1GTUA

Ligand-free human glutathione s-transferase m1a-1a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Functions of His107 in the catalytic mechanism of human glutathione S-transferase hGSTM1a-1a.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gtuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gtuA01
3E9JB 1EZKA 1K3YA 5L71A 3QAVA 1RQMA 3AY8A 10GSA 2B5XA 3M0FA 2X8GA 3I69A 3EC3A 2TRXA 5FT3A 3GMFA 1G6WA 4ECJA 5G1KA 3IV4A 2JADA 1DE2A 1J0FA 4IVFA 1XW5A 2VM1A 2GLRA 4GTUA 5BMUA 2GSTA 4CHSA 4EE0A 3D22A 1BQ7A 4BL7A 1O6JA 3I43A 5GSSA 5ECHB 4IP6A 4LL4B 2MZCA 3ERFA 4HZ2A 2M72A 3F6FA 3ZITA 3D4MA 4KCAA 1TRVA 2YV9A 4MZBA 4FQUA 2OA7A 4EXJA 3L4NA 5KN3A 5ECMB 3EVIA 2HYXA 1ZGNA 2JZSA 1DE1A 2WS2A 4PQHA 3L9SA 5CRDA 1HNBA 4N0ZA 2H0GA 5ECQB 4JZQA 2JZTA 3BCIA 4QL9A 4I5QA 4G19A 1A2MA 1X9WB 4HU9A 1LU4A 4MPGA 3ZRDA 1FW1A 1T1VA 3UEMA 5ENUA 1ZZYA 2RM6A 5AIXA 4MA9A 3C1SA 2IN3A 2AAWA 1PL1A 3F4SA 2GSQA 4USSA 3F9UA 1HNCA 1XW9A 4G0IA 1WE0A 2PU9C 1VF3A 5F07A 4KSOA 1M2BA 4WBRD 4XS4B 1LJRA 3A3TA 2YWOA 2IFQA 4WR5A 1AQXA 1JLVA 2J23A 3KMNA 1VF1A 3FK8A 1E2YA 1WOUA 3PGTA 2K6VA 4TR1B 5LD0A 1MDIA 1EP7A 3GNJA 3LEFA 4WEYA 3EU4A 1VF4A 2CA8A 4LMWA 1Y25A 3L78A 4L8EA 2H6XA 4KSMA 2BJXA 3ZZXA 4XCSA 2C8UA 3M9JA 1GTAA 1XBSA 2PUKC 4QQ7A 2LJAA 4PNFA 4PURA 2FWEA 4NPBA 2Z9SA 3HZ4A 2HRFA 1B9YC 4ID0A 4ILFA 5J5NA 2LEGA 1V98A 2ZNMA 2QC7A 2YNXA 2B5EA 2L5OA 4ZL8A 3F3RA 1A23A 3GHAA 2OACA 2D2ZA 2BTOT 3GV1A 4MF7A 1S3AA 2C3QA 2DBCA 2FWFA 2VCQA 5DCHA 5J9CA 1B8XA 2CVDA 2GGTA 3VURA 2MBSA 1AQVA 4ECIA 2M80A 5A4UA 4PTSA 3F6DA 3QD9A 1T00A 2I1UA 1PQNA 2VCWA 3VPQA 3C1RA 1KNGA 3O6TA 4JEDA 4HZ4A 2GT6A 2H19A 5DQSA 2H72A 2J9HA 4WETA 1YEPA 1O85A 6GSUA 2VCTA 4PQ1A 3UAPA 1PSQA 4XS1A 3GL3A 2FY6A 3GX0A 2MMNA 1YY7A 2GQKA 5ECKB 2YOIA 5D73A 5DBQA 2VCVA 2KHPA 1AAZA 3VWXA 1NHYA 1X9SB 1K0CA 5LCZA 4I8BA 2C0EA 3VLNA 4BVXA 3HDCA 1YQ1A 2YWNA 3QAWA 3TJBA 4XHMA 3CRTA 2F3MA 3C8EA 4MF6A 4FO5A 3CRUA 4V2NA 4TR0A 3CTFA 4FYBA 1BG5A 1OC9B 3ERGA 3PH9A 1YKCA 5ECSA 4PUFC 3KP8A 3Q74A 3G7YA 1EGRA 2WDUA 4AJ6A 1HYUA 3O76A 5GAPD 1TP9A 3MSZA 1EV9A 2BMXA 1GSQA 4TXOB 1XOAA 1PX7A 3QAGA 3P90A 2HRNA 2HZFA 2PPTA 2AV4A 2LRTA 2H70A 4F2IA 3GSSA 1SYXA 2HSMB 1GULA 1B9XC 3TJFA 2VCXA 4J57E 1GNEA 1EOHA 3TKSC 4IQAA 5DJMA 4GWRA 2LJKA 5GAND 4ZBAA 3KH7A 1XWKA 5EL8A 1TK0B 22GSA 3FW2A 1ERTA 3M9KA 3KP9A 1PKZA 2PGTA 4D73A 1HQOA 3KH9A 5J4UA 3FZAA 1AXDA 4NXIA 2N5BA 3DIEA 4WF4A 4HDEA 3GN3A 2LUSA 1F6MC 4NV2A 4IGJA 1DBYA 2JL4A 4HEA2 2YANA 1BEDA 1WJKA 5CNWA 5H5QA 2LTKA 3L0HA 7GSSA 1S3CA 2OE3A 3EU3A 2VOCA 1K0NA 2ON7A 4BVYB 5ECOB 4AJ7A 4E8EA 4GQCA 1TOFA 2H75A 5COHA 3ZFBA 3VI7A 4ZIJA 2GZYA 1GWCA 3R2QA 2DJJA 5KN1A 1TK8B 1QGVA 2AYTA 5INYA 3G7IA 1TRWA 2I3YA 2WCIA 4MJEA 3HYPA 1C72A 2C3TA 5G1LA 2K8SA 2L57A 2B7JA 3HJPA 2C4JA 4LLRA 4ZL9A 2LQOA 3GTUA 2DJ1A 1DSBA 4LL1B 1ERUA 4MJBA 4OO4A 5FHIA 3UVTA 4NWYA 2LNTA 3LYPA 3FY7A 2LRNA 3DVXA 2JACA 5ECNB 4NAXA 3TGZA 2X64A 2XC2A 2I81A 11GSA 1JFUA 6GSWA 3KTLA 1T8EB 2EIQA 6GSVA 2OE1A 3FR6A 13GSA 3WD6A 1XCCA 3ZREA 3D0ZA 3E3EA 3UOMA 4BWQA 3TUEA 3DEXA 3QR6A 4JBBA 4IN0A 5ECRB 1TDIA 5IO2A 3IXRA 2O89A 2XPEA 3EE2A 3M8NA 3GIXA 1TU7A 5AIVA 3GRXA 5ELAA 1ZCPA 4IELA 3RDWA 3W8SA 1Z7RA 4OCEA 1MDJA 3RPNA 2P5QA 4ZB8A 3DVWA 2V6OA 2GQMA 1N2AA 1F9MA 5ECPB 4JR4A 4ZILA 2L6CA 1B4QA 2KUCA 2KOKA 4ACSA 4MJCA 1ZL9A 4TR4A 3ZIVA 1ZYEA 2VM2A 3F4TA 1B4PA 1DUGA 2FWHA 4AF2A 4WKWA 3CSHA 1ZYQB 2RUEA 1SENA 1FAAA 3HZ8A 1T3BA 4F9ZA 2I9HA 1WWJA 2DC5A 2CZ3A 2WRTA 1FB6A 1WRYA 1Z9HA 4YH2A 2LNSA 5C00A 4JE1A 2H1BA 3PINA 1YZXA 1K0MA 4ML1A 1PX6A 3KD0A 1GSSA 4I97A 5A4WA 1OVNA 4FYUA 1O73A 4RQRA 3FZ9A 2LQQA 2O7KA 1THXA 1PL2A 4BL7B 5HR0A 4G2EA 3G7JA 1WMJA 1J9BA 3VK9A 2H6YA 1T7PB 3O3TA 1V57A 4PX1A 5F0GA 1R5PA 1GSYA 3OR5A 4K0GA 1KTEA 2DJ2A 1H75A 1X5CA 1LBKA 3FZ4A 5G5FA 1GTIA 1I9DA 5ID2A 1ERWA 3IHQA 5JCGA 2E2GA 1EWXA 1ERVA 3RPPA 4IP1A 2IIYA 5IO0A 3WT2A 3VFIA 1GSEA 1R7HA 3MWHA 1GTUA 4ECCA 3QCPA 1OE8A 3KXOA 4ZB6A 4EC0A 4OO5A 1AQWA 2L4QA 1R5AA 1V58A 2EIOA 2OBIA 1SJ6A 3LWAA 2QGVA 1SKRB 1EEJA 1XWBA 3KM6A 3QFAC 3H1NA 1M9AA 6GSSA 1SU9A 12GSA 1IYHA 2GSSA 2VO4A 2LV3A 3GKKA 5B6NA 2JSYA 5DAKA 1X0RA 1JHBA 4GQFA 1G7OA 3U6VA 2IFQB 4MCUA 1XWAA 2VL3A 2GT5A 3RHCA 2FNOA 1E6BA 4J2FA 3J7Yb 3CSIA 4IS0A 4KAEA 4DSQA 3UMAA 4YQMA 4HQSA 1V2AA 2UZ8A 4NMUA 2C80A 4KDUA 4N0VA 4RUVA 5HR1A 2QKEA 3N5OA 1UN2A 1I5GA 2P31A 1YF1A 2YWIA 5DALA 2CT6A 4KX4A 2LRCA 4IQ1A 3LFLA 1S3DA 3SWLA 3RBTA 3I9V2 3IK9A 1KBNA 1GSFA 3CSJA 5CO3A 2OKAA 2HQTA 2VCZA 3VI5A 4YQUA 1GNWA 1AIUA 4ML6A 1TRSA 1K0AA 5DVBA 4OFMA 2GVPA 1A2JA 2XBQA 4O32A 1M99A 4EUYA 1ON4A 4KCEA 3IA1A 4ZB9A 3MDKA 1K0DA 1TRUA 4Q5FA 2CZ2A 2GTUA 4GSSA 5CP1A 1GTBA 4IHUA 3HD5A 1XIYA 3BJ5A 5IMZA 3H4KA 3WGXA 4KDXA 2IMFA 3LXZA 2F51A 1ML6A 2WB9A 2YZUA 1A8YA 4IW9A 4XRDA 3L9UA 1WPIA 2VD0A 4HJ2A 2K9FA 1H4OA 2YZHA 3IE3A 1ST9A 3CTGA 1GRXA 4CDOA 5GZZB 2H66A 4GXZA 2H76A 1U87A 2MMOA 4TN8A 3LQ7A 4E8HA 2NBSA 5J41A 3F63A 1TW9A 1GLQA 3APOA 1O7UA 1HD2A 3K8NA 3ZFLA 1OE7A 4GCIA 2LS5A 1SK2A 2FHEA 2VLTA 4L5LA 4V2MA 4BVXB 3U5RE 5HR3A 3KJYA 4OD7A 1FB0A 2B7KA 17GSA 4Z7XA 3EURA 2OADA 5ECIB 2H1DA 2VL2C 4J56E 5G30A 4KDYA 3ME7A 3LORA 5ELGA 2VIMA 3VWWA 4X1UA 5D96A 1JZDA 2B1LA 1FO5A 5D93A 1K0OA 2VL2A 4O5RA 1M2AA 2HRKA 4YQVA 2YP6A 4XTSA 1SK1A 1YDKA 2B3SA 3UBKA 1GUMA 1MD3A 2WZ9A 3IAS2 1OAZA 3W8JA 4TRXA 3F4RA 1R4WA 3WGDA 2LJRA 2NDOA 3GX8A 4K0NA 3DYRA 2GDRA 5HR2A 19GSA 1X9MB 3UARA 3IC8A 1XZOA 5IPHA 4I6XA 1GUHA 4WBJA 2XPDA 2R5GA 2O8VB 3DKSA 2PWJA 2V6KA 3TRXA 3IR4A 3TKSA 2MYGA 3ZTLA 1O8XA 4D73B 3IK7A 3LXTA 1XXUA 3HHVA 4GSNA 3LJRA 2H01A 4HS1A 5DQYA 4WF5A 4F03A 5IMDA 5LNKe 4NHWA 2HT9A 4CW9A 2WGRA 3RHBA 1A0RP 4O92A 1SD9A 5AN1A 2IWTA 4BA7A 3RAZA 2IMDA 2X99A 2H8LA 1URMA 3IC4A 1O81A 2ZUPA 2EC4A 1SJZA 3Q18A 3UBLA 5JCWA 1VGLA 2HSNB 1PRXA 3APSA 2DIZA 4MF5A 1IYIA 1NW2A 4ZBDA 3P2AA 1TTZA 3IAM2 4G10A 1QUWA 2XHFA 2HFDA 4V1Ap 5IMFA 4XIHA 1XW6A 1SKWB 2DJKA 3P7XA 4L0WA 1RK4A 3GKXA 4DSSA 1Z6NA 5E59A 1U3AA 2FGXA 3ZIJA 2H1AA 2HNLA 3SBCA 1K3OA 4KB3A 4JR6A 4KW6A 3WYWA 3ED3A 4BWSA 1G7EA 1WIKA 1ZOFA 2MMAA 4PXOA 3VWVA 3HY2A 3MNGA 2VLVA 1FVJA 4TXVA 4PNGA 20GSA 1OC8A 3ZVJA 1XVQA 4HOJA 3IRAA 3GTUB 2HLSA 2HZEA 4F82A 2R37A 3N9JA 2FA4A 2G0FA 4P3YB 2DMMA 3BBYA 4POKA 1QFNA 3MAKA 5H5SA 3QOUA 5KN2A 3EWLA 3VPTA 5KN0A 4O7HA 2RM5A 4ZBBA 2C1YA 3KTBA 4POBA 2H71A 5DDLA 4HQZA 1GUKA 1A2LA 3GKNA 3LGCA 1EV4A 2B6MA 5CAXA 4Q5QA 2NPBA 3JCML 3A2WA 2JZRA 3BCKA 3BOAA 3TJKA 3GFKA 1Z7PA 3FEUA 3H93A 2V2GA 4L0UA 1PMTA 2HRAA 4OMVA 4Q5NA 2X8HA 4MZCA 5CREA 5FWGA 1M9BA 2EIRA 2V32A 4NV5A 2IPAA 4Q5RA 2NVLA 4N30A 3ZLPA 3HKRA 2H73A 4MDCA 3TRQA 2DJ3A 1SL0B 1O8WA 1VRSD 4FIWA 5D9TA 2F8FA 4TKYA 1ILOA 2R6KA 4FH8A 2DSAA 1BYEA 1SYRA 1A8LA 3KIJA 2RIIA 3IBHA 4MABA 1SK0A 3KEBA 1BJXA 3KMOA 5D9VA 3I6AA 3DD3A 4HJMA 5C04A 4IJIA 3FHKA 2E7PA 1G6YA 3QFBC 5HFIA 5J9BA 4K2DA 2YJ7A 3ZL5A 2P5RA 5F06A 2V41A 4OFTA 5G31A 5IMAA 14GSA 2HE3A 4G0LA 4GF0A 4MLYA 4ISDA 4DEJA 3C71A 2PMTA 2LSTA 5G5EA 1EP8A 2CVKA 2DLXA 1X5EA 2A4VA 1PN9A 3EYTA 1F3AA 1ABAA 4EF0A 3GURA 9GSSA 3WGEA 3HA9A 1NSWA 2WJUA 1GH2A 4K6XA 5ID2B 2HI7A 3HVVA 3HJMA 3TRPA 1XFLA 3R3EA 3TKPA 2FD3A 2PERA 5IOXA 4MPFA 2RUFA 2JU5A 2N5FA 5IQYA 5JWRB 2PVOC 2GSRA 1M2DA 2FLSA 4KGIA 5F05A 5IPGA 3J7Yk 4KUNA 1XPVA 5CRWA 3ZMLA 2FCHA 2M46A 3IPZA 3UVHA 3FZ5A 4KF9A 2C0FA 4X0XA 3TJGA 1A24A 2GS3A 4MZWA 3D5JA 1TI3A 1ZMAA 3TOTA 3TDGA 2YPMA 4KE3A 5HQPA 4PUAA 3TB2A 1KEBA 1W89A 1VF2A 1EOGA 3Q6OA 5DAKB 4XS4A 5IM9A 1TJDA 3GA4A 5HFGA 2K18A 4AJ8A 2ON5A 2IMIA 2CAQA 4IBPA 2C3NA 2OBKA 2OE0A 3VWUA 3W6GA 4PGTA 1Y6EA 2IMEA 3US3A 3HJOA 4F0BA 2YWMA 16GSA 3EMXA 3DMLA 4F0CA 1JZWA 4TR1A 1FG4A 5AISA 1AW9A 3TKQA 8GSSA 2F8AA 2E0QA 2KLXA 1JLWA 3M1GA 2AUVA 2XBIA 3HXSA 1EEMA 3H8QA 1HNAA 4ZXGA 5CYYA 2AHEA 1U88A 5DALB 1ACVA 5ECLB 3F0IA 1A0FA 1K0BA 1XWGA 3NZNA 4GSTA 2L59A 1F3BA 3GUSA 4ECBA 1JZOA 2CX3A 3HCZA 3ZMKA 4RQXA 5AGYA 1R26A 5B6MA 4QL7A 4POLA 1SD8A 2ZCTA 3A2XA 1F37A 1YJ6A 2P0GA 2QSIA 4AGSA 3CXGA 3LG6A 4OFNA 3FR3A 4HI7A 3G9BA 1MD4A 1FHEA 2LKUA 4X43A 3FR9A 3WT1A 2L4CA 4EDZA 3D21A 5D8IA 2PN8A 4XS6A 1FVKA 2FA8A 2JSZA 4EL1A 1FOVA 4XRAA 1GP1A 5E4WA 4G0KA 1NM3A 2CV4A 1T4YA 5GSTA 5ABRA 3LYKA 2FUG2 3UIWA 2H30A 3A5WA 3EMPA 4HUAA 2VUPA 3APQA 1F2EA 2YCDA 4GLTA 2TIRA 2H1GA 1PA3A 1BX9A 1WP0A 1TXXA 1NHOA 2H0HA 3TKSE 3NOFA 2REMA 4KNDA 1J08A 1U3IA 1SL2B 2PVQA 3IOSA 2MMZA 4POMA 1MTCA 5CRGA 1PD21 5D9WA 3GKMA 2HSHA 5H5RA 2C0DA 1Q4JA 3FRCA 3QPMA 6GSTA 5DJLA 2DJ0A 4KH7A 3DXBA 3GH6A 4I2UA 1BAYA 4PQIA 3LSZA 5IMVA 5F8BA 1QK8A 1UC7A 4WR4A 4V1Ag 2R4VA 18GSA 2VAFA 1U6TA 5EY6A 2DIYA 4GRFA 5KEJA 2WFCA 4L5OA 1OKDA 1OC9A 3CMIA 5IMCA 4OWYA 1CQGA 4JRRA 1MDKA 3FYGA 1XWCA 4IJ3A 2MBTA 3GH9A 3CBUA 5IOWA 1XVWA 4I2TA 2IMKA 3PR8A 2HRKB 2H0IA 4JU5A 2A2RA 4KA0A 2YV7A 1T4ZA 4H86A 4IKHA 2VD1A 4MP4A 3ME8A 4RI7A 4TXOA 2IJYA 3D6IA 2CX4A 2O87A 4EVMA 4YAVA 1TKDB 1GL8A 4LA1A 1G0TA 2R3XA 2HSMA 2NTOA 1GSUA 3DGQA 2CVBA 2G2QA 6GSXA 4MJAA 3EINA 3BD2A 3UL3A 4LMVA 1B48A 3ZVJD 3ISOA 5CRHA 4G9HA 3TKRA 4MH2A 4WXTA 4ZL7A 5B8BA 4K7IA 5EVOA 3F3QA 2AB6A 3ZYWA 2PBJA 2VL9A 1MEKA 5JCUA 1OKTA 1THOA 2E2MA 1QMVA 3Q19A 2B5YA 3IDVA 2RLIA 3CYNA 3M3MA 1RW1A 4NHZA 1QXHA 6GSYA 1AUCA 1PKWA 3F8UA 4EO3A 1GLPA 1TU8A 1QQ2A 4OCFA 2CQ9A 3KZQA 5A5KA 4BVYA 2C0GA 1AC1A 2X8CA 5JWQB 5A4VA 2KP2A 4DVCA 2YJHA 1SL1B 4MMMA 4EKZA 3L9VA 1UVZA 3GL5A 3KCMA 4DSSB 1SKSB 4V2LA 5J3RA 4FYCA 4TW5A 2L6DA 1GSDA 1K3LA 4TOPA 1Z6MA 3UJ1A 3TCOA 2N5AA 4MK3A 4K7OA 2YN1A 3TOUA 4RI6A 2O85A 4K9ZA 2DMLA 3DWVA 1Z5YE 4TR3A 1N8JA 2IL3A 1X5DA 1USBA 2HZEB 1Q98A 3S9FA 5HFKA 3QMXA 3A2VA 1SJIA 1M0UA 4K7NA 3V1WA 1V40A 1YEXA 4BPYA 1OC3A 5B7CA 2I4AA 4MH3A 4N11A 4DSRA 1XOBA 1M7TA 3D4TA 2HSYA 1Z3EA 2F9SA 1TK5B 2FWGA 2H6ZA 1UA5A 5B8AA 3KGKA 1YF0A 1JZRA 3ERWA 1YKAA 2V1MA 5EPFA 2ES7A 3P8WA 3E0UA 3HVSA 1PGTA 3DRNA 4K8MA 2VLUA 2WULA 3GSTA 2AJQB 5G2ZA 1V9WA 3HVXA 2KP1A 1OYJA 3C73A 4TVEA 3TJJA 2R2JA 4K1FA 4N10A 3FKFA 2ALBA 2GZZA 4HU7A 4ULXA 2HXKA 1W4VA 5D9XA 1TI1A 3NIVA 5JWOB 2L5LA 1CQHA 2A2SA 3QDNA 5DCGA 2TRCP 4EDYA 2GZPA 2GQLA 3H79A 2K8VA 2B1KA 3C7MA 3GYKA 2H74A 2OJLA 3PPUA 5IIZA 1EGOA 2CAIA 4YAPA
