1GTUA

Ligand-free human glutathione s-transferase m1a-1a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Functions of His107 in the catalytic mechanism of human glutathione S-transferase hGSTM1a-1a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gtuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gtuA01
3KH9A 2V1MA 2GSRA 2AJQB 3TKRA 3WYWA 2MMOA 4PNFA 3NOFA 2HZEA 4GTUA 2RUFA 3WGXA 2H8LA 4O92A 2L6CA 3DWVA 5ECOB 4L8EA 4KSMA 3J7Yk 1ZYQB 2XPDA 3D4TA 5AIVA 4BVYB 3GL5A 1GLPA 1BQ7A 2YOIA 3U6VA 1GSQA 4G0KA 1XCCA 4ULXA 4F0CA 1TU8A 4IKHA 2M80A 3DEXA 5GSSA 5LNKe 2O7KA 2JACA 1QXHA 3C73A 1SJIA 1X5CA 1K0NA 4NWYA 6GSTA 1MEKA 4I5QA 1FO5A 4HU7A 3MSZA 4KSOA 13GSA 3TRPA 4IS0A 12GSA 3IAS2 4K8MA 4MJAA 1AUCA 3GKNA 16GSA 4ZBAA 1U3AA 3IRAA 4EKZA 2TRXA 4ZL9A 3HCZA 3ZIJA 2KOKA 1J08A 3QAWA 4MDCA 1OKDA 1ZYEA 1F6MC 3PH9A 3QAVA 1XOAA 3PINA 4K0GA 1PMTA 5ECPB 4PURA 2A4VA 1GTAA 2P31A 5IQYA 2H1BA 5HFIA 4KX4A 5F06A 3H8QA 5D8IA 1DBYA 1EEJA 4HZ2A 2YV9A 11GSA 1B4PA 1PX6A 5ECNB 1A2LA 2HT9A 2DMMA 4HJ2A 2KP2A 5H5RA 5F07A 2VM2A 1TK0B 2FWFA 2FWEA 3W8SA 2I81A 4GF0A 3G9BA 2GS3A 2H6ZA 1TXXA 4EC0A 3KCMA 2VCWA 1GLQA 4XRAA 1ZL9A 1GSDA 1X9MB 1JZRA 4JZQA 4F2IA 2LQOA 3EE2A 2XBQA 3P90A 2B3SA 2IFQB 3IE3A 3R3EA 4KGIA 4ZBDA 3F4RA 4ZILA 2WZ9A 2RM5A 2KUCA 2NPBA 3TKSC 4RI6A 1WOUA 2LUSA 4ACSA 2OJLA 4TVEA 4D73B 4GWRA 2GZPA 5JWQB 5F8BA 2YP6A 3I69A 1A0RP 1V40A 2FWGA 1UA5A 3QR6A 4AJ6A 2B7JA 3HZ8A 3LSZA 1GTUA 3ZL5A 2F8AA 3GH9A 4QQ7A 2LEGA 2I4AA 3Q6OA 4KCEA 4WBJA 2OE0A 2LS5A 3E3EA 4POLA 4GQFA 3FEUA 1HQOA 1PL1A 3MWHA 3CSIA 4IHUA 4N0ZA 2R3XA 5KEJA 1X5EA 1NM3A 2QGVA 3FY7A 2VLTA 4EVMA 3VWXA 3QFBC 2VL2C 3GSTA 1EOHA 1TK8B 2H75A 4HDEA 1THXA 1OC9A 3HJPA 2FWHA 2YNXA 4HS1A 5CO3A 4J2FA 2ZNMA 1K3YA 4ID0A 1FAAA 1LJRA 1OE8A 2OACA 4NPBA 3A5WA 2DC5A 3R2QA 3EC3A 1GUKA 5D9XA 2L4CA 2DMLA 3KEBA 2H73A 4OMVA 1TI3A 4HQZA 4KDXA 2E2MA 4MZCA 1U88A 1ABAA 5D9VA 2NVLA 3L9SA 1ZCPA 3TDGA 2J9HA 3TRXA 4YQUA 4G19A 3S9FA 1A0FA 2GQLA 3OR5A 4ZB8A 4O5RA 1EGRA 5D93A 1O8XA 2YJHA 1ZZYA 1QUWA 2IMEA 4OCEA 2PUKC 4V1Ag 2X99A 1VF2A 3M9JA 3D21A 2V6KA 3M8NA 4TOPA 1Z5YE 1IYHA 5HR2A 4J57E 1JFUA 1XFLA 4JR6A 3UJ1A 2L4QA 2GGTA 2GT6A 3GYKA 2LKUA 3IDVA 2B5YA 3L9VA 2DJ3A 2OE1A 1KTEA 2L5LA 1W89A 4HUAA 2DIYA 4X1UA 1O73A 1HD2A 3GFKA 2M72A 2VAFA 2H76A 3ZFLA 3HZ4A 2KLXA 1DE2A 2C0FA 1R5PA 1RQMA 3FK8A 2C80A 2DSAA 2LV3A 1UVZA 4FH8A 4NV5A 1ILOA 2YANA 3EMPA 3M9KA 3TJFA 4L5OA 1FVJA 3KP8A 2VCXA 1F9MA 1XWAA 3UVHA 5G5EA 4ILFA 3CRTA 3CMIA 4OO5A 3EVIA 4MA9A 4X0XA 3WT2A 3C7MA 4WR5A 3BBYA 1GSEA 3EURA 1K0BA 2IIYA 3DMLA 2FA8A 2O85A 3TCOA 4KW6A 1FG4A 4IN0A 1YF0A 2EC4A 3GURA 5GAPD 2B1LA 3CBUA 1T7PB 2PGTA 1N8JA 2N5FA 4CHSA 3IV4A 4MP4A 1BJXA 1Z6NA 3CSHA 3M1GA 5H5QA 1GULA 2HNLA 1SJ6A 3UBKA 2WRTA 9GSSA 2JSYA 4XRDA 3ZIVA 1Y25A 1AW9A 5C00A 5DJMA 2V2GA 2VLUA 1FB0A 4RUVA 1EV9A 2FGXA 2EIQA 3TRQA 1HNBA 4OO4A 1S3CA 2JZRA 3IC8A 3IC4A 5HR3A 5LCZA 4CW9A 2C3NA 4XS4A 2DJ0A 4N10A 3KTBA 3BD2A 3LG6A 3LJRA 4Q5QA 3DYRA 3VK9A 4MK3A 1MDIA 1USBA 3F63A 2YZUA 2O87A 4NHWA 4MJBA 3ZLPA 5HR0A 5B8AA 2CVKA 2FA4A 1Y6EA 3KMOA 3IA1A 3LGCA 2HZFA 4MF6A 4HU9A 2QKEA 4IP1A 1GTIA 2UZ8A 3O6TA 3GH6A 1WPIA 1PSQA 2YJ7A 4PTSA 4DEJA 2FLSA 2OKAA 1Z3EA 1OE7A 5DVBA 4O7HA 4YH2A 3QD9A 1TTZA 5CREA 3KMNA 5ECSA 2CVDA 4F9ZA 3DGQA 3M0FA 1S3DA 3VI5A 4DSQA 1ERUA 3ZTLA 3CYNA 1KNGA 5A4UA 1GRXA 2HRAA 3GNJA 1Q4JA 6GSUA 4XS6A 6GSVA 5E59A 4AF2A 1XVQA 1ACVA 3VWWA 2MMNA 2HFDA 3L9UA 3ME7A 2LJRA 3GIXA 1IYIA 1K3OA 4ECJA 4GQCA 3FKFA 4PX1A 5INYA 5GSTA 1E6BA 1XZOA 4F0BA 5H5SA 4Z7XA 3PPUA 1GSYA 4ZB6A 3EWLA 3A2WA 1TRWA 1M9BA 4YAPA 3ZVJA 2N5BA 1TDIA 2M46A 1E2YA 4MLYA 1QMVA 3FHKA 4ECCA 1A2MA 4G0IA 3TGZA 2ZUPA 20GSA 5D9WA 5A5KA 4KH7A 4BVYA 2YWIA 4KE3A 1M2DA 4TRXA 3TKSA 3WGDA 5CP1A 4L0UA 1MDJA 1Z7RA 4P3YB 2YWOA 1ERWA 2XHFA 1YDKA 1G6YA 2WULA 1TRUA 4EUYA 3CTGA 1NHOA 2HRNA 5CRWA 4LL4B 1TK5B 4MZBA 2MBTA 2VO4A 3O3TA 2GZZA 1PKZA 1GH2A 4IELA 3MNGA 1Z6MA 1YZXA 4BA7A 3F3RA 4N0VA 2PN8A 1FHEA 1A23A 1X5DA 1XWCA 1VF1A 1EGOA 3TJJA 1NHYA 4WBRD 3SWLA 4BPYA 2YCDA 3KIJA 2VL2A 5A4VA 2C0GA 4USSA 2B1KA 3TJBA 4JBBA 3FZ4A 4KA0A 3G7JA 1M0UA 5EL8A 5IO2A 1T4ZA 5IOWA 5IM9A 3F6FA 1C72A 3NZNA 2WCIA 5CRDA 3LORA 3RAZA 5AGYA 2L6DA 2YWMA 4ZB9A 1U3IA 5DDLA 4NXIA 1VF3A 4N30A 2IL3A 2WDUA 4LA1A 4MPFA 2H6YA 5F0GA 3UARA 1G7OA 5A4WA 1ZMAA 4E8HA 5HFGA 4G0LA 4ML1A 1BEDA 3IBHA 1A8YA 3UL3A 1A8LA 5CYYA 4PGTA 14GSA 4RI7A 4V2NA 4MPGA 1GNEA 1SL2B 3IOSA 5COHA 4TXOB 3UOMA 2WS2A 1OYJA 2F51A 2H01A 1GP1A 4FQUA 4TR1B 4POMA 2LSTA 2AYTA 3C1SA 1CQGA 4EXJA 2KHPA 2I9HA 3F4TA 1URMA 1FOVA 1U87A 2V41A 4BVXB 4EF0A 3EINA 5D73A 2IFQA 1EP7A 4IQ1A 3HVXA 3LWAA 3TJGA 1Z9HA 1MD3A 5KN2A 3F0IA 1KEBA 2GQMA 5G30A 2DJ2A 3US3A 22GSA 19GSA 4D73A 4WF4A 1SKSB 2CX4A 2XC2A 2GSSA 3TKQA 4ZL7A 4BVXA 4AJ7A 3C1RA 2XBIA 1PGTA 1O7UA 4MMMA 3QOUA 2ES7A 1H4OA 5C04A 3GUSA 3APQA 3L0HA 2TRCP 1ML6A 4Q5NA 3TJKA 1EEMA 4F82A 3LEFA 2JSZA 4BL7B 2HXKA 2R37A 1A2JA 3DVWA 3GX0A 1SK1A 3HVSA 2D2ZA 1O85A 2TIRA 3FR9A 4PNGA 2JZTA 1BX9A 4XTSA 4IJ3A 4FYBA 4CDOA 2MBSA 5HFKA 2IMKA 2WJUA 5ABRA 4Q5FA 5J4UA 3A2VA 2VCZA 4EE0A 2CAQA 2FY6A 3GX8A 2HSMB 2XPEA 1MD4A 2PBJA 4BWSA 1K0DA 5ID2B 4K7OA 2PVOC 1PKWA 5DJLA 1Z7PA 2JZSA 2VIMA 1X9SB 4POKA 1K0MA 3GKMA 3JCML 5JWRB 1SU9A 1M99A 2OE3A 2VCVA 3KH7A 3H93A 1M2BA 2HSMA 1G7EA 4OFTA 1YEPA 1PD21 3TUEA 2QSIA 1TRSA 2BMXA 3VFIA 1N2AA 4OD7A 2OA7A 5ID2A 5ECMB 2YPMA 1XW6A 2WGRA 3GSSA 5DALB 4WF5A 2A2RA 1G6WA 2VD1A 2B5XA 4NHZA 4EDYA 1O8WA 4KF9A 5DAKB 1JZOA 1CQHA 2HSHA 2C3TA 5EPFA 3VPQA 1XPVA 2P5QA 2BJXA 4MJEA 1T1VA 2FUG2 1J9BA 4YQVA 4AJ8A 2FD3A 3Q18A 2HE3A 1EP8A 2E7PA 1R7HA 5IMAA 3VWVA 3ME8A 2BTOT 1AC1A 1EV4A 1FW1A 5EVOA 3HJOA 2GSQA 3BJ5A 3G7IA 1HNCA 4N11A 4JU5A 4FIWA 4J56E 2L5OA 4JRRA 4DSRA 4ZBBA 1W4VA 2GDRA 3FZAA 2IWTA 2P0GA 3WD6A 1GSFA 5EY6A 3UAPA 2B5EA 2L59A 2E2GA 1EZKA 4PUFC 1GTBA 18GSA 1VGLA 3W8JA 4PQIA 3KP9A 3GTUB 1SD8A 3F9UA 2H1DA 2H6XA 4AGSA 3LQ7A 2WFCA 4DVCA 5IIZA 3BCKA 1DUGA 1V58A 3VWUA 1TJDA 1M9AA 4YAVA 2AAWA 5J41A 1EWXA 1K0AA 