1GNEA

The three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
232
structure length
232
Chain Sequence
b'SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMELDKWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Three-dimensional structure of Schistosoma japonicum glutathione S-transferase fused with a six-amino acid conserved neutralizing epitope of gp41 from HIV.
pubmed rcsb
source organism Synthetic construct
molecule tags Transferase
total genus 63
structure length 232
sequence length 232
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1994-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gneA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gneA01
4TR3A 5DCGA 1FVKA 5KEJA 2CX3A 5F0GA 4KE3A 4GF0A 3F6DA 3QAWA 2L4CA 2WDUA 5J9CA 12GSA 1MTCA 5AIXA 17GSA 2PWJA 1SL1B 3GSSA 4X0XA 4JZQA 1C72A 2FGXA 2NDOA 1OKTA 4POMA 2DLXA 2H76A 3VWWA 3EU4A 4GLTA 2O7KA 3F8UA 4K0NA 4P3YB 5EPFA 2GQKA 3FR6A 3WGEA 4FO5A 1MD3A 5D9TA 4TN8A 3QR6A 2V1MA 3C8EA 2HZFA 3Q6OA 1U3AA 4WBRD 1A24A 5CRHA 2CVDA 4PQ1A 4USSA 4L5OA 4YH2A 1S3CA 5ECOB 22GSA 1XCCA 3EYTA 3HJOA 2YNXA 2B5YA 2BMXA 2IIYA 2J23A 3I69A 4DVCA 1U3IA 4G0KA 2VLVA 2IMIA 2VL2C 4ZL9A 1R7HA 3FZAA 3HJPA 1T3BA 5HR1A 2PBJA 2J9HA 4RQRA 2LNTA 3VPTA 3IE3A 1NHYA 3EE2A 3KH9A 4PGTA 2O85A 4HU7A 4NMUA 3QCPA 3TRPA 3LJRA 4K7NA 2AV4A 2M80A 3BCKA 4FYCA 4OMVA 2YJHA 4I2TA 4F0CA 4G2EA 2VD0A 5D8IA 2CZ3A 3TKSE 3EVIA 3PH9A 1W4VA 2MMZA 1A23A 3IOSA 4KDUA 2R2JA 4V1Ag 1BJXA 3G7IA 3ZITA 4QQ7A 1LU4A 3CSIA 4IQ1A 3V1WA 2AYTA 3FK8A 4GRFA 3M3MA 3K8NA 3IPZA 1GL8A 3H79A 4BWSA 2N5AA 2X64A 1G0TA 4GWRA 4WKWA 6GSTA 4FIWA 2R5GA 1OC9B 2H71A 2CQ9A 5ECRB 2H1AA 2A2SA 1Q98A 1JZDA 3MWHA 5HQPA 5D96A 4Q5NA 3FZ9A 1Q4JA 2GTUA 2IJYA 2OADA 2MMOA 2PVQA 4N11A 4MLYA 3DGQA 6GSYA 1PMTA 2LSTA 3QFAC 2VCWA 3QFBC 1TP9A 2CVKA 5JWQB 4K9ZA 1T00A 3MDKA 2AHEA 2NBSA 4OFNA 2VCZA 4F9ZA 1XWGA 2RLIA 1SKRB 2R6KA 4IJIA 2RM6A 5HFGA 2B5EA 3HA9A 2GSRA 1YEPA 3M1GA 5IQYA 4XHMA 5A4UA 3GX0A 3KH7A 1BEDA 3GSTA 2ZUPA 3P2AA 2DMLA 3IA1A 4MZWA 3ISOA 2LUSA 1NHOA 4JU5A 4DEJA 4HU9A 2I3YA 4L5LA 3A3TA 1G7OA 2PGTA 5GZZB 4PURA 3GFKA 4BA7A 2QSIA 1J08A 3APOA 2Z9SA 4TR1B 3J7Yk 4EDYA 1OC9A 5A4WA 18GSA 1TJDA 1TOFA 5IMVA 2O87A 3WYWA 1XVWA 4NWYA 2KP1A 5JWOB 1JLVA 1FO5A 3TJFA 1TK0B 3TJJA 1ZMAA 6GSSA 3Q18A 2WRTA 2OE3A 3U6VA 2GSSA 1GTAA 3RDWA 3SBCA 4JE1A 3O76A 4H86A 3HVSA 3ZMLA 4QL7A 3D4TA 2H1BA 4CDOA 1YY7A 2ZCTA 3ERFA 1WPIA 4YQVA 3EWLA 3LFLA 2K6VA 1JZWA 3EURA 5FWGA 1OVNA 1M7TA 2YJ7A 2O8VB 2ZNMA 3LORA 4IP1A 1J0FA 3IK7A 2M72A 3D21A 4ISDA 2E0QA 1V9WA 2LV3A 1X9WB 3H93A 3UBKA 2EC4A 2YZUA 1A2LA 3N9JA 3CTGA 1OE7A 2WB9A 1M9AA 2HYXA 3C1SA 3C71A 3W8JA 2LEGA 1TRVA 4KDYA 2IFQB 1OYJA 3MSZA 2RUEA 2ON7A 4O92A 3DWVA 3TJGA 1PA3A 4ZL7A 7GSSA 2VL2A 1AXDA 4F03A 3KD0A 3L0HA 4BVXB 3GTUB 3KP9A 5D9VA 2WZ9A 2DJ3A 5HFIA 2OBKA 5E59A 3UMAA 3P7XA 2L4QA 1A8YA 2KLXA 2HI7A 1H75A 3VWVA 2HE3A 3G7YA 5J5NA 1OAZA 5CAXA 5CREA 2I1UA 3ZMKA 4HI7A 2QGVA 3GV1A 1WIKA 5G2ZA 2H19A 2GQMA 3UOMA 5IMCA 4PQHA 3EINA 3GRXA 1BG5A 1SU9A 2VCVA 4MPFA 5ECIB 3LQ7A 2X8GA 4BWQA 4BVYB 3N5OA 2JSYA 4XRAA 3ZLPA 1WWJA 3OR5A 3QPMA 4N10A 4MF7A 2WGRA 1EV4A 3D0ZA 3L9SA 1K3LA 1M99A 2MYGA 2HRKB 2GZPA 4HS1A 5AN1A 9GSSA 3HVXA 1DBYA 1PGTA 5IOXA 1ST9A 1PD21 3C1RA 3KJYA 3CMIA 1SK1A 3UARA 1ZGNA 2H6XA 3FZ4A 6GSVA 2H6ZA 3HZ8A 3CRUA 2HQTA 2D2ZA 4EL1A 2VCTA 3D22A 2CA8A 1K0OA 5AGYA 2KHPA 2C0EA 2UZ8A 4RUVA 4V2MA 1WRYA 4KH7A 2O89A 5JCGA 4MP4A 2E2MA 4TOPA 2MMAA 2GT5A 4ID0A 3L78A 4DSQA 2XBQA 3TJKA 2KUCA 3TUEA 4ZXGA 3FR3A 3IRAA 4WBJA 1HYUA 3LXTA 4XS4A 2FWEA 1PL2A 3KZQA 4I6XA 1EGRA 4GTUA 2YV9A 4G10A 1YF1A 1MDIA 5ENUA 4ZB8A 1JZOA 2AB6A 3WD6A 5IO0A 2YANA 1GLQA 2F3MA 5EY6A 3GA4A 4MJEA 2VL3A 5FHIA 1Z7RA 1TK5B 3QMXA 2JL4A 4XRDA 2QC7A 2C0FA 3G7JA 3ZIVA 3GKXA 2WJUA 3M0FA 2C3TA 4GSNA 3F4RA 1H4OA 2P5QA 3FZ5A 1JZRA 4O32A 5HFKA 5DJLA 3UL3A 4BPYA 2GT6A 3KTBA 1XW6A 1XW5A 1X5EA 2RM5A 4EE0A 1BAYA 1U88A 3DIEA 2TRXA 3GX8A 3HY2A 3FR9A 2JU5A 1ERUA 1X0RA 3LGCA 2PVOC 3IC4A 2DJ1A 2JZSA 4ULXA 1S3DA 2VAFA 3IAS2 1AQWA 3H1NA 2A4VA 2K18A 2H73A 2H8LA 1ON4A 3RAZA 4RI6A 2V2GA 2REMA 1DSBA 1RK4A 4ZILA 3PINA 4IELA 3HDCA 2HRFA 3TKQA 1GTUA 3E0UA 5EL8A 1N8JA 1BX9A 3LG6A 4DSSB 2R37A 3DRNA 4E8HA 2VCQA 6GSWA 5B8BA 4HDEA 3GL5A 3WGXA 1BQ7A 3KTLA 2F51A 3KCMA 4GCIA 3TKRA 4J56E 3HHVA 3C7MA 3KMNA 2B7JA 1GTBA 1MD4A 2C3NA 2LNSA 3PR8A 3TDGA 5GAND 1M9BA 1UVZA 3EMPA 2C8UA 2VLTA 4OCEA 4ZIJA 4WF5A 1B48A 1GULA 4AJ6A 1Z5YE 1U87A 1ZL9A 1JFUA 4KCEA 2V6OA 2A2RA 2DBCA 5H5QA 1K0NA 4AGSA 2OJLA 1DUGA 1EP8A 2ALBA 1K0AA 3GH6A 4Q5QA 2DIYA 2GZZA 5GSTA 2H72A 4IS0A 2HZEB 2GSQA 3HD5A 3E3EA 2B1KA 3ZVJA 3A2VA 1Y25A 1FW1A 1B8XA 1O81A 1E2YA 3A5WA 1AIUA 2IN3A 1GSUA 2RUFA 3FY7A 1T4ZA 4EXJA 4J57E 1X9SB 1USBA 2CX4A 1I9DA 2NTOA 1FVJA 4L0WA 3VFIA 2DSAA 1OC3A 3VURA 1PRXA 16GSA 4NHWA 4XIHA 4DSSA 5IMDA 3GN3A 3CSHA 2WS2A 2HSYA 4JR4A 2IWTA 1IYHA 2YWOA 3TKSC 1URMA 2NPBA 4IQAA 2JADA 1GH2A 3FRCA 3R3EA 4FH8A 5IIZA 3TB2A 3IK9A 5DVBA 1QQ2A 3IXRA 4MK3A 2JACA 3GH9A 1DE1A 3VPQA 1SKSB 2VLUA 4I5QA 1BYEA 2YZHA 1ERWA 2R3XA 5JCWA 2DIZA 5H5SA 5AIVA 5DAKA 1O7UA 4N0VA 1TRUA 2HFDA 3GNJA 2H66A 1HQOA 1GWCA 4WXTA 1ILOA 4IW9A 3QD9A 3U5RE 2GQLA 4N0ZA 4HZ4A 1F2EA 2HZEA 3PPUA 2LTKA 4X1UA 4K6XA 5DJMA 1GLPA 4X43A 3KMOA 1R5AA 4PXOA 3BBYA 5D73A 1FOVA 3UVTA 3BJ5A 1Z7PA 1AQVA 2LJRA 5LD0A 5G1LA 1XBSA 3ERWA 5HR3A 11GSA 3O3TA 2N5FA 4HQZA 1WJKA 3UEMA 4ECBA 2WFCA 5E4WA 2RIIA 2GVPA 4K1FA 3LXZA 2B1LA 5IPGA 4ZBDA 4KNDA 3IR4A 4NV2A 5H5RA 1QFNA 4GXZA 4KAEA 2P5RA 2CV4A 3I43A 1MDKA 4Q5FA 3CXGA 1FB0A 3KGKA 4MABA 1YZXA 2H30A 1U6TA 2HT9A 4F82A 4XS1A 4FQUA 5GAPD 1ERTA 5CYYA 1SK2A 6GSUA 1JLWA 2F8AA 3PGTA 5IMFA 1XOBA 2XPDA 1G7EA 1GSDA 5D9WA 4XCSA 2HLSA 4ECJA 1FHEA 5CP1A 4TKYA 4ZBAA 3D5JA 1VGLA 1SYXA 1A2JA 2EIRA 1V57A 1AC1A 3I6AA 3APSA 1SD9A 4NHZA 5CRGA 3WT1A 3C73A 4QL9A 1Z6NA 3HVVA 5J4UA 2N5BA 2H01A 4ML6A 2YWNA 3QDNA 4OO4A 2GLRA 3P90A 4WEYA 3UJ1A 4MA9A 2LRTA 4MZBA 5IM9A 4GQFA 3NIVA 3GUSA 5D93A 2HRAA 1O8WA 1S3AA 4FYBA 3KM6A 4PNGA 5JWRB 3VLNA 1VF4A 3VK9A 3VWXA 2X99A 2PUKC 1O6JA 3TJBA 3UAPA 1ML6A 4OO5A 3JCML 4PQIA 4IHUA 2HXKA 5FT3A 1GSFA 4LMWA 3H8QA 4NAXA 1SYRA 2OA7A 3UBLA 3TKPA 3GMFA 3GURA 3BCIA 1R4WA 1PN9A 1PL1A 4XS4B 4LMVA 1Y6EA 2VL9A 5CO3A 4BL7B 5KN1A 2LQQA 2FD3A 2DMMA 4K7OA 3TOUA 2HSHA 4IKHA 1FB6A 5IO2A 4MZCA 1K0MA 4KSMA 2H1GA 2E2GA 3M8NA 2LRCA 1SL0B 2FNOA 1T8EB 3IV4A 2OACA 1FAAA 2ON5A 2IL3A 14GSA 2H70A 1WMJA 1OC8A 4FYUA 4EDZA 2VM2A 5G5FA 1Z9HA 5KN2A 1EEMA 4ACSA 3LSZA 4RQXA 1GUKA 3RHBA 2OE1A 1TU8A 5J9BA 8GSSA 2L57A 4V1Ap 2C4JA 4MPGA 2FWHA 1EP7A 1GSEA 4JRRA 3EMXA 4GQCA 5G5EA 1Z6MA 1UA5A 2DJ2A 5D9XA 1XVQA 5DBQA 4CW9A 4YAPA 3I9V2 2B3SA 1SD8A 3M9KA 1K0DA 3IBHA 2FUG2 4KUNA 3ZREA 3EU3A 3ZRDA 2LS5A 1IYIA 3ZFLA 4K0GA 2F8FA 2FY6A 2H75A 4IP6A 4DSRA 4IBPA 4TXOA 2HNLA 1T4YA 2B5XA 4TRXA 2L6DA 5CRWA 1TXXA 3ZFBA 4G9HA 1K0CA 1K0BA 4J2FA 4BL7A 4MF6A 1HNCA 1QMVA 3Q19A 3DD3A 2ES7A 1AW9A 1FG4A 2PU9C 4MMMA 3ZL5A 4EC0A 5ECPB 3KIJA 1V98A 1Z3EA 5COHA 2HSMB 1EZKA 1PSQA 4EO3A 4NV5A 1I5GA 1TU7A 2FCHA 4E8EA 5G31A 4HOJA 3US3A 3W8SA 2MMNA 2PPTA 1X5DA 2P31A 3ZYWA 2I81A 3D6IA 1TK8B 2OBIA 2X8CA 5DQSA 1EOGA 1GUMA 4POBA 4ILFA 4K2DA 4WF4A 2VOCA 1O85A 3CTFA 4K8MA 2VO4A 1SK0A 1G6YA 1W89A 2R4VA 1PX6A 4L0UA 1RW1A 5B6MA 3O6TA 1LBKA 4ML1A 5CNWA 3ZTLA 2YOIA 1XXUA 19GSA 2C0GA 4HEA2 2H1DA 1AQXA 3DKSA 3DMLA 3RBTA 1XZOA 2P0GA 4HQSA 3F63A 2YN1A 1R26A 2E7PA 3APQA 4XTSA 4Z7XA 1GNEA 2MZCA 3KEBA 3BD2A 2B6MA 4IVFA 1CQHA 1XWBA 1CQGA 4ECIA 3MAKA 4KA0A 2M46A 2C80A 3DXBA 2HSMA 3D4MA 1XW9A 5F05A 2NVLA 1SL2B 4JEDA 1F37A 1PKWA 2JZTA 1ACVA 3VI7A 2L5LA 3DVWA 3WGDA 2MBTA 5F06A 3L4NA 4YQMA 3FKFA 1AAZA 1KTEA 1EV9A 2XBIA 1TRWA 4PUAA 1T1VA 4G0LA 5HR2A 2JSZA 2YV7A 4YQUA 1YKAA 4NPBA 4AJ8A 1GSSA 4ECCA 3ME8A 5DAKB 5B7CA 1PQNA 3F9UA 1SJIA 4HZ2A 3J7Yb 3WT2A 2CAIA 1KNGA 1OKDA 1UN2A 1WE0A 1GSYA 4KSOA 2V41A 2GZYA 2VD1A 3HZ4A 1SJZA 2WCIA 1XWKA 1F9MA 4EVMA 2KOKA 5JCUA 1YQ1A 2H0GA 5KN0A 1EGOA 1KBNA 2V6KA 4MCUA 1GUHA 3F6FA 3HKRA 1UC7A 4TXVA 2VIMA 3CBUA 2DJ0A 2I4AA 2BJXA 3E9JB 2XHFA 4PX1A 1ZYQB 2QKEA 4K7IA 1SENA 1M2DA 1QGVA 4IGJA 4O7HA 5B8AA 2LKUA 3AY8A 5IOWA 5KN3A 1PX7A 1B9YC 2K8VA 1THXA 3GKKA 3IC8A 5ID2B 3FEUA 5ECMB 1F6MC 3TCOA 2IPAA 2FLSA 1ZYEA 4YAVA 4TR4A 5F8BA 2DC5A 5IMZA 2IMKA 3ZVJD 4GSSA 5L71A 3LEFA 1MDJA 4TVEA 1GTIA 3ME7A 1J9BA 4ZBBA 2PERA 1QXHA 3F3RA 3QAGA 2LJAA 2TIRA 4JR6A 2AAWA 5EVOA 3F4SA 1GRXA 3L9VA 3FHKA 5ABRA 1TKDB 1XWAA 4MDCA 5ECKB 4IJ3A 1TI1A 5ELGA 4PTSA 4POKA 2CAQA 4L8EA 4ZB9A 1EOHA 3QOUA 1QK8A 3SWLA 4HUAA 1X9MB 3FW2A 5ECNB 3M9JA 1LJRA 1A2MA 2XPEA 5GSSA 1PKZA 1ERVA 5AISA 3TGZA 4KB3A 4HJ2A 2MBSA 5ID2A 1HD2A 5A4VA 4PUFC 3QAVA 2LJKA 3RHCA 4WETA 3GL3A 2AJQB 3A2WA 3HCZA 4OFMA 3VI5A 2FA8A 4OD7A 3ZIJA 1TRSA 3Q74A 3GYKA 1B9XC 1ZCPA 4O5RA 2IMEA 4LA1A 2H0HA 4LL1B 2L6CA 4KW6A 1O73A 2BTOT 1M2AA 5G30A 1F3AA 3LWAA 2VCXA 4RI7A 2C1YA 4KCAA 4G19A 2LRNA 4KGIA 2YCDA 2G2QA 5J41A 1EEJA 3EC3A 5ECLB 1XFLA 4OFTA 3TOTA 3HJMA 2IMDA 5ECQB 1T7PB 2K9FA 2C0DA 2V32A 1K3OA 2YWMA 5INYA 1YJ6A 4EUYA 2FWFA 1RQMA 2H74A 1KEBA 4ZB6A 3DYRA 1V2AA 4G0IA 1M2BA 3LYKA 2XC2A 5F07A 3NOFA 1YDKA 3F4TA 1ZZYA 1OE8A 3G9BA 5DCHA 1G6WA 1EWXA 4OWYA 2K8SA 5DDLA 3NZNA 2FWGA 3DEXA 2X8HA 2I9HA 4ZL8A 2FHEA 4IN0A 3BOAA 4LLRA 2WULA 4XS6A 4D73B 1XWCA 4V2NA 4KF9A 1WP0A 3GKMA 1X5CA 2VM1A 4TR1A 3RPNA 2C3QA 5LCZA 2YPMA 1E6BA 2IMFA 1YF0A 4CHSA 2OKAA 3TRXA 2DJJA 5J3RA 4OCFA 6GSXA 1JHBA 1YEXA 4WR4A 4EKZA 4TXOB 3S9FA 4I97A 4MJAA 1YKCA 1B4QA 2OE0A 3RPPA 3IDVA 3KXOA 2G0FA 3HYPA 1NW2A 4MH3A 2FA4A 3P8WA 4MJCA 4JBBA 3W6GA 2HSNB 4GSTA 3FYGA 4MJBA 3IHQA 4PNFA 4AJ7A 1GSQA 2F9SA 1TW9A 3TKSA 4POLA 1XIYA 3GHAA 3GIXA 5IPHA 1GP1A 1TDIA 5ELAA 1K3YA 1A0RP 2PN8A 3MNGA 5BMUA 1V40A 1B4PA 1WOUA 1TTZA 2H6YA 2CZ2A 1MEKA 2CT6A 10GSA 3HXSA 2TRCP 1A8LA 1R5PA 1HNBA 2JZRA 2L5OA 1V58A 3GKNA 2B7KA 2IFQA 1VF2A 4MH2A 1NM3A 4WR5A 4D73A 2YWIA 4EF0A 5DALB 3F3QA 4V2LA 1XOAA 4I2UA 3CYNA 1M0UA 5G1KA 4TW5A 1XPVA 3KP8A 1AUCA 4BVXA 3GTUA 5ECHB 2L59A 3CSJA 2PMTA 5A5KA 3H4KA 5C00A 2GGTA 2H0IA 3UIWA 2EIOA 3IAM2 5IMAA 2EIQA 2LQOA 1O8XA 4F0BA 2HRNA 2DJKA 4KDXA 4TR0A 3F0IA 5HR0A 3L9UA 5ECSA 1ABAA 5CRDA 3VWUA 4NXIA 5DQYA 4AF2A 3R2QA 3CRTA 4KX4A 4F2IA 2CVBA 1NSWA 1QUWA 4Q5RA 1SJ6A 1VF3A 1VF1A 1F3BA 5B6NA 1ZOFA 1SKWB 1N2AA 2GS3A 3A2XA 2YP6A 4BVYA 4HJMA 2VUPA 13GSA 1DE2A 4LL4B 2GSTA 2GDRA 4I8BA 3TRQA 3ZZXA 5LNKe 2HRKA 4N30A 5DALA 3ERGA 2KP2A 3UVHA 20GSA 1VRSD 4MF5A 5C04A 1TI3A 2AUVA 1A0FA 1THOA 3ED3A 3DVXA 1GNWA 1HNAA 3LYPA
