA 3C1SA 3DGQA 1XW6A 1XIYA 5ECQB 5IMVA 5EVOA 2X8CA 3U5RE 4XS4B 1T7PB 4MABA 2HRNA 3WYWA 1ABAA 1BG1A 4YKFA 4KE3A 4MP4A 1RW1A 4FQUA 3N9JA 4NHWA 1XWGA 3R2QA 3PPUA 2F8FA 3L9UA 4IBPA 4EIPA 2X8HA 2WGRA 1OAZA 4KAEA 2VCXA 2O8VB 2WVZA 2IJYA 1S3RA 4TVEA 1GP1A 1SK2A 1X9WB 2WFCA 5IOXA 5COHA 3WGXA 4V2LA 1O8XA 1USBA 2J23A 3QAWA 3QFBC 2O5VA 4X1UA 4O5RA 1SENA 3BJ5A 3GYKA 17GSA 1AQXA 1U88A 1SVMA 4IVFA 3UVTA 5KN3A 4K2XA 2EIQA 5F8BA 1GLQA 5IQYA 5J47A 1PGTA 3GX8A 3Q74A 2N5FA 3IK7A 2JSYA 1GUHA 5EPFA 2E2GA 1SJZA 4E68A 4TR1B 2QGVA 2AHEA 3EINA 5HFKA 1H4OA 3H4KA 3CSJA 2YN1A 1TKDB 3GKKA 3N5OA 2BMXA 3I43A 4MZBA 4KA0A 5A4WA 1EGOA 2Z9SA 5JCGA 1JZOA 4AJ8A 2FGXA 3UOMA 3TKSC 2H0GA 2H19A 4OD7A 4XS4A 1EWXA 5CRWA 2OACA 2HSHA 1E2YA 2VD1A 2VL2C 2V2GA 4MDCA 1WWJA 2FCHA 2M80A 5LNKe 1A0FA 1B9YC 1WRYA 1FG4A 1A8LA 3IBHA 4I2UA 4GXZA 3FR6A 2K8VA 4MLYA 3IE3A 2GT5A 5IMZA 3A2WA 4YAVA 4KSOA 1G7EA 2L4QA 3FZ5A 3Q6OA 4K7OA 4PGTA 1SJIA 1M3IA 1ZZYA 1F37A 5IPGA 1A8YA 1GSUA 1O81A 5F0GA 4MMMA 2WZ9A 3HVVA 1GSYA 2J9HA 1GH2A 5A5KA 5A5HB 1A24A 1TRVA 4EE0A 2RM6A 5J40A 2H1BA 1N8JA 1OC3A 3ERFA 3F9UA 3EURA 4KH7A 2NTOA 2PVQA 1O7UA 3QCPA 1HNBA 6GSTA 2IMFA 1E6BA 3VWUA 4TR1A 1KEBA 2GS3A 5HR1A 4GLTA 5IOWA 1GTUA 4CW9A 4PQHA 1IYHA 5F07A 4OO4A 1THXA 1TRUA 1T00A 1XG8A 1ACVA 2L57A 2O87A 2EFDA 3HKRA 4ZB8A 2XPDA 1SYXA 4WR5A 3UL3A 1Z3EA 1PN9A 3DYRA 5IIZA 5IMAA 2OE3A 4ZL9A 1PFOA 1FO5A 1K0BA 1DUGA 4Q5NA 1WIKA 1WMJA 4HU9A 3KP8A 1YQ1A 4AI6A 1XWBA 2GZPA 4GQFA 1Y6EA 1DSBA 4LL1B 1ZYQB 5AIVA 2RUFA 4IS0A 2MMZA 4EIQA 3LORA 3ZIVA 2PERA 1OC9B 3ZLPA 4O92A 1CQHA 1FVKA 2DKIA 2I3YA 4D73B 2LQOA 2IMDA 2FWGA 2H73A 3TDGA 2EIRA 3QOUA 1KTEA 5ECMB 3CTGA 4BWSA 1QQ2A 3DVWA 1TRSA 2L6DA 1QK8A 1I1IP 2GDRA 2FNOA 2WW1A 5A5HA 3G9BA 4TXOB 5DBQA 3TB2A 2B1LA 3TOTA 2YWIA 4PNFA 3BD2A 3HJOA 1FOVA 4OFTA 1F9MA 5J41A 3QD9A 4K0GA 3VK9A 4BA7A 2HSMB 3IC4A 1OVNA 2B5XA 3IHQA 4YQMA 3VFIA 5HQPA 2V6KA 1VRSD 2B6MA 2MBTA 1JLWA 3PR8A 5A4UA 4HUAA 4N10A 4EDYA 2HZFA 4RUVA 4KCAA 2YOIA 4MH2A 1QUWA 1G7OA 1T3BA 4AKGA 5IM9A 2C3QA 1GNWA 1BEDA 3TU3B 2N5AA 3W8JA 4TR4A 3KH9A 2H76A 5ID2B 2IMEA 1SD9A 2GZYA 4OFNA 2C4JA 2ALBA 1GTBA 2H6ZA 13GSA 3GSSA 2N5BA 3GIXA 2HXKA 4Z2UA 2VAFA 4GF0A 1OC9A 3E9JB 2H6XA 3LYPA 1XXUA 4BL7B 3ZITA 3LG6A 5JWOB 5DQYA 4KB3A 1R5PA 3HJMA 2IN3A 3CYNA 4WXTA 5HR2A 3P2AA 4ACSA 3C8EA 5AIXA 2HLSA 4YKGA 4TXOA 3HHVA 4HJMA 4V2MA 5ECRB 3LGCA 4Q5RA 4PHZC 3RGBC 2IIYA 4J57E 1BX9A 2OKAA 2LSTA 4K0NA 4O5QA 4TR0A 1NSWA 5G5EA 2CVKA 3GURA 1ERWA 1T4ZA 3L4NA 3VURA 2DJ0A 3KZQA 4TW5A 3UMAA 3NOFA 2HSMA 2H1LA 2H0HA 6GSUA 1EOGA 5IMDA 2REMA 3GTUA 2XHFA 4N11A 4AKIA 3CMIA 2O36A 2G0FA 1XVWA 3HA9A 3RPPA 2IL3A 2DSAA 5ENUA 1QXHA 4FYCA 4K8MA 2QA2A 1URMA 3CHXC 4L5LA 2LTKA 3UIWA 3A5WA 2R3XA 4KX4A 2E2MA 4HU7A 2MZCA 3CSIA 3VPTA 1W89A 1MDJA 1GSDA 4XTSA 3WT1A 3W8SA 14GSA 4OWYA 1GRXA 1ERVA 3UBKA 4ISDA 4TN8A 3HVSA 2TIRA 3ZYWA 2LKUA 5DDLA 3ZFBA 4BL7A 2A4VA 1JZRA 2E7PA 4AKXB 2QA1A 5ECOB 3LEFA 4O5UA 4CDOA 5ABRA 4F0CA 2WZSA 4MJEA 5D9WA 3KMNA 3Q18A 2I9HA 1EOHA 3ME7A 5H5RA 2O3EA 1SVLA 2F51A 4ZL8A 1TU7A 2VCVA 2VCWA 1XW9A 4NXIA 4GSTA 2LNSA 1XBSA 3ME8A 2VM1A 2YZHA 5AN1A 1YVLA 1RQMA 1TXXA 1ZOFA 2H6YA 1V58A 4I97A 4F82A 3QAVA 1EEJA 3DIEA 4NMUA 3HZ4A 3EMXA 2P5QA 5G1KA 3IPZA 4DSRA 2M72A 4MJBA 1J9BA 3M1GA 5GSSA 1PSQA 4FYBA 2B5YA 2C0GA 3TKQA 1Y1UA 4L5OA 3DEXA 2LUSA 1AC1A 4W66A 5JCUA 3MYDA 3TKSE 3L9VA 4K5RA 2G2QA 2ON5A 4AJ6A 1I5GA 5LCZA 2LJRA 3CQFA 5E59A 4KDXA 6GSWA 1QMVA 5ECNB 3CRUA 3LFLA 2QSIA 5J5NA 1YDKA 1PX7A 4ZB9A 3DD3A 4LLRA 4TKYA 1KBNA 4NV5A 5CYYA 3D4MA 1OC8A 5ECIB 5A4VA 2WCIA 2HSNB 3HYPA 4IN0A 4JZQA 3EYTA 1VGLA 4KNDA 1H75A 2D2ZA 5AGYA 3HZ8A 4G0IA 5GAPD 5GSTA 3E3EA 1HQOA 1WOUA 3I69A 2EC4A 1UC7A 5BRTA 3TJKA 3EWLA 2DJJA 2C0DA 1YKCA 3A3TA 4ZXGA 1WPIA 1ILOA 5B8AA 6GSVA 2P5RA 3TRQA 3GRXA 3RHBA 4CY6A 1TDIA 4GRFA 1SKSB 4MPGA 1XOBA 1MD4A 2LS5A 1YEPA 5IO2A 4GDFA 3A2VA 4BIKA 16GSA 1M3JA 2WW3A 1GLPA 1K0OA 4PQIA 1ZGNA 2NVLA 2HYXA 5ECPB 1SYRA 1R26A 2IFQB 1MEKA 1BG5A 2R0PA 3IK9A 5CNWA 1WJKA 4GQCA 2HSYA 2B1KA 3ISOA 2GQLA 1PQNA 2IPAA 3CBUA 1U3AA 3HMJG 1K0AA 6GSXA 2GVPA 3TKPA 2LRNA 2CVBA 1BYEA 1FAAA 2H72A 2LV3A 2YJ7A 4I6XA 5D8IA 4IELA 4MF5A 3KCMA 3QMXA 5G2ZA 2HSNA 1PMTA 1A2MA 1NHYA 2JL4A 1ZMAA 1MTCA 2NPBA 2VUPA 4EO3A 3LW9A 1BF5A 2C80A 4HS1A 5A34B 4G19A 2DKHA 5GAND 3QAGA 3RAZA 3F4TA 2JZRA 2EFCA 3EU4A 1G6WA 1X0RA 5ECLB 5CRHA 3HCZA 4FXYP 4XIHA 2CX4A 2B7JA 3TOUA 2H71A 5CP1A 4IJIA 5E4WA 3FZ9A 3LJRA 3GKNA 2EFEA 3ZTLA 3IR4A 4LMVA 3TGZA 2CAQA 1FHEA 4CY8A 5HFGA 2LQQA 3LQ7A 5JCWA 3GL3A 4YAPA 2LRTA 2YV7A 1SD8A 1LU4A 5INYA 4IJ3A 2IFQA 3C71A 3ZMLA 4JRRA 2WULA 1MDIA 3M9JA 1M9AA 3KH7A 2YWNA 3SWLA 3GL5A 2IMIA 2K18A 1K3OA 1EV9A 3RHCA 4HI7A 3GUSA 2UZ8A 5EY6A 4XS1A 1SKWB 3GKXA 1F3AA 1GNEA 4HQSA 5LD0A 2PVOC 3PINA 4X4JA 4USSA 1PKZA 3K8NA 3GNJA 2VCZA 2VL3A 18GSA 3QR6A 4TR3A 3H8QA 3RFRC 4G0LA 3S9FA 3WGEA 2DJ2A 1K0MA 5J9CA 4GWRA 4ILFA 5A34A 3D0ZA 2RM5A 4HDEA 3F3RA 2PWJA 2V1MA 3ZVJA 2IWTA 4EL1A 2CZ3A 2H0IA 1VF1A 1ERTA 3EU3A 4RI7A 2OJLA 2DJ1A 3QDNA 2GSRA 7GSSA 4Z7XA 2R4VA 2H1DA 1R7HA 3FHKA 4J2FA 3BCIA 5ELAA 4HSCX 3APSA 2JZTA 2MMOA 3UBLA 4EKZA 3VWXA 2FA4A 3IAS2 3KGKA 1X5CA 1OE7A 2CZ2A 4YQUA 2A4HA 4ZBDA 4ML6A 4ZL7A 2VCQA 4OCFA 4LA1A 1VF4A 1V98A 2C3TA 3UEMA 1FW1A 2R0GA 3PH9A 3H79A 4KCEA 2RUEA 2C3NA 4ICYA 2XBIA 4PUFC 1TU8A 3F3QA 4AF2A 5G31A 4WF5A 4ECCA 1B48A 1GSSA 1YEXA 4ECIA 1AUCA 1ZYNA 3L78A 2H70A 1ZYPA 2VM2A 5D9TA 3CWGA 4O32A 4OFMA 2VCTA 3IRAA 4G0KA 3P7XA 2GQKA 2R2JA 1ML6A 3ERWA 3MDKA 2RIIA 3GH9A 3M8NA 1EZKA 4TXVA 4POBA 2VL9A 1RK4A 2IMKA 4D73A 2M46A 1AXDA 19GSA 3P8WA 1M9BA 1JZDA 5J4UA 2PU9C 2WW2A 2CQ9A 22GSA 4KF9A 2XBQA 4V2NA 2HZEB 1FB6A 2DC5A 4Z2RA 4I2TA 2YWMA 5B6MA 4NHZA 3IHGA 4IHUA 1XOAA 5CO3A 4LMWA 1M7TA 2PBJA 1T8EB 1QGVA 1F6MC 1MDKA 1FVJA 1YF1A 4DSSB 1UN2A 3DMLA 3DWVA 1TRWA 4EF0A 1J0FA 1HD2A 4WEYA 5DAKB 2A2RA 1FOHA 2R37A 3J7Yk 5EL8A 3APQA 1A2JA 2VD0A 3F63A 1ON4A 4X43A 1PA3A 1Z5YE 3ERGA 3VI5A 1BQ7A 4EUYA 4X0XA 4HEA2 3GH6A 2H30A 4N3ZA 5ID2A 1TJDA 1B4PA 2X49A 1SU9A 4A5PA 3FW2A 1PL2A 5H5QA 5J4VA 2VLTA 4PI2C 2H8LA 4HZ2A 4IGJA 4PX1A 2HT9A 1SJ6A 2LJAA 2CT6A 3WT2A 1Z6NA 1TOFA 4XS6A 1GL8A 2YP6A 4G9HA 3CTFA 3MSZA 2KP2A 5G1LA 5F05A 3VPQA 4TOPA 4Q5QA 5D9XA 3KEBA 2MMNA 3FZAA 2DMLA 4KSMA 1A23A 5HR0A 2JSZA 2C0EA 2HZEA 2P31A 2KP1A 2CV4A 3GMFA 4IQ1A 3C73A 2R0CA 4IP6A 3D21A 4PXOA 4P3YB 1O6JA 4RQRA 4BVXB 1BAYA 1PD21 2JZSA 1XW5A 1O8WA 2I4AA 1B9XC 4DSSA 2GLRA 1VF2A 3IC8A 1JHBA 4AGSA 5KN2A 4ZILA 2YJHA 3LXZA 3ZZXA 2VO4A 2V41A 1M2AA 4MJAA 4GSNA 2X99A 2V32A 3IXRA 4WR4A 4NAXA 5DVBA 2FHEA 1TP9A 5CREA 2UV8G 6GSYA 3APOA 3NIVA 4Z2TA 1UVZA 10GSA 3BCKA 1EP7A 4E8EA 1EEMA 1KNGA 5JWQB 3G7JA 2WRTA 2AB6A 1GUKA 1Q4JA 1V2AA 1X5DA 1SL0B 2C1YA 3OR5A 1GTAA 1LBKA 5A1NB 2PMTA 4K9ZA 4QQ7A 1NM3A 3F4RA 3ZFLA 9GSSA 1V9WA 2MYGA 4AJ7A 1AIUA 1SK0A 3UVHA 2K8SA 3DRNA 2FD3A 3UARA 3M9KA 4G01A 2CX3A 4LL4B 2A2SA 3TKSA 4BVXA 4I8BA 3FRCA 4Q5FA 3O76A 2HRKB 2PPTA 1EP8A 2I1UA 4OO5A 2OE1A 1EV4A 2WB9A 4JU5A 2VL2A 3G7IA
chains in the Genus database with same CATH topology