1ERTA 3LXZA 2EIRA 2F3MA 2DJJA 3G7YA 2ZCTA 3HJMA 2LJAA 3GV1A 1SL0B 2H70A 2CV4A 1B4QA 10GSA 1VF4A 2OBIA 1QQ2A 3ERGA 2H0IA 2YZHA 1OC8A 1G0TA 1AQWA 1XWGA 2KP1A 5IMZA 2HLSA 1AQXA 1SL1B 3GKXA 5HR1A 1H75A 2VCTA 3ZYWA 3UEMA 3KGKA 1TKDB 3DKSA 5ECKB 2V6OA 1WMJA 4MH2A 1F3BA 1TW9A 1XWKA 3IPZA 3BCIA 1V2AA 3ZMLA 3WT1A 1JZDA 4IW9A 4KB3A 1T4YA 1PA3A 2OBKA 4G2EA 2N5AA 4I6XA 1ON4A 2H19A 4LLRA 3HY2A 4OWYA 5IMCA 6GSWA 4HI7A 3WGEA 1Q98A 1ST9A 3RHCA 6GSYA 2WB9A 3F8UA 4MCUA 4ML6A 5ECRB 2IJYA 1T00A 4ISDA 3FZ9A 1RW1A 1AAZA 4GCIA 4JR4A 2HSYA 1YY7A 1R26A 1I9DA 3RBTA 1TI1A 3A3TA 2ALBA 3KTLA 3GRXA 3O76A 4NAXA 2F8FA 5JWOB 1SD9A 3Q19A 5LD0A 2R6KA 4X43A 4I2UA 4I2TA 3P8WA 4EDZA 4V1Ap 1K0CA 3U5RE 2GSTA 4TR4A 3CSJA 2DIZA 3ERWA 5B7CA 5JCGA 2HZEB 2VUPA 2GT5A 1M7TA 5GZZB 5G1LA 5BMUA 5B6MA 2PVQA 3BOAA 4HOJA 1V9WA 2R4VA 5HQPA 3J7Yb 4K6XA 3EU3A 2ON7A 4LL1B 2VCQA 2C8UA 2LNSA 3IXRA 2LQQA 4TR0A 5E4WA 4KDUA 2DBCA 1TP9A 8GSSA 3N5OA 1OVNA 2H1AA 1FVKA 2CVBA 1TU7A 3LXTA 4LMWA 3L78A 3VLNA 5IMVA 2K8SA 3P2AA 2K6VA 3GMFA 3ERFA 5CNWA 5D9TA 4OFNA 1WE0A 1S3AA 2IMDA 4MH3A 3HKRA 3P7XA 2R2JA 1AQVA 4GLTA 1VRSD 2VLVA 1SKRB 3L4NA 3ISOA 4ECIA 2LRTA 1GUHA 1OKTA 4FO5A 5AN1A 3D5JA 4G10A 3IHQA 1B48A 1YQ1A 3DIEA 3CTFA 1QGVA 3IAM2 1GUMA 2PERA 3ZRDA 1GNWA 2H0GA 2IN3A 1EOGA 3UVTA 1KBNA 2G2QA 2VL9A 5FHIA 4K2DA 4HZ4A 4GSNA 3MDKA 1TOFA 1K3LA 3I6AA 4NV2A 3FYGA 1SJZA 5G5FA 5ECIB 1ZOFA 3FZ5A 3HD5A 5L71A 2LRCA 3QDNA 4ZL8A 1WRYA 3F4SA 2RUEA 2MMAA 2C3QA 2A2SA 1SYXA 5IMFA 3RHBA 3HA9A 4HQSA 5F05A 1HYUA 1JLWA 3IK7A 2AHEA 1XOBA 3ZVJD 1F2EA 2CT6A 5ELAA 4FYCA 1T8EB 1A24A 4O32A 4IBPA 2J23A 3QAGA 2X8GA 3KXOA 1LBKA 1LU4A 2H1GA 3AY8A 3D0ZA 2JADA 2AUVA 4MABA 2PU9C 1AXDA 3HDCA 1O6JA 2P5RA 3GKKA 2H71A 2JU5A 5G2ZA 2AV4A 2EIOA 1BYEA 4Q5RA 2VM1A 2AB6A 2VOCA 2R5GA 2C1YA 2C0DA 1NSWA 5G1KA 4L0WA 2DJ1A 4POBA 5CAXA 1BG5A 3DRNA 3KM6A 2F9SA 4TXOA 3C8EA 3PGTA 1TRVA 1XBSA 5DQYA 5G31A 2CX3A 2JL4A 4GSSA 3IK9A 1B9XC 5IOXA 4HJMA 3GHAA 3UIWA 4TR1A 2IMFA 1B8XA 3A2XA 4K1FA 5JCUA 1R5AA 6GSXA 3DD3A 1F3AA 2GZYA 2ON5A 4WXTA 4HEA2 3IR4A 3FW2A 1XW9A 4FYUA 4E8EA 2IMIA 2IPAA 3KD0A 4OCFA 2I1UA 1O81A 1BAYA 1OC9B 4TXVA 2GQKA 1SYRA 4K0NA 1JLVA 1X9WB 4QL9A 4JE1A 1PN9A 2FHEA 1R4WA 3ZREA 2LNTA 3TKPA 1X0RA 3LYKA 2CZ3A 3HVVA 3LFLA 1YKCA 3ZITA 3D6IA 1DSBA 3QFAC 5KN0A 3N9JA 2X8HA 3SBCA 5IO0A 2HQTA 3K8NA 2HYXA 1YKAA 5ECHB 2O89A 3H79A 4IP6A 2C0EA 2REMA 1GSUA 2MZCA 2CA8A 4GSTA 2LJKA 3HXSA 1WJKA 5DQSA 4BL7A 5J9CA 3HHVA 4OFMA 5CRGA 17GSA 2RM6A 3ZZXA 3H4KA 5DBQA 3VPTA 1V57A 2H72A 2H30A 3TOTA 3VI7A 1FB6A 4TR3A 4H86A 2CQ9A 2H74A 2MMZA 2H0HA 3V1WA 2K8VA 1YF1A 3QMXA 1XIYA 5CRHA 4ECBA 2YV7A 3APSA 4K7NA 3ED3A 3W6GA 1XXUA 3QCPA 2YN1A 4YQMA 3CRUA 1XWBA 2G0FA 4WEYA 1SK2A 4XIHA 3ZFBA 6GSSA 2HI7A 1UC7A 4K9ZA 5DCGA 2PMTA 2K18A 4XHMA 3E0UA 4I8BA 2HSNB 5FT3A 3QPMA 4V2MA 5DCHA 3FR6A 4KNDA 4XCSA 5KN3A 2X8CA 2B6MA 4WKWA 4TKYA 3LYPA 5J5NA 4RQRA 1SKWB 4MZWA 2GVPA 5DALA 2PWJA 5DAKA 2YWNA 3UBLA 2E0QA 3ZMKA 2DJKA 2FNOA 1OAZA 1WWJA 4V2LA 1YJ6A 4XS1A 1YEXA 3Q74A 2H66A 1M2AA 1SENA 2LTKA 2NTOA 4ZXGA 1U6TA 5D96A 1ZGNA 4MJCA 2K9FA 2NBSA 4PQHA 3TOUA 5JCWA 4G9HA 1WP0A 1J0FA 4MF7A 4PQ1A 2L57A 1V98A 5IPHA 5GAND 1NW2A 4MF5A 2I3YA 1ERVA 3GN3A 2HRKB 4PXOA 4WETA 4TN8A 3PR8A 1OC3A 1PQNA 1MTCA 3KJYA 1WIKA 3F3QA 3I9V2 3GTUA 2V32A 4GXZA 4IVFA 1QK8A 3M3MA 2HRFA 3RPPA 3NIVA 4JEDA 1UN2A 4KCAA 4NMUA 1B9YC 1PL2A 4IJIA 2HRKA 1MDKA 1RK4A 3D22A 4L5LA 5ELGA 4XS4B 4KAEA 3DVXA 3E9JB 2X64A 2GTUA 4KUNA 2FCHA 3D4MA 3GL3A 3MAKA 5ECLB 3CXGA 2RLIA 1GL8A 4GRFA 4IGJA 2OADA 2O8VB 5IPGA 2CZ2A 1XW5A 3TKSE 3KZQA 1JHBA 4IQAA 1JZWA 5ENUA 2C4JA 1DE1A 2CAIA 3VURA 4PUAA 2B7KA 5IMDA 2MYGA 4DSSB 2VL3A 3H1NA 2DLXA 3I43A 1GSSA 2RIIA 3FRCA 1K0OA 4TW5A 3FR3A 1I5GA 3TB2A 3APOA 5FWGA 1F37A 7GSSA 4WR4A 4K7IA 4EL1A 2LRNA 1XVWA 2PPTA 5KN1A 5J9BA 3UMAA 3HYPA 4I97A 1SK0A 3C71A 5AISA 3GA4A 1AIUA 4RQXA 4DSSA 3RPNA 3EMXA 2GLRA 1PRXA 4EO3A 1T3BA 3DXBA 5AIXA 4ZIJA 3EU4A 1HNAA 2NDOA 1PX7A 2Z9SA 4LMVA 4BWQA 5ECQB 4QL7A 3F6DA 5B8BA 5J3RA 5B6NA 4F03A 3EYTA 2VD0A 1THOA 3RDWA 1QFNA 4KDYA 2QC7A 1GWCA
chains in the Genus database with same CATH superfamily
3KH9A 4Z2RA 2V1MA 2GSRA 2AJQB 3TKRA 3WYWA 2MMOA 4PNFA 3NOFA 2HZEA 4GTUA 3MIXA 2RUFA 3WGXA 2H8LA 4O92A 2L6CA 3DWVA 2O5VA 5ECOB 4L8EA 4KSMA 3J7Yk 1ZYQB 2XPDA 3D4TA 5AIVA 4BVYB 3GL5A 1M3JA 1GLPA 1BQ7A 2YOIA 5J4VA 1BG1A 3U6VA 1GSQA 3HMJG 4G0KA 1XCCA 4ULXA 4F0CA 1TU8A 4IKHA 2M80A 3DEXA 5GSSA 5LNKe 2O7KA 2JACA 1QXHA 3C73A 1SJIA 1X5CA 1K0NA 4NWYA 6GSTA 1MEKA 4I5QA 1FO5A 4HU7A 3MSZA 4KSOA 4K5SA 13GSA 3TRPA 4IS0A 12GSA 3IAS2 4K8MA 5J40A 4MJAA 1AUCA 3GKNA 16GSA 4ZBAA 1U3AA 3IRAA 4EKZA 2TRXA 4ZL9A 3HCZA 3ZIJA 2KOKA 1J08A 3QAWA 4MDCA 1OKDA 1ZYEA 1F6MC 3PH9A 3QAVA 1XOAA 3PINA 4K0GA 1PMTA 4A5PA 4Z2UA 5ECPB 4PURA 2A4VA 1GTAA 2P31A 5IQYA 2H1BA 5HFIA 3CWGA 4KX4A 5F06A 3H8QA 5D8IA 1DBYA 1EEJA 4HZ2A 2YV9A 11GSA 1B4PA 1PX6A 5ECNB 1A2LA 2HT9A 2DMMA 4HJ2A 2KP2A 5H5RA 5F07A 4W66A 2VM2A 1TK0B 2O36A 2FWFA 2FWEA 3W8SA 2I81A 4GF0A 3G9BA 2GS3A 2H6ZA 1TXXA 4EC0A 3KCMA 2VCWA 1GLQA 4XRAA 1ZL9A 1GSDA 1X9MB 1JZRA 4JZQA 4F2IA 2LQOA 3EE2A 2XBQA 3P90A 2B3SA 2IFQB 2VKZG 3IE3A 3R3EA 4KGIA 4ZBDA 3F4RA 4ZILA 2WZ9A 2RM5A 2KUCA 2NPBA 3TKSC 4RI6A 1WOUA 2LUSA 4ACSA 2OJLA 2WVXB 4TVEA 4D73B 4GWRA 2GZPA 5JWQB 5F8BA 2YP6A 3I69A 1A0RP 1V40A 2FWGA 1UA5A 3QR6A 4AJ6A 2B7JA 3HZ8A 3LSZA 1GTUA 3ZL5A 2F8AA 3GH9A 4QQ7A 2LEGA 2I4AA 3Q6OA 4KCEA 4WBJA 2OE0A 2LS5A 3E3EA 4POLA 4GQFA 3FEUA 1HQOA 1PL1A 3MWHA 3CSIA 2WW2A 4IHUA 4N0ZA 2R3XA 5KEJA 1X5EA 1NM3A 2QGVA 3FY7A 2VLTA 4EVMA 3VWXA 1ZYPA 3QFBC 2VL2C 3GSTA 1EOHA 1TK8B 2H75A 4HDEA 1THXA 1OC9A 3HJPA 2FWHA 2YNXA 4HS1A 5CO3A 4J2FA 2ZNMA 1K3YA 4ID0A 1FAAA 1LJRA 1OE8A 2OACA 4NPBA 3A5WA 2DC5A 3R2QA 3EC3A 1GUKA 5D9XA 2L4CA 2DMLA 3KEBA 2H73A 4OMVA 1TI3A 4HQZA 4KDXA 2E2MA 4MZCA 1U88A 1ABAA 5D9VA 2NVLA 3L9SA 1ZCPA 3TDGA 2J9HA 3TRXA 5A1NB 4YQUA 4G19A 3S9FA 1A0FA 2GQLA 4K5RA 3OR5A 4ZB8A 4O5RA 1EGRA 5D93A 1O8XA 2YJHA 1ZZYA 1QUWA 2IMEA 4OCEA 2PUKC 