chains in the Genus database with same CATH superfamily
4TR3A 5DCGA 1FVKA 5KEJA 2CX3A 5F0GA 1SVMA 4KE3A 4GF0A 3F6DA 3QAWA 2L4CA 2WDUA 5J9CA 12GSA 1MTCA 5AIXA 17GSA 2PWJA 1SL1B 3GSSA 4X0XA 4JZQA 1C72A 2FGXA 2NDOA 4HSCX 1OKTA 4POMA 2DLXA 2H76A 3VWWA 3EU4A 4GLTA 2O7KA 3F8UA 4K0NA 4P3YB 5EPFA 2GQKA 3FR6A 3WGEA 4FO5A 1MD3A 5D9TA 4TN8A 5KOXA 3QR6A 2V1MA 3C8EA 2HZFA 3HMJG 4BIKA 3Q6OA 1U3AA 4WBRD 1A24A 5CRHA 2CVDA 4PQ1A 4USSA 4L5OA 4YH2A 1S3CA 5ECOB 22GSA 1XCCA 3EYTA 3TU3B 3HJOA 5A34A 2YNXA 2B5YA 2BMXA 2IIYA 3CHXC 3I69A 2J23A 4DVCA 1U3IA 4G0KA 2VLVA 2IMIA 2VL2C 4ZL9A 1R7HA 3FZAA 3HJPA 1T3BA 5HR1A 2PBJA 2J9HA 4RQRA 2LNTA 3VPTA 3IE3A 1NHYA 3EE2A 3KH9A 4PGTA 4MNNA 2O85A 4HU7A 4NMUA 3QCPA 3TRPA 3LJRA 4K7NA 2AV4A 2M80A 3BCKA 4FYCA 4K5SA 4OMVA 2YJHA 4I2TA 4F0CA 4G2EA 2VD0A 5D8IA 2CZ3A 3TKSE 3EVIA 3PH9A 1W4VA 2MMZA 1A23A 3IOSA 4KDUA 2R2JA 4V1Ag 1BJXA 3G7IA 4CY6A 3ZITA 4QQ7A 1LU4A 3CSIA 4IQ1A 3V1WA 2AYTA 3FK8A 2QA2A 4GRFA 3M3MA 3K8NA 3IPZA 1GL8A 3H79A 2O5VA 4BWSA 2N5AA 2X64A 1G0TA 4GWRA 4WKWA 6GSTA 4FIWA 2R5GA 1OC9B 2H71A 2CQ9A 5ECRB 2H1AA 2A2SA 1Q98A 1JZDA 3MWHA 5HQPA 5D96A 4Q5NA 3FZ9A 1Q4JA 2GTUA 2IJYA 2OADA 2MMOA 2PVQA 4N11A 4MLYA 3DGQA 6GSYA 1PMTA 2LSTA 3QFAC 2VCWA 3QFBC 2UV8G 1TP9A 2CVKA 4K9ZA 5JWQB 4AI6A 1T00A 3MDKA 2AHEA 2NBSA 4OFNA 2VCZA 4F9ZA 1XWGA 2RLIA 1SKRB 2R6KA 4IJIA 2RM6A 5HFGA 2B5EA 3HA9A 2GSRA 1YEPA 3M1GA 5IQYA 4XHMA 5A4UA 3GX0A 3KH7A 3A5IA 1BEDA 3GSTA 2ZUPA 3P2AA 2DMLA 2H1LA 2EFEA 4YKFA 3IA1A 4MZWA 3HVNA 3ISOA 2LUSA 1NHOA 4JU5A 4DEJA 4HU9A 2I3YA 4L5LA 3A3TA 1G7OA 2PGTA 5GZZB 4PURA 3GFKA 5A1NB 4BA7A 2QSIA 1J08A 3APOA 2Z9SA 4TR1B 3J7Yk 4EDYA 1OC9A 5A4WA 18GSA 1TJDA 1TOFA 5IMVA 2O87A 3WYWA 1XVWA 4NWYA 2KP1A 5JWOB 1JLVA 1FO5A 3TJFA 1TK0B 3TJJA 1ZMAA 6GSSA 3Q18A 2WRTA 2OE3A 3U6VA 2GSSA 1GTAA 3RDWA 3SBCA 3O76A 4H86A 4JE1A 3HVSA 3ZMLA 4QL7A 3D4TA 2H1BA 4CDOA 1YY7A 2ZCTA 3ERFA 1WPIA 4YQVA 3EWLA 3LFLA 2K6VA 1JZWA 3EURA 5FWGA 1OVNA 1M7TA 2YJ7A 2O8VB 2ZNMA 3LORA 2X4AA 4IP1A 1J0FA 3IK7A 2M72A 3D21A 4ISDA 2E0QA 1V9WA 2LV3A 1X9WB 5BMUB 3H93A 3UBKA 2EC4A 2YZUA 1A2LA 3N9JA 3CTGA 1OE7A 2WB9A 1BG1A 1M9AA 2HYXA 3C1SA 3C71A 3W8JA 2LEGA 1TRVA 4O5UA 4KDYA 2IFQB 1OYJA 3MSZA 2RUEA 2ON7A 4O92A 3DWVA 3TJGA 1PA3A 4ZL7A 4G01A 4N3ZA 7GSSA 2VL2A 1AXDA 4F03A 3KD0A 3L0HA 4BVXB 3GTUB 3KP9A 5D9VA 2WZ9A 2DJ3A 5HFIA 2OBKA 5E59A 3RFRC 4AKGA 3UMAA 3P7XA 2L4QA 1A8YA 2KLXA 2HI7A 1H75A 3VWVA 2HE3A 3G7YA 5J5NA 1OAZA 5CAXA 5CREA 2I1UA 3ZMKA 4HI7A 2QGVA 3GV1A 1WIKA 5G2ZA 2H19A 2GQMA 3UOMA 5IMCA 4PQHA 3EINA 3GRXA 1BG5A 1SU9A 2VCVA 4MPFA 5ECIB 3LQ7A 2X8GA 4QMKA 1S4BP 4BWQA 4BVYB 3N5OA 2JSYA 4XRAA 3ZLPA 1WWJA 3OR5A 3QPMA 4N10A 4MF7A 2WGRA 1EV4A 3D0ZA 3L9SA 4ZB7A 1K3LA 1M99A 2MYGA 2HRKB 2GZPA 4HS1A 5AN1A 9GSSA 3HVXA 1DBYA 1PGTA 5IOXA 1ST9A 1PD21 3C1RA 3KJYA 3CMIA 1SK1A 3UARA 1ZGNA 3CWGA 2H6XA 3FZ4A 6GSVA 2H6ZA 3HZ8A 3CRUA 2HQTA 2D2ZA 4EL1A 2VCTA 3D22A 2CA8A 1K0OA 5AGYA 2KHPA 2C0EA 2UZ8A 4RUVA 4PI0C 4V2MA 1WRYA 5BRTA 4KH7A 2O89A 5JCGA 4MP4A 2E2MA 4TOPA 2MMAA 2GT5A 4ID0A 3L78A 4DSQA 2XBQA 3TJKA 2KUCA 3TUEA 4ZXGA 3FR3A 3IRAA 4WBJA 1HYUA 3LXTA 4XS4A 2FWEA 1PL2A 3KZQA 4I6XA 1EGRA 4GTUA 2YV9A 4G10A 1YF1A 1MDIA 5ENUA 2EFDA 4ZB8A 1JZOA 2AB6A 3WD6A 5IO0A 2YANA 1GLQA 3EPTA 4Z2UA 2F3MA 5EY6A 3GA4A 4MJEA 2VL3A 5FHIA 4PHZC 1Z7RA 3QMXA 1TK5B 2JL4A 4XRDA 2QC7A 2C0FA 3G7JA 3ZIVA 3GKXA 5A34B 2WJUA 3M0FA 2C3TA 4GSNA 3F4RA 1H4OA 2P5QA 3FZ5A 1JZRA 4O32A 5HFKA 5DJLA 3UL3A 4EIQA 4BPYA 2GT6A 3KTBA 1XW6A 2OT3A 1XW5A 1X5EA 2RM5A 4EE0A 1BAYA 1U88A 2R0GA 1M3JA 3DIEA 2TRXA 3GX8A 3HY2A 3FR9A 2JU5A 1ERUA 1X0RA 3LGCA 2PVOC 3IC4A 2O3EA 2DJ1A 2JZSA 4ULXA 1S3DA 2VAFA 1SVLA 3IAS2 1AQWA 3H1NA 2A4VA 2K18A 2H73A 2H8LA 1ON4A 3RAZA 4RI6A 2V2GA 4K5RA 2REMA 1DSBA 1RK4A 4ZILA 3PINA 4IELA 3HDCA 2HRFA 3TKQA 1GTUA 3E0UA 5EL8A 1N8JA 1BX9A 3LG6A 4DSSB 2R37A 3DRNA 4E8HA 2VCQA 6GSWA 1ZYPA 5B8BA 4HDEA 3GL5A 3WGXA 1BQ7A 3KTLA 2F51A 3KCMA 4GCIA 3TKRA 4J56E 3HHVA 3C7MA 3KMNA 2B7JA 1GTBA 4EIPA 1MD4A 4X4JA 2VKZG 2C3NA 2LNSA 3PR8A 3TDGA 5GAND 1M9BA 1UVZA 3EMPA 2C8UA 2VLTA 4OCEA 4ZIJA 4WF5A 1B48A 1GULA 2EFHA 4AJ6A 1Z5YE 1U87A 1ZL9A 4ICYA 1JFUA 4KCEA 2V6OA 2A2RA 2DBCA 5H5QA 1K0NA 4AGSA 2OJLA 1DUGA 1EP8A 1BF5A 2ALBA 1K0AA 3GH6A 4Q5QA 2DIYA 4CY8A 2GZZA 5GSTA 2H72A 4IS0A 4AKXB 2HZEB 2GSQA 3HD5A 3E3EA 2B1KA 3ZVJA 3A2VA 1Y25A 1FW1A 1B8XA 1O81A 1E2YA 3A5WA 1AIUA 2IN3A 1GSUA 2RUFA 3FY7A 1T4ZA 4EXJA 4J57E 1X9SB 1USBA 2CX4A 1I9DA 2NTOA 1FVJA 4L0WA 4Z2RA 3VFIA 5A5HA 2DSAA 1OC3A 3VURA 1PRXA 16GSA 4NHWA 4XIHA 4DSSA 5IMDA 3GN3A 3CSHA 2WS2A 2HSYA 2IWTA 4JR4A 1IYHA 2YWOA 1N25A 3TKSC 1URMA 2NPBA 4IQAA 2JADA 1GH2A 3FRCA 3R3EA 4FH8A 5IIZA 3TB2A 5J47A 3IK9A 1ZYNA 5DVBA 1QQ2A 3IXRA 4MK3A 2JACA 3GH9A 1DE1A 3VPQA 1SKSB 2VLUA 4I5QA 1BYEA 2YZHA 1ERWA 2R3XA 5JCWA 2DIZA 5H5SA 5AIVA 5DAKA 1O7UA 4N0VA 1TRUA 2HFDA 3GNJA 2H66A 1HQOA 3LW9A 1GWCA 4WXTA 1ILOA 4IW9A 3QD9A 3U5RE 2GQLA 4N0ZA 4HZ4A 1F2EA 2HZEA 3PPUA 2LTKA 4X1UA 4K6XA 5DJMA 1GLPA 4X43A 3KMOA 1R5AA 4PXOA 3BBYA 5D73A 1FOVA 3UVTA 3BJ5A 1Z7PA 1AQVA 2LJRA 5LD0A 5G1LA 1XBSA 3ERWA 5HR3A 11GSA 3O3TA 2N5FA 4HQZA 1WJKA 3UEMA 4ECBA 2WFCA 5E4WA 2RIIA 2GVPA 4K1FA 3LXZA 2B1LA 5IPGA 4ZBDA 4KNDA 5KOWA 3IR4A 4NV2A 5H5RA 1QFNA 4GXZA 4KAEA 2P5RA 2CV4A 3I43A 1MDKA 4Q5FA 3CXGA 1FB0A 3KGKA 4MABA 1YZXA 2H30A 1U6TA 2HT9A 4F82A 4XS1A 4FQUA 5GAPD 1ERTA 5CYYA 1SK2A 6GSUA 1JLWA 2F8AA 3PGTA 5IMFA 1XOBA 2XPDA 1G7EA 1GSDA 5D9WA 2DKHA 4XCSA 2HLSA 4ECJA 1FHEA 5CP1A 4TKYA 4ZBAA 3D5JA 1VGLA 1SYXA 1A2JA 2EIRA 1V57A 1AC1A 3I6AA 3APSA 1SD9A 4NHZA 5CRGA 3WT1A 3C73A 4QL9A 1Z6NA 3HVVA 5J4UA 2N5BA 2H01A 4ML6A 2YWNA 3QDNA 4OO4A 2GLRA 3P90A 4WEYA 3UJ1A 2R0CA 4MA9A 2WW0A 2LRTA 4MZBA 5IM9A 4GQFA 3NIVA 3GUSA 5D93A 2HRAA 1O8WA 1S3AA 4FYBA 3KM6A 4PNGA 5JWRB 3VLNA 1VF4A 3VK9A 3VWXA 2X99A 2PUKC 5J4VA 1O6JA 3TJBA 3UAPA 1ML6A 4OO5A 3JCML 4PQIA 4IHUA 2HXKA 5FT3A 2WW2A 1GSFA 5J40A 4LMWA 3H8QA 1M3IA 4NAXA 1SYRA 2OA7A 3UBLA 3TKPA 3GMFA 3GURA 3BCIA 1R4WA 1TXUA 1PN9A 1PL1A 4XS4B 4LMVA 1Y6EA 2VL9A 5CO3A 4BL7B 5KN1A 2LQQA 2FD3A 2DMMA 4K7OA 3TOUA 2HSHA 4IKHA 1FB6A 5IO2A 4MZCA 1K0MA 4KSMA 2H1GA 2E2GA 3M8NA 2LRCA 1SL0B 2FNOA 1T8EB 3IV4A 2OACA 1FAAA 2ON5A 2IL3A 2A2PA 14GSA 2H70A 1WMJA 1OC8A 4FYUA 4EDZA 1S3RA 2VM2A 5G5FA 1Z9HA 5KN2A 1EEMA 4ACSA 3LSZA 4RQXA 1GUKA 3RHBA 2OE1A 1TU8A 5J9BA 8GSSA 2L57A 4V1Ap 2C4JA 4MPGA 2FWHA 1EP7A 1GSEA 4JRRA 3EMXA 4GQCA 5G5EA 3CQFA 1Z6MA 1UA5A 2DJ2A 5D9XA 1XVQA 5DBQA 4CW9A 4YAPA 3I9V2 2B3SA 1SD8A 3M9KA 1PFOA 1K0DA 3IBHA 2FUG2 4KUNA 3ZREA 3EU3A 3ZRDA 2LS5A 1IYIA 3ZFLA 4K0GA 2F8FA 2FY6A 2H75A 4IP6A 4DSRA 4IBPA 4TXOA 2HNLA 1XG8A 1T4YA 2B5XA 4TRXA 2L6DA 5CRWA 1TXXA 3ZFBA 4G9HA 1K0CA 1K0BA 4J2FA 4BL7A 4A5PA 4MF6A 1HNCA 1QMVA 3Q19A 3DD3A 2ES7A 1AW9A 1FG4A 2PU9C 4MMMA 3ZL5A 4EC0A 5ECPB 3KIJA 1V98A 1Z3EA 2WZSA 5COHA 2HSMB 2EFCA 1EZKA 1PSQA 4EO3A 4NV5A 1I5GA 1TU7A 2FCHA 4E8EA 5G31A 4HOJA 3US3A 3W8SA 2MMNA 2PPTA 1X5DA 2P31A 3ZYWA 4FXYP 2I81A 3D6IA 1TK8B 2OBIA 2X8CA 5DQSA 1EOGA 1GUMA 4K2XA 4POBA 4ILFA 4K2DA 4WF4A 2VOCA 1O85A 4PI2C 3CTFA 4K8MA 2VO4A 1SK0A 1G6YA 1W89A 2R4VA 1PX6A 4L0UA 1Y1UA 1RW1A 5B6MA 3O6TA 1LBKA 4ML1A 5CNWA 3ZTLA 2YOIA 1XXUA 19GSA 2C0GA 4HEA2 2H1DA 1AQXA 3DKSA 2QA1A 3DMLA 2O36A 3RBTA 1XZOA 2P0GA 4HQSA 3F63A 2YN1A 1R26A 2E7PA 3APQA 4XTSA 5A5HB 4Z7XA 1GNEA 2MZCA 3KEBA 3BD2A 2B6MA 4IVFA 1CQHA 1XWBA 1CQGA 4ECIA 3MAKA 4KA0A 2M46A 2C80A 3DXBA 2HSMA 3D4MA 1XW9A 5F05A 2NVLA 1SL2B 4JEDA 1F37A 1PKWA 2JZTA 1ACVA 3VI7A 2L5LA 3DVWA 4YKGA 3WGDA 4AKIA 2MBTA 5F06A 5J4YA 3L4NA 4YQMA 3FKFA 1AAZA 1KTEA 1EV9A 2XBIA 1TRWA 4PUAA 1T1VA 4G0LA 5HR2A 2JSZA 2YV7A 4YQUA 1YKAA 4NPBA 2A4HA 4AJ8A 1GSSA 4ECCA 3ME8A 5DAKB 5B7CA 1PQNA 3F9UA 1SJIA 4HZ2A 3J7Yb 3WT2A 2CAIA 1KNGA 1OKDA 1UN2A 1WE0A 1GSYA 4KSOA 2V41A 2GZYA 2VD1A 3HZ4A 1SJZA 2WCIA 1XWKA 1F9MA 3MIXA 4EVMA 2KOKA 5JCUA 1YQ1A 2H0GA 5KN0A 1EGOA 1KBNA 2V6KA 4MCUA 1GUHA 3F6FA 3HKRA 1UC7A 4TXVA 2VIMA 3CBUA 2DJ0A 2I4AA 2BJXA 3E9JB 1FOHA 2XHFA 4PX1A 1ZYQB 2QKEA 4K7IA 1SENA 1M2DA 1QGVA 4IGJA 4O7HA 5B8AA 2LKUA 3AY8A 5IOWA 5KN3A 1PX7A 1B9YC 2K8VA 1THXA 3GKKA 3IC8A 5ID2B 3FEUA 5ECMB 1F6MC 3TCOA 2IPAA 2FLSA 1ZYEA 4YAVA 4TR4A 5F8BA 2DC5A 5IMZA 2IMKA 3ZVJD 4GSSA 5L71A 3LEFA 1MDJA 4TVEA 1GTIA 3ME7A 1J9BA 4ZBBA 2PERA 1QXHA 3F3RA 3QAGA 2LJAA 2TIRA 4JR6A 2AAWA 5EVOA 3F4SA 1GRXA 3L9VA 3FHKA 5ABRA 1TKDB 1XWAA 4MDCA 5ECKB 4IJ3A 1TI1A 4AKHA 5ELGA 4PTSA 4POKA 2CAQA 4L8EA 4ZB9A 1EOHA 3QOUA 1QK8A 3SWLA 4HUAA 2R0PA 1X9MB 3FW2A 5ECNB 3M9JA 1LJRA 1A2MA 2XPEA 3MYDA 5GSSA 1PKZA 1ERVA 5AISA 3TGZA 4KB3A 4HJ2A 2MBSA 5ID2A 1HD2A 5A4VA 4PUFC 3QAVA 2LJKA 3RHCA 4WETA 3GL3A 2AJQB 3A2WA 3HCZA 4OFMA 3VI5A 2FA8A 4OD7A 3ZIJA 1PN0A 1TRSA 3Q74A 3GYKA 1B9XC 1ZCPA 4O5RA 2IMEA 4LA1A 2H0HA 1SVOA 4LL1B 2L6CA 4KW6A 1O73A 2BTOT 1M2AA 5G30A 1F3AA 3LWAA 2VCXA 4RI7A 2C1YA 4KCAA 4G19A 2LRNA 4KGIA 2YCDA 2G2QA 5J41A 1EEJA 3EC3A 5ECLB 1XFLA 4OFTA 