1GNEA

The three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
232
structure length
232
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMELDKWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Three-dimensional structure of Schistosoma japonicum glutathione S-transferase fused with a six-amino acid conserved neutralizing epitope of gp41 from HIV.
pubmed rcsb
source organism Synthetic construct
molecule tags Transferase
total genus 63
structure length 232
sequence length 232
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1994-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gneA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gneA01
2AUVA 2YANA 1AIUA 4YQUA 4GSTA 2FD3A 4NXIA 5ECSA 2IPAA 2VL2A 5HR1A 3CSIA 1W89A 2V2GA 3Q74A 4XIHA 2PU9C 3GKMA 4BVXA 4K0GA 4QL7A 3BCKA 1EEMA 2TRCP 4LMVA 2LJRA 2NVLA 4GQFA 3GL3A 3ZRDA 2JADA 2MMAA 1XWGA 5IMZA 1ZL9A 4P3YB 2CX3A 4POBA 2JSYA 2H30A 3J7Yb 2PBJA 1V40A 4HI7A 1BAYA 4F9ZA 4K7OA 1G6WA 4KNDA 3KP9A 5C04A 2XC2A 2XBIA 3M0FA 2CZ2A 4V1Ag 3HCZA 1B48A 4EE0A 5KN0A 5J9BA 2YNXA 1WWJA 1GNEA 2ALBA 1Z5YE 2WB9A 2H0GA 3FYGA 4ZB6A 1BX9A 3KH9A 3SWLA 4DSRA 4CW9A 1K0OA 1U3IA 1BG5A 3FZ4A 3HA9A 5J4UA 4KDXA 1C72A 2EIOA 1A2JA 2LRTA 4PUFC 5G31A 2Z9SA 2H6XA 1Y25A 3HYPA 5HFKA 1BEDA 2X8GA 1Z6NA 3US3A 1YEPA 5ECQB 1O6JA 5KN1A 1YKAA 5JCWA 4EDYA 4KGIA 1B9XC 2NPBA 1TW9A 2DC5A 2KHPA 4HS1A 4HU7A 5HFGA 5IO2A 1GLQA 2B3SA 4WEYA 1HNCA 4ULXA 3ZTLA 2N5FA 5J5NA 3ED3A 2HNLA 4MJBA 1SJ6A 4ZL8A 3NOFA 1M99A 2GLRA 4AJ6A 4DSQA 2FWHA 1V98A 4RI7A 2MBTA 5CRDA 2LJAA 1AQVA 4BVYB 2VCTA 19GSA 3ZIVA 2VLVA 2F8AA 2K8VA 2YJHA 1YY7A 5JWOB 1ZYQB 2ZUPA 2JZTA 4MLYA 4MCUA 3ZL5A 5F06A 1OYJA 3KZQA 3KXOA 1DE1A 2LRNA 3UVTA 4KF9A 5A4VA 3LXTA 4FYCA 3IRAA 1LBKA 2VO4A 2GQLA 4TOPA 2P5QA 5DQSA 4KX4A 5D73A 1F3BA 1A0FA 2PMTA 2HFDA 5B6MA 5ECLB 3QFAC 7GSSA 2B6MA 2HXKA 1T7PB 1ON4A 1ZOFA 3RPNA 2P0GA 4O32A 3I6AA 2YZUA 1EEJA 1CQHA 3LWAA 3GKNA 2LNSA 4OFTA 3MAKA 2FA8A 3EMPA 4BWSA 1DE2A 3ISOA 6GSXA 3IC4A 1N8JA 1WRYA 2L6DA 2LQOA 4K0NA 1I5GA 9GSSA 3QAWA 4POMA 3F9UA 3GYKA 1GSSA 5LD0A 1SKSB 5IIZA 3D22A 2CVKA 4BWQA 1MTCA 5G1KA 2M46A 4YQMA 2YWIA 2VIMA 1TI1A 3TGZA 3VWWA 3IDVA 2I9HA 4NV5A 2YOIA 4GLTA 2OJLA 3GV1A 4N0ZA 3TKPA 3Q18A 2H6ZA 5KN3A 5J3RA 2GDRA 2YZHA 3I69A 2VD0A 4JEDA 1S3CA 1OC9B 3GL5A 4TR0A 3GURA 3TCOA 2MYGA 1VRSD 5DDLA 4GF0A 3TUEA 1O8WA 2PERA 1TI3A 1O73A 2IMKA 2B5YA 2XBQA 1K3YA 1G0TA 4PXOA 1GTBA 2WDUA 2DJKA 3IE3A 2TIRA 14GSA 4IN0A 2IMEA 4WBRD 4F03A 2WRTA 1X5DA 1XOBA 5HQPA 1MD3A 2NDOA 4DVCA 5FWGA 1SL1B 1WP0A 4IELA 8GSSA 4L8EA 2LNTA 5CRWA 2RM5A 2C80A 2I3YA 1LU4A 1AXDA 3HVXA 3G7YA 1U87A 5G2ZA 3GSTA 3GTUB 20GSA 5AGYA 1QGVA 1W4VA 2XPEA 2HRNA 3LYPA 4HUAA 3MNGA 4Z7XA 3BBYA 1U3AA 5DAKB 3P8WA 1XXUA 1KTEA 3QCPA 4G19A 16GSA 3DWVA 3GX8A 1CQGA 2FCHA 5ELGA 1T4ZA 2GSRA 1GL8A 3FEUA 2JL4A 4E8EA 2DJ1A 1XWKA 1ERWA 4G0LA 2E2MA 4X0XA 4ECJA 5AIVA 2ON5A 3DEXA 5G1LA 6GSUA 4HQSA 4XRDA 1KNGA 1B4PA 2HRFA 1XBSA 2CAIA 1FOVA 4TXOB 1UA5A 1OE7A 4XS4B 2F9SA 4GSNA 3FZAA 2R2JA 3ZIJA 4TN8A 2FUG2 5ID2B 2YN1A 1AAZA 2P31A 2VCZA 3VFIA 2V6KA 3E0UA 4EF0A 5EL8A 5GAND 4HZ4A 3FRCA 1GSDA 4WETA 1DUGA 5JCUA 5ECPB 2GT5A 2NTOA 4MH3A 4OCEA 1TRSA 5ECMB 5D93A 1M0UA 4MMMA 1QQ2A 2JSZA 4MABA 5ABRA 3DIEA 3KD0A 3HZ8A 4BPYA 3UIWA 3TOTA 2FA4A 2GS3A 3IXRA 4ID0A 4IVFA 5F07A 2GSQA 4TR1A 2EIRA 4LA1A 5L71A 2N5BA 3UBKA 3QPMA 1HQOA 2HSMA 3G7IA 5GSSA 2AAWA 4IJIA 11GSA 4D73B 2H1DA 3IHQA 4CDOA 3L9VA 4PX1A 1A24A 1AQXA 4LL4B 3EE2A 3CSHA 3C71A 4JR6A 3VPQA 4YAPA 4I2UA 4NHZA 3OR5A 2WS2A 3H1NA 3IPZA 4OO4A 1V57A 2L5LA 4HOJA 4PQHA 1BQ7A 4WF5A 2VCVA 3ZITA 4L0UA 4ML6A 1V9WA 2ZNMA 5D9VA 4G0KA 2CAQA 4ECCA 3EU3A 1GWCA 2HZFA 3TDGA 4RQXA 3LEFA 1MDIA 2FNOA 1GULA 2YWMA 3QD9A 1SENA 2GZYA 4FYBA 1RW1A 5AIXA 1XWCA 1U6TA 2IMDA 1H75A 3TRPA 2WULA 3GTUA 2X99A 2HRAA 4MDCA 4XS1A 4N10A 3FHKA 3HJOA 3ERGA 3ZMLA 3E9JB 3IBHA 3QOUA 4PURA 1TOFA 4GQCA 4IJ3A 3BD2A 10GSA 4PQ1A 3DVWA 2E7PA 3GUSA 3ME8A 1NM3A 1FAAA 2A2SA 2PPTA 4NAXA 3JCML 4KW6A 3APQA 4FO5A 4X1UA 3ZYWA 4CHSA 3QMXA 1YEXA 3TJFA 1KBNA 5HR2A 1URMA 5DBQA 1F2EA 5G5FA 4XS4A 3SBCA 1THXA 3BJ5A 3EINA 2F8FA 1QUWA 2P5RA 3RDWA 2H19A 1Z9HA 1XCCA 6GSTA 2VCXA 2C8UA 5IPGA 4WBJA 3FR3A 1HYUA 5GZZB 1GUMA 1R5PA 5EPFA 3TKRA 4IP6A 4OWYA 4GXZA 1S3DA 3FZ9A 4MF5A 22GSA 1XVWA 1ZGNA 2HSYA 3NZNA 1R5AA 2XPDA 2PVQA 1GNWA 4ZBAA 3QR6A 2R5GA 4NWYA 3WT2A 4PTSA 1EGOA 2FWGA 5C00A 4EXJA 3WGEA 2HQTA 1IYIA 1MDJA 1YF1A 4FIWA 1SKRB 1TTZA 4ZL7A 2H75A 3D21A 1M9BA 1PX6A 2PVOC 1XVQA 5IMDA 3KTLA 4KA0A 3DXBA 3TKQA 1F3AA 3WGDA 2GQMA 2D2ZA 1X0RA 4ECIA 1DSBA 2JZSA 2HZEA 5D9TA 4Q5QA 3WGXA 5JWRB 4EL1A 3UJ1A 1ZYEA 3DD3A 2KLXA 2J23A 1USBA 2X8HA 3ZVJA 2MMOA 2VCWA 1A8YA 1B8XA 2DJ0A 5DALB 2V1MA 2BJXA 4TRXA 4I8BA 4ZIJA 2YV9A 2AYTA 4RQRA 3F6DA 4N11A 3L0HA 4HQZA 3F8UA 4DSSB 4TXVA 4TW5A 3IAM2 2IFQA 2X8CA 5D9WA 4V2LA 1TK5B 4MPFA 3A2VA 3LFLA 2R6KA 1K3OA 1TDIA 1M2AA 3F6FA 5IM9A 4V2NA 1AUCA 4O5RA 1QXHA 4TR4A 2YP6A 2H76A 1ML6A 1XPVA 4NV2A 3KH7A 4YH2A 1E2YA 4ZBBA 1O7UA 1XW5A 2MMZA 1A2MA 2C0GA 3KGKA 2DMLA 1ST9A 3VLNA 1GSYA 3TJGA 3PGTA 3UOMA 2H74A 5IMFA 3GSSA 4KSOA 2CV4A 1J08A 3GFKA 4K7NA 1SL2B 2H1BA 2E2GA 2HRKB 3EWLA 1SYRA 3ZFLA 3DYRA 1V58A 2XHFA 1A8LA 2QC7A 4POKA 1QFNA 3D4TA 4MZBA 1R7HA 4MJEA 3KTBA 4ZL9A 2FHEA 3VPTA 5CAXA 2F51A 2G0FA 4KUNA 3C7MA 3KM6A 3C73A 1PKWA 3ERWA 4MF7A 4KH7A 3LXZA 3KEBA 5A4UA 3A2WA 5IMAA 4HU9A 2KOKA 4OD7A 4N30A 4GRFA 3TRQA 2OKAA 5DCGA 4KCAA 4KCEA 4O7HA 5J41A 1JZRA 3RAZA 1JLVA 1SU9A 1M7TA 2YWNA 1X9MB 2I81A 1WPIA 3A5WA 1T4YA 2B1LA 3D6IA 1K0DA 3RHBA 5CYYA 4EKZA 1LJRA 3WD6A 2PUKC 3FR9A 5B8BA 3K8NA 1JFUA 4PUAA 2UZ8A 4EC0A 4G0IA 2K18A 5DQYA 3IK9A 3TRXA 4ECBA 5CREA 3TKSE 3IA1A 5ECIB 5CP1A 4OFNA 4IQ1A 3D5JA 2IL3A 4RI6A 1UN2A 4HJMA 1TRUA 2DJ2A 3GKXA 5ECNB 2DSAA 4MZWA 4G2EA 4AJ7A 5DALA 5A4WA 1M9AA 5LNKe 3D4MA 5B7CA 1PA3A 3CTGA 1F37A 1T8EB 3GX0A 2LUSA 5COHA 17GSA 1YZXA 1XWAA 4BVYA 5KEJA 1E6BA 4IHUA 1GRXA 4BL7B 5G5EA 3EMXA 5F05A 2LEGA 1QMVA 1TRVA 3F4RA 3R2QA 3DVXA 3I43A 1SYXA 2JACA 2VOCA 4MK3A 3P7XA 3APSA 4KDUA 2V32A 2GZPA 2OA7A 5EVOA 3M9KA 2GZZA 3C8EA 4BVXB 2L4CA 4GCIA 4JZQA 1G6YA 3L9UA 1TK8B 1XOAA 5AN1A 1ACVA 3LYKA 4BA7A 1FO5A 1AQWA 2EC4A 2VL9A 1EZKA 3GMFA 1ZMAA 4IQAA 1T1VA 1SK2A 5IOXA 2MMNA 3MDKA 18GSA 4ZILA 4ZB8A 4L0WA 4TVEA 3TKSC 3LSZA 1O81A 3HVSA 2C3NA 3IAS2 2OE3A 3KP8A 4F82A 2I1UA 1GP1A 4HDEA 4F2IA 2FWFA 3VWUA 3VURA 2A4VA 3KIJA 3LQ7A 4PGTA 1UC7A 2RIIA 2WFCA 3FY7A 2OADA 2VCQA 2J9HA 3D0ZA 2H01A 2B5XA 3FW2A 4NMUA 4Q5RA 3QAGA 3DMLA 3CSJA 3G9BA 2AB6A 2VUPA 1JLWA 3ZLPA 3HXSA 1FG4A 2DJJA 2EIQA 3M9JA 3A2XA 5ECHB 4AF2A 4V2MA 3DRNA 2QKEA 2OE0A 4DEJA 3ZFBA 3MWHA 4QL9A 2IIYA 1V2AA 1OC9A 4JBBA 1PN9A 1GTAA 5ECKB 1K0CA 3LG6A 1A23A 5A5KA 4HZ2A 1Z6MA 4Q5NA 1K3LA 4KAEA 2CX4A 4IW9A 12GSA 4EVMA 4K1FA 5E4WA 4ZXGA 3HJMA 3TJKA 5IMCA 4Q5FA 2IJYA 2A2RA 4WF4A 4KB3A 4OFMA 3GN3A 4GWRA 3FZ5A 1TRWA 3CYNA 1KEBA 3UBLA 4AGSA 4MA9A 4K7IA 1JZWA 4LLRA 5IQYA 1NHOA 1TU7A 2CVDA 4HJ2A 4I2TA 5GAPD 5DAKA 2PGTA 3F0IA 5E59A 1DBYA 3EYTA 2L59A 3M3MA 2OBKA 1GSFA 4MJCA 2IN3A 2K8SA 1YQ1A 1Y6EA 3LJRA 2QGVA 6GSYA 2YWOA 3EVIA 2OACA 1MEKA 1X5EA 1XW9A 5H5QA 1K0MA 3MSZA 2V41A 1EGRA 1N2AA 1K0BA 5ELAA 1GH2A 1SK1A 2CQ9A 2YCDA 1THOA 4TXOA 1FVKA 1Q4JA 1OKTA 4ML1A 2AV4A 4MP4A 5ID2A 1VF4A 3HKRA 1ILOA 3UMAA 5IOWA 2B5EA 1EV9A 1GSQA 3QFBC 3TJBA 4WKWA 1T3BA 1YF0A 2DLXA 3GH6A 2B7KA 3TB2A 1WE0A 2H0IA 2ES7A 3H4KA 4PNGA 5CO3A 3O3TA 3WYWA 2M80A 3HD5A 2H72A 3PH9A 3UAPA 1SJZA 3HZ4A 1X9SB 4KSMA 1SKWB 1MD4A 3RPPA 2VL2C 1ABAA 3HHVA 2NBSA 4V1Ap 2VAFA 2H6YA 2ZCTA 3TJJA 3W8SA 3PR8A 1GSEA 3IOSA 3KJYA 2HLSA 1OC3A 1GSUA 3C1SA 3NIVA 1WIKA 2JZRA 1TJDA 3F3QA 1EOGA 1XW6A 5G30A 2CVBA 1X9WB 2REMA 2IMFA 4D73A 2CT6A 4MZCA 2K9FA 2C0DA 3IC8A 3GHAA 3ZMKA 5B8AA 3CRUA 2LSTA 2C4JA 4E8HA 2H70A 2HE3A 2OBIA 4G9HA 3M1GA 4ACSA 2I4AA 1TK0B 2AHEA 1Q98A 5HR3A 1AW9A 2O87A 5ENUA 3FR6A 2L57A 2BMXA 1GUKA 3CBUA 4EDZA 4FYUA 2X64A 2LRCA 3IR4A 2PN8A 2YPMA 3ZZXA 1J0FA 3VK9A 1SD8A 4JE1A 4J2FA 2C0FA 3F63A 1PKZA 2DBCA 4MJAA 5F0GA 3DKSA 2QSIA 2RLIA 1WOUA 3CMIA 1EOHA 1XFLA 1BJXA 1FVJA 4TR3A 3H93A 1PX7A 1HD2A 5H5SA 2CA8A 4GSSA 5HR0A 2WJUA 2GSSA 1S3AA 1JZDA 2G2QA 1EP7A 3L4NA 3DGQA 2FLSA 3CXGA 3VI5A 2LTKA 13GSA 4PQIA 4MH2A 3EC3A 3U5RE 1Z3EA 4XS6A 4X43A 5DJLA 6GSVA 1O85A 2GT6A 4HEA2 1VGLA 1GLPA 1M2BA 2FY6A 1NHYA 5IPHA 2R3XA 1GTIA 3CTFA 4O92A 3I9V2 3LORA 2WGRA 3KCMA 3N9JA 3J7Yk 3O6TA 4G10A 1PL2A 2LKUA 6GSSA 1XWBA 4N0VA 2H66A 3GKKA 3WT1A 4XCSA 2HYXA 1NSWA 2VM1A 2WCIA 2C3QA 1O8XA 4WXTA 2B7JA 3S9FA 4AJ8A 2VD1A 1ERTA 1ERUA 3O76A 4USSA 4WR5A 5DJMA 1PGTA 2F3MA 1A0RP 1K0AA 5ECRB 2RUFA 4TR1B 1ZCPA 4JR4A 2R37A 1SD9A 3FKFA 4K2DA 2C3TA 1EWXA 2YJ7A 2HSMB 1OE8A 5D8IA 2LS5A 1QK8A 2HT9A 4OCFA 2DIZA 3TOUA 1H4OA 1UVZA 2VM2A 1B4QA 2CZ3A 4IKHA 4KDYA 2H1AA 3L9SA 2AJQB 2KP1A 1WJKA 1OVNA 5GSTA 3IV4A 4JU5A 2VLTA 3GH9A 1YDKA 4MF6A 4TKYA 3ERFA 1X5CA 1FHEA 4OMVA 5IMVA 5KN2A 3GRXA 3C1RA 1TU8A 5CRHA 1ZZYA 2N5AA 3AY8A 2HI7A 3EU4A 1VF1A 1TXXA 4NHWA 1NW2A 3F4SA 2LQQA 2BTOT 4FH8A 4IBPA 2DIYA 1YKCA 2K6VA 3PINA 2H8LA 5D96A 1PMTA 4LMWA 3P2AA 3VWVA 3E3EA 3UVHA 3KMOA 1PD21 5ECOB 2R4VA 4WR4A 2VLUA 1Z7PA 2KP2A 1VF3A 3LGCA 2IWTA 2L4QA 1XZOA 3G7JA 3HVVA 4ISDA 4ILFA 1PQNA 2GGTA 3H79A 1J9BA 4LL1B 1A2LA 1RQMA 6GSWA 3U6VA 5CRGA 2DMMA 5JWQB 4XTSA 3W6GA 3APOA 4DSSA 5IO0A 1SJIA 4JRRA 1AC1A 1T00A 4KE3A 1RK4A 4K6XA 1OKDA 1R4WA 3TKSA 4I5QA 1SK0A 2OE1A 1MDKA 2GTUA 1YJ6A 2GVPA 2PWJA 4YAVA 1GTUA 2YV7A 5BMUA 2VL3A 2KUCA 4RUVA 2V6OA 3GIXA 1IYHA 5D9XA 3R3EA 4MPGA 1FB0A 3F4TA 4I6XA 5F8BA 3H8QA 2RM6A 1XIYA 1PSQA 4POLA 5J9CA 1M2DA 3CRTA 4XHMA 1F6MC 3A3TA 2H71A 5JCGA 2C1YA 4K9ZA 4K8MA 3Q6OA 2GQKA 2HRKA 3M8NA 1TP9A 4H86A 1TKDB 2H73A 2O85A 4YQVA 1SL0B 5HFIA 2LV3A 2O89A 3QDNA 1R26A 3HJPA 1I9DA 3ZREA 2E0QA 3VI7A 3IK7A 2HSNB 2JU5A 2ON7A 1F9MA 3QAVA 4ZB9A 4F0CA 1HNBA 2IMIA 5CNWA 2TRXA 4FQUA 2GSTA 4GTUA 5B6NA 4EUYA 3UARA 3F3RA 1PL1A 3P90A 3HDCA 4J56E 2B1KA 3Q19A 2MZCA 3N5OA 3W8JA 3UEMA 3ME7A 2HZEB 2FWEA 1JHBA 2L5OA 3PPUA 3RBTA 1FB6A 2HSHA 2M72A 4EO3A 2L6CA 4L5OA 5FHIA 3VWXA 2RUEA 4QQ7A 1WMJA 2MBSA 1EP8A 2H0HA 1VF2A 4PNFA 1BYEA 1FW1A 4IS0A 3BCIA 4L5LA 3UL3A 2H1GA 2LJKA 3GA4A 3GNJA 4ZBDA 5DCHA 4F0BA 2DJ3A 1OC8A 5FT3A 2FGXA 5AISA 4J57E 4NPBA 5DVBA 4IP1A 3V1WA 1Z7RA 1PRXA 1HNAA 1JZOA 2IFQB 3ZVJD 4IGJA 1ERVA 1GUHA 3BOAA 3RHCA 5INYA 1K0NA 1G7EA 5EY6A 2WZ9A 1U88A 4OO5A 5H5RA 3FK8A 4XRAA 1G7OA 3KMNA 3L78A 1EV4A 1B9YC 4I97A 3HY2A 2O8VB 5LCZA 1OAZA 2C0EA 4BL7A 3EURA 2O7KA