chains in the Genus database with same CATH superfamily
3E9JB 1EZKA 1K3YA 5L71A 3QAVA 1RQMA 4EIPA 3AY8A 10GSA 2B5XA 3M0FA 2X8GA 3I69A 3EC3A 2TRXA 5FT3A 3GMFA 1G6WA 4ECJA 5G1KA 3IV4A 2JADA 1DE2A 1J0FA 4IVFA 2WVXA 1XW5A 2VM1A 2GLRA 4GTUA 5BMUA 2GSTA 4MNNA 4CHSA 4EE0A 3D22A 1BQ7A 2O3EA 4BL7A 1O6JA 3I43A 5GSSA 5ECHB 4IP6A 4LL4B 2MZCA 3ERFA 4HZ2A 2M72A 3F6FA 4ICYA 3ZITA 3D4MA 4KCAA 1TRVA 2YV9A 4MZBA 4FQUA 2OA7A 4EXJA 3L4NA 2A4HA 1ZYNA 5KN3A 5ECMB 3TU3B 3EVIA 2HYXA 1ZGNA 2JZSA 1DE1A 2WS2A 4PQHA 3L9SA 5CRDA 1HNBA 4N0ZA 2H0GA 5ECQB 4JZQA 2JZTA 3BCIA 4QL9A 4I5QA 4G19A 1A2MA 1X9WB 4HU9A 1LU4A 4MPGA 3ZRDA 1FW1A 4AKGA 1T1VA 3UEMA 5ENUA 1ZZYA 2RM6A 5AIXA 4MA9A 3C1SA 2IN3A 2AAWA 1PL1A 3F4SA 2GSQA 4USSA 4Z2RA 3F9UA 1HNCA 1XW9A 4G0IA 1WE0A 2PU9C 1VF3A 5F07A 4KSOA 1M2BA 4WBRD 4XS4B 1LJRA 3A3TA 2YWOA 2IFQA 4WR5A 1AQXA 1JLVA 2J23A 3KMNA 2O36A 1VF1A 3FK8A 1E2YA 1WOUA 3PGTA 2K6VA 4TR1B 5LD0A 1MDIA 1EP7A 3GNJA 3LEFA 4WEYA 3EU4A 1VF4A 2CA8A 4LMWA 1Y25A 3L78A 4L8EA 2H6XA 4KSMA 2BJXA 3ZZXA 4CY6A 4XCSA 2C8UA 2A2PA 3M9JA 1GTAA 1XBSA 2PUKC 4QQ7A 2LJAA 4PNFA 4PURA 4Z2UA 2FWEA 4NPBA 2Z9SA 3HZ4A 2HRFA 1B9YC 4ID0A 3MYDA 4ILFA 5J5NA 2LEGA 1V98A 4AI6A 2ZNMA 2QC7A 2YNXA 2B5EA 2L5OA 4ZL8A 3F3RA 1A23A 3GHAA 2OACA 2D2ZA 2BTOT 3GV1A 4MF7A 1S3AA 2C3QA 2QA2A 2DBCA 2FWFA 2VCQA 5DCHA 3FMWA 5J9CA 1B8XA 2CVDA 2GGTA 3VURA 2MBSA 1AQVA 4ECIA 2M80A 2WW0A 5A4UA 4PTSA 3F6DA 3QD9A 4K5SA 1T00A 2I1UA 1PQNA 5J40A 2VCWA 3VPQA 3C1RA 1KNGA 3O6TA 4JEDA 4HZ4A 2GT6A 2H19A 5DQSA 2H72A 2J9HA 4WETA 1YEPA 1O85A 6GSUA 2VCTA 4PQ1A 3UAPA 1PSQA 4BIKA 4XS1A 3GL3A 2FY6A 3GX0A 2MMNA 1YY7A 2GQKA 5ECKB 2YOIA 5D73A 5DBQA 2VCVA 2KHPA 1AAZA 3VWXA 1NHYA 4X4JA 1X9SB 1K0CA 5LCZA 4I8BA 2C0EA 3VLNA 4BVXA 3HDCA 1YQ1A 2DKIA 2YWNA 4AKIA 3QAWA 3TJBA 4XHMA 3CRTA 2F3MA 3C8EA 4MF6A 4FO5A 3CRUA 4V2NA 4TR0A 3CTFA 4FYBA 1BG5A 1OC9B 3ERGA 3PH9A 1YKCA 5ECSA 4PUFC 3Q74A 3KP8A 3G7YA 1EGRA 2WDUA 4AJ6A 1HYUA 3O76A 5GAPD 1TP9A 3MSZA 1EV9A 2BMXA 3CQFA 1GSQA 4TXOB 1XOAA 1PX7A 3QAGA 3P90A 2HRNA 2HZFA 2PPTA 2AV4A 5KOWA 2LRTA 2H70A 4F2IA 3GSSA 1SYXA 2HSMB 1GULA 1B9XC 3TJFA 2VCXA 4J57E 1GNEA 1EOHA 3TKSC 4IQAA 5DJMA 4GWRA 2LJKA 5GAND 4ZBAA 3KH7A 1XWKA 5EL8A 1TK0B 22GSA 3FW2A 1ERTA 3M9KA 3KP9A 1PKZA 2PGTA 4D73A 1HQOA 1BF5A 3KH9A 5J4UA 3FZAA 1AXDA 4NXIA 2N5BA 3DIEA 4WF4A 4PI0C 2EFCA 4HDEA 4G01A 2LUSA 3GN3A 1F6MC 4NV2A 4IGJA 1DBYA 2JL4A 4HEA2 2YANA 1BEDA 5A5HA 1WJKA 5CNWA 5H5QA 2LTKA 2WW1A 2WW2A 3L0HA 7GSSA 1S3CA 2HSNA 3EU3A 2OE3A 2VOCA 1K0NA 2ON7A 4BVYB 5ECOB 4AJ7A 4E8EA 4GQCA 1TOFA 2H75A 5COHA 3ZFBA 3VI7A 4ZIJA 2GZYA 1GWCA 3R2QA 2DJJA 5KN1A 1TK8B 2X4AA 1QGVA 2AYTA 5INYA 3G7IA 1TRWA 2I3YA 1TXUA 2WCIA 4MJEA 3HYPA 1C72A 2C3TA 5G1LA 2K8SA 2L57A 2B7JA 3HJPA 2C4JA 4LLRA 4ZL9A 2LQOA 3GTUA 2DJ1A 1DSBA 4LL1B 1ERUA 4MJBA 4OO4A 5FHIA 3UVTA 4NWYA 2LNTA 3LYPA 3FY7A 2LRNA 3DVXA 2JACA 5ECNB 4NAXA 3TGZA 2X64A 2XC2A 2I81A 11GSA 1JFUA 6GSWA 3KTLA 1T8EB 2O5VA 2EIQA 6GSVA 2OE1A 3FR6A 13GSA 3WD6A 1XCCA 3ZREA 3D0ZA 3E3EA 3UOMA 4BWQA 3TUEA 3DEXA 3QR6A 4JBBA 4IN0A 5ECRB 1TDIA 5IO2A 3IXRA 2O89A 2XPEA 3EE2A 3M8NA 3GIXA 1TU7A 5AIVA 3LW9A 3GRXA 5ELAA 1ZCPA 4IELA 3RDWA 3W8SA 1Z7RA 4OCEA 2UV8G 1MDJA 3RPNA 2P5QA 4ZB8A 3DVWA 2V6OA 2GQMA 1N2AA 1F9MA 5ECPB 4JR4A 4ZILA 2L6CA 1B4QA 2KUCA 2KOKA 4ACSA 4MJCA 1ZL9A 4O5QA 4TR4A 3ZIVA 1ZYEA 2VM2A 3F4TA 1B4PA 1DUGA 2FWHA 4AF2A 4WKWA 3CSHA 1ZYQB 2RUEA 1SENA 1FAAA 3HZ8A 1T3BA 4F9ZA 2I9HA 1WWJA 2DC5A 2CZ3A 2WW3A 1M3IA 2WRTA 1FB6A 1WRYA 1Z9HA 4YH2A 2LNSA 5C00A 4JE1A 2H1BA 3PINA 2WVXB 1YZXA 1K0MA 4ML1A 1PX6A 3KD0A 1GSSA 4I97A 5A4WA 1OVNA 4FYUA 5BMUB 1O73A 4RQRA 3FZ9A 2LQQA 2O7KA 1THXA 1PL2A 4BL7B 5HR0A 4G2EA 3G7JA 1WMJA 4AKHA 1J9BA 3VK9A 2H6YA 1T7PB 3O3TA 1V57A 4PX1A 5F0GA 1R5PA 1GSYA 3OR5A 4K0GA 1KTEA 2DJ2A 1H75A 1X5CA 1LBKA 3FZ4A 5G5FA 1GTIA 4GDFA 1I9DA 5ID2A 1ERWA 3IHQA 5JCGA 2E2GA 1EWXA 1ERVA 3RPPA 4IP1A 2IIYA 5IO0A 3WT2A 3VFIA 1GSEA 1R7HA 3MWHA 1GTUA 4ECCA 3QCPA 1OE8A 3KXOA 4ZB6A 4EC0A 4OO5A 1AQWA 2L4QA 1R5AA 1V58A 2EIOA 2OBIA 1SJ6A 3LWAA 2QGVA 1SKRB 1SVOA 1EEJA 1XWBA 3KM6A 3QFAC 3H1NA 1M9AA 6GSSA 1SU9A 12GSA 1IYHA 2GSSA 2VO4A 2LV3A 3GKKA 2QA1A 5B6NA 2JSYA 5DAKA 1X0RA 5J4VA 1BG1A 1JHBA 4GQFA 1G7OA 3U6VA 2IFQB 2R0CA 4MCUA 1XWAA 2VL3A 2GT5A 3RHCA 2FNOA 1E6BA 4J2FA 3J7Yb 3CSIA 4IS0A 4KAEA 4ZB7A 4DSQA 3UMAA 4YQMA 4HQSA 1V2AA 2UZ8A 4NMUA 2C80A 4KDUA 4N0VA 4RUVA 5HR1A 2QKEA 3N5OA 1UN2A 1I5GA 2P31A 1YF1A 2YWIA 5DALA 2CT6A 4KX4A 2LRCA 4IQ1A 3LFLA 1S3DA 3SWLA 3RBTA 3I9V2 3IK9A 1KBNA 1GSFA 1XG8A 3CSJA 5CO3A 2OKAA 2HQTA 2VCZA 3VI5A 4O5UA 4YQUA 1GNWA 1AIUA 4ML6A 1TRSA 1K0AA 5DVBA 4OFMA 4QMKA 2GVPA 1A2JA 5J47A 2XBQA 4O32A 1M99A 3RFRC 4EUYA 1ON4A 4KCEA 3IA1A 4ZB9A 3MDKA 1S4BP 1K0DA 1TRUA 4Q5FA 1PN0A 2CZ2A 2GTUA 4GSSA 5CP1A 1GTBA 4IHUA 3HD5A 1XIYA 3BJ5A 5IMZA 3H4KA 3WGXA 4KDXA 2IMFA 3LXZA 2F51A 1ML6A 2WB9A 2YZUA 5A1NA 1A8YA 3CWGA 4IW9A 3L9UA 4XRDA 1WPIA 2VD0A 4HJ2A 2K9FA 1H4OA 2YZHA 3IE3A 1ST9A 3CTGA 1GRXA 4CDOA 5GZZB 2H66A 4GXZA 2H76A 1U87A 2MMOA 4TN8A 3LQ7A 4E8HA 2NBSA 5J41A 3F63A 1TW9A 1GLQA 3APOA 1O7UA 1HD2A 3K8NA 3ZFLA 1OE7A 4GCIA 2LS5A 1SK2A 2FHEA 2VLTA 4L5LA 4V2MA 3IHGA 4BVXB 3U5RE 5HR3A 3KJYA 4OD7A 1FB0A 2B7KA 17GSA 4Z7XA 3EURA 2OADA 5ECIB 2H1DA 2VL2C 4J56E 5G30A 4KDYA 3ME7A 3LORA 5ELGA 2VIMA 4YKFA 3VWWA 4X1UA 5D96A 1JZDA 2B1LA 1FO5A 5D93A 1K0OA 2VL2A 4O5RA 1M2AA 2HRKA 2EFEA 4YQVA 2YP6A 4XTSA 1SK1A 1YDKA 2B3SA 3UBKA 1GUMA 1MD3A 2WZ9A 3IAS2 1OAZA 3W8JA 4TRXA 3F4RA 4HSCX 1R4WA 3WGDA 2LJRA 2NDOA 3GX8A 4K0NA 3DYRA 2GDRA 5HR2A 19GSA 1X9MB 1N25A 3UARA 3IC8A 1XZOA 5IPHA 4I6XA 1GUHA 4WBJA 2XPDA 2R5GA 2O8VB 3DKSA 2PWJA 4W66A 2V6KA 3TRXA 2WZSA 3IR4A 3TKSA 2H1LA 2MYGA 3ZTLA 1O8XA 4D73B 3IK7A 3LXTA 1XXUA 3HHVA 4GSNA 3LJRA 2H01A 4HS1A 5DQYA 4WF5A 4F03A 5IMDA 5LNKe 4PI2C 4NHWA 2HT9A 4CW9A 2WGRA 3RHBA 1A0RP 4O92A 1SD9A 5AN1A 2IWTA 4BA7A 3RAZA 2IMDA 2X99A 2H8LA 1URMA 3IC4A 1O81A 5A5HB 2ZUPA 2EC4A 1SJZA 3Q18A 3UBLA 5JCWA 1VGLA 2HSNB 1PRXA 3APSA 2DIZA 4MF5A 1IYIA 1NW2A 4ZBDA 3P2AA 1TTZA 3IAM2 4G10A 1QUWA 2X49A 2XHFA 2HFDA 4V1Ap 5IMFA 4XIHA 1XW6A 1SKWB 2DJKA 3P7XA 4L0WA 1RK4A 3GKXA 4DSSA 1Z6NA 5E59A 1U3AA 2FGXA 3ZIJA 2H1AA 2HNLA 3SBCA 1K3OA 4KB3A 4JR6A 4KW6A 3WYWA 3ED3A 4BWSA 1G7EA 1WIKA 1ZOFA 2MMAA 4PXOA 3VWVA 3HY2A 3MNGA 2VLVA 1FVJA 4TXVA 4PNGA 20GSA 1OC8A 3ZVJA 1XVQA 4HOJA 3IRAA 3GTUB 2HLSA 2HZEA 4F82A 2R37A 3N9JA 2FA4A 2G0FA 4P3YB 2DMMA 3BBYA 4POKA 1QFNA 3MAKA 5H5SA 3QOUA 5KN2A 3EWLA 3VPTA 3MIXA 5KN0A 4O7HA 2RM5A 4ZBBA 2C1YA 3KTBA 4POBA 2H71A 5DDLA 4HQZA 1GUKA 1A2LA 3GKNA 3LGCA 1EV4A 2B6MA 5CAXA 4Q5QA 2NPBA 3JCML 3A2WA 2JZRA 3BCKA 3BOAA 3TJKA 3GFKA 1Z7PA 3FEUA 3H93A 2V2GA 4L0UA 1PMTA 2HRAA 4OMVA 4Q5NA 2X8HA 4MZCA 5CREA 2DKHA 5FWGA 1M9BA 2EIRA 5A34A 2V32A 4NV5A 2IPAA 4Q5RA 2NVLA 4N30A 3ZLPA 3HKRA 4YKGA 2H73A 4MDCA 3TRQA 4N3ZA 2DJ3A 1SL0B 1O8WA 1VRSD 4FIWA 5D9TA 2F8FA 4TKYA 1ILOA 2R6KA 4FH8A 2DSAA 1BYEA 1SYRA 1A8LA 3KIJA 2RIIA 3IBHA 4MABA 1SK0A 3KEBA 1BJXA 3KMOA 5D9VA 3I6AA 3DD3A 4HJMA 5C04A 2R0GA 4IJIA 3FHKA 2E7PA 1G6YA 3QFBC 5HFIA 5J9BA 1FOHA 3RGBC 4K2DA 4CY8A 2EFDA 2YJ7A 3ZL5A 2P5RA 5F06A 2V41A 1Y1UA 4OFTA 5G31A 5IMAA 14GSA 2HE3A 4G0LA 4GF0A 4MLYA 4ISDA 4DEJA 3C71A 2PMTA 2LSTA 5G5EA 3CHXC 1EP8A 2CVKA 2DLXA 1X5EA 2A4VA 1PN9A 3EYTA 1F3AA 1ABAA 4EF0A 3GURA 9GSSA 3WGEA 3HA9A 1NSWA 2WJUA 1GH2A 4K6XA 5ID2B 2HI7A 3HVVA 3HJMA 3TRPA 1XFLA 3R3EA 3TKPA 2FD3A 2PERA 5IOXA 4MPFA 2RUFA 2JU5A 2N5FA 5IQYA 5JWRB 2PVOC 2GSRA 1M2DA 2FLSA 4KGIA 5F05A 5IPGA 3J7Yk 4KUNA 1XPVA 5CRWA 3ZMLA 2FCHA 2M46A 1YVLA 3IPZA 3UVHA 3FZ5A 4KF9A 2C0FA 4X0XA 3TJGA 1A24A 2GS3A 4MZWA 3D5JA 1TI3A 1ZMAA 3TOTA 3TDGA 2YPMA 4KE3A 5HQPA 4PUAA 3TB2A 1KEBA 1W89A 1VF2A 1EOGA 3Q6OA 5DAKB 4XS4A 5IM9A 1TJDA 3GA4A 5HFGA 2K18A 4AJ8A 2ON5A 2IMIA 2CAQA 4IBPA 2C3NA 2OBKA 2OE0A 3VWUA 3W6GA 4PGTA 1Y6EA 2IMEA 3US3A 3HJOA 4F0BA 2YWMA 16GSA 3EMXA 3DMLA 4F0CA 1JZWA 4TR1A 1FG4A 5AISA 1AW9A 3TKQA 8GSSA 2F8AA 2E0QA 2KLXA 1JLWA 3M1GA 2AUVA 2XBIA 3HXSA 1EEMA 3H8QA 1HNAA 4ZXGA 5BRTA 5CYYA 2AHEA 1U88A 5DALB 1ACVA 5ECLB 3F0IA 1A0FA 1K0BA 1PFOA 1ZYPA 1XWGA 3NZNA 4GSTA 2L59A 1F3BA 3GUSA 4ECBA 1JZOA 2CX3A 3HCZA 3ZMKA 4RQXA 5AGYA 1R26A 5B6MA 4QL7A 4POLA 1SD8A 2ZCTA 3A2XA 1F37A 1YJ6A 2P0GA 2QSIA 2OT3A 4AGSA 3CXGA 3LG6A 4OFNA 3FR3A 4HI7A 3G9BA 1MD4A 1FHEA 2LKUA 4X43A 3FR9A 3WT1A 2L4CA 4EDZA 3D21A 5D8IA 2PN8A 4XS6A 1FVKA 2FA8A 2JSZA 4EL1A 1FOVA 4XRAA 1GP1A 5E4WA 4G0KA 1NM3A 2CV4A 1T4YA 5GSTA 5ABRA 3LYKA 2FUG2 3UIWA 5A1NB 2H30A 3A5WA 3EMPA 4HUAA 2VUPA 3APQA 1F2EA 2YCDA 4GLTA 2TIRA 2H1GA 1PA3A 1BX9A 1WP0A 1TXXA 1NHOA 2H0HA 3TKSE 3NOFA 2REMA 4KNDA 1J08A 1U3IA 1SL2B 2PVQA 3IOSA 2MMZA 4POMA 1SVMA 1MTCA 4A5PA 5CRGA 1PD21 5D9WA 3GKMA 2HSHA 5H5RA 2C0DA 1Q4JA 3FRCA 3QPMA 6GSTA 5DJLA 2DJ0A 4KH7A 3DXBA 3GH6A 4I2UA 1BAYA 4PQIA 1I1IP 3LSZA 5IMVA 5F8BA 1QK8A 1UC7A 4WR4A 4V1Ag 2R4VA 18GSA 2VAFA 1U6TA 5EY6A 2DIYA 4GRFA 5KEJA 2WFCA 4L5OA 1OKDA 1OC9A 3CMIA 5IMCA 4OWYA 1CQGA 4JRRA 1MDKA 3FYGA 1XWCA 4IJ3A 2MBTA 3GH9A 3CBUA 5IOWA 1XVWA 4I2TA 2IMKA 3PR8A 2HRKB 2H0IA 4JU5A 2A2RA 4KA0A 2YV7A 1T4ZA 4H86A 4IKHA 2VD1A 4MP4A 3ME8A 4RI7A 4TXOA 2IJYA 3D6IA 2CX4A 2O87A 4EVMA 4YAVA 1TKDB 1GL8A 4LA1A 1G0TA 2R3XA 2WVYA 2HSMA 2NTOA 1GSUA 3DGQA 2CVBA 2G2QA 6GSXA 4MJAA 3A5IA 3EINA 4PHZC 3BD2A 1M3JA 3UL3A 4LMVA 1B48A 3ZVJD 3ISOA 5CRHA 4G9HA 3TKRA 4MH2A 4WXTA 4ZL7A 5B8BA 4K7IA 5EVOA 3F3QA 2AB6A 4AKXB 3ZYWA 2PBJA 2VKZG 2VL9A 1MEKA 5JCUA 1OKTA 1THOA 2E2MA 1QMVA 3Q19A 2B5YA 4K5RA 3IDVA 2RLIA 3CYNA 3M3MA 4E68A 1RW1A 4NHZA 1QXHA 6GSYA 1AUCA 1PKWA 3F8UA 1S3RA 4EO3A 1GLPA 1TU8A 1QQ2A 4OCFA 2CQ9A 3KZQA 5A5KA 4BVYA 2C0GA 1AC1A 2X8CA 5JWQB 4FXYP 1YEWC 5A4VA 2KP2A 4DVCA 2WVZA 2YJHA 1SL1B 4MMMA 4EKZA 3L9VA 1UVZA 3GL5A 3KCMA 4DSSB 1SKSB 4V2LA 5J3RA 4FYCA 4TW5A 2L6DA 3HMJG 1GSDA 1K3LA 4TOPA 1Z6MA 3UJ1A 4EIQA 3TCOA 2N5AA 4Z2TA 4MK3A 4K7OA 2YN1A 3TOUA 4RI6A 2O85A 4K9ZA 1SVLA 2DMLA 3DWVA 1Z5YE 5KOXA 4TR3A 1N8JA 2IL3A 1X5DA 5J4YA 1USBA 2HZEB 1Q98A 3S9FA 5HFKA 3QMXA 3A2VA 1SJIA 1M0UA 4K7NA 3V1WA 1V40A 1YEXA 4BPYA 1OC3A 5B7CA 2I4AA 4MH3A 4N11A 4DSRA 1XOBA 1M7TA 3D4TA 2HSYA 1Z3EA 2F9SA 1TK5B 2FWGA 2H6ZA 1UA5A 5B8AA 3KGKA 1YF0A 1JZRA 3ERWA 1YKAA 2V1MA 5EPFA 2ES7A 3P8WA 3E0UA 3HVSA 1PGTA 3DRNA 4K8MA 2VLUA 2WULA 3GSTA 2AJQB 2R0PA 5G2ZA 1V9WA 3HVXA 2KP1A 1OYJA 3C73A 4TVEA 3TJJA 2R2JA 5A34B 4K1FA 4N10A 3FKFA 2ALBA 2GZZA 4HU7A 3HVNA 4ULXA 2HXKA 1W4VA 5D9XA 1TI1A 3NIVA 5JWOB 2L5LA 4K2XA 1CQHA 2A2SA 3EPTA 3QDNA 5DCGA 2TRCP 4EDYA 2EFHA 2GZPA 2GQLA 3H79A 2K8VA 2B1KA 3C7MA 3GYKA 2H74A 2OJLA 3PPUA 5IIZA 1EGOA 2CAIA 4YAPA