3TOTA 3HJMA 2IMDA 5ECQB 1T7PB 2K9FA 2C0DA 2V32A 2WW1A 1K3OA 2YWMA 5INYA 1YJ6A 4EUYA 2FWFA 1RQMA 2WVXB 2H74A 1KEBA 4ZB6A 3DYRA 1V2AA 4G0IA 1M2BA 3LYKA 2WVYA 2XC2A 5F07A 3NOFA 1YDKA 3F4TA 1YEWC 1ZZYA 1OE8A 3G9BA 5DCHA 1G6WA 1EWXA 4OWYA 2K8SA 5DDLA 3NZNA 2FWGA 3DEXA 2X8HA 2I9HA 4ZL8A 2FHEA 4IN0A 3BOAA 4LLRA 2WULA 5A1NA 4XS6A 4D73B 1XWCA 4V2NA 4KF9A 1WP0A 3GKMA 1X5CA 2VM1A 4TR1A 3RPNA 2C3QA 5LCZA 2YPMA 4O5QA 1E6BA 2IMFA 1YF0A 4CHSA 2OKAA 3TRXA 2DJJA 5J3RA 4OCFA 6GSXA 1JHBA 1YEXA 4WR4A 4EKZA 4TXOB 3S9FA 4I97A 4MJAA 1YKCA 1B4QA 2OE0A 3RPPA 3IDVA 3KXOA 2G0FA 3HYPA 1NW2A 4MH3A 2FA4A 3P8WA 4MJCA 4JBBA 3W6GA 2HSNB 4GSTA 3FYGA 4MJBA 3IHQA 4PNFA 4AJ7A 2X49A 3FMWA 1GSQA 2F9SA 1TW9A 3TKSA 4POLA 1XIYA 2WVXA 3GHAA 3GIXA 5IPHA 1GP1A 1TDIA 5ELAA 1K3YA 1A0RP 2PN8A 4E68A 2DKIA 3MNGA 5BMUA 1V40A 1B4PA 1WOUA 1TTZA 2H6YA 2CZ2A 1MEKA 2CT6A 10GSA 3HXSA 2TRCP 3RGBC 1A8LA 1R5PA 1HNBA 2JZRA 2L5OA 1V58A 3GKNA 2B7KA 2IFQA 1VF2A 4MH2A 1NM3A 4WR5A 4D73A 2YWIA 4EF0A 5DALB 3F3QA 4V2LA 1XOAA 4I2UA 3CYNA 1M0UA 5G1KA 4TW5A 1XPVA 2WVZA 1AUCA 3KP8A 4BVXA 3GTUA 5ECHB 2L59A 3CSJA 2PMTA 5A5KA 3H4KA 5C00A 2GGTA 2H0IA 3UIWA 2EIOA 3IAM2 5IMAA 2EIQA 2LQOA 1O8XA 4F0BA 2HRNA 2DJKA 4KDXA 4TR0A 3F0IA 5HR0A 3L9UA 1YVLA 5ECSA 1ABAA 5CRDA 2HSNA 3VWUA 4NXIA 5DQYA 4AF2A 3R2QA 3CRTA 4KX4A 4F2IA 2CVBA 2WW3A 1NSWA 1QUWA 4Z2TA 4Q5RA 1SJ6A 1VF3A 1VF1A 1F3BA 1I1IP 5B6NA 1ZOFA 1SKWB 1N2AA 2GS3A 3A2XA 2YP6A 4BVYA 4HJMA 2VUPA 4GDFA 13GSA 1DE2A 4LL4B 2GSTA 2GDRA 4I8BA 3TRQA 3IHGA 3ZZXA 5LNKe 2HRKA 4N30A 5DALA 3ERGA 2KP2A 3UVHA 20GSA 1VRSD 4MF5A 5C04A 1TI3A 2AUVA 1A0FA 1THOA 3ED3A 3DVXA 1GNWA 4W66A 1HNAA 3LYPA
chains in the Genus database with same CATH topology
4TR3A 5DCGA 1FVKA 5KEJA 2CX3A 5F0GA 1SVMA 4KE3A 4GF0A 3F6DA 3QAWA 2L4CA 2WDUA 5J9CA 12GSA 1MTCA 5AIXA 17GSA 2PWJA 1SL1B 3GSSA 4X0XA 4JZQA 1C72A 2FGXA 2NDOA 1OKTA 4POMA 2DLXA 2H76A 3VWWA 3EU4A 4GLTA 2O7KA 3F8UA 4K0NA 4P3YB 5EPFA 2GQKA 3FR6A 3WGEA 4FO5A 1MD3A 5D9TA 4TN8A 5KOXA 3QR6A 2V1MA 3C8EA 2HZFA 3HMJG 3Q6OA 1U3AA 4WBRD 1A24A 5CRHA 2CVDA 4PQ1A 4USSA 4L5OA 4YH2A 1S3CA 5ECOB 22GSA 1XCCA 3EYTA 3TU3B 3HJOA 5A34A 2YNXA 2B5YA 2BMXA 2IIYA 2J23A 3I69A 4DVCA 1U3IA 4G0KA 2VLVA 2IMIA 2VL2C 4ZL9A 1R7HA 3FZAA 3HJPA 1T3BA 5HR1A 2PBJA 2J9HA 4RQRA 2LNTA 3VPTA 3IE3A 1NHYA 3EE2A 3KH9A 4PGTA 4MNNA 2O85A 4HU7A 4NMUA 3QCPA 3TRPA 3LJRA 4K7NA 2AV4A 2M80A 3BCKA 4FYCA 4K5SA 4OMVA 2YJHA 4I2TA 4F0CA 4G2EA 2VD0A 5D8IA 2CZ3A 3TKSE 3EVIA 3PH9A 1W4VA 2MMZA 1A23A 3IOSA 4KDUA 2R2JA 4V1Ag 1BJXA 3G7IA 4CY6A 3ZITA 4QQ7A 1LU4A 3CSIA 4IQ1A 3V1WA 2AYTA 3FK8A 2QA2A 4GRFA 3M3MA 3K8NA 3IPZA 1GL8A 3H79A 2O5VA 4BWSA 2N5AA 2X64A 1G0TA 4GWRA 4WKWA 6GSTA 4FIWA 2R5GA 1OC9B 2H71A 2CQ9A 5ECRB 2H1AA 2A2SA 1Q98A 1JZDA 3MWHA 5HQPA 5D96A 4Q5NA 3FZ9A 1Q4JA 2GTUA 2IJYA 2OADA 2MMOA 2PVQA 4N11A 4MLYA 3DGQA 6GSYA 1PMTA 2LSTA 3QFAC 2VCWA 3QFBC 2UV8G 1TP9A 2CVKA 4K9ZA 5JWQB 4AI6A 1T00A 3MDKA 2AHEA 2NBSA 4OFNA 2VCZA 4F9ZA 1XWGA 2RLIA 1SKRB 2R6KA 4IJIA 2RM6A 5HFGA 2B5EA 3HA9A 2GSRA 1YEPA 3M1GA 5IQYA 4XHMA 5A4UA 3GX0A 3KH7A 3A5IA 1BEDA 3GSTA 2ZUPA 3P2AA 2DMLA 2H1LA 2EFEA 4YKFA 3IA1A 4MZWA 3ISOA 2LUSA 1NHOA 4JU5A 4DEJA 4HU9A 2I3YA 4L5LA 3A3TA 1G7OA 2PGTA 5GZZB 4PURA 3GFKA 5A1NB 4BA7A 2QSIA 1J08A 3APOA 2Z9SA 4TR1B 3J7Yk 4EDYA 1OC9A 5A4WA 18GSA 1TJDA 1TOFA 5IMVA 2O87A 3WYWA 1XVWA 4NWYA 2KP1A 5JWOB 1JLVA 1FO5A 3TJFA 1TK0B 3TJJA 1ZMAA 6GSSA 3Q18A 2WRTA 2OE3A 3U6VA 2GSSA 1GTAA 3RDWA 3SBCA 3O76A 4H86A 4JE1A 3HVSA 3ZMLA 4QL7A 3D4TA 2H1BA 4CDOA 1YY7A 2ZCTA 3ERFA 1WPIA 4YQVA 3EWLA 3LFLA 2K6VA 1JZWA 3EURA 5FWGA 1OVNA 1M7TA 2YJ7A 2O8VB 2ZNMA 3LORA 2X4AA 4IP1A 1J0FA 3IK7A 2M72A 3D21A 4ISDA 2E0QA 1V9WA 2LV3A 1X9WB 5BMUB 3H93A 3UBKA 2EC4A 2YZUA 1A2LA 3N9JA 3CTGA 1OE7A 2WB9A 1BG1A 1M9AA 2HYXA 3C1SA 3C71A 3W8JA 2LEGA 1TRVA 4O5UA 4KDYA 2IFQB 1OYJA 3MSZA 2RUEA 2ON7A 4O92A 3DWVA 3TJGA 1PA3A 4ZL7A 4G01A 4N3ZA 7GSSA 2VL2A 1AXDA 4F03A 3KD0A 3L0HA 4BVXB 3GTUB 3KP9A 5D9VA 2WZ9A 2DJ3A 5HFIA 2OBKA 5E59A 4AKGA 3UMAA 3P7XA 2L4QA 1A8YA 2KLXA 2HI7A 1H75A 3VWVA 2HE3A 3G7YA 5J5NA 1OAZA 5CAXA 5CREA 2I1UA 3ZMKA 4HI7A 2QGVA 3GV1A 1WIKA 5G2ZA 2H19A 2GQMA 3UOMA 5IMCA 4PQHA 3EINA 3GRXA 1BG5A 1SU9A 2VCVA 4MPFA 5ECIB 3LQ7A 2X8GA 4QMKA 4BWQA 4BVYB 3N5OA 2JSYA 4XRAA 3ZLPA 1WWJA 3OR5A 3QPMA 4N10A 4MF7A 2WGRA 1EV4A 3D0ZA 3L9SA 4ZB7A 1K3LA 1M99A 2MYGA 2HRKB 2GZPA 4HS1A 5AN1A 9GSSA 3HVXA 1DBYA 1PGTA 5IOXA 1ST9A 1PD21 3C1RA 3KJYA 3CMIA 1SK1A 3UARA 1ZGNA 3CWGA 2H6XA 3FZ4A 6GSVA 2H6ZA 3HZ8A 3CRUA 2HQTA 2D2ZA 4EL1A 2VCTA 3D22A 2CA8A 1K0OA 5AGYA 2KHPA 2C0EA 2UZ8A 4RUVA 4V2MA 1WRYA 5BRTA 4KH7A 2O89A 5JCGA 4MP4A 2E2MA 4TOPA 2MMAA 2GT5A 4ID0A 3L78A 4DSQA 2XBQA 3TJKA 2KUCA 3TUEA 4ZXGA 3FR3A 3IRAA 4WBJA 1HYUA 3LXTA 4XS4A 2FWEA 1PL2A 3KZQA 4I6XA 1EGRA 4GTUA 2YV9A 4G10A 1YF1A 1MDIA 5ENUA 2EFDA 4ZB8A 1JZOA 2AB6A 3WD6A 5IO0A 2YANA 1GLQA 3EPTA 4Z2UA 2F3MA 5EY6A 3GA4A 4MJEA 2VL3A 5FHIA 1Z7RA 1TK5B 3QMXA 2JL4A 4XRDA 2QC7A 2C0FA 3G7JA 3ZIVA 3GKXA 5A34B 2WJUA 3M0FA 2C3TA 4GSNA 3F4RA 1H4OA 2P5QA 3FZ5A 1JZRA 4O32A 5HFKA 5DJLA 3UL3A 4EIQA 4BPYA 2GT6A 3KTBA 1XW6A 2OT3A 1XW5A 1X5EA 2RM5A 4EE0A 1BAYA 1U88A 2R0GA 3DIEA 2TRXA 3GX8A 3HY2A 3FR9A 2JU5A 1ERUA 1X0RA 3LGCA 2PVOC 3IC4A 2DJ1A 2JZSA 4ULXA 1S3DA 2VAFA 1SVLA 3IAS2 1AQWA 3H1NA 2A4VA 2K18A 2H73A 2H8LA 1ON4A 3RAZA 4RI6A 2V2GA 4K5RA 2REMA 1DSBA 1RK4A 4ZILA 3PINA 4IELA 3HDCA 2HRFA 3TKQA 1GTUA 3E0UA 5EL8A 1N8JA 1BX9A 3LG6A 4DSSB 2R37A 3DRNA 4E8HA 2VCQA 6GSWA 1ZYPA 5B8BA 4HDEA 3GL5A 3WGXA 1BQ7A 3KTLA 2F51A 3KCMA 4GCIA 3TKRA 4J56E 3HHVA 3C7MA 3KMNA 2B7JA 1GTBA 4EIPA 1MD4A 4X4JA 2VKZG 2C3NA 2LNSA 3PR8A 3TDGA 5GAND 1M9BA 1UVZA 3EMPA 2C8UA 2VLTA 4OCEA 4ZIJA 4WF5A 1B48A 1GULA 2EFHA 4AJ6A 1Z5YE 1U87A 1ZL9A 4ICYA 1JFUA 4KCEA 2V6OA 2A2RA 2DBCA 5H5QA 1K0NA 4AGSA 2OJLA 1DUGA 1EP8A 1BF5A 2ALBA 1K0AA 3GH6A 4Q5QA 2DIYA 4CY8A 2GZZA 5GSTA 2H72A 4IS0A 4AKXB 2HZEB 2GSQA 3HD5A 3E3EA 2B1KA 3ZVJA 3A2VA 1Y25A 1FW1A 1B8XA 1O81A 1E2YA 3A5WA 1AIUA 2IN3A 1GSUA 2RUFA 3FY7A 1T4ZA 4EXJA 4J57E 1X9SB 1USBA 2CX4A 1I9DA 2NTOA 1FVJA 4L0WA 4Z2RA 3VFIA 5A5HA 2DSAA 1OC3A 3VURA 1PRXA 16GSA 4NHWA 4XIHA 4DSSA 5IMDA 3GN3A 3CSHA 2WS2A 2HSYA 2IWTA 4JR4A 1IYHA 2YWOA 1N25A 3TKSC 1URMA 2NPBA 4IQAA 2JADA 1GH2A 3FRCA 3R3EA 4FH8A 5IIZA 3TB2A 5J47A 3IK9A 1ZYNA 5DVBA 1QQ2A 3IXRA 4MK3A 2JACA 3GH9A 1DE1A 3VPQA 1SKSB 2VLUA 4I5QA 1BYEA 2YZHA 1ERWA 2R3XA 5JCWA 2DIZA 5H5SA 5AIVA 5DAKA 1O7UA 4N0VA 1TRUA 2HFDA 3GNJA 2H66A 3LW9A 1HQOA 1GWCA 4WXTA 1ILOA 4IW9A 3QD9A 3U5RE 2GQLA 4N0ZA 4HZ4A 1F2EA 2HZEA 3PPUA 2LTKA 4X1UA 4K6XA 5DJMA 1GLPA 4X43A 3KMOA 1R5AA 4PXOA 3BBYA 5D73A 1FOVA 3UVTA 3BJ5A 1Z7PA 1AQVA 2LJRA 5LD0A 5G1LA 1XBSA 3ERWA 5HR3A 11GSA 3O3TA 2N5FA 4HQZA 1WJKA 3UEMA 4ECBA 2WFCA 5E4WA 2RIIA 2GVPA 4K1FA 3LXZA 2B1LA 5IPGA 4ZBDA 4KNDA 5KOWA 3IR4A 4NV2A 5H5RA 1QFNA 4GXZA 4KAEA 2P5RA 2CV4A 3I43A 1MDKA 4Q5FA 3CXGA 1FB0A 3KGKA 4MABA 1YZXA 2H30A 1U6TA 2HT9A 4F82A 4XS1A 4FQUA 5GAPD 1ERTA 5CYYA 1SK2A 6GSUA 1JLWA 2F8AA 3PGTA 5IMFA 1XOBA 2XPDA 1G7EA 1GSDA 5D9WA 2DKHA 4XCSA 2HLSA 4ECJA 1FHEA 5CP1A 4TKYA 4ZBAA 3D5JA 1VGLA 1SYXA 1A2JA 2EIRA 1V57A 1AC1A 3I6AA 3APSA 1SD9A 4NHZA 5CRGA 3WT1A 3C73A 4QL9A 1Z6NA 3HVVA 5J4UA 2N5BA 2H01A 4ML6A 2YWNA 3QDNA 4OO4A 2GLRA 3P90A 4WEYA 3UJ1A 2R0CA 4MA9A 2LRTA 4MZBA 5IM9A 4GQFA 3NIVA 3GUSA 5D93A 2HRAA 1O8WA 1S3AA 4FYBA 3KM6A 4PNGA 5JWRB 3VLNA 1VF4A 3VK9A 3VWXA 2X99A 2PUKC 5J4VA 1O6JA 3TJBA 3UAPA 1ML6A 4OO5A 3JCML 4PQIA 4IHUA 2HXKA 5FT3A 1GSFA 5J40A 4LMWA 3H8QA 4NAXA 1SYRA 2OA7A 3UBLA 3TKPA 3GMFA 3GURA 3BCIA 1R4WA 1TXUA 1PN9A 1PL1A 4XS4B 4LMVA 1Y6EA 2VL9A 5CO3A 4BL7B 5KN1A 2LQQA 2FD3A 2DMMA 4K7OA 3TOUA 2HSHA 4IKHA 1FB6A 5IO2A 4MZCA 1K0MA 4KSMA 2H1GA 2E2GA 3M8NA 2LRCA 1SL0B 2FNOA 1T8EB 3IV4A 2OACA 1FAAA 2ON5A 2IL3A 2A2PA 14GSA 2H70A 1WMJA 1OC8A 4FYUA 4EDZA 2VM2A 5G5FA 1Z9HA 5KN2A 1EEMA 4ACSA 3LSZA 4RQXA 1GUKA 3RHBA 2OE1A 1TU8A 5J9BA 8GSSA 2L57A 4V1Ap 2C4JA 4MPGA 2FWHA 1EP7A 1GSEA 4JRRA 3EMXA 4GQCA 5G5EA 1Z6MA 1UA5A 2DJ2A 5D9XA 1XVQA 5DBQA 4CW9A 4YAPA 3I9V2 2B3SA 1SD8A 3M9KA 1K0DA 3IBHA 2FUG2 4KUNA 3ZREA 3EU3A 3ZRDA 2LS5A 1IYIA 3ZFLA 4K0GA 2F8FA 2FY6A 2H75A 4IP6A 4DSRA 4IBPA 4TXOA 2HNLA 1T4YA 2B5XA 4TRXA 2L6DA 5CRWA 1TXXA 3ZFBA 4G9HA 1K0CA 1K0BA 4J2FA 4BL7A 4A5PA 4MF6A 1HNCA 1QMVA 3Q19A 3DD3A 2ES7A 1AW9A 1FG4A 2PU9C 4MMMA 3ZL5A 4EC0A 5ECPB 3KIJA 1V98A 1Z3EA 5COHA 2HSMB 2EFCA 1EZKA 1PSQA 4EO3A 4NV5A 1I5GA 1TU7A 2FCHA 4E8EA 5G31A 4HOJA 3US3A 3W8SA 2MMNA 2PPTA 1X5DA 2P31A 3ZYWA 2I81A 3D6IA 1TK8B 2OBIA 2X8CA 5DQSA 1EOGA 1GUMA 4K2XA 4POBA 4ILFA 4K2DA 4WF4A 2VOCA 1O85A 3CTFA 4K8MA 2VO4A 1SK0A 1G6YA 1W89A 2R4VA 1PX6A 4L0UA 1Y1UA 1RW1A 5B6MA 3O6TA 1LBKA 4ML1A 5CNWA 3ZTLA 2YOIA 1XXUA 19GSA 2C0GA 4HEA2 2H1DA 1AQXA 3DKSA 2QA1A 3DMLA 3RBTA 1XZOA 2P0GA 4HQSA 3F63A 2YN1A 1R26A 2E7PA 3APQA 4XTSA 5A5HB 4Z7XA 1GNEA 2MZCA 3KEBA 3BD2A 2B6MA 4IVFA 1CQHA 1XWBA 1CQGA 4ECIA 3MAKA 4KA0A 2M46A 2C80A 3DXBA 2HSMA 3D4MA 1XW9A 5F05A 2NVLA 1SL2B 4JEDA 1F37A 1PKWA 2JZTA 1ACVA 3VI7A 2L5LA 3DVWA 4YKGA 3WGDA 4AKIA 2MBTA 5F06A 5J4YA 3L4NA 4YQMA 3FKFA 1AAZA 1KTEA 1EV9A 2XBIA 1TRWA 4PUAA 1T1VA 4G0LA 5HR2A 2JSZA 2YV7A 4YQUA 1YKAA 4NPBA 2A4HA 4AJ8A 1GSSA 4ECCA 3ME8A 5DAKB 5B7CA 1PQNA 3F9UA 1SJIA 4HZ2A 3J7Yb 3WT2A 2CAIA 1KNGA 1OKDA 1UN2A 1WE0A 1GSYA 4KSOA 2V41A 2GZYA 2VD1A 3HZ4A 1SJZA 2WCIA 1XWKA 1F9MA 3MIXA 4EVMA 2KOKA 5JCUA 1YQ1A 2H0GA 5KN0A 1EGOA 1KBNA 2V6KA 4MCUA 1GUHA 3F6FA 3HKRA 1UC7A 4TXVA 2VIMA 3CBUA 2DJ0A 2I4AA 2BJXA 3E9JB 1FOHA 2XHFA 4PX1A 1ZYQB 2QKEA 4K7IA 1SENA 1M2DA 1QGVA 4IGJA 4O7HA 5B8AA 2LKUA 3AY8A 5IOWA 5KN3A 1PX7A 1B9YC 2K8VA 1THXA 3GKKA 3IC8A 5ID2B 3FEUA 5ECMB 1F6MC 3TCOA 2IPAA 2FLSA 1ZYEA 4YAVA 4TR4A 5F8BA 2DC5A 5IMZA 2IMKA 3ZVJD 4GSSA 5L71A 3LEFA 1MDJA 4TVEA 1GTIA 3ME7A 1J9BA 4ZBBA 2PERA 1QXHA 3F3RA 3QAGA 2LJAA 2TIRA 4JR6A 2AAWA 5EVOA 3F4SA 1GRXA 3L9VA 3FHKA 5ABRA 1TKDB 1XWAA 4MDCA 5ECKB 4IJ3A 1TI1A 4AKHA 5ELGA 4PTSA 4POKA 2CAQA 4L8EA 4ZB9A 1EOHA 3QOUA 1QK8A 3SWLA 4HUAA 2R0PA 1X9MB 3FW2A 5ECNB 3M9JA 1LJRA 1A2MA 2XPEA 3MYDA 5GSSA 1PKZA 1ERVA 5AISA 3TGZA 4KB3A 4HJ2A 2MBSA 5ID2A 1HD2A 5A4VA 4PUFC 3QAVA 2LJKA 3RHCA 4WETA 3GL3A 2AJQB 3A2WA 3HCZA 4OFMA 3VI5A 2FA8A 4OD7A 3ZIJA 1PN0A 1TRSA 3Q74A 3GYKA 1B9XC 1ZCPA 4O5RA 2IMEA 4LA1A 2H0HA 1SVOA 4LL1B 2L6CA 4KW6A 1O73A 2BTOT 1M2AA 5G30A 1F3AA 3LWAA 2VCXA 4RI7A 2C1YA 4KCAA 4G19A 2LRNA 4KGIA 2YCDA 2G2QA 5J41A 1EEJA 3EC3A 5ECLB 1XFLA 4OFTA 3TOTA 3HJMA 2IMDA 5ECQB 1T7PB 2K9FA 2C0DA 2V32A 1K3OA 2YWMA 5INYA 1YJ6A 4EUYA 2FWFA 1RQMA 2H74A 1KEBA 4ZB6A 3DYRA 1V2AA 4G0IA 1M2BA 3LYKA 2XC2A 5F07A 3NOFA 1YDKA 3F4TA 1ZZYA 1OE8A 3G9BA 5DCHA 1G6WA 1EWXA 4OWYA 2K8SA 5DDLA 3NZNA 2FWGA 3DEXA 2X8HA 2I9HA 4ZL8A 2FHEA 4IN0A 3BOAA 4LLRA 2WULA 5A1NA 4XS6A 4D73B 1XWCA 4V2NA 4KF9A 1WP0A 3GKMA 1X5CA 2VM1A 4TR1A 3RPNA 2C3QA 5LCZA 2YPMA 4O5QA 1E6BA 2IMFA 1YF0A 4CHSA 2OKAA 3TRXA 2DJJA 5J3RA 4OCFA 6GSXA 1JHBA 1YEXA 4WR4A 4EKZA 4TXOB 3S9FA 4I97A 4MJAA 1YKCA 1B4QA 2OE0A 3RPPA 3IDVA 3KXOA 2G0FA 3HYPA 1NW2A 4MH3A 2FA4A 3P8WA 4MJCA 4JBBA 3W6GA 2HSNB 4GSTA 3FYGA 4MJBA 3IHQA 4PNFA 4AJ7A 2X49A 3FMWA 1GSQA 2F9SA 1TW9A 3TKSA 4POLA 1XIYA 3GHAA 3GIXA 5IPHA 1GP1A 1TDIA 5ELAA 1K3YA 1A0RP 2PN8A 4E68A 2DKIA 3MNGA 5BMUA 1V40A 1B4PA 1WOUA 1TTZA 2H6YA 2CZ2A 1MEKA 2CT6A 10GSA 3HXSA 2TRCP 1A8LA 1R5PA 1HNBA 2JZRA 2L5OA 1V58A 3GKNA 2B7KA 2IFQA 1VF2A 4MH2A 1NM3A 4WR5A 4D73A 2YWIA 4EF0A 5DALB 3F3QA 4V2LA 1XOAA 4I2UA 3CYNA 1M0UA 5G1KA 4TW5A 1XPVA 3KP8A 1AUCA 4BVXA 3GTUA 5ECHB 2L59A 3CSJA 2PMTA 5A5KA 3H4KA 5C00A 2GGTA 2H0IA 3UIWA 2EIOA 3IAM2 5IMAA 2EIQA 2LQOA 1O8XA 4F0BA 2HRNA 2DJKA 4KDXA 4TR0A 3F0IA 5HR0A 3L9UA 1YVLA 5ECSA 1ABAA 5CRDA 2HSNA 3VWUA 4NXIA 5DQYA 4AF2A 3R2QA 3CRTA 4KX4A 4F2IA 2CVBA 1NSWA 1QUWA 4Z2TA 4Q5RA 1SJ6A 1VF3A 1VF1A 1F3BA 5B6NA 1ZOFA 1SKWB 1N2AA 2GS3A 3A2XA 2YP6A 4BVYA 4HJMA 2VUPA 4GDFA 13GSA 1DE2A 4LL4B 2GSTA 2GDRA 4I8BA 3TRQA 3IHGA 3ZZXA 5LNKe 2HRKA 4N30A 5DALA 3ERGA 2KP2A 3UVHA 20GSA 1VRSD 4MF5A 5C04A 1TI3A 2AUVA 1A0FA 1THOA 3ED3A 3DVXA 1GNWA 4W66A 1HNAA 3LYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TR3 A;  5DCG A;  1FVK A;  5KEJ A;  2CX3 A;  5F0G A;  4KE3 A;  4GF0 A;  3F6D A;  3QAW A;  2L4C A;  2WDU A;  5J9C A;  12GS A;  1MTC A;  5AIX A;  17GS A;  2PWJ A;  1SL1 B;  3GSS A;  4X0X A;  4JZQ A;  1C72 A;  2FGX A;  2NDO A;  1OKT A;  4POM A;  2DLX A;  2H76 A;  3VWW A;  3EU4 A;  4GLT A;  2O7K A;  3F8U A;  4K0N A;  4P3Y B;  5EPF A;  2GQK A;  3FR6 A;  3WGE A;  4FO5 A;  1MD3 A;  5D9T A;  4TN8 A;  3QR6 A;  2V1M A;  3C8E A;  2HZF A;  3Q6O A;  1U3A A;  4WBR D;  1A24 A;  5CRH A;  2CVD A;  4PQ1 A;  4USS A;  4L5O A;  4YH2 A;  1S3C A;  5ECO B;  22GS A;  1XCC A;  3EYT A;  3HJO A;  2YNX A;  2B5Y A;  2BMX A;  2IIY A;  2J23 A;  3I69 A;  4DVC A;  1U3I A;  4G0K A;  2VLV A;  2IMI A;  2VL2 C;  4ZL9 A;  1R7H A;  3FZA A;  3HJP A;  1T3B A;  5HR1 A;  2PBJ A;  2J9H A;  4RQR A;  2LNT A;  3VPT A;  3IE3 A;  1NHY A;  3EE2 A;  3KH9 A;  4PGT A;  2O85 A;  4HU7 A;  4NMU A;  3QCP A;  3TRP A;  3LJR A;  4K7N A;  2AV4 A;  2M80 A;  3BCK A;  4FYC A;  4OMV A;  2YJH A;  4I2T A;  4F0C A;  4G2E A;  2VD0 A;  5D8I A;  2CZ3 A;  3TKS E;  3EVI A;  3PH9 A;  1W4V A;  2MMZ A;  1A23 A;  3IOS A;  4KDU A;  2R2J A;  4V1A g;  1BJX A;  3G7I A;  3ZIT A;  4QQ7 A;  1LU4 A;  3CSI A;  4IQ1 A;  3V1W A;  2AYT A;  3FK8 A;  4GRF A;  3M3M A;  3K8N A;  3IPZ A;  1GL8 A;  3H79 A;  4BWS A;  2N5A A;  2X64 A;  1G0T A;  4GWR A;  4WKW A;  6GST A;  4FIW A;  2R5G A;  1OC9 B;  2H71 A;  2CQ9 A;  5ECR B;  2H1A A;  2A2S A;  1Q98 A;  1JZD A;  3MWH A;  5HQP A;  5D96 A;  4Q5N A;  3FZ9 A;  1Q4J A;  2GTU A;  2IJY A;  2OAD A;  2MMO A;  2PVQ A;  4N11 A;  4MLY A;  3DGQ A;  6GSY A;  1PMT A;  2LST A;  3QFA C;  2VCW A;  3QFB C;  1TP9 A;  2CVK A;  5JWQ B;  4K9Z A;  1T00 A;  3MDK A;  2AHE A;  2NBS A;  4OFN A;  2VCZ A;  4F9Z A;  1XWG A;  2RLI A;  1SKR B;  2R6K A;  4IJI A;  2RM6 A;  5HFG A;  2B5E A;  3HA9 A;  2GSR A;  1YEP A;  3M1G A;  5IQY A;  4XHM A;  5A4U A;  3GX0 A;  3KH7 A;  1BED A;  3GST A;  2ZUP A;  3P2A A;  2DML A;  3IA1 A;  4MZW A;  3ISO A;  2LUS A;  1NHO A;  4JU5 A;  4DEJ A;  4HU9 A;  2I3Y A;  4L5L A;  3A3T A;  1G7O A;  2PGT A;  5GZZ B;  4PUR A;  3GFK A;  4BA7 A;  2QSI A;  1J08 A;  3APO A;  2Z9S A;  4TR1 B;  3J7Y k;  4EDY A;  1OC9 A;  5A4W A;  18GS A;  1TJD A;  1TOF A;  5IMV A;  2O87 A;  3WYW A;  1XVW A;  4NWY A;  2KP1 A;  5JWO B;  1JLV A;  1FO5 A;  3TJF A;  1TK0 B;  3TJJ A;  1ZMA A;  6GSS A;  3Q18 A;  2WRT A;  2OE3 A;  3U6V A;  2GSS A;  1GTA A;  3RDW A;  3SBC A;  4JE1 A;  3O76 A;  4H86 A;  3HVS A;  3ZML A;  4QL7 A;  3D4T A;  2H1B A;  4CDO A;  1YY7 A;  2ZCT A;  3ERF A;  1WPI A;  4YQV A;  3EWL A;  3LFL A;  2K6V A;  1JZW A;  3EUR A;  5FWG A;  1OVN A;  1M7T A;  2YJ7 A;  2O8V B;  2ZNM A;  3LOR A;  4IP1 A;  1J0F A;  3IK7 A;  2M72 A;  3D21 A;  4ISD A;  2E0Q A;  1V9W A;  2LV3 A;  1X9W B;  3H93 A;  3UBK A;  2EC4 A;  2YZU A;  1A2L A;  3N9J A;  3CTG A;  1OE7 A;  2WB9 A;  1M9A A;  2HYX A;  3C1S A;  3C71 A;  3W8J A;  2LEG A;  1TRV A;  4KDY A;  2IFQ B;  1OYJ A;  3MSZ A;  2RUE A;  2ON7 A;  4O92 A;  3DWV A;  3TJG A;  1PA3 A;  4ZL7 A;  7GSS A;  2VL2 A;  1AXD A;  4F03 A;  3KD0 A;  3L0H A;  4BVX B;  3GTU B;  3KP9 A;  5D9V A;  2WZ9 A;  2DJ3 A;  5HFI A;  2OBK A;  5E59 A;  3UMA A;  3P7X A;  2L4Q A;  1A8Y A;  2KLX A;  2HI7 A;  1H75 A;  3VWV A;  2HE3 A;  3G7Y A;  5J5N A;  1OAZ A;  5CAX A;  5CRE A;  2I1U A;  3ZMK A;  4HI7 A;  2QGV A;  3GV1 A;  1WIK A;  5G2Z A;  2H19 A;  2GQM A;  3UOM A;  5IMC A;  4PQH A;  3EIN A;  3GRX A;  1BG5 A;  1SU9 A;  2VCV A;  4MPF A;  5ECI B;  3LQ7 A;  2X8G A;  4BWQ A;  4BVY B;  3N5O A;  2JSY A;  4XRA A;  3ZLP A;  1WWJ A;  3OR5 A;  3QPM A;  4N10 A;  4MF7 A;  2WGR A;  1EV4 A;  3D0Z A;  3L9S A;  1K3L A;  1M99 A;  2MYG A;  2HRK B;  2GZP A;  4HS1 A;  5AN1 A;  9GSS A;  3HVX A;  1DBY A;  1PGT A;  5IOX A;  1ST9 A;  1PD2 1;  3C1R A;  3KJY A;  3CMI A;  1SK1 A;  3UAR A;  1ZGN A;  2H6X A;  3FZ4 A;  6GSV A;  2H6Z A;  3HZ8 A;  3CRU A;  2HQT A;  2D2Z A;  4EL1 A;  2VCT A;  3D22 A;  2CA8 A;  1K0O A;  5AGY A;  2KHP A;  2C0E A;  2UZ8 A;  4RUV A;  4V2M A;  1WRY A;  4KH7 A;  2O89 A;  5JCG A;  4MP4 A;  2E2M A;  4TOP A;  2MMA A;  2GT5 A;  4ID0 A;  3L78 A;  4DSQ A;  2XBQ A;  3TJK A;  2KUC A;  3TUE A;  4ZXG A;  3FR3 A;  3IRA A;  4WBJ A;  1HYU A;  3LXT A;  4XS4 A;  2FWE A;  1PL2 A;  3KZQ A;  4I6X A;  1EGR A;  4GTU A;  2YV9 A;  4G10 A;  1YF1 A;  1MDI A;  5ENU A;  4ZB8 A;  1JZO A;  2AB6 A;  3WD6 A;  5IO0 A;  2YAN A;  1GLQ A;  2F3M A;  5EY6 A;  3GA4 A;  4MJE A;  2VL3 A;  5FHI A;  1Z7R A;  1TK5 B;  3QMX A;  2JL4 A;  4XRD A;  2QC7 A;  2C0F A;  3G7J A;  3ZIV A;  3GKX A;  2WJU A;  3M0F A;  2C3T A;  4GSN A;  3F4R A;  1H4O A;  2P5Q A;  3FZ5 A;  1JZR A;  4O32 A;  5HFK A;  5DJL A;  3UL3 A;  4BPY A;  2GT6 A;  3KTB A;  1XW6 A;  1XW5 A;  1X5E A;  2RM5 A;  4EE0 A;  1BAY A;  1U88 A;  3DIE A;  2TRX A;  3GX8 A;  3HY2 A;  3FR9 A;  2JU5 A;  1ERU A;  1X0R A;  3LGC A;  2PVO C;  3IC4 A;  2DJ1 A;  2JZS A;  4ULX A;  1S3D A;  2VAF A;  3IAS 2;  1AQW A;  3H1N A;  2A4V A;  2K18 A;  2H73 A;  2H8L A;  1ON4 A;  3RAZ A;  4RI6 A;  2V2G A;  2REM A;  1DSB A;  1RK4 A;  4ZIL A;  3PIN A;  4IEL A;  3HDC A;  2HRF A;  3TKQ A;  1GTU A;  3E0U A;  5EL8 A;  1N8J A;  1BX9 A;  3LG6 A;  4DSS B;  2R37 A;  3DRN A;  4E8H A;  2VCQ A;  6GSW A;  5B8B A;  4HDE A;  3GL5 A;  3WGX A;  1BQ7 A;  3KTL A;  2F51 A;  3KCM A;  4GCI A;  3TKR A;  4J56 E;  3HHV A;  3C7M A;  3KMN A;  2B7J A;  1GTB A;  1MD4 A;  2C3N A;  2LNS A;  3PR8 A;  3TDG A;  5GAN D;  1M9B A;  1UVZ A;  3EMP A;  2C8U A;  2VLT A;  4OCE A;  4ZIJ A;  4WF5 A;  1B48 A;  1GUL A;  4AJ6 A;  1Z5Y E;  1U87 A;  1ZL9 A;  1JFU A;  4KCE A;  2V6O A;  2A2R A;  2DBC A;  5H5Q A;  1K0N A;  4AGS A;  2OJL A;  1DUG A;  1EP8 A;  2ALB A;  1K0A A;  3GH6 A;  4Q5Q A;  2DIY A;  2GZZ A;  5GST A;  2H72 A;  4IS0 A;  2HZE B;  2GSQ A;  3HD5 A;  3E3E A;  2B1K A;  3ZVJ A;  3A2V A;  1Y25 A;  1FW1 A;  1B8X A;  1O81 A;  1E2Y A;  3A5W A;  1AIU A;  2IN3 A;  1GSU A;  2RUF A;  3FY7 A;  1T4Z A;  4EXJ A;  4J57 E;  1X9S B;  1USB A;  2CX4 A;  1I9D A;  2NTO A;  1FVJ A;  4L0W A;  3VFI A;  2DSA A;  1OC3 A;  3VUR A;  1PRX A;  16GS A;  4NHW A;  4XIH A;  4DSS A;  5IMD A;  3GN3 A;  3CSH A;  2WS2 A;  2HSY A;  4JR4 A;  2IWT A;  1IYH A;  2YWO A;  3TKS C;  1URM A;  2NPB A;  4IQA A;  2JAD A;  1GH2 A;  3FRC A;  3R3E A;  4FH8 A;  5IIZ A;  3TB2 A;  3IK9 A;  5DVB A;  1QQ2 A;  3IXR A;  4MK3 A;  2JAC A;  3GH9 A;  1DE1 A;  3VPQ A;  1SKS B;  2VLU A;  4I5Q A;  1BYE A;  2YZH A;  1ERW A;  2R3X A;  5JCW A;  2DIZ A;  5H5S A;  5AIV A;  5DAK A;  1O7U A;  4N0V A;  1TRU A;  2HFD A;  3GNJ A;  2H66 A;  1HQO A;  1GWC A;  4WXT A;  1ILO A;  4IW9 A;  3QD9 A;  3U5R E;  2GQL A;  4N0Z A;  4HZ4 A;  1F2E A;  2HZE A;  3PPU A;  2LTK A;  4X1U A;  4K6X A;  5DJM A;  1GLP A;  4X43 A;  3KMO A;  1R5A A;  4PXO A;  3BBY A;  5D73 A;  1FOV A;  3UVT A;  3BJ5 A;  1Z7P A;  1AQV A;  2LJR A;  5LD0 A;  5G1L A;  1XBS A;  3ERW A;  5HR3 A;  11GS A;  3O3T A;  2N5F A;  4HQZ A;  1WJK A;  3UEM A;  4ECB A;  2WFC A;  5E4W A;  2RII A;  2GVP A;  4K1F A;  3LXZ A;  2B1L A;  5IPG A;  4ZBD A;  4KND A;  3IR4 A;  4NV2 A;  5H5R A;  1QFN A;  4GXZ A;  4KAE A;  2P5R A;  2CV4 A;  3I43 A;  1MDK A;  4Q5F A;  3CXG A;  1FB0 A;  3KGK A;  4MAB A;  1YZX A;  2H30 