chains in the Genus database with same CATH superfamily
2AUVA 2YANA 1AIUA 4YQUA 4GSTA 2FD3A 4NXIA 5ECSA 2IPAA 2VL2A 5HR1A 3CSIA 1W89A 2V2GA 5A1NB 3Q74A 4XIHA 2PU9C 3GKMA 4BVXA 4K0GA 4QL7A 3BCKA 1EEMA 2TRCP 4LMVA 2LJRA 2NVLA 4GQFA 3GL3A 3ZRDA 4E68A 2JADA 2MMAA 1PN0A 1XWGA 5IMZA 2WVYA 1ZL9A 4P3YB 2CX3A 4POBA 2JSYA 2H30A 3J7Yb 2PBJA 1V40A 4HI7A 1BAYA 4F9ZA 4K7OA 1G6WA 4KNDA 3KP9A 5C04A 2XC2A 2XBIA 3M0FA 2CZ2A 4V1Ag 3A5IA 3HCZA 1B48A 4EE0A 5KN0A 4AKIA 5J9BA 2YNXA 1WWJA 1GNEA 2ALBA 1Z5YE 2WB9A 2H0GA 3FYGA 4ZB6A 1BX9A 3KH9A 3SWLA 4DSRA 4CW9A 1K0OA 1U3IA 1BG5A 3FZ4A 3HA9A 5J4UA 4KDXA 1C72A 2EIOA 1A2JA 2LRTA 4PUFC 5G31A 2Z9SA 2H6XA 1FOHA 1Y25A 3HYPA 5HFKA 1BEDA 2X8GA 1Z6NA 3US3A 1YEPA 5ECQB 1O6JA 5KN1A 1YKAA 5JCWA 4EDYA 4KGIA 1B9XC 2NPBA 1TW9A 2DC5A 2KHPA 4HS1A 4HU7A 5HFGA 5IO2A 1GLQA 2B3SA 4WEYA 1HNCA 4ULXA 3ZTLA 2N5FA 5J5NA 3ED3A 2HNLA 4MJBA 2VKZG 1SJ6A 4ZL8A 2O36A 3NOFA 1M99A 2GLRA 4AJ6A 4DSQA 2FWHA 1Y1UA 1V98A 4RI7A 2MBTA 5CRDA 2LJAA 1AQVA 1SVMA 4BVYB 2VCTA 19GSA 3ZIVA 2VLVA 2F8AA 2K8VA 2YJHA 1YY7A 5JWOB 1ZYQB 2ZUPA 2JZTA 4MLYA 4MCUA 3ZL5A 5F06A 1OYJA 3KZQA 3KXOA 2R0PA 1DE1A 2LRNA 3UVTA 4KF9A 5A4VA 3LXTA 4FYCA 3IRAA 1LBKA 2VO4A 2GQLA 4TOPA 2P5QA 5DQSA 4KX4A 5D73A 1F3BA 1A0FA 2PMTA 2HFDA 5B6MA 5ECLB 3QFAC 7GSSA 2B6MA 2HXKA 1T7PB 1ON4A 1ZOFA 3RPNA 2P0GA 4O32A 3I6AA 2YZUA 1EEJA 1CQHA 2EFDA 3LWAA 3GKNA 2LNSA 2WVXA 4OFTA 3MAKA 2FA8A 3EMPA 4BWSA 1DE2A 2EFEA 3ISOA 6GSXA 1PFOA 3IC4A 1N8JA 1WRYA 2L6DA 2LQOA 4K0NA 1I5GA 9GSSA 4MNNA 3QAWA 4POMA 3GYKA 3F9UA 1GSSA 1S4BP 5LD0A 1SKSB 5IIZA 3D22A 2CVKA 4BWQA 1MTCA 5G1KA 2M46A 4YQMA 2YWIA 2VIMA 1TI1A 3IHGA 3TGZA 3VWWA 3IDVA 2I9HA 4NV5A 2YOIA 4GLTA 2OJLA 3GV1A 4N0ZA 3TKPA 3Q18A 2H6ZA 5KN3A 5J3RA 2GDRA 2YZHA 2X4AA 3I69A 2VD0A 4JEDA 1S3CA 1OC9B 3GL5A 4TR0A 3GURA 3TCOA 2MYGA 3RFRC 1VRSD 5DDLA 4GF0A 3TUEA 1O8WA 2PERA 1TI3A 1O73A 2IMKA 2B5YA 2XBQA 1K3YA 1G0TA 4PXOA 1GTBA 2WDUA 2DJKA 3IE3A 2TIRA 14GSA 4IN0A 2IMEA 4WBRD 4F03A 2WRTA 1X5DA 1XOBA 5HQPA 1MD3A 2NDOA 4DVCA 5FWGA 1SL1B 1WP0A 4IELA 8GSSA 4L8EA 2LNTA 5CRWA 3CHXC 2RM5A 2C80A 2I3YA 1LU4A 1AXDA 3HVXA 3G7YA 1U87A 5G2ZA 3GSTA 3GTUB 20GSA 5AGYA 1QGVA 1W4VA 2XPEA 2HRNA 3LYPA 4HUAA 4K2XA 3MNGA 4Z7XA 3BBYA 4AI6A 1U3AA 5DAKB 3P8WA 1XXUA 1KTEA 3QCPA 4G19A 16GSA 3DWVA 3GX8A 1CQGA 4EIQA 2FCHA 4ICYA 5ELGA 1T4ZA 2GSRA 1GL8A 3FEUA 2JL4A 4E8EA 2DJ1A 1XWKA 1ERWA 4G0LA 2E2MA 4X0XA 4O5UA 4ECJA 5KOXA 5AIVA 2ON5A 3DEXA 5G1LA 6GSUA 4HQSA 4XRDA 1KNGA 1B4PA 2HRFA 1XBSA 2CAIA 1FOVA 4TXOB 1UA5A 1OE7A 4XS4B 2F9SA 4GSNA 3FZAA 2R2JA 3ZIJA 4TN8A 2FUG2 5ID2B 2YN1A 1M3JA 1AAZA 2P31A 2VCZA 3VFIA 2V6KA 3E0UA 4EF0A 5EL8A 5GAND 4HZ4A 3FRCA 1GSDA 4WETA 1DUGA 5JCUA 5ECPB 2GT5A 2NTOA 4MH3A 4OCEA 1TRSA 5ECMB 5D93A 1M0UA 4MMMA 1QQ2A 2JSZA 4MABA 5ABRA 3DIEA 3KD0A 3HZ8A 4BPYA 3UIWA 3TOTA 2FA4A 2GS3A 3IXRA 4ID0A 4IVFA 5F07A 2GSQA 4TR1A 2EIRA 4LA1A 5L71A 1YEWC 2N5BA 3UBKA 3QPMA 1HQOA 2HSMA 3G7IA 5GSSA 2AAWA 4IJIA 11GSA 4D73B 2H1DA 3IHQA 4CDOA 3L9VA 4PX1A 1A24A 1AQXA 3RGBC 3EE2A 4LL4B 3CSHA 3C71A 4JR6A 2WVZA 3VPQA 4YAPA 4I2UA 4NHZA 3OR5A 2WS2A 3H1NA 3IPZA 4OO4A 1V57A 2L5LA 4HOJA 4PQHA 1BQ7A 4WF5A 2VCVA 3ZITA 4L0UA 4ML6A 1V9WA 2ZNMA 5D9VA 4G0KA 2CAQA 4ECCA 3EU3A 1GWCA 2HZFA 3TDGA 4RQXA 3LEFA 1MDIA 2FNOA 1GULA 2YWMA 3QD9A 1SENA 2GZYA 4FYBA 1RW1A 5AIXA 1XWCA 1U6TA 2IMDA 3MIXA 1H75A 3TRPA 5A5HB 2WULA 3GTUA 2X99A 2HRAA 4MDCA 4XS1A 4N10A 3FHKA 3HJOA 3ERGA 3ZMLA 3E9JB 3IBHA 4A5PA 3QOUA 4PURA 1TOFA 4GQCA 4IJ3A 3BD2A 10GSA 4PQ1A 3DVWA 2E7PA 3GUSA 3ME8A 1NM3A 1FAAA 2A2SA 2PPTA 4NAXA 3JCML 4KW6A 3APQA 4FO5A 4X1UA 3ZYWA 3TU3B 4CHSA 3QMXA 1YEXA 3TJFA 1KBNA 5HR2A 1URMA 4Z2TA 5DBQA 1F2EA 5G5FA 4XS4A 3SBCA 4BIKA 1SVOA 1THXA 3BJ5A 5A34A 3EINA 2F8FA 1QUWA 4N3ZA 2P5RA 3RDWA 2H19A 1Z9HA 1XCCA 6GSTA 2VCXA 2C8UA 5IPGA 4WBJA 3FR3A 1HYUA 5GZZB 1GUMA 1R5PA 5EPFA 3TKRA 4IP6A 4OWYA 4GXZA 1S3DA 3FZ9A 4MF5A 22GSA 1XVWA 1ZGNA 2HSYA 4GDFA 3NZNA 1R5AA 2XPDA 2PVQA 1GNWA 4ZBAA 3QR6A 2R5GA 4NWYA 3WT2A 2O5VA 4PTSA 1EGOA 2FWGA 5C00A 4EXJA 3WGEA 2HSNA 2HQTA 1IYIA 1MDJA 1YF1A 4FIWA 1SKRB 1TTZA 4ZL7A 2H75A 3D21A 1M9BA 1PX6A 2PVOC 1XVQA 5IMDA 3KTLA 4KA0A 3DXBA 3TKQA 1F3AA 3WGDA 2GQMA 2D2ZA 1X0RA 5KOWA 4ECIA 1DSBA 4W66A 2JZSA 2HZEA 5D9TA 4Q5QA 3WGXA 5JWRB 4EL1A 3UJ1A 4AKHA 1ZYEA 3DD3A 2KLXA 3HVNA 2O3EA 2J23A 1USBA 2X49A 2X8HA 3ZVJA 2MMOA 2VCWA 4CY8A 1A8YA 1B8XA 2DJ0A 5DALB 2V1MA 2BJXA 4TRXA 4I8BA 4ZIJA 2YV9A 2AYTA 4RQRA 3F6DA 4N11A 3L0HA 4HQZA 3F8UA 4DSSB 1SVLA 4TXVA 4TW5A 3IAM2 2IFQA 2X8CA 5D9WA 1TXUA 4V2LA 1TK5B 4MPFA 3A2VA 3LFLA 2R6KA 1K3OA 1TDIA 1M2AA 3F6FA 5IM9A 4V2NA 5BMUB 1AUCA 4O5RA 1QXHA 4TR4A 2YP6A 2H76A 1ML6A 1XPVA 4NV2A 3KH7A 4YH2A 1E2YA 4ZBBA 1O7UA 1XW5A 2MMZA 1A2MA 2C0GA 3KGKA 2DMLA 5A1NA 1ST9A 3VLNA 4CY6A 1GSYA 3TJGA 3PGTA 3UOMA 2H74A 5IMFA 3GSSA 4KSOA 2CV4A 1J08A 3GFKA 4K7NA 1SL2B 4O5QA 3MYDA 2H1BA 2E2GA 2HRKB 3EWLA 1SYRA 3ZFLA 3DYRA 1V58A 2XHFA 1A8LA 2QC7A 4POKA 1ZYPA 3LW9A 1QFNA 2QA2A 3D4TA 4MZBA 1R7HA 4MJEA 3KTBA 4ZL9A 2FHEA 3VPTA 5CAXA 2F51A 2G0FA 4KUNA 3C7MA 3KM6A 3C73A 1PKWA 1N25A 3ERWA 4MF7A 4KH7A 3LXZA 3KEBA 5A4UA 3A2WA 5IMAA 1BG1A 4HU9A 2KOKA 4OD7A 4N30A 4GRFA 3TRQA 2OKAA 5DCGA 4KCAA 4KCEA 4Z2UA 4O7HA 5J41A 1JZRA 3RAZA 1JLVA 1SU9A 1M7TA 2YWNA 1X9MB 2I81A 1WPIA 3A5WA 1T4YA 2B1LA 3D6IA 1K0DA 3RHBA 5CYYA 2DKIA 4EKZA 1LJRA 3WD6A 2PUKC 3FR9A 5B8BA 3K8NA 1JFUA 4PUAA 2UZ8A 4EC0A 4G0IA 2K18A 5DQYA 3IK9A 3TRXA 4ECBA 5CREA 3TKSE 3IA1A 1XG8A 5ECIB 5CP1A 4OFNA 4IQ1A 3D5JA 1S3RA 2IL3A 4RI6A 1UN2A 4HJMA 1TRUA 2DJ2A 1YVLA 3GKXA 5ECNB 2DSAA 4MZWA 4G2EA 4AJ7A 5DALA 5A4WA 1M9AA 5LNKe 3D4MA 5B7CA 1PA3A 3CTGA 1F37A 1T8EB 3GX0A 2LUSA 5COHA 17GSA 1YZXA 1XWAA 4BVYA 5KEJA 1E6BA 4IHUA 1GRXA 4BL7B 5G5EA 3EMXA 5F05A 2LEGA 1QMVA 1TRVA 2UV8G 3F4RA 3R2QA 3DVXA 3I43A 1SYXA 2JACA 2VOCA 4MK3A 3P7XA 3APSA 4KDUA 2V32A 2GZPA 2OA7A 5EVOA 3M9KA 2GZZA 3C8EA 4BVXB 2L4CA 4GCIA 4JZQA 1G6YA 3L9UA 2R0CA 1TK8B 1XOAA 3FMWA 5AN1A 1ACVA 3LYKA 4BA7A 1FO5A 1AQWA 2EC4A 2VL9A 4Z2RA 1EZKA 3GMFA 1ZMAA 4IQAA 1T1VA 1SK2A 5IOXA 2WW2A 3MDKA 2MMNA 18GSA 4ZILA 4ZB8A 4L0WA 4TVEA 3TKSC 3LSZA 1O81A 3HVSA 2C3NA 3IAS2 2OE3A 3KP8A 4F82A 2I1UA 1GP1A 4HDEA 4F2IA 2FWFA 3VWUA 3VURA 2A4VA 3KIJA 3LQ7A 4PGTA 1UC7A 2RIIA 2WFCA 3FY7A 2OADA 2VCQA 2WW3A 2J9HA 3D0ZA 2H01A 2B5XA 3FW2A 4NMUA 4Q5RA 3QAGA 3DMLA 3CSJA 3G9BA 2AB6A 2VUPA 4PI0C 1JLWA 3ZLPA 3HXSA 1FG4A 2DJJA 2EIQA 2R0GA 3M9JA 3A2XA 2QA1A 5ECHB 4AF2A 4V2MA 3DRNA 2QKEA 2OE0A 4DEJA 3ZFBA 3MWHA 4QL9A 2IIYA 1V2AA 1OC9A 4JBBA 1PN9A 1GTAA 5ECKB 1K0CA 3LG6A 1A23A 5A5KA 4HZ2A 1Z6MA 4Q5NA 1K3LA 4KAEA 2CX4A 4IW9A 12GSA 4AKGA 4EVMA 4K1FA 5BRTA 5E4WA 4ZXGA 3HJMA 3TJKA 5IMCA 4Q5FA 2IJYA 2A2RA 4WF4A 4KB3A 4OFMA 3GN3A 4GWRA 3FZ5A 5J4YA 1TRWA 3CYNA 1KEBA 3UBLA 4AGSA 4MA9A 4K7IA 1JZWA 4LLRA 5IQYA 1NHOA 1TU7A 2CVDA 4HJ2A 4I2TA 5GAPD 5DAKA 3EPTA 2PGTA 3F0IA 5E59A 1DBYA 3EYTA 2L59A 3M3MA 2OBKA 1GSFA 4MJCA 2IN3A 2K8SA 1YQ1A 1Y6EA 3LJRA 2QGVA 6GSYA 2YWOA 3EVIA 2OACA 1MEKA 1X5EA 1XW9A 5H5QA 1K0MA 3MSZA 2V41A 1EGRA 1N2AA 1K0BA 5ELAA 1GH2A 1SK1A 2CQ9A 2YCDA 1THOA 4TXOA 1FVKA 1Q4JA 1OKTA 5J40A 4ML1A 2AV4A 4MP4A 5ID2A 1VF4A 3HKRA 1ILOA 3UMAA 5IOWA 2B5EA 1EV9A 1GSQA 3QFBC 2WVXB 3TJBA 4WKWA 1T3BA 1YF0A 2DLXA 3GH6A 2B7KA 3TB2A 1WE0A 2H0IA 2ES7A 3H4KA 4PNGA 5CO3A 3O3TA 3WYWA 2M80A 4X4JA 3HD5A 2H72A 3PH9A 3UAPA 1SJZA 3HZ4A 1X9SB 4KSMA 1SKWB 1MD4A 3RPPA 2VL2C 1ABAA 3HHVA 2NBSA 4V1Ap 2VAFA 2H6YA 2ZCTA 3TJJA 3W8SA 3PR8A 1GSEA 3IOSA 4K5SA 3KJYA 2HLSA 1OC3A 1GSUA 3C1SA 4QMKA 3NIVA 1WIKA 2JZRA 1TJDA 3F3QA 1EOGA 1XW6A 5G30A 2CVBA 1X9WB 2REMA 2IMFA 4D73A 2CT6A 4MZCA 2K9FA 2C0DA 3IC8A 3GHAA 3ZMKA 5B8AA 3CRUA 2LSTA 2C4JA 4E8HA 2H70A 2HE3A 2OBIA 4G9HA 3M1GA 3CWGA 4ACSA 2I4AA 1TK0B 2AHEA 1Q98A 5HR3A 1AW9A 2O87A 5ENUA 3FR6A 5J4VA 2DKHA 2L57A 2BMXA 1GUKA 3CBUA 4EDZA 4FYUA 2X64A 2LRCA 3IR4A 2PN8A 2YPMA 3ZZXA 1J0FA 3VK9A 3HMJG 1SD8A 4JE1A 4J2FA 2C0FA 3F63A 1PKZA 2DBCA 4MJAA 5F0GA 3DKSA 2QSIA 2RLIA 1WOUA 3CMIA 1EOHA 1XFLA 1BJXA 1FVJA 4HSCX 4TR3A 3H93A 1PX7A 1HD2A 5H5SA 2CA8A 4GSSA 5HR0A 5A5HA 2WJUA 2GSSA 1S3AA 1JZDA 2G2QA 1EP7A 3L4NA 3DGQA 2FLSA 3CXGA 3VI5A 2LTKA 13GSA 4PQIA 4MH2A 3EC3A 3U5RE 1Z3EA 4XS6A 4X43A 5DJLA 6GSVA 1O85A 4PI2C 2GT6A 4HEA2 1VGLA 1GLPA 1M2BA 2FY6A 1NHYA 5IPHA 2R3XA 1GTIA 3CTFA 4O92A 3I9V2 3LORA 2WGRA 3KCMA 3N9JA 3J7Yk 3O6TA 4G10A 1PL2A 2LKUA 6GSSA 1XWBA 4N0VA 2H66A 2OT3A 1ZYNA 3GKKA 3WT1A 4FXYP 4XCSA 2HYXA 1NSWA 2VM1A 2WCIA 2C3QA 1O8XA 4WXTA 2B7JA 3S9FA 4AJ8A 2VD1A 1ERTA 1ERUA 3O76A 4USSA 4WR5A 5DJMA 1PGTA 1BF5A 2F3MA 1A0RP 1K0AA 5ECRB 2RUFA 4TR1B 1ZCPA 4YKGA 4JR4A 2R37A 1SD9A 3FKFA 4K2DA 2C3TA 1EWXA 2YJ7A 2HSMB 1OE8A 2WW1A 5D8IA 2LS5A 1QK8A 2HT9A 4OCFA 2DIZA 3TOUA 1H4OA 1UVZA 2VM2A 1B4QA 2CZ3A 4IKHA 4KDYA 2H1AA 3L9SA 4EIPA 2AJQB 2KP1A 1WJKA 1OVNA 5GSTA 4AKXB 3IV4A 4JU5A 2VLTA 3GH9A 1YDKA 4MF6A 4TKYA 3ERFA 1X5CA 1FHEA 4OMVA 5IMVA 5KN2A 2H1LA 3GRXA 3C1RA 