2B7KA 3KP9A 2DBCA 2GSSA 4XRAA 5BMUB 5J9BA 1HYUA 3A2XA 3CXGA 2FWFA 5AISA 2V6OA 2GQMA 4FH8A 2MBSA 4G10A 5DJLA 4L8EA 3DXBA 4HOJA 3BBYA 1XWCA 1JLVA 1EGRA 2JADA 5D73A 4POKA 4RQXA 2AJQB 3RDWA 2AUVA 2PGTA 2O85A 3ZMKA 4YQVA 5CAXA 2C0FA 1S3DA 4ECJA 4OMVA 3TJFA 1GULA 2HE3A 1TK5B 2L5LA 4PQ1A 2YPMA 4PTSA 3L9SA 3M0FA 4JR4A 1M0UA 3IAM2 2HQTA 1HNCA 1M99A 1K0CA 4PURA 3A5IA 5CRDA 1M2DA 1A2LA 1C72A 5A1NA 3JCML 2YNXA 1K0NA 4F03A 4GSSA 5D96A 2KHPA 1UA5A 4FYUA 4ZBAA 2TRXA 4HJ2A 1LJRA 3GSTA 2AV4A 3FZ4A 3IV4A 4JEDA 3VI7A 3GX0A 3TJGA 2AAWA 2X64A 3FYGA 4L0UA 1XWKA 5DALB 2FUG2 2VKZG 2HRKA 1B4QA 4K7NA 3CRTA 3D5JA 1TK8B 8GSSA 2BJXA 2L5OA 3TRXA 1DE2A 5BMUA 11GSA 3HDCA 4GTUA 3UAPA 3MIXA 5HFIA 4POMA 3GFKA 2VLVA 1GSQA 4K6XA 3HJPA 4WBRD 3GHAA 2TRCP 4HQZA 2XC2A 2ES7A 1XWAA 4TRXA 2FWHA 1NW2A 2LNTA 4V1Ag 1JFUA 1M2BA 2PN8A 3AY8A 1OE8A 4WKWA 5B6NA 4EVMA 5DJMA 2HRAA 3LSZA 2LEGA 2E0QA 20GSA 2FY6A 4K1FA 1SL1B 5L71A 3LXTA 2LRCA 2YZUA 2GT6A 5KOXA 2JU5A 3FY7A 4GCIA 5C00A 5B7CA 1ZYEA 5J3RA 5IO0A 5FT3A 2DJ3A 1YKAA 4XCSA 1HNAA 1WE0A 3MNGA 3ZL5A 1Q98A 1AAZA 3HD5A 1QFNA 1TI1A 5DALA 2HFDA 3F4SA 2GGTA 2FWEA 4XHMA 1T4YA 1OYJA 4I5QA 3IOSA 1ZL9A 3D22A 1GUMA 5JWRB 4G2EA 1SK1A 3I9V2 3ZRDA 4QL7A 4MH3A 1OKTA 1Z6MA 2YCDA 2H1GA 1X9MB 2H74A 3P90A 4ECBA 2AYTA 5D93A 1SL2B 4N30A 4WBJA 4MF6A 3C7MA 3ZIJA 4N0ZA 4POLA 1K0DA 3KJYA 3V1WA 4ZBBA 1X9SB 2QC7A 1VF3A 3RBTA 4MZCA 2B3SA 1R4WA 1K3LA 3FK8A 2YANA 1XZOA 1V40A 5G5FA 1S3CA 3KD0A 1TXUA 3E0UA 4KDUA 1F3BA 2K6VA 3C1RA 1W4VA 4F0BA 2XPEA 2H66A 4V1Ap 1CQGA 3TUEA 2OT3A 3EE2A 5KOWA 4BVYB 1U87A 3FR3A 4IKHA 1XFLA 5B8BA 2H01A 2NBSA 3FR9A 3MWHA 1GTIA 3DVXA 2R6KA 2WJUA 1YJ6A 1J08A 1N2AA 3TKRA 4PNGA 3FKFA 3GTUB 4EC0A 2FA8A 2KUCA 3EC3A 1SKRB 1THOA 4MPFA 3KM6A 5FWGA 2ZUPA 1I9DA 1XVQA 1K3YA 2GTUA 4IP1A 1N25A 1TK0B 3TRPA 3Q19A 1R5AA 4DEJA 3FEUA 2H75A 5D9VA 1DE1A 3UJ1A 4BWQA 3NZNA 4MCUA 4ML1A 2ZNMA 5DCHA 5ECHB 1TI3A 2F8AA 1ERUA 2YV9A 3O6TA 1AQVA 4IQAA 1AW9A 1WP0A 3GKMA 5J4YA 4NV2A 3HXSA 4ZB6A 4E8HA 4XRDA 2O7KA 1O73A 3TJJA 4RI6A 5ELGA 4NPBA 2GZZA 4KGIA 3ZVJD 3CSHA 4EXJA 3EPTA 2F3MA 3QPMA 5H5SA 5F06A 3IA1A 2WDUA 1ZCPA 3ED3A 1X5EA 3BOAA 2YWOA 3VLNA 2L6CA 2ZCTA 3D6IA 4JE1A 5FHIA 4HZ4A 1YY7A 1PKWA 2CAIA 3GN3A 3M3MA 5ECKB 1MD3A 2K9FA 4KUNA 5C04A 4DVCA 4BVYA 5GZZB 1GWCA 12GSA 1B8XA 4ULXA 3D4TA 2JACA 3KXOA 4J56E 4YH2A 1GSFA 2CA8A 1FB0A 2HNLA 1YF0A 3TCOA 4OCEA 5HR3A 2O89A 4O7HA 3MAKA 2GSQA 3SBCA 1NHOA 3VWWA 6GSSA 1S3AA 1A0RP 3QFAC 2OBKA 1JZWA 4CHSA 4FIWA 2B5EA 2HI7A 2WS2A 2BTOT 5KN0A 2KOKA 4EDZA 2LJKA 2NDOA 2VIMA 4L0WA 3KMOA 2PUKC 1O85A 4N0VA 1ST9A 2GSTA 5DCGA 1BJXA 3R3EA 2C8UA 3PGTA 4ZIJA 3EVIA 4K7IA 4WF4A 3L0HA 2VOCA 1Z7RA 1Z9HA 3G7YA 4MJCA 4NWYA 2OADA 1U3IA 4KDYA 1Z7PA 2X4AA 4IW9A 3TJBA 1XPVA 2DMMA 1F2EA 1TTZA 4FO5A 3F6FA 1U6TA 2EIOA 2VLUA 1V57A 4QMKA 2F9SA 4H86A 1TW9A 2OE0A 2R5GA 2OA7A 2H1AA 4F9ZA 4JBBA 3F6DA 4QL9A 2I81A 1IYIA 5IPHA 3WD6A 2A2PA 4MNNA 3HY2A 5DAKA 5ECSA 3IDVA 1SVOA 2QKEA 1DBYA 2DLXA 4MK3A 4KW6A 3I6AA 3F0IA 2EFHA 1OKDA 4WETA 3KIJA 5G30A 3WGDA 3H1NA 2HRFA 4ID0A 2RLIA 3ZREA 2DJKA 3LYKA 4MZWA 1T1VA 2DIYA 3VWVA 2OBIA 3RPNA 4JR6A 3U6VA 4ZB7A 4K5SA 5DQSA 5CRGA 3J7Yb 3O3TA 3GA4A 3F8UA 3GV1A 1PX6A 5IMCA 2CVDA 3KTLA 2L59A 2X8GA 4F2IA 2ON7A 2P0GA 4MF7A 3EMPA 5KEJA 1Y25A 3KTBA 1G6YA 4AKHA 1AQWA 2L4CA 2DIZA 4K2DA 1PN0A 3DKSA 4PUAA 2KLXA 1G0TA 4BPYA 4MA9A 5KN1A 1PRXA 1GSEA 3US3A 1PL1A 1XCCA 2FLSA 3LWAA 3FMWA 1YZXA 4DSQA 5IMFA 2MMAA 3HVXA 3H93A 3W6GA 3C1SA 3DGQA 1XW6A 1XIYA 5ECQB 5IMVA 5EVOA 2X8CA 3U5RE 4XS4B 1T7PB 4MABA 2HRNA 3WYWA 1ABAA 1BG1A 4YKFA 4KE3A 4MP4A 1RW1A 4FQUA 3N9JA 4NHWA 1XWGA 3R2QA 3PPUA 2F8FA 3L9UA 4IBPA 4EIPA 2X8HA 2WGRA 1OAZA 4KAEA 2VCXA 2O8VB 2IJYA 4TVEA 1GP1A 1SK2A 1X9WB 2WFCA 5IOXA 5COHA 3WGXA 4V2LA 1O8XA 1USBA 2J23A 3QAWA 3QFBC 2O5VA 4X1UA 4O5RA 1SENA 3BJ5A 3GYKA 17GSA 1AQXA 1U88A 1SVMA 4IVFA 3UVTA 5KN3A 4K2XA 2EIQA 5F8BA 1GLQA 5IQYA 5J47A 1PGTA 3GX8A 3Q74A 2N5FA 3IK7A 2JSYA 1GUHA 5EPFA 2E2GA 1SJZA 4E68A 4TR1B 2QGVA 2AHEA 3EINA 5HFKA 1H4OA 3H4KA 3CSJA 2YN1A 1TKDB 3GKKA 3N5OA 2BMXA 3I43A 4MZBA 4KA0A 5A4WA 1EGOA 2Z9SA 5JCGA 1JZOA 4AJ8A 2FGXA 3UOMA 3TKSC 2H0GA 2H19A 4OD7A 4XS4A 1EWXA 5CRWA 2OACA 2HSHA 1E2YA 2VD1A 2VL2C 2V2GA 4MDCA 1WWJA 2FCHA 2M80A 5LNKe 1A0FA 1B9YC 1WRYA 1FG4A 1A8LA 3IBHA 4I2UA 4GXZA 3FR6A 2K8VA 4MLYA 3IE3A 2GT5A 5IMZA 3A2WA 4YAVA 4KSOA 1G7EA 2L4QA 3FZ5A 3Q6OA 4K7OA 4PGTA 1SJIA 1ZZYA 1F37A 5IPGA 1A8YA 1GSUA 1O81A 5F0GA 4MMMA 2WZ9A 3HVVA 1GSYA 2J9HA 1GH2A 5A5KA 5A5HB 1A24A 1TRVA 4EE0A 2RM6A 5J40A 2H1BA 1N8JA 1OC3A 3ERFA 3F9UA 3EURA 4KH7A 2NTOA 2PVQA 1O7UA 3QCPA 1HNBA 6GSTA 2IMFA 1E6BA 3VWUA 4TR1A 1KEBA 2GS3A 5HR1A 4GLTA 5IOWA 1GTUA 4CW9A 4PQHA 1IYHA 5F07A 4OO4A 1THXA 1TRUA 1T00A 1ACVA 2L57A 2O87A 2EFDA 3HKRA 4ZB8A 2XPDA 1SYXA 4WR5A 3UL3A 1Z3EA 1PN9A 3DYRA 5IIZA 5IMAA 2OE3A 4ZL9A 1FO5A 1K0BA 1DUGA 4Q5NA 1WIKA 1WMJA 4HU9A 3KP8A 1YQ1A 4AI6A 1XWBA 2GZPA 4GQFA 1Y6EA 1DSBA 4LL1B 1ZYQB 5AIVA 2RUFA 4IS0A 2MMZA 4EIQA 3LORA 3ZIVA 2PERA 1OC9B 3ZLPA 4O92A 1CQHA 1FVKA 2DKIA 2I3YA 4D73B 2LQOA 2IMDA 2FWGA 2H73A 3TDGA 2EIRA 3QOUA 1KTEA 5ECMB 3CTGA 4BWSA 1QQ2A 3DVWA 1TRSA 2L6DA 1QK8A 2GDRA 2FNOA 5A5HA 3G9BA 4TXOB 5DBQA 3TB2A 2B1LA 3TOTA 2YWIA 4PNFA 3BD2A 3HJOA 1FOVA 4OFTA 1F9MA 5J41A 3QD9A 4K0GA 3VK9A 4BA7A 2HSMB 3IC4A 1OVNA 2B5XA 3IHQA 4YQMA 3VFIA 5HQPA 2V6KA 1VRSD 2B6MA 2MBTA 1JLWA 3PR8A 5A4UA 4HUAA 4N10A 4EDYA 2HZFA 4RUVA 4KCAA 2YOIA 4MH2A 1QUWA 1G7OA 1T3BA 4AKGA 5IM9A 2C3QA 1GNWA 1BEDA 3TU3B 2N5AA 3W8JA 4TR4A 3KH9A 2H76A 5ID2B 2IMEA 1SD9A 2GZYA 4OFNA 2C4JA 2ALBA 1GTBA 2H6ZA 13GSA 3GSSA 2N5BA 3GIXA 2HXKA 4Z2UA 2VAFA 4GF0A 1OC9A 3E9JB 2H6XA 3LYPA 1XXUA 4BL7B 3ZITA 3LG6A 5JWOB 5DQYA 4KB3A 1R5PA 3HJMA 2IN3A 3CYNA 4WXTA 5HR2A 3P2AA 4ACSA 3C8EA 5AIXA 2HLSA 4YKGA 4TXOA 3HHVA 4HJMA 4V2MA 5ECRB 3LGCA 4Q5RA 2IIYA 4J57E 1BX9A 2OKAA 2LSTA 4K0NA 4O5QA 4TR0A 1NSWA 5G5EA 2CVKA 3GURA 1ERWA 1T4ZA 3L4NA 3VURA 2DJ0A 3KZQA 4TW5A 3UMAA 3NOFA 2HSMA 2H1LA 2H0HA 6GSUA 1EOGA 5IMDA 2REMA 3GTUA 2XHFA 4N11A 4AKIA 3CMIA 2G0FA 1XVWA 3HA9A 3RPPA 2IL3A 2DSAA 5ENUA 1QXHA 4FYCA 4K8MA 2QA2A 1URMA 4L5LA 2LTKA 3UIWA 3A5WA 2R3XA 4KX4A 2E2MA 4HU7A 2MZCA 3CSIA 3VPTA 1W89A 1MDJA 1GSDA 4XTSA 3WT1A 3W8SA 14GSA 4OWYA 1GRXA 1ERVA 3UBKA 4ISDA 4TN8A 3HVSA 2TIRA 3ZYWA 2LKUA 5DDLA 3ZFBA 4BL7A 2A4VA 1JZRA 2E7PA 4AKXB 2QA1A 5ECOB 3LEFA 4O5UA 4CDOA 5ABRA 4F0CA 4MJEA 5D9WA 3KMNA 3Q18A 2I9HA 1EOHA 3ME7A 5H5RA 1SVLA 2F51A 4ZL8A 1TU7A 2VCVA 2VCWA 1XW9A 4NXIA 4GSTA 2LNSA 1XBSA 3ME8A 2VM1A 2YZHA 5AN1A 1YVLA 1RQMA 1TXXA 1ZOFA 2H6YA 1V58A 4I97A 4F82A 3QAVA 1EEJA 3DIEA 4NMUA 3HZ4A 3EMXA 2P5QA 5G1KA 3IPZA 4DSRA 2M72A 4MJBA 1J9BA 3M1GA 5GSSA 1PSQA 4FYBA 2B5YA 2C0GA 3TKQA 1Y1UA 4L5OA 3DEXA 2LUSA 1AC1A 4W66A 5JCUA 3MYDA 3TKSE 3L9VA 4K5RA 2G2QA 2ON5A 4AJ6A 1I5GA 5LCZA 2LJRA 5E59A 4KDXA 6GSWA 1QMVA 5ECNB 3CRUA 3LFLA 2QSIA 5J5NA 1YDKA 1PX7A 4ZB9A 3DD3A 4LLRA 4TKYA 1KBNA 4NV5A 5CYYA 3D4MA 1OC8A 5ECIB 5A4VA 2WCIA 2HSNB 3HYPA 4IN0A 4JZQA 3EYTA 1VGLA 4KNDA 1H75A 2D2ZA 5AGYA 3HZ8A 4G0IA 5GAPD 5GSTA 3E3EA 1HQOA 1WOUA 3I69A 2EC4A 1UC7A 5BRTA 3TJKA 3EWLA 2DJJA 2C0DA 1YKCA 3A3TA 4ZXGA 1WPIA 1ILOA 5B8AA 6GSVA 2P5RA 3TRQA 3GRXA 3RHBA 4CY6A 1TDIA 4GRFA 1SKSB 4MPGA 1XOBA 1MD4A 2LS5A 1YEPA 5IO2A 4GDFA 3A2VA 16GSA 1GLPA 1K0OA 4PQIA 1ZGNA 2NVLA 2HYXA 5ECPB 1SYRA 1R26A 2IFQB 1MEKA 1BG5A 2R0PA 3IK9A 5CNWA 1WJKA 4GQCA 2HSYA 2B1KA 3ISOA 2GQLA 1PQNA 2IPAA 3CBUA 1U3AA 3HMJG 1K0AA 6GSXA 2GVPA 3TKPA 2LRNA 2CVBA 1BYEA 1FAAA 2H72A 2LV3A 2YJ7A 4I6XA 5D8IA 4IELA 4MF5A 3KCMA 3QMXA 5G2ZA 2HSNA 1PMTA 1A2MA 1NHYA 2JL4A 1ZMAA 1MTCA 2NPBA 2VUPA 4EO3A 3LW9A 1BF5A 2C80A 4HS1A 5A34B 4G19A 2DKHA 5GAND 3QAGA 3RAZA 3F4TA 2JZRA 2EFCA 3EU4A 1G6WA 1X0RA 5ECLB 5CRHA 3HCZA 4XIHA 2CX4A 2B7JA 3TOUA 2H71A 5CP1A 4IJIA 5E4WA 3FZ9A 3LJRA 3GKNA 2EFEA 3ZTLA 3IR4A 4LMVA 3TGZA 2CAQA 1FHEA 4CY8A 5HFGA 2LQQA 3LQ7A 5JCWA 3GL3A 4YAPA 2LRTA 2YV7A 1SD8A 1LU4A 5INYA 4IJ3A 2IFQA 3C71A 3ZMLA 4JRRA 2WULA 1MDIA 3M9JA 1M9AA 3KH7A 2YWNA 3SWLA 3GL5A 2IMIA 2K18A 1K3OA 1EV9A 3RHCA 4HI7A 3GUSA 2UZ8A 5EY6A 4XS1A 1SKWB 3GKXA 1F3AA 1GNEA 4HQSA 5LD0A 2PVOC 3PINA 4X4JA 4USSA 1PKZA 3K8NA 3GNJA 2VCZA 2VL3A 18GSA 3QR6A 4TR3A 3H8QA 4G0LA 3S9FA 3WGEA 2DJ2A 1K0MA 5J9CA 4GWRA 4ILFA 5A34A 3D0ZA 2RM5A 4HDEA 3F3RA 2PWJA 2V1MA 3ZVJA 2IWTA 4EL1A 2CZ3A 2H0IA 1VF1A 1ERTA 3EU3A 4RI7A 2OJLA 2DJ1A 3QDNA 2GSRA 7GSSA 4Z7XA 2R4VA 2H1DA 1R7HA 3FHKA 4J2FA 3BCIA 5ELAA 3APSA 2JZTA 2MMOA 3UBLA 4EKZA 3VWXA 2FA4A 3IAS2 3KGKA 1X5CA 1OE7A 2CZ2A 4YQUA 2A4HA 4ZBDA 4ML6A 4ZL7A 2VCQA 4OCFA 4LA1A 1VF4A 1V98A 2C3TA 3UEMA 1FW1A 2R0GA 3PH9A 3H79A 4KCEA 2RUEA 2C3NA 4ICYA 2XBIA 4PUFC 1TU8A 3F3QA 4AF2A 5G31A 4WF5A 4ECCA 1B48A 1GSSA 1YEXA 4ECIA 1AUCA 1ZYNA 3L78A 2H70A 1ZYPA 2VM2A 5D9TA 3CWGA 4O32A 4OFMA 2VCTA 3IRAA 4G0KA 3P7XA 2GQKA 2R2JA 1ML6A 