4V1Ag 4AKGA 2X99A 1VF2A 3M9JA 3D21A 2V6KA 3M8NA 4TOPA 1Z5YE 1IYHA 5HR2A 4J57E 1JFUA 1XFLA 4JR6A 3UJ1A 4E68A 2L4QA 2DKIA 2GGTA 2GT6A 3GYKA 2LKUA 3IDVA 2B5YA 3L9VA 2DJ3A 2OE1A 1KTEA 2L5LA 1W89A 4HUAA 2DIYA 4X1UA 1O73A 1HD2A 4MNNA 3GFKA 2M72A 2VAFA 2H76A 3ZFLA 3HZ4A 2KLXA 1DE2A 2C0FA 1R5PA 1RQMA 3FK8A 2C80A 2DSAA 2LV3A 1UVZA 4FH8A 4CY8A 4NV5A 5J4YA 1ILOA 2YANA 3EMPA 3M9KA 2H1LA 3TJFA 4L5OA 1FVJA 3KP8A 2VCXA 1F9MA 1XWAA 3UVHA 5G5EA 4ILFA 3CRTA 3CMIA 4OO5A 2R0CA 3EVIA 4MA9A 4X0XA 3WT2A 3C7MA 4WR5A 3RGBC 3BBYA 1GSEA 3EURA 1K0BA 2IIYA 3DMLA 2FA8A 2O85A 3TCOA 4KW6A 1FG4A 4IN0A 1YF0A 2EC4A 3GURA 5GAPD 2B1LA 4AKXB 3CBUA 1T7PB 2PGTA 1N8JA 2N5FA 4CHSA 3IV4A 4MP4A 1BJXA 1Z6NA 3CSHA 2EFHA 3M1GA 5H5QA 1GULA 2HNLA 1SJ6A 3UBKA 2WRTA 9GSSA 2WW3A 2JSYA 4XRDA 3ZIVA 1Y25A 1AW9A 5C00A 5DJMA 2V2GA 2VLUA 1FB0A 4RUVA 1EV9A 2FGXA 2EIQA 3TRQA 1HNBA 4OO4A 4G01A 1S3CA 2JZRA 3IC8A 3IC4A 5HR3A 5LCZA 4CW9A 2C3NA 4XS4A 2DJ0A 4N10A 3KTBA 3BD2A 3LG6A 3LJRA 4Q5QA 3DYRA 3VK9A 4MK3A 1MDIA 1USBA 3F63A 2YZUA 5A5HB 2O87A 4NHWA 4MJBA 3ZLPA 5HR0A 5B8AA 2CVKA 2FA4A 1Y6EA 3KMOA 3IA1A 3LGCA 2HZFA 4MF6A 4HU9A 2QKEA 4IP1A 1GTIA 2UZ8A 3O6TA 3GH6A 1WPIA 1PSQA 2YJ7A 4PTSA 4DEJA 2FLSA 2OKAA 1Z3EA 1OE7A 5DVBA 4O7HA 5A34B 4AKIA 4YH2A 1M3IA 3QD9A 1TTZA 5CREA 5BMUB 3KMNA 5ECSA 2CVDA 4F9ZA 3DGQA 3M0FA 1S3DA 3VI5A 4DSQA 1ERUA 3ZTLA 3CYNA 1KNGA 5A4UA 1GRXA 2HRAA 1FOHA 3GNJA 1Q4JA 6GSUA 5A34A 4XS6A 6GSVA 5E59A 4AF2A 1XVQA 1TXUA 1ZYNA 1ACVA 3VWWA 2MMNA 2HFDA 3L9UA 3ME7A 2LJRA 3GIXA 1IYIA 1K3OA 4ECJA 4GQCA 3FKFA 4PX1A 5INYA 5GSTA 1E6BA 1XZOA 4F0BA 5H5SA 4Z7XA 3PPUA 1GSYA 4ZB6A 3EWLA 3A2WA 1TRWA 1M9BA 4YAPA 3ZVJA 2N5BA 1TDIA 2M46A 1E2YA 4MLYA 1QMVA 3FHKA 4ECCA 1A2MA 4G0IA 3TGZA 2ZUPA 20GSA 5D9WA 5A5KA 4KH7A 4BVYA 2YWIA 4KE3A 1M2DA 4TRXA 3TKSA 3WGDA 5CP1A 4L0UA 1MDJA 1Z7RA 4P3YB 2YWOA 1ERWA 2XHFA 1YDKA 1G6YA 3CHXC 1TRUA 2WULA 4EUYA 3CTGA 1NHOA 2HRNA 5CRWA 4LL4B 1TK5B 4MZBA 2MBTA 2VO4A 3O3TA 2GZZA 1PKZA 1GH2A 4IELA 3MNGA 1Z6MA 1YZXA 4BA7A 3F3RA 4N0VA 2PN8A 1FHEA 1A23A 1X5DA 1XWCA 1VF1A 1EGOA 3TJJA 1NHYA 4WBRD 3SWLA 4BPYA 2YCDA 3KIJA 2VL2A 5A4VA 2C0GA 4USSA 2B1KA 3TJBA 4JBBA 3FZ4A 4KA0A 3G7JA 1M0UA 5EL8A 5IO2A 1T4ZA 5IOWA 5IM9A 3F6FA 1C72A 4X4JA 3NZNA 2WCIA 5CRDA 3LORA 3RAZA 5AGYA 2L6DA 2R0GA 2YWMA 4ZB9A 1U3IA 5DDLA 3FMWA 4NXIA 1VF3A 4N30A 2IL3A 2WDUA 4LA1A 4MPFA 2H6YA 5F0GA 3UARA 1G7OA 5A4WA 1ZMAA 4E8HA 5HFGA 4G0LA 3A5IA 4ML1A 1BEDA 3IBHA 1A8YA 3UL3A 1A8LA 5CYYA 4PGTA 14GSA 4RI7A 4V2NA 4MPGA 1GNEA 1SL2B 2WVZA 3IOSA 5COHA 4TXOB 3UOMA 2WS2A 1OYJA 2F51A 2H01A 1GP1A 4FQUA 4TR1B 4POMA 2LSTA 2AYTA 4CY6A 3C1SA 2X4AA 1CQGA 4EXJA 2KHPA 2I9HA 3F4TA 1YVLA 1URMA 1FOVA 1U87A 2V41A 4BVXB 4EF0A 3EINA 5D73A 2IFQA 1EP7A 4IQ1A 3HVXA 3LWAA 3TJGA 1Z9HA 1MD3A 5KN2A 3F0IA 1KEBA 2GQMA 5G30A 2DJ2A 3US3A 22GSA 19GSA 2WVXA 4D73A 4WF4A 1SKSB 2CX4A 2XC2A 2GSSA 3TKQA 4ZL7A 4BVXA 4AJ7A 3C1RA 2XBIA 5KOWA 1PGTA 1O7UA 4MMMA 3LW9A 3QOUA 2ES7A 1H4OA 2A2PA 5C04A 3GUSA 3APQA 3L0HA 2TRCP 1ML6A 4Q5NA 3TJKA 1EEMA 4F82A 3LEFA 2JSZA 4BL7B 2HXKA 2R37A 1A2JA 3DVWA 3GX0A 1SK1A 3HVSA 4K2XA 2D2ZA 1O85A 2TIRA 3FR9A 4PNGA 2JZTA 1BX9A 4XTSA 4IJ3A 4FYBA 4CDOA 2MBSA 5HFKA 2IMKA 2WJUA 5ABRA 4Q5FA 5J4UA 3A2VA 2VCZA 2X49A 4EE0A 2CAQA 2FY6A 3GX8A 2HSMB 2XPEA 1MD4A 1Y1UA 2PBJA 1BF5A 4BWSA 1K0DA 4PHZC 5ID2B 4K7OA 1SVLA 2PVOC 1SVMA 1PKWA 5DJLA 1Z7PA 2JZSA 2VIMA 1X9SB 4POKA 1K0MA 3GKMA 2QA2A 3JCML 5JWRB 1SU9A 1M99A 2OE3A 2VCVA 3KH7A 3H93A 1M2BA 2HSMA 1G7EA 4OFTA 1YEPA 5A1NA 4EIPA 1PD21 3TUEA 2QSIA 1TRSA 2BMXA 3VFIA 1N2AA 4OD7A 2OA7A 5ID2A 5ECMB 2YPMA 1XW6A 2WGRA 3GSSA 5DALB 5J47A 4WF5A 2A2RA 1G6WA 2VD1A 2B5XA 4NHZA 4EDYA 1O8WA 4KF9A 5DAKB 1JZOA 1CQHA 2HSHA 2C3TA 5EPFA 3VPQA 1XPVA 2P5QA 2BJXA 4PI2C 1T1VA 2FUG2 4MJEA 1J9BA 4YQVA 4HSCX 4AJ8A 2FD3A 3Q18A 2HE3A 2DKHA 1EP8A 2E7PA 1R7HA 5IMAA 3VWVA 3ME8A 3TU3B 2BTOT 1AC1A 1EV4A 1FW1A 5EVOA 3HJOA 2UV8G 2GSQA 3BJ5A 3G7IA 1HNCA 4N11A 4JU5A 1I1IP 4YKFA 4FIWA 4J56E 2L5OA 4JRRA 4DSRA 4ZBBA 1W4VA 2GDRA 3FZAA 2IWTA 2P0GA 3WD6A 1GSFA 5EY6A 3UAPA 2B5EA 2L59A 2E2GA 1EZKA 4PUFC 1GTBA 18GSA 1VGLA 3W8JA 4PQIA 3KP9A 3GTUB 1SD8A 3F9UA 2H1DA 2H6XA 4AGSA 3LQ7A 2WFCA 4DVCA 5IIZA 3BCKA 1DUGA 1V58A 4GDFA 3VWUA 1TJDA 4BIKA 1M9AA 4FXYP 4YAVA 2AAWA 5J41A 1EWXA 1K0AA 1ERTA 3LXZA 2EIRA 2F3MA 2DJJA 3G7YA 2ZCTA 3HJMA 2LJAA 3GV1A 1SL0B 2H70A 2CV4A 1B4QA 10GSA 1VF4A 2OBIA 1QQ2A 3ERGA 2H0IA 2YZHA 1OC8A 1G0TA 1AQWA 1XWGA 2KP1A 5IMZA 2HLSA 1AQXA 1SL1B 3GKXA 5HR1A 1H75A 2VCTA 3ZYWA 3UEMA 3KGKA 1TKDB 3DKSA 5ECKB 2V6OA 1WMJA 4MH2A 1F3BA 1TW9A 1XWKA 3IPZA 3BCIA 1V2AA 3ZMLA 3WT1A 1JZDA 4IW9A 4KB3A 1T4YA 1PA3A 2OBKA 4G2EA 2N5AA 4I6XA 1ON4A 2H19A 4LLRA 2QA1A 3HY2A 4OWYA 5IMCA 6GSWA 1PN0A 4HI7A 3WGEA 1Q98A 1ST9A 3RHCA 6GSYA 2WB9A 3F8UA 4MCUA 4ML6A 5ECRB 2IJYA 1T00A 4ISDA 3FZ9A 1RW1A 5A5HA 1AAZA 4GCIA 4JR4A 2HSYA 1YY7A 2O3EA 1R26A 1I9DA 3RBTA 1TI1A 3A3TA 2ALBA 3HVNA 3KTLA 3GRXA 3O76A 4NAXA 2F8FA 5JWOB 1SD9A 3Q19A 5LD0A 2R6KA 4X43A 4I2UA 4I2TA 3P8WA 4EDZA 4V1Ap 1K0CA 3U5RE 2GSTA 4TR4A 3CSJA 2DIZA 3ERWA 5B7CA 5JCGA 2HZEB 2VUPA 3RFRC 2GT5A 1M7TA 5GZZB 5G1LA 5BMUA 5B6MA 2PVQA 3BOAA 4HOJA 1V9WA 2R4VA 5HQPA 3IHGA 3J7Yb 4AI6A 4K6XA 3EU3A 2ON7A 4LL1B 2VCQA 2C8UA 2A4HA 2LNSA 4Z2TA 3IXRA 4N3ZA 2LQQA 4TR0A 5E4WA 4KDUA 2DBCA 1TP9A 8GSSA 3N5OA 1OVNA 3MYDA 2H1AA 2EFDA 1FVKA 2CVBA 1TU7A 3LXTA 4LMWA 3L78A 3VLNA 5IMVA 2K8SA 3P2AA 2K6VA 3GMFA 3ERFA 4ZB7A 5CNWA 5D9TA 4OFNA 1WE0A 1S3AA 2IMDA 4MH3A 3HKRA 3P7XA 2R2JA 3EPTA 1AQVA 4GLTA 1VRSD 2VLVA 1SKRB 3L4NA 3ISOA 4ECIA 2LRTA 1GUHA 1OKTA 4FO5A 5AN1A 3D5JA 4G10A 3IHQA 2OT3A 1B48A 1SVOA 1YQ1A 3DIEA 3CTFA 1QGVA 3IAM2 1GUMA 2PERA 3ZRDA 1GNWA 2H0GA 2IN3A 1EOGA 3UVTA 1KBNA 2G2QA 2VL9A 5FHIA 2R0PA 4K2DA 4HZ4A 4GSNA 3MDKA 1TOFA 1K3LA 3I6AA 4NV2A 3FYGA 1SJZA 5G5FA 5ECIB 1ZOFA 3FZ5A 3HD5A 5L71A 2LRCA 3QDNA 4ZL8A 1WRYA 3F4SA 2RUEA 2MMAA 2C3QA 2A2SA 1SYXA 2WZSA 5IMFA 3RHBA 3HA9A 4HQSA 5F05A 1HYUA 1JLWA 3IK7A 2AHEA 1XOBA 3ZVJD 1F2EA 2CT6A 5ELAA 4FYCA 