4YKFA 1TU8A 5CRHA 1ZZYA 2N5AA 3AY8A 2HI7A 3EU4A 1VF1A 1TXXA 4NHWA 1NW2A 3F4SA 2LQQA 2BTOT 4FH8A 4IBPA 2DIYA 1YKCA 4K5RA 2K6VA 3PINA 2H8LA 5D96A 1PMTA 4LMWA 1I1IP 3P2AA 3VWVA 3E3EA 3UVHA 3KMOA 1PD21 5J47A 5ECOB 2R4VA 4WR4A 2VLUA 1Z7PA 2KP2A 2EFHA 1VF3A 3LGCA 2IWTA 2L4QA 1XZOA 3G7JA 3HVVA 4ISDA 4ILFA 1PQNA 2GGTA 3H79A 1J9BA 4LL1B 1A2LA 1RQMA 2A2PA 6GSWA 3U6VA 5CRGA 2DMMA 5JWQB 4XTSA 3W6GA 3APOA 4DSSA 5IO0A 1SJIA 4JRRA 1AC1A 1T00A 4KE3A 1RK4A 4K6XA 1OKDA 1R4WA 3TKSA 4I5QA 1SK0A 2OE1A 1MDKA 2GTUA 1YJ6A 2GVPA 2PWJA 4YAVA 1GTUA 2YV7A 5BMUA 2VL3A 2WW0A 2KUCA 4RUVA 2V6OA 3GIXA 1IYHA 5D9XA 3R3EA 4MPGA 1FB0A 3F4TA 4I6XA 2WZSA 5F8BA 5A34B 3H8QA 2RM6A 1XIYA 1PSQA 4POLA 5J9CA 1M2DA 3CRTA 4XHMA 1F6MC 3A3TA 2H71A 5JCGA 2C1YA 4K9ZA 4K8MA 3Q6OA 2GQKA 2HRKA 3M8NA 1TP9A 4H86A 1TKDB 2H73A 2O85A 4YQVA 1SL0B 5HFIA 2LV3A 2O89A 3QDNA 1R26A 3HJPA 1I9DA 3ZREA 2E0QA 3VI7A 3IK7A 2HSNB 2JU5A 2ON7A 1F9MA 3QAVA 2A4HA 4ZB7A 4ZB9A 4F0CA 1HNBA 2IMIA 5CNWA 2TRXA 4FQUA 2GSTA 4GTUA 5B6NA 4EUYA 3UARA 3F3RA 2EFCA 1PL1A 3P90A 3HDCA 4J56E 2B1KA 3Q19A 2MZCA 3N5OA 3W8JA 3UEMA 3ME7A 2HZEB 2FWEA 1JHBA 2L5OA 3PPUA 3RBTA 1FB6A 2HSHA 2M72A 4EO3A 2L6CA 4L5OA 5FHIA 3VWXA 2RUEA 4QQ7A 4G01A 1WMJA 2MBSA 1M3IA 1EP8A 4PHZC 2H0HA 1VF2A 4PNFA 1BYEA 1FW1A 4IS0A 3BCIA 4L5LA 3UL3A 2H1GA 2LJKA 3GA4A 3GNJA 4ZBDA 5DCHA 4F0BA 2DJ3A 1OC8A 5FT3A 2FGXA 5AISA 4J57E 4NPBA 5DVBA 4IP1A 3V1WA 1Z7RA 1PRXA 1HNAA 1JZOA 2IFQB 3ZVJD 4IGJA 1ERVA 1GUHA 3BOAA 3RHCA 5INYA 1K0NA 1G7EA 5EY6A 2WZ9A 1U88A 4OO5A 5H5RA 3FK8A 4XRAA 1G7OA 3KMNA 3L78A 1EV4A 1B9YC 4I97A 3HY2A 2O8VB 5LCZA 1OAZA 2C0EA 4BL7A 3EURA 2O7KA 3CQFA
chains in the Genus database with same CATH topology
2AUVA 2YANA 1AIUA 4YQUA 4GSTA 2FD3A 4NXIA 5ECSA 2IPAA 2VL2A 5HR1A 3CSIA 1W89A 2V2GA 5A1NB 3Q74A 4XIHA 2PU9C 3GKMA 4BVXA 4K0GA 4QL7A 3BCKA 1EEMA 2TRCP 4LMVA 2LJRA 2NVLA 4GQFA 3GL3A 3ZRDA 4E68A 2JADA 2MMAA 1PN0A 1XWGA 5IMZA 1ZL9A 4P3YB 2CX3A 4POBA 2JSYA 2H30A 3J7Yb 2PBJA 1V40A 4HI7A 1BAYA 4F9ZA 4K7OA 1G6WA 4KNDA 3KP9A 5C04A 2XC2A 2XBIA 3M0FA 2CZ2A 4V1Ag 3A5IA 3HCZA 1B48A 4EE0A 5KN0A 4AKIA 5J9BA 2YNXA 1WWJA 1GNEA 2ALBA 1Z5YE 2WB9A 2H0GA 3FYGA 4ZB6A 1BX9A 3KH9A 3SWLA 4DSRA 4CW9A 1K0OA 1U3IA 1BG5A 3FZ4A 3HA9A 5J4UA 4KDXA 1C72A 2EIOA 1A2JA 2LRTA 4PUFC 5G31A 2Z9SA 2H6XA 1FOHA 1Y25A 3HYPA 5HFKA 1BEDA 2X8GA 1Z6NA 3US3A 1YEPA 5ECQB 1O6JA 5KN1A 1YKAA 5JCWA 4EDYA 4KGIA 1B9XC 2NPBA 1TW9A 2DC5A 2KHPA 4HS1A 4HU7A 5HFGA 5IO2A 1GLQA 2B3SA 4WEYA 1HNCA 4ULXA 3ZTLA 2N5FA 5J5NA 3ED3A 2HNLA 4MJBA 2VKZG 1SJ6A 4ZL8A 3NOFA 1M99A 2GLRA 4AJ6A 4DSQA 2FWHA 1Y1UA 1V98A 4RI7A 2MBTA 5CRDA 2LJAA 1AQVA 1SVMA 4BVYB 2VCTA 19GSA 3ZIVA 2VLVA 2F8AA 2K8VA 2YJHA 1YY7A 5JWOB 1ZYQB 2ZUPA 2JZTA 4MLYA 4MCUA 3ZL5A 5F06A 1OYJA 3KZQA 3KXOA 2R0PA 1DE1A 2LRNA 3UVTA 4KF9A 5A4VA 3LXTA 4FYCA 3IRAA 1LBKA 2VO4A 2GQLA 4TOPA 2P5QA 5DQSA 4KX4A 5D73A 1F3BA 1A0FA 2PMTA 2HFDA 5B6MA 5ECLB 3QFAC 7GSSA 2B6MA 2HXKA 1T7PB 1ON4A 1ZOFA 3RPNA 2P0GA 4O32A 3I6AA 2YZUA 1EEJA 1CQHA 2EFDA 3LWAA 3GKNA 2LNSA 4OFTA 3MAKA 2FA8A 3EMPA 4BWSA 1DE2A 2EFEA 3ISOA 6GSXA 3IC4A 1N8JA 1WRYA 2L6DA 2LQOA 4K0NA 1I5GA 9GSSA 4MNNA 3QAWA 4POMA 3F9UA 3GYKA 1GSSA 5LD0A 1SKSB 5IIZA 3D22A 2CVKA 4BWQA 1MTCA 5G1KA 2M46A 4YQMA 2YWIA 2VIMA 1TI1A 3IHGA 3TGZA 3VWWA 3IDVA 2I9HA 4NV5A 2YOIA 4GLTA 2OJLA 3GV1A 4N0ZA 3TKPA 3Q18A 2H6ZA 5KN3A 5J3RA 2GDRA 2YZHA 2X4AA 3I69A 2VD0A 4JEDA 1S3CA 1OC9B 3GL5A 4TR0A 3GURA 3TCOA 2MYGA 1VRSD 5DDLA 4GF0A 3TUEA 1O8WA 2PERA 1TI3A 1O73A 2IMKA 2B5YA 2XBQA 1K3YA 1G0TA 4PXOA 1GTBA 2WDUA 2DJKA 3IE3A 2TIRA 14GSA 4IN0A 2IMEA 4WBRD 4F03A 2WRTA 1X5DA 1XOBA 5HQPA 1MD3A 2NDOA 4DVCA 5FWGA 1SL1B 1WP0A 4IELA 8GSSA 4L8EA 2LNTA 5CRWA 2RM5A 2C80A 2I3YA 1LU4A 1AXDA 3HVXA 3G7YA 1U87A 5G2ZA 3GSTA 3GTUB 20GSA 5AGYA 1QGVA 1W4VA 2XPEA 2HRNA 3LYPA 4HUAA 4K2XA 3MNGA 4Z7XA 3BBYA 4AI6A 1U3AA 5DAKB 3P8WA 1XXUA 1KTEA 3QCPA 4G19A 16GSA 3DWVA 3GX8A 1CQGA 4EIQA 2FCHA 4ICYA 5ELGA 1T4ZA 2GSRA 1GL8A 3FEUA 2JL4A 4E8EA 2DJ1A 1XWKA 1ERWA 4G0LA 2E2MA 4X0XA 4O5UA 4ECJA 5KOXA 5AIVA 2ON5A 3DEXA 5G1LA 6GSUA 4HQSA 4XRDA 1KNGA 1B4PA 2HRFA 1XBSA 2CAIA 1FOVA 4TXOB 1UA5A 1OE7A 4XS4B 2F9SA 4GSNA 3FZAA 2R2JA 3ZIJA 4TN8A 2FUG2 5ID2B 2YN1A 1AAZA 2P31A 2VCZA 3VFIA 2V6KA 3E0UA 4EF0A 5EL8A 5GAND 4HZ4A 3FRCA 1GSDA 4WETA 1DUGA 5JCUA 5ECPB 2GT5A 2NTOA 4MH3A 4OCEA 1TRSA 5ECMB 5D93A 1M0UA 4MMMA 1QQ2A 2JSZA 4MABA 5ABRA 3DIEA 3KD0A 3HZ8A 4BPYA 3UIWA 3TOTA 2FA4A 2GS3A 3IXRA 4ID0A 4IVFA 5F07A 2GSQA 4TR1A 2EIRA 4LA1A 5L71A 2N5BA 3UBKA 3QPMA 1HQOA 2HSMA 3G7IA 5GSSA 2AAWA 4IJIA 11GSA 4D73B 2H1DA 3IHQA 4CDOA 3L9VA 4PX1A 1A24A 1AQXA 4LL4B 3EE2A 3CSHA 3C71A 4JR6A 3VPQA 4YAPA 4I2UA 4NHZA 3OR5A 2WS2A 3H1NA 3IPZA 4OO4A 1V57A 2L5LA 4HOJA 4PQHA 1BQ7A 4WF5A 2VCVA 3ZITA 4L0UA 4ML6A 1V9WA 2ZNMA 5D9VA 4G0KA 2CAQA 4ECCA 3EU3A 1GWCA 2HZFA 3TDGA 4RQXA 3LEFA 1MDIA 2FNOA 1GULA 2YWMA 3QD9A 1SENA 2GZYA 4FYBA 1RW1A 5AIXA 1XWCA 1U6TA 2IMDA 3MIXA 1H75A 3TRPA 5A5HB 2WULA 3GTUA 2X99A 2HRAA 4MDCA 4XS1A 4N10A 3FHKA 3HJOA 3ERGA 3ZMLA 3E9JB 3IBHA 4A5PA 3QOUA 4PURA 1TOFA 4GQCA 4IJ3A 3BD2A 10GSA 4PQ1A 3DVWA 2E7PA 3GUSA 3ME8A 1NM3A 1FAAA 2A2SA 2PPTA 4NAXA 3JCML 4KW6A 3APQA 4FO5A 4X1UA 3ZYWA 3TU3B 4CHSA 3QMXA 1YEXA 3TJFA 1KBNA 5HR2A 1URMA 4Z2TA 5DBQA 1F2EA 5G5FA 4XS4A 3SBCA 1SVOA 1THXA 3BJ5A 5A34A 3EINA 2F8FA 1QUWA 4N3ZA 2P5RA 3RDWA 2H19A 1Z9HA 1XCCA 6GSTA 2VCXA 2C8UA 5IPGA 4WBJA 3FR3A 1HYUA 5GZZB 1GUMA 1R5PA 5EPFA 3TKRA 4IP6A 4OWYA 4GXZA 1S3DA 3FZ9A 4MF5A 22GSA 1XVWA 1ZGNA 2HSYA 4GDFA 3NZNA 1R5AA 2XPDA 2PVQA 1GNWA 4ZBAA 3QR6A 2R5GA 4NWYA 3WT2A 2O5VA 4PTSA 1EGOA 2FWGA 5C00A 4EXJA 3WGEA 2HSNA 2HQTA 1IYIA 1MDJA 1YF1A 4FIWA 1SKRB 1TTZA 4ZL7A 2H75A 3D21A 1M9BA 1PX6A 2PVOC 1XVQA 5IMDA 3KTLA 4KA0A 3DXBA 3TKQA 1F3AA 3WGDA 2GQMA 2D2ZA 1X0RA 5KOWA 4ECIA 1DSBA 4W66A 2JZSA 2HZEA 5D9TA 4Q5QA 3WGXA 5JWRB 4EL1A 3UJ1A 4AKHA 1ZYEA 3DD3A 2KLXA 2J23A 1USBA 2X49A 2X8HA 3ZVJA 2MMOA 2VCWA 4CY8A 1A8YA 1B8XA 2DJ0A 5DALB 2V1MA 2BJXA 4TRXA 4I8BA 4ZIJA 2YV9A 2AYTA 4RQRA 3F6DA 4N11A 3L0HA 4HQZA 3F8UA 4DSSB 1SVLA 4TXVA 4TW5A 3IAM2 2IFQA 2X8CA 5D9WA 1TXUA 4V2LA 1TK5B 4MPFA 3A2VA 3LFLA 2R6KA 1K3OA 1TDIA 1M2AA 3F6FA 5IM9A 4V2NA 5BMUB 1AUCA 4O5RA 1QXHA 4TR4A 2YP6A 2H76A 1ML6A 1XPVA 4NV2A 3KH7A 4YH2A 1E2YA 4ZBBA 1O7UA 1XW5A 2MMZA 1A2MA 2C0GA 3KGKA 2DMLA 5A1NA 1ST9A 3VLNA 4CY6A 1GSYA 3TJGA 3PGTA 3UOMA 2H74A 5IMFA 3GSSA 4KSOA 2CV4A 1J08A 3GFKA 4K7NA 1SL2B 4O5QA 3MYDA 2H1BA 2E2GA 2HRKB 3EWLA 1SYRA 3ZFLA 3DYRA 1V58A 2XHFA 1A8LA 2QC7A 4POKA 1ZYPA 3LW9A 1QFNA 2QA2A 3D4TA 4MZBA 1R7HA 4MJEA 3KTBA 4ZL9A 2FHEA 3VPTA 5CAXA 2F51A 2G0FA 4KUNA 3C7MA 3KM6A 3C73A 1PKWA 1N25A 3ERWA 4MF7A 4KH7A 3LXZA 3KEBA 5A4UA 3A2WA 5IMAA 1BG1A 4HU9A 2KOKA 4OD7A 4N30A 4GRFA 3TRQA 2OKAA 5DCGA 4KCAA 4KCEA 4Z2UA 4O7HA 5J41A 1JZRA 3RAZA 1JLVA 1SU9A 1M7TA 2YWNA 1X9MB 2I81A 1WPIA 3A5WA 1T4YA 2B1LA 3D6IA 1K0DA 3RHBA 5CYYA 2DKIA 4EKZA 1LJRA 3WD6A 2PUKC 3FR9A 5B8BA 3K8NA 1JFUA 4PUAA 2UZ8A 4EC0A 4G0IA 2K18A 5DQYA 3IK9A 3TRXA 4ECBA 5CREA 3TKSE 3IA1A 5ECIB 5CP1A 4OFNA 4IQ1A 3D5JA 2IL3A 4RI6A 1UN2A 4HJMA 1TRUA 2DJ2A 1YVLA 3GKXA 5ECNB 2DSAA 4MZWA 4G2EA 4AJ7A 5DALA 5A4WA 1M9AA 5LNKe 3D4MA 5B7CA 1PA3A 3CTGA 1F37A 1T8EB 3GX0A 2LUSA 5COHA 17GSA 1YZXA 1XWAA 4BVYA 5KEJA 1E6BA 4IHUA 1GRXA 4BL7B 5G5EA 3EMXA 5F05A 2LEGA 1QMVA 1TRVA 2UV8G 3F4RA 3R2QA 3DVXA 3I43A 1SYXA 2JACA 2VOCA 4MK3A 3P7XA 3APSA 4KDUA 2V32A 2GZPA 2OA7A 5EVOA 3M9KA 2GZZA 3C8EA 4BVXB 2L4CA 4GCIA 4JZQA 1G6YA 3L9UA 2R0CA 1TK8B 1XOAA 3FMWA 5AN1A 1ACVA 3LYKA 4BA7A 1FO5A 1AQWA 2EC4A 2VL9A 4Z2RA 1EZKA 3GMFA 1ZMAA 4IQAA 1T1VA 1SK2A 5IOXA 2MMNA 3MDKA 18GSA 4ZILA 4ZB8A 4L0WA 4TVEA 3TKSC 3LSZA 1O81A 3HVSA 2C3NA 3IAS2 2OE3A 3KP8A 4F82A 2I1UA 1GP1A 4HDEA 4F2IA 2FWFA 3VWUA 3VURA 2A4VA 3KIJA 3LQ7A 4PGTA 1UC7A 2RIIA 2WFCA 3FY7A 2OADA 2VCQA 2J9HA 3D0ZA 2H01A 2B5XA 3FW2A 4NMUA 4Q5RA 3QAGA 3DMLA 3CSJA 3G9BA 2AB6A 2VUPA 1JLWA 3ZLPA 3HXSA 1FG4A 2DJJA 2EIQA 2R0GA 3M9JA 3A2XA 2QA1A 5ECHB 4AF2A 4V2MA 3DRNA 2QKEA 2OE0A 4DEJA 3ZFBA 3MWHA 4QL9A 2IIYA 1V2AA 1OC9A 4JBBA 1PN9A 1GTAA 5ECKB 1K0CA 3LG6A 1A23A 5A5KA 4HZ2A 1Z6MA 4Q5NA 1K3LA 4KAEA 2CX4A 4IW9A 12GSA 4AKGA 4EVMA 4K1FA 5BRTA 5E4WA 4ZXGA 3HJMA 3TJKA 5IMCA 4Q5FA 2IJYA 2A2RA 4WF4A 4KB3A 4OFMA 3GN3A 4GWRA 3FZ5A 5J4YA 1TRWA 3CYNA 1KEBA 3UBLA 4AGSA 4MA9A 4K7IA 1JZWA 4LLRA 5IQYA 1NHOA 1TU7A 2CVDA 4HJ2A 4I2TA 5GAPD 5DAKA 3EPTA 2PGTA 3F0IA 5E59A 1DBYA 3EYTA 2L59A 3M3MA 2OBKA 1GSFA 4MJCA 2IN3A 2K8SA 1YQ1A 1Y6EA 3LJRA 2QGVA 6GSYA 2YWOA 3EVIA 2OACA 1MEKA 1X5EA 1XW9A 5H5QA 1K0MA 3MSZA 2V41A 1EGRA 1N2AA 1K0BA 5ELAA 1GH2A 1SK1A 2CQ9A 2YCDA 1THOA 4TXOA 1FVKA 1Q4JA 1OKTA 5J40A 4ML1A 2AV4A 4MP4A 5ID2A 1VF4A 3HKRA 1ILOA 3UMAA 5IOWA 2B5EA 1EV9A 1GSQA 3QFBC 3TJBA 4WKWA 1T3BA 1YF0A 2DLXA 3GH6A 2B7KA 3TB2A 1WE0A 2H0IA 2ES7A 3H4KA 4PNGA 5CO3A 3O3TA 3WYWA 2M80A 4X4JA 3HD5A 2H72A 3PH9A 3UAPA 1SJZA 3HZ4A 1X9SB 4KSMA 1SKWB 1MD4A 3RPPA 2VL2C 1ABAA 3HHVA 2NBSA 4V1Ap 2VAFA 2H6YA 2ZCTA 3TJJA 3W8SA 3PR8A 1GSEA 3IOSA 4K5SA 3KJYA 2HLSA 1OC3A 1GSUA 3C1SA 4QMKA 3NIVA 1WIKA 2JZRA 1TJDA 3F3QA 1EOGA 1XW6A 5G30A 2CVBA 1X9WB 2REMA 2IMFA 4D73A 2CT6A 4MZCA 2K9FA 2C0DA 3IC8A 3GHAA 3ZMKA 5B8AA 3CRUA 2LSTA 2C4JA 4E8HA 2H70A 2HE3A 2OBIA 4G9HA 3M1GA 3CWGA 4ACSA 2I4AA 1TK0B 2AHEA 1Q98A 5HR3A 1AW9A 2O87A 5ENUA 3FR6A 5J4VA 2DKHA 2L57A 2BMXA 1GUKA 3CBUA 4EDZA 4FYUA 2X64A 2LRCA 3IR4A 2PN8A 2YPMA 3ZZXA 1J0FA 3VK9A 3HMJG 1SD8A 4JE1A 4J2FA 2C0FA 3F63A 1PKZA 2DBCA 4MJAA 5F0GA 3DKSA 2QSIA 2RLIA 1WOUA 3CMIA 1EOHA 1XFLA 1BJXA 1FVJA 4TR3A 3H93A 1PX7A 1HD2A 5H5SA 2CA8A 4GSSA 5HR0A 5A5HA 2WJUA 2GSSA 1S3AA 1JZDA 2G2QA 1EP7A 3L4NA 3DGQA 2FLSA 3CXGA 3VI5A 2LTKA 13GSA 4PQIA 4MH2A 3EC3A 