3ERWA 3MDKA 2RIIA 3GH9A 3M8NA 1EZKA 4TXVA 4POBA 2VL9A 1RK4A 2IMKA 4D73A 2M46A 1AXDA 19GSA 3P8WA 1M9BA 1JZDA 5J4UA 2PU9C 2CQ9A 22GSA 4KF9A 2XBQA 4V2NA 2HZEB 1FB6A 2DC5A 4Z2RA 4I2TA 2YWMA 5B6MA 4NHZA 3IHGA 4IHUA 1XOAA 5CO3A 4LMWA 1M7TA 2PBJA 1T8EB 1QGVA 1F6MC 1MDKA 1FVJA 1YF1A 4DSSB 1UN2A 3DMLA 3DWVA 1TRWA 4EF0A 1J0FA 1HD2A 4WEYA 5DAKB 2A2RA 1FOHA 2R37A 3J7Yk 5EL8A 3APQA 1A2JA 2VD0A 3F63A 1ON4A 4X43A 1PA3A 1Z5YE 3ERGA 3VI5A 1BQ7A 4EUYA 4X0XA 4HEA2 3GH6A 2H30A 4N3ZA 5ID2A 1TJDA 1B4PA 2X49A 1SU9A 4A5PA 3FW2A 1PL2A 5H5QA 5J4VA 2VLTA 2H8LA 4HZ2A 4IGJA 4PX1A 2HT9A 1SJ6A 2LJAA 2CT6A 3WT2A 1Z6NA 1TOFA 4XS6A 1GL8A 2YP6A 4G9HA 3CTFA 3MSZA 2KP2A 5G1LA 5F05A 3VPQA 4TOPA 4Q5QA 5D9XA 3KEBA 2MMNA 3FZAA 2DMLA 4KSMA 1A23A 5HR0A 2JSZA 2C0EA 2HZEA 2P31A 2KP1A 2CV4A 3GMFA 4IQ1A 3C73A 2R0CA 4IP6A 3D21A 4PXOA 4P3YB 1O6JA 4RQRA 4BVXB 1BAYA 1PD21 2JZSA 1XW5A 1O8WA 2I4AA 1B9XC 4DSSA 2GLRA 1VF2A 3IC8A 1JHBA 4AGSA 5KN2A 4ZILA 2YJHA 3LXZA 3ZZXA 2VO4A 2V41A 1M2AA 4MJAA 4GSNA 2X99A 2V32A 3IXRA 4WR4A 4NAXA 5DVBA 2FHEA 1TP9A 5CREA 2UV8G 6GSYA 3APOA 3NIVA 4Z2TA 1UVZA 10GSA 3BCKA 1EP7A 4E8EA 1EEMA 1KNGA 5JWQB 3G7JA 2WRTA 2AB6A 1GUKA 1Q4JA 1V2AA 1X5DA 1SL0B 2C1YA 3OR5A 1GTAA 1LBKA 5A1NB 2PMTA 4K9ZA 4QQ7A 1NM3A 3F4RA 3ZFLA 9GSSA 1V9WA 2MYGA 4AJ7A 1AIUA 1SK0A 3UVHA 2K8SA 3DRNA 2FD3A 3UARA 3M9KA 4G01A 2CX3A 4LL4B 2A2SA 3TKSA 4BVXA 4I8BA 3FRCA 4Q5FA 3O76A 2HRKB 2PPTA 1EP8A 2I1UA 4OO5A 2OE1A 1EV4A 2WB9A 4JU5A 2VL2A 3G7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7K A;  3KP9 A;  2DBC A;  2GSS A;  4XRA A;  5J9B A;  1HYU A;  3A2X A;  3CXG A;  2FWF A;  5AIS A;  2V6O A;  2GQM A;  4FH8 A;  2MBS A;  4G10 A;  5DJL A;  4L8E A;  3DXB A;  4HOJ A;  3BBY A;  1XWC A;  1JLV A;  1EGR A;  2JAD A;  5D73 A;  4POK A;  4RQX A;  2AJQ B;  3RDW A;  2AUV A;  2PGT A;  2O85 A;  3ZMK A;  4YQV A;  5CAX A;  2C0F A;  1S3D A;  4ECJ A;  4OMV A;  3TJF A;  1GUL A;  2HE3 A;  1TK5 B;  2L5L A;  4PQ1 A;  2YPM A;  4PTS A;  3L9S A;  3M0F A;  4JR4 A;  1M0U A;  3IAM 2;  2HQT A;  1HNC A;  1M99 A;  1K0C A;  4PUR A;  5CRD A;  1M2D A;  1A2L A;  1C72 A;  3JCM L;  2YNX A;  1K0N A;  4F03 A;  4GSS A;  5D96 A;  2KHP A;  1UA5 A;  4FYU A;  4ZBA A;  2TRX A;  4HJ2 A;  1LJR A;  3GST A;  2AV4 A;  3FZ4 A;  3IV4 A;  4JED A;  3VI7 A;  3GX0 A;  3TJG A;  2AAW A;  2X64 A;  3FYG A;  4L0U A;  1XWK A;  5DAL B;  2FUG 2;  2HRK A;  1B4Q A;  4K7N A;  3CRT A;  3D5J A;  1TK8 B;  8GSS A;  2BJX A;  2L5O A;  3TRX A;  1DE2 A;  5BMU A;  11GS A;  3HDC A;  4GTU A;  3UAP A;  5HFI A;  4POM A;  3GFK A;  2VLV A;  1GSQ A;  4K6X A;  3HJP A;  4WBR D;  3GHA A;  2TRC P;  4HQZ A;  2XC2 A;  2ES7 A;  1XWA A;  4TRX A;  2FWH A;  1NW2 A;  2LNT A;  4V1A g;  1JFU A;  1M2B A;  2PN8 A;  3AY8 A;  1OE8 A;  4WKW A;  5B6N A;  4EVM A;  5DJM A;  2HRA A;  3LSZ A;  2LEG A;  2E0Q A;  20GS A;  2FY6 A;  4K1F A;  1SL1 B;  5L71 A;  3LXT A;  2LRC A;  2YZU A;  2GT6 A;  2JU5 A;  3FY7 A;  4GCI A;  5C00 A;  5B7C A;  1ZYE A;  5J3R A;  5IO0 A;  5FT3 A;  2DJ3 A;  1YKA A;  4XCS A;  1HNA A;  1WE0 A;  3MNG A;  3ZL5 A;  1Q98 A;  1AAZ A;  3HD5 A;  1QFN A;  1TI1 A;  5DAL A;  2HFD A;  3F4S A;  2GGT A;  2FWE A;  4XHM A;  1T4Y A;  1OYJ A;  4I5Q A;  3IOS A;  1ZL9 A;  3D22 A;  1GUM A;  5JWR B;  4G2E A;  1SK1 A;  3I9V 2;  3ZRD A;  4QL7 A;  4MH3 A;  1OKT A;  1Z6M A;  2YCD A;  2H1G A;  1X9M B;  2H74 A;  3P90 A;  4ECB A;  2AYT A;  5D93 A;  1SL2 B;  4N30 A;  4WBJ A;  4MF6 A;  3C7M A;  3ZIJ A;  4N0Z A;  4POL A;  1K0D A;  3KJY A;  3V1W A;  4ZBB A;  1X9S B;  2QC7 A;  1VF3 A;  3RBT A;  4MZC A;  2B3S A;  1R4W A;  1K3L A;  3FK8 A;  2YAN A;  1XZO A;  1V40 A;  5G5F A;  1S3C A;  3KD0 A;  3E0U A;  4KDU A;  1F3B A;  2K6V A;  3C1R A;  1W4V A;  4F0B A;  2XPE A;  2H66 A;  4V1A p;  1CQG A;  3TUE A;  3EE2 A;  4BVY B;  1U87 A;  3FR3 A;  4IKH A;  1XFL A;  5B8B A;  2H01 A;  2NBS A;  3FR9 A;  3MWH A;  1GTI A;  3DVX A;  2R6K A;  2WJU A;  1YJ6 A;  1J08 A;  1N2A A;  3TKR A;  4PNG A;  3FKF A;  3GTU B;  4EC0 A;  2FA8 A;  2KUC A;  3EC3 A;  1SKR B;  1THO A;  4MPF A;  3KM6 A;  5FWG A;  2ZUP A;  1I9D A;  1XVQ A;  1K3Y A;  2GTU A;  4IP1 A;  1TK0 B;  3TRP A;  3Q19 A;  1R5A A;  4DEJ A;  3FEU A;  2H75 A;  5D9V A;  1DE1 A;  3UJ1 A;  4BWQ A;  3NZN A;  4MCU A;  4ML1 A;  2ZNM A;  5DCH A;  5ECH B;  1TI3 A;  2F8A A;  1ERU A;  2YV9 A;  3O6T A;  1AQV A;  4IQA A;  1AW9 A;  1WP0 A;  3GKM A;  4NV2 A;  3HXS A;  4ZB6 A;  4E8H A;  4XRD A;  2O7K A;  1O73 A;  3TJJ A;  4RI6 A;  5ELG A;  4NPB A;  2GZZ A;  4KGI A;  3ZVJ D;  3CSH A;  4EXJ A;  2F3M A;  3QPM A;  5H5S A;  5F06 A;  3IA1 A;  2WDU A;  1ZCP A;  3ED3 A;  1X5E A;  3BOA A;  2YWO A;  3VLN A;  2L6C A;  2ZCT A;  3D6I A;  4JE1 A;  5FHI A;  4HZ4 A;  1YY7 A;  1PKW A;  2CAI A;  3GN3 A;  3M3M A;  5ECK B;  1MD3 A;  2K9F A;  4KUN A;  5C04 A;  4DVC A;  4BVY A;  5GZZ B;  1GWC A;  12GS A;  1B8X A;  4ULX A;  3D4T A;  2JAC A;  3KXO A;  4J56 E;  4YH2 A;  1GSF A;  2CA8 A;  1FB0 A;  2HNL A;  1YF0 A;  3TCO A;  4OCE A;  5HR3 A;  2O89 A;  4O7H A;  3MAK A;  2GSQ A;  3SBC A;  1NHO A;  3VWW A;  6GSS A;  1S3A A;  1A0R P;  3QFA C;  2OBK A;  1JZW A;  4CHS A;  4FIW A;  2B5E A;  2HI7 A;  2WS2 A;  2BTO T;  5KN0 A;  2KOK A;  4EDZ A;  2LJK A;  2NDO A;  2VIM A;  4L0W A;  3KMO A;  2PUK C;  1O85 A;  4N0V A;  1ST9 A;  2GST A;  5DCG A;  1BJX A;  3R3E A;  2C8U A;  3PGT A;  4ZIJ A;  3EVI A;  4K7I A;  4WF4 A;  3L0H A;  2VOC A;  1Z7R A;  1Z9H A;  3G7Y A;  4MJC A;  4NWY A;  2OAD A;  1U3I A;  4KDY A;  1Z7P A;  4IW9 A;  3TJB A;  1XPV A;  2DMM A;  1F2E A;  1TTZ A;  4FO5 A;  3F6F A;  1U6T A;  2EIO A;  2VLU A;  1V57 A;  2F9S A;  4H86 A;  1TW9 A;  2OE0 A;  2R5G A;  2OA7 A;  2H1A A;  4F9Z A;  4JBB A;  3F6D A;  4QL9 A;  2I81 A;  1IYI A;  5IPH A;  3WD6 A;  3HY2 A;  5DAK A;  5ECS A;  3IDV A;  2QKE A;  1DBY A;  2DLX A;  4MK3 A;  4KW6 A;  3I6A A;  3F0I A;  1OKD A;  4WET A;  3KIJ A;  5G30 A;  3WGD A;  3H1N A;  2HRF A;  4ID0 A;  2RLI A;  3ZRE A;  2DJK A;  3LYK A;  4MZW A;  1T1V A;  2DIY A;  3VWV A;  2OBI A;  3RPN A;  4JR6 A;  3U6V A;  5DQS A;  5CRG A;  3J7Y b;  3O3T A;  3GA4 A;  3F8U A;  3GV1 A;  1PX6 A;  5IMC A;  2CVD A;  3KTL A;  2L59 A;  2X8G A;  4F2I A;  2ON7 A;  2P0G A;  4MF7 A;  3EMP A;  5KEJ A;  1Y25 A;  3KTB A;  1G6Y A;  1AQW A;  2L4C A;  2DIZ A;  4K2D A;  3DKS A;  4PUA A;  2KLX A;  1G0T A;  4BPY A;  4MA9 A;  5KN1 A;  1PRX A;  1GSE A;  3US3 A;  1PL1 A;  1XCC A;  2FLS A;  3LWA A;  1YZX A;  4DSQ A;  5IMF A;  2MMA A;  3HVX A;  3H93 A;  3W6G A;  3C1S A;  3DGQ A;  1XW6 A;  1XIY A;  5ECQ B;  5IMV A;  5EVO A;  2X8C A;  3U5R E;  4XS4 B;  1T7P B;  4MAB A;  2HRN A;  3WYW A;  1ABA A;  4KE3 A;  4MP4 A;  1RW1 A;  4FQU A;  3N9J A;  4NHW A;  1XWG A;  3R2Q A;  3PPU A;  2F8F A;  3L9U A;  4IBP A;  2X8H A;  2WGR A;  1OAZ A;  4KAE A;  2VCX A;  2O8V B;  2IJY A;  4TVE A;  1GP1 A;  1SK2 A;  1X9W B;  2WFC A;  5IOX A;  5COH A;  3WGX A;  4V2L A;  1O8X A;  1USB A;  2J23 A;  3QAW A;  3QFB C;  4X1U A;  4O5R A;  1SEN A;  3BJ5 A;  3GYK A;  17GS A;  1AQX A;  1U88 A;  4IVF A;  3UVT A;  5KN3 A;  2EIQ A;  5F8B A;  1GLQ A;  5IQY A;  1PGT A;  3GX8 A;  3Q74 A;  2N5F A;  3IK7 A;  2JSY A;  1GUH A;  5EPF A;  2E2G A;  1SJZ A;  4TR1 B;  2QGV A;  2AHE A;  3EIN A;  5HFK A;  1H4O A;  3H4K A;  3CSJ A;  2YN1 A;  1TKD B;  3GKK A;  3N5O A;  2BMX A;  3I43 A;  4MZB A;  4KA0 A;  5A4W A;  1EGO A;  2Z9S A;  5JCG A;  1JZO A;  4AJ8 A;  2FGX A;  3UOM A;  3TKS C;  2H0G A;  2H19 A;  4OD7 A;  4XS4 A;  1EWX A;  5CRW A;  2OAC A;  2HSH A;  1E2Y A;  2VD1 A;  2VL2 C;  2V2G A;  4MDC A;  1WWJ A;  2FCH A;  2M80 A;  5LNK e;  1A0F A;  1B9Y C;  1WRY A;  1FG4 A;  1A8L A;  3IBH A;  4I2U A;  4GXZ A;  3FR6 A;  2K8V A;  4MLY A;  3IE3 A;  2GT5 A;  5IMZ A;  3A2W A;  4YAV A;  4KSO A;  1G7E A;  2L4Q A;  3FZ5 A;  3Q6O A;  4K7O A;  4PGT A;  1SJI A;  1ZZY A;  1F37 A;  5IPG A;  1A8Y A;  1GSU A;  1O81 A;  5F0G