A;  1U6T A;  2HT9 A;  4F82 A;  4XS1 A;  4FQU A;  5GAP D;  1ERT A;  5CYY A;  1SK2 A;  6GSU A;  1JLW A;  2F8A A;  3PGT A;  5IMF A;  1XOB A;  2XPD A;  1G7E A;  1GSD A;  5D9W A;  4XCS A;  2HLS A;  4ECJ A;  1FHE A;  5CP1 A;  4TKY A;  4ZBA A;  3D5J A;  1VGL A;  1SYX A;  1A2J A;  2EIR A;  1V57 A;  1AC1 A;  3I6A A;  3APS A;  1SD9 A;  4NHZ A;  5CRG A;  3WT1 A;  3C73 A;  4QL9 A;  1Z6N A;  3HVV A;  5J4U A;  2N5B A;  2H01 A;  4ML6 A;  2YWN A;  3QDN A;  4OO4 A;  2GLR A;  3P90 A;  4WEY A;  3UJ1 A;  4MA9 A;  2LRT A;  4MZB A;  5IM9 A;  4GQF A;  3NIV A;  3GUS A;  5D93 A;  2HRA A;  1O8W A;  1S3A A;  4FYB A;  3KM6 A;  4PNG A;  5JWR B;  3VLN A;  1VF4 A;  3VK9 A;  3VWX A;  2X99 A;  2PUK C;  1O6J A;  3TJB A;  3UAP A;  1ML6 A;  4OO5 A;  3JCM L;  4PQI A;  4IHU A;  2HXK A;  5FT3 A;  1GSF A;  4LMW A;  3H8Q A;  4NAX A;  1SYR A;  2OA7 A;  3UBL A;  3TKP A;  3GMF A;  3GUR A;  3BCI A;  1R4W A;  1PN9 A;  1PL1 A;  4XS4 B;  4LMV A;  1Y6E A;  2VL9 A;  5CO3 A;  4BL7 B;  5KN1 A;  2LQQ A;  2FD3 A;  2DMM A;  4K7O A;  3TOU A;  2HSH A;  4IKH A;  1FB6 A;  5IO2 A;  4MZC A;  1K0M A;  4KSM A;  2H1G A;  2E2G A;  3M8N A;  2LRC A;  1SL0 B;  2FNO A;  1T8E B;  3IV4 A;  2OAC A;  1FAA A;  2ON5 A;  2IL3 A;  14GS A;  2H70 A;  1WMJ A;  1OC8 A;  4FYU A;  4EDZ A;  2VM2 A;  5G5F A;  1Z9H A;  5KN2 A;  1EEM A;  4ACS A;  3LSZ A;  4RQX A;  1GUK A;  3RHB A;  2OE1 A;  1TU8 A;  5J9B A;  8GSS A;  2L57 A;  4V1A p;  2C4J A;  4MPG A;  2FWH A;  1EP7 A;  1GSE A;  4JRR A;  3EMX A;  4GQC A;  5G5E A;  1Z6M A;  1UA5 A;  2DJ2 A;  5D9X A;  1XVQ A;  5DBQ A;  4CW9 A;  4YAP A;  3I9V 2;  2B3S A;  1SD8 A;  3M9K A;  1K0D A;  3IBH A;  2FUG 2;  4KUN A;  3ZRE A;  3EU3 A;  3ZRD A;  2LS5 A;  1IYI A;  3ZFL A;  4K0G A;  2F8F A;  2FY6 A;  2H75 A;  4IP6 A;  4DSR A;  4IBP A;  4TXO A;  2HNL A;  1T4Y A;  2B5X A;  4TRX A;  2L6D A;  5CRW A;  1TXX A;  3ZFB A;  4G9H A;  1K0C A;  1K0B A;  4J2F A;  4BL7 A;  4MF6 A;  1HNC A;  1QMV A;  3Q19 A;  3DD3 A;  2ES7 A;  1AW9 A;  1FG4 A;  2PU9 C;  4MMM A;  3ZL5 A;  4EC0 A;  5ECP B;  3KIJ A;  1V98 A;  1Z3E A;  5COH A;  2HSM B;  1EZK A;  1PSQ A;  4EO3 A;  4NV5 A;  1I5G A;  1TU7 A;  2FCH A;  4E8E A;  5G31 A;  4HOJ A;  3US3 A;  3W8S A;  2MMN A;  2PPT A;  1X5D A;  2P31 A;  3ZYW A;  2I81 A;  3D6I A;  1TK8 B;  2OBI A;  2X8C A;  5DQS A;  1EOG A;  1GUM A;  4POB A;  4ILF A;  4K2D A;  4WF4 A;  2VOC A;  1O85 A;  3CTF A;  4K8M A;  2VO4 A;  1SK0 A;  1G6Y A;  1W89 A;  2R4V A;  1PX6 A;  4L0U A;  1RW1 A;  5B6M A;  3O6T A;  1LBK A;  4ML1 A;  5CNW A;  3ZTL A;  2YOI A;  1XXU A;  19GS A;  2C0G A;  4HEA 2;  2H1D A;  1AQX A;  3DKS A;  3DML A;  3RBT A;  1XZO A;  2P0G A;  4HQS A;  3F63 A;  2YN1 A;  1R26 A;  2E7P A;  3APQ A;  4XTS A;  4Z7X A;  1GNE A;  2MZC A;  3KEB A;  3BD2 A;  2B6M A;  4IVF A;  1CQH A;  1XWB A;  1CQG A;  4ECI A;  3MAK A;  4KA0 A;  2M46 A;  2C80 A;  3DXB A;  2HSM A;  3D4M A;  1XW9 A;  5F05 A;  2NVL A;  1SL2 B;  4JED A;  1F37 A;  1PKW A;  2JZT A;  1ACV A;  3VI7 A;  2L5L A;  3DVW A;  3WGD A;  2MBT A;  5F06 A;  3L4N A;  4YQM A;  3FKF A;  1AAZ A;  1KTE A;  1EV9 A;  2XBI A;  1TRW A;  4PUA A;  1T1V A;  4G0L A;  5HR2 A;  2JSZ A;  2YV7 A;  4YQU A;  1YKA A;  4NPB A;  4AJ8 A;  1GSS A;  4ECC A;  3ME8 A;  5DAK B;  5B7C A;  1PQN A;  3F9U A;  1SJI A;  4HZ2 A;  3J7Y b;  3WT2 A;  2CAI A;  1KNG A;  1OKD A;  1UN2 A;  1WE0 A;  1GSY A;  4KSO A;  2V41 A;  2GZY A;  2VD1 A;  3HZ4 A;  1SJZ A;  2WCI A;  1XWK A;  1F9M A;  4EVM A;  2KOK A;  5JCU A;  1YQ1 A;  2H0G A;  5KN0 A;  1EGO A;  1KBN A;  2V6K A;  4MCU A;  1GUH A;  3F6F A;  3HKR A;  1UC7 A;  4TXV A;  2VIM A;  3CBU A;  2DJ0 A;  2I4A A;  2BJX A;  3E9J B;  2XHF A;  4PX1 A;  1ZYQ B;  2QKE A;  4K7I A;  1SEN A;  1M2D A;  1QGV A;  4IGJ A;  4O7H A;  5B8A A;  2LKU A;  3AY8 A;  5IOW A;  5KN3 A;  1PX7 A;  1B9Y C;  2K8V A;  1THX A;  3GKK A;  3IC8 A;  5ID2 B;  3FEU A;  5ECM B;  1F6M C;  3TCO A;  2IPA A;  2FLS A;  1ZYE A;  4YAV A;  4TR4 A;  5F8B A;  2DC5 A;  5IMZ A;  2IMK A;  3ZVJ D;  4GSS A;  5L71 A;  3LEF A;  1MDJ A;  4TVE A;  1GTI A;  3ME7 A;  1J9B A;  4ZBB A;  2PER A;  1QXH A;  3F3R A;  3QAG A;  2LJA A;  2TIR A;  4JR6 A;  2AAW A;  5EVO A;  3F4S A;  1GRX A;  3L9V A;  3FHK A;  5ABR A;  1TKD B;  1XWA A;  4MDC A;  5ECK B;  4IJ3 A;  1TI1 A;  5ELG A;  4PTS A;  4POK A;  2CAQ A;  4L8E A;  4ZB9 A;  1EOH A;  3QOU A;  1QK8 A;  3SWL A;  4HUA A;  1X9M B;  3FW2 A;  5ECN B;  3M9J A;  1LJR A;  1A2M A;  2XPE A;  5GSS A;  1PKZ A;  1ERV A;  5AIS A;  3TGZ A;  4KB3 A;  4HJ2 A;  2MBS A;  5ID2 A;  1HD2 A;  5A4V A;  4PUF C;  3QAV A;  2LJK A;  3RHC A;  4WET A;  3GL3 A;  2AJQ B;  3A2W A;  3HCZ A;  4OFM A;  3VI5 A;  2FA8 A;  4OD7 A;  3ZIJ A;  1TRS A;  3Q74 A;  3GYK A;  1B9X C;  1ZCP A;  4O5R A;  2IME A;  4LA1 A;  2H0H A;  4LL1 B;  2L6C A;  4KW6 A;  1O73 A;  2BTO T;  1M2A A;  5G30 A;  1F3A A;  3LWA A;  2VCX A;  4RI7 A;  2C1Y A;  4KCA A;  4G19 A;  2LRN A;  4KGI A;  2YCD A;  2G2Q A;  5J41 A;  1EEJ A;  3EC3 A;  5ECL B;  1XFL A;  4OFT A;  3TOT A;  3HJM A;  2IMD A;  5ECQ B;  1T7P B;  2K9F A;  2C0D A;  2V32 A;  1K3O A;  2YWM A;  5INY A;  1YJ6 A;  4EUY A;  2FWF A;  1RQM A;  2H74 A;  1KEB A;  4ZB6 A;  3DYR A;  1V2A A;  4G0I A;  1M2B A;  3LYK A;  2XC2 A;  5F07 A;  3NOF A;  1YDK A;  3F4T A;  1ZZY A;  1OE8 A;  3G9B A;  5DCH A;  1G6W A;  1EWX A;  4OWY A;  2K8S A;  5DDL A;  3NZN A;  2FWG A;  3DEX A;  2X8H A;  2I9H A;  4ZL8 A;  2FHE A;  4IN0 A;  3BOA A;  4LLR A;  2WUL A;  4XS6 A;  4D73 B;  1XWC A;  4V2N A;  4KF9 A;  1WP0 A;  3GKM A;  1X5C A;  2VM1 A;  4TR1 A;  3RPN A;  2C3Q A;  5LCZ A;  2YPM A;  1E6B A;  2IMF A;  1YF0 A;  4CHS A;  2OKA A;  3TRX A;  2DJJ A;  5J3R A;  4OCF A;  6GSX A;  1JHB A;  1YEX A;  4WR4 A;  4EKZ A;  4TXO B;  3S9F A;  4I97 A;  4MJA A;  1YKC A;  1B4Q A;  2OE0 A;  3RPP A;  3IDV A;  3KXO A;  2G0F A;  3HYP A;  1NW2 A;  4MH3 A;  2FA4 A;  3P8W A;  4MJC A;  4JBB A;  3W6G A;  2HSN B;  4GST A;  3FYG A;  4MJB A;  3IHQ A;  4PNF A;  4AJ7 A;  1GSQ A;  2F9S A;  1TW9 A;  3TKS A;  4POL A;  1XIY A;  3GHA A;  3GIX A;  5IPH A;  1GP1 A;  1TDI A;  5ELA A;  1K3Y A;  1A0R P;  2PN8 A;  3MNG A;  5BMU A;  1V40 A;  1B4P A;  1WOU A;  1TTZ A;  2H6Y A;  2CZ2 A;  1MEK A;  2CT6 A;  10GS A;  3HXS A;  2TRC P;  1A8L A;  1R5P A;  1HNB A;  2JZR A;  2L5O A;  1V58 A;  3GKN A;  2B7K A;  2IFQ A;  1VF2 A;  4MH2 A;  1NM3 A;  4WR5 A;  4D73 A;  2YWI A;  4EF0 A;  5DAL B;  3F3Q A;  4V2L A;  1XOA A;  4I2U A;  3CYN A;  1M0U A;  5G1K A;  4TW5 A;  1XPV A;  3KP8 A;  1AUC A;  4BVX A;  3GTU A;  5ECH B;  2L59 A;  3CSJ A;  2PMT A;  5A5K A;  3H4K A;  5C00 A;  2GGT A;  2H0I A;  3UIW A;  2EIO A;  3IAM 2;  5IMA A;  2EIQ A;  2LQO A;  1O8X A;  4F0B A;  2HRN A;  2DJK A;  4KDX A;  4TR0 A;  3F0I A;  5HR0 A;  3L9U A;  5ECS A;  1ABA A;  5CRD A;  3VWU A;  4NXI A;  5DQY A;  4AF2 A;  3R2Q A;  3CRT A;  4KX4 A;  4F2I A;  2CVB A;  1NSW A;  1QUW A;  4Q5R A;  1SJ6 A;  1VF3 A;  1VF1 A;  1F3B A;  5B6N A;  1ZOF A;  1SKW B;  1N2A A;  2GS3 A;  3A2X A;  2YP6 A;  4BVY A;  4HJM A;  2VUP A;  13GS A;  1DE2 A;  4LL4 B;  2GST A;  2GDR A;  4I8B A;  3TRQ A;  3ZZX A;  5LNK e;  2HRK A;  4N30 A;  5DAL A;  3ERG A;  2KP2 A;  3UVH A;  20GS A;  1VRS D;  4MF5 A;  5C04 A;  1TI3 A;  2AUV A;  1A0F A;  1THO A;  3ED3 A;  3DVX A;  1GNW A;  1HNA A;  3LYP A; 
#chains in the Genus database with same CATH topology
 4TR3 A;  5DCG A;  1FVK A;  5KEJ A;  2CX3 A;  5F0G A;  1SVM A;  4KE3 A;  4GF0 A;  3F6D A;  3QAW A;  2L4C A;  2WDU A;  5J9C A;  12GS A;  1MTC A;  5AIX A;  17GS A;  2PWJ A;  1SL1 B;  3GSS A;  4X0X A;  4JZQ A;  1C72 A;  2FGX A;  2NDO A;  4HSC X;  1OKT A;  4POM A;  2DLX A;  2H76 A;  3VWW A;  3EU4 A;  4GLT A;  2O7K A;  3F8U A;  4K0N A;  4P3Y B;  5EPF A;  2GQK A;  3FR6 A;  3WGE A;  4FO5 A;  1MD3 A;  5D9T A;  4TN8 A;  5KOX A;  3QR6 A;  2V1M A;  3C8E A;  2HZF A;  3HMJ G;  4BIK A;  3Q6O A;  1U3A A;  4WBR D;  1A24 A;  5CRH A;  2CVD A;  4PQ1 A;  4USS A;  4L5O A;  4YH2 A;  1S3C A;  5ECO B;  22GS A;  1XCC A;  3EYT A;  3TU3 B;  3HJO A;  5A34 A;  2YNX A;  2B5Y A;  2BMX A;  2IIY A;  3CHX C;  3I69 A;  2J23 A;  4DVC A;  1U3I A;  4G0K A;  2VLV A;  2IMI A;  2VL2 C;  4ZL9 A;  1R7H A;  3FZA A;  3HJP A;  1T3B A;  5HR1 A;  2PBJ A;  2J9H A;  4RQR A;  2LNT A;  3VPT A;  3IE3 A;  1NHY A;  3EE2 A;  3KH9 A;  4PGT A;  4MNN A;  2O85 A;  4HU7 A;  4NMU A;  3QCP A;  3TRP A;  3LJR A;  4K7N A;  2AV4 A;  2M80 A;  3BCK A;  4FYC A;  4K5S A;  4OMV A;  2YJH A;  4I2T A;  4F0C A;  4G2E A;  2VD0 A;  5D8I A;  2CZ3 A;  3TKS E;  3EVI A;  3PH9 A;  1W4V A;  2MMZ A;  1A23 A;  3IOS A;  4KDU A;  2R2J A;  4V1A g;  1BJX A;  3G7I A;  4CY6 A;  3ZIT A;  4QQ7 A;  1LU4 A;  3CSI A;  4IQ1 A;  3V1W A;  2AYT A;  3FK8 A;  2QA2 A;  4GRF A;  3M3M A;  3K8N A;  3IPZ A;  1GL8 A;  3H79 A;  2O5V A;  4BWS A;  2N5A A;  2X64 A;  1G0T A;  4GWR A;  4WKW A;  6GST A;  4FIW A;  2R5G A;  1OC9 B;  2H71 A;  2CQ9 A;  5ECR B;  2H1A A;  2A2S A;  1Q98 A;  1JZD A;  3MWH A;  5HQP A;  5D96 A;  4Q5N A;  3FZ9 A;  1Q4J A;  2GTU A;  2IJY A;  2OAD A;  2MMO A;  2PVQ A;  4N11 A;  4MLY A;  3DGQ A;  6GSY A;  1PMT A;  2LST A;  3QFA C;  2VCW A;  3QFB C;  2UV8 G;  1TP9 A;  2CVK A;  4K9Z A;  5JWQ B;  4AI6 A;  1T00 A;  3MDK A;  2AHE A;  2NBS A;  4OFN A;  2VCZ A;  4F9Z A;  1XWG A;  2RLI A;  1SKR B;  2R6K A;  4IJI A;  2RM6 A;  5HFG A;  2B5E A;  3HA9 A;  2GSR A;  1YEP A;  3M1G A;  5IQY A;  4XHM A;  5A4U A;  3GX0 A;  3KH7 A;  3A5I A;  1BED A;  3GST A;  2ZUP A;  3P2A A;  2DML A;  2H1L A;  2EFE A;  4YKF A;  3IA1 A;  4MZW A;  3HVN A;  3ISO A;  2LUS A;  1NHO A;  4JU5 A;  4DEJ A;  4HU9 A;  2I3Y A;  4L5L A;  3A3T A;  1G7O