3U5RE 1Z3EA 4XS6A 4X43A 5DJLA 6GSVA 1O85A 2GT6A 4HEA2 1VGLA 1GLPA 1M2BA 2FY6A 1NHYA 5IPHA 2R3XA 1GTIA 3CTFA 4O92A 3I9V2 3LORA 2WGRA 3KCMA 3N9JA 3J7Yk 3O6TA 4G10A 1PL2A 2LKUA 6GSSA 1XWBA 4N0VA 2H66A 2OT3A 1ZYNA 3GKKA 3WT1A 4XCSA 2HYXA 1NSWA 2VM1A 2WCIA 2C3QA 1O8XA 4WXTA 2B7JA 3S9FA 4AJ8A 2VD1A 1ERTA 1ERUA 3O76A 4USSA 4WR5A 5DJMA 1PGTA 1BF5A 2F3MA 1A0RP 1K0AA 5ECRB 2RUFA 4TR1B 1ZCPA 4YKGA 4JR4A 2R37A 1SD9A 3FKFA 4K2DA 2C3TA 1EWXA 2YJ7A 2HSMB 1OE8A 5D8IA 2LS5A 1QK8A 2HT9A 4OCFA 2DIZA 3TOUA 1H4OA 1UVZA 2VM2A 1B4QA 2CZ3A 4IKHA 4KDYA 2H1AA 3L9SA 4EIPA 2AJQB 2KP1A 1WJKA 1OVNA 5GSTA 4AKXB 3IV4A 4JU5A 2VLTA 3GH9A 1YDKA 4MF6A 4TKYA 3ERFA 1X5CA 1FHEA 4OMVA 5IMVA 5KN2A 2H1LA 3GRXA 3C1RA 4YKFA 1TU8A 5CRHA 1ZZYA 2N5AA 3AY8A 2HI7A 3EU4A 1VF1A 1TXXA 4NHWA 1NW2A 3F4SA 2LQQA 2BTOT 4FH8A 4IBPA 2DIYA 1YKCA 4K5RA 2K6VA 3PINA 2H8LA 5D96A 1PMTA 4LMWA 3P2AA 3VWVA 3E3EA 3UVHA 3KMOA 1PD21 5J47A 5ECOB 2R4VA 4WR4A 2VLUA 1Z7PA 2KP2A 2EFHA 1VF3A 3LGCA 2IWTA 2L4QA 1XZOA 3G7JA 3HVVA 4ISDA 4ILFA 1PQNA 2GGTA 3H79A 1J9BA 4LL1B 1A2LA 1RQMA 2A2PA 6GSWA 3U6VA 5CRGA 2DMMA 5JWQB 4XTSA 3W6GA 3APOA 4DSSA 5IO0A 1SJIA 4JRRA 1AC1A 1T00A 4KE3A 1RK4A 4K6XA 1OKDA 1R4WA 3TKSA 4I5QA 1SK0A 2OE1A 1MDKA 2GTUA 1YJ6A 2GVPA 2PWJA 4YAVA 1GTUA 2YV7A 5BMUA 2VL3A 2KUCA 4RUVA 2V6OA 3GIXA 1IYHA 5D9XA 3R3EA 4MPGA 1FB0A 3F4TA 4I6XA 5F8BA 5A34B 3H8QA 2RM6A 1XIYA 1PSQA 4POLA 5J9CA 1M2DA 3CRTA 4XHMA 1F6MC 3A3TA 2H71A 5JCGA 2C1YA 4K9ZA 4K8MA 3Q6OA 2GQKA 2HRKA 3M8NA 1TP9A 4H86A 1TKDB 2H73A 2O85A 4YQVA 1SL0B 5HFIA 2LV3A 2O89A 3QDNA 1R26A 3HJPA 1I9DA 3ZREA 2E0QA 3VI7A 3IK7A 2HSNB 2JU5A 2ON7A 1F9MA 3QAVA 2A4HA 4ZB7A 4ZB9A 4F0CA 1HNBA 2IMIA 5CNWA 2TRXA 4FQUA 2GSTA 4GTUA 5B6NA 4EUYA 3UARA 3F3RA 2EFCA 1PL1A 3P90A 3HDCA 4J56E 2B1KA 3Q19A 2MZCA 3N5OA 3W8JA 3UEMA 3ME7A 2HZEB 2FWEA 1JHBA 2L5OA 3PPUA 3RBTA 1FB6A 2HSHA 2M72A 4EO3A 2L6CA 4L5OA 5FHIA 3VWXA 2RUEA 4QQ7A 4G01A 1WMJA 2MBSA 1EP8A 2H0HA 1VF2A 4PNFA 1BYEA 1FW1A 4IS0A 3BCIA 4L5LA 3UL3A 2H1GA 2LJKA 3GA4A 3GNJA 4ZBDA 5DCHA 4F0BA 2DJ3A 1OC8A 5FT3A 2FGXA 5AISA 4J57E 4NPBA 5DVBA 4IP1A 3V1WA 1Z7RA 1PRXA 1HNAA 1JZOA 2IFQB 3ZVJD 4IGJA 1ERVA 1GUHA 3BOAA 3RHCA 5INYA 1K0NA 1G7EA 5EY6A 2WZ9A 1U88A 4OO5A 5H5RA 3FK8A 4XRAA 1G7OA 3KMNA 3L78A 1EV4A 1B9YC 4I97A 3HY2A 2O8VB 5LCZA 1OAZA 2C0EA 4BL7A 3EURA 2O7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUV A;  2YAN A;  1AIU A;  4YQU A;  4GST A;  2FD3 A;  4NXI A;  5ECS A;  2IPA A;  2VL2 A;  5HR1 A;  3CSI A;  1W89 A;  2V2G A;  3Q74 A;  4XIH A;  2PU9 C;  3GKM A;  4BVX A;  4K0G A;  4QL7 A;  3BCK A;  1EEM A;  2TRC P;  4LMV A;  2LJR A;  2NVL A;  4GQF A;  3GL3 A;  3ZRD A;  2JAD A;  2MMA A;  1XWG A;  5IMZ A;  1ZL9 A;  4P3Y B;  2CX3 A;  4POB A;  2JSY A;  2H30 A;  3J7Y b;  2PBJ A;  1V40 A;  4HI7 A;  1BAY A;  4F9Z A;  4K7O A;  1G6W A;  4KND A;  3KP9 A;  5C04 A;  2XC2 A;  2XBI A;  3M0F A;  2CZ2 A;  4V1A g;  3HCZ A;  1B48 A;  4EE0 A;  5KN0 A;  5J9B A;  2YNX A;  1WWJ A;  1GNE A;  2ALB A;  1Z5Y E;  2WB9 A;  2H0G A;  3FYG A;  4ZB6 A;  1BX9 A;  3KH9 A;  3SWL A;  4DSR A;  4CW9 A;  1K0O A;  1U3I A;  1BG5 A;  3FZ4 A;  3HA9 A;  5J4U A;  4KDX A;  1C72 A;  2EIO A;  1A2J A;  2LRT A;  4PUF C;  5G31 A;  2Z9S A;  2H6X A;  1Y25 A;  3HYP A;  5HFK A;  1BED A;  2X8G A;  1Z6N A;  3US3 A;  1YEP A;  5ECQ B;  1O6J A;  5KN1 A;  1YKA A;  5JCW A;  4EDY A;  4KGI A;  1B9X C;  2NPB A;  1TW9 A;  2DC5 A;  2KHP A;  4HS1 A;  4HU7 A;  5HFG A;  5IO2 A;  1GLQ A;  2B3S A;  4WEY A;  1HNC A;  4ULX A;  3ZTL A;  2N5F A;  5J5N A;  3ED3 A;  2HNL A;  4MJB A;  1SJ6 A;  4ZL8 A;  3NOF A;  1M99 A;  2GLR A;  4AJ6 A;  4DSQ A;  2FWH A;  1V98 A;  4RI7 A;  2MBT A;  5CRD A;  2LJA A;  1AQV A;  4BVY B;  2VCT A;  19GS A;  3ZIV A;  2VLV A;  2F8A A;  2K8V A;  2YJH A;  1YY7 A;  5JWO B;  1ZYQ B;  2ZUP A;  2JZT A;  4MLY A;  4MCU A;  3ZL5 A;  5F06 A;  1OYJ A;  3KZQ A;  3KXO A;  1DE1 A;  2LRN A;  3UVT A;  4KF9 A;  5A4V A;  3LXT A;  4FYC A;  3IRA A;  1LBK A;  2VO4 A;  2GQL A;  4TOP A;  2P5Q A;  5DQS A;  4KX4 A;  5D73 A;  1F3B A;  1A0F A;  2PMT A;  2HFD A;  5B6M A;  5ECL B;  3QFA C;  7GSS A;  2B6M A;  2HXK A;  1T7P B;  1ON4 A;  1ZOF A;  3RPN A;  2P0G A;  4O32 A;  3I6A A;  2YZU A;  1EEJ A;  1CQH A;  3LWA A;  3GKN A;  2LNS A;  4OFT A;  3MAK A;  2FA8 A;  3EMP A;  4BWS A;  1DE2 A;  3ISO A;  6GSX A;  3IC4 A;  1N8J A;  1WRY A;  2L6D A;  2LQO A;  4K0N A;  1I5G A;  9GSS A;  3QAW A;  4POM A;  3F9U A;  3GYK A;  1GSS A;  5LD0 A;  1SKS B;  5IIZ A;  3D22 A;  2CVK A;  4BWQ A;  1MTC A;  5G1K A;  2M46 A;  4YQM A;  2YWI A;  2VIM A;  1TI1 A;  3TGZ A;  3VWW A;  3IDV A;  2I9H A;  4NV5 A;  2YOI A;  4GLT A;  2OJL A;  3GV1 A;  4N0Z A;  3TKP A;  3Q18 A;  2H6Z A;  5KN3 A;  5J3R A;  2GDR A;  2YZH A;  3I69 A;  2VD0 A;  4JED A;  1S3C A;  1OC9 B;  3GL5 A;  4TR0 A;  3GUR A;  3TCO A;  2MYG A;  1VRS D;  5DDL A;  4GF0 A;  3TUE A;  1O8W A;  2PER A;  1TI3 A;  1O73 A;  2IMK A;  2B5Y A;  2XBQ A;  1K3Y A;  1G0T A;  4PXO A;  1GTB A;  2WDU A;  2DJK A;  3IE3 A;  2TIR A;  14GS A;  4IN0 A;  2IME A;  4WBR D;  4F03 A;  2WRT A;  1X5D A;  1XOB A;  5HQP A;  1MD3 A;  2NDO A;  4DVC A;  5FWG A;  1SL1 B;  1WP0 A;  4IEL A;  8GSS A;  4L8E A;  2LNT A;  5CRW A;  2RM5 A;  2C80 A;  2I3Y A;  1LU4 A;  1AXD A;  3HVX A;  3G7Y A;  1U87 A;  5G2Z A;  3GST A;  3GTU B;  20GS A;  5AGY A;  1QGV A;  1W4V A;  2XPE A;  2HRN A;  3LYP A;  4HUA A;  3MNG A;  4Z7X A;  3BBY A;  1U3A A;  5DAK B;  3P8W A;  1XXU A;  1KTE A;  3QCP A;  4G19 A;  16GS A;  3DWV A;  3GX8 A;  1CQG A;  2FCH A;  5ELG A;  1T4Z A;  2GSR A;  1GL8 A;  3FEU A;  2JL4 A;  4E8E A;  2DJ1 A;  1XWK A;  1ERW A;  4G0L A;  2E2M A;  4X0X A;  4ECJ A;  5AIV A;  2ON5 A;  3DEX A;  5G1L A;  6GSU A;  4HQS A;  4XRD A;  1KNG A;  1B4P A;  2HRF A;  1XBS A;  2CAI A;  1FOV A;  4TXO B;  1UA5 A;  1OE7 A;  4XS4 B;  2F9S A;  4GSN A;  3FZA A;  2R2J A;  3ZIJ A;  4TN8 A;  2FUG 2;  5ID2 B;  2YN1 A;  1AAZ A;  2P31 A;  2VCZ A;  3VFI A;  2V6K A;  3E0U A;  4EF0 A;  5EL8 A;  5GAN D;  4HZ4 A;  3FRC A;  1GSD A;  4WET A;  1DUG A;  5JCU A;  5ECP B;  2GT5 A;  2NTO A;  4MH3 A;  4OCE A;  1TRS A;  5ECM B;  5D93 A;  1M0U A;  4MMM A;  1QQ2 A;  2JSZ A;  4MAB A;  5ABR A;  3DIE A;  3KD0 A;  3HZ8 A;  4BPY A;  3UIW A;  3TOT A;  2FA4 A;  2GS3 A;  3IXR A;  4ID0 A;  4IVF A;  5F07 A;  2GSQ A;  4TR1 A;  2EIR A;  4LA1 A;  5L71 A;  2N5B A;  3UBK A;  3QPM A;  1HQO A;  2HSM A;  3G7I A;  5GSS A;  2AAW A;  4IJI A;  11GS A;  4D73 B;  2H1D A;  3IHQ A;  4CDO A;  3L9V A;  4PX1 A;  1A24 A;  1AQX A;  4LL4 B;  3EE2 A;  3CSH A;  3C71 A;  4JR6 A;  3VPQ A;  4YAP A;  4I2U A;  4NHZ A;  3OR5 A;  2WS2 A;  3H1N A;  3IPZ A;  4OO4 A;  1V57 A;  2L5L A;  4HOJ A;  4PQH A;  1BQ7 A;  4WF5 A;  2VCV A;  3ZIT A;  4L0U A;  4ML6 A;  1V9W A;  2ZNM A;  5D9V A;  4G0K A;  2CAQ A;  4ECC A;  3EU3 A;  1GWC A;  2HZF A;  3TDG A;  4RQX A;  3LEF A;  1MDI A;  2FNO A;  1GUL A;  2YWM A;  3QD9 A;  1SEN A;  2GZY A;  4FYB A;  1RW1 A;  5AIX A;  1XWC A;  1U6T A;  2IMD A;  1H75 A;  3TRP A;  2WUL A;  3GTU A;  2X99 A;  2HRA A;  4MDC A;  4XS1 A;  4N10 A;  3FHK A;  3HJO A;  3ERG A;  3ZML A;  3E9J B;  3IBH A;  3QOU A;  4PUR A;  1TOF A;  4GQC A;  4IJ3 A;  3BD2 A;  10GS A;  4PQ1 A;  3DVW A;  2E7P A;  3GUS A;  3ME8 A;  1NM3 A;  1FAA A;  2A2S A;  2PPT A;  4NAX A;  3JCM L;  4KW6 A;  3APQ A;  4FO5 A;  4X1U A;  3ZYW A;  4CHS A;  3QMX A;  1YEX A;  3TJF A;  1KBN A;  5HR2 A;  1URM A;  5DBQ A;  1F2E A;  5G5F A;  4XS4 A;  3SBC A;  1THX A;  3BJ5 A;  3EIN A;  2F8F A;  1QUW A;  2P5R A;  3RDW A;  2H19 A;  1Z9H A;  1XCC A;  6GST A;  2VCX A;  2C8U A;  5IPG A;  4WBJ A;  3FR3 A;  1HYU A;  5GZZ B;  1GUM A;  1R5P A;  5EPF A;  3TKR A;  4IP6 A;  4OWY A;  4GXZ A;  1S3D A;  3FZ9 A;  4MF5 A;  22GS A;  1XVW A;  1ZGN A;  2HSY A;  3NZN A;  1R5A A;  2XPD A;  2PVQ A;  1GNW A;  4ZBA A;  3QR6 A;  2R5G A;  4NWY A;  3WT2 A;  4PTS A;  1EGO A;  2FWG A;  5C00 A;  4EXJ A;  3WGE A;  2HQT A;  1IYI A;  1MDJ A;  1YF1 A;  4FIW A;  1SKR B;  1TTZ A;  4ZL7 A;  2H75 A;  3D21 A;  1M9B A;  1PX6 A;  2PVO C;  1XVQ A;  5IMD A;  3KTL A;  4KA0 A;  3DXB A;  3TKQ A;  1F3A A;  3WGD A;  2GQM A;  2D2Z A;  1X0R A;  4ECI A;  1DSB A;  2JZS A;  2HZE A;  5D9T A;  4Q5Q A;  3WGX A;  5JWR B;  4EL1 A;  3UJ1 A;  1ZYE A;  3DD3 A;  2KLX A;  2J23 A;  1USB A;  2X8H A;  3ZVJ A;  2MMO A;  2VCW A;  1A8Y A;  1B8X A;  2DJ0 A;  5DAL B;  2V1M A;  2BJX A;  4TRX A;  4I8B A;  4ZIJ A;  2YV9 A;  2AYT A;  4RQR A;  3F6D A;  4N11 A;  3L0H A;  4HQZ A;  3F8U A;  4DSS B;  4TXV A;  4TW5 A;  3IAM 2;  2IFQ A;  2X8C A;  5D9W A;  4V2L A;  1TK5 B;  4MPF A;  3A2V A;  3LFL A;  2R6K A;  1K3O A;  1TDI A;  1M2A A;  3F6F A;  5IM9 A;  4V2N A;  1AUC A;  4O5R A;  1QXH A;  4TR4 A;  2YP6 A;  2H76 A;  1ML6 A;  1XPV A;  4NV2 A;  3KH7 A;  4YH2 A;  1E2Y A;  4ZBB A;  1O7U A;  1XW5 A;  2MMZ A;  1A2M A;  2C0G A;  3KGK A;  2DML A;  1ST9 A;  3VLN A;  1GSY A;  3TJG A;  3PGT A;  3UOM A;  2H74 A;  5IMF A;  3GSS A;  4KSO A;  2CV4 A;  1J08 A;  3GFK A;  4K7N A;  1SL2 B;  2H1B A;  2E2G A;  2HRK B;  3EWL A;  1SYR A;  3ZFL A;  3DYR A;  1V58 A;  2XHF A;  1A8L A;  2QC7 A;  4POK A;  1QFN A;  3D4T A;  4MZB A;  1R7H A;  4MJE A;  3KTB A;  4ZL9 A;  2FHE A;  3VPT A;  5CAX A;  2F51 A;  2G0F A;  4KUN A;  3C7M A;  3KM6 A;  3C73 A;  1PKW A;  3ERW A;  4MF7 A;  4KH7 A;  3LXZ A;  3KEB A;  5A4U A;  3A2W A;  5IMA A;  4HU9 A;  2KOK A;  4OD7 A;  4N30 A;  4GRF A;  3TRQ A;  2OKA A;  5DCG A;  4KCA A;  4KCE A;  4O7H A;  5J41 A;  1JZR A;  3RAZ A;  1JLV A;  1SU9 A;  1M7T A;  2YWN A;  1X9M B;  2I81 A;  1WPI A;  3A5W A;  1T4Y A;  2B1L A;  3D6I A;  1K0D A;  3RHB A;  5CYY A;  4EKZ A;  1LJR A;  3WD6 A;  2PUK C;  3FR9 A;  5B8B A;  3K8N A;  1JFU A;  4PUA A;  2UZ8 A;  4EC0 A;  4G0I A;  2K18 A;  5DQY A;  3IK9 A;  3TRX A;  4ECB A;  5CRE A;  3TKS E;  3IA1 A;  5ECI B;  5CP1 A;  4OFN A;  4IQ1 A;  3D5J A;  2IL3 A;  4RI6 A;  1UN2 A;  4HJM A;  1TRU A;  2DJ2 A;  3GKX A;  5ECN B;  2DSA A;  4MZW A;  4G2E A;  4AJ7 A;  5DAL A;  5A4W A;  1M9A A;  5LNK e;  3D4M A;  5B7C A;  1PA3 A;  3CTG A;  1F37 A;  1T8E B;  3GX0 A;  2LUS A;  5COH A;  17GS A;  1YZX A;  1XWA A;  4BVY A;  5KEJ A;  1E6B A;  4IHU A;  1GRX A;  4BL7 B;  5G5E A;  3EMX A;  5F05 A;  2LEG A;  1QMV A;  1TRV A;  3F4R A;  3R2Q A;  3DVX A;  3I43 A;  1SYX A;  2JAC A;  2VOC A;  4MK3 A;  3P7X A;  3APS A;  4KDU A;  2V32 A;  2GZP A;  2OA7 A;  5EVO A;  3M9K A;  2GZZ A;  3C8E A;  4BVX B;  2L4C A;  4GCI A;  4JZQ A;  1G6Y A;  3L9U A;  1TK8 B;  1XOA A;  5AN1 A;  1ACV A;  3LYK A;  4BA7 A;  1FO5 A;  1AQW A;  2EC4 A;  2VL9 A;  1EZK A;  3GMF A;  1ZMA A;  4IQA A;  1T1V A;  1SK2 A;  5IOX A;  2MMN A;  3MDK A;  18GS A;  4ZIL A;  4ZB8 A;  4L0W A;  4TVE A;  3TKS C;  3LSZ A;  1O81 A;  3HVS A;  2C3N A;  3IAS 2;  2OE3 A;  3KP8 A;  4F82 A;  2I1U A;  1GP1 A;  4HDE A;  4F2I A;  2FWF A;  3VWU A;  3VUR A;  2A4V A;  3KIJ A;  3LQ7 A;  4PGT A;  1UC7 A;  2RII A;  2WFC A;  3FY7 A;  2OAD A;  2VCQ A;  2J9H A;  3D0Z A;  2H01 A;  2B5X A;  3FW2 A;  4NMU A;  4Q5R A;  3QAG A;  3DML A;  3CSJ A;  3G9B A;  2AB6 A;  2VUP A;  1JLW A;  3ZLP A;  3HXS A;  1FG4 A;  2DJJ A;  2EIQ A;  3M9J A;  3A2X A;  5ECH B;  4AF2 A;  4V2M A;  3DRN A;  2QKE A;  2OE0 A;  4DEJ A;  3ZFB A;  3MWH A;  4QL9 A;  2IIY A;  1V2A A;  1OC9 A;  4JBB A;  1PN9 A;  1GTA A;  5ECK B;  1K0C A;  3LG6 A;  1A23 A;  5A5K A;  4HZ2 A;  1Z6M A;  4Q5N A;  1K3L A;  4KAE A;  2CX4 A;  4IW9 A;  12GS A;  4EVM A;  4K1F A;  5E4W A;  4ZXG A;  3HJM A;  3TJK A;  5IMC A;  4Q5F A;  2IJY A;  2A2R A;  4WF4 A;  4KB3 A;  4OFM A;  3GN3 A;  4GWR A;  3FZ5 A;  1TRW A;  3CYN A;  1KEB A;  3UBL A;  4AGS A;  4MA9 A;  4K7I A;  1JZW A;  4LLR A;  5IQY A;  1NHO A;  1TU7 A;  2CVD A;  4HJ2 A;  4I2T A;  5GAP D;  5DAK A;  2PGT A;  3F0I A;  5E59 A;  1DBY A;  3EYT A;  2L59 A;  3M3M A;  2OBK A;  1GSF A;  4MJC A;  2IN3 A;  2K8S A;  1YQ1 A;  1Y6E A;  3LJR A;  2QGV A;  6GSY A;  2YWO A;  3EVI A;  2OAC A;  1MEK A;  1X5E A;  1XW9 A;  5H5Q A;  1K0M A;  3MSZ A;  2V41 A;  1EGR A;  1N2A A;  1K0B A;  5ELA A;  1GH2 A;  1SK1 A;  2CQ9 A;  2YCD A;  1THO A;  4TXO A;  1FVK A;  1Q4J A;  1OKT A;  4ML1 A;  2AV4 A;  4MP4 A;  5ID2 A;  1VF4 A;  3HKR A;  1ILO A;  3UMA A;  5IOW A;  2B5E A;  1EV9 A;  1GSQ A;  3QFB C;  3TJB A;  4WKW A;  1T3B A;  1YF0 A;  2DLX A;  3GH6 A;  2B7K A;  3TB2 A;  1WE0 A;  2H0I A;  2ES7 A;  3H4K A;  4PNG A;  5CO3 A;  3O3T A;  3WYW A;  2M80 A;  3HD5 A;  2H72 A;  3PH9 A;  3UAP A;  1SJZ A;  3HZ4 A;  1X9S B;  4KSM A;  1SKW B;  1MD4 A;  3RPP A;  2VL2 C;  1ABA A;  3HHV A;  2NBS A;  4V1A p;  2VAF A;  2H6Y A;  2ZCT A;  3TJJ A;  3W8S A;  3PR8 A;  1GSE A;  3IOS A;  3KJY A;  2HLS A;  1OC3 A;  1GSU A;  3C1S A;  3NIV A;  1WIK A;  2JZR A;  1TJD A;  3F3Q A;  1EOG A;  1XW6 A;  5G30 A;  2CVB A;  1X9W B;  2REM A;  2IMF A;  4D73 A;  2CT6 A;  4MZC A;  2K9F A;  2C0D A;  3IC8 A;  3GHA A;  3ZMK A;  5B8A A;  3CRU A;  2LST A;  2C4J A;  4E8H A;  2H70 A;  2HE3 A;  2OBI A;  4G9H A;  3M1G A;  4ACS A;  2I4A A;  1TK0 B;  2AHE A;  1Q98 A;  5HR3 A;  1AW9 A;  2O87 A;  5ENU A;  3FR6 A;  2L57 A;  2BMX A;  1GUK A;  3CBU A;  4EDZ A;  4FYU A;  2X64 A;  2LRC A;  3IR4 A;  2PN8 A;  2YPM A;  3ZZX A;  1J0F A;  3VK9 A;  1SD8 A;  4JE1 A;  4J2F A;  2C0F A;  3F63 A;  1PKZ A;  2DBC A;  4MJA A;  5F0G A;  3DKS A;  2QSI A;  2RLI A;  1WOU A;  3CMI A;  1EOH A;  1XFL A;  1BJX A;  1FVJ A;  4TR3 A;  3H93 A;  1PX7 A;  1HD2 A;  5H5S A;  2CA8 A;  4GSS A;  5HR0 A;  2WJU A;  2GSS A;  1S3A A;  1JZD A;  2G2Q A;  1EP7 A;  3L4N A;  3DGQ A;  2FLS A;  3CXG A;  3VI5 A;  2LTK A;  13GS A;  4PQI A;  4MH2 A;  3EC3 A;  3U5R E;  1Z3E A;  4XS6 A;  4X43 A;  5DJL A;  6GSV A;  1O85 A;  2GT6 A;  4HEA 2;  1VGL A;  1GLP A;  1M2B A;  2FY6 A;  1NHY A;  5IPH A;  2R3X A;  1GTI A;  3CTF A;  4O92 A;  3I9V 2;  3LOR A;  2WGR A;  3KCM A;  3N9J A;  3J7Y k;  3O6T A;  4G10 A;  1PL2 A;  2LKU A;  6GSS A;  1XWB A;  4N0V A;  2H66 A;  3GKK A;  3WT1 A;  4XCS A;  2HYX A;  1NSW A;  2VM1 A;  2WCI A;  2C3Q A;  1O8X A;  4WXT A;  2B7J A;  3S9F A;  4AJ8 A;  2VD1 A;  1ERT A;  1ERU A;  3O76 A;  4USS A;  4WR5 A;  5DJM A;  1PGT A;  2F3M A;  1A0R P;  1K0A A;  5ECR B;  2RUF A;  4TR1 B;  1ZCP A;  4JR4 A;  2R37 A;  1SD9 A;  3FKF A;  4K2D A;  2C3T A;  1EWX A;  2YJ7 A;  2HSM B;  1OE8 A;  5D8I A;  2LS5 A;  1QK8 A;  2HT9 A;  4OCF A;  2DIZ A;  3TOU A;  1H4O A;  1UVZ A;  2VM2 A;  1B4Q A;  2CZ3 A;  4IKH A;  4KDY A;  2H1A A;  3L9S A;  2AJQ B;  2KP1 A;  1WJK A;  1OVN A;  5GST A;  3IV4 A;  4JU5 A;  2VLT A;  3GH9 A;  1YDK A;  4MF6 A;  4TKY A;  3ERF A;  1X5C A;  1FHE A;  4OMV A;  5IMV A;  5KN2 A;  3GRX A;  3C1R A;  1TU8 A;  5CRH A;  1ZZY A;  2N5A A;  3AY8 A;  2HI7 A;  3EU4 A;  1VF1 A;  1TXX A;  4NHW A;  1NW2 A;  3F4S A;  2LQQ A;  2BTO T;  4FH8 A;  4IBP A;  2DIY A;  1YKC A;  2K6V A;  3PIN A;  2H8L A;  5D96 A;  1PMT A;  4LMW A;  3P2A A;  3VWV A;  3E3E A;  3UVH A;  3KMO A;  1PD2 1;  5ECO B;  2R4V A;  4WR4 A;  2VLU A;  1Z7P A;  2KP2 A;  1VF3 A;  3LGC A;  2IWT A;  2L4Q A;  1XZO A;  3G7J A;  3HVV A;  4ISD A;  4ILF A;  1PQN A;  2GGT A;  3H79 A;  1J9B A;  4LL1 B;  1A2L A;  1RQM A;  6GSW A;  3U6V A;  5CRG A;  2DMM A;  5JWQ B;  4XTS A;  3W6G A;  3APO A;  4DSS A;  5IO0 A;  1SJI A;  4JRR A;  1AC1 A;  1T00 A;  4KE3 A;  1RK4 A;  4K6X A;  1OKD A;  1R4W A;  3TKS A;  4I5Q A;  1SK0 A;  2OE1 A;  1MDK A;  2GTU A;  1YJ6 A;  2GVP A;  2PWJ A;  4YAV A;  1GTU A;  2YV7 A;  5BMU A;  2VL3 A;  2KUC A;  4RUV A;  2V6O A;  3GIX A;  1IYH A;  5D9X A;  3R3E A;  4MPG A;  1FB0 A;  3F4T A;  4I6X A;  5F8B A;  3H8Q A;  2RM6 A;  1XIY A;  1PSQ A;  4POL A;  5J9C A;  1M2D A;  3CRT A;  4XHM A;  1F6M C;  3A3T A;  2H71 A;  5JCG A;  2C1Y A;  4K9Z A;  4K8M A;  3Q6O A;  2GQK A;  2HRK A;  3M8N A;  1TP9 A;  4H86 A;  1TKD B;  2H73 A;  2O85 A;  4YQV A;  1SL0 B;  5HFI A;  2LV3 A;  2O89 A;  3QDN A;  1R26 A;  3HJP A;  1I9D A;  3ZRE A;  2E0Q A;  3VI7 A;  3IK7 A;  2HSN B;  2JU5 A;  2ON7 A;  1F9M A;  3QAV A;  4ZB9 A;  4F0C A;  1HNB A;  2IMI A;  5CNW A;  2TRX A;  4FQU A;  2GST A;  4GTU A;  5B6N A;  4EUY A;  3UAR A;  3F3R A;  1PL1 A;  3P90 A;  3HDC A;  4J56 E;  2B1K A;  3Q19 A;  2MZC A;  3N5O A;  3W8J A;  3UEM A;  3ME7 A;  2HZE B;  2FWE A;  1JHB A;  2L5O A;  3PPU A;  3RBT A;  1FB6 A;  2HSH A;  2M72 A;  4EO3 A;  2L6C A;  4L5O A;  5FHI A;  3VWX A;  2RUE A;  4QQ7 A;  1WMJ A;  2MBS A;  1EP8 A;  2H0H A;  1VF2 A;  4PNF A;  1BYE A;  1FW1 A;  4IS0 A;  3BCI A;  4L5L A;  3UL3 A;  2H1G A;  2LJK A;  3GA4 A;  3GNJ A;  4ZBD A;  5DCH A;  4F0B A;  2DJ3 A;  1OC8 A;  5FT3 A;  2FGX A;  5AIS A;  4J57 E;  4NPB A;  5DVB A;  4IP1 A;  3V1W A;  1Z7R A;  1PRX A;  1HNA A;  1JZO A;  2IFQ B;  3ZVJ D;  4IGJ A;  1ERV A;  1GUH A;  3BOA A;  3RHC A;  5INY A;  1K0N A;  1G7E A;  5EY6 A;  2WZ9 A;  1U88 A;  4OO5 A;  5H5R A;  3FK8 A;  4XRA A;  1G7O A;  3KMN A;  3L78 A;  1EV4 A;  1B9Y C;  4I97 A;  3HY2 A;  2O8V B;  5LCZ A;  1OAZ A;  2C0E A;  4BL7 A;  3EUR A;  2O7K A; 
#chains in the Genus database with same CATH topology
 2AUV A;  2YAN A;  1AIU A;  4YQU A;  4GST A;  2FD3 A;  4NXI A;  5ECS A;  2IPA A;  2VL2 A;  5HR1 A;  3CSI A;  1W89 A;  2V2G A;  5A1N B;  3Q74 A;  4XIH A;  2PU9 C;  3GKM A;  4BVX A;  4K0G A;  4QL7 A;  3BCK A;  1EEM A;  2TRC P;  4LMV A;  2LJR A;  2NVL A;  4GQF A;  3GL3 A;  3ZRD A;  4E68 A;  2JAD A;  2MMA A;  1PN0 A;  1XWG A;  5IMZ A;  2WVY A;  1ZL9 A;  4P3Y B;  2CX3 A;  4POB A;  2JSY A;  2H30 A;  3J7Y b;  2PBJ A;  1V40 A;  4HI7 A;  1BAY A;  4F9Z A;  4K7O A;  1G6W A;  4KND A;  3KP9 A;  5C04 A;  2XC2 A;  2XBI A;  3M0F A;  2CZ2 A;  4V1A g;  3A5I A;  3HCZ A;  1B48 A;  4EE0 A;  5KN0 A;  4AKI A;  5J9B A;  2YNX A;  1WWJ A;  1GNE A;  2ALB A;  1Z5Y E;  2WB9 A;  2H0G A;  3FYG A;  4ZB6 A;  1BX9 A;  3KH9 A;  3SWL A;  4DSR A;  4CW9 A;  1K0O A;  1U3I A;  1BG5 A;  3FZ4 A;  3HA9 A;  5J4U A;  4KDX A;  1C72 A;  2EIO A;  1A2J A;  2LRT A;  4PUF C;  5G31 A;  2Z9S A;  2H6X A;  1FOH A;  1Y25 A;  3HYP A;  5HFK A;  1BED A;  2X8G A;  1Z6N A;  3US3 A;  1YEP A;  5ECQ B;  1O6J A;  5KN1 A;  1YKA A;  5JCW A;  4EDY A;  4KGI A;  1B9X C;  2NPB A;  1TW9 A;  2DC5 A;  2KHP A;  4HS1 A;  4HU7 A;  5HFG A;  5IO2 A;  1GLQ A;  2B3S A;  4WEY A;  1HNC A;  4ULX A;  3ZTL A;  2N5F A;  5J5N A;  3ED3 A;  2HNL A;  4MJB A;  2VKZ G;  1SJ6 A;  4ZL8 A;  2O36 A;  3NOF A;  1M99 A;  2GLR A;  4AJ6 A;  4DSQ A;  2FWH A;  1Y1U A;  1V98 A;  4RI7 A;  2MBT A;  5CRD A;  2LJA A;  1AQV A;  1SVM A;  4BVY B;  2VCT A;  19GS A;  3ZIV A;  2VLV A;  2F8A A;  2K8V A;  2YJH A;  1YY7 A;  5JWO B;  1ZYQ B;  2ZUP A;  2JZT A;  4MLY A;  4MCU A;  3ZL5 A;  5F06 A;  1OYJ A;  3KZQ A;  3KXO A;  2R0P A;  1DE1 A;  2LRN A;  3UVT A;  4KF9 A;  5A4V A;  3LXT A;  4FYC A;  3IRA A;  1LBK A;  2VO4 A;  2GQL A;  4TOP A;  2P5Q A;  5DQS A;  4KX4 A;  5D73 A;  1F3B A;  1A0F A;  2PMT A;  2HFD A;  5B6M A;  5ECL B;  3QFA C;  7GSS A;  2B6M A;  2HXK A;  1T7P B;  1ON4 A;  1ZOF A;  3RPN A;  2P0G A;  4O32 A;  3I6A A;  2YZU A;  1EEJ A;  1CQH A;  2EFD A;  3LWA A;  3GKN A;  2LNS A;  2WVX A;  4OFT A;  3MAK A;  2FA8 A;  3EMP A;  4BWS A;  1DE2 A;  2EFE A;  3ISO A;  6GSX A;  1PFO A;  3IC4 A;  1N8J A;  1WRY A;  2L6D A;  2LQO A;  4K0N A;  1I5G A;  9GSS A;  4MNN A;  3QAW A;  4POM A;  3GYK A;  3F9U A;  1GSS A;  1S4B P;  5LD0 A;  1SKS B;  