1T8EB 1A24A 4O32A 4IBPA 2J23A 3QAGA 2X8GA 3KXOA 1LBKA 1LU4A 2H1GA 3AY8A 2WW0A 3D0ZA 2JADA 2AUVA 4MABA 2PU9C 1AXDA 3HDCA 1O6JA 2P5RA 3GKKA 2H71A 2JU5A 5G2ZA 2AV4A 2EIOA 1BYEA 4Q5RA 2VM1A 2AB6A 2VOCA 2R5GA 2C1YA 2C0DA 1NSWA 5G1KA 4L0WA 2DJ1A 4POBA 5CAXA 1BG5A 3DRNA 3KM6A 2F9SA 4TXOA 3C8EA 3PGTA 1TRVA 1XBSA 5DQYA 5G31A 2CX3A 2JL4A 4GSSA 3IK9A 1B9XC 5IOXA 4HJMA 4QMKA 3GHAA 3UIWA 4TR1A 2IMFA 1B8XA 3A2XA 4K1FA 5JCUA 1R5AA 6GSXA 3DD3A 1F3AA 2GZYA 2ON5A 4WXTA 4HEA2 3IR4A 4EIQA 3FW2A 1XW9A 4FYUA 4E8EA 2IMIA 2IPAA 3KD0A 4OCFA 2I1UA 1O81A 1BAYA 1OC9B 4TXVA 2GQKA 4ICYA 1SYRA 5BRTA 4K0NA 1JLVA 1X9WB 4QL9A 4JE1A 1PN9A 2FHEA 1R4WA 3ZREA 2LNTA 3TKPA 1X0RA 2CZ3A 3LYKA 3HVVA 3LFLA 1YKCA 3ZITA 3D6IA 1DSBA 3QFAC 5KN0A 3N9JA 2X8HA 3SBCA 5IO0A 2HQTA 3K8NA 2HYXA 1YKAA 5ECHB 2O89A 3H79A 4IP6A 2C0EA 2REMA 1GSUA 2MZCA 2CA8A 4GSTA 2LJKA 3HXSA 1WJKA 5DQSA 4BL7A 5J9CA 3HHVA 1PFOA 4O5QA 4OFMA 5CRGA 17GSA 2RM6A 3ZZXA 3H4KA 5DBQA 3VPTA 1V57A 2H72A 2H30A 2EFEA 3TOTA 3VI7A 1FB6A 4TR3A 4H86A 2CQ9A 1XG8A 2H74A 2MMZA 2H0HA 3V1WA 2K8VA 1YF1A 3QMXA 1XIYA 5CRHA 4ECBA 2YV7A 3APSA 4K7NA 3ED3A 3W6GA 1XXUA 3QCPA 2YN1A 4YQMA 3CRUA 1XWBA 2G0FA 4WEYA 1SK2A 4XIHA 1S4BP 3ZFBA 6GSSA 2HI7A 1UC7A 4K9ZA 5DCGA 2PMTA 2K18A 4XHMA 3E0UA 4I8BA 2HSNB 5FT3A 3QPMA 4V2MA 5DCHA 3FR6A 4KNDA 4XCSA 5KN3A 2X8CA 2B6MA 4WKWA 4TKYA 3LYPA 5J5NA 4RQRA 1SKWB 4MZWA 2GVPA 5DALA 2PWJA 5DAKA 2YWNA 3CQFA 3UBLA 2HSNA 2E0QA 3ZMKA 2DJKA 2FNOA 1OAZA 1WWJA 4V2LA 1YJ6A 4XS1A 1YEXA 3Q74A 2H66A 1M2AA 1SENA 2LTKA 2NTOA 4ZXGA 1U6TA 5D96A 1ZGNA 4MJCA 2K9FA 2NBSA 4PQHA 3TOUA 5JCWA 4G9HA 1WP0A 1J0FA 4MF7A 1YEWC 4PQ1A 2L57A 1V98A 5IPHA 5GAND 2WVYA 1NW2A 4MF5A 2I3YA 1ERVA 3GN3A 2HRKB 4PXOA 4WETA 4TN8A 3PR8A 2WW1A 1OC3A 1PQNA 1MTCA 2EFCA 3KJYA 1WIKA 3F3QA 3I9V2 3GTUA 2V32A 4GXZA 4IVFA 1QK8A 3M3MA 2HRFA 3RPPA 3NIVA 4JEDA 1UN2A 4KCAA 4NMUA 1B9YC 1PL2A 4IJIA 2HRKA 1MDKA 1RK4A 3D22A 4L5LA 5ELGA 4XS4B 4KAEA 3DVXA 4PI0C 3E9JB 2X64A 2GTUA 4KUNA 2FCHA 3D4MA 3GL3A 3MAKA 5ECLB 3CXGA 2RLIA 1GL8A 4GRFA 4IGJA 2OADA 2O8VB 5IPGA 2CZ2A 1XW5A 3TKSE 3KZQA 1JHBA 1N25A 4IQAA 1JZWA 5ENUA 2C4JA 1DE1A 5KOXA 2CAIA 3VURA 4PUAA 2B7KA 5IMDA 2MYGA 4DSSB 2VL3A 3H1NA 2DLXA 3I43A 1GSSA 2RIIA 3FRCA 1K0OA 4TW5A 3FR3A 1I5GA 3TB2A 3APOA 5FWGA 1F37A 7GSSA 4YKGA 4WR4A 4K7IA 4EL1A 2LRNA 1XVWA 2PPTA 5KN1A 1S3RA 4O5UA 5J9BA 3UMAA 3HYPA 4I97A 1SK0A 3C71A 5AISA 3GA4A 1AIUA 4RQXA 4DSSA 3RPNA 3EMXA 2GLRA 1PRXA 4AKHA 4EO3A 1T3BA 3DXBA 5AIXA 4ZIJA 3EU4A 1HNAA 2NDOA 1PX7A 2Z9SA 4LMVA 4BWQA 5ECQB 4QL7A 3F6DA 5B8BA 5J3RA 5B6NA 4F03A 3EYTA 2VD0A 1THOA 3RDWA 1QFNA 4KDYA 2QC7A 1GWCA
chains in the Genus database with same CATH topology
3KH9A 4Z2RA 2V1MA 2GSRA 2AJQB 3TKRA 3WYWA 2MMOA 4PNFA 3NOFA 2HZEA 4GTUA 3MIXA 2RUFA 3WGXA 2H8LA 4O92A 2L6CA 3DWVA 2O5VA 5ECOB 4L8EA 4KSMA 3J7Yk 1ZYQB 2XPDA 3D4TA 5AIVA 4BVYB 3GL5A 1GLPA 1BQ7A 2YOIA 5J4VA 1BG1A 3U6VA 1GSQA 3HMJG 4G0KA 1XCCA 4ULXA 4F0CA 1TU8A 4IKHA 2M80A 3DEXA 5GSSA 5LNKe 2O7KA 2JACA 1QXHA 3C73A 1SJIA 1X5CA 1K0NA 4NWYA 6GSTA 1MEKA 4I5QA 1FO5A 4HU7A 3MSZA 4KSOA 4K5SA 13GSA 3TRPA 4IS0A 12GSA 3IAS2 4K8MA 5J40A 4MJAA 1AUCA 3GKNA 16GSA 4ZBAA 1U3AA 3IRAA 4EKZA 2TRXA 4ZL9A 3HCZA 3ZIJA 2KOKA 1J08A 3QAWA 4MDCA 1OKDA 1ZYEA 1F6MC 3PH9A 3QAVA 1XOAA 3PINA 4K0GA 1PMTA 4A5PA 4Z2UA 5ECPB 4PURA 2A4VA 1GTAA 2P31A 5IQYA 2H1BA 5HFIA 3CWGA 4KX4A 5F06A 3H8QA 5D8IA 1DBYA 1EEJA 4HZ2A 2YV9A 11GSA 1B4PA 1PX6A 5ECNB 1A2LA 2HT9A 2DMMA 4HJ2A 2KP2A 5H5RA 5F07A 4W66A 2VM2A 1TK0B 2FWFA 2FWEA 3W8SA 2I81A 4GF0A 3G9BA 2GS3A 2H6ZA 1TXXA 4EC0A 3KCMA 2VCWA 1GLQA 4XRAA 1ZL9A 1GSDA 1X9MB 1JZRA 4JZQA 4F2IA 2LQOA 3EE2A 2XBQA 3P90A 2B3SA 2IFQB 2VKZG 3IE3A 3R3EA 4KGIA 4ZBDA 3F4RA 4ZILA 2WZ9A 2RM5A 2KUCA 2NPBA 3TKSC 4RI6A 1WOUA 2LUSA 4ACSA 2OJLA 4TVEA 4D73B 4GWRA 2GZPA 5JWQB 5F8BA 2YP6A 3I69A 1A0RP 1V40A 2FWGA 1UA5A 3QR6A 4AJ6A 2B7JA 3HZ8A 3LSZA 1GTUA 3ZL5A 2F8AA 3GH9A 4QQ7A 2LEGA 2I4AA 3Q6OA 4KCEA 4WBJA 2OE0A 2LS5A 3E3EA 4POLA 4GQFA 3FEUA 1HQOA 1PL1A 3MWHA 3CSIA 4IHUA 4N0ZA 2R3XA 5KEJA 1X5EA 1NM3A 2QGVA 3FY7A 2VLTA 4EVMA 3VWXA 1ZYPA 3QFBC 2VL2C 3GSTA 1EOHA 1TK8B 2H75A 4HDEA 1THXA 1OC9A 3HJPA 2FWHA 2YNXA 4HS1A 5CO3A 4J2FA 2ZNMA 1K3YA 4ID0A 1FAAA 1LJRA 1OE8A 2OACA 4NPBA 3A5WA 2DC5A 3R2QA 3EC3A 1GUKA 5D9XA 2L4CA 2DMLA 3KEBA 2H73A 4OMVA 1TI3A 4HQZA 4KDXA 2E2MA 4MZCA 1U88A 1ABAA 5D9VA 2NVLA 3L9SA 1ZCPA 3TDGA 2J9HA 3TRXA 5A1NB 4YQUA 4G19A 3S9FA 1A0FA 2GQLA 4K5RA 3OR5A 4ZB8A 4O5RA 1EGRA 5D93A 1O8XA 2YJHA 1ZZYA 1QUWA 2IMEA 4OCEA 2PUKC 4V1Ag 4AKGA 2X99A 1VF2A 3M9JA 3D21A 2V6KA 3M8NA 4TOPA 1Z5YE 1IYHA 5HR2A 4J57E 1JFUA 1XFLA 4JR6A 3UJ1A 4E68A 2L4QA 2DKIA 2GGTA 2GT6A 3GYKA 2LKUA 3IDVA 2B5YA 3L9VA 2DJ3A 2OE1A 1KTEA 2L5LA 1W89A 4HUAA 2DIYA 4X1UA 1O73A 1HD2A 4MNNA 3GFKA 2M72A 2VAFA 2H76A 3ZFLA 3HZ4A 2KLXA 1DE2A 2C0FA 1R5PA 1RQMA 3FK8A 2C80A 2DSAA 2LV3A 1UVZA 4FH8A 4CY8A 4NV5A 5J4YA 1ILOA 2YANA 3EMPA 3M9KA 2H1LA 3TJFA 4L5OA 1FVJA 3KP8A 2VCXA 1F9MA 1XWAA 3UVHA 5G5EA 4ILFA 3CRTA 3CMIA 4OO5A 2R0CA 3EVIA 4MA9A 4X0XA 3WT2A 3C7MA 4WR5A 3BBYA 1GSEA 3EURA 1K0BA 2IIYA 3DMLA 2FA8A 2O85A 3TCOA 4KW6A 1FG4A 4IN0A 1YF0A 2EC4A 3GURA 5GAPD 2B1LA 4AKXB 3CBUA 1T7PB 2PGTA 1N8JA 2N5FA 4CHSA 3IV4A 4MP4A 1BJXA 1Z6NA 3CSHA 2EFHA 3M1GA 5H5QA 1GULA 2HNLA 1SJ6A 3UBKA 2WRTA 9GSSA 2JSYA 4XRDA 3ZIVA 1Y25A 1AW9A 5C00A 5DJMA 2V2GA 2VLUA 1FB0A 4RUVA 1EV9A 2FGXA 2EIQA 3TRQA 1HNBA 4OO4A 4G01A 1S3CA 2JZRA 3IC8A 3IC4A 5HR3A 5LCZA 4CW9A 2C3NA 4XS4A 2DJ0A 4N10A 3KTBA 3BD2A 3LG6A 3LJRA 4Q5QA 3DYRA 3VK9A 4MK3A 1MDIA 1USBA 3F63A 2YZUA 5A5HB 2O87A 4NHWA 4MJBA 3ZLPA 5HR0A 5B8AA 2CVKA 2FA4A 1Y6EA 3KMOA 3IA1A 3LGCA 2HZFA 4MF6A 4HU9A 2QKEA 4IP1A 1GTIA 2UZ8A 3O6TA 3GH6A 1WPIA 1PSQA 2YJ7A 4PTSA 4DEJA 2FLSA 2OKAA 1Z3EA 1OE7A 5DVBA 4O7HA 5A34B 4AKIA 4YH2A 3QD9A 1TTZA 5CREA 5BMUB 3KMNA 5ECSA 2CVDA 4F9ZA 3DGQA 3M0FA 1S3DA 3VI5A 4DSQA 1ERUA 3ZTLA 3CYNA 1KNGA 5A4UA 1GRXA 2HRAA 1FOHA 3GNJA 1Q4JA 6GSUA 5A34A 4XS6A 6GSVA 5E59A 4AF2A 1XVQA 1TXUA 1ZYNA 1ACVA 