chains in the Genus database with same CATH topology
3E9JB 1EZKA 1K3YA 5L71A 3QAVA 1RQMA 4EIPA 3AY8A 10GSA 2B5XA 3M0FA 2X8GA 3I69A 3EC3A 2TRXA 5FT3A 3GMFA 1G6WA 4ECJA 5G1KA 3IV4A 2JADA 1DE2A 1J0FA 4IVFA 1XW5A 2VM1A 2GLRA 4GTUA 5BMUA 2GSTA 4MNNA 4CHSA 4EE0A 3D22A 1BQ7A 4BL7A 1O6JA 3I43A 5GSSA 5ECHB 4IP6A 4LL4B 2MZCA 3ERFA 4HZ2A 2M72A 3F6FA 4ICYA 3ZITA 3D4MA 4KCAA 1TRVA 2YV9A 4MZBA 4FQUA 2OA7A 4EXJA 3L4NA 2A4HA 1ZYNA 5KN3A 5ECMB 3TU3B 3EVIA 2HYXA 1ZGNA 2JZSA 1DE1A 2WS2A 4PQHA 3L9SA 5CRDA 1HNBA 4N0ZA 2H0GA 5ECQB 4JZQA 2JZTA 3BCIA 4QL9A 4I5QA 4G19A 1A2MA 1X9WB 4HU9A 1LU4A 4MPGA 3ZRDA 1FW1A 4AKGA 1T1VA 3UEMA 5ENUA 1ZZYA 2RM6A 5AIXA 4MA9A 3C1SA 2IN3A 2AAWA 1PL1A 3F4SA 2GSQA 4USSA 4Z2RA 3F9UA 1HNCA 1XW9A 4G0IA 1WE0A 2PU9C 1VF3A 5F07A 4KSOA 1M2BA 4WBRD 4XS4B 1LJRA 3A3TA 2YWOA 2IFQA 4WR5A 1AQXA 1JLVA 2J23A 3KMNA 1VF1A 3FK8A 1E2YA 1WOUA 3PGTA 2K6VA 4TR1B 5LD0A 1MDIA 1EP7A 3GNJA 3LEFA 4WEYA 3EU4A 1VF4A 2CA8A 4LMWA 1Y25A 3L78A 4L8EA 2H6XA 4KSMA 2BJXA 3ZZXA 4CY6A 4XCSA 2C8UA 2A2PA 3M9JA 1GTAA 1XBSA 2PUKC 4QQ7A 2LJAA 4PNFA 4PURA 4Z2UA 2FWEA 4NPBA 2Z9SA 3HZ4A 2HRFA 1B9YC 4ID0A 3MYDA 4ILFA 5J5NA 2LEGA 1V98A 4AI6A 2ZNMA 2QC7A 2YNXA 2B5EA 2L5OA 4ZL8A 3F3RA 1A23A 3GHAA 2OACA 2D2ZA 2BTOT 3GV1A 4MF7A 1S3AA 2C3QA 2QA2A 2DBCA 2FWFA 2VCQA 5DCHA 3FMWA 5J9CA 1B8XA 2CVDA 2GGTA 3VURA 2MBSA 1AQVA 4ECIA 2M80A 5A4UA 4PTSA 3F6DA 3QD9A 4K5SA 1T00A 2I1UA 1PQNA 5J40A 2VCWA 3VPQA 3C1RA 1KNGA 3O6TA 4JEDA 4HZ4A 2GT6A 2H19A 5DQSA 2H72A 2J9HA 4WETA 1YEPA 1O85A 6GSUA 2VCTA 4PQ1A 3UAPA 1PSQA 4XS1A 3GL3A 2FY6A 3GX0A 2MMNA 1YY7A 2GQKA 5ECKB 2YOIA 5D73A 5DBQA 2VCVA 2KHPA 1AAZA 3VWXA 1NHYA 4X4JA 1X9SB 1K0CA 5LCZA 4I8BA 2C0EA 3VLNA 4BVXA 3HDCA 1YQ1A 2DKIA 2YWNA 4AKIA 3QAWA 3TJBA 4XHMA 3CRTA 2F3MA 3C8EA 4MF6A 4FO5A 3CRUA 4V2NA 4TR0A 3CTFA 4FYBA 1BG5A 1OC9B 3ERGA 3PH9A 1YKCA 5ECSA 4PUFC 3KP8A 3Q74A 3G7YA 1EGRA 2WDUA 4AJ6A 1HYUA 3O76A 5GAPD 1TP9A 3MSZA 1EV9A 2BMXA 1GSQA 4TXOB 1XOAA 1PX7A 3QAGA 3P90A 2HRNA 2HZFA 2PPTA 2AV4A 5KOWA 2LRTA 2H70A 4F2IA 3GSSA 1SYXA 2HSMB 1GULA 1B9XC 3TJFA 2VCXA 4J57E 1GNEA 1EOHA 3TKSC 4IQAA 5DJMA 4GWRA 2LJKA 5GAND 4ZBAA 3KH7A 1XWKA 5EL8A 1TK0B 22GSA 3FW2A 1ERTA 3M9KA 3KP9A 1PKZA 2PGTA 4D73A 1HQOA 1BF5A 3KH9A 5J4UA 3FZAA 1AXDA 4NXIA 2N5BA 3DIEA 4WF4A 2EFCA 4HDEA 4G01A 2LUSA 3GN3A 1F6MC 4NV2A 4IGJA 1DBYA 2JL4A 4HEA2 2YANA 1BEDA 5A5HA 1WJKA 5CNWA 5H5QA 2LTKA 3L0HA 7GSSA 1S3CA 2HSNA 3EU3A 2OE3A 2VOCA 1K0NA 2ON7A 4BVYB 5ECOB 4AJ7A 4E8EA 4GQCA 1TOFA 2H75A 5COHA 3ZFBA 3VI7A 4ZIJA 2GZYA 1GWCA 3R2QA 2DJJA 5KN1A 1TK8B 2X4AA 1QGVA 2AYTA 5INYA 3G7IA 1TRWA 2I3YA 1TXUA 2WCIA 4MJEA 3HYPA 1C72A 2C3TA 5G1LA 2K8SA 2L57A 2B7JA 3HJPA 2C4JA 4LLRA 4ZL9A 2LQOA 3GTUA 2DJ1A 1DSBA 4LL1B 1ERUA 4MJBA 4OO4A 5FHIA 3UVTA 4NWYA 2LNTA 3LYPA 3FY7A 2LRNA 3DVXA 2JACA 5ECNB 4NAXA 3TGZA 2X64A 2XC2A 2I81A 11GSA 1JFUA 6GSWA 3KTLA 1T8EB 2O5VA 2EIQA 6GSVA 2OE1A 3FR6A 13GSA 3WD6A 1XCCA 3ZREA 3D0ZA 3E3EA 3UOMA 4BWQA 3TUEA 3DEXA 3QR6A 4JBBA 4IN0A 5ECRB 1TDIA 5IO2A 3IXRA 2O89A 2XPEA 3EE2A 3M8NA 3GIXA 1TU7A 5AIVA 3LW9A 3GRXA 5ELAA 1ZCPA 4IELA 3RDWA 3W8SA 1Z7RA 4OCEA 2UV8G 1MDJA 3RPNA 2P5QA 4ZB8A 3DVWA 2V6OA 2GQMA 1N2AA 1F9MA 5ECPB 4JR4A 4ZILA 2L6CA 1B4QA 2KUCA 2KOKA 4ACSA 4MJCA 1ZL9A 4O5QA 4TR4A 3ZIVA 1ZYEA 2VM2A 3F4TA 1B4PA 1DUGA 2FWHA 4AF2A 4WKWA 3CSHA 1ZYQB 2RUEA 1SENA 1FAAA 3HZ8A 1T3BA 4F9ZA 2I9HA 1WWJA 2DC5A 2CZ3A 2WRTA 1FB6A 1WRYA 1Z9HA 4YH2A 2LNSA 5C00A 4JE1A 2H1BA 3PINA 1YZXA 1K0MA 4ML1A 1PX6A 3KD0A 1GSSA 4I97A 5A4WA 1OVNA 4FYUA 5BMUB 1O73A 4RQRA 3FZ9A 2LQQA 2O7KA 1THXA 1PL2A 4BL7B 5HR0A 4G2EA 3G7JA 1WMJA 4AKHA 1J9BA 3VK9A 2H6YA 1T7PB 3O3TA 1V57A 4PX1A 5F0GA 1R5PA 1GSYA 3OR5A 4K0GA 1KTEA 2DJ2A 1H75A 1X5CA 1LBKA 3FZ4A 5G5FA 1GTIA 4GDFA 1I9DA 5ID2A 1ERWA 3IHQA 5JCGA 2E2GA 1EWXA 1ERVA 3RPPA 4IP1A 2IIYA 5IO0A 3WT2A 3VFIA 1GSEA 1R7HA 3MWHA 1GTUA 4ECCA 3QCPA 1OE8A 3KXOA 4ZB6A 4EC0A 4OO5A 1AQWA 2L4QA 1R5AA 1V58A 2EIOA 2OBIA 1SJ6A 3LWAA 2QGVA 1SKRB 1SVOA 1EEJA 1XWBA 3KM6A 3QFAC 3H1NA 1M9AA 6GSSA 1SU9A 12GSA 1IYHA 2GSSA 2VO4A 2LV3A 3GKKA 2QA1A 5B6NA 2JSYA 5DAKA 1X0RA 5J4VA 1BG1A 1JHBA 4GQFA 1G7OA 3U6VA 2IFQB 2R0CA 4MCUA 1XWAA 2VL3A 2GT5A 3RHCA 2FNOA 1E6BA 4J2FA 3J7Yb 3CSIA 4IS0A 4KAEA 4ZB7A 4DSQA 3UMAA 4YQMA 4HQSA 1V2AA 2UZ8A 4NMUA 2C80A 4KDUA 4N0VA 4RUVA 5HR1A 2QKEA 3N5OA 1UN2A 1I5GA 2P31A 1YF1A 2YWIA 5DALA 2CT6A 4KX4A 2LRCA 4IQ1A 3LFLA 1S3DA 3SWLA 3RBTA 3I9V2 3IK9A 1KBNA 1GSFA 3CSJA 5CO3A 2OKAA 2HQTA 2VCZA 3VI5A 4O5UA 4YQUA 1GNWA 1AIUA 4ML6A 1TRSA 1K0AA 5DVBA 4OFMA 4QMKA 2GVPA 1A2JA 5J47A 2XBQA 4O32A 1M99A 4EUYA 1ON4A 4KCEA 3IA1A 4ZB9A 3MDKA 1K0DA 1TRUA 4Q5FA 1PN0A 2CZ2A 2GTUA 4GSSA 5CP1A 1GTBA 4IHUA 3HD5A 1XIYA 3BJ5A 5IMZA 3H4KA 3WGXA 4KDXA 2IMFA 3LXZA 2F51A 1ML6A 2WB9A 2YZUA 5A1NA 1A8YA 3CWGA 4IW9A 3L9UA 4XRDA 1WPIA 2VD0A 4HJ2A 2K9FA 1H4OA 2YZHA 3IE3A 1ST9A 3CTGA 1GRXA 4CDOA 5GZZB 2H66A 4GXZA 2H76A 1U87A 2MMOA 4TN8A 3LQ7A 4E8HA 2NBSA 5J41A 3F63A 1TW9A 1GLQA 3APOA 1O7UA 1HD2A 3K8NA 3ZFLA 1OE7A 4GCIA 2LS5A 1SK2A 2FHEA 2VLTA 4L5LA 4V2MA 3IHGA 4BVXB 3U5RE 5HR3A 3KJYA 4OD7A 1FB0A 2B7KA 17GSA 4Z7XA 3EURA 2OADA 5ECIB 2H1DA 2VL2C 4J56E 5G30A 4KDYA 3ME7A 3LORA 5ELGA 2VIMA 4YKFA 3VWWA 4X1UA 5D96A 1JZDA 2B1LA 1FO5A 5D93A 1K0OA 2VL2A 4O5RA 1M2AA 2HRKA 2EFEA 4YQVA 2YP6A 4XTSA 1SK1A 1YDKA 2B3SA 3UBKA 1GUMA 1MD3A 2WZ9A 3IAS2 1OAZA 3W8JA 4TRXA 3F4RA 1R4WA 3WGDA 2LJRA 2NDOA 3GX8A 4K0NA 3DYRA 2GDRA 5HR2A 19GSA 1X9MB 1N25A 3UARA 3IC8A 1XZOA 5IPHA 4I6XA 1GUHA 4WBJA 2XPDA 2R5GA 2O8VB 3DKSA 2PWJA 4W66A 2V6KA 3TRXA 3IR4A 3TKSA 2H1LA 2MYGA 3ZTLA 1O8XA 4D73B 3IK7A 3LXTA 1XXUA 3HHVA 4GSNA 3LJRA 2H01A 4HS1A 5DQYA 4WF5A 4F03A 5IMDA 5LNKe 4NHWA 2HT9A 4CW9A 2WGRA 3RHBA 1A0RP 4O92A 1SD9A 5AN1A 2IWTA 4BA7A 3RAZA 2IMDA 2X99A 2H8LA 1URMA 3IC4A 1O81A 5A5HB 2ZUPA 2EC4A 1SJZA 3Q18A 3UBLA 5JCWA 1VGLA 2HSNB 1PRXA 3APSA 2DIZA 4MF5A 1IYIA 1NW2A 4ZBDA 3P2AA 1TTZA 3IAM2 4G10A 1QUWA 2X49A 2XHFA 2HFDA 4V1Ap 5IMFA 4XIHA 1XW6A 1SKWB 2DJKA 3P7XA 4L0WA 1RK4A 3GKXA 4DSSA 1Z6NA 5E59A 1U3AA 2FGXA 3ZIJA 2H1AA 2HNLA 3SBCA 1K3OA 4KB3A 4JR6A 4KW6A 3WYWA 3ED3A 4BWSA 1G7EA 1WIKA 1ZOFA 2MMAA 4PXOA 3VWVA 3HY2A 3MNGA 2VLVA 1FVJA 4TXVA 4PNGA 20GSA 1OC8A 3ZVJA 1XVQA 4HOJA 3IRAA 3GTUB 2HLSA 2HZEA 4F82A 2R37A 3N9JA 2FA4A 2G0FA 4P3YB 2DMMA 3BBYA 4POKA 1QFNA 3MAKA 5H5SA 3QOUA 5KN2A 3EWLA 3VPTA 3MIXA 5KN0A 4O7HA 2RM5A 4ZBBA 2C1YA 3KTBA 4POBA 2H71A 5DDLA 4HQZA 1GUKA 1A2LA 3GKNA 3LGCA 1EV4A 2B6MA 5CAXA 4Q5QA 2NPBA 3JCML 3A2WA 2JZRA 3BCKA 3BOAA 3TJKA 3GFKA 1Z7PA 3FEUA 3H93A 2V2GA 4L0UA 1PMTA 2HRAA 4OMVA 4Q5NA 2X8HA 4MZCA 5CREA 2DKHA 5FWGA 1M9BA 2EIRA 5A34A 2V32A 4NV5A 2IPAA 4Q5RA 2NVLA 4N30A 3ZLPA 3HKRA 4YKGA 2H73A 4MDCA 3TRQA 4N3ZA 2DJ3A 1SL0B 1O8WA 1VRSD 4FIWA 5D9TA 2F8FA 4TKYA 1ILOA 2R6KA 4FH8A 2DSAA 1BYEA 1SYRA 1A8LA 3KIJA 2RIIA 3IBHA 4MABA 1SK0A 3KEBA 1BJXA 3KMOA 5D9VA 3I6AA 3DD3A 4HJMA 5C04A 2R0GA 4IJIA 3FHKA 2E7PA 1G6YA 3QFBC 5HFIA 5J9BA 1FOHA 4K2DA 4CY8A 2EFDA 2YJ7A 3ZL5A 2P5RA 5F06A 2V41A 1Y1UA 4OFTA 5G31A 5IMAA 14GSA 2HE3A 4G0LA 4GF0A 4MLYA 4ISDA 4DEJA 3C71A 2PMTA 2LSTA 5G5EA 1EP8A 2CVKA 2DLXA 1X5EA 2A4VA 1PN9A 3EYTA 1F3AA 1ABAA 4EF0A 3GURA 9GSSA 3WGEA 3HA9A 1NSWA 2WJUA 1GH2A 4K6XA 5ID2B 2HI7A 3HVVA 3HJMA 3TRPA 1XFLA 3R3EA 3TKPA 2FD3A 2PERA 5IOXA 4MPFA 2RUFA 2JU5A 2N5FA 5IQYA 5JWRB 2PVOC 2GSRA 1M2DA 2FLSA 4KGIA 5F05A 5IPGA 3J7Yk 4KUNA 1XPVA 5CRWA 3ZMLA 2FCHA 2M46A 1YVLA 3IPZA 3UVHA 3FZ5A 4KF9A 2C0FA 4X0XA 3TJGA 1A24A 2GS3A 4MZWA 3D5JA 1TI3A 1ZMAA 3TOTA 3TDGA 2YPMA 4KE3A 5HQPA 4PUAA 3TB2A 1KEBA 1W89A 1VF2A 1EOGA 3Q6OA 5DAKB 4XS4A 5IM9A 1TJDA 3GA4A 5HFGA 2K18A 4AJ8A 2ON5A 2IMIA 2CAQA 4IBPA 2C3NA 2OBKA 2OE0A 3VWUA 3W6GA 4PGTA 1Y6EA 2IMEA 3US3A 3HJOA 4F0BA 2YWMA 16GSA 3EMXA 3DMLA 4F0CA 1JZWA 4TR1A 1FG4A 5AISA 1AW9A 3TKQA 8GSSA 2F8AA 2E0QA 2KLXA 1JLWA 3M1GA 2AUVA 2XBIA 3HXSA 1EEMA 3H8QA 1HNAA 4ZXGA 5BRTA 5CYYA 2AHEA 1U88A 5DALB 1ACVA 5ECLB 3F0IA 1A0FA 1K0BA 1ZYPA 1XWGA 3NZNA 4GSTA 2L59A 1F3BA 3GUSA 4ECBA 1JZOA 2CX3A 3HCZA 3ZMKA 4RQXA 5AGYA 1R26A 5B6MA 4QL7A 4POLA 1SD8A 2ZCTA 3A2XA 1F37A 1YJ6A 2P0GA 2QSIA 2OT3A 4AGSA 3CXGA 3LG6A 4OFNA 3FR3A 4HI7A 3G9BA 1MD4A 1FHEA 2LKUA 4X43A 3FR9A 3WT1A 2L4CA 4EDZA 3D21A 5D8IA 2PN8A 4XS6A 1FVKA 2FA8A 2JSZA 4EL1A 1FOVA 4XRAA 