5IIZ A;  3D22 A;  2CVK A;  4BWQ A;  1MTC A;  5G1K A;  2M46 A;  4YQM A;  2YWI A;  2VIM A;  1TI1 A;  3IHG A;  3TGZ A;  3VWW A;  3IDV A;  2I9H A;  4NV5 A;  2YOI A;  4GLT A;  2OJL A;  3GV1 A;  4N0Z A;  3TKP A;  3Q18 A;  2H6Z A;  5KN3 A;  5J3R A;  2GDR A;  2YZH A;  2X4A A;  3I69 A;  2VD0 A;  4JED A;  1S3C A;  1OC9 B;  3GL5 A;  4TR0 A;  3GUR A;  3TCO A;  2MYG A;  3RFR C;  1VRS D;  5DDL A;  4GF0 A;  3TUE A;  1O8W A;  2PER A;  1TI3 A;  1O73 A;  2IMK A;  2B5Y A;  2XBQ A;  1K3Y A;  1G0T A;  4PXO A;  1GTB A;  2WDU A;  2DJK A;  3IE3 A;  2TIR A;  14GS A;  4IN0 A;  2IME A;  4WBR D;  4F03 A;  2WRT A;  1X5D A;  1XOB A;  5HQP A;  1MD3 A;  2NDO A;  4DVC A;  5FWG A;  1SL1 B;  1WP0 A;  4IEL A;  8GSS A;  4L8E A;  2LNT A;  5CRW A;  3CHX C;  2RM5 A;  2C80 A;  2I3Y A;  1LU4 A;  1AXD A;  3HVX A;  3G7Y A;  1U87 A;  5G2Z A;  3GST A;  3GTU B;  20GS A;  5AGY A;  1QGV A;  1W4V A;  2XPE A;  2HRN A;  3LYP A;  4HUA A;  4K2X A;  3MNG A;  4Z7X A;  3BBY A;  4AI6 A;  1U3A A;  5DAK B;  3P8W A;  1XXU A;  1KTE A;  3QCP A;  4G19 A;  16GS A;  3DWV A;  3GX8 A;  1CQG A;  4EIQ A;  2FCH A;  4ICY A;  5ELG A;  1T4Z A;  2GSR A;  1GL8 A;  3FEU A;  2JL4 A;  4E8E A;  2DJ1 A;  1XWK A;  1ERW A;  4G0L A;  2E2M A;  4X0X A;  4O5U A;  4ECJ A;  5KOX A;  5AIV A;  2ON5 A;  3DEX A;  5G1L A;  6GSU A;  4HQS A;  4XRD A;  1KNG A;  1B4P A;  2HRF A;  1XBS A;  2CAI A;  1FOV A;  4TXO B;  1UA5 A;  1OE7 A;  4XS4 B;  2F9S A;  4GSN A;  3FZA A;  2R2J A;  3ZIJ A;  4TN8 A;  2FUG 2;  5ID2 B;  2YN1 A;  1M3J A;  1AAZ A;  2P31 A;  2VCZ A;  3VFI A;  2V6K A;  3E0U A;  4EF0 A;  5EL8 A;  5GAN D;  4HZ4 A;  3FRC A;  1GSD A;  4WET A;  1DUG A;  5JCU A;  5ECP B;  2GT5 A;  2NTO A;  4MH3 A;  4OCE A;  1TRS A;  5ECM B;  5D93 A;  1M0U A;  4MMM A;  1QQ2 A;  2JSZ A;  4MAB A;  5ABR A;  3DIE A;  3KD0 A;  3HZ8 A;  4BPY A;  3UIW A;  3TOT A;  2FA4 A;  2GS3 A;  3IXR A;  4ID0 A;  4IVF A;  5F07 A;  2GSQ A;  4TR1 A;  2EIR A;  4LA1 A;  5L71 A;  1YEW C;  2N5B A;  3UBK A;  3QPM A;  1HQO A;  2HSM A;  3G7I A;  5GSS A;  2AAW A;  4IJI A;  11GS A;  4D73 B;  2H1D A;  3IHQ A;  4CDO A;  3L9V A;  4PX1 A;  1A24 A;  1AQX A;  3RGB C;  3EE2 A;  4LL4 B;  3CSH A;  3C71 A;  4JR6 A;  2WVZ A;  3VPQ A;  4YAP A;  4I2U A;  4NHZ A;  3OR5 A;  2WS2 A;  3H1N A;  3IPZ A;  4OO4 A;  1V57 A;  2L5L A;  4HOJ A;  4PQH A;  1BQ7 A;  4WF5 A;  2VCV A;  3ZIT A;  4L0U A;  4ML6 A;  1V9W A;  2ZNM A;  5D9V A;  4G0K A;  2CAQ A;  4ECC A;  3EU3 A;  1GWC A;  2HZF A;  3TDG A;  4RQX A;  3LEF A;  1MDI A;  2FNO A;  1GUL A;  2YWM A;  3QD9 A;  1SEN A;  2GZY A;  4FYB A;  1RW1 A;  5AIX A;  1XWC A;  1U6T A;  2IMD A;  3MIX A;  1H75 A;  3TRP A;  5A5H B;  2WUL A;  3GTU A;  2X99 A;  2HRA A;  4MDC A;  4XS1 A;  4N10 A;  3FHK A;  3HJO A;  3ERG A;  3ZML A;  3E9J B;  3IBH A;  4A5P A;  3QOU A;  4PUR A;  1TOF A;  4GQC A;  4IJ3 A;  3BD2 A;  10GS A;  4PQ1 A;  3DVW A;  2E7P A;  3GUS A;  3ME8 A;  1NM3 A;  1FAA A;  2A2S A;  2PPT A;  4NAX A;  3JCM L;  4KW6 A;  3APQ A;  4FO5 A;  4X1U A;  3ZYW A;  3TU3 B;  4CHS A;  3QMX A;  1YEX A;  3TJF A;  1KBN A;  5HR2 A;  1URM A;  4Z2T A;  5DBQ A;  1F2E A;  5G5F A;  4XS4 A;  3SBC A;  4BIK A;  1SVO A;  1THX A;  3BJ5 A;  5A34 A;  3EIN A;  2F8F A;  1QUW A;  4N3Z A;  2P5R A;  3RDW A;  2H19 A;  1Z9H A;  1XCC A;  6GST A;  2VCX A;  2C8U A;  5IPG A;  4WBJ A;  3FR3 A;  1HYU A;  5GZZ B;  1GUM A;  1R5P A;  5EPF A;  3TKR A;  4IP6 A;  4OWY A;  4GXZ A;  1S3D A;  3FZ9 A;  4MF5 A;  22GS A;  1XVW A;  1ZGN A;  2HSY A;  4GDF A;  3NZN A;  1R5A A;  2XPD A;  2PVQ A;  1GNW A;  4ZBA A;  3QR6 A;  2R5G A;  4NWY A;  3WT2 A;  2O5V A;  4PTS A;  1EGO A;  2FWG A;  5C00 A;  4EXJ A;  3WGE A;  2HSN A;  2HQT A;  1IYI A;  1MDJ A;  1YF1 A;  4FIW A;  1SKR B;  1TTZ A;  4ZL7 A;  2H75 A;  3D21 A;  1M9B A;  1PX6 A;  2PVO C;  1XVQ A;  5IMD A;  3KTL A;  4KA0 A;  3DXB A;  3TKQ A;  1F3A A;  3WGD A;  2GQM A;  2D2Z A;  1X0R A;  5KOW A;  4ECI A;  1DSB A;  4W66 A;  2JZS A;  2HZE A;  5D9T A;  4Q5Q A;  3WGX A;  5JWR B;  4EL1 A;  3UJ1 A;  4AKH A;  1ZYE A;  3DD3 A;  2KLX A;  3HVN A;  2O3E A;  2J23 A;  1USB A;  2X49 A;  2X8H A;  3ZVJ A;  2MMO A;  2VCW A;  4CY8 A;  1A8Y A;  1B8X A;  2DJ0 A;  5DAL B;  2V1M A;  2BJX A;  4TRX A;  4I8B A;  4ZIJ A;  2YV9 A;  2AYT A;  4RQR A;  3F6D A;  4N11 A;  3L0H A;  4HQZ A;  3F8U A;  4DSS B;  1SVL A;  4TXV A;  4TW5 A;  3IAM 2;  2IFQ A;  2X8C A;  5D9W A;  1TXU A;  4V2L A;  1TK5 B;  4MPF A;  3A2V A;  3LFL A;  2R6K A;  1K3O A;  1TDI A;  1M2A A;  3F6F A;  5IM9 A;  4V2N A;  5BMU B;  1AUC A;  4O5R A;  1QXH A;  4TR4 A;  2YP6 A;  2H76 A;  1ML6 A;  1XPV A;  4NV2 A;  3KH7 A;  4YH2 A;  1E2Y A;  4ZBB A;  1O7U A;  1XW5 A;  2MMZ A;  1A2M A;  2C0G A;  3KGK A;  2DML A;  5A1N A;  1ST9 A;  3VLN A;  4CY6 A;  1GSY A;  3TJG A;  3PGT A;  3UOM A;  2H74 A;  5IMF A;  3GSS A;  4KSO A;  2CV4 A;  1J08 A;  3GFK A;  4K7N A;  1SL2 B;  4O5Q A;  3MYD A;  2H1B A;  2E2G A;  2HRK B;  3EWL A;  1SYR A;  3ZFL A;  3DYR A;  1V58 A;  2XHF A;  1A8L A;  2QC7 A;  4POK A;  1ZYP A;  3LW9 A;  1QFN A;  2QA2 A;  3D4T A;  4MZB A;  1R7H A;  4MJE A;  3KTB A;  4ZL9 A;  2FHE A;  3VPT A;  5CAX A;  2F51 A;  2G0F A;  4KUN A;  3C7M A;  3KM6 A;  3C73 A;  1PKW A;  1N25 A;  3ERW A;  4MF7 A;  4KH7 A;  3LXZ A;  3KEB A;  5A4U A;  3A2W A;  5IMA A;  1BG1 A;  4HU9 A;  2KOK A;  4OD7 A;  4N30 A;  4GRF A;  3TRQ A;  2OKA A;  5DCG A;  4KCA A;  4KCE A;  4Z2U A;  4O7H A;  5J41 A;  1JZR A;  3RAZ A;  1JLV A;  1SU9 A;  1M7T A;  2YWN A;  1X9M B;  2I81 A;  1WPI A;  3A5W A;  1T4Y A;  2B1L A;  3D6I A;  1K0D A;  3RHB A;  5CYY A;  2DKI A;  4EKZ A;  1LJR A;  3WD6 A;  2PUK C;  3FR9 A;  5B8B A;  3K8N A;  1JFU A;  4PUA A;  2UZ8 A;  4EC0 A;  4G0I A;  2K18 A;  5DQY A;  3IK9 A;  3TRX A;  4ECB A;  5CRE A;  3TKS E;  3IA1 A;  1XG8 A;  5ECI B;  5CP1 A;  4OFN A;  4IQ1 A;  3D5J A;  1S3R A;  2IL3 A;  4RI6 A;  1UN2 A;  4HJM A;  1TRU A;  2DJ2 A;  1YVL A;  3GKX A;  5ECN B;  2DSA A;  4MZW A;  4G2E A;  4AJ7 A;  5DAL A;  5A4W A;  1M9A A;  5LNK e;  3D4M A;  5B7C A;  1PA3 A;  3CTG A;  1F37 A;  1T8E B;  3GX0 A;  2LUS A;  5COH A;  17GS A;  1YZX A;  1XWA A;  4BVY A;  5KEJ A;  1E6B A;  4IHU A;  1GRX A;  4BL7 B;  5G5E A;  3EMX A;  5F05 A;  2LEG A;  1QMV A;  1TRV A;  2UV8 G;  3F4R A;  3R2Q A;  3DVX A;  3I43 A;  1SYX A;  2JAC A;  2VOC A;  4MK3 A;  3P7X A;  3APS A;  4KDU A;  2V32 A;  2GZP A;  2OA7 A;  5EVO A;  3M9K A;  2GZZ A;  3C8E A;  4BVX B;  2L4C A;  4GCI A;  4JZQ A;  1G6Y A;  3L9U A;  2R0C A;  1TK8 B;  1XOA A;  3FMW A;  5AN1 A;  1ACV A;  3LYK A;  4BA7 A;  1FO5 A;  1AQW A;  2EC4 A;  2VL9 A;  4Z2R A;  1EZK A;  3GMF A;  1ZMA A;  4IQA A;  1T1V A;  1SK2 A;  5IOX A;  2WW2 A;  3MDK A;  2MMN A;  18GS A;  4ZIL A;  4ZB8 A;  4L0W A;  4TVE A;  3TKS C;  3LSZ A;  1O81 A;  3HVS A;  2C3N A;  3IAS 2;  2OE3 A;  3KP8 A;  4F82 A;  2I1U A;  1GP1 A;  4HDE A;  4F2I A;  2FWF A;  3VWU A;  3VUR A;  2A4V A;  3KIJ A;  3LQ7 A;  4PGT A;  1UC7 A;  2RII A;  2WFC A;  3FY7 A;  2OAD A;  2VCQ A;  2WW3 A;  2J9H A;  3D0Z A;  2H01 A;  2B5X A;  3FW2 A;  4NMU A;  4Q5R A;  3QAG A;  3DML A;  3CSJ A;  3G9B A;  2AB6 A;  2VUP A;  4PI0 C;  1JLW A;  3ZLP A;  3HXS A;  1FG4 A;  2DJJ A;  2EIQ A;  2R0G A;  3M9J A;  3A2X A;  2QA1 A;  5ECH B;  4AF2 A;  4V2M A;  3DRN A;  2QKE A;  2OE0 A;  4DEJ A;  3ZFB A;  3MWH A;  4QL9 A;  2IIY A;  1V2A A;  1OC9 A;  4JBB A;  1PN9 A;  1GTA A;  5ECK B;  1K0C A;  3LG6 A;  1A23 A;  5A5K A;  4HZ2 A;  1Z6M A;  4Q5N A;  1K3L A;  4KAE A;  2CX4 A;  4IW9 A;  12GS A;  4AKG A;  4EVM A;  4K1F A;  5BRT A;  5E4W A;  4ZXG A;  3HJM A;  3TJK A;  5IMC A;  4Q5F A;  2IJY A;  2A2R A;  4WF4 A;  4KB3 A;  4OFM A;  3GN3 A;  4GWR A;  3FZ5 A;  5J4Y A;  1TRW A;  3CYN A;  1KEB A;  3UBL A;  4AGS A;  4MA9 A;  4K7I A;  1JZW A;  4LLR A;  5IQY A;  1NHO A;  1TU7 A;  2CVD A;  4HJ2 A;  4I2T A;  5GAP D;  5DAK A;  3EPT A;  2PGT A;  3F0I A;  5E59 A;  1DBY A;  3EYT A;  2L59 A;  3M3M A;  2OBK A;  1GSF A;  4MJC A;  2IN3 A;  2K8S A;  1YQ1 A;  1Y6E A;  3LJR A;  2QGV A;  6GSY A;  2YWO A;  3EVI A;  2OAC A;  1MEK A;  1X5E A;  1XW9 A;  5H5Q A;  1K0M A;  3MSZ A;  2V41 A;  1EGR A;  1N2A A;  1K0B A;  5ELA A;  1GH2 A;  1SK1 A;  2CQ9 A;  2YCD A;  1THO A;  4TXO A;  1FVK A;  1Q4J A;  1OKT A;  5J40 A;  4ML1 A;  2AV4 A;  4MP4 A;  5ID2 A;  1VF4 A;  3HKR A;  1ILO A;  3UMA A;  5IOW A;  2B5E A;  1EV9 A;  1GSQ A;  3QFB C;  2WVX B;  3TJB A;  4WKW A;  1T3B A;  1YF0 A;  2DLX A;  3GH6 A;  2B7K A;  3TB2 A;  1WE0 A;  2H0I A;  2ES7 A;  3H4K A;  4PNG A;  5CO3 A;  3O3T A;  3WYW A;  2M80 A;  4X4J A;  3HD5 A;  2H72 A;  3PH9 A;  3UAP A;  1SJZ A;  3HZ4 A;  1X9S B;  4KSM A;  1SKW B;  1MD4 A;  3RPP A;  2VL2 C;  1ABA A;  3HHV A;  2NBS A;  4V1A p;  2VAF A;  2H6Y A;  2ZCT A;  3TJJ A;  3W8S A;  3PR8 A;  1GSE A;  3IOS A;  4K5S A;  3KJY A;  2HLS A;  1OC3 A;  1GSU A;  3C1S A;  4QMK A;  3NIV A;  1WIK A;  2JZR A;  1TJD A;  3F3Q A;  1EOG A;  1XW6 A;  5G30 A;  2CVB A;  1X9W B;  2REM A;  2IMF A;  4D73 A;  2CT6 A;  4MZC A;  2K9F A;  2C0D A;  3IC8 A;  3GHA A;  3ZMK A;  5B8A A;  3CRU A;  2LST A;  2C4J A;  4E8H A;  2H70 A;  2HE3 A;  2OBI A;  4G9H A;  3M1G A;  3CWG A;  4ACS A;  2I4A A;  1TK0 B;  2AHE A;  1Q98 A;  5HR3 A;  1AW9 A;  2O87 A;  5ENU A;  3FR6 A;  5J4V A;  2DKH A;  2L57 A;  2BMX A;  1GUK A;  3CBU A;  4EDZ A;  4FYU A;  2X64 A;  2LRC A;  3IR4 A;  2PN8 A;  2YPM A;  3ZZX A;  1J0F A;  3VK9 A;  3HMJ G;  1SD8 A;  4JE1 A;  4J2F A;  2C0F A;  3F63 A;  1PKZ A;  2DBC A;  4MJA A;  5F0G A;  3DKS A;  2QSI A;  2RLI A;  1WOU A;  3CMI A;  1EOH A;  1XFL A;  1BJX A;  1FVJ A;  4HSC X;  4TR3 A;  3H93 A;  1PX7 A;  1HD2 A;  5H5S A;  2CA8 A;  