3VWWA 2MMNA 2HFDA 3L9UA 3ME7A 2LJRA 3GIXA 1IYIA 1K3OA 4ECJA 4GQCA 3FKFA 4PX1A 5INYA 5GSTA 1E6BA 1XZOA 4F0BA 5H5SA 4Z7XA 3PPUA 1GSYA 4ZB6A 3EWLA 3A2WA 1TRWA 1M9BA 4YAPA 3ZVJA 2N5BA 1TDIA 2M46A 1E2YA 4MLYA 1QMVA 3FHKA 4ECCA 1A2MA 4G0IA 3TGZA 2ZUPA 20GSA 5D9WA 5A5KA 4KH7A 4BVYA 2YWIA 4KE3A 1M2DA 4TRXA 3TKSA 3WGDA 5CP1A 4L0UA 1MDJA 1Z7RA 4P3YB 2YWOA 1ERWA 2XHFA 1YDKA 1G6YA 2WULA 1TRUA 4EUYA 3CTGA 1NHOA 2HRNA 5CRWA 4LL4B 1TK5B 4MZBA 2MBTA 2VO4A 3O3TA 2GZZA 1PKZA 1GH2A 4IELA 3MNGA 1Z6MA 1YZXA 4BA7A 3F3RA 4N0VA 2PN8A 1FHEA 1A23A 1X5DA 1XWCA 1VF1A 1EGOA 3TJJA 1NHYA 4WBRD 3SWLA 4BPYA 2YCDA 3KIJA 2VL2A 5A4VA 2C0GA 4USSA 2B1KA 3TJBA 4JBBA 3FZ4A 4KA0A 3G7JA 1M0UA 5EL8A 5IO2A 1T4ZA 5IOWA 5IM9A 3F6FA 1C72A 4X4JA 3NZNA 2WCIA 5CRDA 3LORA 3RAZA 5AGYA 2L6DA 2R0GA 2YWMA 4ZB9A 1U3IA 5DDLA 3FMWA 4NXIA 1VF3A 4N30A 2IL3A 2WDUA 4LA1A 4MPFA 2H6YA 5F0GA 3UARA 1G7OA 5A4WA 1ZMAA 4E8HA 5HFGA 4G0LA 3A5IA 4ML1A 1BEDA 3IBHA 1A8YA 3UL3A 1A8LA 5CYYA 4PGTA 14GSA 4RI7A 4V2NA 4MPGA 1GNEA 1SL2B 3IOSA 5COHA 4TXOB 3UOMA 2WS2A 1OYJA 2F51A 2H01A 1GP1A 4FQUA 4TR1B 4POMA 2LSTA 2AYTA 4CY6A 3C1SA 2X4AA 1CQGA 4EXJA 2KHPA 2I9HA 3F4TA 1YVLA 1URMA 1FOVA 1U87A 2V41A 4BVXB 4EF0A 3EINA 5D73A 2IFQA 1EP7A 4IQ1A 3HVXA 3LWAA 3TJGA 1Z9HA 1MD3A 5KN2A 3F0IA 1KEBA 2GQMA 5G30A 2DJ2A 3US3A 22GSA 19GSA 4D73A 4WF4A 1SKSB 2CX4A 2XC2A 2GSSA 3TKQA 4ZL7A 4BVXA 4AJ7A 3C1RA 2XBIA 5KOWA 1PGTA 1O7UA 4MMMA 3LW9A 3QOUA 2ES7A 1H4OA 2A2PA 5C04A 3GUSA 3APQA 3L0HA 2TRCP 1ML6A 4Q5NA 3TJKA 1EEMA 4F82A 3LEFA 2JSZA 4BL7B 2HXKA 2R37A 1A2JA 3DVWA 3GX0A 1SK1A 3HVSA 4K2XA 2D2ZA 1O85A 2TIRA 3FR9A 4PNGA 2JZTA 1BX9A 4XTSA 4IJ3A 4FYBA 4CDOA 2MBSA 5HFKA 2IMKA 2WJUA 5ABRA 4Q5FA 5J4UA 3A2VA 2VCZA 2X49A 4EE0A 2CAQA 2FY6A 3GX8A 2HSMB 2XPEA 1MD4A 1Y1UA 2PBJA 1BF5A 4BWSA 1K0DA 5ID2B 4K7OA 1SVLA 2PVOC 1SVMA 1PKWA 5DJLA 1Z7PA 2JZSA 2VIMA 1X9SB 4POKA 1K0MA 3GKMA 2QA2A 3JCML 5JWRB 1SU9A 1M99A 2OE3A 2VCVA 3KH7A 3H93A 1M2BA 2HSMA 1G7EA 4OFTA 1YEPA 5A1NA 4EIPA 1PD21 3TUEA 2QSIA 1TRSA 2BMXA 3VFIA 1N2AA 4OD7A 2OA7A 5ID2A 5ECMB 2YPMA 1XW6A 2WGRA 3GSSA 5DALB 5J47A 4WF5A 2A2RA 1G6WA 2VD1A 2B5XA 4NHZA 4EDYA 1O8WA 4KF9A 5DAKB 1JZOA 1CQHA 2HSHA 2C3TA 5EPFA 3VPQA 1XPVA 2P5QA 2BJXA 4MJEA 1T1VA 2FUG2 1J9BA 4YQVA 4AJ8A 2FD3A 3Q18A 2HE3A 2DKHA 1EP8A 2E7PA 1R7HA 5IMAA 3VWVA 3ME8A 3TU3B 2BTOT 1AC1A 1EV4A 1FW1A 5EVOA 3HJOA 2UV8G 2GSQA 3BJ5A 3G7IA 1HNCA 4N11A 4JU5A 4YKFA 4FIWA 4J56E 2L5OA 4JRRA 4DSRA 4ZBBA 1W4VA 2GDRA 3FZAA 2IWTA 2P0GA 3WD6A 1GSFA 5EY6A 3UAPA 2B5EA 2L59A 2E2GA 1EZKA 4PUFC 1GTBA 18GSA 1VGLA 3W8JA 4PQIA 3KP9A 3GTUB 1SD8A 3F9UA 2H1DA 2H6XA 4AGSA 3LQ7A 2WFCA 4DVCA 5IIZA 3BCKA 1DUGA 1V58A 4GDFA 3VWUA 1TJDA 1M9AA 4YAVA 2AAWA 5J41A 1EWXA 1K0AA 1ERTA 3LXZA 2EIRA 2F3MA 2DJJA 3G7YA 2ZCTA 3HJMA 2LJAA 3GV1A 1SL0B 2H70A 2CV4A 1B4QA 10GSA 1VF4A 2OBIA 1QQ2A 3ERGA 2H0IA 2YZHA 1OC8A 1G0TA 1AQWA 1XWGA 2KP1A 5IMZA 2HLSA 1AQXA 1SL1B 3GKXA 5HR1A 1H75A 2VCTA 3ZYWA 3UEMA 3KGKA 1TKDB 3DKSA 5ECKB 2V6OA 1WMJA 4MH2A 1F3BA 1TW9A 1XWKA 3IPZA 3BCIA 1V2AA 3ZMLA 3WT1A 1JZDA 4IW9A 4KB3A 1T4YA 1PA3A 2OBKA 4G2EA 2N5AA 4I6XA 1ON4A 2H19A 4LLRA 2QA1A 3HY2A 4OWYA 5IMCA 6GSWA 1PN0A 4HI7A 3WGEA 1Q98A 1ST9A 3RHCA 6GSYA 2WB9A 3F8UA 4MCUA 4ML6A 5ECRB 2IJYA 1T00A 4ISDA 3FZ9A 1RW1A 5A5HA 1AAZA 4GCIA 4JR4A 2HSYA 1YY7A 1R26A 1I9DA 3RBTA 1TI1A 3A3TA 2ALBA 3KTLA 3GRXA 3O76A 4NAXA 2F8FA 5JWOB 1SD9A 3Q19A 5LD0A 2R6KA 4X43A 4I2UA 4I2TA 3P8WA 4EDZA 4V1Ap 1K0CA 3U5RE 2GSTA 4TR4A 3CSJA 2DIZA 3ERWA 5B7CA 5JCGA 2HZEB 2VUPA 2GT5A 1M7TA 5GZZB 5G1LA 5BMUA 5B6MA 2PVQA 3BOAA 4HOJA 1V9WA 2R4VA 5HQPA 3IHGA 3J7Yb 4AI6A 4K6XA 3EU3A 2ON7A 4LL1B 2VCQA 2C8UA 2A4HA 2LNSA 4Z2TA 3IXRA 4N3ZA 2LQQA 4TR0A 5E4WA 4KDUA 2DBCA 1TP9A 8GSSA 3N5OA 1OVNA 3MYDA 2H1AA 2EFDA 1FVKA 2CVBA 1TU7A 3LXTA 4LMWA 3L78A 3VLNA 5IMVA 2K8SA 3P2AA 2K6VA 3GMFA 3ERFA 4ZB7A 5CNWA 5D9TA 4OFNA 1WE0A 1S3AA 2IMDA 4MH3A 3HKRA 3P7XA 2R2JA 3EPTA 1AQVA 4GLTA 1VRSD 2VLVA 1SKRB 3L4NA 3ISOA 4ECIA 2LRTA 1GUHA 1OKTA 4FO5A 5AN1A 3D5JA 4G10A 3IHQA 2OT3A 1B48A 1SVOA 1YQ1A 3DIEA 3CTFA 1QGVA 3IAM2 1GUMA 2PERA 3ZRDA 1GNWA 2H0GA 2IN3A 1EOGA 3UVTA 1KBNA 2G2QA 2VL9A 5FHIA 2R0PA 4K2DA 4HZ4A 4GSNA 3MDKA 1TOFA 1K3LA 3I6AA 4NV2A 3FYGA 1SJZA 5G5FA 5ECIB 1ZOFA 3FZ5A 3HD5A 5L71A 2LRCA 3QDNA 4ZL8A 1WRYA 3F4SA 2RUEA 2MMAA 2C3QA 2A2SA 1SYXA 5IMFA 3RHBA 3HA9A 4HQSA 5F05A 1HYUA 1JLWA 3IK7A 2AHEA 1XOBA 3ZVJD 1F2EA 2CT6A 5ELAA 4FYCA 1T8EB 1A24A 4O32A 4IBPA 2J23A 3QAGA 2X8GA 3KXOA 1LBKA 1LU4A 2H1GA 3AY8A 3D0ZA 2JADA 2AUVA 4MABA 2PU9C 1AXDA 3HDCA 1O6JA 2P5RA 3GKKA 2H71A 2JU5A 5G2ZA 2AV4A 2EIOA 1BYEA 4Q5RA 2VM1A 2AB6A 2VOCA 2R5GA 2C1YA 2C0DA 1NSWA 5G1KA 4L0WA 2DJ1A 4POBA 5CAXA 1BG5A 3DRNA 3KM6A 2F9SA 4TXOA 3C8EA 3PGTA 1TRVA 1XBSA 5DQYA 5G31A 2CX3A 2JL4A 4GSSA 3IK9A 1B9XC 5IOXA 4HJMA 4QMKA 3GHAA 3UIWA 4TR1A 2IMFA 1B8XA 3A2XA 4K1FA 5JCUA 1R5AA 6GSXA 3DD3A 1F3AA 2GZYA 2ON5A 4WXTA 4HEA2 3IR4A 4EIQA 3FW2A 1XW9A 4FYUA 4E8EA 2IMIA 2IPAA 3KD0A 4OCFA 2I1UA 1O81A 1BAYA 1OC9B 4TXVA 2GQKA 4ICYA 1SYRA 5BRTA 4K0NA 1JLVA 1X9WB 4QL9A 4JE1A 1PN9A 2FHEA 1R4WA 3ZREA 2LNTA 3TKPA 1X0RA 3LYKA 2CZ3A 3HVVA 3LFLA 1YKCA 3ZITA 3D6IA 1DSBA 3QFAC 5KN0A 3N9JA 2X8HA 3SBCA 5IO0A 2HQTA 3K8NA 2HYXA 1YKAA 5ECHB 2O89A 3H79A 4IP6A 2C0EA 2REMA 1GSUA 2MZCA 2CA8A 4GSTA 2LJKA 3HXSA 1WJKA 5DQSA 4BL7A 5J9CA 3HHVA 4O5QA 4OFMA 5CRGA 17GSA 2RM6A 3ZZXA 3H4KA 5DBQA 3VPTA 1V57A 2H72A 2H30A 2EFEA 3TOTA 3VI7A 1FB6A 4TR3A 4H86A 2CQ9A 2H74A 2MMZA 2H0HA 3V1WA 2K8VA 1YF1A 3QMXA 1XIYA 5CRHA 4ECBA 2YV7A 3APSA 4K7NA 3ED3A 3W6GA 1XXUA 3QCPA 2YN1A 4YQMA 3CRUA 1XWBA 2G0FA 4WEYA 1SK2A 4XIHA 3ZFBA 6GSSA 2HI7A 1UC7A 4K9ZA 5DCGA 2PMTA 2K18A 4XHMA 3E0UA 4I8BA 2HSNB 5FT3A 3QPMA 4V2MA 5DCHA 3FR6A 4KNDA 4XCSA 5KN3A 2X8CA 2B6MA 4WKWA 4TKYA 3LYPA 5J5NA 4RQRA 1SKWB 4MZWA 2GVPA 5DALA 2PWJA 5DAKA 2YWNA 3UBLA 2HSNA 2E0QA 3ZMKA 2DJKA 2FNOA 1OAZA 1WWJA 4V2LA 1YJ6A 4XS1A 1YEXA 3Q74A 2H66A 1M2AA 1SENA 2LTKA 2NTOA 4ZXGA 1U6TA 5D96A 1ZGNA 4MJCA 2K9FA 2NBSA 4PQHA 3TOUA 