1GP1A 5E4WA 4G0KA 1NM3A 2CV4A 1T4YA 5GSTA 5ABRA 3LYKA 2FUG2 3UIWA 5A1NB 2H30A 3A5WA 3EMPA 4HUAA 2VUPA 3APQA 1F2EA 2YCDA 4GLTA 2TIRA 2H1GA 1PA3A 1BX9A 1WP0A 1TXXA 1NHOA 2H0HA 3TKSE 3NOFA 2REMA 4KNDA 1J08A 1U3IA 1SL2B 2PVQA 3IOSA 2MMZA 4POMA 1SVMA 1MTCA 4A5PA 5CRGA 1PD21 5D9WA 3GKMA 2HSHA 5H5RA 2C0DA 1Q4JA 3FRCA 3QPMA 6GSTA 5DJLA 2DJ0A 4KH7A 3DXBA 3GH6A 4I2UA 1BAYA 4PQIA 3LSZA 5IMVA 5F8BA 1QK8A 1UC7A 4WR4A 4V1Ag 2R4VA 18GSA 2VAFA 1U6TA 5EY6A 2DIYA 4GRFA 5KEJA 2WFCA 4L5OA 1OKDA 1OC9A 3CMIA 5IMCA 4OWYA 1CQGA 4JRRA 1MDKA 3FYGA 1XWCA 4IJ3A 2MBTA 3GH9A 3CBUA 5IOWA 1XVWA 4I2TA 2IMKA 3PR8A 2HRKB 2H0IA 4JU5A 2A2RA 4KA0A 2YV7A 1T4ZA 4H86A 4IKHA 2VD1A 4MP4A 3ME8A 4RI7A 4TXOA 2IJYA 3D6IA 2CX4A 2O87A 4EVMA 4YAVA 1TKDB 1GL8A 4LA1A 1G0TA 2R3XA 2HSMA 2NTOA 1GSUA 3DGQA 2CVBA 2G2QA 6GSXA 4MJAA 3A5IA 3EINA 3BD2A 3UL3A 4LMVA 1B48A 3ZVJD 3ISOA 5CRHA 4G9HA 3TKRA 4MH2A 4WXTA 4ZL7A 5B8BA 4K7IA 5EVOA 3F3QA 2AB6A 4AKXB 3ZYWA 2PBJA 2VKZG 2VL9A 1MEKA 5JCUA 1OKTA 1THOA 2E2MA 1QMVA 3Q19A 2B5YA 4K5RA 3IDVA 2RLIA 3CYNA 3M3MA 4E68A 1RW1A 4NHZA 1QXHA 6GSYA 1AUCA 1PKWA 3F8UA 4EO3A 1GLPA 1TU8A 1QQ2A 4OCFA 2CQ9A 3KZQA 5A5KA 4BVYA 2C0GA 1AC1A 2X8CA 5JWQB 5A4VA 2KP2A 4DVCA 2YJHA 1SL1B 4MMMA 4EKZA 3L9VA 1UVZA 3GL5A 3KCMA 4DSSB 1SKSB 4V2LA 5J3RA 4FYCA 4TW5A 2L6DA 3HMJG 1GSDA 1K3LA 4TOPA 1Z6MA 3UJ1A 4EIQA 3TCOA 2N5AA 4Z2TA 4MK3A 4K7OA 2YN1A 3TOUA 4RI6A 2O85A 4K9ZA 1SVLA 2DMLA 3DWVA 1Z5YE 5KOXA 4TR3A 1N8JA 2IL3A 1X5DA 5J4YA 1USBA 2HZEB 1Q98A 3S9FA 5HFKA 3QMXA 3A2VA 1SJIA 1M0UA 4K7NA 3V1WA 1V40A 1YEXA 4BPYA 1OC3A 5B7CA 2I4AA 4MH3A 4N11A 4DSRA 1XOBA 1M7TA 3D4TA 2HSYA 1Z3EA 2F9SA 1TK5B 2FWGA 2H6ZA 1UA5A 5B8AA 3KGKA 1YF0A 1JZRA 3ERWA 1YKAA 2V1MA 5EPFA 2ES7A 3P8WA 3E0UA 3HVSA 1PGTA 3DRNA 4K8MA 2VLUA 2WULA 3GSTA 2AJQB 2R0PA 5G2ZA 1V9WA 3HVXA 2KP1A 1OYJA 3C73A 4TVEA 3TJJA 2R2JA 5A34B 4K1FA 4N10A 3FKFA 2ALBA 2GZZA 4HU7A 4ULXA 2HXKA 1W4VA 5D9XA 1TI1A 3NIVA 5JWOB 2L5LA 4K2XA 1CQHA 2A2SA 3EPTA 3QDNA 5DCGA 2TRCP 4EDYA 2EFHA 2GZPA 2GQLA 3H79A 2K8VA 2B1KA 3C7MA 3GYKA 2H74A 2OJLA 3PPUA 5IIZA 1EGOA 2CAIA 4YAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9J B;  1EZK A;  1K3Y A;  5L71 A;  3QAV A;  1RQM A;  3AY8 A;  10GS A;  2B5X A;  3M0F A;  2X8G A;  3I69 A;  3EC3 A;  2TRX A;  5FT3 A;  3GMF A;  1G6W A;  4ECJ A;  5G1K A;  3IV4 A;  2JAD A;  1DE2 A;  1J0F A;  4IVF A;  1XW5 A;  2VM1 A;  2GLR A;  4GTU A;  5BMU A;  2GST A;  4CHS A;  4EE0 A;  3D22 A;  1BQ7 A;  4BL7 A;  1O6J A;  3I43 A;  5GSS A;  5ECH B;  4IP6 A;  4LL4 B;  2MZC A;  3ERF A;  4HZ2 A;  2M72 A;  3F6F A;  3ZIT A;  3D4M A;  4KCA A;  1TRV A;  2YV9 A;  4MZB A;  4FQU A;  2OA7 A;  4EXJ A;  3L4N A;  5KN3 A;  5ECM B;  3EVI A;  2HYX A;  1ZGN A;  2JZS A;  1DE1 A;  2WS2 A;  4PQH A;  3L9S A;  5CRD A;  1HNB A;  4N0Z A;  2H0G A;  5ECQ B;  4JZQ A;  2JZT A;  3BCI A;  4QL9 A;  4I5Q A;  4G19 A;  1A2M A;  1X9W B;  4HU9 A;  1LU4 A;  4MPG A;  3ZRD A;  1FW1 A;  1T1V A;  3UEM A;  5ENU A;  1ZZY A;  2RM6 A;  5AIX A;  4MA9 A;  3C1S A;  2IN3 A;  2AAW A;  1PL1 A;  3F4S A;  2GSQ A;  4USS A;  3F9U A;  1HNC A;  1XW9 A;  4G0I A;  1WE0 A;  2PU9 C;  1VF3 A;  5F07 A;  4KSO A;  1M2B A;  4WBR D;  4XS4 B;  1LJR A;  3A3T A;  2YWO A;  2IFQ A;  4WR5 A;  1AQX A;  1JLV A;  2J23 A;  3KMN A;  1VF1 A;  3FK8 A;  1E2Y A;  1WOU A;  3PGT A;  2K6V A;  4TR1 B;  5LD0 A;  1MDI A;  1EP7 A;  3GNJ A;  3LEF A;  4WEY A;  3EU4 A;  1VF4 A;  2CA8 A;  4LMW A;  1Y25 A;  3L78 A;  4L8E A;  2H6X A;  4KSM A;  2BJX A;  3ZZX A;  4XCS A;  2C8U A;  3M9J A;  1GTA A;  1XBS A;  2PUK C;  4QQ7 A;  2LJA A;  4PNF A;  4PUR A;  2FWE A;  4NPB A;  2Z9S A;  3HZ4 A;  2HRF A;  1B9Y C;  4ID0 A;  4ILF A;  5J5N A;  2LEG A;  1V98 A;  2ZNM A;  2QC7 A;  2YNX A;  2B5E A;  2L5O A;  4ZL8 A;  3F3R A;  1A23 A;  3GHA A;  2OAC A;  2D2Z A;  2BTO T;  3GV1 A;  4MF7 A;  1S3A A;  2C3Q A;  2DBC A;  2FWF A;  2VCQ A;  5DCH A;  5J9C A;  1B8X A;  2CVD A;  2GGT A;  3VUR A;  2MBS A;  1AQV A;  4ECI A;  2M80 A;  5A4U A;  4PTS A;  3F6D A;  3QD9 A;  1T00 A;  2I1U A;  1PQN A;  2VCW A;  3VPQ A;  3C1R A;  1KNG A;  3O6T A;  4JED A;  4HZ4 A;  2GT6 A;  2H19 A;  5DQS A;  2H72 A;  2J9H A;  4WET A;  1YEP A;  1O85 A;  6GSU A;  2VCT A;  4PQ1 A;  3UAP A;  1PSQ A;  4XS1 A;  3GL3 A;  2FY6 A;  3GX0 A;  2MMN A;  1YY7 A;  2GQK A;  5ECK B;  2YOI A;  5D73 A;  5DBQ A;  2VCV A;  2KHP A;  1AAZ A;  3VWX A;  1NHY A;  1X9S B;  1K0C A;  5LCZ A;  4I8B A;  2C0E A;  3VLN A;  4BVX A;  3HDC A;  1YQ1 A;  2YWN A;  3QAW A;  3TJB A;  4XHM A;  3CRT A;  2F3M A;  3C8E A;  4MF6 A;  4FO5 A;  3CRU A;  4V2N A;  4TR0 A;  3CTF A;  4FYB A;  1BG5 A;  1OC9 B;  3ERG A;  3PH9 A;  1YKC A;  5ECS A;  4PUF C;  3KP8 A;  3Q74 A;  3G7Y A;  1EGR A;  2WDU A;  4AJ6 A;  1HYU A;  3O76 A;  5GAP D;  1TP9 A;  3MSZ A;  1EV9 A;  2BMX A;  1GSQ A;  4TXO B;  1XOA A;  1PX7 A;  3QAG A;  3P90 A;  2HRN A;  2HZF A;  2PPT A;  2AV4 A;  2LRT A;  2H70 A;  4F2I A;  3GSS A;  1SYX A;  2HSM B;  1GUL A;  1B9X C;  3TJF A;  2VCX A;  4J57 E;  1GNE A;  1EOH A;  3TKS C;  4IQA A;  5DJM A;  4GWR A;  2LJK A;  5GAN D;  4ZBA A;  3KH7 A;  1XWK A;  5EL8 A;  1TK0 B;  22GS A;  3FW2 A;  1ERT A;  3M9K A;  3KP9 A;  1PKZ A;  2PGT A;  4D73 A;  1HQO A;  3KH9 A;  5J4U A;  3FZA A;  1AXD A;  4NXI A;  2N5B A;  3DIE A;  4WF4 A;  4HDE A;  3GN3 A;  2LUS A;  1F6M C;  4NV2 A;  4IGJ A;  1DBY A;  2JL4 A;  4HEA 2;  2YAN A;  1BED A;  1WJK A;  5CNW A;  5H5Q A;  2LTK A;  3L0H A;  7GSS A;  1S3C A;  2OE3 A;  3EU3 A;  2VOC A;  1K0N A;  2ON7 A;  4BVY B;  5ECO B;  4AJ7 A;  4E8E A;  4GQC A;  1TOF A;  2H75 A;  5COH A;  3ZFB A;  3VI7 A;  4ZIJ A;  2GZY A;  1GWC A;  3R2Q A;  2DJJ A;  5KN1 A;  1TK8 B;  1QGV A;  2AYT A;  5INY A;  3G7I A;  1TRW A;  2I3Y A;  2WCI A;  4MJE A;  3HYP A;  1C72 A;  2C3T A;  5G1L A;  2K8S A;  2L57 A;  2B7J A;  3HJP A;  2C4J A;  4LLR A;  4ZL9 A;  2LQO A;  3GTU A;  2DJ1 A;  1DSB A;  4LL1 B;  1ERU A;  4MJB A;  4OO4 A;  5FHI A;  3UVT A;  4NWY A;  2LNT A;  3LYP A;  3FY7 A;  2LRN A;  3DVX A;  2JAC A;  5ECN B;  4NAX A;  3TGZ A;  2X64 A;  2XC2 A;  2I81 A;  11GS A;  1JFU A;  6GSW A;  3KTL A;  1T8E B;  2EIQ A;  6GSV A;  2OE1 A;  3FR6 A;  13GS A;  3WD6 A;  1XCC A;  3ZRE A;  3D0Z A;  3E3E A;  3UOM A;  4BWQ A;  3TUE A;  3DEX A;  3QR6 A;  4JBB A;  4IN0 A;  5ECR B;  1TDI A;  5IO2 A;  3IXR A;  2O89 A;  2XPE A;  3EE2 A;  3M8N A;  3GIX A;  1TU7 A;  5AIV A;  3GRX A;  5ELA A;  1ZCP A;  4IEL A;  3RDW A;  3W8S A;  1Z7R A;  4OCE A;  1MDJ A;  3RPN A;  2P5Q A;  4ZB8 A;  3DVW A;  2V6O A;  2GQM A;  1N2A A;  1F9M A;  5ECP B;  4JR4 A;  4ZIL A;  2L6C A;  1B4Q A;  2KUC A;  2KOK A;  4ACS A;  4MJC A;  1ZL9 A;  4TR4 A;  3ZIV A;  1ZYE A;  2VM2 A;  3F4T A;  1B4P A;  1DUG A;  2FWH A;  4AF2 A;  4WKW A;  3CSH A;  1ZYQ B;  2RUE A;  1SEN A;  1FAA A;  3HZ8 A;  1T3B A;  4F9Z A;  2I9H A;  1WWJ A;  2DC5 A;  2CZ3 A;  2WRT A;  1FB6 A;  1WRY A;  1Z9H A;  4YH2 A;  2LNS A;  5C00 A;  4JE1 A;  2H1B A;  3PIN A;  1YZX A;  1K0M A;  4ML1 A;  1PX6 A;  3KD0 A;  1GSS A;  4I97 A;  5A4W A;  1OVN A;  4FYU A;  1O73 A;  4RQR A;  3FZ9 A;  2LQQ A;  2O7K A;  1THX A;  1PL2 A;  4BL7 B;  5HR0 A;  4G2E A;  3G7J A;  1WMJ A;  1J9B A;  3VK9 A;  2H6Y A;  1T7P B;  3O3T A;  1V57 A;  4PX1 A;  5F0G A;  1R5P A;  1GSY A;  3OR5 A;  4K0G A;  1KTE A;  2DJ2 A;  1H75 A;  1X5C A;  1LBK A;  3FZ4 A;  5G5F A;  1GTI A;  1I9D A;  5ID2 A;  1ERW A;  3IHQ A;  5JCG A;  2E2G A;  1EWX A;  1ERV A;  3RPP A;  4IP1 A;  2IIY A;  5IO0 A;  3WT2 A;  3VFI A;  1GSE A;  1R7H A;  3MWH A;  1GTU A;  4ECC A;  3QCP A;  1OE8 A;  3KXO A;  4ZB6 A;  4EC0 A;  4OO5 A;  1AQW A;  2L4Q A;  1R5A A;  1V58 A;  2EIO A;  2OBI A;  1SJ6 A;  3LWA A;  2QGV A;  1SKR B;  1EEJ A;  1XWB A;  3KM6 A;  3QFA C;  3H1N A;  1M9A A;  6GSS A;  1SU9 A;  12GS A;  1IYH A;  2GSS A;  2VO4 A;  2LV3 A;  3GKK A;  5B6N A;  2JSY A;  5DAK A;  1X0R A;  1JHB A;  4GQF A;  1G7O A;  3U6V A;  2IFQ B;  4MCU A;  1XWA A;  2VL3 A;  2GT5 A;  3RHC A;  2FNO A;  1E6B A;  4J2F A;  3J7Y b;  3CSI A;  4IS0 A;  4KAE A;  4DSQ A;  3UMA A;  4YQM A;  4HQS A;  1V2A A;  2UZ8 A;  4NMU A;  2C80 A;  4KDU A;  4N0V A;  4RUV A;  5HR1 A;  2QKE A;  3N5O A;  1UN2 A;  1I5G A;  2P31 A;  1YF1 A;  2YWI A;  5DAL A;  2CT6 A;  4KX4 A;  2LRC A;  4IQ1 A;  3LFL A;  1S3D A;  3SWL A;  3RBT A;  3I9V 2;  3IK9 A;  1KBN A;  1GSF A;  3CSJ A;  5CO3 A;  2OKA A;  2HQT A;  2VCZ A;  3VI5 A;  4YQU A;  1GNW A;  1AIU A;  4ML6 A;  1TRS A;  1K0A A;  5DVB A;  4OFM A;  2GVP A;  1A2J A;  2XBQ A;  4O32 A;  1M99 A;  4EUY A;  1ON4 A;  4KCE A;  3IA1 A;  4ZB9 A;  3MDK A;  1K0D A;  1TRU A;  4Q5F A;  2CZ2 A;  2GTU A;  4GSS A;  5CP1 A;  1GTB A;  4IHU A;  3HD5 A;  1XIY A;  3BJ5 A;  5IMZ A;  3H4K A;  3WGX A;  4KDX A;  2IMF A;  3LXZ A;  2F51 A;  1ML6 A;  2WB9 A;  2YZU A;  1A8Y A;  4IW9 A;  4XRD A;  3L9U A;  1WPI A;  2VD0 A;  4HJ2 A;  2K9F A;  1H4O A;  2YZH A;  3IE3 A;  1ST9 A;  3CTG A;  1GRX A;  4CDO A;  5GZZ B;  2H66 A;  4GXZ A;  2H76 A;  1U87 A;  2MMO A;  4TN8 A;  3LQ7 A;  4E8H A;  2NBS A;  5J41 A;  3F63 A;  1TW9 A;  1GLQ A;  3APO A;  1O7U A;  1HD2 A;  3K8N A;  3ZFL A;  1OE7 A;  4GCI A;  2LS5 A;  1SK2 A;  2FHE A;  2VLT A;  4L5L A;  4V2M A;  4BVX B;  3U5R E;  5HR3 A;  3KJY A;  4OD7 A;  1FB0 A;  2B7K A;  17GS A;  4Z7X A;  3EUR A;  2OAD A;  5ECI B;  2H1D A;  2VL2 C;  4J56 E;  5G30 A;  4KDY A;  3ME7 A;  3LOR A;  5ELG A;  2VIM A;  3VWW A;  4X1U A;  5D96 A;  1JZD A;  2B1L A;  1FO5 A;  5D93 A;  1K0O A;  2VL2 A;  4O5R A;  1M2A A;  2HRK A;  4YQV A;  2YP6 A;  4XTS A;  1SK1 A;  1YDK A;  2B3S A;  3UBK A;  1GUM A;  1MD3 A;  2WZ9 A;  3IAS 2;  1OAZ A;  3W8J A;  4TRX A;  3F4R A;  1R4W A;  3WGD A;  2LJR A;  2NDO A;  3GX8 A;  4K0N A;  3DYR A;  2GDR A;  5HR2 A;  19GS A;  1X9M B;  3UAR A;  3IC8 A;  1XZO A;  5IPH A;  4I6X A;  1GUH A;  4WBJ A;  2XPD A;  2R5G A;  2O8V B;  3DKS A;  2PWJ A;  2V6K A;  3TRX A;  3IR4 A;  3TKS A;  2MYG A;  3ZTL A;  1O8X A;  4D73 B;  3IK7 A;  3LXT A;  1XXU A;  3HHV A;  4GSN A;  3LJR A;  2H01 A;  4HS1 A;  5DQY A;  4WF5 A;  4F03 A;  5IMD A;  5LNK e;  4NHW A;  2HT9 A;  4CW9 A;  2WGR A;  3RHB A;  1A0R P;  4O92 A;  1SD9 A;  5AN1 A;  2IWT A;  4BA7 A;  3RAZ A;  2IMD A;  2X99 A;  2H8L A;  1URM A;  3IC4 A;  1O81 A;  2ZUP A;  2EC4 A;  1SJZ A;  3Q18 A;  3UBL A;  5JCW A;  1VGL A;  2HSN B;  1PRX A;  3APS A;  2DIZ A;  4MF5 A;  1IYI A;  1NW2 A;  4ZBD A;  3P2A A;  1TTZ A;  3IAM 2;  4G10 A;  1QUW A;  2XHF A;  2HFD A;  4V1A p;  5IMF A;  4XIH A;  1XW6 A;  1SKW B;  2DJK A;  3P7X A;  4L0W A;  1RK4 A;  3GKX A;  4DSS A;  1Z6N A;  5E59 A;  1U3A A;  2FGX A;  3ZIJ A;  2H1A A;  2HNL A;  3SBC A;  1K3O A;  4KB3 A;  4JR6 A;  4KW6 A;  3WYW A;  3ED3 A;  4BWS A;  1G7E A;  1WIK A;  1ZOF A;  2MMA A;  4PXO A;  3VWV A;  3HY2 A;  3MNG A;  2VLV A;  1FVJ A;  4TXV A;  4PNG A;  20GS A;  1OC8 A;  3ZVJ A;  1XVQ A;  4HOJ A;  3IRA A;  3GTU B;  2HLS A;  2HZE A;  4F82 A;  2R37 A;  3N9J A;  2FA4 A;  2G0F A;  4P3Y B;  2DMM A;  3BBY A;  4POK A;  1QFN A;  3MAK A;  5H5S A;  3QOU A;  5KN2 A;  3EWL A;  3VPT A;  5KN0 A;  4O7H A;  2RM5 A;  4ZBB A;  2C1Y A;  3KTB A;  4POB A;  2H71 A;  5DDL A;  4HQZ A;  1GUK A;  1A2L A;  3GKN A;  3LGC A;  1EV4 A;  2B6M A;  5CAX A;  4Q5Q A;  2NPB A;  3JCM L;  3A2W A;  2JZR A;  3BCK A;  3BOA A;  3TJK A;  3GFK A;  1Z7P A;  3FEU A;  3H93 A;  2V2G A;  4L0U A;  1PMT A;  2HRA A;  4OMV A;  4Q5N A;  2X8H A;  4MZC A;  5CRE A;  5FWG A;  1M9B A;  2EIR A;  2V32 A;  4NV5 A;  2IPA A;  4Q5R A;  2NVL A;  4N30 A;  3ZLP A;  3HKR A;  2H73 A;  4MDC A;  3TRQ A;  2DJ3 A;  1SL0 B;  1O8W A;  1VRS D;  4FIW A;  5D9T A;  2F8F A;  4TKY A;  1ILO A;  2R6K A;  4FH8 A;  2DSA A;  1BYE A;  1SYR A;  1A8L A;  3KIJ A;  2RII A;  3IBH A;  4MAB A;  1SK0 A;  3KEB A;  1BJX A;  3KMO A;  5D9V A;  3I6A A;  3DD3 A;  4HJM A;  5C04 A;  4IJI A;  3FHK A;  2E7P A;  1G6Y A;  3QFB C;  5HFI A;  5J9B A;  4K2D A;  2YJ7 A;  3ZL5 A;  2P5R A;  5F06 A;  2V41 A;  4OFT A;  5G31 A;  5IMA A;  14GS A;  2HE3 A;  4G0L A;  4GF0 A;  4MLY A;  4ISD A;  4DEJ A;  3C71 A;  2PMT A;  2LST A;  5G5E A;  1EP8 A;  2CVK A;  2DLX A;  1X5E A;  2A4V A;  1PN9 A;  3EYT A;  1F3A A;  1ABA A;  4EF0 A;  3GUR A;  9GSS A;  3WGE A;  3HA9 A;  1NSW A;  2WJU A;  1GH2 A;  4K6X A;  5ID2 B;  2HI7 A;  3HVV A;  3HJM A;  3TRP A;  1XFL A;  3R3E A;  3TKP A;  2FD3 A;  2PER A;  5IOX A;  4MPF A;  2RUF A;  2JU5 A;  2N5F A;  5IQY A;  5JWR B;  2PVO C;  2GSR A;  1M2D A;  2FLS A;  4KGI A;  5F05 A;  5IPG A;  3J7Y k;  4KUN A;  1XPV A;  5CRW A;  3ZML A;  2FCH A;  2M46 A;  3IPZ A;  3UVH A;  3FZ5 A;  4KF9 A;  2C0F A;  4X0X A;  3TJG A;  1A24 A;  2GS3 A;  4MZW A;  3D5J A;  1TI3 A;  1ZMA A;  3TOT A;  3TDG A;  2YPM A;  4KE3 A;  5HQP A;  4PUA A;  3TB2 A;  1KEB A;  1W89 A;  1VF2 A;  1EOG A;  3Q6O A;  5DAK B;  4XS4 A;  5IM9 A;  1TJD A;  3GA4 A;  5HFG A;  2K18 A;  4AJ8 A;  2ON5 A;  2IMI A;  2CAQ A;  4IBP A;  2C3N A;  2OBK A;  2OE0 A;  3VWU A;  3W6G A;  4PGT A;  1Y6E A;  2IME A;  3US3 A;  3HJO A;  4F0B A;  2YWM A;  16GS A;  3EMX A;  3DML A;  4F0C A;  1JZW A;  4TR1 A;  1FG4 A;  5AIS A;  1AW9 A;  3TKQ A;  8GSS A;  2F8A A;  2E0Q A;  2KLX A;  1JLW A;  3M1G A;  2AUV A;  2XBI A;  3HXS A;  1EEM A;  3H8Q A;  1HNA A;  4ZXG A;  5CYY A;  2AHE A;  1U88 A;  5DAL B;  1ACV A;  5ECL B;  3F0I A;  1A0F A;  1K0B A;  1XWG A;  3NZN A;  4GST A;  2L59 A;  1F3B A;  3GUS A;  4ECB A;  1JZO A;  2CX3 A;  3HCZ A;  3ZMK A;  4RQX A;  5AGY A;  1R26 A;  5B6M A;  4QL7 A;  4POL A;  1SD8 A;  2ZCT A;  3A2X A;  1F37 A;  1YJ6 A;  2P0G A;  2QSI A;  4AGS A;  3CXG A;  3LG6 A;  4OFN A;  3FR3 A;  4HI7 A;  3G9B A;  1MD4 A;  1FHE A;  2LKU A;  4X43 A;  3FR9 A;  3WT1 A;  2L4C A;  4EDZ A;  3D21 A;  5D8I A;  2PN8 A;  4XS6 A;  1FVK A;  2FA8 A;  2JSZ A;  4EL1 A;  1FOV A;  4XRA A;  1GP1 A;  5E4W A;  4G0K A;  1NM3 A;  2CV4 A;  1T4Y A;  5GST A;  5ABR A;  3LYK A;  2FUG 2;  3UIW A;  2H30 A;  3A5W A;  3EMP A;  4HUA A;  2VUP A;  3APQ A;  1F2E A;  2YCD A;  4GLT A;  2TIR A;  2H1G A;  1PA3 A;  1BX9 A;  1WP0 A;  1TXX A;  1NHO A;  2H0H A;  3TKS E;  3NOF A;  2REM A;  4KND A;  1J08 A;  1U3I A;  1SL2 B;  2PVQ A;  3IOS A;  2MMZ A;  4POM A;  1MTC A;  5CRG A;  1PD2 1;  5D9W A;  3GKM A;  2HSH A;  5H5R A;  2C0D A;  1Q4J A;  3FRC A;  3QPM A;  6GST A;  5DJL A;  2DJ0 A;  4KH7 A;  3DXB A;  3GH6 A;  4I2U A;  1BAY A;  4PQI A;  3LSZ A;  5IMV A;  5F8B A;  1QK8 A;  1UC7 A;  4WR4 A;  4V1A g;  2R4V A;  18GS A;  2VAF A;  1U6T A;  5EY6 A;  2DIY A;  4GRF A;  5KEJ A;  2WFC A;  4L5O A;  1OKD A;  1OC9 A;  3CMI A;  5IMC A;  4OWY A;  1CQG A;  4JRR A;  1MDK A;  3FYG A;  1XWC A;  4IJ3 A;  2MBT A;  3GH9 A;  3CBU A;  5IOW A;  1XVW A;  4I2T A;  2IMK A;  3PR8 A;  2HRK B;  2H0I A;  4JU5 A;  2A2R A;  4KA0 A;  2YV7 A;  1T4Z A;  4H86 A;  4IKH A;  2VD1 A;  4MP4 A;  3ME8 A;  4RI7 A;  4TXO A;  2IJY A;  3D6I A;  2CX4 A;  2O87 A;  4EVM A;  4YAV A;  1TKD B;  1GL8 A;  4LA1 A;  1G0T A;  2R3X A;  2HSM A;  2NTO A;  1GSU A;  3DGQ A;  2CVB A;  2G2Q A;  6GSX A;  4MJA A;  3EIN A;  3BD2 A;  3UL3 A;  4LMV A;  1B48 A;  3ZVJ D;  3ISO A;  5CRH A;  4G9H A;  3TKR A;  4MH2 A;  4WXT A;  4ZL7 A;  5B8B A;  4K7I A;  5EVO A;  3F3Q A;  2AB6 A;  3ZYW A;  2PBJ A;  2VL9 A;  1MEK A;  5JCU A;  1OKT A;  1THO A;  2E2M A;  1QMV A;  3Q19 A;  2B5Y A;  3IDV A;  2RLI A;  3CYN A;  3M3M A;  1RW1 A;  4NHZ A;  1QXH A;  6GSY A;  1AUC A;  1PKW A;  3F8U A;  4EO3 A;  1GLP A;  1TU8 A;  1QQ2 A;  4OCF A;  2CQ9 A;  3KZQ A;  5A5K A;  4BVY A;  2C0G A;  1AC1 A;  2X8C A;  5JWQ B;  5A4V A;  2KP2 A;  4DVC A;  2YJH A;  1SL1 B;  4MMM A;  4EKZ A;  3L9V A;  1UVZ A;  3GL5 A;  3KCM A;  4DSS B;  1SKS B;  4V2L A;  5J3R A;  4FYC A;  4TW5 A;  2L6D A;  1GSD A;  1K3L A;  4TOP A;  1Z6M A;  3UJ1 A;  3TCO A;  2N5A A;  4MK3 A;  4K7O A;  2YN1 A;  3TOU A;  4RI6 A;  2O85 A;  4K9Z A;  2DML A;  3DWV A;  1Z5Y E;  4TR3 A;  1N8J A;  2IL3 A;  1X5D A;  1USB A;  2HZE B;  1Q98 A;  3S9F A;  5HFK A;  3QMX A;  3A2V A;  1SJI A;  1M0U A;  4K7N A;  3V1W A;  1V40 A;  1YEX A;  4BPY A;  1OC3 A;  5B7C A;  2I4A A;  4MH3 A;  4N11 A;  4DSR A;  1XOB A;  1M7T A;  3D4T A;  2HSY A;  1Z3E A;  2F9S A;  1TK5 B;  2FWG A;  2H6Z A;  1UA5 A;  5B8A A;  3KGK A;  1YF0 A;  1JZR A;  3ERW A;  1YKA A;  2V1M A;  5EPF A;  2ES7 A;  3P8W A;  3E0U A;  3HVS A;  1PGT A;  3DRN A;  4K8M A;  2VLU A;  2WUL A;  3GST A;  2AJQ B;  5G2Z A;  1V9W A;  3HVX A;  2KP1 A;  1OYJ A;  3C73 A;  4TVE A;  3TJJ A;  2R2J A;  4K1F A;  4N10 A;  3FKF A;  2ALB A;  2GZZ A;  4HU7 A;  4ULX A;  2HXK A;  1W4V A;  5D9X A;  1TI1 A;  3NIV A;  5JWO B;  2L5L A;  1CQH A;  2A2S A;  3QDN A;  5DCG A;  2TRC P;  4EDY A;  2GZP A;  2GQL A;  3H79 A;  2K8V A;  2B1K A;  3C7M A;  3GYK A;  2H74 A;  2OJL A;  3PPU A;  5IIZ A;  1EGO A;  2CAI A;  4YAP A; 
#chains in the Genus database with same CATH topology
 3E9J B;  1EZK A;  1K3Y A;  5L71 A;  3QAV A;  1RQM A;  4EIP A;  3AY8 A;  10GS A;  2B5X A;  3M0F A;  2X8G A;  3I69 A;  3EC3 A;  2TRX A;  5FT3 A;  3GMF A;  1G6W A;  4ECJ A;  5G1K A;  3IV4 A;  2JAD A;  1DE2 A;  1J0F A;  4IVF A;  2WVX A;  1XW5 A;  2VM1 A;  2GLR A;  4GTU A;  5BMU A;  2GST A;  4MNN A;  4CHS A;  4EE0 A;  3D22 A;  1BQ7 A;  2O3E A;  4BL7 A;  1O6J A;  3I43 A;  5GSS A;  5ECH B;  4IP6 A;  4LL4 B;  2MZC A;  3ERF A;  4HZ2 A;  2M72 A;  3F6F A;  4ICY A;  3ZIT A;  3D4M A;  4KCA A;  1TRV A;  2YV9 A;  4MZB A;  4FQU A;  2OA7 A;  4EXJ A;  3L4N A;  2A4H A;  1ZYN A;  5KN3 A;  5ECM B;  3TU3 B;  3EVI A;  2HYX A;  1ZGN A;  2JZS A;  1DE1 A;  2WS2 A;  4PQH A;  3L9S A;  5CRD A;  1HNB A;  4N0Z A;  2H0G A;  5ECQ B;  4JZQ A;  2JZT A;  3BCI A;  4QL9 A;  4I5Q A;  4G19 A;  1A2M A;  1X9W B;  4HU9 A;  1LU4 A;  4MPG A;  3ZRD A;  1FW1 A;  4AKG A;  1T1V A;  3UEM A;  5ENU A;  1ZZY A;  2RM6 A;  5AIX A;  4MA9 A;  3C1S A;  2IN3 A;  2AAW A;  1PL1 A;  3F4S A;  2GSQ A;  4USS A;  4Z2R A;  3F9U A;  1HNC A;  1XW9 A;  4G0I A;  1WE0 A;  2PU9 C;  1VF3 A;  5F07 A;  4KSO A;  1M2B A;  4WBR D;  4XS4 B;  1LJR A;  3A3T A;  2YWO A;  2IFQ A;  4WR5 A;  1AQX A;  1JLV A;  2J23 A;  3KMN A;  2O36 A;  1VF1 A;  3FK8 A;  1E2Y A;  1WOU A;  3PGT A;  2K6V A;  4TR1 B;  5LD0 A;  1MDI A;  1EP7 A;  3GNJ A;  3LEF A;  4WEY A;  3EU4 A;  1VF4 A;  2CA8 A;  4LMW A;  1Y25 A;  3L78 A;  4L8E A;  2H6X A;  4KSM A;  2BJX A;  3ZZX A;  4CY6 A;  4XCS A;  2C8U A;  2A2P A;  3M9J A;  1GTA A;  1XBS A;  2PUK C;  4QQ7 A;  2LJA A;  4PNF A;  4PUR A;  4Z2U A;  2FWE A;  4NPB A;  2Z9S A;  3HZ4 A;  2HRF A;  1B9Y C;  4ID0 A;  3MYD A;  4ILF A;  5J5N A;  2LEG A;  1V98 A;  4AI6 A;  2ZNM A;  2QC7 A;  2YNX A;  2B5E A;  2L5O A;  4ZL8 A;  3F3R A;  1A23 A;  3GHA A;  2OAC A;  2D2Z A;  2BTO T;  3GV1 A;  4MF7 A;  1S3A A;  2C3Q A;  2QA2 A;  2DBC A;  2FWF A;  2VCQ A;  5DCH A;  3FMW A;  5J9C A;  1B8X A;  2CVD A;  2GGT A;  3VUR A;  2MBS A;  1AQV A;  4ECI A;  2M80 A;  2WW0 A;  5A4U A;  4PTS A;  3F6D A;  3QD9 A;  4K5S A;  1T00 A;  2I1U A;  1PQN A;  5J40 A;  2VCW A;  3VPQ A;  3C1R A;  1KNG A;  3O6T A;  4JED A;  4HZ4 A;  2GT6 A;  2H19 A;  5DQS A;  2H72 A;  2J9H A;  4WET A;  1YEP A;  1O85 A;  6GSU A;  2VCT A;  4PQ1 A;  3UAP A;  1PSQ A;  4BIK A;  4XS1 A;  3GL3 A;  2FY6 A;  3GX0 A;  2MMN A;  1YY7 A;  2GQK A;  5ECK B;  2YOI A;  5D73 A;  5DBQ A;  2VCV