4GSS A;  5HR0 A;  5A5H A;  2WJU A;  2GSS A;  1S3A A;  1JZD A;  2G2Q A;  1EP7 A;  3L4N A;  3DGQ A;  2FLS A;  3CXG A;  3VI5 A;  2LTK A;  13GS A;  4PQI A;  4MH2 A;  3EC3 A;  3U5R E;  1Z3E A;  4XS6 A;  4X43 A;  5DJL A;  6GSV A;  1O85 A;  4PI2 C;  2GT6 A;  4HEA 2;  1VGL A;  1GLP A;  1M2B A;  2FY6 A;  1NHY A;  5IPH A;  2R3X A;  1GTI A;  3CTF A;  4O92 A;  3I9V 2;  3LOR A;  2WGR A;  3KCM A;  3N9J A;  3J7Y k;  3O6T A;  4G10 A;  1PL2 A;  2LKU A;  6GSS A;  1XWB A;  4N0V A;  2H66 A;  2OT3 A;  1ZYN A;  3GKK A;  3WT1 A;  4FXY P;  4XCS A;  2HYX A;  1NSW A;  2VM1 A;  2WCI A;  2C3Q A;  1O8X A;  4WXT A;  2B7J A;  3S9F A;  4AJ8 A;  2VD1 A;  1ERT A;  1ERU A;  3O76 A;  4USS A;  4WR5 A;  5DJM A;  1PGT A;  1BF5 A;  2F3M A;  1A0R P;  1K0A A;  5ECR B;  2RUF A;  4TR1 B;  1ZCP A;  4YKG A;  4JR4 A;  2R37 A;  1SD9 A;  3FKF A;  4K2D A;  2C3T A;  1EWX A;  2YJ7 A;  2HSM B;  1OE8 A;  2WW1 A;  5D8I A;  2LS5 A;  1QK8 A;  2HT9 A;  4OCF A;  2DIZ A;  3TOU A;  1H4O A;  1UVZ A;  2VM2 A;  1B4Q A;  2CZ3 A;  4IKH A;  4KDY A;  2H1A A;  3L9S A;  4EIP A;  2AJQ B;  2KP1 A;  1WJK A;  1OVN A;  5GST A;  4AKX B;  3IV4 A;  4JU5 A;  2VLT A;  3GH9 A;  1YDK A;  4MF6 A;  4TKY A;  3ERF A;  1X5C A;  1FHE A;  4OMV A;  5IMV A;  5KN2 A;  2H1L A;  3GRX A;  3C1R A;  4YKF A;  1TU8 A;  5CRH A;  1ZZY A;  2N5A A;  3AY8 A;  2HI7 A;  3EU4 A;  1VF1 A;  1TXX A;  4NHW A;  1NW2 A;  3F4S A;  2LQQ A;  2BTO T;  4FH8 A;  4IBP A;  2DIY A;  1YKC A;  4K5R A;  2K6V A;  3PIN A;  2H8L A;  5D96 A;  1PMT A;  4LMW A;  1I1I P;  3P2A A;  3VWV A;  3E3E A;  3UVH A;  3KMO A;  1PD2 1;  5J47 A;  5ECO B;  2R4V A;  4WR4 A;  2VLU A;  1Z7P A;  2KP2 A;  2EFH A;  1VF3 A;  3LGC A;  2IWT A;  2L4Q A;  1XZO A;  3G7J A;  3HVV A;  4ISD A;  4ILF A;  1PQN A;  2GGT A;  3H79 A;  1J9B A;  4LL1 B;  1A2L A;  1RQM A;  2A2P A;  6GSW A;  3U6V A;  5CRG A;  2DMM A;  5JWQ B;  4XTS A;  3W6G A;  3APO A;  4DSS A;  5IO0 A;  1SJI A;  4JRR A;  1AC1 A;  1T00 A;  4KE3 A;  1RK4 A;  4K6X A;  1OKD A;  1R4W A;  3TKS A;  4I5Q A;  1SK0 A;  2OE1 A;  1MDK A;  2GTU A;  1YJ6 A;  2GVP A;  2PWJ A;  4YAV A;  1GTU A;  2YV7 A;  5BMU A;  2VL3 A;  2WW0 A;  2KUC A;  4RUV A;  2V6O A;  3GIX A;  1IYH A;  5D9X A;  3R3E A;  4MPG A;  1FB0 A;  3F4T A;  4I6X A;  2WZS A;  5F8B A;  5A34 B;  3H8Q A;  2RM6 A;  1XIY A;  1PSQ A;  4POL A;  5J9C A;  1M2D A;  3CRT A;  4XHM A;  1F6M C;  3A3T A;  2H71 A;  5JCG A;  2C1Y A;  4K9Z A;  4K8M A;  3Q6O A;  2GQK A;  2HRK A;  3M8N A;  1TP9 A;  4H86 A;  1TKD B;  2H73 A;  2O85 A;  4YQV A;  1SL0 B;  5HFI A;  2LV3 A;  2O89 A;  3QDN A;  1R26 A;  3HJP A;  1I9D A;  3ZRE A;  2E0Q A;  3VI7 A;  3IK7 A;  2HSN B;  2JU5 A;  2ON7 A;  1F9M A;  3QAV A;  2A4H A;  4ZB7 A;  4ZB9 A;  4F0C A;  1HNB A;  2IMI A;  5CNW A;  2TRX A;  4FQU A;  2GST A;  4GTU A;  5B6N A;  4EUY A;  3UAR A;  3F3R A;  2EFC A;  1PL1 A;  3P90 A;  3HDC A;  4J56 E;  2B1K A;  3Q19 A;  2MZC A;  3N5O A;  3W8J A;  3UEM A;  3ME7 A;  2HZE B;  2FWE A;  1JHB A;  2L5O A;  3PPU A;  3RBT A;  1FB6 A;  2HSH A;  2M72 A;  4EO3 A;  2L6C A;  4L5O A;  5FHI A;  3VWX A;  2RUE A;  4QQ7 A;  4G01 A;  1WMJ A;  2MBS A;  1M3I A;  1EP8 A;  4PHZ C;  2H0H A;  1VF2 A;  4PNF A;  1BYE A;  1FW1 A;  4IS0 A;  3BCI A;  4L5L A;  3UL3 A;  2H1G A;  2LJK A;  3GA4 A;  3GNJ A;  4ZBD A;  5DCH A;  4F0B A;  2DJ3 A;  1OC8 A;  5FT3 A;  2FGX A;  5AIS A;  4J57 E;  4NPB A;  5DVB A;  4IP1 A;  3V1W A;  1Z7R A;  1PRX A;  1HNA A;  1JZO A;  2IFQ B;  3ZVJ D;  4IGJ A;  1ERV A;  1GUH A;  3BOA A;  3RHC A;  5INY A;  1K0N A;  1G7E A;  5EY6 A;  2WZ9 A;  1U88 A;  4OO5 A;  5H5R A;  3FK8 A;  4XRA A;  1G7O A;  3KMN A;  3L78 A;  1EV4 A;  1B9Y C;  4I97 A;  3HY2 A;  2O8V B;  5LCZ A;  1OAZ A;  2C0E A;  4BL7 A;  3EUR A;  2O7K A;  3CQF A; 
#chains in the Genus database with same CATH homology
 2AUV A;  2YAN A;  1AIU A;  4YQU A;  4GST A;  2FD3 A;  4NXI A;  5ECS A;  2IPA A;  2VL2 A;  5HR1 A;  3CSI A;  1W89 A;  2V2G A;  5A1N B;  3Q74 A;  4XIH A;  2PU9 C;  3GKM A;  4BVX A;  4K0G A;  4QL7 A;  3BCK A;  1EEM A;  2TRC P;  4LMV A;  2LJR A;  2NVL A;  4GQF A;  3GL3 A;  3ZRD A;  4E68 A;  2JAD A;  2MMA A;  1PN0 A;  1XWG A;  5IMZ A;  1ZL9 A;  4P3Y B;  2CX3 A;  4POB A;  2JSY A;  2H30 A;  3J7Y b;  2PBJ A;  1V40 A;  4HI7 A;  1BAY A;  4F9Z A;  4K7O A;  1G6W A;  4KND A;  3KP9 A;  5C04 A;  2XC2 A;  2XBI A;  3M0F A;  2CZ2 A;  4V1A g;  3A5I A;  3HCZ A;  1B48 A;  4EE0 A;  5KN0 A;  4AKI A;  5J9B A;  2YNX A;  1WWJ A;  1GNE A;  2ALB A;  1Z5Y E;  2WB9 A;  2H0G A;  3FYG A;  4ZB6 A;  1BX9 A;  3KH9 A;  3SWL A;  4DSR A;  4CW9 A;  1K0O A;  1U3I A;  1BG5 A;  3FZ4 A;  3HA9 A;  5J4U A;  4KDX A;  1C72 A;  2EIO A;  1A2J A;  2LRT A;  4PUF C;  5G31 A;  2Z9S A;  2H6X A;  1FOH A;  1Y25 A;  3HYP A;  5HFK A;  1BED A;  2X8G A;  1Z6N A;  3US3 A;  1YEP A;  5ECQ B;  1O6J A;  5KN1 A;  1YKA A;  5JCW A;  4EDY A;  4KGI A;  1B9X C;  2NPB A;  1TW9 A;  2DC5 A;  2KHP A;  4HS1 A;  4HU7 A;  5HFG A;  5IO2 A;  1GLQ A;  2B3S A;  4WEY A;  1HNC A;  4ULX A;  3ZTL A;  2N5F A;  5J5N A;  3ED3 A;  2HNL A;  4MJB A;  2VKZ G;  1SJ6 A;  4ZL8 A;  3NOF A;  1M99 A;  2GLR A;  4AJ6 A;  4DSQ A;  2FWH A;  1Y1U A;  1V98 A;  4RI7 A;  2MBT A;  5CRD A;  2LJA A;  1AQV A;  1SVM A;  4BVY B;  2VCT A;  19GS A;  3ZIV A;  2VLV A;  2F8A A;  2K8V A;  2YJH A;  1YY7 A;  5JWO B;  1ZYQ B;  2ZUP A;  2JZT A;  4MLY A;  4MCU A;  3ZL5 A;  5F06 A;  1OYJ A;  3KZQ A;  3KXO A;  2R0P A;  1DE1 A;  2LRN A;  3UVT A;  4KF9 A;  5A4V A;  3LXT A;  4FYC A;  3IRA A;  1LBK A;  2VO4 A;  2GQL A;  4TOP A;  2P5Q A;  5DQS A;  4KX4 A;  5D73 A;  1F3B A;  1A0F A;  2PMT A;  2HFD A;  5B6M A;  5ECL B;  3QFA C;  7GSS A;  2B6M A;  2HXK A;  1T7P B;  1ON4 A;  1ZOF A;  3RPN A;  2P0G A;  4O32 A;  3I6A A;  2YZU A;  1EEJ A;  1CQH A;  2EFD A;  3LWA A;  3GKN A;  2LNS A;  4OFT A;  3MAK A;  2FA8 A;  3EMP A;  4BWS A;  1DE2 A;  2EFE A;  3ISO A;  6GSX A;  3IC4 A;  1N8J A;  1WRY A;  2L6D A;  2LQO A;  4K0N A;  1I5G A;  9GSS A;  4MNN A;  3QAW A;  4POM A;  3F9U A;  3GYK A;  1GSS A;  5LD0 A;  1SKS B;  5IIZ A;  3D22 A;  2CVK A;  4BWQ A;  1MTC A;  5G1K A;  2M46 A;  4YQM A;  2YWI A;  2VIM A;  1TI1 A;  3IHG A;  3TGZ A;  3VWW A;  3IDV A;  2I9H A;  4NV5 A;  2YOI A;  4GLT A;  2OJL A;  3GV1 A;  4N0Z A;  3TKP A;  3Q18 A;  2H6Z A;  5KN3 A;  5J3R A;  2GDR A;  2YZH A;  2X4A A;  3I69 A;  2VD0 A;  4JED A;  1S3C A;  1OC9 B;  3GL5 A;  4TR0 A;  3GUR A;  3TCO A;  2MYG A;  1VRS D;  5DDL A;  4GF0 A;  3TUE A;  1O8W A;  2PER A;  1TI3 A;  1O73 A;  2IMK A;  2B5Y A;  2XBQ A;  1K3Y A;  1G0T A;  4PXO A;  1GTB A;  2WDU A;  2DJK A;  3IE3 A;  2TIR A;  14GS A;  4IN0 A;  2IME A;  4WBR D;  4F03 A;  2WRT A;  1X5D A;  1XOB A;  5HQP A;  1MD3 A;  2NDO A;  4DVC A;  5FWG A;  1SL1 B;  1WP0 A;  4IEL A;  8GSS A;  4L8E A;  2LNT A;  5CRW A;  2RM5 A;  2C80 A;  2I3Y A;  1LU4 A;  1AXD A;  3HVX A;  3G7Y A;  1U87 A;  5G2Z A;  3GST A;  3GTU B;  20GS A;  5AGY A;  1QGV A;  1W4V A;  2XPE A;  2HRN A;  3LYP A;  4HUA A;  4K2X A;  3MNG A;  4Z7X A;  3BBY A;  4AI6 A;  1U3A A;  5DAK B;  3P8W A;  1XXU A;  1KTE A;  3QCP A;  4G19 A;  16GS A;  3DWV A;  3GX8 A;  1CQG A;  4EIQ A;  2FCH A;  4ICY A;  5ELG A;  1T4Z A;  2GSR A;  1GL8 A;  3FEU A;  2JL4 A;  4E8E A;  2DJ1 A;  1XWK A;  1ERW A;  4G0L A;  2E2M A;  4X0X A;  4O5U A;  4ECJ A;  5KOX A;  5AIV A;  2ON5 A;  3DEX A;  5G1L A;  6GSU A;  4HQS A;  4XRD A;  1KNG A;  1B4P A;  2HRF A;  1XBS A;  2CAI A;  1FOV A;  4TXO B;  1UA5 A;  1OE7 A;  4XS4 B;  2F9S A;  4GSN A;  3FZA A;  2R2J A;  3ZIJ A;  4TN8 A;  2FUG 2;  5ID2 B;  2YN1 A;  1AAZ A;  2P31 A;  2VCZ A;  3VFI A;  2V6K A;  3E0U A;  4EF0 A;  5EL8 A;  5GAN D;  4HZ4 A;  3FRC A;  1GSD A;  4WET A;  1DUG A;  5JCU A;  5ECP B;  2GT5 A;  2NTO A;  4MH3 A;  4OCE A;  1TRS A;  5ECM B;  5D93 A;  1M0U A;  4MMM A;  1QQ2 A;  2JSZ A;  4MAB A;  5ABR A;  3DIE A;  3KD0 A;  3HZ8 A;  4BPY A;  3UIW A;  3TOT A;  2FA4 A;  2GS3 A;  3IXR A;  4ID0 A;  4IVF A;  5F07 A;  2GSQ A;  4TR1 A;  2EIR A;  4LA1 A;  5L71 A;  2N5B A;  3UBK A;  3QPM A;  1HQO A;  2HSM A;  3G7I A;  5GSS A;  2AAW A;  4IJI A;  11GS A;  4D73 B;  2H1D A;  3IHQ A;  4CDO A;  3L9V A;  4PX1 A;  1A24 A;  1AQX A;  4LL4 B;  3EE2 A;  3CSH A;  3C71 A;  4JR6 A;  3VPQ A;  4YAP A;  4I2U A;  4NHZ A;  3OR5 A;  2WS2 A;  3H1N A;  3IPZ A;  4OO4 A;  1V57 A;  2L5L A;  4HOJ A;  4PQH A;  1BQ7 A;  4WF5 A;  2VCV A;  3ZIT A;  4L0U A;  4ML6 A;  1V9W A;  2ZNM A;  5D9V A;  4G0K A;  2CAQ A;  4ECC A;  3EU3 A;  1GWC A;  2HZF A;  3TDG A;  4RQX A;  3LEF A;  1MDI A;  2FNO A;  1GUL A;  2YWM A;  3QD9 A;  1SEN A;  2GZY A;  4FYB A;  1RW1 A;  5AIX A;  1XWC A;  1U6T A;  2IMD A;  3MIX A;  1H75 A;  3TRP A;  5A5H B;  2WUL A;  3GTU A;  2X99 A;  2HRA A;  4MDC A;  4XS1 A;  4N10 A;  3FHK A;  3HJO A;  3ERG A;  3ZML A;  3E9J B;  3IBH A;  4A5P A;  3QOU A;  4PUR A;  1TOF A;  4GQC A;  4IJ3 A;  3BD2 A;  10GS A;  4PQ1 A;  3DVW A;  2E7P A;  3GUS A;  3ME8 A;  1NM3 A;  1FAA A;  2A2S A;  2PPT A;  4NAX A;  3JCM L;  4KW6 A;  3APQ A;  4FO5 A;  4X1U A;  3ZYW A;  3TU3 B;  4CHS A;  3QMX A;  1YEX A;  3TJF A;  1KBN A;  5HR2 A;  1URM A;  4Z2T A;  5DBQ A;  1F2E A;  5G5F A;  4XS4 A;  3SBC A;  1SVO A;  1THX A;  3BJ5 A;  5A34 A;  3EIN A;  2F8F A;  1QUW A;  4N3Z A;  2P5R A;  3RDW A;  2H19 A;  1Z9H A;  1XCC A;  6GST A;  2VCX A;  2C8U A;  5IPG A;  4WBJ A;  3FR3 A;  1HYU A;  5GZZ B;  1GUM A;  1R5P A;  5EPF A;  3TKR A;  4IP6 A;  4OWY A;  4GXZ A;  1S3D A;  3FZ9 A;  4MF5 A;  22GS A;  1XVW A;  1ZGN A;  2HSY A;  4GDF A;  3NZN A;  1R5A A;  2XPD A;  2PVQ A;  1GNW A;  4ZBA A;  3QR6 A;  2R5G A;  4NWY A;  3WT2 A;  2O5V A;  4PTS A;  1EGO A;  2FWG