A;  4MMM A;  2WZ9 A;  3HVV A;  1GSY A;  2J9H A;  1GH2 A;  5A5K A;  1A24 A;  1TRV A;  4EE0 A;  2RM6 A;  2H1B A;  1N8J A;  1OC3 A;  3ERF A;  3F9U A;  3EUR A;  4KH7 A;  2NTO A;  2PVQ A;  1O7U A;  3QCP A;  1HNB A;  6GST A;  2IMF A;  1E6B A;  3VWU A;  4TR1 A;  1KEB A;  2GS3 A;  5HR1 A;  4GLT A;  5IOW A;  1GTU A;  4CW9 A;  4PQH A;  1IYH A;  5F07 A;  4OO4 A;  1THX A;  1TRU A;  1T00 A;  1ACV A;  2L57 A;  2O87 A;  3HKR A;  4ZB8 A;  2XPD A;  1SYX A;  4WR5 A;  3UL3 A;  1Z3E A;  1PN9 A;  3DYR A;  5IIZ A;  5IMA A;  2OE3 A;  4ZL9 A;  1FO5 A;  1K0B A;  1DUG A;  4Q5N A;  1WIK A;  1WMJ A;  4HU9 A;  3KP8 A;  1YQ1 A;  1XWB A;  2GZP A;  4GQF A;  1Y6E A;  1DSB A;  4LL1 B;  1ZYQ B;  5AIV A;  2RUF A;  4IS0 A;  2MMZ A;  3LOR A;  3ZIV A;  2PER A;  1OC9 B;  3ZLP A;  4O92 A;  1CQH A;  1FVK A;  2I3Y A;  4D73 B;  2LQO A;  2IMD A;  2FWG A;  2H73 A;  3TDG A;  2EIR A;  3QOU A;  1KTE A;  5ECM B;  3CTG A;  4BWS A;  1QQ2 A;  3DVW A;  1TRS A;  2L6D A;  1QK8 A;  2GDR A;  2FNO A;  3G9B A;  4TXO B;  5DBQ A;  3TB2 A;  2B1L A;  3TOT A;  2YWI A;  4PNF A;  3BD2 A;  3HJO A;  1FOV A;  4OFT A;  1F9M A;  5J41 A;  3QD9 A;  4K0G A;  3VK9 A;  4BA7 A;  2HSM B;  3IC4 A;  1OVN A;  2B5X A;  3IHQ A;  4YQM A;  3VFI A;  5HQP A;  2V6K A;  1VRS D;  2B6M A;  2MBT A;  1JLW A;  3PR8 A;  5A4U A;  4HUA A;  4N10 A;  4EDY A;  2HZF A;  4RUV A;  4KCA A;  2YOI A;  4MH2 A;  1QUW A;  1G7O A;  1T3B A;  5IM9 A;  2C3Q A;  1GNW A;  1BED A;  2N5A A;  3W8J A;  4TR4 A;  3KH9 A;  2H76 A;  5ID2 B;  2IME A;  1SD9 A;  2GZY A;  4OFN A;  2C4J A;  2ALB A;  1GTB A;  2H6Z A;  13GS A;  3GSS A;  2N5B A;  3GIX A;  2HXK A;  2VAF A;  4GF0 A;  1OC9 A;  3E9J B;  2H6X A;  3LYP A;  1XXU A;  4BL7 B;  3ZIT A;  3LG6 A;  5JWO B;  5DQY A;  4KB3 A;  1R5P A;  3HJM A;  2IN3 A;  3CYN A;  4WXT A;  5HR2 A;  3P2A A;  4ACS A;  3C8E A;  5AIX A;  2HLS A;  4TXO A;  3HHV A;  4HJM A;  4V2M A;  5ECR B;  3LGC A;  4Q5R A;  2IIY A;  4J57 E;  1BX9 A;  2OKA A;  2LST A;  4K0N A;  4TR0 A;  1NSW A;  5G5E A;  2CVK A;  3GUR A;  1ERW A;  1T4Z A;  3L4N A;  3VUR A;  2DJ0 A;  3KZQ A;  4TW5 A;  3UMA A;  3NOF A;  2HSM A;  2H0H A;  6GSU A;  1EOG A;  5IMD A;  2REM A;  3GTU A;  2XHF A;  4N11 A;  3CMI A;  2G0F A;  1XVW A;  3HA9 A;  3RPP A;  2IL3 A;  2DSA A;  5ENU A;  1QXH A;  4FYC A;  4K8M A;  1URM A;  4L5L A;  2LTK A;  3UIW A;  3A5W A;  2R3X A;  4KX4 A;  2E2M A;  4HU7 A;  2MZC A;  3CSI A;  3VPT A;  1W89 A;  1MDJ A;  1GSD A;  4XTS A;  3WT1 A;  3W8S A;  14GS A;  4OWY A;  1GRX A;  1ERV A;  3UBK A;  4ISD A;  4TN8 A;  3HVS A;  2TIR A;  3ZYW A;  2LKU A;  5DDL A;  3ZFB A;  4BL7 A;  2A4V A;  1JZR A;  2E7P A;  5ECO B;  3LEF A;  4CDO A;  5ABR A;  4F0C A;  4MJE A;  5D9W A;  3KMN A;  3Q18 A;  2I9H A;  1EOH A;  3ME7 A;  5H5R A;  2F51 A;  4ZL8 A;  1TU7 A;  2VCV A;  2VCW A;  1XW9 A;  4NXI A;  4GST A;  2LNS A;  1XBS A;  3ME8 A;  2VM1 A;  2YZH A;  5AN1 A;  1RQM A;  1TXX A;  1ZOF A;  2H6Y A;  1V58 A;  4I97 A;  4F82 A;  3QAV A;  1EEJ A;  3DIE A;  4NMU A;  3HZ4 A;  3EMX A;  2P5Q A;  5G1K A;  3IPZ A;  4DSR A;  2M72 A;  4MJB A;  1J9B A;  3M1G A;  5GSS A;  1PSQ A;  4FYB A;  2B5Y A;  2C0G A;  3TKQ A;  4L5O A;  3DEX A;  2LUS A;  1AC1 A;  5JCU A;  3TKS E;  3L9V A;  2G2Q A;  2ON5 A;  4AJ6 A;  1I5G A;  5LCZ A;  2LJR A;  5E59 A;  4KDX A;  6GSW A;  1QMV A;  5ECN B;  3CRU A;  3LFL A;  2QSI A;  5J5N A;  1YDK A;  1PX7 A;  4ZB9 A;  3DD3 A;  4LLR A;  4TKY A;  1KBN A;  4NV5 A;  5CYY A;  3D4M A;  1OC8 A;  5ECI B;  5A4V A;  2WCI A;  2HSN B;  3HYP A;  4IN0 A;  4JZQ A;  3EYT A;  1VGL A;  4KND A;  1H75 A;  2D2Z A;  5AGY A;  3HZ8 A;  4G0I A;  5GAP D;  5GST A;  3E3E A;  1HQO A;  1WOU A;  3I69 A;  2EC4 A;  1UC7 A;  3TJK A;  3EWL A;  2DJJ A;  2C0D A;  1YKC A;  3A3T A;  4ZXG A;  1WPI A;  1ILO A;  5B8A A;  6GSV A;  2P5R A;  3TRQ A;  3GRX A;  3RHB A;  1TDI A;  4GRF A;  1SKS B;  4MPG A;  1XOB A;  1MD4 A;  2LS5 A;  1YEP A;  5IO2 A;  3A2V A;  16GS A;  1GLP A;  1K0O A;  4PQI A;  1ZGN A;  2NVL A;  2HYX A;  5ECP B;  1SYR A;  1R26 A;  2IFQ B;  1MEK A;  1BG5 A;  3IK9 A;  5CNW A;  1WJK A;  4GQC A;  2HSY A;  2B1K A;  3ISO A;  2GQL A;  1PQN A;  2IPA A;  3CBU A;  1U3A A;  1K0A A;  6GSX A;  2GVP A;  3TKP A;  2LRN A;  2CVB A;  1BYE A;  1FAA A;  2H72 A;  2LV3 A;  2YJ7 A;  4I6X A;  5D8I A;  4IEL A;  4MF5 A;  3KCM A;  3QMX A;  5G2Z A;  1PMT A;  1A2M A;  1NHY A;  2JL4 A;  1ZMA A;  1MTC A;  2NPB A;  2VUP A;  4EO3 A;  2C80 A;  4HS1 A;  4G19 A;  5GAN D;  3QAG A;  3RAZ A;  3F4T A;  2JZR A;  3EU4 A;  1G6W A;  1X0R A;  5ECL B;  5CRH A;  3HCZ A;  4XIH A;  2CX4 A;  2B7J A;  3TOU A;  2H71 A;  5CP1 A;  4IJI A;  5E4W A;  3FZ9 A;  3LJR A;  3GKN A;  3ZTL A;  3IR4 A;  4LMV A;  3TGZ A;  2CAQ A;  1FHE A;  5HFG A;  2LQQ A;  3LQ7 A;  5JCW A;  3GL3 A;  4YAP A;  2LRT A;  2YV7 A;  1SD8 A;  1LU4 A;  5INY A;  4IJ3 A;  2IFQ A;  3C71 A;  3ZML A;  4JRR A;  2WUL A;  1MDI A;  3M9J A;  1M9A A;  3KH7 A;  2YWN A;  3SWL A;  3GL5 A;  2IMI A;  2K18 A;  1K3O A;  1EV9 A;  3RHC A;  4HI7 A;  3GUS A;  2UZ8 A;  5EY6 A;  4XS1 A;  1SKW B;  3GKX A;  1F3A A;  1GNE A;  4HQS A;  5LD0 A;  2PVO C;  3PIN A;  4USS A;  1PKZ A;  3K8N A;  3GNJ A;  2VCZ A;  2VL3 A;  18GS A;  3QR6 A;  4TR3 A;  3H8Q A;  4G0L A;  3S9F A;  3WGE A;  2DJ2 A;  1K0M A;  5J9C A;  4GWR A;  4ILF A;  3D0Z A;  2RM5 A;  4HDE A;  3F3R A;  2PWJ A;  2V1M A;  3ZVJ A;  2IWT A;  4EL1 A;  2CZ3 A;  2H0I A;  1VF1 A;  1ERT A;  3EU3 A;  4RI7 A;  2OJL A;  2DJ1 A;  3QDN A;  2GSR A;  7GSS A;  4Z7X A;  2R4V A;  2H1D A;  1R7H A;  3FHK A;  4J2F A;  3BCI A;  5ELA A;  3APS A;  2JZT A;  2MMO A;  3UBL A;  4EKZ A;  3VWX A;  2FA4 A;  3IAS 2;  3KGK A;  1X5C A;  1OE7 A;  2CZ2 A;  4YQU A;  4ZBD A;  4ML6 A;  4ZL7 A;  2VCQ A;  4OCF A;  4LA1 A;  1VF4 A;  1V98 A;  2C3T A;  3UEM A;  1FW1 A;  3PH9 A;  3H79 A;  4KCE A;  2RUE A;  2C3N A;  2XBI A;  4PUF C;  1TU8 A;  3F3Q A;  4AF2 A;  5G31 A;  4WF5 A;  4ECC A;  1B48 A;  1GSS A;  1YEX A;  4ECI A;  1AUC A;  3L78 A;  2H70 A;  2VM2 A;  5D9T A;  4O32 A;  4OFM A;  2VCT A;  3IRA A;  4G0K A;  3P7X A;  2GQK A;  2R2J A;  1ML6 A;  3ERW A;  3MDK A;  2RII A;  3GH9 A;  3M8N A;  1EZK A;  4TXV A;  4POB A;  2VL9 A;  1RK4 A;  2IMK A;  4D73 A;  2M46 A;  1AXD A;  19GS A;  3P8W A;  1M9B A;  1JZD A;  5J4U A;  2PU9 C;  2CQ9 A;  22GS A;  4KF9 A;  2XBQ A;  4V2N A;  2HZE B;  1FB6 A;  2DC5 A;  4I2T A;  2YWM A;  5B6M A;  4NHZ A;  4IHU A;  1XOA A;  5CO3 A;  4LMW A;  1M7T A;  2PBJ A;  1T8E B;  1QGV A;  1F6M C;  1MDK A;  1FVJ A;  1YF1 A;  4DSS B;  1UN2 A;  3DML A;  3DWV A;  1TRW A;  4EF0 A;  1J0F A;  1HD2 A;  4WEY A;  5DAK B;  2A2R A;  2R37 A;  3J7Y k;  5EL8 A;  3APQ A;  1A2J A;  2VD0 A;  3F63 A;  1ON4 A;  4X43 A;  1PA3 A;  1Z5Y E;  3ERG A;  3VI5 A;  1BQ7 A;  4EUY A;  4X0X A;  4HEA 2;  3GH6 A;  2H30 A;  5ID2 A;  1TJD A;  1B4P A;  1SU9 A;  3FW2 A;  1PL2 A;  5H5Q A;  2VLT A;  2H8L A;  4HZ2 A;  4IGJ A;  4PX1 A;  2HT9 A;  1SJ6 A;  2LJA A;  2CT6 A;  3WT2 A;  1Z6N A;  1TOF A;  4XS6 A;  1GL8 A;  2YP6 A;  4G9H A;  3CTF A;  3MSZ A;  2KP2 A;  5G1L A;  5F05 A;  3VPQ A;  4TOP A;  4Q5Q A;  5D9X A;  3KEB A;  2MMN A;  3FZA A;  2DML A;  4KSM A;  1A23 A;  5HR0 A;  2JSZ A;  2C0E A;  2HZE A;  2P31 A;  2KP1 A;  2CV4 A;  3GMF A;  4IQ1 A;  3C73 A;  4IP6 A;  3D21 A;  4PXO A;  4P3Y B;  1O6J A;  4RQR A;  4BVX B;  1BAY A;  1PD2 1;  2JZS A;  1XW5 A;  1O8W A;  2I4A A;  1B9X C;  4DSS A;  2GLR A;  1VF2 A;  3IC8 A;  1JHB A;  4AGS A;  5KN2 A;  4ZIL A;  3LXZ A;  2YJH A;  3ZZX A;  2VO4 A;  2V41 A;  1M2A A;  4MJA A;  4GSN A;  2X99 A;  2V32 A;  3IXR A;  4WR4 A;  4NAX A;  5DVB A;  2FHE A;  1TP9 A;  5CRE A;  6GSY A;  3APO A;  3NIV A;  1UVZ A;  10GS A;  3BCK A;  1EP7 A;  4E8E A;  1EEM A;  1KNG A;  5JWQ B;  3G7J A;  2WRT A;  2AB6 A;  1GUK A;  1Q4J A;  1V2A A;  1X5D A;  1SL0 B;  2C1Y A;  3OR5 A;  1GTA A;  1LBK A;  2PMT A;  4K9Z A;  4QQ7 A;  1NM3 A;  3F4R A;  3ZFL A;  9GSS A;  1V9W A;  2MYG A;  4AJ7 A;  1AIU A;  1SK0 A;  3UVH A;  2K8S A;  3DRN A;  2FD3 A;  3UAR A;  3M9K A;  2CX3 A;  4LL4 B;  2A2S A;  3TKS A;  4BVX A;  4I8B A;  3FRC A;  4Q5F A;  3O76 A;  2HRK B;  2PPT A;  1EP8 A;  2I1U A;  4OO5 A;  2OE1 A;  1EV4 A;  2WB9 A;  4JU5 A;  2VL2 A;  3G7I A; 