A;  2PGT A;  5GZZ B;  4PUR A;  3GFK A;  5A1N B;  4BA7 A;  2QSI A;  1J08 A;  3APO A;  2Z9S A;  4TR1 B;  3J7Y k;  4EDY A;  1OC9 A;  5A4W A;  18GS A;  1TJD A;  1TOF A;  5IMV A;  2O87 A;  3WYW A;  1XVW A;  4NWY A;  2KP1 A;  5JWO B;  1JLV A;  1FO5 A;  3TJF A;  1TK0 B;  3TJJ A;  1ZMA A;  6GSS A;  3Q18 A;  2WRT A;  2OE3 A;  3U6V A;  2GSS A;  1GTA A;  3RDW A;  3SBC A;  3O76 A;  4H86 A;  4JE1 A;  3HVS A;  3ZML A;  4QL7 A;  3D4T A;  2H1B A;  4CDO A;  1YY7 A;  2ZCT A;  3ERF A;  1WPI A;  4YQV A;  3EWL A;  3LFL A;  2K6V A;  1JZW A;  3EUR A;  5FWG A;  1OVN A;  1M7T A;  2YJ7 A;  2O8V B;  2ZNM A;  3LOR A;  2X4A A;  4IP1 A;  1J0F A;  3IK7 A;  2M72 A;  3D21 A;  4ISD A;  2E0Q A;  1V9W A;  2LV3 A;  1X9W B;  5BMU B;  3H93 A;  3UBK A;  2EC4 A;  2YZU A;  1A2L A;  3N9J A;  3CTG A;  1OE7 A;  2WB9 A;  1BG1 A;  1M9A A;  2HYX A;  3C1S A;  3C71 A;  3W8J A;  2LEG A;  1TRV A;  4O5U A;  4KDY A;  2IFQ B;  1OYJ A;  3MSZ A;  2RUE A;  2ON7 A;  4O92 A;  3DWV A;  3TJG A;  1PA3 A;  4ZL7 A;  4G01 A;  4N3Z A;  7GSS A;  2VL2 A;  1AXD A;  4F03 A;  3KD0 A;  3L0H A;  4BVX B;  3GTU B;  3KP9 A;  5D9V A;  2WZ9 A;  2DJ3 A;  5HFI A;  2OBK A;  5E59 A;  3RFR C;  4AKG A;  3UMA A;  3P7X A;  2L4Q A;  1A8Y A;  2KLX A;  2HI7 A;  1H75 A;  3VWV A;  2HE3 A;  3G7Y A;  5J5N A;  1OAZ A;  5CAX A;  5CRE A;  2I1U A;  3ZMK A;  4HI7 A;  2QGV A;  3GV1 A;  1WIK A;  5G2Z A;  2H19 A;  2GQM A;  3UOM A;  5IMC A;  4PQH A;  3EIN A;  3GRX A;  1BG5 A;  1SU9 A;  2VCV A;  4MPF A;  5ECI B;  3LQ7 A;  2X8G A;  4QMK A;  1S4B P;  4BWQ A;  4BVY B;  3N5O A;  2JSY A;  4XRA A;  3ZLP A;  1WWJ A;  3OR5 A;  3QPM A;  4N10 A;  4MF7 A;  2WGR A;  1EV4 A;  3D0Z A;  3L9S A;  4ZB7 A;  1K3L A;  1M99 A;  2MYG A;  2HRK B;  2GZP A;  4HS1 A;  5AN1 A;  9GSS A;  3HVX A;  1DBY A;  1PGT A;  5IOX A;  1ST9 A;  1PD2 1;  3C1R A;  3KJY A;  3CMI A;  1SK1 A;  3UAR A;  1ZGN A;  3CWG A;  2H6X A;  3FZ4 A;  6GSV A;  2H6Z A;  3HZ8 A;  3CRU A;  2HQT A;  2D2Z A;  4EL1 A;  2VCT A;  3D22 A;  2CA8 A;  1K0O A;  5AGY A;  2KHP A;  2C0E A;  2UZ8 A;  4RUV A;  4PI0 C;  4V2M A;  1WRY A;  5BRT A;  4KH7 A;  2O89 A;  5JCG A;  4MP4 A;  2E2M A;  4TOP A;  2MMA A;  2GT5 A;  4ID0 A;  3L78 A;  4DSQ A;  2XBQ A;  3TJK A;  2KUC A;  3TUE A;  4ZXG A;  3FR3 A;  3IRA A;  4WBJ A;  1HYU A;  3LXT A;  4XS4 A;  2FWE A;  1PL2 A;  3KZQ A;  4I6X A;  1EGR A;  4GTU A;  2YV9 A;  4G10 A;  1YF1 A;  1MDI A;  5ENU A;  2EFD A;  4ZB8 A;  1JZO A;  2AB6 A;  3WD6 A;  5IO0 A;  2YAN A;  1GLQ A;  3EPT A;  4Z2U A;  2F3M A;  5EY6 A;  3GA4 A;  4MJE A;  2VL3 A;  5FHI A;  4PHZ C;  1Z7R A;  3QMX A;  1TK5 B;  2JL4 A;  4XRD A;  2QC7 A;  2C0F A;  3G7J A;  3ZIV A;  3GKX A;  5A34 B;  2WJU A;  3M0F A;  2C3T A;  4GSN A;  3F4R A;  1H4O A;  2P5Q A;  3FZ5 A;  1JZR A;  4O32 A;  5HFK A;  5DJL A;  3UL3 A;  4EIQ A;  4BPY A;  2GT6 A;  3KTB A;  1XW6 A;  2OT3 A;  1XW5 A;  1X5E A;  2RM5 A;  4EE0 A;  1BAY A;  1U88 A;  2R0G A;  1M3J A;  3DIE A;  2TRX A;  3GX8 A;  3HY2 A;  3FR9 A;  2JU5 A;  1ERU A;  1X0R A;  3LGC A;  2PVO C;  3IC4 A;  2O3E A;  2DJ1 A;  2JZS A;  4ULX A;  1S3D A;  2VAF A;  1SVL A;  3IAS 2;  1AQW A;  3H1N A;  2A4V A;  2K18 A;  2H73 A;  2H8L A;  1ON4 A;  3RAZ A;  4RI6 A;  2V2G A;  4K5R A;  2REM A;  1DSB A;  1RK4 A;  4ZIL A;  3PIN A;  4IEL A;  3HDC A;  2HRF A;  3TKQ A;  1GTU A;  3E0U A;  5EL8 A;  1N8J A;  1BX9 A;  3LG6 A;  4DSS B;  2R37 A;  3DRN A;  4E8H A;  2VCQ A;  6GSW A;  1ZYP A;  5B8B A;  4HDE A;  3GL5 A;  3WGX A;  1BQ7 A;  3KTL A;  2F51 A;  3KCM A;  4GCI A;  3TKR A;  4J56 E;  3HHV A;  3C7M A;  3KMN A;  2B7J A;  1GTB A;  4EIP A;  1MD4 A;  4X4J A;  2VKZ G;  2C3N A;  2LNS A;  3PR8 A;  3TDG A;  5GAN D;  1M9B A;  1UVZ A;  3EMP A;  2C8U A;  2VLT A;  4OCE A;  4ZIJ A;  4WF5 A;  1B48 A;  1GUL A;  2EFH A;  4AJ6 A;  1Z5Y E;  1U87 A;  1ZL9 A;  4ICY A;  1JFU A;  4KCE A;  2V6O A;  2A2R A;  2DBC A;  5H5Q A;  1K0N A;  4AGS A;  2OJL A;  1DUG A;  1EP8 A;  1BF5 A;  2ALB A;  1K0A A;  3GH6 A;  4Q5Q A;  2DIY A;  4CY8 A;  2GZZ A;  5GST A;  2H72 A;  4IS0 A;  4AKX B;  2HZE B;  2GSQ A;  3HD5 A;  3E3E A;  2B1K A;  3ZVJ A;  3A2V A;  1Y25 A;  1FW1 A;  1B8X A;  1O81 A;  1E2Y A;  3A5W A;  1AIU A;  2IN3 A;  1GSU A;  2RUF A;  3FY7 A;  1T4Z A;  4EXJ A;  4J57 E;  1X9S B;  1USB A;  2CX4 A;  1I9D A;  2NTO A;  1FVJ A;  4L0W A;  4Z2R A;  3VFI A;  5A5H A;  2DSA A;  1OC3 A;  3VUR A;  1PRX A;  16GS A;  4NHW A;  4XIH A;  4DSS A;  5IMD A;  3GN3 A;  3CSH A;  2WS2 A;  2HSY A;  2IWT A;  4JR4 A;  1IYH A;  2YWO A;  1N25 A;  3TKS C;  1URM A;  2NPB A;  4IQA A;  2JAD A;  1GH2 A;  3FRC A;  3R3E A;  4FH8 A;  5IIZ A;  3TB2 A;  5J47 A;  3IK9 A;  1ZYN A;  5DVB A;  1QQ2 A;  3IXR A;  4MK3 A;  2JAC A;  3GH9 A;  1DE1 A;  3VPQ A;  1SKS B;  2VLU A;  4I5Q A;  1BYE A;  2YZH A;  1ERW A;  2R3X A;  5JCW A;  2DIZ A;  5H5S A;  5AIV A;  5DAK A;  1O7U A;  4N0V A;  1TRU A;  2HFD A;  3GNJ A;  2H66 A;  1HQO A;  3LW9 A;  1GWC A;  4WXT A;  1ILO A;  4IW9 A;  3QD9 A;  3U5R E;  2GQL A;  4N0Z A;  4HZ4 A;  1F2E A;  2HZE A;  3PPU A;  2LTK A;  4X1U A;  4K6X A;  5DJM A;  1GLP A;  4X43 A;  3KMO A;  1R5A A;  4PXO A;  3BBY A;  5D73 A;  1FOV A;  3UVT A;  3BJ5 A;  1Z7P A;  1AQV A;  2LJR A;  5LD0 A;  5G1L A;  1XBS A;  3ERW A;  5HR3 A;  11GS A;  3O3T A;  2N5F A;  4HQZ A;  1WJK A;  3UEM A;  4ECB A;  2WFC A;  5E4W A;  2RII A;  2GVP A;  4K1F A;  3LXZ A;  2B1L A;  5IPG A;  4ZBD A;  4KND A;  5KOW A;  3IR4 A;  4NV2 A;  5H5R A;  1QFN A;  4GXZ A;  4KAE A;  2P5R A;  2CV4 A;  3I43 A;  1MDK A;  4Q5F A;  3CXG A;  1FB0 A;  3KGK A;  4MAB A;  1YZX A;  2H30 A;  1U6T A;  2HT9 A;  4F82 A;  4XS1 A;  4FQU A;  5GAP D;  1ERT A;  5CYY A;  1SK2 A;  6GSU A;  1JLW A;  2F8A A;  3PGT A;  5IMF A;  1XOB A;  2XPD A;  1G7E A;  1GSD A;  5D9W A;  2DKH A;  4XCS A;  2HLS A;  4ECJ A;  1FHE A;  5CP1 A;  4TKY A;  4ZBA A;  3D5J A;  1VGL A;  1SYX A;  1A2J A;  2EIR A;  1V57 A;  1AC1 A;  3I6A A;  3APS A;  1SD9 A;  4NHZ A;  5CRG A;  3WT1 A;  3C73 A;  4QL9 A;  1Z6N A;  3HVV A;  5J4U A;  2N5B A;  2H01 A;  4ML6 A;  2YWN A;  3QDN A;  4OO4 A;  2GLR A;  3P90 A;  4WEY A;  3UJ1 A;  2R0C A;  4MA9 A;  2WW0 A;  2LRT A;  4MZB A;  5IM9 A;  4GQF A;  3NIV A;  3GUS A;  5D93 A;  2HRA A;  1O8W A;  1S3A A;  4FYB A;  3KM6 A;  4PNG A;  5JWR B;  3VLN A;  1VF4 A;  3VK9 A;  3VWX A;  2X99 A;  2PUK C;  5J4V A;  1O6J A;  3TJB A;  3UAP A;  1ML6 A;  4OO5 A;  3JCM L;  4PQI A;  4IHU A;  2HXK A;  5FT3 A;  2WW2 A;  1GSF A;  5J40 A;  4LMW A;  3H8Q A;  1M3I A;  4NAX A;  1SYR A;  2OA7 A;  3UBL A;  3TKP A;  3GMF A;  3GUR A;  3BCI A;  1R4W A;  1TXU A;  1PN9 A;  1PL1 A;  4XS4 B;  4LMV A;  1Y6E A;  2VL9 A;  5CO3 A;  4BL7 B;  5KN1 A;  2LQQ A;  2FD3 A;  2DMM A;  4K7O A;  3TOU A;  2HSH A;  4IKH A;  1FB6 A;  5IO2 A;  4MZC A;  1K0M A;  4KSM A;  2H1G A;  2E2G A;  3M8N A;  2LRC A;  1SL0 B;  2FNO A;  1T8E B;  3IV4 A;  2OAC A;  1FAA A;  2ON5 A;  2IL3 A;  2A2P A;  14GS A;  2H70 A;  1WMJ A;  1OC8 A;  4FYU A;  4EDZ A;  1S3R A;  2VM2 A;  5G5F A;  1Z9H A;  5KN2 A;  1EEM A;  4ACS A;  3LSZ A;  4RQX A;  1GUK A;  3RHB A;  2OE1 A;  1TU8 A;  5J9B A;  8GSS A;  2L57 A;  4V1A p;  2C4J A;  4MPG A;  2FWH A;  1EP7 A;  1GSE A;  4JRR A;  3EMX A;  4GQC A;  5G5E A;  3CQF A;  1Z6M A;  1UA5 A;  2DJ2 A;  5D9X A;  1XVQ A;  5DBQ A;  4CW9 A;  4YAP A;  3I9V 2;  2B3S A;  1SD8 A;  3M9K A;  1PFO A;  1K0D A;  3IBH A;  2FUG 2;  4KUN A;  3ZRE A;  3EU3 A;  3ZRD A;  2LS5 A;  1IYI A;  3ZFL A;  4K0G A;  2F8F A;  2FY6 A;  2H75 A;  4IP6 A;  4DSR A;  4IBP A;  4TXO A;  2HNL A;  1XG8 A;  1T4Y A;  2B5X A;  4TRX A;  2L6D A;  5CRW A;  1TXX A;  3ZFB A;  4G9H A;  1K0C A;  1K0B A;  4J2F A;  4BL7 A;  4A5P A;  4MF6 A;  1HNC A;  1QMV A;  3Q19 A;  3DD3 A;  2ES7 A;  1AW9 A;  1FG4 A;  2PU9 C;  4MMM A;  3ZL5 A;  4EC0 A;  5ECP B;  3KIJ A;  1V98 A;  1Z3E A;  2WZS A;  5COH A;  2HSM B;  2EFC A;  1EZK A;  1PSQ A;  4EO3 A;  4NV5 A;  1I5G A;  1TU7 A;  2FCH A;  4E8E A;  5G31 A;  4HOJ A;  3US3 A;  3W8S A;  2MMN A;  2PPT A;  1X5D A;  2P31 A;  3ZYW A;  4FXY P;  2I81 A;  3D6I A;  1TK8 B;  2OBI A;  2X8C A;  5DQS A;  1EOG A;  1GUM A;  4K2X A;  4POB A;  4ILF A;  4K2D A;  4WF4 A;  2VOC A;  1O85 A;  4PI2 C;  3CTF A;  4K8M A;  2VO4 A;  1SK0 A;  1G6Y A;  1W89 A;  2R4V A;  1PX6 A;  4L0U A;  1Y1U A;  1RW1 A;  5B6M A;  3O6T A;  1LBK A;  4ML1 A;  5CNW A;  3ZTL A;  2YOI A;  1XXU A;  19GS A;  2C0G A;  4HEA 2;  2H1D A;  1AQX A;  3DKS A;  2QA1 A;  3DML A;  2O36 A;  3RBT A;  1XZO A;  2P0G A;  4HQS A;  3F63 A;  2YN1 A;  1R26 A;  2E7P A;  3APQ A;  4XTS A;  5A5H B;  4Z7X A;  1GNE A;  2MZC A;  3KEB A;  3BD2 A;  2B6M A;  4IVF A;  1CQH A;  1XWB A;  1CQG A;  4ECI A;  3MAK A;  4KA0 A;  2M46 A;  2C80 A;  3DXB A;  2HSM A;  3D4M A;  1XW9 A;  5F05 A;  2NVL A;  1SL2 B;  4JED A;  1F37 A;  1PKW A;  2JZT A;  1ACV A;  3VI7 A;  2L5L A;  3DVW A;  4YKG A;  3WGD A;  4AKI A;  2MBT A;  5F06 A;  5J4Y A;  3L4N A;  4YQM A;  3FKF A;  1AAZ A;  1KTE A;  1EV9 A;  2XBI A;  1TRW A;  4PUA A;  1T1V A;  4G0L A;  5HR2 A;  2JSZ A;  2YV7 A;  4YQU A;  1YKA A;  4NPB A;  2A4H A;  4AJ8 A;  1GSS A;  4ECC A;  3ME8 A;  5DAK B;  5B7C A;  1PQN A;  3F9U A;  1SJI A;  4HZ2 A;  3J7Y b;  3WT2 A;  2CAI A;  1KNG A;  1OKD A;  1UN2 A;  1WE0 A;  1GSY A;  4KSO A;  2V41 A;  2GZY A;  2VD1 A;  3HZ4 A;  1SJZ A;  2WCI A;  1XWK A;  1F9M A;  3MIX A;  4EVM A;  2KOK A;  5JCU A;  1YQ1 A;  2H0G A;  5KN0 A;  1EGO A;  1KBN A;  2V6K A;  4MCU A;  1GUH A;  3F6F A;  3HKR A;  1UC7 A;  4TXV A;  2VIM A;  3CBU A;  2DJ0 A;  2I4A A;  2BJX A;  3E9J B;  1FOH A;  2XHF A;  4PX1 A;  1ZYQ B;  2QKE A;  4K7I A;  1SEN A;  1M2D A;  1QGV A;  4IGJ A;  4O7H A;  5B8A A;  2LKU