A;  2KHP A;  1AAZ A;  3VWX A;  1NHY A;  4X4J A;  1X9S B;  1K0C A;  5LCZ A;  4I8B A;  2C0E A;  3VLN A;  4BVX A;  3HDC A;  1YQ1 A;  2DKI A;  2YWN A;  4AKI A;  3QAW A;  3TJB A;  4XHM A;  3CRT A;  2F3M A;  3C8E A;  4MF6 A;  4FO5 A;  3CRU A;  4V2N A;  4TR0 A;  3CTF A;  4FYB A;  1BG5 A;  1OC9 B;  3ERG A;  3PH9 A;  1YKC A;  5ECS A;  4PUF C;  3Q74 A;  3KP8 A;  3G7Y A;  1EGR A;  2WDU A;  4AJ6 A;  1HYU A;  3O76 A;  5GAP D;  1TP9 A;  3MSZ A;  1EV9 A;  2BMX A;  3CQF A;  1GSQ A;  4TXO B;  1XOA A;  1PX7 A;  3QAG A;  3P90 A;  2HRN A;  2HZF A;  2PPT A;  2AV4 A;  5KOW A;  2LRT A;  2H70 A;  4F2I A;  3GSS A;  1SYX A;  2HSM B;  1GUL A;  1B9X C;  3TJF A;  2VCX A;  4J57 E;  1GNE A;  1EOH A;  3TKS C;  4IQA A;  5DJM A;  4GWR A;  2LJK A;  5GAN D;  4ZBA A;  3KH7 A;  1XWK A;  5EL8 A;  1TK0 B;  22GS A;  3FW2 A;  1ERT A;  3M9K A;  3KP9 A;  1PKZ A;  2PGT A;  4D73 A;  1HQO A;  1BF5 A;  3KH9 A;  5J4U A;  3FZA A;  1AXD A;  4NXI A;  2N5B A;  3DIE A;  4WF4 A;  4PI0 C;  2EFC A;  4HDE A;  4G01 A;  2LUS A;  3GN3 A;  1F6M C;  4NV2 A;  4IGJ A;  1DBY A;  2JL4 A;  4HEA 2;  2YAN A;  1BED A;  5A5H A;  1WJK A;  5CNW A;  5H5Q A;  2LTK A;  2WW1 A;  2WW2 A;  3L0H A;  7GSS A;  1S3C A;  2HSN A;  3EU3 A;  2OE3 A;  2VOC A;  1K0N A;  2ON7 A;  4BVY B;  5ECO B;  4AJ7 A;  4E8E A;  4GQC A;  1TOF A;  2H75 A;  5COH A;  3ZFB A;  3VI7 A;  4ZIJ A;  2GZY A;  1GWC A;  3R2Q A;  2DJJ A;  5KN1 A;  1TK8 B;  2X4A A;  1QGV A;  2AYT A;  5INY A;  3G7I A;  1TRW A;  2I3Y A;  1TXU A;  2WCI A;  4MJE A;  3HYP A;  1C72 A;  2C3T A;  5G1L A;  2K8S A;  2L57 A;  2B7J A;  3HJP A;  2C4J A;  4LLR A;  4ZL9 A;  2LQO A;  3GTU A;  2DJ1 A;  1DSB A;  4LL1 B;  1ERU A;  4MJB A;  4OO4 A;  5FHI A;  3UVT A;  4NWY A;  2LNT A;  3LYP A;  3FY7 A;  2LRN A;  3DVX A;  2JAC A;  5ECN B;  4NAX A;  3TGZ A;  2X64 A;  2XC2 A;  2I81 A;  11GS A;  1JFU A;  6GSW A;  3KTL A;  1T8E B;  2O5V A;  2EIQ A;  6GSV A;  2OE1 A;  3FR6 A;  13GS A;  3WD6 A;  1XCC A;  3ZRE A;  3D0Z A;  3E3E A;  3UOM A;  4BWQ A;  3TUE A;  3DEX A;  3QR6 A;  4JBB A;  4IN0 A;  5ECR B;  1TDI A;  5IO2 A;  3IXR A;  2O89 A;  2XPE A;  3EE2 A;  3M8N A;  3GIX A;  1TU7 A;  5AIV A;  3LW9 A;  3GRX A;  5ELA A;  1ZCP A;  4IEL A;  3RDW A;  3W8S A;  1Z7R A;  4OCE A;  2UV8 G;  1MDJ A;  3RPN A;  2P5Q A;  4ZB8 A;  3DVW A;  2V6O A;  2GQM A;  1N2A A;  1F9M A;  5ECP B;  4JR4 A;  4ZIL A;  2L6C A;  1B4Q A;  2KUC A;  2KOK A;  4ACS A;  4MJC A;  1ZL9 A;  4O5Q A;  4TR4 A;  3ZIV A;  1ZYE A;  2VM2 A;  3F4T A;  1B4P A;  1DUG A;  2FWH A;  4AF2 A;  4WKW A;  3CSH A;  1ZYQ B;  2RUE A;  1SEN A;  1FAA A;  3HZ8 A;  1T3B A;  4F9Z A;  2I9H A;  1WWJ A;  2DC5 A;  2CZ3 A;  2WW3 A;  1M3I A;  2WRT A;  1FB6 A;  1WRY A;  1Z9H A;  4YH2 A;  2LNS A;  5C00 A;  4JE1 A;  2H1B A;  3PIN A;  2WVX B;  1YZX A;  1K0M A;  4ML1 A;  1PX6 A;  3KD0 A;  1GSS A;  4I97 A;  5A4W A;  1OVN A;  4FYU A;  5BMU B;  1O73 A;  4RQR A;  3FZ9 A;  2LQQ A;  2O7K A;  1THX A;  1PL2 A;  4BL7 B;  5HR0 A;  4G2E A;  3G7J A;  1WMJ A;  4AKH A;  1J9B A;  3VK9 A;  2H6Y A;  1T7P B;  3O3T A;  1V57 A;  4PX1 A;  5F0G A;  1R5P A;  1GSY A;  3OR5 A;  4K0G A;  1KTE A;  2DJ2 A;  1H75 A;  1X5C A;  1LBK A;  3FZ4 A;  5G5F A;  1GTI A;  4GDF A;  1I9D A;  5ID2 A;  1ERW A;  3IHQ A;  5JCG A;  2E2G A;  1EWX A;  1ERV A;  3RPP A;  4IP1 A;  2IIY A;  5IO0 A;  3WT2 A;  3VFI A;  1GSE A;  1R7H A;  3MWH A;  1GTU A;  4ECC A;  3QCP A;  1OE8 A;  3KXO A;  4ZB6 A;  4EC0 A;  4OO5 A;  1AQW A;  2L4Q A;  1R5A A;  1V58 A;  2EIO A;  2OBI A;  1SJ6 A;  3LWA A;  2QGV A;  1SKR B;  1SVO A;  1EEJ A;  1XWB A;  3KM6 A;  3QFA C;  3H1N A;  1M9A A;  6GSS A;  1SU9 A;  12GS A;  1IYH A;  2GSS A;  2VO4 A;  2LV3 A;  3GKK A;  2QA1 A;  5B6N A;  2JSY A;  5DAK A;  1X0R A;  5J4V A;  1BG1 A;  1JHB A;  4GQF A;  1G7O A;  3U6V A;  2IFQ B;  2R0C A;  4MCU A;  1XWA A;  2VL3 A;  2GT5 A;  3RHC A;  2FNO A;  1E6B A;  4J2F A;  3J7Y b;  3CSI A;  4IS0 A;  4KAE A;  4ZB7 A;  4DSQ A;  3UMA A;  4YQM A;  4HQS A;  1V2A A;  2UZ8 A;  4NMU A;  2C80 A;  4KDU A;  4N0V A;  4RUV A;  5HR1 A;  2QKE A;  3N5O A;  1UN2 A;  1I5G A;  2P31 A;  1YF1 A;  2YWI A;  5DAL A;  2CT6 A;  4KX4 A;  2LRC A;  4IQ1 A;  3LFL A;  1S3D A;  3SWL A;  3RBT A;  3I9V 2;  3IK9 A;  1KBN A;  1GSF A;  1XG8 A;  3CSJ A;  5CO3 A;  2OKA A;  2HQT A;  2VCZ A;  3VI5 A;  4O5U A;  4YQU A;  1GNW A;  1AIU A;  4ML6 A;  1TRS A;  1K0A A;  5DVB A;  4OFM A;  4QMK A;  2GVP A;  1A2J A;  5J47 A;  2XBQ A;  4O32 A;  1M99 A;  3RFR C;  4EUY A;  1ON4 A;  4KCE A;  3IA1 A;  4ZB9 A;  3MDK A;  1S4B P;  1K0D A;  1TRU A;  4Q5F A;  1PN0 A;  2CZ2 A;  2GTU A;  4GSS A;  5CP1 A;  1GTB A;  4IHU A;  3HD5 A;  1XIY A;  3BJ5 A;  5IMZ A;  3H4K A;  3WGX A;  4KDX A;  2IMF A;  3LXZ A;  2F51 A;  1ML6 A;  2WB9 A;  2YZU A;  5A1N A;  1A8Y A;  3CWG A;  4IW9 A;  3L9U A;  4XRD A;  1WPI A;  2VD0 A;  4HJ2 A;  2K9F A;  1H4O A;  2YZH A;  3IE3 A;  1ST9 A;  3CTG A;  1GRX A;  4CDO A;  5GZZ B;  2H66 A;  4GXZ A;  2H76 A;  1U87 A;  2MMO A;  4TN8 A;  3LQ7 A;  4E8H A;  2NBS A;  5J41 A;  3F63 A;  1TW9 A;  1GLQ A;  3APO A;  1O7U A;  1HD2 A;  3K8N A;  3ZFL A;  1OE7 A;  4GCI A;  2LS5 A;  1SK2 A;  2FHE A;  2VLT A;  4L5L A;  4V2M A;  3IHG A;  4BVX B;  3U5R E;  5HR3 A;  3KJY A;  4OD7 A;  1FB0 A;  2B7K A;  17GS A;  4Z7X A;  3EUR A;  2OAD A;  5ECI B;  2H1D A;  2VL2 C;  4J56 E;  5G30 A;  4KDY A;  3ME7 A;  3LOR A;  5ELG A;  2VIM A;  4YKF A;  3VWW A;  4X1U A;  5D96 A;  1JZD A;  2B1L A;  1FO5 A;  5D93 A;  1K0O A;  2VL2 A;  4O5R A;  1M2A A;  2HRK A;  2EFE A;  4YQV A;  2YP6 A;  4XTS A;  1SK1 A;  1YDK A;  2B3S A;  3UBK A;  1GUM A;  1MD3 A;  2WZ9 A;  3IAS 2;  1OAZ A;  3W8J A;  4TRX A;  3F4R A;  4HSC X;  1R4W A;  3WGD A;  2LJR A;  2NDO A;  3GX8 A;  4K0N A;  3DYR A;  2GDR A;  5HR2 A;  19GS A;  1X9M B;  1N25 A;  3UAR A;  3IC8 A;  1XZO A;  5IPH A;  4I6X A;  1GUH A;  4WBJ A;  2XPD A;  2R5G A;  2O8V B;  3DKS A;  2PWJ A;  4W66 A;  2V6K A;  3TRX A;  2WZS A;  3IR4 A;  3TKS A;  2H1L A;  2MYG A;  3ZTL A;  1O8X A;  4D73 B;  3IK7 A;  3LXT A;  1XXU A;  3HHV A;  4GSN A;  3LJR A;  2H01 A;  4HS1 A;  5DQY A;  4WF5 A;  4F03 A;  5IMD A;  5LNK e;  4PI2 C;  4NHW A;  2HT9 A;  4CW9 A;  2WGR A;  3RHB A;  1A0R P;  4O92 A;  1SD9 A;  5AN1 A;  2IWT A;  4BA7 A;  3RAZ A;  2IMD A;  2X99 A;  2H8L A;  1URM A;  3IC4 A;  1O81 A;  5A5H B;  2ZUP A;  2EC4 A;  1SJZ A;  3Q18 A;  3UBL A;  5JCW A;  1VGL A;  2HSN B;  1PRX A;  3APS A;  2DIZ A;  4MF5 A;  1IYI A;  1NW2 A;  4ZBD A;  3P2A A;  1TTZ A;  3IAM 2;  4G10 A;  1QUW A;  2X49 A;  2XHF A;  2HFD A;  4V1A p;  5IMF A;  4XIH A;  1XW6 A;  1SKW B;  2DJK A;  3P7X A;  4L0W A;  1RK4 A;  3GKX A;  4DSS A;  1Z6N A;  5E59 A;  1U3A A;  2FGX A;  3ZIJ A;  2H1A A;  2HNL A;  3SBC A;  1K3O A;  4KB3 A;  4JR6 A;  4KW6 A;  3WYW A;  3ED3 A;  4BWS A;  1G7E A;  1WIK A;  1ZOF A;  2MMA A;  4PXO A;  3VWV A;  3HY2 A;  3MNG A;  2VLV A;  1FVJ A;  4TXV A;  4PNG A;  20GS A;  1OC8 A;  3ZVJ A;  1XVQ A;  4HOJ A;  3IRA A;  3GTU B;  2HLS A;  2HZE A;  4F82 A;  2R37 A;  3N9J A;  2FA4 A;  2G0F A;  4P3Y B;  2DMM A;  3BBY A;  4POK A;  1QFN A;  3MAK A;  5H5S A;  3QOU A;  5KN2 A;  3EWL A;  3VPT A;  3MIX A;  5KN0 A;  4O7H A;  2RM5 A;  4ZBB A;  2C1Y A;  3KTB A;  4POB A;  2H71 A;  5DDL A;  4HQZ A;  1GUK A;  1A2L A;  3GKN A;  3LGC A;  1EV4 A;  2B6M A;  5CAX A;  4Q5Q A;  2NPB A;  3JCM L;  3A2W A;  2JZR A;  3BCK A;  3BOA A;  3TJK A;  3GFK A;  1Z7P A;  3FEU A;  3H93 A;  2V2G A;  4L0U A;  1PMT A;  2HRA A;  4OMV A;  4Q5N A;  2X8H A;  4MZC A;  5CRE A;  2DKH A;  5FWG A;  1M9B A;  2EIR A;  5A34 A;  2V32 A;  4NV5 A;  2IPA A;  4Q5R A;  2NVL A;  4N30 A;  3ZLP A;  3HKR A;  4YKG A;  2H73 A;  4MDC A;  3TRQ A;  4N3Z A;  2DJ3 A;  1SL0 B;  1O8W A;  1VRS D;  4FIW A;  5D9T A;  2F8F A;  4TKY A;  1ILO A;  2R6K A;  4FH8 A;  2DSA A;  1BYE A;  1SYR A;  1A8L A;  3KIJ A;  2RII A;  3IBH A;  4MAB A;  1SK0 A;  3KEB A;  1BJX A;  3KMO A;  5D9V A;  3I6A A;  3DD3 A;  4HJM A;  5C04 A;  2R0G A;  4IJI A;  3FHK A;  2E7P A;  1G6Y A;  3QFB C;  5HFI A;  5J9B A;  1FOH A;  3RGB C;  4K2D A;  4CY8 A;  2EFD A;  2YJ7 A;  3ZL5 A;  2P5R A;  5F06 A;  2V41 A;  1Y1U A;  4OFT A;  5G31 A;  5IMA A;  14GS A;  2HE3 A;  4G0L A;  4GF0 A;  4MLY A;  4ISD A;  4DEJ A;  3C71 A;  2PMT A;  2LST A;  5G5E A;  3CHX C;  1EP8 A;  2CVK A;  2DLX A;  1X5E A;  2A4V A;  1PN9 A;  3EYT A;  1F3A A;  1ABA A;  4EF0 A;  3GUR A;  9GSS A;  3WGE A;  3HA9 A;  1NSW A;  2WJU A;  1GH2 A;  4K6X A;  5ID2 B;  2HI7 A;  3HVV A;  3HJM A;  3TRP A;  1XFL A;  3R3E A;  3TKP A;  2FD3 A;  2PER A;  5IOX A;  4MPF A;  2RUF A;  2JU5 A;  2N5F A;  5IQY A;  5JWR B;  2PVO C;  2GSR A;  1M2D A;  2FLS A;  4KGI A;  5F05 A;  5IPG A;  3J7Y k;  4KUN A;  1XPV A;  5CRW A;  3ZML A;  2FCH A;  2M46 A;  1YVL A;  3IPZ A;  3UVH A;  3FZ5 A;  4KF9 A;  2C0F A;  4X0X A;  3TJG A;  1A24 A;  2GS3 A;  4MZW A;  3D5J A;  1TI3 A;  1ZMA A;  3TOT A;  3TDG A;  2YPM A;  4KE3 A;  5HQP A;  4PUA A;  3TB2 A;  1KEB A;  1W89 A;  1VF2 A;  1EOG A;  3Q6O A;  5DAK B;  4XS4 A;  5IM9 A;  1TJD A;  3GA4 A;  5HFG A;  2K18 A;  4AJ8 A;  2ON5 A;  2IMI A;  2CAQ A;  4IBP A;  2C3N A;  2OBK A;  2OE0 A;  3VWU A;  3W6G A;  4PGT A;  1Y6E A;  2IME A;  3US3 A;  3HJO A;  4F0B A;  2YWM A;  16GS A;  3EMX A;  3DML A;  4F0C A;  1JZW A;  4TR1 A;  1FG4 A;  5AIS A;  1AW9 A;  3TKQ A;  8GSS A;  2F8A A;  2E0Q A;  2KLX A;  1JLW A;  3M1G A;  2AUV A;  2XBI A;  3HXS A;  1EEM A;  3H8Q A;  1HNA A;  4ZXG A;  5BRT A;  5CYY A;  2AHE A;  1U88 A;  5DAL B;  1ACV A;  5ECL B;  3F0I A;  1A0F A;  1K0B A;  1PFO A;  1ZYP A;  1XWG A;  3NZN A;  4GST A;  2L59 