#chains in the Genus database with same CATH topology
 2B7K A;  3KP9 A;  2DBC A;  2GSS A;  4XRA A;  5BMU B;  5J9B A;  1HYU A;  3A2X A;  3CXG A;  2FWF A;  5AIS A;  2V6O A;  2GQM A;  4FH8 A;  2MBS A;  4G10 A;  5DJL A;  4L8E A;  3DXB A;  4HOJ A;  3BBY A;  1XWC A;  1JLV A;  1EGR A;  2JAD A;  5D73 A;  4POK A;  4RQX A;  2AJQ B;  3RDW A;  2AUV A;  2PGT A;  2O85 A;  3ZMK A;  4YQV A;  5CAX A;  2C0F A;  1S3D A;  4ECJ A;  4OMV A;  3TJF A;  1GUL A;  2HE3 A;  1TK5 B;  2L5L A;  4PQ1 A;  2YPM A;  4PTS A;  3L9S A;  3M0F A;  4JR4 A;  1M0U A;  3IAM 2;  2HQT A;  1HNC A;  1M99 A;  1K0C A;  4PUR A;  3A5I A;  5CRD A;  2WVX B;  1M2D A;  1A2L A;  1C72 A;  5A1N A;  3JCM L;  2YNX A;  1K0N A;  4F03 A;  4GSS A;  5D96 A;  2KHP A;  1UA5 A;  4FYU A;  4ZBA A;  2TRX A;  4HJ2 A;  1LJR A;  3GST A;  2AV4 A;  3FZ4 A;  3IV4 A;  4JED A;  3VI7 A;  3GX0 A;  3TJG A;  2AAW A;  2X64 A;  3FYG A;  4L0U A;  1XWK A;  5DAL B;  2FUG 2;  2VKZ G;  2HRK A;  1B4Q A;  4K7N A;  3CRT A;  3D5J A;  1TK8 B;  8GSS A;  2BJX A;  2L5O A;  3TRX A;  1DE2 A;  5BMU A;  11GS A;  3HDC A;  4GTU A;  3UAP A;  3MIX A;  5HFI A;  4POM A;  3GFK A;  2VLV A;  1GSQ A;  4K6X A;  3HJP A;  4WBR D;  3GHA A;  2TRC P;  4HQZ A;  2XC2 A;  2ES7 A;  1XWA A;  4TRX A;  2FWH A;  1NW2 A;  2LNT A;  4V1A g;  1JFU A;  1M2B A;  2PN8 A;  3AY8 A;  1OE8 A;  4WKW A;  5B6N A;  4EVM A;  5DJM A;  2HRA A;  3LSZ A;  2LEG A;  2E0Q A;  20GS A;  2FY6 A;  4K1F A;  1SL1 B;  2WVX A;  5L71 A;  3LXT A;  2LRC A;  2YZU A;  2GT6 A;  5KOX A;  2JU5 A;  3FY7 A;  4GCI A;  5C00 A;  5B7C A;  1ZYE A;  5J3R A;  5IO0 A;  5FT3 A;  3HVN A;  2DJ3 A;  1YKA A;  4XCS A;  1HNA A;  1WE0 A;  3MNG A;  3ZL5 A;  1Q98 A;  1AAZ A;  3HD5 A;  1QFN A;  1TI1 A;  5DAL A;  2HFD A;  3F4S A;  2GGT A;  2FWE A;  4XHM A;  1T4Y A;  1OYJ A;  4I5Q A;  3IOS A;  1ZL9 A;  3D22 A;  1GUM A;  5JWR B;  4G2E A;  1SK1 A;  3I9V 2;  3ZRD A;  4QL7 A;  4MH3 A;  1OKT A;  1Z6M A;  2YCD A;  2H1G A;  1X9M B;  2H74 A;  3P90 A;  4ECB A;  2AYT A;  5D93 A;  1SL2 B;  4N30 A;  4WBJ A;  4MF6 A;  3C7M A;  3ZIJ A;  4N0Z A;  4POL A;  1K0D A;  3KJY A;  3V1W A;  4ZBB A;  1X9S B;  2QC7 A;  1VF3 A;  3RBT A;  4MZC A;  2B3S A;  1R4W A;  1K3L A;  3FK8 A;  2YAN A;  1XZO A;  1V40 A;  5G5F A;  1S3C A;  3KD0 A;  1TXU A;  3E0U A;  4KDU A;  1F3B A;  2K6V A;  3C1R A;  1W4V A;  4F0B A;  2XPE A;  2H66 A;  4V1A p;  1CQG A;  3TUE A;  2OT3 A;  3EE2 A;  5KOW A;  4BVY B;  1U87 A;  3FR3 A;  4IKH A;  1XFL A;  5B8B A;  2H01 A;  2NBS A;  3FR9 A;  3MWH A;  1GTI A;  3DVX A;  2R6K A;  2WJU A;  1YJ6 A;  1J08 A;  1N2A A;  3TKR A;  4PNG A;  3FKF A;  3GTU B;  4EC0 A;  2FA8 A;  2KUC A;  3EC3 A;  1SKR B;  1THO A;  4MPF A;  3KM6 A;  5FWG A;  2ZUP A;  1I9D A;  1XVQ A;  1K3Y A;  2GTU A;  4IP1 A;  1N25 A;  1TK0 B;  3TRP A;  3Q19 A;  1R5A A;  4DEJ A;  3FEU A;  2H75 A;  5D9V A;  1DE1 A;  3UJ1 A;  4BWQ A;  3NZN A;  4MCU A;  4ML1 A;  2ZNM A;  5DCH A;  5ECH B;  1TI3 A;  2F8A A;  1ERU A;  2YV9 A;  3O6T A;  1AQV A;  4IQA A;  1AW9 A;  1WP0 A;  3GKM A;  4PI0 C;  5J4Y A;  4NV2 A;  3HXS A;  4ZB6 A;  4E8H A;  4XRD A;  2O7K A;  1O73 A;  3TJJ A;  4RI6 A;  5ELG A;  4NPB A;  2GZZ A;  4KGI A;  3ZVJ D;  3CSH A;  4EXJ A;  3EPT A;  2F3M A;  3QPM A;  5H5S A;  5F06 A;  3IA1 A;  2WDU A;  1ZCP A;  3ED3 A;  1X5E A;  3BOA A;  2YWO A;  3VLN A;  2L6C A;  2ZCT A;  3D6I A;  4JE1 A;  5FHI A;  4HZ4 A;  1YY7 A;  1PKW A;  2CAI A;  3GN3 A;  3M3M A;  1YEW C;  5ECK B;  1MD3 A;  2K9F A;  4KUN A;  5C04 A;  4DVC A;  4BVY A;  5GZZ B;  1GWC A;  12GS A;  1B8X A;  4ULX A;  3D4T A;  2JAC A;  3KXO A;  4J56 E;  4YH2 A;  1GSF A;  2CA8 A;  1FB0 A;  2HNL A;  1YF0 A;  3TCO A;  4OCE A;  5HR3 A;  2O89 A;  4O7H A;  3MAK A;  2GSQ A;  3SBC A;  1NHO A;  3VWW A;  6GSS A;  1S3A A;  1A0R P;  3QFA C;  2OBK A;  1JZW A;  4CHS A;  4FIW A;  2B5E A;  2HI7 A;  2WS2 A;  2BTO T;  5KN0 A;  2KOK A;  4EDZ A;  2LJK A;  2NDO A;  2VIM A;  4L0W A;  3KMO A;  2PUK C;  1O85 A;  4N0V A;  1ST9 A;  1S4B P;  2GST A;  5DCG A;  1BJX A;  3R3E A;  2C8U A;  3PGT A;  4ZIJ A;  3EVI A;  4K7I A;  4WF4 A;  3L0H A;  2VOC A;  1Z7R A;  1Z9H A;  3G7Y A;  4MJC A;  4NWY A;  2OAD A;  1U3I A;  4KDY A;  1Z7P A;  2X4A A;  4IW9 A;  3TJB A;  1XPV A;  2DMM A;  1F2E A;  1TTZ A;  4FO5 A;  3F6F A;  1U6T A;  2EIO A;  2VLU A;  1V57 A;  4QMK A;  2F9S A;  4H86 A;  1TW9 A;  2OE0 A;  2R5G A;  2OA7 A;  2H1A A;  4F9Z A;  4JBB A;  3F6D A;  4QL9 A;  2I81 A;  2WW0 A;  1IYI A;  5IPH A;  3WD6 A;  2A2P A;  4MNN A;  3HY2 A;  5DAK A;  5ECS A;  3IDV A;  1SVO A;  2QKE A;  1DBY A;  2DLX A;  4MK3 A;  4KW6 A;  3I6A A;  3F0I A;  2EFH A;  1OKD A;  4WET A;  3KIJ A;  5G30 A;  3WGD A;  3H1N A;  2HRF A;  4ID0 A;  2RLI A;  3ZRE A;  2DJK A;  3LYK A;  4MZW A;  1T1V A;  2DIY A;  3VWV A;  2OBI A;  3RPN A;  4JR6 A;  3U6V A;  4ZB7 A;  4K5S A;  5DQS A;  5CRG A;  3J7Y b;  3O3T A;  3GA4 A;  3F8U A;  3GV1 A;  1PX6 A;  5IMC A;  2CVD A;  3KTL A;  2L59 A;  2X8G A;  4F2I A;  2ON7 A;  2P0G A;  4MF7 A;  3EMP A;  2WVY A;  5KEJ A;  1Y25 A;  3KTB A;  1G6Y A;  4AKH A;  1AQW A;  2L4C A;  2DIZ A;  4K2D A;  1PN0 A;  3DKS A;  4PUA A;  2KLX A;  1G0T A;  4BPY A;  4MA9 A;  5KN1 A;  1PRX A;  1GSE A;  3US3 A;  1PL1 A;  1XCC A;  2FLS A;  3LWA A;  3FMW A;  1YZX A;  4DSQ A;  5IMF A;  2MMA A;  3HVX A;  3H93 A;  3W6G A;  3C1S A;  3DGQ A;  1XW6 A;  1XIY A;  5ECQ B;  5IMV A;  5EVO A;  2X8C A;  3U5R E;  4XS4 B;  1T7P B;  4MAB A;  2HRN A;  3WYW A;  1ABA A;  1BG1 A;  4YKF A;  4KE3 A;  4MP4 A;  1RW1 A;  4FQU A;  3N9J A;  4NHW A;  1XWG A;  3R2Q A;  3PPU A;  2F8F A;  3L9U A;  4IBP A;  4EIP A;  2X8H A;  2WGR A;  1OAZ A;  4KAE A;  2VCX A;  2O8V B;  2WVZ A;  2IJY A;  1S3R A;  4TVE A;  1GP1 A;  1SK2 A;  1X9W B;  2WFC A;  5IOX A;  5COH A;  3WGX A;  4V2L A;  1O8X A;  1USB A;  2J23 A;  3QAW A;  3QFB C;  2O5V A;  4X1U A;  4O5R A;  1SEN A;  3BJ5 A;  3GYK A;  17GS A;  1AQX A;  1U88 A;  1SVM A;  4IVF A;  3UVT A;  5KN3 A;  4K2X A;  2EIQ A;  5F8B A;  1GLQ A;  5IQY A;  5J47 A;  1PGT A;  3GX8 A;  3Q74 A;  2N5F A;  3IK7 A;  2JSY A;  1GUH A;  5EPF A;  2E2G A;  1SJZ A;  4E68 A;  4TR1 B;  2QGV A;  2AHE A;  3EIN A;  5HFK A;  1H4O A;  3H4K A;  3CSJ A;  2YN1 A;  1TKD B;  3GKK A;  3N5O A;  2BMX A;  3I43 A;  4MZB A;  4KA0 A;  5A4W A;  1EGO A;  2Z9S A;  5JCG A;  1JZO A;  4AJ8 A;  2FGX A;  3UOM A;  3TKS C;  2H0G A;  2H19 A;  4OD7 A;  4XS4 A;  1EWX A;  5CRW A;  2OAC A;  2HSH A;  1E2Y A;  2VD1 A;  2VL2 C;  2V2G A;  4MDC A;  1WWJ A;  2FCH A;  2M80 A;  5LNK e;  1A0F A;  1B9Y C;  1WRY A;  1FG4 A;  1A8L A;  3IBH A;  4I2U A;  4GXZ A;  3FR6 A;  2K8V A;  4MLY A;  3IE3 A;  2GT5 A;  5IMZ A;  3A2W A;  4YAV A;  4KSO A;  1G7E A;  2L4Q A;  3FZ5 A;  3Q6O A;  4K7O A;  4PGT A;  1SJI A;  1M3I A;  1ZZY A;  1F37 A;  5IPG A;  1A8Y A;  1GSU A;  1O81 A;  5F0G A;  4MMM A;  2WZ9 A;  3HVV A;  1GSY A;  2J9H A;  1GH2 A;  5A5K A;  5A5H B;  1A24 A;  1TRV A;  4EE0 A;  2RM6 A;  5J40 A;  2H1B A;  1N8J A;  1OC3 A;  3ERF A;  3F9U A;  3EUR A;  4KH7 A;  2NTO A;  2PVQ A;  1O7U A;  3QCP A;  1HNB A;  6GST A;  2IMF A;  1E6B A;  3VWU A;  4TR1 A;  1KEB A;  2GS3 A;  5HR1 A;  4GLT A;  5IOW A;  1GTU A;  4CW9 A;  4PQH A;  1IYH A;  5F07 A;  4OO4 A;  1THX A;  1TRU A;  1T00 A;  1XG8 A;  1ACV A;  2L57 A;  2O87 A;  2EFD A;  3HKR A;  4ZB8 A;  2XPD A;  1SYX A;  4WR5 A;  3UL3 A;  1Z3E A;  1PN9 A;  3DYR A;  5IIZ A;  5IMA A;  2OE3 A;  4ZL9 A;  1PFO A;  1FO5 A;  1K0B A;  1DUG A;  4Q5N A;  1WIK A;  1WMJ A;  4HU9 A;  3KP8 A;  1YQ1 A;  4AI6 A;  1XWB A;  2GZP A;  4GQF A;  1Y6E A;  1DSB A;  4LL1 B;  1ZYQ B;  5AIV A;  2RUF A;  4IS0 A;  2MMZ A;  4EIQ A;  3LOR A;  3ZIV A;  2PER A;  1OC9 B;  3ZLP A;  4O92 A;  1CQH A;  1FVK A;  2DKI A;  2I3Y A;  4D73 B;  2LQO A;  2IMD A;  2FWG A;  2H73 A;  3TDG A;  2EIR A;  3QOU A;  1KTE A;  5ECM B;  3CTG A;  4BWS A;  1QQ2 A;  3DVW A;  1TRS A;  2L6D A;  1QK8 A;  1I1I P;  2GDR A;  2FNO A;  2WW1 A;  5A5H A;  3G9B A;  4TXO B;  5DBQ A;  3TB2 A;  2B1L A;  3TOT A;  2YWI A;  4PNF A;  3BD2 A;  3HJO A;  1FOV A;  4OFT A;  1F9M A;  5J41 A;  3QD9 A;  4K0G A;  3VK9 A;  4BA7 A;  2HSM B;  3IC4 A;  1OVN A;  2B5X A;  3IHQ A;  4YQM A;  3VFI A;  5HQP A;  2V6K A;  1VRS D;  2B6M A;  2MBT A;  1JLW A;  3PR8 A;  5A4U A;  4HUA A;  4N10 A;  4EDY A;  2HZF A;  4RUV A;  4KCA A;  2YOI A;  4MH2 A;  1QUW A;  1G7O A;  1T3B A;  4AKG A;  5IM9 A;  2C3Q A;  1GNW A;  1BED A;  3TU3 B;  2N5A A;  3W8J A;  4TR4 A;  3KH9 A;  2H76 A;  5ID2 B;  2IME A;  1SD9 A;  2GZY A;  4OFN A;  2C4J A;  2ALB A;  1GTB A;  2H6Z A;  13GS A;  3GSS A;  2N5B A;  3GIX A;  2HXK A;  4Z2U A;  2VAF A;  4GF0 A;  1OC9 A;  3E9J B;  2H6X A;  3LYP A;  1XXU A;  4BL7 B;  3ZIT A;  3LG6 A;  5JWO B;  5DQY A;  4KB3 A;  1R5P A;  3HJM A;  2IN3 A;  3CYN A;  4WXT A;  5HR2 A;  3P2A A;  4ACS A;  3C8E A;  5AIX A;  2HLS A;  4YKG A;  4TXO A;  3HHV A;  4HJM A;  4V2M A;  5ECR B;  3LGC A;  4Q5R A;  4PHZ C;  3RGB C;  2IIY A;  4J57 E;  1BX9 A;  2OKA A;  2LST A;  4K0N A;  4O5Q A;  4TR0 A;  1NSW A;  5G5E A;  2CVK A;  3GUR A;  1ERW A;  1T4Z A;  3L4N A;  3VUR A;  2DJ0 A;  3KZQ A;  4TW5 A;  3UMA A;  3NOF A;  2HSM A;  2H1L A;  2H0H A;  6GSU A;  1EOG A;  5IMD A;  2REM A;  3GTU A;  2XHF A;  4N11 A;  4AKI A;  3CMI A;  2O36 A;  2G0F A;  1XVW A;  3HA9 A;  3RPP A;  2IL3 A;  2DSA A;  5ENU A;  1QXH A;  4FYC A;  4K8M A;  2QA2 A;  1URM A;  3CHX C;  4L5L A;  2LTK A;  3UIW A;  3A5W A;  2R3X A;  4KX4 A;  2E2M A;  4HU7 A;  2MZC A;  3CSI A;  3VPT A;  1W89 A;  1MDJ A;  1GSD A;  4XTS A;  3WT1 A;  3W8S A;  14GS A;  4OWY A;  1GRX A;  1ERV A;  3UBK A;  4ISD A;  4TN8 A;  3HVS A;  2TIR A;  3ZYW A;  2LKU A;  5DDL A;  3ZFB A;  4BL7 A;  2A4V A;  1JZR A;  2E7P A;  4AKX B;  2QA1 A;  5ECO B;  3LEF A;  4O5U A;  4CDO A;  5ABR A;  4F0C A;  2WZS A;  4MJE A;  5D9W A;  3KMN A;  3Q18 A;  2I9H A;  1EOH A;  3ME7 A;  5H5R A;  2O3E A;  1SVL A;  2F51 A;  4ZL8 A;  1TU7 A;  2VCV A;  2VCW A;  1XW9 A;  4NXI A;  4GST A;  2LNS A;  1XBS A;  3ME8 A;  2VM1 A;  2YZH A;  5AN1 A;  1YVL A;  1RQM A;  1TXX A;  1ZOF A;  2H6Y A;  1V58 A;  4I97 A;  4F82 A;  3QAV A;  1EEJ A;  3DIE A;  4NMU A;  3HZ4 A;  3EMX A;  2P5Q A;  5G1K A;  3IPZ A;  4DSR A;  2M72 A;  4MJB A;  1J9B A;  3M1G A;  5GSS A;  1PSQ A;  4FYB A;  2B5Y A;  2C0G A;  3TKQ A;  1Y1U A;  4L5O A;  3DEX A;  2LUS A;  1AC1 A;  4W66 A;  5JCU A;  3MYD A;  3TKS E;  3L9V A;  4K5R A;  2G2Q A;  2ON5 A;  4AJ6 A;  1I5G A;  5LCZ A;  2LJR A;  3CQF A;  5E59 A;  4KDX A;  6GSW A;  1QMV A;  5ECN B;  3CRU A;  3LFL A;  2QSI A;  5J5N A;  1YDK A;  1PX7 A;  4ZB9 A;  3DD3 A;  4LLR A;  4TKY A;  1KBN A;  4NV5 A;  5CYY A;  3D4M A;  1OC8 A;  5ECI B;  5A4V A;  2WCI A;  2HSN B;  3HYP A;  4IN0 A;  4JZQ A;  3EYT A;  1VGL A;  4KND A;  1H75 A;  2D2Z A;  5AGY A;  3HZ8 A;  4G0I A;  5GAP D;  5GST A;  3E3E A;  1HQO A;  1WOU A;  3I69 A;  2EC4 A;  1UC7 A;  5BRT A;  3TJK A;  3EWL A;  2DJJ A;  2C0D A;  1YKC A;  3A3T A;  4ZXG A;  1WPI A;  1ILO A;  5B8A A;  6GSV A;  2P5R A;  3TRQ A;  3GRX A;  3RHB A;  4CY6 A;  1TDI A;  4GRF A;  1SKS B;  4MPG A;  1XOB A;  1MD4 A;  2LS5 A;  1YEP A;  5IO2 A;  4GDF A;  3A2V A;  4BIK A;  16GS A;  1M3J A;  2WW3 A;  1GLP A;  1K0O A;  4PQI A;  1ZGN A;  2NVL A;  2HYX A;  5ECP B;  1SYR A;  1R26 A;  2IFQ B;  1MEK A;  1BG5 A;  2R0P A;  3IK9 A;  5CNW A;  1WJK A;  4GQC A;  2HSY A;  2B1K A;  3ISO A;  2GQL A;  1PQN A;  2IPA A;  3CBU A;  1U3A A;  3HMJ G;  1K0A A;  6GSX A;  2GVP A;  3TKP A;  2LRN A;  2CVB A;  1BYE A;  1FAA A;  2H72 A;  2LV3 A;  2YJ7 A;  4I6X A;  5D8I A;  4IEL A;  4MF5 A;  3KCM A;  3QMX A;  5G2Z A;  2HSN A;  1PMT A;  1A2M A;  1NHY A;  2JL4 A;  1ZMA A;  1MTC A;  2NPB A;  2VUP A;  4EO3 A;  3LW9 A;  1BF5 A;  2C80 A;  4HS1 A;  5A34 B;  4G19 A;  2DKH A;  5GAN D;  3QAG A;  3RAZ A;  3F4T A;  2JZR A;  2EFC A;  3EU4 A;  1G6W A;  1X0R A;  5ECL B;  5CRH A;  3HCZ A;  4FXY P;  4XIH A;  2CX4 A;  2B7J A;  3TOU A;  2H71 A;  5CP1 A;  4IJI A;  5E4W A;  3FZ9 A;  3LJR A;  3GKN A;  2EFE A;  3ZTL A;  3IR4 A;  4LMV A;  3TGZ A;  2CAQ A;  1FHE A;  4CY8 A;  5HFG A;  2LQQ A;  3LQ7 A;  5JCW A;  3GL3 A;  4YAP A;  2LRT A;  2YV7 A;  1SD8 A;  1LU4 A;  5INY A;  4IJ3 A;  2IFQ A;  3C71 A;  3ZML A;  4JRR A;  2WUL A;  1MDI A;  3M9J A;  1M9A A;  3KH7 A;  2YWN A;  3SWL A;  3GL5 A;  2IMI A;  2K18 A;  1K3O A;  1EV9 A;  3RHC A;  4HI7 A;  3GUS A;  2UZ8 A;  5EY6 A;  4XS1 A;  1SKW B;  3GKX A;  1F3A A;  1GNE A;  4HQS A;  5LD0 A;  2PVO C;  3PIN A;  4X4J A;  4USS A;  1PKZ A;  3K8N A;  3GNJ A;  2VCZ A;  2VL3 A;  18GS A;  3QR6 A;  4TR3 A;  3H8Q A;  3RFR C;  4G0L A;  3S9F A;  3WGE A;  2DJ2 A;  1K0M A;  5J9C A;  4GWR A;  4ILF A;  5A34 A;  3D0Z A;  2RM5 A;  4HDE A;  3F3R A;  2PWJ A;  2V1M A;  3ZVJ A;  2IWT A;  4EL1 A;  2CZ3 A;  2H0I A;  1VF1 A;  1ERT A;  3EU3 A;  4RI7 A;  2OJL A;  2DJ1 A;  3QDN A;  2GSR A;  7GSS A;  4Z7X A;  2R4V A;  2H1D A;  1R7H A;  3FHK A;  4J2F A;  3BCI A;  5ELA A;  4HSC X;  3APS A;  2JZT A;  2MMO A;  3UBL A;  4EKZ A;  3VWX A;  2FA4 A;  3IAS 2;  3KGK A;  1X5C A;  1OE7 A;  2CZ2 A;  4YQU A;  2A4H A;  4ZBD A;  4ML6 A;  4ZL7 A;  2VCQ A;  4OCF A;  4LA1 A;  1VF4 A;  1V98 A;  2C3T A;  3UEM A;  1FW1 A;  2R0G A;  3PH9 A;  3H79 A;  4KCE A;  2RUE A;  2C3N A;  4ICY A;  2XBI A;  4PUF C;  1TU8 A;  3F3Q A;  4AF2 A;  5G31 A;  4WF5 A;  4ECC A;  1B48 A;  1GSS A;  1YEX A;  4ECI A;  1AUC A;  1ZYN A;  3L78 A;  2H70 A;  1ZYP A;  2VM2 A;  5D9T A;  3CWG A;  4O32 A;  4OFM A;  2VCT A;  3IRA A;  4G0K A;  3P7X A;  2GQK A;  2R2J A;  1ML6 A;  3ERW A;  3MDK A;  2RII A;  3GH9 A;  3M8N A;  1EZK A;  4TXV A;  4POB A;  2VL9 A;  1RK4 A;  2IMK A;  4D73 A;  2M46 A;  1AXD A;  19GS A;  3P8W A;  1M9B A;  1JZD A;  5J4U A;  2PU9 C;  2WW2 A;  2CQ9 A;  22GS A;  4KF9 A;  2XBQ A;  4V2N A;  2HZE B;  1FB6 A;  2DC5 A;  4Z2R A;  4I2T A;  2YWM A;  5B6M A;  4NHZ A;  3IHG A;  4IHU A;  1XOA A;  5CO3 A;  4LMW A;  1M7T A;  2PBJ A;  1T8E B;  1QGV A;  1F6M C;  1MDK A;  1FVJ A;  1YF1 A;  4DSS B;  1UN2 A;  3DML A;  3DWV A;  1TRW A;  4EF0 A;  1J0F A;  1HD2 A;  4WEY A;  5DAK B;  2A2R A;  1FOH A;  2R37 A;  3J7Y k;  5EL8 A;  3APQ A;  1A2J A;  2VD0 A;  3F63 A;  1ON4 A;  4X43 A;  1PA3 A;  1Z5Y E;  3ERG A;  3VI5 A;  1BQ7 A;  4EUY A;  4X0X A;  4HEA 2;  3GH6 A;  2H30 A;  4N3Z A;  5ID2 A;  1TJD A;  1B4P A;  2X49 A;  1SU9 A;  4A5P A;  3FW2 A;  1PL2 A;  5H5Q A;  5J4V A;  2VLT A;  4PI2 C;  2H8L A;  4HZ2 A;  4IGJ A;  4PX1 A;  2HT9 A;  1SJ6 A;  2LJA A;  2CT6 A;  3WT2 A;  1Z6N A;  1TOF A;  4XS6 A;  1GL8 A;  2YP6 A;  4G9H A;  3CTF A;  3MSZ A;  2KP2 A;  5G1L A;  5F05 A;  3VPQ A;  4TOP A;  4Q5Q A;  5D9X A;  3KEB A;  2MMN A;  3FZA A;  2DML A;  4KSM A;  1A23 A;  5HR0 A;  2JSZ A;  2C0E A;  2HZE A;  2P31 A;  2KP1 A;  2CV4 A;  3GMF A;  4IQ1 A;  3C73 A;  2R0C A;  4IP6 A;  3D21 A;  4PXO A;  4P3Y B;  1O6J A;  4RQR A;  4BVX B;  1BAY A;  1PD2 1;  2JZS A;  1XW5 A;  1O8W A;  2I4A A;  1B9X C;  4DSS A;  2GLR A;  1VF2 A;  3IC8 A;  1JHB A;  4AGS A;  5KN2 A;  4ZIL A;  2YJH A;  3LXZ A;  3ZZX A;  2VO4 A;  2V41 A;  1M2A A;  4MJA A;  4GSN A;  2X99 A;  2V32 A;  3IXR A;  4WR4 A;  4NAX A;  5DVB A;  2FHE A;  1TP9 A;  5CRE A;  2UV8 G;  6GSY A;  3APO A;  3NIV A;  4Z2T A;  1UVZ A;  10GS A;  3BCK A;  1EP7 A;  4E8E A;  1EEM A;  1KNG A;  5JWQ B;  3G7J A;  2WRT A;  2AB6 A;  1GUK A;  1Q4J A;  1V2A A;  1X5D A;  1SL0 B;  2C1Y A;  3OR5 A;  1GTA A;  1LBK A;  5A1N B;  2PMT A;  4K9Z A;  4QQ7 A;  1NM3 A;  3F4R A;  3ZFL A;  9GSS A;  1V9W A;  2MYG A;  4AJ7 A;  1AIU A;  1SK0 A;  3UVH A;  2K8S A;  3DRN A;  2FD3 A;  3UAR A;  3M9K A;  4G01 A;  2CX3 A;  4LL4 B;  2A2S A;  3TKS A;  4BVX A;  4I8B A;  3FRC A;  4Q5F A;  3O76 A;  2HRK B;  2PPT A;  1EP8 A;  2I1U A;  4OO5 A;  2OE1 A;  1EV4 A;  2WB9 A;  4JU5 A;  2VL2 A;  3G7I A; 