5JCWA 4G9HA 1WP0A 1J0FA 4MF7A 4PQ1A 2L57A 1V98A 5IPHA 5GAND 1NW2A 4MF5A 2I3YA 1ERVA 3GN3A 2HRKB 4PXOA 4WETA 4TN8A 3PR8A 1OC3A 1PQNA 1MTCA 2EFCA 3KJYA 1WIKA 3F3QA 3I9V2 3GTUA 2V32A 4GXZA 4IVFA 1QK8A 3M3MA 2HRFA 3RPPA 3NIVA 4JEDA 1UN2A 4KCAA 4NMUA 1B9YC 1PL2A 4IJIA 2HRKA 1MDKA 1RK4A 3D22A 4L5LA 5ELGA 4XS4B 4KAEA 3DVXA 3E9JB 2X64A 2GTUA 4KUNA 2FCHA 3D4MA 3GL3A 3MAKA 5ECLB 3CXGA 2RLIA 1GL8A 4GRFA 4IGJA 2OADA 2O8VB 5IPGA 2CZ2A 1XW5A 3TKSE 3KZQA 1JHBA 1N25A 4IQAA 1JZWA 5ENUA 2C4JA 1DE1A 5KOXA 2CAIA 3VURA 4PUAA 2B7KA 5IMDA 2MYGA 4DSSB 2VL3A 3H1NA 2DLXA 3I43A 1GSSA 2RIIA 3FRCA 1K0OA 4TW5A 3FR3A 1I5GA 3TB2A 3APOA 5FWGA 1F37A 7GSSA 4YKGA 4WR4A 4K7IA 4EL1A 2LRNA 1XVWA 2PPTA 5KN1A 4O5UA 5J9BA 3UMAA 3HYPA 4I97A 1SK0A 3C71A 5AISA 3GA4A 1AIUA 4RQXA 4DSSA 3RPNA 3EMXA 2GLRA 1PRXA 4AKHA 4EO3A 1T3BA 3DXBA 5AIXA 4ZIJA 3EU4A 1HNAA 2NDOA 1PX7A 2Z9SA 4LMVA 4BWQA 5ECQB 4QL7A 3F6DA 5B8BA 5J3RA 5B6NA 4F03A 3EYTA 2VD0A 1THOA 3RDWA 1QFNA 4KDYA 2QC7A 1GWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KH9 A;  2V1M A;  2GSR A;  2AJQ B;  3TKR A;  3WYW A;  2MMO A;  4PNF A;  3NOF A;  2HZE A;  4GTU A;  2RUF A;  3WGX A;  2H8L A;  4O92 A;  2L6C A;  3DWV A;  5ECO B;  4L8E A;  4KSM A;  3J7Y k;  1ZYQ B;  2XPD A;  3D4T A;  5AIV A;  4BVY B;  3GL5 A;  1GLP A;  1BQ7 A;  2YOI A;  3U6V A;  1GSQ A;  4G0K A;  1XCC A;  4ULX A;  4F0C A;  1TU8 A;  4IKH A;  2M80 A;  3DEX A;  5GSS A;  5LNK e;  2O7K A;  2JAC A;  1QXH A;  3C73 A;  1SJI A;  1X5C A;  1K0N A;  4NWY A;  6GST A;  1MEK A;  4I5Q A;  1FO5 A;  4HU7 A;  3MSZ A;  4KSO A;  13GS A;  3TRP A;  4IS0 A;  12GS A;  3IAS 2;  4K8M A;  4MJA A;  1AUC A;  3GKN A;  16GS A;  4ZBA A;  1U3A A;  3IRA A;  4EKZ A;  2TRX A;  4ZL9 A;  3HCZ A;  3ZIJ A;  2KOK A;  1J08 A;  3QAW A;  4MDC A;  1OKD A;  1ZYE A;  1F6M C;  3PH9 A;  3QAV A;  1XOA A;  3PIN A;  4K0G A;  1PMT A;  5ECP B;  4PUR A;  2A4V A;  1GTA A;  2P31 A;  5IQY A;  2H1B A;  5HFI A;  4KX4 A;  5F06 A;  3H8Q A;  5D8I A;  1DBY A;  1EEJ A;  4HZ2 A;  2YV9 A;  11GS A;  1B4P A;  1PX6 A;  5ECN B;  1A2L A;  2HT9 A;  2DMM A;  4HJ2 A;  2KP2 A;  5H5R A;  5F07 A;  2VM2 A;  1TK0 B;  2FWF A;  2FWE A;  3W8S A;  2I81 A;  4GF0 A;  3G9B A;  2GS3 A;  2H6Z A;  1TXX A;  4EC0 A;  3KCM A;  2VCW A;  1GLQ A;  4XRA A;  1ZL9 A;  1GSD A;  1X9M B;  1JZR A;  4JZQ A;  4F2I A;  2LQO A;  3EE2 A;  2XBQ A;  3P90 A;  2B3S A;  2IFQ B;  3IE3 A;  3R3E A;  4KGI A;  4ZBD A;  3F4R A;  4ZIL A;  2WZ9 A;  2RM5 A;  2KUC A;  2NPB A;  3TKS C;  4RI6 A;  1WOU A;  2LUS A;  4ACS A;  2OJL A;  4TVE A;  4D73 B;  4GWR A;  2GZP A;  5JWQ B;  5F8B A;  2YP6 A;  3I69 A;  1A0R P;  1V40 A;  2FWG A;  1UA5 A;  3QR6 A;  4AJ6 A;  2B7J A;  3HZ8 A;  3LSZ A;  1GTU A;  3ZL5 A;  2F8A A;  3GH9 A;  4QQ7 A;  2LEG A;  2I4A A;  3Q6O A;  4KCE A;  4WBJ A;  2OE0 A;  2LS5 A;  3E3E A;  4POL A;  4GQF A;  3FEU A;  1HQO A;  1PL1 A;  3MWH A;  3CSI A;  4IHU A;  4N0Z A;  2R3X A;  5KEJ A;  1X5E A;  1NM3 A;  2QGV A;  3FY7 A;  2VLT A;  4EVM A;  3VWX A;  3QFB C;  2VL2 C;  3GST A;  1EOH A;  1TK8 B;  2H75 A;  4HDE A;  1THX A;  1OC9 A;  3HJP A;  2FWH A;  2YNX A;  4HS1 A;  5CO3 A;  4J2F A;  2ZNM A;  1K3Y A;  4ID0 A;  1FAA A;  1LJR A;  1OE8 A;  2OAC A;  4NPB A;  3A5W A;  2DC5 A;  3R2Q A;  3EC3 A;  1GUK A;  5D9X A;  2L4C A;  2DML A;  3KEB A;  2H73 A;  4OMV A;  1TI3 A;  4HQZ A;  4KDX A;  2E2M A;  4MZC A;  1U88 A;  1ABA A;  5D9V A;  2NVL A;  3L9S A;  1ZCP A;  3TDG A;  2J9H A;  3TRX A;  4YQU A;  4G19 A;  3S9F A;  1A0F A;  2GQL A;  3OR5 A;  4ZB8 A;  4O5R A;  1EGR A;  5D93 A;  1O8X A;  2YJH A;  1ZZY A;  1QUW A;  2IME A;  4OCE A;  2PUK C;  4V1A g;  2X99 A;  1VF2 A;  3M9J A;  3D21 A;  2V6K A;  3M8N A;  4TOP A;  1Z5Y E;  1IYH A;  5HR2 A;  4J57 E;  1JFU A;  1XFL A;  4JR6 A;  3UJ1 A;  2L4Q A;  2GGT A;  2GT6 A;  3GYK A;  2LKU A;  3IDV A;  2B5Y A;  3L9V A;  2DJ3 A;  2OE1 A;  1KTE A;  2L5L A;  1W89 A;  4HUA A;  2DIY A;  4X1U A;  1O73 A;  1HD2 A;  3GFK A;  2M72 A;  2VAF A;  2H76 A;  3ZFL A;  3HZ4 A;  2KLX A;  1DE2 A;  2C0F A;  1R5P A;  1RQM A;  3FK8 A;  2C80 A;  2DSA A;  2LV3 A;  1UVZ A;  4FH8 A;  4NV5 A;  1ILO A;  2YAN A;  3EMP A;  3M9K A;  3TJF A;  4L5O A;  1FVJ A;  3KP8 A;  2VCX A;  1F9M A;  1XWA A;  3UVH A;  5G5E A;  4ILF A;  3CRT A;  3CMI A;  4OO5 A;  3EVI A;  4MA9 A;  4X0X A;  3WT2 A;  3C7M A;  4WR5 A;  3BBY A;  1GSE A;  3EUR A;  1K0B A;  2IIY A;  3DML A;  2FA8 A;  2O85 A;  3TCO A;  4KW6 A;  1FG4 A;  4IN0 A;  1YF0 A;  2EC4 A;  3GUR A;  5GAP D;  2B1L A;  3CBU A;  1T7P B;  2PGT A;  1N8J A;  2N5F A;  4CHS A;  3IV4 A;  4MP4 A;  1BJX A;  1Z6N A;  3CSH A;  3M1G A;  5H5Q A;  1GUL A;  2HNL A;  1SJ6 A;  3UBK A;  2WRT A;  9GSS A;  2JSY A;  4XRD A;  3ZIV A;  1Y25 A;  1AW9 A;  5C00 A;  5DJM A;  2V2G A;  2VLU A;  1FB0 A;  4RUV A;  1EV9 A;  2FGX A;  2EIQ A;  3TRQ A;  1HNB A;  4OO4 A;  1S3C A;  2JZR A;  3IC8 A;  3IC4 A;  5HR3 A;  5LCZ A;  4CW9 A;  2C3N A;  4XS4 A;  2DJ0 A;  4N10 A;  3KTB A;  3BD2 A;  3LG6 A;  3LJR A;  4Q5Q A;  3DYR A;  3VK9 A;  4MK3 A;  1MDI A;  1USB A;  3F63 A;  2YZU A;  2O87 A;  4NHW A;  4MJB A;  3ZLP A;  5HR0 A;  5B8A A;  2CVK A;  2FA4 A;  1Y6E A;  3KMO A;  3IA1 A;  3LGC A;  2HZF A;  4MF6 A;  4HU9 A;  2QKE A;  4IP1 A;  1GTI A;  2UZ8 A;  3O6T A;  3GH6 A;  1WPI A;  1PSQ A;  2YJ7 A;  4PTS A;  4DEJ A;  2FLS A;  2OKA A;  1Z3E A;  1OE7 A;  5DVB A;  4O7H A;  4YH2 A;  3QD9 A;  1TTZ A;  5CRE A;  3KMN A;  5ECS A;  2CVD A;  4F9Z A;  3DGQ A;  3M0F A;  1S3D A;  3VI5 A;  4DSQ A;  1ERU A;  3ZTL A;  3CYN A;  1KNG A;  5A4U A;  1GRX A;  2HRA A;  3GNJ A;  1Q4J A;  6GSU A;  4XS6 A;  6GSV A;  5E59 A;  4AF2 A;  1XVQ A;  1ACV A;  3VWW A;  2MMN A;  2HFD A;  3L9U A;  3ME7 A;  2LJR A;  3GIX A;  1IYI A;  1K3O A;  4ECJ A;  4GQC A;  3FKF A;  4PX1 A;  5INY A;  5GST A;  1E6B A;  1XZO A;  4F0B A;  5H5S A;  4Z7X A;  3PPU A;  1GSY A;  4ZB6 A;  3EWL A;  3A2W A;  1TRW A;  1M9B A;  4YAP A;  3ZVJ A;  2N5B A;  1TDI A;  2M46 A;  1E2Y A;  4MLY A;  