A;  3AY8 A;  5IOW A;  5KN3 A;  1PX7 A;  1B9Y C;  2K8V A;  1THX A;  3GKK A;  3IC8 A;  5ID2 B;  3FEU A;  5ECM B;  1F6M C;  3TCO A;  2IPA A;  2FLS A;  1ZYE A;  4YAV A;  4TR4 A;  5F8B A;  2DC5 A;  5IMZ A;  2IMK A;  3ZVJ D;  4GSS A;  5L71 A;  3LEF A;  1MDJ A;  4TVE A;  1GTI A;  3ME7 A;  1J9B A;  4ZBB A;  2PER A;  1QXH A;  3F3R A;  3QAG A;  2LJA A;  2TIR A;  4JR6 A;  2AAW A;  5EVO A;  3F4S A;  1GRX A;  3L9V A;  3FHK A;  5ABR A;  1TKD B;  1XWA A;  4MDC A;  5ECK B;  4IJ3 A;  1TI1 A;  4AKH A;  5ELG A;  4PTS A;  4POK A;  2CAQ A;  4L8E A;  4ZB9 A;  1EOH A;  3QOU A;  1QK8 A;  3SWL A;  4HUA A;  2R0P A;  1X9M B;  3FW2 A;  5ECN B;  3M9J A;  1LJR A;  1A2M A;  2XPE A;  3MYD A;  5GSS A;  1PKZ A;  1ERV A;  5AIS A;  3TGZ A;  4KB3 A;  4HJ2 A;  2MBS A;  5ID2 A;  1HD2 A;  5A4V A;  4PUF C;  3QAV A;  2LJK A;  3RHC A;  4WET A;  3GL3 A;  2AJQ B;  3A2W A;  3HCZ A;  4OFM A;  3VI5 A;  2FA8 A;  4OD7 A;  3ZIJ A;  1PN0 A;  1TRS A;  3Q74 A;  3GYK A;  1B9X C;  1ZCP A;  4O5R A;  2IME A;  4LA1 A;  2H0H A;  1SVO A;  4LL1 B;  2L6C A;  4KW6 A;  1O73 A;  2BTO T;  1M2A A;  5G30 A;  1F3A A;  3LWA A;  2VCX A;  4RI7 A;  2C1Y A;  4KCA A;  4G19 A;  2LRN A;  4KGI A;  2YCD A;  2G2Q A;  5J41 A;  1EEJ A;  3EC3 A;  5ECL B;  1XFL A;  4OFT A;  3TOT A;  3HJM A;  2IMD A;  5ECQ B;  1T7P B;  2K9F A;  2C0D A;  2V32 A;  2WW1 A;  1K3O A;  2YWM A;  5INY A;  1YJ6 A;  4EUY A;  2FWF A;  1RQM A;  2WVX B;  2H74 A;  1KEB A;  4ZB6 A;  3DYR A;  1V2A A;  4G0I A;  1M2B A;  3LYK A;  2WVY A;  2XC2 A;  5F07 A;  3NOF A;  1YDK A;  3F4T A;  1YEW C;  1ZZY A;  1OE8 A;  3G9B A;  5DCH A;  1G6W A;  1EWX A;  4OWY A;  2K8S A;  5DDL A;  3NZN A;  2FWG A;  3DEX A;  2X8H A;  2I9H A;  4ZL8 A;  2FHE A;  4IN0 A;  3BOA A;  4LLR A;  2WUL A;  5A1N A;  4XS6 A;  4D73 B;  1XWC A;  4V2N A;  4KF9 A;  1WP0 A;  3GKM A;  1X5C A;  2VM1 A;  4TR1 A;  3RPN A;  2C3Q A;  5LCZ A;  2YPM A;  4O5Q A;  1E6B A;  2IMF A;  1YF0 A;  4CHS A;  2OKA A;  3TRX A;  2DJJ A;  5J3R A;  4OCF A;  6GSX A;  1JHB A;  1YEX A;  4WR4 A;  4EKZ A;  4TXO B;  3S9F A;  4I97 A;  4MJA A;  1YKC A;  1B4Q A;  2OE0 A;  3RPP A;  3IDV A;  3KXO A;  2G0F A;  3HYP A;  1NW2 A;  4MH3 A;  2FA4 A;  3P8W A;  4MJC A;  4JBB A;  3W6G A;  2HSN B;  4GST A;  3FYG A;  4MJB A;  3IHQ A;  4PNF A;  4AJ7 A;  2X49 A;  3FMW A;  1GSQ A;  2F9S A;  1TW9 A;  3TKS A;  4POL A;  1XIY A;  2WVX A;  3GHA A;  3GIX A;  5IPH A;  1GP1 A;  1TDI A;  5ELA A;  1K3Y A;  1A0R P;  2PN8 A;  4E68 A;  2DKI A;  3MNG A;  5BMU A;  1V40 A;  1B4P A;  1WOU A;  1TTZ A;  2H6Y A;  2CZ2 A;  1MEK A;  2CT6 A;  10GS A;  3HXS A;  2TRC P;  3RGB C;  1A8L A;  1R5P A;  1HNB A;  2JZR A;  2L5O A;  1V58 A;  3GKN A;  2B7K A;  2IFQ A;  1VF2 A;  4MH2 A;  1NM3 A;  4WR5 A;  4D73 A;  2YWI A;  4EF0 A;  5DAL B;  3F3Q A;  4V2L A;  1XOA A;  4I2U A;  3CYN A;  1M0U A;  5G1K A;  4TW5 A;  1XPV A;  2WVZ A;  1AUC A;  3KP8 A;  4BVX A;  3GTU A;  5ECH B;  2L59 A;  3CSJ A;  2PMT A;  5A5K A;  3H4K A;  5C00 A;  2GGT A;  2H0I A;  3UIW A;  2EIO A;  3IAM 2;  5IMA A;  2EIQ A;  2LQO A;  1O8X A;  4F0B A;  2HRN A;  2DJK A;  4KDX A;  4TR0 A;  3F0I A;  5HR0 A;  3L9U A;  1YVL A;  5ECS A;  1ABA A;  5CRD A;  2HSN A;  3VWU A;  4NXI A;  5DQY A;  4AF2 A;  3R2Q A;  3CRT A;  4KX4 A;  4F2I A;  2CVB A;  2WW3 A;  1NSW A;  1QUW A;  4Z2T A;  4Q5R A;  1SJ6 A;  1VF3 A;  1VF1 A;  1F3B A;  1I1I P;  5B6N A;  1ZOF A;  1SKW B;  1N2A A;  2GS3 A;  3A2X A;  2YP6 A;  4BVY A;  4HJM A;  2VUP A;  4GDF A;  13GS A;  1DE2 A;  4LL4 B;  2GST A;  2GDR A;  4I8B A;  3TRQ A;  3IHG A;  3ZZX A;  5LNK e;  2HRK A;  4N30 A;  5DAL A;  3ERG A;  2KP2 A;  3UVH A;  20GS A;  1VRS D;  4MF5 A;  5C04 A;  1TI3 A;  2AUV A;  1A0F A;  1THO A;  3ED3 A;  3DVX A;  1GNW A;  4W66 A;  1HNA A;  3LYP A; 
#chains in the Genus database with same CATH homology
 4TR3 A;  5DCG A;  1FVK A;  5KEJ A;  2CX3 A;  5F0G A;  1SVM A;  4KE3 A;  4GF0 A;  3F6D A;  3QAW A;  2L4C A;  2WDU A;  5J9C A;  12GS A;  1MTC A;  5AIX A;  17GS A;  2PWJ A;  1SL1 B;  3GSS A;  4X0X A;  4JZQ A;  1C72 A;  2FGX A;  2NDO A;  1OKT A;  4POM A;  2DLX A;  2H76 A;  3VWW A;  3EU4 A;  4GLT A;  2O7K A;  3F8U A;  4K0N A;  4P3Y B;  5EPF A;  2GQK A;  3FR6 A;  3WGE A;  4FO5 A;  1MD3 A;  5D9T A;  4TN8 A;  5KOX A;  3QR6 A;  2V1M A;  3C8E A;  2HZF A;  3HMJ G;  3Q6O A;  1U3A A;  4WBR D;  1A24 A;  5CRH A;  2CVD A;  4PQ1 A;  4USS A;  4L5O A;  4YH2 A;  1S3C A;  5ECO B;  22GS A;  1XCC A;  3EYT A;  3TU3 B;  3HJO A;  5A34 A;  2YNX A;  2B5Y A;  2BMX A;  2IIY A;  2J23 A;  3I69 A;  4DVC A;  1U3I A;  4G0K A;  2VLV A;  2IMI A;  2VL2 C;  4ZL9 A;  1R7H A;  3FZA A;  3HJP A;  1T3B A;  5HR1 A;  2PBJ A;  2J9H A;  4RQR A;  2LNT A;  3VPT A;  3IE3 A;  1NHY A;  3EE2 A;  3KH9 A;  4PGT A;  4MNN A;  2O85 A;  4HU7 A;  4NMU A;  3QCP A;  3TRP A;  3LJR A;  4K7N A;  2AV4 A;  2M80 A;  3BCK A;  4FYC A;  4K5S A;  4OMV A;  2YJH A;  4I2T A;  4F0C A;  4G2E A;  2VD0 A;  5D8I A;  2CZ3 A;  3TKS E;  3EVI A;  3PH9 A;  1W4V A;  2MMZ A;  1A23 A;  3IOS A;  4KDU A;  2R2J A;  4V1A g;  1BJX A;  3G7I A;  4CY6 A;  3ZIT A;  4QQ7 A;  1LU4 A;  3CSI A;  4IQ1 A;  3V1W A;  2AYT A;  3FK8 A;  2QA2 A;  4GRF A;  3M3M A;  3K8N A;  3IPZ A;  1GL8 A;  3H79 A;  2O5V A;  4BWS A;  2N5A A;  2X64 A;  1G0T A;  4GWR A;  4WKW A;  6GST A;  4FIW A;  2R5G A;  1OC9 B;  2H71 A;  2CQ9 A;  5ECR B;  2H1A A;  2A2S A;  1Q98 A;  1JZD A;  3MWH A;  5HQP A;  5D96 A;  4Q5N A;  3FZ9 A;  1Q4J A;  2GTU A;  2IJY A;  2OAD A;  2MMO A;  2PVQ A;  4N11 A;  4MLY A;  3DGQ A;  6GSY A;  1PMT A;  2LST A;  3QFA C;  2VCW A;  3QFB C;  2UV8 G;  1TP9 A;  2CVK A;  4K9Z A;  5JWQ B;  4AI6 A;  1T00 A;  3MDK A;  2AHE A;  2NBS A;  4OFN A;  2VCZ A;  4F9Z A;  1XWG A;  2RLI A;  1SKR B;  2R6K A;  4IJI A;  2RM6 A;  5HFG A;  2B5E A;  3HA9 A;  2GSR A;  1YEP A;  3M1G A;  5IQY A;  4XHM A;  5A4U A;  3GX0 A;  3KH7 A;  3A5I A;  1BED A;  3GST A;  2ZUP A;  3P2A A;  2DML A;  2H1L A;  2EFE A;  4YKF A;  3IA1 A;  4MZW A;  3ISO A;  2LUS A;  1NHO A;  4JU5 A;  4DEJ A;  4HU9 A;  2I3Y A;  4L5L A;  3A3T A;  1G7O A;  2PGT A;  5GZZ B;  4PUR A;  3GFK A;  5A1N B;  4BA7 A;  2QSI A;  1J08 A;  3APO A;  2Z9S A;  4TR1 B;  3J7Y k;  4EDY A;  1OC9 A;  5A4W A;  18GS A;  1TJD A;  1TOF A;  5IMV A;  2O87 A;  3WYW A;  1XVW A;  4NWY A;  2KP1 A;  5JWO B;  1JLV A;  1FO5 A;  3TJF A;  1TK0 B;  3TJJ A;  1ZMA A;  6GSS A;  3Q18 A;  2WRT A;  2OE3 A;  3U6V A;  2GSS A;  1GTA A;  3RDW A;  3SBC A;  3O76 A;  4H86 A;  4JE1 A;  3HVS A;  3ZML A;  4QL7 A;  3D4T A;  2H1B A;  4CDO A;  1YY7 A;  2ZCT A;  3ERF A;  1WPI A;  4YQV A;  3EWL A;  3LFL A;  2K6V A;  1JZW A;  3EUR A;  5FWG A;  1OVN A;  1M7T A;  2YJ7 A;  2O8V B;  2ZNM A;  3LOR A;  2X4A A;  4IP1 A;  1J0F A;  3IK7 A;  2M72 A;  3D21 A;  4ISD A;  2E0Q A;  1V9W A;  2LV3 A;  1X9W B;  5BMU B;  3H93 A;  3UBK A;  2EC4 A;  2YZU A;  1A2L A;  3N9J A;  3CTG A;  1OE7 A;  2WB9 A;  1BG1 A;  1M9A A;  2HYX A;  3C1S A;  3C71 A;  3W8J A;  2LEG A;  1TRV A;  4O5U A;  4KDY A;  2IFQ B;  1OYJ A;  3MSZ A;  2RUE A;  2ON7 A;  4O92 A;  3DWV A;  3TJG A;  1PA3 A;  4ZL7 A;  4G01 A;  4N3Z A;  7GSS A;  2VL2 A;  1AXD A;  4F03 A;  3KD0 A;  3L0H A;  4BVX B;  3GTU B;  3KP9 A;  5D9V A;  2WZ9 A;  2DJ3 A;  5HFI A;  2OBK A;  5E59 A;  4AKG A;  3UMA A;  3P7X A;  2L4Q A;  1A8Y A;  2KLX A;  2HI7 A;  1H75 A;  3VWV A;  2HE3 A;  3G7Y A;  5J5N A;  1OAZ A;  5CAX A;  5CRE A;  2I1U A;  3ZMK A;  4HI7 A;  2QGV A;  3GV1 A;  1WIK A;  5G2Z A;  2H19 A;  2GQM A;  3UOM A;  5IMC A;  4PQH A;  3EIN A;  3GRX A;  1BG5 A;  1SU9 A;  2VCV A;  4MPF A;  5ECI B;  3LQ7 A;  2X8G A;  4QMK A;  4BWQ A;  4BVY B;  3N5O A;  2JSY A;  4XRA A;  3ZLP A;  1WWJ A;  3OR5 A;  3QPM A;  4N10 A;  4MF7 A;  2WGR A;  1EV4 A;  3D0Z A;  3L9S A;  4ZB7 A;  1K3L A;  1M99 A;  2MYG A;  2HRK B;  2GZP A;  4HS1 A;  5AN1 A;  9GSS A;  3HVX A;  1DBY A;  1PGT A;  5IOX A;  1ST9 A;  1PD2 1;  3C1R A;  3KJY A;  3CMI A;  1SK1 A;  3UAR A;  1ZGN A;  3CWG A;  2H6X A;  3FZ4 A;  6GSV A;  2H6Z A;  3HZ8 A;  3CRU A;  2HQT A;  2D2Z A;  4EL1 A;  2VCT A;  3D22 A;  2CA8 A;  1K0O A;  5AGY A;  2KHP A;  2C0E A;  2UZ8 A;  4RUV A;  4V2M A;  1WRY A;  5BRT A;  4KH7 A;  2O89 A;  5JCG A;  4MP4 A;  2E2M A;  4TOP A;  2MMA A;  2GT5 A;  4ID0 A;  3L78 A;  4DSQ A;  2XBQ A;  3TJK A;  2KUC A;  3TUE A;  4ZXG A;  3FR3 A;  3IRA A;  4WBJ A;  1HYU A;  3LXT A;  4XS4 A;  2FWE A;  1PL2 A;  3KZQ A;  4I6X A;  1EGR A;  4GTU A;  2YV9 A;  4G10 A;  1YF1 A;  1MDI A;  5ENU A;  2EFD A;  4ZB8 A;  1JZO A;  2AB6 A;  3WD6 A;  5IO0 A;  2YAN A;  1GLQ A;  3EPT A;  4Z2U A;  2F3M A;  5EY6 A;  3GA4 A;  4MJE A;  2VL3 A;  5FHI A;  1Z7R A;  1TK5 B;  3QMX A;  2JL4 A;  4XRD A;  2QC7 A;  2C0F A;  3G7J A;  3ZIV A;  3GKX A;  5A34 B;  2WJU A;  3M0F A;  2C3T A;  4GSN A;  3F4R A;  1H4O A;  2P5Q A;  3FZ5 A;  1JZR A;  4O32 A;  5HFK A;  5DJL A;  3UL3 A;  4EIQ A;  4BPY A;  2GT6 A;  3KTB A;  1XW6 A;  2OT3 A;  1XW5 A;  1X5E A;  2RM5 A;  4EE0 A;  1BAY A;  1U88 A;  2R0G A;  3DIE A;  2TRX A;  3GX8 A;  3HY2 A;  3FR9 A;  2JU5 A;  1ERU A;  1X0R A;  3LGC A;  2PVO C;  3IC4 A;  2DJ1 A;  2JZS A;  4ULX A;  1S3D A;  2VAF A;  1SVL A;  3IAS 2;  1AQW A;  3H1N A;  2A4V A;  2K18 A;  2H73 A;  2H8L A;  1ON4 A;  3RAZ A;  4RI6 A;  2V2G A;  4K5R A;  2REM A;  1DSB A;  1RK4 A;  4ZIL A;  3PIN A;  4IEL A;  3HDC A;  2HRF A;  3TKQ A;  1GTU A;  3E0U A;  5EL8 A;  1N8J A;  1BX9 A;  3LG6 A;  4DSS B;  2R37 A;  3DRN A;  4E8H A;  2VCQ A;  6GSW A;  1ZYP A;  5B8B A;  4HDE A;  3GL5 A;  3WGX A;  1BQ7 A;  3KTL A;  2F51 A;  3KCM A;  4GCI A;  3TKR A;  4J56 E;  3HHV A;  3C7M A;  3KMN A;  2B7J A;  1GTB A;  4EIP A;  1MD4 A;  4X4J A;  2VKZ G;  2C3N A;  2LNS A;  3PR8 A;  3TDG A;  5GAN D;  1M9B A;  1UVZ A;  3EMP A;  2C8U A;  2VLT A;  4OCE A;  4ZIJ A;  4WF5 A;  1B48 A;  1GUL A;  2EFH A;  4AJ6 A;  1Z5Y E;  1U87 A;  1ZL9 A;  4ICY A;  1JFU A;  4KCE A;  2V6O A;  2A2R A;  2DBC A;  5H5Q A;  1K0N A;  4AGS A;  2OJL A;  1DUG A;  1EP8 A;  1BF5 A;  2ALB A;  1K0A A;  3GH6 A;  4Q5Q A;  2DIY A;  4CY8 A;  2GZZ A;  5GST A;  2H72 A;  4IS0 A;  4AKX B;  2HZE B;  2GSQ A;  3HD5 A;  3E3E A;  2B1K A;  3ZVJ A;  3A2V A;  1Y25 A;  1FW1 A;  1B8X A;  1O81 A;  1E2Y A;  3A5W A;  1AIU A;  2IN3 A;  1GSU A;  2RUF A;  3FY7 A;  1T4Z A;  4EXJ A;  4J57 E;  1X9S B;  1USB A;  2CX4 A;  1I9D A;  2NTO A;  1FVJ A;  4L0W A;  4Z2R A;  3VFI A;  5A5H A;  2DSA A;  1OC3 A;  3VUR A;  1PRX A;  16GS A;  4NHW A;  4XIH A;  4DSS A;  5IMD A;  3GN3 A;  3CSH A;  2WS2 A;  2HSY A;  2IWT A;  4JR4 A;  1IYH A;  2YWO A;  1N25 A;  3TKS C;  1URM A;  2NPB A;  4IQA A;  2JAD A;  1GH2 A;  3FRC A;  3R3E A;  4FH8 A;  5IIZ A;  3TB2 A;  5J47 A;  3IK9 A;  1ZYN A;  5DVB A;  1QQ2 A;  3IXR A;  4MK3 A;  2JAC A;  3GH9 A;  1DE1 A;  3VPQ A;  1SKS B;  2VLU A;  4I5Q A;  1BYE A;  2YZH A;  1ERW A;  2R3X A;  5JCW A;  2DIZ A;  5H5S A;  5AIV A;  5DAK A;  1O7U A;  4N0V A;  1TRU A;  2HFD A;  3GNJ A;  2H66 A;  3LW9 A;  1HQO A;  1GWC A;  4WXT A;  1ILO A;  4IW9 A;  3QD9 A;  3U5R E;  2GQL A;  4N0Z A;  4HZ4 A;  1F2E A;  2HZE A;  3PPU A;  2LTK A;  4X1U A;  4K6X A;  5DJM A;  1GLP A;  4X43 A;  3KMO A;  1R5A A;  4PXO A;  3BBY A;  5D73 A;  1FOV A;  3UVT A;  3BJ5 A;  1Z7P A;  1AQV A;  2LJR A;  5LD0 A;  5G1L A;  1XBS A;  3ERW A;  5HR3 A;  11GS A;  3O3T A;  2N5F A;  4HQZ A;  1WJK A;  3UEM A;  4ECB A;  2WFC A;  5E4W A;  2RII A;  2GVP A;  4K1F A;  3LXZ A;  2B1L A;  5IPG A;  4ZBD A;  4KND A;  5KOW A;  3IR4 A;  4NV2 A;  5H5R A;  1QFN A;  4GXZ A;  4KAE A;  2P5R A;  2CV4 A;  3I43 A;  1MDK A;  4Q5F A;  3CXG A;  1FB0 A;  3KGK A;  4MAB A;  1YZX A;  2H30 A;  1U6T A;  2HT9 A;  4F82 A;  4XS1 A;  4FQU A;  5GAP D;  1ERT A;  5CYY A;  1SK2 A;  6GSU A;  1JLW A;  2F8A A;  3PGT A;  5IMF A;  1XOB A;  2XPD A;  1G7E A;  1GSD A;  5D9W A;  2DKH A;  4XCS A;  2HLS A;  4ECJ A;  1FHE A;  5CP1 A;  4TKY A;  4ZBA A;  3D5J A;  1VGL A;  1SYX A;  1A2J A;  2EIR A;  1V57 A;  1AC1 A;  3I6A A;  3APS A;  1SD9 A;  4NHZ A;  5CRG A;  3WT1 A;  3C73 A;  4QL9 A;  1Z6N A;  3HVV A;  5J4U A;  2N5B A;  2H01 A;  4ML6 A;  2YWN A;  3QDN A;  4OO4 A;  2GLR A;  3P90 A;  4WEY A;  3UJ1 A;  2R0C A;  4MA9 A;  2LRT A;  4MZB A;  5IM9 A;  4GQF A;  3NIV A;  3GUS A;  5D93 A;  2HRA A;  1O8W A;  1S3A A;  4FYB A;  3KM6 A;  4PNG A;  5JWR B;  3VLN A;  1VF4 A;  3VK9 A;  3VWX A;  2X99 A;  2PUK C;  5J4V A;  1O6J A;  3TJB A;  3UAP A;  1ML6 A;  4OO5 A;  3JCM L;  4PQI A;  4IHU A;  2HXK A;  5FT3 A;  1GSF A;  5J40 A;  4LMW A;  3H8Q A;  4NAX A;  1SYR A;  2OA7 A;  3UBL A;  3TKP A;  3GMF A;  3GUR A;  3BCI A;  1R4W A;  1TXU A;  1PN9 A;  1PL1 A;  4XS4 B;  4LMV A;  1Y6E A;  2VL9 A;  5CO3 A;  4BL7 B;  5KN1 A;  2LQQ A;  2FD3 A;  2DMM A;  4K7O A;  3TOU A;  2HSH A;  4IKH A;  1FB6 A;  5IO2 A;  4MZC A;  1K0M A;  4KSM A;  2H1G A;  2E2G A;  3M8N A;  2LRC A;  1SL0 B;  2FNO A;  1T8E B;  3IV4 A;  2OAC A;  1FAA A;  2ON5 A;  2IL3 A;  2A2P A;  14GS A;  2H70 A;  1WMJ A;  1OC8 A;  4FYU A;  4EDZ A;  2VM2 A;  5G5F A;  1Z9H A;  5KN2 A;  1EEM A;  4ACS A;  3LSZ A;  4RQX A;  1GUK A;  3RHB A;  2OE1 A;  1TU8 A;  5J9B A;  8GSS A;  2L57 A;  4V1A p;  2C4J A;  4MPG A;  2FWH A;  1EP7 A;  1GSE A;  4JRR A;  3EMX A;  4GQC A;  5G5E A;  1Z6M A;  1UA5 A;  2DJ2 A;  5D9X A;  1XVQ A;  5DBQ A;  4CW9 A;  4YAP A;  3I9V 2;  2B3S A;  1SD8 A;  3M9K A;  1K0D A;  3IBH A;  2FUG 2;  4KUN A;  3ZRE A;  3EU3 A;  3ZRD A;  2LS5 A;  1IYI A;  3ZFL A;  4K0G A;  2F8F A;  2FY6 A;  2H75 A;  4IP6 A;  4DSR A;  4IBP A;  4TXO A;  2HNL A;  1T4Y A;  2B5X A;  4TRX A;  2L6D A;  5CRW A;  1TXX A;  3ZFB A;  4G9H A;  1K0C A;  1K0B A;  4J2F A;  4BL7 A;  4A5P A;  4MF6 A;  1HNC A;  1QMV A;  3Q19 A;  3DD3 A;  2ES7 A;  1AW9 A;  1FG4 A;  2PU9 C;  4MMM A;  3ZL5 A;  4EC0 A;  5ECP B;  3KIJ A;  1V98 A;  1Z3E A;  5COH A;  2HSM B;  2EFC A;  1EZK A;  1PSQ A;  4EO3 A;  4NV5 A;  1I5G A;  1TU7 A;  2FCH A;  4E8E A;  5G31 A;  4HOJ A;  3US3 A;  3W8S A;  2MMN A;  2PPT A;  1X5D A;  2P31 A;  3ZYW A;  2I81 A;  3D6I A;  1TK8 B;  2OBI A;  2X8C A;  5DQS A;  1EOG A;  1GUM A;  4K2X A;  4POB A;  4ILF A;  4K2D A;  4WF4 A;  2VOC A;  1O85 A;  3CTF A;  4K8M A;  2VO4 A;  1SK0 A;  1G6Y A;  1W89 A;  2R4V A;  1PX6 A;  4L0U A;  1Y1U A;  1RW1 A;  5B6M A;  3O6T A;  1LBK A;  4ML1 A;  5CNW A;  3ZTL A;  2YOI A;  1XXU A;  19GS A;  2C0G A;  4HEA 2;  2H1D A;  1AQX A;  3DKS A;  2QA1 A;  3DML A;  3RBT A;  1XZO A;  2P0G A;  4HQS A;  3F63 A;  2YN1 A;  1R26 A;  2E7P A;  3APQ A;  4XTS A;  5A5H B;  4Z7X A;  1GNE A;  2MZC A;  3KEB A;  3BD2 A;  2B6M A;  4IVF A;  1CQH A;  1XWB A;  1CQG A;  4ECI A;  3MAK A;  4KA0 A;  2M46 A;  2C80 A;  3DXB A;  2HSM A;  3D4M A;  1XW9 A;  5F05 A;  2NVL A;  1SL2 B;  4JED A;  1F37 A;  1PKW A;  2JZT A;  1ACV A;  3VI7 A;  2L5L A;  3DVW A;  4YKG A;  3WGD A;  4AKI A;  2MBT A;  5F06 A;  5J4Y A;  3L4N A;  4YQM A;  3FKF A;  1AAZ A;  1KTE A;  1EV9 A;  2XBI A;  1TRW A;  4PUA A;  1T1V A;  4G0L A;  5HR2 A;  2JSZ A;  2YV7 A;  4YQU A;  1YKA A;  4NPB A;  2A4H A;  4AJ8 A;  1GSS A;  4ECC A;  3ME8 A;  5DAK B;  5B7C A;  1PQN A;  3F9U A;  1SJI A;  4HZ2 A;  3J7Y b;  3WT2 A;  2CAI A;  1KNG A;  1OKD A;  1UN2 A;  1WE0 A;  1GSY A;  4KSO A;  2V41 A;  2GZY A;  2VD1 A;  3HZ4 A;  1SJZ A;  2WCI A;  1XWK A;  1F9M A;  3MIX A;  4EVM A;  2KOK A;  5JCU A;  1YQ1 A;  2H0G A;  5KN0 A;  1EGO A;  1KBN A;  2V6K A;  4MCU A;  1GUH A;  3F6F A;  3HKR A;  1UC7 A;  4TXV A;  2VIM A;  3CBU A;  2DJ0 A;  2I4A A;  2BJX A;  3E9J B;  1FOH A;  2XHF A;  4PX1 A;  1ZYQ B;  2QKE A;  4K7I A;  1SEN A;  1M2D A;  1QGV A;  4IGJ A;  4O7H A;  5B8A A;  2LKU A;  3AY8 A;  5IOW A;  5KN3 A;  1PX7 A;  1B9Y C;  2K8V A;  1THX A;  3GKK A;  3IC8 A;  5ID2 B;  3FEU A;  5ECM B;  1F6M C;  3TCO A;  2IPA A;  2FLS A;  1ZYE A;  4YAV A;  4TR4 A;  5F8B A;  2DC5 A;  5IMZ A;  2IMK A;  3ZVJ D;  4GSS A;  5L71 A;  3LEF A;  1MDJ A;  4TVE A;  1GTI A;  3ME7 A;  1J9B A;  4ZBB A;  2PER A;  1QXH A;  3F3R A;  3QAG A;  2LJA A;  2TIR A;  4JR6 A;  2AAW A;  5EVO A;  3F4S A;  1GRX A;  3L9V A;  3FHK A;  5ABR A;  1TKD B;  1XWA A;  4MDC A;  5ECK B;  4IJ3 A;  1TI1 A;  4AKH A;  5ELG A;  4PTS A;  4POK A;  2CAQ A;  4L8E A;  4ZB9 A;  1EOH A;  3QOU A;  1QK8 A;  3SWL A;  4HUA A;  2R0P A;  1X9M B;  3FW2 A;  5ECN B;  3M9J A;  1LJR A;  1A2M A;  2XPE A;  3MYD A;  5GSS A;  1PKZ A;  1ERV A;  5AIS A;  3TGZ A;  4KB3 A;  4HJ2 A;  2MBS A;  5ID2 A;  1HD2 A;  5A4V A;  4PUF C;  3QAV A;  2LJK A;  3RHC A;  4WET A;  3GL3 A;  2AJQ B;  3A2W A;  3HCZ A;  4OFM A;  3VI5 A;  2FA8 A;  4OD7 A;  3ZIJ A;  1PN0 A;  1TRS A;  3Q74 A;  3GYK A;  1B9X C;  1ZCP A;  4O5R A;  2IME A;  4LA1 A;  2H0H A;  1SVO A;  4LL1 B;  2L6C A;  4KW6 A;  1O73 A;  2BTO T;  1M2A A;  5G30 A;  1F3A A;  3LWA A;  2VCX A;  4RI7 A;  2C1Y A;  4KCA A;  4G19 A;  2LRN A;  4KGI A;  2YCD A;  2G2Q A;  5J41 A;  1EEJ A;  3EC3 A;  5ECL B;  1XFL A;  4OFT A;  3TOT A;  3HJM A;  2IMD A;  5ECQ B;  1T7P B;  2K9F A;  2C0D A;  2V32 A;  1K3O A;  2YWM A;  5INY A;  1YJ6 A;  4EUY A;  2FWF A;  1RQM A;  2H74 A;  1KEB A;  4ZB6 A;  3DYR A;  1V2A A;  4G0I A;  1M2B A;  3LYK A;  2XC2 A;  5F07 A;  3NOF A;  1YDK A;  3F4T A;  1ZZY A;  1OE8 A;  3G9B A;  5DCH A;  1G6W A;  1EWX A;  4OWY A;  2K8S A;  5DDL A;  3NZN A;  2FWG A;  3DEX A;  2X8H A;  2I9H A;  4ZL8 A;  2FHE A;  4IN0 A;  3BOA A;  4LLR A;  2WUL A;  5A1N A;  4XS6 A;  4D73 B;  1XWC A;  4V2N A;  4KF9 A;  1WP0 A;  3GKM A;  1X5C A;  2VM1 A;  4TR1 A;  3RPN A;  2C3Q A;  5LCZ A;  2YPM A;  4O5Q A;  1E6B A;  2IMF A;  1YF0 A;  4CHS A;  2OKA A;  3TRX A;  2DJJ A;  5J3R A;  4OCF A;  6GSX A;  1JHB A;  1YEX A;  4WR4 A;  4EKZ A;  4TXO B;  3S9F A;  4I97 A;  4MJA A;  1YKC A;  1B4Q A;  2OE0 A;  3RPP A;  3IDV A;  3KXO A;  2G0F A;  3HYP A;  1NW2 A;  4MH3 A;  2FA4 A;  3P8W A;  4MJC A;  4JBB A;  3W6G A;  2HSN B;  4GST A;  3FYG A;  4MJB A;  3IHQ A;  4PNF A;  4AJ7 A;  2X49 A;  3FMW A;  1GSQ A;  2F9S A;  1TW9 A;  3TKS A;  4POL A;  1XIY A;  3GHA A;  3GIX A;  5IPH A;  1GP1 A;  1TDI A;  5ELA A;  1K3Y A;  1A0R P;  2PN8 A;  4E68 A;  2DKI A;  3MNG A;  5BMU A;  1V40 A;  1B4P A;  1WOU A;  1TTZ A;  2H6Y A;  2CZ2 A;  1MEK A;  2CT6 A;  10GS A;  3HXS A;  2TRC P;  1A8L A;  1R5P A;  1HNB A;  2JZR A;  2L5O A;  1V58 A;  3GKN A;  2B7K A;  2IFQ A;  1VF2 A;  4MH2 A;  1NM3 A;  4WR5 A;  4D73 A;  2YWI A;  4EF0 A;  5DAL B;  3F3Q A;  4V2L A;  1XOA A;  4I2U A;  3CYN A;  1M0U A;  5G1K A;  4TW5 A;  1XPV A;  3KP8 A;  1AUC A;  4BVX A;  3GTU A;  5ECH B;  2L59 A;  3CSJ A;  2PMT A;  5A5K A;  3H4K A;  5C00 A;  2GGT A;  2H0I A;  3UIW A;  2EIO A;  3IAM 2;  5IMA A;  2EIQ A;  2LQO A;  1O8X A;  4F0B A;  2HRN A;  2DJK A;  4KDX A;  4TR0 A;  3F0I A;  5HR0 A;  3L9U A;  1YVL A;  5ECS A;  1ABA A;  5CRD A;  2HSN A;  3VWU A;  4NXI A;  5DQY A;  4AF2 A;  3R2Q A;  3CRT A;  4KX4 A;  4F2I A;  2CVB A;  1NSW A;  1QUW A;  4Z2T A;  4Q5R A;  1SJ6 A;  1VF3 A;  1VF1 A;  1F3B A;  5B6N A;  1ZOF A;  1SKW B;  1N2A A;  2GS3 A;  3A2X A;  2YP6 A;  4BVY A;  4HJM A;  2VUP A;  4GDF A;  13GS A;  1DE2 A;  4LL4 B;  2GST A;  2GDR A;  4I8B A;  3TRQ A;  3IHG A;  3ZZX A;  5LNK e;  2HRK A;  4N30 A;  5DAL A;  3ERG A;  2KP2 A;  3UVH A;  20GS A;  1VRS D;  4MF5 A;  5C04 A;  1TI3 A;  2AUV A;  1A0F A;  1THO A;  3ED3 A;  3DVX A;  1GNW A;  4W66 A;  1HNA A;  3LYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...