A;  1F3B A;  3GUS A;  4ECB A;  1JZO A;  2CX3 A;  3HCZ A;  3ZMK A;  4RQX A;  5AGY A;  1R26 A;  5B6M A;  4QL7 A;  4POL A;  1SD8 A;  2ZCT A;  3A2X A;  1F37 A;  1YJ6 A;  2P0G A;  2QSI A;  2OT3 A;  4AGS A;  3CXG A;  3LG6 A;  4OFN A;  3FR3 A;  4HI7 A;  3G9B A;  1MD4 A;  1FHE A;  2LKU A;  4X43 A;  3FR9 A;  3WT1 A;  2L4C A;  4EDZ A;  3D21 A;  5D8I A;  2PN8 A;  4XS6 A;  1FVK A;  2FA8 A;  2JSZ A;  4EL1 A;  1FOV A;  4XRA A;  1GP1 A;  5E4W A;  4G0K A;  1NM3 A;  2CV4 A;  1T4Y A;  5GST A;  5ABR A;  3LYK A;  2FUG 2;  3UIW A;  5A1N B;  2H30 A;  3A5W A;  3EMP A;  4HUA A;  2VUP A;  3APQ A;  1F2E A;  2YCD A;  4GLT A;  2TIR A;  2H1G A;  1PA3 A;  1BX9 A;  1WP0 A;  1TXX A;  1NHO A;  2H0H A;  3TKS E;  3NOF A;  2REM A;  4KND A;  1J08 A;  1U3I A;  1SL2 B;  2PVQ A;  3IOS A;  2MMZ A;  4POM A;  1SVM A;  1MTC A;  4A5P A;  5CRG A;  1PD2 1;  5D9W A;  3GKM A;  2HSH A;  5H5R A;  2C0D A;  1Q4J A;  3FRC A;  3QPM A;  6GST A;  5DJL A;  2DJ0 A;  4KH7 A;  3DXB A;  3GH6 A;  4I2U A;  1BAY A;  4PQI A;  1I1I P;  3LSZ A;  5IMV A;  5F8B A;  1QK8 A;  1UC7 A;  4WR4 A;  4V1A g;  2R4V A;  18GS A;  2VAF A;  1U6T A;  5EY6 A;  2DIY A;  4GRF A;  5KEJ A;  2WFC A;  4L5O A;  1OKD A;  1OC9 A;  3CMI A;  5IMC A;  4OWY A;  1CQG A;  4JRR A;  1MDK A;  3FYG A;  1XWC A;  4IJ3 A;  2MBT A;  3GH9 A;  3CBU A;  5IOW A;  1XVW A;  4I2T A;  2IMK A;  3PR8 A;  2HRK B;  2H0I A;  4JU5 A;  2A2R A;  4KA0 A;  2YV7 A;  1T4Z A;  4H86 A;  4IKH A;  2VD1 A;  4MP4 A;  3ME8 A;  4RI7 A;  4TXO A;  2IJY A;  3D6I A;  2CX4 A;  2O87 A;  4EVM A;  4YAV A;  1TKD B;  1GL8 A;  4LA1 A;  1G0T A;  2R3X A;  2WVY A;  2HSM A;  2NTO A;  1GSU A;  3DGQ A;  2CVB A;  2G2Q A;  6GSX A;  4MJA A;  3A5I A;  3EIN A;  4PHZ C;  3BD2 A;  1M3J A;  3UL3 A;  4LMV A;  1B48 A;  3ZVJ D;  3ISO A;  5CRH A;  4G9H A;  3TKR A;  4MH2 A;  4WXT A;  4ZL7 A;  5B8B A;  4K7I A;  5EVO A;  3F3Q A;  2AB6 A;  4AKX B;  3ZYW A;  2PBJ A;  2VKZ G;  2VL9 A;  1MEK A;  5JCU A;  1OKT A;  1THO A;  2E2M A;  1QMV A;  3Q19 A;  2B5Y A;  4K5R A;  3IDV A;  2RLI A;  3CYN A;  3M3M A;  4E68 A;  1RW1 A;  4NHZ A;  1QXH A;  6GSY A;  1AUC A;  1PKW A;  3F8U A;  1S3R A;  4EO3 A;  1GLP A;  1TU8 A;  1QQ2 A;  4OCF A;  2CQ9 A;  3KZQ A;  5A5K A;  4BVY A;  2C0G A;  1AC1 A;  2X8C A;  5JWQ B;  4FXY P;  1YEW C;  5A4V A;  2KP2 A;  4DVC A;  2WVZ A;  2YJH A;  1SL1 B;  4MMM A;  4EKZ A;  3L9V A;  1UVZ A;  3GL5 A;  3KCM A;  4DSS B;  1SKS B;  4V2L A;  5J3R A;  4FYC A;  4TW5 A;  2L6D A;  3HMJ G;  1GSD A;  1K3L A;  4TOP A;  1Z6M A;  3UJ1 A;  4EIQ A;  3TCO A;  2N5A A;  4Z2T A;  4MK3 A;  4K7O A;  2YN1 A;  3TOU A;  4RI6 A;  2O85 A;  4K9Z A;  1SVL A;  2DML A;  3DWV A;  1Z5Y E;  5KOX A;  4TR3 A;  1N8J A;  2IL3 A;  1X5D A;  5J4Y A;  1USB A;  2HZE B;  1Q98 A;  3S9F A;  5HFK A;  3QMX A;  3A2V A;  1SJI A;  1M0U A;  4K7N A;  3V1W A;  1V40 A;  1YEX A;  4BPY A;  1OC3 A;  5B7C A;  2I4A A;  4MH3 A;  4N11 A;  4DSR A;  1XOB A;  1M7T A;  3D4T A;  2HSY A;  1Z3E A;  2F9S A;  1TK5 B;  2FWG A;  2H6Z A;  1UA5 A;  5B8A A;  3KGK A;  1YF0 A;  1JZR A;  3ERW A;  1YKA A;  2V1M A;  5EPF A;  2ES7 A;  3P8W A;  3E0U A;  3HVS A;  1PGT A;  3DRN A;  4K8M A;  2VLU A;  2WUL A;  3GST A;  2AJQ B;  2R0P A;  5G2Z A;  1V9W A;  3HVX A;  2KP1 A;  1OYJ A;  3C73 A;  4TVE A;  3TJJ A;  2R2J A;  5A34 B;  4K1F A;  4N10 A;  3FKF A;  2ALB A;  2GZZ A;  4HU7 A;  3HVN A;  4ULX A;  2HXK A;  1W4V A;  5D9X A;  1TI1 A;  3NIV A;  5JWO B;  2L5L A;  4K2X A;  1CQH A;  2A2S A;  3EPT A;  3QDN A;  5DCG A;  2TRC P;  4EDY A;  2EFH A;  2GZP A;  2GQL A;  3H79 A;  2K8V A;  2B1K A;  3C7M A;  3GYK A;  2H74 A;  2OJL A;  3PPU A;  5IIZ A;  1EGO A;  2CAI A;  4YAP A; 
#chains in the Genus database with same CATH homology
 3E9J B;  1EZK A;  1K3Y A;  5L71 A;  3QAV A;  1RQM A;  4EIP A;  3AY8 A;  10GS A;  2B5X A;  3M0F A;  2X8G A;  3I69 A;  3EC3 A;  2TRX A;  5FT3 A;  3GMF A;  1G6W A;  4ECJ A;  5G1K A;  3IV4 A;  2JAD A;  1DE2 A;  1J0F A;  4IVF A;  1XW5 A;  2VM1 A;  2GLR A;  4GTU A;  5BMU A;  2GST A;  4MNN A;  4CHS A;  4EE0 A;  3D22 A;  1BQ7 A;  4BL7 A;  1O6J A;  3I43 A;  5GSS A;  5ECH B;  4IP6 A;  4LL4 B;  2MZC A;  3ERF A;  4HZ2 A;  2M72 A;  3F6F A;  4ICY A;  3ZIT A;  3D4M A;  4KCA A;  1TRV A;  2YV9 A;  4MZB A;  4FQU A;  2OA7 A;  4EXJ A;  3L4N A;  2A4H A;  1ZYN A;  5KN3 A;  5ECM B;  3TU3 B;  3EVI A;  2HYX A;  1ZGN A;  2JZS A;  1DE1 A;  2WS2 A;  4PQH A;  3L9S A;  5CRD A;  1HNB A;  4N0Z A;  2H0G A;  5ECQ B;  4JZQ A;  2JZT A;  3BCI A;  4QL9 A;  4I5Q A;  4G19 A;  1A2M A;  1X9W B;  4HU9 A;  1LU4 A;  4MPG A;  3ZRD A;  1FW1 A;  4AKG A;  1T1V A;  3UEM A;  5ENU A;  1ZZY A;  2RM6 A;  5AIX A;  4MA9 A;  3C1S A;  2IN3 A;  2AAW A;  1PL1 A;  3F4S A;  2GSQ A;  4USS A;  4Z2R A;  3F9U A;  1HNC A;  1XW9 A;  4G0I A;  1WE0 A;  2PU9 C;  1VF3 A;  5F07 A;  4KSO A;  1M2B A;  4WBR D;  4XS4 B;  1LJR A;  3A3T A;  2YWO A;  2IFQ A;  4WR5 A;  1AQX A;  1JLV A;  2J23 A;  3KMN A;  1VF1 A;  3FK8 A;  1E2Y A;  1WOU A;  3PGT A;  2K6V A;  4TR1 B;  5LD0 A;  1MDI A;  1EP7 A;  3GNJ A;  3LEF A;  4WEY A;  3EU4 A;  1VF4 A;  2CA8 A;  4LMW A;  1Y25 A;  3L78 A;  4L8E A;  2H6X A;  4KSM A;  2BJX A;  3ZZX A;  4CY6 A;  4XCS A;  2C8U A;  2A2P A;  3M9J A;  1GTA A;  1XBS A;  2PUK C;  4QQ7 A;  2LJA A;  4PNF A;  4PUR A;  4Z2U A;  2FWE A;  4NPB A;  2Z9S A;  3HZ4 A;  2HRF A;  1B9Y C;  4ID0 A;  3MYD A;  4ILF A;  5J5N A;  2LEG A;  1V98 A;  4AI6 A;  2ZNM A;  2QC7 A;  2YNX A;  2B5E A;  2L5O A;  4ZL8 A;  3F3R A;  1A23 A;  3GHA A;  2OAC A;  2D2Z A;  2BTO T;  3GV1 A;  4MF7 A;  1S3A A;  2C3Q A;  2QA2 A;  2DBC A;  2FWF A;  2VCQ A;  5DCH A;  3FMW A;  5J9C A;  1B8X A;  2CVD A;  2GGT A;  3VUR A;  2MBS A;  1AQV A;  4ECI A;  2M80 A;  5A4U A;  4PTS A;  3F6D A;  3QD9 A;  4K5S A;  1T00 A;  2I1U A;  1PQN A;  5J40 A;  2VCW A;  3VPQ A;  3C1R A;  1KNG A;  3O6T A;  4JED A;  4HZ4 A;  2GT6 A;  2H19 A;  5DQS A;  2H72 A;  2J9H A;  4WET A;  1YEP A;  1O85 A;  6GSU A;  2VCT A;  4PQ1 A;  3UAP A;  1PSQ A;  4XS1 A;  3GL3 A;  2FY6 A;  3GX0 A;  2MMN A;  1YY7 A;  2GQK A;  5ECK B;  2YOI A;  5D73 A;  5DBQ A;  2VCV A;  2KHP A;  1AAZ A;  3VWX A;  1NHY A;  4X4J A;  1X9S B;  1K0C A;  5LCZ A;  4I8B A;  2C0E A;  3VLN A;  4BVX A;  3HDC A;  1YQ1 A;  2DKI A;  2YWN A;  4AKI A;  3QAW A;  3TJB A;  4XHM A;  3CRT A;  2F3M A;  3C8E A;  4MF6 A;  4FO5 A;  3CRU A;  4V2N A;  4TR0 A;  3CTF A;  4FYB A;  1BG5 A;  1OC9 B;  3ERG A;  3PH9 A;  1YKC A;  5ECS A;  4PUF C;  3KP8 A;  3Q74 A;  3G7Y A;  1EGR A;  2WDU A;  4AJ6 A;  1HYU A;  3O76 A;  5GAP D;  1TP9 A;  3MSZ A;  1EV9 A;  2BMX A;  1GSQ A;  4TXO B;  1XOA A;  1PX7 A;  3QAG A;  3P90 A;  2HRN A;  2HZF A;  2PPT A;  2AV4 A;  5KOW A;  2LRT A;  2H70 A;  4F2I A;  3GSS A;  1SYX A;  2HSM B;  1GUL A;  1B9X C;  3TJF A;  2VCX A;  4J57 E;  1GNE A;  1EOH A;  3TKS C;  4IQA A;  5DJM A;  4GWR A;  2LJK A;  5GAN D;  4ZBA A;  3KH7 A;  1XWK A;  5EL8 A;  1TK0 B;  22GS A;  3FW2 A;  1ERT A;  3M9K A;  3KP9 A;  1PKZ A;  2PGT A;  4D73 A;  1HQO A;  1BF5 A;  3KH9 A;  5J4U A;  3FZA A;  1AXD A;  4NXI A;  2N5B A;  3DIE A;  4WF4 A;  2EFC A;  4HDE A;  4G01 A;  2LUS A;  3GN3 A;  1F6M C;  4NV2 A;  4IGJ A;  1DBY A;  2JL4 A;  4HEA 2;  2YAN A;  1BED A;  5A5H A;  1WJK A;  5CNW A;  5H5Q A;  2LTK A;  3L0H A;  7GSS A;  1S3C A;  2HSN A;  3EU3 A;  2OE3 A;  2VOC A;  1K0N A;  2ON7 A;  4BVY B;  5ECO B;  4AJ7 A;  4E8E A;  4GQC A;  1TOF A;  2H75 A;  5COH A;  3ZFB A;  3VI7 A;  4ZIJ A;  2GZY A;  1GWC A;  3R2Q A;  2DJJ A;  5KN1 A;  1TK8 B;  2X4A A;  1QGV A;  2AYT A;  5INY A;  3G7I A;  1TRW A;  2I3Y A;  1TXU A;  2WCI A;  4MJE A;  3HYP A;  1C72 A;  2C3T A;  5G1L A;  2K8S A;  2L57 A;  2B7J A;  3HJP A;  2C4J A;  4LLR A;  4ZL9 A;  2LQO A;  3GTU A;  2DJ1 A;  1DSB A;  4LL1 B;  1ERU A;  4MJB A;  4OO4 A;  5FHI A;  3UVT A;  4NWY A;  2LNT A;  3LYP A;  3FY7 A;  2LRN A;  3DVX A;  2JAC A;  5ECN B;  4NAX A;  3TGZ A;  2X64 A;  2XC2 A;  2I81 A;  11GS A;  1JFU A;  6GSW A;  3KTL A;  1T8E B;  2O5V A;  2EIQ A;  6GSV A;  2OE1 A;  3FR6 A;  13GS A;  3WD6 A;  1XCC A;  3ZRE A;  3D0Z A;  3E3E A;  3UOM A;  4BWQ A;  3TUE A;  3DEX A;  3QR6 A;  4JBB A;  4IN0 A;  5ECR B;  1TDI A;  5IO2 A;  3IXR A;  2O89 A;  2XPE A;  3EE2 A;  3M8N A;  3GIX A;  1TU7 A;  5AIV A;  3LW9 A;  3GRX A;  5ELA A;  1ZCP A;  4IEL A;  3RDW A;  3W8S A;  1Z7R A;  4OCE A;  2UV8 G;  1MDJ A;  3RPN A;  2P5Q A;  4ZB8 A;  3DVW A;  2V6O A;  2GQM A;  1N2A A;  1F9M A;  5ECP B;  4JR4 A;  4ZIL A;  2L6C A;  1B4Q A;  2KUC A;  2KOK A;  4ACS A;  4MJC A;  1ZL9 A;  4O5Q A;  4TR4 A;  3ZIV A;  1ZYE A;  2VM2 A;  3F4T A;  1B4P A;  1DUG A;  2FWH A;  4AF2 A;  4WKW A;  3CSH A;  1ZYQ B;  2RUE A;  1SEN A;  1FAA A;  3HZ8 A;  1T3B A;  4F9Z A;  2I9H A;  1WWJ A;  2DC5 A;  2CZ3 A;  2WRT A;  1FB6 A;  1WRY A;  1Z9H A;  4YH2 A;  2LNS A;  5C00 A;  4JE1 A;  2H1B A;  3PIN A;  1YZX A;  1K0M A;  4ML1 A;  1PX6 A;  3KD0 A;  1GSS A;  4I97 A;  5A4W A;  1OVN A;  4FYU A;  5BMU B;  1O73 A;  4RQR A;  3FZ9 A;  2LQQ A;  2O7K A;  1THX A;  1PL2 A;  4BL7 B;  5HR0 A;  4G2E A;  3G7J A;  1WMJ A;  4AKH A;  1J9B A;  3VK9 A;  2H6Y A;  1T7P B;  3O3T A;  1V57 A;  4PX1 A;  5F0G A;  1R5P A;  1GSY A;  3OR5 A;  4K0G A;  1KTE A;  2DJ2 A;  1H75 A;  1X5C A;  1LBK A;  3FZ4 A;  5G5F A;  1GTI A;  4GDF A;  1I9D A;  5ID2 A;  1ERW A;  3IHQ A;  5JCG A;  2E2G A;  1EWX A;  1ERV A;  3RPP A;  4IP1 A;  2IIY A;  5IO0 A;  3WT2 A;  3VFI A;  1GSE A;  1R7H A;  3MWH A;  1GTU A;  4ECC A;  3QCP A;  1OE8 A;  3KXO A;  4ZB6 A;  4EC0 A;  4OO5 A;  1AQW A;  2L4Q A;  1R5A A;  1V58 A;  2EIO A;  2OBI A;  1SJ6 A;  3LWA A;  2QGV A;  1SKR