1QMV A;  3FHK A;  4ECC A;  1A2M A;  4G0I A;  3TGZ A;  2ZUP A;  20GS A;  5D9W A;  5A5K A;  4KH7 A;  4BVY A;  2YWI A;  4KE3 A;  1M2D A;  4TRX A;  3TKS A;  3WGD A;  5CP1 A;  4L0U A;  1MDJ A;  1Z7R A;  4P3Y B;  2YWO A;  1ERW A;  2XHF A;  1YDK A;  1G6Y A;  2WUL A;  1TRU A;  4EUY A;  3CTG A;  1NHO A;  2HRN A;  5CRW A;  4LL4 B;  1TK5 B;  4MZB A;  2MBT A;  2VO4 A;  3O3T A;  2GZZ A;  1PKZ A;  1GH2 A;  4IEL A;  3MNG A;  1Z6M A;  1YZX A;  4BA7 A;  3F3R A;  4N0V A;  2PN8 A;  1FHE A;  1A23 A;  1X5D A;  1XWC A;  1VF1 A;  1EGO A;  3TJJ A;  1NHY A;  4WBR D;  3SWL A;  4BPY A;  2YCD A;  3KIJ A;  2VL2 A;  5A4V A;  2C0G A;  4USS A;  2B1K A;  3TJB A;  4JBB A;  3FZ4 A;  4KA0 A;  3G7J A;  1M0U A;  5EL8 A;  5IO2 A;  1T4Z A;  5IOW A;  5IM9 A;  3F6F A;  1C72 A;  3NZN A;  2WCI A;  5CRD A;  3LOR A;  3RAZ A;  5AGY A;  2L6D A;  2YWM A;  4ZB9 A;  1U3I A;  5DDL A;  4NXI A;  1VF3 A;  4N30 A;  2IL3 A;  2WDU A;  4LA1 A;  4MPF A;  2H6Y A;  5F0G A;  3UAR A;  1G7O A;  5A4W A;  1ZMA A;  4E8H A;  5HFG A;  4G0L A;  4ML1 A;  1BED A;  3IBH A;  1A8Y A;  3UL3 A;  1A8L A;  5CYY A;  4PGT A;  14GS A;  4RI7 A;  4V2N A;  4MPG A;  1GNE A;  1SL2 B;  3IOS A;  5COH A;  4TXO B;  3UOM A;  2WS2 A;  1OYJ A;  2F51 A;  2H01 A;  1GP1 A;  4FQU A;  4TR1 B;  4POM A;  2LST A;  2AYT A;  3C1S A;  1CQG A;  4EXJ A;  2KHP A;  2I9H A;  3F4T A;  1URM A;  1FOV A;  1U87 A;  2V41 A;  4BVX B;  4EF0 A;  3EIN A;  5D73 A;  2IFQ A;  1EP7 A;  4IQ1 A;  3HVX A;  3LWA A;  3TJG A;  1Z9H A;  1MD3 A;  5KN2 A;  3F0I A;  1KEB A;  2GQM A;  5G30 A;  2DJ2 A;  3US3 A;  22GS A;  19GS A;  4D73 A;  4WF4 A;  1SKS B;  2CX4 A;  2XC2 A;  2GSS A;  3TKQ A;  4ZL7 A;  4BVX A;  4AJ7 A;  3C1R A;  2XBI A;  1PGT A;  1O7U A;  4MMM A;  3QOU A;  2ES7 A;  1H4O A;  5C04 A;  3GUS A;  3APQ A;  3L0H A;  2TRC P;  1ML6 A;  4Q5N A;  3TJK A;  1EEM A;  4F82 A;  3LEF A;  2JSZ A;  4BL7 B;  2HXK A;  2R37 A;  1A2J A;  3DVW A;  3GX0 A;  1SK1 A;  3HVS A;  2D2Z A;  1O85 A;  2TIR A;  3FR9 A;  4PNG A;  2JZT A;  1BX9 A;  4XTS A;  4IJ3 A;  4FYB A;  4CDO A;  2MBS A;  5HFK A;  2IMK A;  2WJU A;  5ABR A;  4Q5F A;  5J4U A;  3A2V A;  2VCZ A;  4EE0 A;  2CAQ A;  2FY6 A;  3GX8 A;  2HSM B;  2XPE A;  1MD4 A;  2PBJ A;  4BWS A;  1K0D A;  5ID2 B;  4K7O A;  2PVO C;  1PKW A;  5DJL A;  1Z7P A;  2JZS A;  2VIM A;  1X9S B;  4POK A;  1K0M A;  3GKM A;  3JCM L;  5JWR B;  1SU9 A;  1M99 A;  2OE3 A;  2VCV A;  3KH7 A;  3H93 A;  1M2B A;  2HSM A;  1G7E A;  4OFT A;  1YEP A;  1PD2 1;  3TUE A;  2QSI A;  1TRS A;  2BMX A;  3VFI A;  1N2A A;  4OD7 A;  2OA7 A;  5ID2 A;  5ECM B;  2YPM A;  1XW6 A;  2WGR A;  3GSS A;  5DAL B;  4WF5 A;  2A2R A;  1G6W A;  2VD1 A;  2B5X A;  4NHZ A;  4EDY A;  1O8W A;  4KF9 A;  5DAK B;  1JZO A;  1CQH A;  2HSH A;  2C3T A;  5EPF A;  3VPQ A;  1XPV A;  2P5Q A;  2BJX A;  4MJE A;  1T1V A;  2FUG 2;  1J9B A;  4YQV A;  4AJ8 A;  2FD3 A;  3Q18 A;  2HE3 A;  1EP8 A;  2E7P A;  1R7H A;  5IMA A;  3VWV A;  3ME8 A;  2BTO T;  1AC1 A;  1EV4 A;  1FW1 A;  5EVO A;  3HJO A;  2GSQ A;  3BJ5 A;  3G7I A;  1HNC A;  4N11 A;  4JU5 A;  4FIW A;  4J56 E;  2L5O A;  4JRR A;  4DSR A;  4ZBB A;  1W4V A;  2GDR A;  3FZA A;  2IWT A;  2P0G A;  3WD6 A;  1GSF A;  5EY6 A;  3UAP A;  2B5E A;  2L59 A;  2E2G A;  1EZK A;  4PUF C;  1GTB A;  18GS A;  1VGL A;  3W8J A;  4PQI A;  3KP9 A;  3GTU B;  1SD8 A;  3F9U A;  2H1D A;  2H6X A;  4AGS A;  3LQ7 A;  2WFC A;  4DVC A;  5IIZ A;  3BCK A;  1DUG A;  1V58 A;  3VWU A;  1TJD A;  1M9A A;  4YAV A;  2AAW A;  5J41 A;  1EWX A;  1K0A A;  1ERT A;  3LXZ A;  2EIR A;  2F3M A;  2DJJ A;  3G7Y A;  2ZCT A;  3HJM A;  2LJA A;  3GV1 A;  1SL0 B;  2H70 A;  2CV4 A;  1B4Q A;  10GS A;  1VF4 A;  2OBI A;  1QQ2 A;  3ERG A;  2H0I A;  2YZH A;  1OC8 A;  1G0T A;  1AQW A;  1XWG A;  2KP1 A;  5IMZ A;  2HLS A;  1AQX A;  1SL1 B;  3GKX A;  5HR1 A;  1H75 A;  2VCT A;  3ZYW A;  3UEM A;  3KGK A;  1TKD B;  3DKS A;  5ECK B;  2V6O A;  1WMJ A;  4MH2 A;  1F3B A;  1TW9 A;  1XWK A;  3IPZ A;  3BCI A;  1V2A A;  3ZML A;  3WT1 A;  1JZD A;  4IW9 A;  4KB3 A;  1T4Y A;  1PA3 A;  2OBK A;  4G2E A;  2N5A A;  4I6X A;  1ON4 A;  2H19 A;  4LLR A;  3HY2 A;  4OWY A;  5IMC A;  6GSW A;  4HI7 A;  3WGE A;  1Q98 A;  1ST9 A;  3RHC A;  6GSY A;  2WB9 A;  3F8U A;  4MCU A;  4ML6 A;  5ECR B;  2IJY A;  1T00 A;  4ISD A;  3FZ9 A;  1RW1 A;  1AAZ A;  4GCI A;  4JR4 A;  2HSY A;  1YY7 A;  1R26 A;  1I9D A;  3RBT A;  1TI1 A;  3A3T A;  2ALB A;  3KTL A;  3GRX A;  3O76 A;  4NAX A;  2F8F A;  5JWO B;  1SD9 A;  3Q19 A;  5LD0 A;  2R6K A;  4X43 A;  4I2U A;  4I2T A;  3P8W A;  4EDZ A;  4V1A p;  1K0C A;  3U5R E;  2GST A;  4TR4 A;  3CSJ A;  2DIZ A;  3ERW A;  5B7C A;  5JCG A;  2HZE B;  2VUP A;  2GT5 A;  1M7T A;  5GZZ B;  5G1L A;  5BMU A;  5B6M A;  2PVQ A;  3BOA A;  4HOJ A;  1V9W A;  2R4V A;  5HQP A;  3J7Y b;  4K6X A;  3EU3 A;  2ON7 A;  4LL1 B;  2VCQ A;  2C8U A;  2LNS A;  3IXR A;  2LQQ A;  4TR0 A;  5E4W A;  4KDU A;  2DBC A;  1TP9 A;  8GSS A;  3N5O A;  1OVN A;  2H1A A;  1FVK A;  2CVB A;  1TU7 A;  3LXT A;  4LMW A;  3L78 A;  3VLN A;  5IMV A;  2K8S A;  3P2A A;  2K6V A;  3GMF A;  3ERF A;  5CNW A;  5D9T A;  4OFN A;  1WE0 A;  1S3A A;  2IMD A;  4MH3 A;  3HKR A;  3P7X A;  2R2J A;  1AQV A;  4GLT A;  1VRS D;  2VLV A;  1SKR B;  3L4N A;  3ISO A;  4ECI A;  2LRT A;  1GUH A;  1OKT A;  4FO5 A;  5AN1 A;  3D5J A;  4G10 A;  3IHQ A;  1B48 A;  1YQ1 A;  3DIE A;  3CTF A;  1QGV A;  3IAM 2;  1GUM A;  2PER A;  3ZRD A;  1GNW A;  2H0G A;  2IN3 A;  1EOG A;  3UVT A;  1KBN A;  2G2Q A;  2VL9 A;  5FHI A;  4K2D A;  4HZ4 A;  4GSN A;  3MDK A;  1TOF A;  1K3L A;  3I6A A;  4NV2 A;  3FYG A;  1SJZ A;  5G5F A;  5ECI B;  1ZOF A;  3FZ5 A;  3HD5 A;  5L71 A;  2LRC A;  3QDN A;  4ZL8 A;  1WRY A;  3F4S A;  2RUE A;  2MMA A;  2C3Q A;  2A2S A;  1SYX A;  5IMF A;  3RHB A;  3HA9 A;  4HQS A;  5F05 A;  1HYU A;  1JLW A;  3IK7 A;  2AHE A;  1XOB A;  3ZVJ D;  1F2E A;  2CT6 A;  5ELA A;  4FYC A;  1T8E B;  1A24 A;  4O32 A;  4IBP A;  2J23 A;  3QAG A;  2X8G A;  