#chains in the Genus database with same CATH homology
 2B7K A;  3KP9 A;  2DBC A;  2GSS A;  4XRA A;  5BMU B;  5J9B A;  1HYU A;  3A2X A;  3CXG A;  2FWF A;  5AIS A;  2V6O A;  2GQM A;  4FH8 A;  2MBS A;  4G10 A;  5DJL A;  4L8E A;  3DXB A;  4HOJ A;  3BBY A;  1XWC A;  1JLV A;  1EGR A;  2JAD A;  5D73 A;  4POK A;  4RQX A;  2AJQ B;  3RDW A;  2AUV A;  2PGT A;  2O85 A;  3ZMK A;  4YQV A;  5CAX A;  2C0F A;  1S3D A;  4ECJ A;  4OMV A;  3TJF A;  1GUL A;  2HE3 A;  1TK5 B;  2L5L A;  4PQ1 A;  2YPM A;  4PTS A;  3L9S A;  3M0F A;  4JR4 A;  1M0U A;  3IAM 2;  2HQT A;  1HNC A;  1M99 A;  1K0C A;  4PUR A;  3A5I A;  5CRD A;  1M2D A;  1A2L A;  1C72 A;  5A1N A;  3JCM L;  2YNX A;  1K0N A;  4F03 A;  4GSS A;  5D96 A;  2KHP A;  1UA5 A;  4FYU A;  4ZBA A;  2TRX A;  4HJ2 A;  1LJR A;  3GST A;  2AV4 A;  3FZ4 A;  3IV4 A;  4JED A;  3VI7 A;  3GX0 A;  3TJG A;  2AAW A;  2X64 A;  3FYG A;  4L0U A;  1XWK A;  5DAL B;  2FUG 2;  2VKZ G;  2HRK A;  1B4Q A;  4K7N A;  3CRT A;  3D5J A;  1TK8 B;  8GSS A;  2BJX A;  2L5O A;  3TRX A;  1DE2 A;  5BMU A;  11GS A;  3HDC A;  4GTU A;  3UAP A;  3MIX A;  5HFI A;  4POM A;  3GFK A;  2VLV A;  1GSQ A;  4K6X A;  3HJP A;  4WBR D;  3GHA A;  2TRC P;  4HQZ A;  2XC2 A;  2ES7 A;  1XWA A;  4TRX A;  2FWH A;  1NW2 A;  2LNT A;  4V1A g;  1JFU A;  1M2B A;  2PN8 A;  3AY8 A;  1OE8 A;  4WKW A;  5B6N A;  4EVM A;  5DJM A;  2HRA A;  3LSZ A;  2LEG A;  2E0Q A;  20GS A;  2FY6 A;  4K1F A;  1SL1 B;  5L71 A;  3LXT A;  2LRC A;  2YZU A;  2GT6 A;  5KOX A;  2JU5 A;  3FY7 A;  4GCI A;  5C00 A;  5B7C A;  1ZYE A;  5J3R A;  5IO0 A;  5FT3 A;  2DJ3 A;  1YKA A;  4XCS A;  1HNA A;  1WE0 A;  3MNG A;  3ZL5 A;  1Q98 A;  1AAZ A;  3HD5 A;  1QFN A;  1TI1 A;  5DAL A;  2HFD A;  3F4S A;  2GGT A;  2FWE A;  4XHM A;  1T4Y A;  1OYJ A;  4I5Q A;  3IOS A;  1ZL9 A;  3D22 A;  1GUM A;  5JWR B;  4G2E A;  1SK1 A;  3I9V 2;  3ZRD A;  4QL7 A;  4MH3 A;  1OKT A;  1Z6M A;  2YCD A;  2H1G A;  1X9M B;  2H74 A;  3P90 A;  4ECB A;  2AYT A;  5D93 A;  1SL2 B;  4N30 A;  4WBJ A;  4MF6 A;  3C7M A;  3ZIJ A;  4N0Z A;  4POL A;  1K0D A;  3KJY A;  3V1W A;  4ZBB A;  1X9S B;  2QC7 A;  1VF3 A;  3RBT A;  4MZC A;  2B3S A;  1R4W A;  1K3L A;  3FK8 A;  2YAN A;  1XZO A;  1V40 A;  5G5F A;  1S3C A;  3KD0 A;  1TXU A;  3E0U A;  4KDU A;  1F3B A;  2K6V A;  3C1R A;  1W4V A;  4F0B A;  2XPE A;  2H66 A;  4V1A p;  1CQG A;  3TUE A;  2OT3 A;  3EE2 A;  5KOW A;  4BVY B;  1U87 A;  3FR3 A;  4IKH A;  1XFL A;  5B8B A;  2H01 A;  2NBS A;  3FR9 A;  3MWH A;  1GTI A;  3DVX A;  2R6K A;  2WJU A;  1YJ6 A;  1J08 A;  1N2A A;  3TKR A;  4PNG A;  3FKF A;  3GTU B;  4EC0 A;  2FA8 A;  2KUC A;  3EC3 A;  1SKR B;  1THO A;  4MPF A;  3KM6 A;  5FWG A;  2ZUP A;  1I9D A;  1XVQ A;  1K3Y A;  2GTU A;  4IP1 A;  1N25 A;  1TK0 B;  3TRP A;  3Q19 A;  1R5A A;  4DEJ A;  3FEU A;  2H75 A;  5D9V A;  1DE1 A;  3UJ1 A;  4BWQ A;  3NZN A;  4MCU A;  4ML1 A;  2ZNM A;  5DCH A;  5ECH B;  1TI3 A;  2F8A A;  1ERU A;  2YV9 A;  3O6T A;  1AQV A;  4IQA A;  1AW9 A;  1WP0 A;  3GKM A;  5J4Y A;  4NV2 A;  3HXS A;  4ZB6 A;  4E8H A;  4XRD A;  2O7K A;  1O73 A;  3TJJ A;  4RI6 A;  5ELG A;  4NPB A;  2GZZ A;  4KGI A;  3ZVJ D;  3CSH A;  4EXJ A;  3EPT A;  2F3M A;  3QPM A;  5H5S A;  5F06 A;  3IA1 A;  2WDU A;  1ZCP A;  3ED3 A;  1X5E A;  3BOA A;  2YWO A;  3VLN A;  2L6C A;  2ZCT A;  3D6I A;  4JE1 A;  5FHI A;  4HZ4 A;  1YY7 A;  1PKW A;  2CAI A;  3GN3 A;  3M3M A;  5ECK B;  1MD3 A;  2K9F A;  4KUN A;  5C04 A;  4DVC A;  4BVY A;  5GZZ B;  1GWC A;  12GS A;  1B8X A;  4ULX A;  3D4T A;  2JAC A;  3KXO A;  4J56 E;  4YH2 A;  1GSF A;  2CA8 A;  1FB0 A;  2HNL A;  1YF0 A;  3TCO A;  4OCE A;  5HR3 A;  2O89 A;  4O7H A;  3MAK A;  2GSQ A;  3SBC A;  1NHO A;  3VWW A;  6GSS A;  1S3A A;  1A0R P;  3QFA C;  2OBK A;  1JZW A;  4CHS A;  4FIW A;  2B5E A;  2HI7 A;  2WS2 A;  2BTO T;  5KN0 A;  2KOK A;  4EDZ A;  2LJK A;  2NDO A;  2VIM A;  4L0W A;  3KMO A;  2PUK C;  1O85 A;  4N0V A;  1ST9 A;  2GST A;  5DCG A;  1BJX A;  3R3E A;  2C8U A;  3PGT A;  4ZIJ A;  3EVI A;  4K7I A;  4WF4 A;  3L0H A;  2VOC A;  1Z7R A;  1Z9H A;  3G7Y A;  4MJC A;  4NWY A;  2OAD A;  1U3I A;  4KDY A;  1Z7P A;  2X4A A;  4IW9 A;  3TJB A;  1XPV A;  2DMM A;  1F2E A;  1TTZ A;  4FO5 A;  3F6F A;  1U6T A;  2EIO A;  2VLU A;  1V57 A;  4QMK A;  2F9S A;  4H86 A;  1TW9 A;  2OE0 A;  2R5G A;  2OA7 A;  2H1A A;  4F9Z A;  4JBB A;  3F6D A;  4QL9 A;  2I81 A;  1IYI A;  5IPH A;  3WD6 A;  2A2P A;  4MNN A;  3HY2 A;  5DAK A;  5ECS A;  3IDV A;  1SVO A;  2QKE A;  1DBY A;  2DLX A;  4MK3 A;  4KW6 A;  3I6A A;  3F0I A;  2EFH A;  1OKD A;  4WET A;  3KIJ A;  5G30 A;  3WGD A;  3H1N A;  2HRF A;  4ID0 A;  2RLI A;  3ZRE A;  2DJK A;  3LYK A;  4MZW A;  1T1V A;  2DIY A;  3VWV A;  2OBI A;  3RPN A;  4JR6 A;  3U6V A;  4ZB7 A;  4K5S A;  5DQS A;  5CRG A;  3J7Y b;  3O3T A;  3GA4 A;  3F8U A;  3GV1 A;  1PX6 A;  5IMC A;  2CVD A;  3KTL A;  2L59 A;  2X8G A;  4F2I A;  2ON7 A;  2P0G A;  4MF7 A;  3EMP A;  5KEJ A;  1Y25 A;  3KTB A;  1G6Y A;  4AKH A;  1AQW A;  2L4C A;  2DIZ A;  4K2D A;  1PN0 A;  3DKS A;  4PUA A;  2KLX A;  1G0T A;  4BPY A;  4MA9 A;  5KN1 A;  1PRX A;  1GSE A;  3US3 A;  1PL1 A;  1XCC A;  2FLS A;  3LWA A;  3FMW A;  1YZX A;  4DSQ A;  5IMF A;  2MMA A;  3HVX A;  3H93 A;  3W6G A;  3C1S A;  3DGQ A;  1XW6 A;  1XIY A;  5ECQ B;  5IMV A;  5EVO A;  2X8C A;  3U5R E;  4XS4 B;  1T7P B;  4MAB A;  2HRN A;  3WYW A;  1ABA A;  1BG1 A;  4YKF A;  4KE3 A;  4MP4 A;  1RW1 A;  4FQU A;  3N9J A;  4NHW A;  1XWG A;  3R2Q A;  3PPU A;  2F8F A;  3L9U A;  4IBP A;  4EIP A;  2X8H A;  2WGR A;  1OAZ A;  4KAE A;  2VCX A;  2O8V B;  2IJY A;  4TVE A;  1GP1 A;  1SK2 A;  1X9W B;  2WFC A;  5IOX A;  5COH A;  3WGX A;  4V2L A;  1O8X A;  1USB A;  2J23 A;  3QAW A;  3QFB C;  2O5V A;  4X1U A;  4O5R A;  1SEN A;  3BJ5 A;  3GYK A;  17GS A;  1AQX A;  1U88 A;  1SVM A;  4IVF A;  3UVT A;  5KN3 A;  4K2X A;  2EIQ A;  5F8B A;  1GLQ A;  5IQY A;  5J47 A;  1PGT A;  3GX8 A;  3Q74 A;  2N5F A;  3IK7 A;  2JSY A;  1GUH A;  5EPF A;  2E2G A;  1SJZ A;  4E68 A;  4TR1 B;  2QGV A;  2AHE A;  3EIN A;  5HFK A;  1H4O A;  3H4K A;  3CSJ A;  2YN1 A;  1TKD B;  3GKK A;  3N5O A;  2BMX A;  3I43 A;  4MZB A;  4KA0 A;  5A4W A;  1EGO A;  2Z9S A;  5JCG A;  1JZO A;  4AJ8 A;  2FGX A;  3UOM A;  3TKS C;  2H0G A;  2H19 A;  4OD7 A;  4XS4 A;  1EWX A;  5CRW A;  2OAC A;  2HSH A;  1E2Y A;  2VD1 A;  2VL2 C;  2V2G A;  4MDC A;  1WWJ A;  2FCH A;  2M80 A;  5LNK e;  1A0F A;  1B9Y C;  1WRY A;  1FG4 A;  1A8L A;  3IBH A;  4I2U A;  4GXZ A;  3FR6 A;  2K8V A;  4MLY A;  3IE3 A;  2GT5 A;  5IMZ A;  3A2W A;  4YAV A;  4KSO A;  1G7E A;  2L4Q A;  3FZ5 A;  3Q6O A;  4K7O A;  4PGT A;  1SJI A;  1ZZY A;  1F37 A;  5IPG A;  1A8Y A;  1GSU A;  1O81 A;  5F0G A;  4MMM A;  2WZ9 A;  3HVV A;  1GSY A;  2J9H A;  1GH2 A;  5A5K A;  5A5H B;  1A24 A;  1TRV A;  4EE0 A;  2RM6 A;  5J40 A;  2H1B A;  1N8J A;  1OC3 A;  3ERF A;  3F9U A;  3EUR A;  4KH7 A;  2NTO A;  2PVQ A;  1O7U A;  3QCP A;  1HNB A;  6GST A;  2IMF A;  1E6B A;  3VWU A;  4TR1 A;  1KEB A;  2GS3 A;  5HR1 A;  4GLT A;  5IOW A;  1GTU A;  4CW9 A;  4PQH A;  1IYH A;  5F07 A;  4OO4 A;  1THX A;  1TRU A;  1T00 A;  1ACV A;  2L57 A;  2O87 A;  2EFD A;  3HKR A;  4ZB8 A;  2XPD A;  1SYX A;  4WR5 A;  3UL3 A;  1Z3E A;  1PN9 A;  3DYR A;  5IIZ A;  5IMA A;  2OE3 A;  4ZL9 A;  1FO5 A;  1K0B A;  1DUG A;  4Q5N A;  1WIK A;  1WMJ A;  4HU9 A;  3KP8 A;  1YQ1 A;  4AI6 A;  1XWB A;  2GZP A;  4GQF A;  1Y6E A;  1DSB A;  4LL1 B;  1ZYQ B;  5AIV A;  2RUF A;  4IS0 A;  2MMZ A;  4EIQ A;  3LOR A;  3ZIV A;  2PER A;  1OC9 B;  3ZLP A;  4O92 A;  1CQH A;  1FVK A;  2DKI A;  2I3Y A;  4D73 B;  2LQO A;  2IMD A;  2FWG A;  2H73 A;  3TDG A;  2EIR A;  3QOU A;  1KTE A;  5ECM B;  3CTG A;  4BWS A;  1QQ2 A;  3DVW A;  1TRS A;  2L6D A;  1QK8 A;  2GDR A;  2FNO A;  5A5H A;  3G9B A;  4TXO B;  5DBQ A;  3TB2 A;  2B1L A;  3TOT A;  2YWI A;  4PNF A;  3BD2 A;  3HJO A;  1FOV A;  4OFT A;  1F9M A;  5J41 A;  3QD9 A;  4K0G A;  3VK9 A;  4BA7 A;  2HSM B;  3IC4 A;  1OVN A;  2B5X A;  3IHQ A;  4YQM A;  3VFI A;  5HQP A;  2V6K A;  1VRS D;  2B6M A;  2MBT A;  1JLW A;  3PR8 A;  5A4U A;  4HUA A;  4N10 A;  4EDY A;  2HZF A;  4RUV A;  4KCA A;  2YOI A;  4MH2 A;  1QUW A;  1G7O A;  1T3B A;  4AKG A;  5IM9 A;  2C3Q A;  1GNW A;  1BED A;  3TU3 B;  2N5A A;  3W8J A;  4TR4 A;  3KH9 A;  2H76 A;  5ID2 B;  2IME A;  1SD9 A;  2GZY A;  4OFN A;  2C4J A;  2ALB A;  1GTB A;  2H6Z A;  13GS A;  3GSS A;  2N5B A;  3GIX A;  2HXK A;  4Z2U A;  2VAF A;  4GF0 A;  1OC9 A;  3E9J B;  2H6X A;  3LYP A;  1XXU A;  4BL7 B;  3ZIT A;  3LG6 A;  5JWO B;  5DQY A;  4KB3 A;  1R5P A;  3HJM A;  2IN3 A;  3CYN A;  4WXT A;  5HR2 A;  3P2A A;  4ACS A;  3C8E A;  5AIX A;  2HLS A;  4YKG A;  4TXO A;  3HHV A;  4HJM A;  4V2M A;  5ECR B;  3LGC A;  4Q5R A;  2IIY A;  4J57 E;  1BX9 A;  2OKA A;  2LST A;  4K0N A;  4O5Q A;  4TR0 A;  1NSW A;  5G5E A;  2CVK A;  3GUR A;  1ERW A;  1T4Z A;  3L4N A;  3VUR A;  2DJ0 A;  3KZQ A;  4TW5 A;  3UMA A;  3NOF A;  2HSM A;  2H1L A;  2H0H A;  6GSU A;  1EOG A;  5IMD A;  2REM A;  3GTU A;  2XHF A;  4N11 A;  4AKI A;  3CMI A;  2G0F A;  1XVW A;  3HA9 A;  3RPP A;  2IL3 A;  2DSA A;  5ENU A;  1QXH A;  4FYC A;  4K8M A;  2QA2 A;  1URM A;  4L5L A;  2LTK A;  3UIW A;  3A5W A;  2R3X A;  4KX4 A;  2E2M A;  4HU7 A;  2MZC A;  3CSI A;  3VPT A;  1W89 A;  1MDJ A;  1GSD A;  4XTS A;  3WT1 A;  3W8S A;  14GS A;  4OWY A;  1GRX A;  1ERV A;  3UBK A;  4ISD A;  4TN8 A;  3HVS A;  2TIR A;  3ZYW A;  2LKU A;  5DDL A;  3ZFB A;  4BL7 A;  2A4V A;  1JZR A;  2E7P A;  4AKX B;  2QA1 A;  5ECO B;  3LEF A;  4O5U A;  4CDO A;  5ABR A;  4F0C A;  4MJE A;  5D9W A;  3KMN A;  3Q18 A;  2I9H A;  1EOH A;  3ME7 A;  5H5R A;  1SVL A;  2F51 A;  4ZL8 A;  1TU7 A;  2VCV A;  2VCW A;  1XW9 A;  4NXI A;  4GST A;  2LNS A;  1XBS A;  3ME8 A;  2VM1 A;  2YZH A;  5AN1 A;  1YVL A;  1RQM A;  1TXX A;  1ZOF A;  2H6Y A;  1V58 A;  4I97 A;  4F82 A;  3QAV A;  1EEJ A;  3DIE A;  4NMU A;  3HZ4 A;  3EMX A;  2P5Q A;  5G1K A;  3IPZ A;  4DSR A;  2M72 A;  4MJB A;  1J9B A;  3M1G A;  5GSS A;  1PSQ A;  4FYB A;  2B5Y A;  2C0G A;  3TKQ A;  1Y1U A;  4L5O A;  3DEX A;  2LUS A;  1AC1 A;  4W66 A;  5JCU A;  3MYD A;  3TKS E;  3L9V A;  4K5R A;  2G2Q A;  2ON5 A;  4AJ6 A;  1I5G A;  5LCZ A;  2LJR A;  5E59 A;  4KDX A;  6GSW A;  1QMV A;  5ECN B;  3CRU A;  3LFL A;  2QSI A;  5J5N A;  1YDK A;  1PX7 A;  4ZB9 A;  3DD3 A;  4LLR A;  4TKY A;  1KBN A;  4NV5 A;  5CYY A;  3D4M A;  1OC8 A;  5ECI B;  5A4V A;  2WCI A;  2HSN B;  3HYP A;  4IN0 A;  4JZQ A;  3EYT A;  1VGL A;  4KND A;  1H75 A;  2D2Z A;  5AGY A;  3HZ8 A;  4G0I A;  5GAP D;  5GST A;  3E3E A;  1HQO A;  1WOU A;  3I69 A;  2EC4 A;  1UC7 A;  5BRT A;  3TJK A;  3EWL A;  2DJJ A;  2C0D A;  1YKC A;  3A3T A;  4ZXG A;  1WPI A;  1ILO A;  5B8A A;  6GSV A;  2P5R A;  3TRQ A;  3GRX A;  3RHB A;  4CY6 A;  1TDI A;  4GRF A;  1SKS B;  4MPG A;  1XOB A;  1MD4 A;  2LS5 A;  1YEP A;  5IO2 A;  4GDF A;  3A2V A;  16GS A;  1GLP A;  1K0O A;  4PQI A;  1ZGN A;  2NVL A;  2HYX A;  5ECP B;  1SYR A;  1R26 A;  2IFQ B;  1MEK A;  1BG5 A;  2R0P A;  3IK9 A;  5CNW A;  1WJK A;  4GQC A;  2HSY A;  2B1K A;  3ISO A;  2GQL A;  1PQN A;  2IPA A;  3CBU A;  1U3A A;  3HMJ G;  1K0A A;  6GSX A;  2GVP A;  3TKP A;  2LRN A;  2CVB A;  1BYE A;  1FAA A;  2H72 A;  2LV3 A;  2YJ7 A;  4I6X A;  5D8I A;  4IEL A;  4MF5 A;  3KCM A;  3QMX A;  5G2Z A;  2HSN A;  1PMT A;  1A2M A;  1NHY A;  2JL4 A;  1ZMA A;  1MTC A;  2NPB A;  2VUP A;  4EO3 A;  3LW9 A;  1BF5 A;  2C80 A;  4HS1 A;  5A34 B;  4G19 A;  2DKH A;  5GAN D;  3QAG A;  3RAZ A;  3F4T A;  2JZR A;  2EFC A;  3EU4 A;  1G6W A;  1X0R A;  5ECL B;  5CRH A;  3HCZ A;  4XIH A;  2CX4 A;  2B7J A;  3TOU A;  2H71 A;  5CP1 A;  4IJI A;  5E4W A;  3FZ9 A;  3LJR A;  3GKN A;  2EFE A;  3ZTL A;  3IR4 A;  4LMV A;  3TGZ A;  2CAQ A;  1FHE A;  4CY8 A;  5HFG A;  2LQQ A;  3LQ7 A;  5JCW A;  3GL3 A;  4YAP A;  2LRT A;  2YV7 A;  1SD8 A;  1LU4 A;  5INY A;  4IJ3 A;  2IFQ A;  3C71 A;  3ZML A;  4JRR A;  2WUL A;  1MDI A;  3M9J A;  1M9A A;  3KH7 A;  2YWN A;  3SWL A;  3GL5 A;  2IMI A;  2K18 A;  1K3O A;  1EV9 A;  3RHC A;  4HI7 A;  3GUS A;  2UZ8 A;  5EY6 A;  4XS1 A;  1SKW B;  3GKX A;  1F3A A;  1GNE A;  4HQS A;  5LD0 A;  2PVO C;  3PIN A;  4X4J A;  4USS A;  1PKZ A;  3K8N A;  3GNJ A;  2VCZ A;  2VL3 A;  18GS A;  3QR6 A;  4TR3 A;  3H8Q A;  4G0L A;  3S9F A;  3WGE A;  2DJ2 A;  1K0M A;  5J9C A;  4GWR A;  4ILF A;  5A34 A;  3D0Z A;  2RM5 A;  4HDE A;  3F3R A;  2PWJ A;  2V1M A;  3ZVJ A;  2IWT A;  4EL1 A;  2CZ3 A;  2H0I A;  1VF1 A;  1ERT A;  3EU3 A;  4RI7 A;  2OJL A;  2DJ1 A;  3QDN A;  2GSR A;  7GSS A;  4Z7X A;  2R4V A;  2H1D A;  1R7H A;  3FHK A;  4J2F A;  3BCI A;  5ELA A;  3APS A;  2JZT A;  2MMO A;  3UBL A;  4EKZ A;  3VWX A;  2FA4 A;  3IAS 2;  3KGK A;  1X5C A;  1OE7 A;  2CZ2 A;  4YQU A;  2A4H A;  4ZBD A;  4ML6 A;  4ZL7 A;  2VCQ A;  4OCF A;  4LA1 A;  1VF4 A;  1V98 A;  2C3T A;  3UEM A;  1FW1 A;  2R0G A;  3PH9 A;  3H79 A;  4KCE A;  2RUE A;  2C3N A;  4ICY A;  2XBI A;  4PUF C;  1TU8 A;  3F3Q A;  4AF2 A;  5G31 A;  4WF5 A;  4ECC A;  1B48 A;  1GSS A;  1YEX A;  4ECI A;  1AUC A;  1ZYN A;  3L78 A;  2H70 A;  1ZYP A;  2VM2 A;  5D9T A;  3CWG A;  4O32 A;  4OFM A;  2VCT A;  3IRA A;  4G0K A;  3P7X A;  2GQK A;  2R2J A;  1ML6 A;  3ERW A;  3MDK A;  2RII A;  3GH9 A;  3M8N A;  1EZK A;  4TXV A;  4POB A;  2VL9 A;  1RK4 A;  2IMK A;  4D73 A;  2M46 A;  1AXD A;  19GS A;  3P8W A;  1M9B A;  1JZD A;  5J4U A;  2PU9 C;  2CQ9 A;  22GS A;  4KF9 A;  2XBQ A;  4V2N A;  2HZE B;  1FB6 A;  2DC5 A;  4Z2R A;  4I2T A;  2YWM A;  5B6M A;  4NHZ A;  3IHG A;  4IHU A;  1XOA A;  5CO3 A;  4LMW A;  1M7T A;  2PBJ A;  1T8E B;  1QGV A;  1F6M C;  1MDK A;  1FVJ A;  1YF1 A;  4DSS B;  1UN2 A;  3DML A;  3DWV A;  1TRW A;  4EF0 A;  1J0F A;  1HD2 A;  4WEY A;  5DAK B;  2A2R A;  1FOH A;  2R37 A;  3J7Y k;  5EL8 A;  3APQ A;  1A2J A;  2VD0 A;  3F63 A;  1ON4 A;  4X43 A;  1PA3 A;  1Z5Y E;  3ERG A;  3VI5 A;  1BQ7 A;  4EUY A;  4X0X A;  4HEA 2;  3GH6 A;  2H30 A;  4N3Z A;  5ID2 A;  1TJD A;  1B4P A;  2X49 A;  1SU9 A;  4A5P A;  3FW2 A;  1PL2 A;  5H5Q A;  5J4V A;  2VLT A;  2H8L A;  4HZ2 A;  4IGJ A;  4PX1 A;  2HT9 A;  1SJ6 A;  2LJA A;  2CT6 A;  3WT2 A;  1Z6N A;  1TOF A;  4XS6 A;  1GL8 A;  2YP6 A;  4G9H A;  3CTF A;  3MSZ A;  2KP2 A;  5G1L A;  5F05 A;  3VPQ A;  4TOP A;  4Q5Q A;  5D9X A;  3KEB A;  2MMN A;  3FZA A;  2DML A;  4KSM A;  1A23 A;  5HR0 A;  2JSZ A;  2C0E A;  2HZE A;  2P31 A;  2KP1 A;  2CV4 A;  3GMF A;  4IQ1 A;  3C73 A;  2R0C A;  4IP6 A;  3D21 A;  4PXO A;  4P3Y B;  1O6J A;  4RQR A;  4BVX B;  1BAY A;  1PD2 1;  2JZS A;  1XW5 A;  1O8W A;  2I4A A;  1B9X C;  4DSS A;  2GLR A;  1VF2 A;  3IC8 A;  1JHB A;  4AGS A;  5KN2 A;  4ZIL A;  2YJH A;  3LXZ A;  3ZZX A;  2VO4 A;  2V41 A;  1M2A A;  4MJA A;  4GSN A;  2X99 A;  2V32 A;  3IXR A;  4WR4 A;  4NAX A;  5DVB A;  2FHE A;  1TP9 A;  5CRE A;  2UV8 G;  6GSY A;  3APO A;  3NIV A;  4Z2T A;  1UVZ A;  10GS A;  3BCK A;  1EP7 A;  4E8E A;  1EEM A;  1KNG A;  5JWQ B;  3G7J A;  2WRT A;  2AB6 A;  1GUK A;  1Q4J A;  1V2A A;  1X5D A;  1SL0 B;  2C1Y A;  3OR5 A;  1GTA A;  1LBK A;  5A1N B;  2PMT A;  4K9Z A;  4QQ7 A;  1NM3 A;  3F4R A;  3ZFL A;  9GSS A;  1V9W A;  2MYG A;  4AJ7 A;  1AIU A;  1SK0 A;  3UVH A;  2K8S A;  3DRN A;  2FD3 A;  3UAR A;  3M9K A;  4G01 A;  2CX3 A;  4LL4 B;  2A2S A;  3TKS A;  4BVX A;  4I8B A;  3FRC A;  4Q5F A;  3O76 A;  2HRK B;  2PPT A;  1EP8 A;  2I1U A;  4OO5 A;  2OE1 A;  1EV4 A;  2WB9 A;  4JU5 A;  2VL2 A;  3G7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...