B;  1SVO A;  1EEJ A;  1XWB A;  3KM6 A;  3QFA C;  3H1N A;  1M9A A;  6GSS A;  1SU9 A;  12GS A;  1IYH A;  2GSS A;  2VO4 A;  2LV3 A;  3GKK A;  2QA1 A;  5B6N A;  2JSY A;  5DAK A;  1X0R A;  5J4V A;  1BG1 A;  1JHB A;  4GQF A;  1G7O A;  3U6V A;  2IFQ B;  2R0C A;  4MCU A;  1XWA A;  2VL3 A;  2GT5 A;  3RHC A;  2FNO A;  1E6B A;  4J2F A;  3J7Y b;  3CSI A;  4IS0 A;  4KAE A;  4ZB7 A;  4DSQ A;  3UMA A;  4YQM A;  4HQS A;  1V2A A;  2UZ8 A;  4NMU A;  2C80 A;  4KDU A;  4N0V A;  4RUV A;  5HR1 A;  2QKE A;  3N5O A;  1UN2 A;  1I5G A;  2P31 A;  1YF1 A;  2YWI A;  5DAL A;  2CT6 A;  4KX4 A;  2LRC A;  4IQ1 A;  3LFL A;  1S3D A;  3SWL A;  3RBT A;  3I9V 2;  3IK9 A;  1KBN A;  1GSF A;  3CSJ A;  5CO3 A;  2OKA A;  2HQT A;  2VCZ A;  3VI5 A;  4O5U A;  4YQU A;  1GNW A;  1AIU A;  4ML6 A;  1TRS A;  1K0A A;  5DVB A;  4OFM A;  4QMK A;  2GVP A;  1A2J A;  5J47 A;  2XBQ A;  4O32 A;  1M99 A;  4EUY A;  1ON4 A;  4KCE A;  3IA1 A;  4ZB9 A;  3MDK A;  1K0D A;  1TRU A;  4Q5F A;  1PN0 A;  2CZ2 A;  2GTU A;  4GSS A;  5CP1 A;  1GTB A;  4IHU A;  3HD5 A;  1XIY A;  3BJ5 A;  5IMZ A;  3H4K A;  3WGX A;  4KDX A;  2IMF A;  3LXZ A;  2F51 A;  1ML6 A;  2WB9 A;  2YZU A;  5A1N A;  1A8Y A;  3CWG A;  4IW9 A;  3L9U A;  4XRD A;  1WPI A;  2VD0 A;  4HJ2 A;  2K9F A;  1H4O A;  2YZH A;  3IE3 A;  1ST9 A;  3CTG A;  1GRX A;  4CDO A;  5GZZ B;  2H66 A;  4GXZ A;  2H76 A;  1U87 A;  2MMO A;  4TN8 A;  3LQ7 A;  4E8H A;  2NBS A;  5J41 A;  3F63 A;  1TW9 A;  1GLQ A;  3APO A;  1O7U A;  1HD2 A;  3K8N A;  3ZFL A;  1OE7 A;  4GCI A;  2LS5 A;  1SK2 A;  2FHE A;  2VLT A;  4L5L A;  4V2M A;  3IHG A;  4BVX B;  3U5R E;  5HR3 A;  3KJY A;  4OD7 A;  1FB0 A;  2B7K A;  17GS A;  4Z7X A;  3EUR A;  2OAD A;  5ECI B;  2H1D A;  2VL2 C;  4J56 E;  5G30 A;  4KDY A;  3ME7 A;  3LOR A;  5ELG A;  2VIM A;  4YKF A;  3VWW A;  4X1U A;  5D96 A;  1JZD A;  2B1L A;  1FO5 A;  5D93 A;  1K0O A;  2VL2 A;  4O5R A;  1M2A A;  2HRK A;  2EFE A;  4YQV A;  2YP6 A;  4XTS A;  1SK1 A;  1YDK A;  2B3S A;  3UBK A;  1GUM A;  1MD3 A;  2WZ9 A;  3IAS 2;  1OAZ A;  3W8J A;  4TRX A;  3F4R A;  1R4W A;  3WGD A;  2LJR A;  2NDO A;  3GX8 A;  4K0N A;  3DYR A;  2GDR A;  5HR2 A;  19GS A;  1X9M B;  1N25 A;  3UAR A;  3IC8 A;  1XZO A;  5IPH A;  4I6X A;  1GUH A;  4WBJ A;  2XPD A;  2R5G A;  2O8V B;  3DKS A;  2PWJ A;  4W66 A;  2V6K A;  3TRX A;  3IR4 A;  3TKS A;  2H1L A;  2MYG A;  3ZTL A;  1O8X A;  4D73 B;  3IK7 A;  3LXT A;  1XXU A;  3HHV A;  4GSN A;  3LJR A;  2H01 A;  4HS1 A;  5DQY A;  4WF5 A;  4F03 A;  5IMD A;  5LNK e;  4NHW A;  2HT9 A;  4CW9 A;  2WGR A;  3RHB A;  1A0R P;  4O92 A;  1SD9 A;  5AN1 A;  2IWT A;  4BA7 A;  3RAZ A;  2IMD A;  2X99 A;  2H8L A;  1URM A;  3IC4 A;  1O81 A;  5A5H B;  2ZUP A;  2EC4 A;  1SJZ A;  3Q18 A;  3UBL A;  5JCW A;  1VGL A;  2HSN B;  1PRX A;  3APS A;  2DIZ A;  4MF5 A;  1IYI A;  1NW2 A;  4ZBD A;  3P2A A;  1TTZ A;  3IAM 2;  4G10 A;  1QUW A;  2X49 A;  2XHF A;  2HFD A;  4V1A p;  5IMF A;  4XIH A;  1XW6 A;  1SKW B;  2DJK A;  3P7X A;  4L0W A;  1RK4 A;  3GKX A;  4DSS A;  1Z6N A;  5E59 A;  1U3A A;  2FGX A;  3ZIJ A;  2H1A A;  2HNL A;  3SBC A;  1K3O A;  4KB3 A;  4JR6 A;  4KW6 A;  3WYW A;  3ED3 A;  4BWS A;  1G7E A;  1WIK A;  1ZOF A;  2MMA A;  4PXO A;  3VWV A;  3HY2 A;  3MNG A;  2VLV A;  1FVJ A;  4TXV A;  4PNG A;  20GS A;  1OC8 A;  3ZVJ A;  1XVQ A;  4HOJ A;  3IRA A;  3GTU B;  2HLS A;  2HZE A;  4F82 A;  2R37 A;  3N9J A;  2FA4 A;  2G0F A;  4P3Y B;  2DMM A;  3BBY A;  4POK A;  1QFN A;  3MAK A;  5H5S A;  3QOU A;  5KN2 A;  3EWL A;  3VPT A;  3MIX A;  5KN0 A;  4O7H A;  2RM5 A;  4ZBB A;  2C1Y A;  3KTB A;  4POB A;  2H71 A;  5DDL A;  4HQZ A;  1GUK A;  1A2L A;  3GKN A;  3LGC A;  1EV4 A;  2B6M A;  5CAX A;  4Q5Q A;  2NPB A;  3JCM L;  3A2W A;  2JZR A;  3BCK A;  3BOA A;  3TJK A;  3GFK A;  1Z7P A;  3FEU A;  3H93 A;  2V2G A;  4L0U A;  1PMT A;  2HRA A;  4OMV A;  4Q5N A;  2X8H A;  4MZC A;  5CRE A;  2DKH A;  5FWG A;  1M9B A;  2EIR A;  5A34 A;  2V32 A;  4NV5 A;  2IPA A;  4Q5R A;  2NVL A;  4N30 A;  3ZLP A;  3HKR A;  4YKG A;  2H73 A;  4MDC A;  3TRQ A;  4N3Z A;  2DJ3 A;  1SL0 B;  1O8W A;  1VRS D;  4FIW A;  5D9T A;  2F8F A;  4TKY A;  1ILO A;  2R6K A;  4FH8 A;  2DSA A;  1BYE A;  1SYR A;  1A8L A;  3KIJ A;  2RII A;  3IBH A;  4MAB A;  1SK0 A;  3KEB A;  1BJX A;  3KMO A;  5D9V A;  3I6A A;  3DD3 A;  4HJM A;  5C04 A;  2R0G A;  4IJI A;  3FHK A;  2E7P A;  1G6Y A;  3QFB C;  5HFI A;  5J9B A;  1FOH A;  4K2D A;  4CY8 A;  2EFD A;  2YJ7 A;  3ZL5 A;  2P5R A;  5F06 A;  2V41 A;  1Y1U A;  4OFT A;  5G31 A;  5IMA A;  14GS A;  2HE3 A;  4G0L A;  4GF0 A;  4MLY A;  4ISD A;  4DEJ A;  3C71 A;  2PMT A;  2LST A;  5G5E A;  1EP8 A;  2CVK A;  2DLX A;  1X5E A;  2A4V A;  1PN9 A;  3EYT A;  1F3A A;  1ABA A;  4EF0 A;  3GUR A;  9GSS A;  3WGE A;  3HA9 A;  1NSW A;  2WJU A;  1GH2 A;  4K6X A;  5ID2 B;  2HI7 A;  3HVV A;  3HJM A;  3TRP A;  1XFL A;  3R3E A;  3TKP A;  2FD3 A;  2PER A;  5IOX A;  4MPF A;  2RUF A;  2JU5 A;  2N5F A;  5IQY A;  5JWR B;  2PVO C;  2GSR A;  1M2D A;  2FLS A;  4KGI A;  5F05 A;  5IPG A;  3J7Y k;  4KUN A;  1XPV A;  5CRW A;  3ZML A;  2FCH A;  2M46 A;  1YVL A;  3IPZ A;  3UVH A;  3FZ5 A;  4KF9 A;  2C0F A;  4X0X A;  3TJG A;  1A24 A;  2GS3 A;  4MZW A;  3D5J A;  1TI3 A;  1ZMA A;  3TOT A;  3TDG A;  2YPM A;  4KE3 A;  5HQP A;  4PUA A;  3TB2 A;  1KEB A;  1W89 A;  1VF2 A;  1EOG A;  3Q6O A;  5DAK B;  4XS4 A;  5IM9 A;  1TJD A;  3GA4 A;  5HFG A;  2K18 A;  4AJ8 A;  2ON5 A;  2IMI A;  2CAQ A;  4IBP A;  2C3N A;  2OBK A;  2OE0 A;  3VWU A;  3W6G A;  4PGT A;  1Y6E A;  2IME A;  3US3 A;  3HJO A;  4F0B A;  2YWM A;  16GS A;  3EMX A;  3DML A;  4F0C A;  1JZW A;  4TR1 A;  1FG4 A;  5AIS A;  1AW9 A;  3TKQ A;  8GSS A;  2F8A A;  2E0Q A;  2KLX A;  1JLW A;  3M1G A;  2AUV A;  2XBI A;  3HXS A;  1EEM A;  3H8Q A;  1HNA A;  4ZXG A;  5BRT A;  5CYY A;  2AHE A;  1U88 A;  5DAL B;  1ACV A;  5ECL B;  3F0I A;  1A0F A;  1K0B A;  1ZYP A;  1XWG A;  3NZN A;  4GST A;  2L59 A;  1F3B A;  3GUS A;  4ECB A;  1JZO A;  2CX3 A;  3HCZ A;  3ZMK A;  4RQX A;  5AGY A;  1R26 A;  5B6M A;  4QL7 A;  4POL A;  1SD8 A;  2ZCT A;  3A2X A;  1F37 A;  1YJ6 A;  2P0G A;  2QSI A;  2OT3 A;  4AGS A;  3CXG A;  3LG6 A;  4OFN A;  3FR3 A;  4HI7 A;  3G9B A;  1MD4 A;  1FHE A;  2LKU A;  4X43 A;  3FR9 A;  3WT1 A;  2L4C A;  4EDZ A;  3D21 A;  5D8I A;  2PN8 A;  4XS6 A;  1FVK A;  2FA8 A;  2JSZ A;  4EL1 A;  1FOV A;  4XRA A;  1GP1 A;  5E4W A;  4G0K A;  1NM3 A;  2CV4 A;  1T4Y A;  5GST A;  5ABR A;  3LYK A;  2FUG 2;  3UIW A;  5A1N B;  2H30 A;  3A5W A;  3EMP A;  4HUA A;  2VUP A;  3APQ A;  1F2E A;  2YCD A;  4GLT A;  2TIR A;  2H1G A;  1PA3 A;  1BX9 A;  1WP0 A;  1TXX A;  1NHO A;  2H0H A;  3TKS E;  3NOF A;  2REM A;  4KND A;  1J08 A;  1U3I A;  1SL2 B;  2PVQ A;  3IOS A;  2MMZ A;  4POM A;  1SVM A;  1MTC A;  4A5P A;  5CRG A;  1PD2 1;  5D9W A;  3GKM A;  2HSH A;  5H5R A;  2C0D A;  1Q4J A;  3FRC A;  3QPM A;  6GST A;  5DJL A;  2DJ0 A;  4KH7 A;  3DXB A;  3GH6 A;  4I2U A;  1BAY A;  4PQI A;  3LSZ A;  5IMV A;  5F8B A;  1QK8 A;  1UC7 A;  4WR4 A;  4V1A g;  2R4V A;  18GS A;  2VAF A;  1U6T A;  5EY6 A;  2DIY A;  4GRF A;  5KEJ A;  2WFC A;  4L5O A;  1OKD A;  1OC9 A;  3CMI A;  5IMC A;  4OWY A;  1CQG A;  4JRR A;  1MDK A;  3FYG A;  1XWC A;  4IJ3 A;  2MBT A;  3GH9 A;  3CBU A;  5IOW A;  1XVW A;  4I2T A;  2IMK A;  3PR8 A;  2HRK B;  2H0I A;  4JU5 A;  2A2R A;  4KA0 A;  2YV7 A;  1T4Z A;  4H86 A;  4IKH A;  2VD1 A;  4MP4 A;  3ME8 A;  4RI7 A;  4TXO A;  2IJY A;  3D6I A;  2CX4 A;  2O87 A;  4EVM A;  4YAV A;  1TKD B;  1GL8 A;  4LA1 A;  1G0T A;  2R3X A;  2HSM A;  2NTO A;  1GSU A;  3DGQ A;  2CVB A;  2G2Q A;  6GSX A;  4MJA A;  3A5I A;  3EIN A;  3BD2 A;  3UL3 A;  4LMV A;  1B48 A;  3ZVJ D;  3ISO A;  5CRH A;  4G9H A;  3TKR A;  4MH2 A;  4WXT A;  4ZL7 A;  5B8B A;  4K7I A;  5EVO A;  3F3Q A;  2AB6 A;  4AKX B;  3ZYW A;  2PBJ A;  2VKZ G;  2VL9 A;  1MEK A;  5JCU A;  1OKT A;  1THO A;  2E2M A;  1QMV A;  3Q19 A;  2B5Y A;  4K5R A;  3IDV A;  2RLI A;  3CYN A;  3M3M A;  4E68 A;  1RW1 A;  4NHZ A;  1QXH A;  6GSY A;  1AUC A;  1PKW A;  3F8U A;  4EO3 A;  1GLP A;  1TU8 A;  1QQ2 A;  4OCF A;  2CQ9 A;  3KZQ A;  5A5K A;  4BVY A;  2C0G A;  1AC1 A;  2X8C A;  5JWQ B;  5A4V A;  2KP2 A;  4DVC A;  2YJH A;  1SL1 B;  4MMM A;  4EKZ A;  3L9V A;  1UVZ A;  3GL5 A;  3KCM A;  4DSS B;  1SKS B;  4V2L A;  5J3R A;  4FYC A;  4TW5 A;  2L6D A;  3HMJ G;  1GSD A;  1K3L A;  4TOP A;  1Z6M A;  3UJ1 A;  4EIQ A;  3TCO A;  2N5A A;  4Z2T A;  4MK3 A;  4K7O A;  2YN1 A;  3TOU A;  4RI6 A;  2O85 A;  4K9Z A;  1SVL A;  2DML A;  3DWV A;  1Z5Y E;  5KOX A;  4TR3 A;  1N8J A;  2IL3 A;  1X5D A;  5J4Y A;  1USB A;  2HZE B;  1Q98 A;  3S9F A;  5HFK A;  3QMX A;  3A2V A;  1SJI A;  1M0U A;  4K7N A;  3V1W A;  1V40 A;  1YEX A;  4BPY A;  1OC3 A;  5B7C A;  2I4A A;  4MH3 A;  4N11 A;  4DSR A;  1XOB A;  1M7T A;  3D4T A;  2HSY A;  1Z3E A;  2F9S A;  1TK5 B;  2FWG A;  2H6Z A;  1UA5 A;  5B8A A;  3KGK A;  1YF0 A;  1JZR A;  3ERW A;  1YKA A;  2V1M A;  5EPF A;  2ES7 A;  3P8W A;  3E0U A;  3HVS A;  1PGT A;  3DRN A;  4K8M A;  2VLU A;  2WUL A;  3GST A;  2AJQ B;  2R0P A;  5G2Z A;  1V9W A;  3HVX A;  2KP1 A;  1OYJ A;  3C73 A;  4TVE A;  3TJJ A;  2R2J A;  5A34 B;  4K1F A;  4N10 A;  3FKF A;  2ALB A;  2GZZ A;  4HU7 A;  4ULX A;  2HXK A;  1W4V A;  5D9X A;  1TI1 A;  3NIV A;  5JWO B;  2L5L A;  4K2X A;  1CQH A;  2A2S A;  3EPT A;  3QDN A;  5DCG A;  2TRC P;  4EDY A;  2EFH A;  2GZP A;  2GQL A;  3H79 A;  2K8V A;  2B1K A;  3C7M A;  3GYK A;  2H74 A;  2OJL A;  3PPU A;  5IIZ A;  1EGO A;  2CAI A;  4YAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...