A;  5C00 A;  4EXJ A;  3WGE A;  2HSN A;  2HQT A;  1IYI A;  1MDJ A;  1YF1 A;  4FIW A;  1SKR B;  1TTZ A;  4ZL7 A;  2H75 A;  3D21 A;  1M9B A;  1PX6 A;  2PVO C;  1XVQ A;  5IMD A;  3KTL A;  4KA0 A;  3DXB A;  3TKQ A;  1F3A A;  3WGD A;  2GQM A;  2D2Z A;  1X0R A;  5KOW A;  4ECI A;  1DSB A;  4W66 A;  2JZS A;  2HZE A;  5D9T A;  4Q5Q A;  3WGX A;  5JWR B;  4EL1 A;  3UJ1 A;  4AKH A;  1ZYE A;  3DD3 A;  2KLX A;  2J23 A;  1USB A;  2X49 A;  2X8H A;  3ZVJ A;  2MMO A;  2VCW A;  4CY8 A;  1A8Y A;  1B8X A;  2DJ0 A;  5DAL B;  2V1M A;  2BJX A;  4TRX A;  4I8B A;  4ZIJ A;  2YV9 A;  2AYT A;  4RQR A;  3F6D A;  4N11 A;  3L0H A;  4HQZ A;  3F8U A;  4DSS B;  1SVL A;  4TXV A;  4TW5 A;  3IAM 2;  2IFQ A;  2X8C A;  5D9W A;  1TXU A;  4V2L A;  1TK5 B;  4MPF A;  3A2V A;  3LFL A;  2R6K A;  1K3O A;  1TDI A;  1M2A A;  3F6F A;  5IM9 A;  4V2N A;  5BMU B;  1AUC A;  4O5R A;  1QXH A;  4TR4 A;  2YP6 A;  2H76 A;  1ML6 A;  1XPV A;  4NV2 A;  3KH7 A;  4YH2 A;  1E2Y A;  4ZBB A;  1O7U A;  1XW5 A;  2MMZ A;  1A2M A;  2C0G A;  3KGK A;  2DML A;  5A1N A;  1ST9 A;  3VLN A;  4CY6 A;  1GSY A;  3TJG A;  3PGT A;  3UOM A;  2H74 A;  5IMF A;  3GSS A;  4KSO A;  2CV4 A;  1J08 A;  3GFK A;  4K7N A;  1SL2 B;  4O5Q A;  3MYD A;  2H1B A;  2E2G A;  2HRK B;  3EWL A;  1SYR A;  3ZFL A;  3DYR A;  1V58 A;  2XHF A;  1A8L A;  2QC7 A;  4POK A;  1ZYP A;  3LW9 A;  1QFN A;  2QA2 A;  3D4T A;  4MZB A;  1R7H A;  4MJE A;  3KTB A;  4ZL9 A;  2FHE A;  3VPT A;  5CAX A;  2F51 A;  2G0F A;  4KUN A;  3C7M A;  3KM6 A;  3C73 A;  1PKW A;  1N25 A;  3ERW A;  4MF7 A;  4KH7 A;  3LXZ A;  3KEB A;  5A4U A;  3A2W A;  5IMA A;  1BG1 A;  4HU9 A;  2KOK A;  4OD7 A;  4N30 A;  4GRF A;  3TRQ A;  2OKA A;  5DCG A;  4KCA A;  4KCE A;  4Z2U A;  4O7H A;  5J41 A;  1JZR A;  3RAZ A;  1JLV A;  1SU9 A;  1M7T A;  2YWN A;  1X9M B;  2I81 A;  1WPI A;  3A5W A;  1T4Y A;  2B1L A;  3D6I A;  1K0D A;  3RHB A;  5CYY A;  2DKI A;  4EKZ A;  1LJR A;  3WD6 A;  2PUK C;  3FR9 A;  5B8B A;  3K8N A;  1JFU A;  4PUA A;  2UZ8 A;  4EC0 A;  4G0I A;  2K18 A;  5DQY A;  3IK9 A;  3TRX A;  4ECB A;  5CRE A;  3TKS E;  3IA1 A;  5ECI B;  5CP1 A;  4OFN A;  4IQ1 A;  3D5J A;  2IL3 A;  4RI6 A;  1UN2 A;  4HJM A;  1TRU A;  2DJ2 A;  1YVL A;  3GKX A;  5ECN B;  2DSA A;  4MZW A;  4G2E A;  4AJ7 A;  5DAL A;  5A4W A;  1M9A A;  5LNK e;  3D4M A;  5B7C A;  1PA3 A;  3CTG A;  1F37 A;  1T8E B;  3GX0 A;  2LUS A;  5COH A;  17GS A;  1YZX A;  1XWA A;  4BVY A;  5KEJ A;  1E6B A;  4IHU A;  1GRX A;  4BL7 B;  5G5E A;  3EMX A;  5F05 A;  2LEG A;  1QMV A;  1TRV A;  2UV8 G;  3F4R A;  3R2Q A;  3DVX A;  3I43 A;  1SYX A;  2JAC A;  2VOC A;  4MK3 A;  3P7X A;  3APS A;  4KDU A;  2V32 A;  2GZP A;  2OA7 A;  5EVO A;  3M9K A;  2GZZ A;  3C8E A;  4BVX B;  2L4C A;  4GCI A;  4JZQ A;  1G6Y A;  3L9U A;  2R0C A;  1TK8 B;  1XOA A;  3FMW A;  5AN1 A;  1ACV A;  3LYK A;  4BA7 A;  1FO5 A;  1AQW A;  2EC4 A;  2VL9 A;  4Z2R A;  1EZK A;  3GMF A;  1ZMA A;  4IQA A;  1T1V A;  1SK2 A;  5IOX A;  2MMN A;  3MDK A;  18GS A;  4ZIL A;  4ZB8 A;  4L0W A;  4TVE A;  3TKS C;  3LSZ A;  1O81 A;  3HVS A;  2C3N A;  3IAS 2;  2OE3 A;  3KP8 A;  4F82 A;  2I1U A;  1GP1 A;  4HDE A;  4F2I A;  2FWF A;  3VWU A;  3VUR A;  2A4V A;  3KIJ A;  3LQ7 A;  4PGT A;  1UC7 A;  2RII A;  2WFC A;  3FY7 A;  2OAD A;  2VCQ A;  2J9H A;  3D0Z A;  2H01 A;  2B5X A;  3FW2 A;  4NMU A;  4Q5R A;  3QAG A;  3DML A;  3CSJ A;  3G9B A;  2AB6 A;  2VUP A;  1JLW A;  3ZLP A;  3HXS A;  1FG4 A;  2DJJ A;  2EIQ A;  2R0G A;  3M9J A;  3A2X A;  2QA1 A;  5ECH B;  4AF2 A;  4V2M A;  3DRN A;  2QKE A;  2OE0 A;  4DEJ A;  3ZFB A;  3MWH A;  4QL9 A;  2IIY A;  1V2A A;  1OC9 A;  4JBB A;  1PN9 A;  1GTA A;  5ECK B;  1K0C A;  3LG6 A;  1A23 A;  5A5K A;  4HZ2 A;  1Z6M A;  4Q5N A;  1K3L A;  4KAE A;  2CX4 A;  4IW9 A;  12GS A;  4AKG A;  4EVM A;  4K1F A;  5BRT A;  5E4W A;  4ZXG A;  3HJM A;  3TJK A;  5IMC A;  4Q5F A;  2IJY A;  2A2R A;  4WF4 A;  4KB3 A;  4OFM A;  3GN3 A;  4GWR A;  3FZ5 A;  5J4Y A;  1TRW A;  3CYN A;  1KEB A;  3UBL A;  4AGS A;  4MA9 A;  4K7I A;  1JZW A;  4LLR A;  5IQY A;  1NHO A;  1TU7 A;  2CVD A;  4HJ2 A;  4I2T A;  5GAP D;  5DAK A;  3EPT A;  2PGT A;  3F0I A;  5E59 A;  1DBY A;  3EYT A;  2L59 A;  3M3M A;  2OBK A;  1GSF A;  4MJC A;  2IN3 A;  2K8S A;  1YQ1 A;  1Y6E A;  3LJR A;  2QGV A;  6GSY A;  2YWO A;  3EVI A;  2OAC A;  1MEK A;  1X5E A;  1XW9 A;  5H5Q A;  1K0M A;  3MSZ A;  2V41 A;  1EGR A;  1N2A A;  1K0B A;  5ELA A;  1GH2 A;  1SK1 A;  2CQ9 A;  2YCD A;  1THO A;  4TXO A;  1FVK A;  1Q4J A;  1OKT A;  5J40 A;  4ML1 A;  2AV4 A;  4MP4 A;  5ID2 A;  1VF4 A;  3HKR A;  1ILO A;  3UMA A;  5IOW A;  2B5E A;  1EV9 A;  1GSQ A;  3QFB C;  3TJB A;  4WKW A;  1T3B A;  1YF0 A;  2DLX A;  3GH6 A;  2B7K A;  3TB2 A;  1WE0 A;  2H0I A;  2ES7 A;  3H4K A;  4PNG A;  5CO3 A;  3O3T A;  3WYW A;  2M80 A;  4X4J A;  3HD5 A;  2H72 A;  3PH9 A;  3UAP A;  1SJZ A;  3HZ4 A;  1X9S B;  4KSM A;  1SKW B;  1MD4 A;  3RPP A;  2VL2 C;  1ABA A;  3HHV A;  2NBS A;  4V1A p;  2VAF A;  2H6Y A;  2ZCT A;  3TJJ A;  3W8S A;  3PR8 A;  1GSE A;  3IOS A;  4K5S A;  3KJY A;  2HLS A;  1OC3 A;  1GSU A;  3C1S A;  4QMK A;  3NIV A;  1WIK A;  2JZR A;  1TJD A;  3F3Q A;  1EOG A;  1XW6 A;  5G30 A;  2CVB A;  1X9W B;  2REM A;  2IMF A;  4D73 A;  2CT6 A;  4MZC A;  2K9F A;  2C0D A;  3IC8 A;  3GHA A;  3ZMK A;  5B8A A;  3CRU A;  2LST A;  2C4J A;  4E8H A;  2H70 A;  2HE3 A;  2OBI A;  4G9H A;  3M1G A;  3CWG A;  4ACS A;  2I4A A;  1TK0 B;  2AHE A;  1Q98 A;  5HR3 A;  1AW9 A;  2O87 A;  5ENU A;  3FR6 A;  5J4V A;  2DKH A;  2L57 A;  2BMX A;  1GUK A;  3CBU A;  4EDZ A;  4FYU A;  2X64 A;  2LRC A;  3IR4 A;  2PN8 A;  2YPM A;  3ZZX A;  1J0F A;  3VK9 A;  3HMJ G;  1SD8 A;  4JE1 A;  4J2F A;  2C0F A;  3F63 A;  1PKZ A;  2DBC A;  4MJA A;  5F0G A;  3DKS A;  2QSI A;  2RLI A;  1WOU A;  3CMI A;  1EOH A;  1XFL A;  1BJX A;  1FVJ A;  4TR3 A;  3H93 A;  1PX7 A;  1HD2 A;  5H5S A;  2CA8 A;  4GSS A;  5HR0 A;  5A5H A;  2WJU A;  2GSS A;  1S3A A;  1JZD A;  2G2Q A;  1EP7 A;  3L4N A;  3DGQ A;  2FLS A;  3CXG A;  3VI5 A;  2LTK A;  13GS A;  4PQI A;  4MH2 A;  3EC3 A;  3U5R E;  1Z3E A;  4XS6 A;  4X43 A;  5DJL A;  6GSV A;  1O85 A;  2GT6 A;  4HEA 2;  1VGL A;  1GLP A;  1M2B A;  2FY6 A;  1NHY A;  5IPH A;  2R3X A;  1GTI A;  3CTF A;  4O92 A;  3I9V 2;  3LOR A;  2WGR A;  3KCM A;  3N9J A;  3J7Y k;  3O6T A;  4G10 A;  1PL2 A;  2LKU A;  6GSS A;  1XWB A;  4N0V A;  2H66 A;  2OT3 A;  1ZYN A;  3GKK A;  3WT1 A;  4XCS A;  2HYX A;  1NSW A;  2VM1 A;  2WCI A;  2C3Q A;  1O8X A;  4WXT A;  2B7J A;  3S9F A;  4AJ8 A;  2VD1 A;  1ERT A;  1ERU A;  3O76 A;  4USS A;  4WR5 A;  5DJM A;  1PGT A;  1BF5 A;  2F3M A;  1A0R P;  1K0A A;  5ECR B;  2RUF A;  4TR1 B;  1ZCP A;  4YKG A;  4JR4 A;  2R37 A;  1SD9 A;  3FKF A;  4K2D A;  2C3T A;  1EWX A;  2YJ7 A;  2HSM B;  1OE8 A;  5D8I A;  2LS5 A;  1QK8 A;  2HT9 A;  4OCF A;  2DIZ A;  3TOU A;  1H4O A;  1UVZ A;  2VM2 A;  1B4Q A;  2CZ3 A;  4IKH A;  4KDY A;  2H1A A;  3L9S A;  4EIP A;  2AJQ B;  2KP1 A;  1WJK A;  1OVN A;  5GST A;  4AKX B;  3IV4 A;  4JU5 A;  2VLT A;  3GH9 A;  1YDK A;  4MF6 A;  4TKY A;  3ERF A;  1X5C A;  1FHE A;  4OMV A;  5IMV A;  5KN2 A;  2H1L A;  3GRX A;  3C1R A;  4YKF A;  1TU8 A;  5CRH A;  1ZZY A;  2N5A A;  3AY8 A;  2HI7 A;  3EU4 A;  1VF1 A;  1TXX A;  4NHW A;  1NW2 A;  3F4S A;  2LQQ A;  2BTO T;  4FH8 A;  4IBP A;  2DIY A;  1YKC A;  4K5R A;  2K6V A;  3PIN A;  2H8L A;  5D96 A;  1PMT A;  4LMW A;  3P2A A;  3VWV A;  3E3E A;  3UVH A;  3KMO A;  1PD2 1;  5J47 A;  5ECO B;  2R4V A;  4WR4 A;  2VLU A;  1Z7P A;  2KP2 A;  2EFH A;  1VF3 A;  3LGC A;  2IWT A;  2L4Q A;  1XZO A;  3G7J A;  3HVV A;  4ISD A;  4ILF A;  1PQN A;  2GGT A;  3H79 A;  1J9B A;  4LL1 B;  1A2L A;  1RQM A;  2A2P A;  6GSW A;  3U6V A;  5CRG A;  2DMM A;  5JWQ B;  4XTS A;  3W6G A;  3APO A;  4DSS A;  5IO0 A;  1SJI A;  4JRR A;  1AC1 A;  1T00 A;  4KE3 A;  1RK4 A;  4K6X A;  1OKD A;  1R4W A;  3TKS A;  4I5Q A;  1SK0 A;  2OE1 A;  1MDK A;  2GTU A;  1YJ6 A;  2GVP A;  2PWJ A;  4YAV A;  1GTU A;  2YV7 A;  5BMU A;  2VL3 A;  2KUC A;  4RUV A;  2V6O A;  3GIX A;  1IYH A;  5D9X A;  3R3E A;  4MPG A;  1FB0 A;  3F4T A;  4I6X A;  5F8B A;  5A34 B;  3H8Q A;  2RM6 A;  1XIY A;  1PSQ A;  4POL A;  5J9C A;  1M2D A;  3CRT A;  4XHM A;  1F6M C;  3A3T A;  2H71 A;  5JCG A;  2C1Y A;  4K9Z A;  4K8M A;  3Q6O A;  2GQK A;  2HRK A;  3M8N A;  1TP9 A;  4H86 A;  1TKD B;  2H73 A;  2O85 A;  4YQV A;  1SL0 B;  5HFI A;  2LV3 A;  2O89 A;  3QDN A;  1R26 A;  3HJP A;  1I9D A;  3ZRE A;  2E0Q A;  3VI7 A;  3IK7 A;  2HSN B;  2JU5 A;  2ON7 A;  1F9M A;  3QAV A;  2A4H A;  4ZB7 A;  4ZB9 A;  4F0C A;  1HNB A;  2IMI A;  5CNW A;  2TRX A;  4FQU A;  2GST A;  4GTU A;  5B6N A;  4EUY A;  3UAR A;  3F3R A;  2EFC A;  1PL1 A;  3P90 A;  3HDC A;  4J56 E;  2B1K A;  3Q19 A;  2MZC A;  3N5O A;  3W8J A;  3UEM A;  3ME7 A;  2HZE B;  2FWE A;  1JHB A;  2L5O A;  3PPU A;  3RBT A;  1FB6 A;  2HSH A;  2M72 A;  4EO3 A;  2L6C A;  4L5O A;  5FHI A;  3VWX A;  2RUE A;  4QQ7 A;  4G01 A;  1WMJ A;  2MBS A;  1EP8 A;  2H0H A;  1VF2 A;  4PNF A;  1BYE A;  1FW1 A;  4IS0 A;  3BCI A;  4L5L A;  3UL3 A;  2H1G A;  2LJK A;  3GA4 A;  3GNJ A;  4ZBD A;  5DCH A;  4F0B A;  2DJ3 A;  1OC8 A;  5FT3 A;  2FGX A;  5AIS A;  4J57 E;  4NPB A;  5DVB A;  4IP1 A;  3V1W A;  1Z7R A;  1PRX A;  1HNA A;  1JZO A;  2IFQ B;  3ZVJ D;  4IGJ A;  1ERV A;  1GUH A;  3BOA A;  3RHC A;  5INY A;  1K0N A;  1G7E A;  5EY6 A;  2WZ9 A;  1U88 A;  4OO5 A;  5H5R A;  3FK8 A;  4XRA A;  1G7O A;  3KMN A;  3L78 A;  1EV4 A;  1B9Y C;  4I97 A;  3HY2 A;  2O8V B;  5LCZ A;  1OAZ A;  2C0E A;  4BL7 A;  3EUR A;  2O7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...