3KXO A;  1LBK A;  1LU4 A;  2H1G A;  3AY8 A;  3D0Z A;  2JAD A;  2AUV A;  4MAB A;  2PU9 C;  1AXD A;  3HDC A;  1O6J A;  2P5R A;  3GKK A;  2H71 A;  2JU5 A;  5G2Z A;  2AV4 A;  2EIO A;  1BYE A;  4Q5R A;  2VM1 A;  2AB6 A;  2VOC A;  2R5G A;  2C1Y A;  2C0D A;  1NSW A;  5G1K A;  4L0W A;  2DJ1 A;  4POB A;  5CAX A;  1BG5 A;  3DRN A;  3KM6 A;  2F9S A;  4TXO A;  3C8E A;  3PGT A;  1TRV A;  1XBS A;  5DQY A;  5G31 A;  2CX3 A;  2JL4 A;  4GSS A;  3IK9 A;  1B9X C;  5IOX A;  4HJM A;  3GHA A;  3UIW A;  4TR1 A;  2IMF A;  1B8X A;  3A2X A;  4K1F A;  5JCU A;  1R5A A;  6GSX A;  3DD3 A;  1F3A A;  2GZY A;  2ON5 A;  4WXT A;  4HEA 2;  3IR4 A;  3FW2 A;  1XW9 A;  4FYU A;  4E8E A;  2IMI A;  2IPA A;  3KD0 A;  4OCF A;  2I1U A;  1O81 A;  1BAY A;  1OC9 B;  4TXV A;  2GQK A;  1SYR A;  4K0N A;  1JLV A;  1X9W B;  4QL9 A;  4JE1 A;  1PN9 A;  2FHE A;  1R4W A;  3ZRE A;  2LNT A;  3TKP A;  1X0R A;  3LYK A;  2CZ3 A;  3HVV A;  3LFL A;  1YKC A;  3ZIT A;  3D6I A;  1DSB A;  3QFA C;  5KN0 A;  3N9J A;  2X8H A;  3SBC A;  5IO0 A;  2HQT A;  3K8N A;  2HYX A;  1YKA A;  5ECH B;  2O89 A;  3H79 A;  4IP6 A;  2C0E A;  2REM A;  1GSU A;  2MZC A;  2CA8 A;  4GST A;  2LJK A;  3HXS A;  1WJK A;  5DQS A;  4BL7 A;  5J9C A;  3HHV A;  4OFM A;  5CRG A;  17GS A;  2RM6 A;  3ZZX A;  3H4K A;  5DBQ A;  3VPT A;  1V57 A;  2H72 A;  2H30 A;  3TOT A;  3VI7 A;  1FB6 A;  4TR3 A;  4H86 A;  2CQ9 A;  2H74 A;  2MMZ A;  2H0H A;  3V1W A;  2K8V A;  1YF1 A;  3QMX A;  1XIY A;  5CRH A;  4ECB A;  2YV7 A;  3APS A;  4K7N A;  3ED3 A;  3W6G A;  1XXU A;  3QCP A;  2YN1 A;  4YQM A;  3CRU A;  1XWB A;  2G0F A;  4WEY A;  1SK2 A;  4XIH A;  3ZFB A;  6GSS A;  2HI7 A;  1UC7 A;  4K9Z A;  5DCG A;  2PMT A;  2K18 A;  4XHM A;  3E0U A;  4I8B A;  2HSN B;  5FT3 A;  3QPM A;  4V2M A;  5DCH A;  3FR6 A;  4KND A;  4XCS A;  5KN3 A;  2X8C A;  2B6M A;  4WKW A;  4TKY A;  3LYP A;  5J5N A;  4RQR A;  1SKW B;  4MZW A;  2GVP A;  5DAL A;  2PWJ A;  5DAK A;  2YWN A;  3UBL A;  2E0Q A;  3ZMK A;  2DJK A;  2FNO A;  1OAZ A;  1WWJ A;  4V2L A;  1YJ6 A;  4XS1 A;  1YEX A;  3Q74 A;  2H66 A;  1M2A A;  1SEN A;  2LTK A;  2NTO A;  4ZXG A;  1U6T A;  5D96 A;  1ZGN A;  4MJC A;  2K9F A;  2NBS A;  4PQH A;  3TOU A;  5JCW A;  4G9H A;  1WP0 A;  1J0F A;  4MF7 A;  4PQ1 A;  2L57 A;  1V98 A;  5IPH A;  5GAN D;  1NW2 A;  4MF5 A;  2I3Y A;  1ERV A;  3GN3 A;  2HRK B;  4PXO A;  4WET A;  4TN8 A;  3PR8 A;  1OC3 A;  1PQN A;  1MTC A;  3KJY A;  1WIK A;  3F3Q A;  3I9V 2;  3GTU A;  2V32 A;  4GXZ A;  4IVF A;  1QK8 A;  3M3M A;  2HRF A;  3RPP A;  3NIV A;  4JED A;  1UN2 A;  4KCA A;  4NMU A;  1B9Y C;  1PL2 A;  4IJI A;  2HRK A;  1MDK A;  1RK4 A;  3D22 A;  4L5L A;  5ELG A;  4XS4 B;  4KAE A;  3DVX A;  3E9J B;  2X64 A;  2GTU A;  4KUN A;  2FCH A;  3D4M A;  3GL3 A;  3MAK A;  5ECL B;  3CXG A;  2RLI A;  1GL8 A;  4GRF A;  4IGJ A;  2OAD A;  2O8V B;  5IPG A;  2CZ2 A;  1XW5 A;  3TKS E;  3KZQ A;  1JHB A;  4IQA A;  1JZW A;  5ENU A;  2C4J A;  1DE1 A;  2CAI A;  3VUR A;  4PUA A;  2B7K A;  5IMD A;  2MYG A;  4DSS B;  2VL3 A;  3H1N A;  2DLX A;  3I43 A;  1GSS A;  2RII A;  3FRC A;  1K0O A;  4TW5 A;  3FR3 A;  1I5G A;  3TB2 A;  3APO A;  5FWG A;  1F37 A;  7GSS A;  4WR4 A;  4K7I A;  4EL1 A;  2LRN A;  1XVW A;  2PPT A;  5KN1 A;  5J9B A;  3UMA A;  3HYP A;  4I97 A;  1SK0 A;  3C71 A;  5AIS A;  3GA4 A;  1AIU A;  4RQX A;  4DSS A;  3RPN A;  3EMX A;  2GLR A;  1PRX A;  4EO3 A;  1T3B A;  3DXB A;  5AIX A;  4ZIJ A;  3EU4 A;  1HNA A;  2NDO A;  1PX7 A;  2Z9S A;  4LMV A;  4BWQ A;  5ECQ B;  4QL7 A;  3F6D A;  5B8B A;  5J3R A;  5B6N A;  4F03 A;  3EYT A;  2VD0 A;  1THO A;  3RDW A;  1QFN A;  4KDY A;  2QC7 A;  1GWC A; 
#chains in the Genus database with same CATH topology
 3KH9 A;  4Z2R A;  2V1M A;  2GSR A;  2AJQ B;  3TKR A;  3WYW A;  2MMO A;  4PNF A;  3NOF A;  2HZE A;  4GTU A;  3MIX A;  2RUF A;  3WGX A;  2H8L A;  4O92 A;  2L6C A;  3DWV A;  2O5V A;  5ECO B;  4L8E A;  4KSM A;  3J7Y k;  1ZYQ B;  2XPD A;  3D4T A;  5AIV A;  4BVY B;  3GL5 A;  1M3J A;  1GLP A;  1BQ7 A;  2YOI A;  5J4V A;  1BG1 A;  3U6V A;  1GSQ A;  3HMJ G;  4G0K A;  1XCC A;  4ULX A;  4F0C A;  1TU8 A;  4IKH A;  2M80 A;  3DEX A;  5GSS A;  5LNK e;  2O7K A;  2JAC A;  1QXH A;  3C73 A;  1SJI A;  1X5C A;  1K0N A;  4NWY A;  6GST A;  1MEK A;  4I5Q A;  1FO5 A;  4HU7 A;  3MSZ A;  4KSO A;  4K5S A;  13GS A;  3TRP A;  4IS0 A;  12GS A;  3IAS 2;  4K8M A;  5J40 A;  4MJA A;  1AUC A;  3GKN A;  16GS A;  4ZBA A;  1U3A A;  3IRA A;  4EKZ A;  2TRX A;  4ZL9 A;  3HCZ A;  3ZIJ A;  2KOK A;  1J08 A;  3QAW A;  4MDC A;  1OKD A;  1ZYE A;  1F6M C;  3PH9 A;  3QAV A;  1XOA A;  3PIN A;  4K0G A;  1PMT A;  4A5P A;  4Z2U A;  5ECP B;  4PUR A;  2A4V A;  1GTA A;  2P31 A;  5IQY A;  2H1B A;  5HFI A;  3CWG A;  4KX4 A;  5F06 A;  3H8Q A;  5D8I A;  1DBY A;  1EEJ A;  4HZ2 A;  2YV9 A;  11GS A;  1B4P A;  1PX6 A;  5ECN B;  1A2L A;  2HT9 A;  2DMM A;  4HJ2 A;  2KP2 A;  5H5R A;  5F07 A;  4W66 A;  2VM2 A;  1TK0 B;  2O36 A;  2FWF A;  2FWE A;  3W8S A;  2I81 A;  4GF0 A;  3G9B A;  2GS3 A;  2H6Z A;  1TXX A;  4EC0 A;  3KCM A;  2VCW A;  1GLQ A;  4XRA A;  1ZL9 A;  1GSD A;  1X9M B;  1JZR A;  4JZQ A;  4F2I A;  2LQO A;  3EE2 A;  2XBQ A;  3P90 A;  2B3S A;  2IFQ B;  2VKZ G;  3IE3 A;  3R3E A;  4KGI A;  4ZBD A;  3F4R A;  4ZIL A;  2WZ9 A;  2RM5 A;  2KUC A;  2NPB A;  3TKS C;  4RI6 A;  1WOU A;  2LUS A;  4ACS A;  2OJL A;  2WVX B;  4TVE A;  4D73 B;  4GWR A;  2GZP A;  5JWQ B;  5F8B A;  2YP6 A;  3I69 A;  1A0R P;  1V40 A;  2FWG A;  1UA5 A;  3QR6 A;  4AJ6 A;  2B7J A;  3HZ8 A;  3LSZ A;  1GTU A;  3ZL5 A;  2F8A A;  3GH9 A;  4QQ7 A;  2LEG A;  2I4A A;  3Q6O A;  4KCE A;  4WBJ A;  2OE0 A;  2LS5 A;  3E3E A;  4POL A;  4GQF A;  3FEU A;  1HQO A;  1PL1 A;  3MWH A;  3CSI A;  2WW2 A;  4IHU A;  4N0Z A;  2R3X A;  5KEJ A;  1X5E A;  1NM3 A;  2QGV A;  3FY7 A;  2VLT A;  4EVM A;  3VWX A;  1ZYP A;  3QFB C;  2VL2 C;  3GST A;  1EOH A;  1TK8 B;  2H75 A;  4HDE A;  1THX A;  1OC9 A;  3HJP A;  2FWH A;  2YNX A;  4HS1 A;  5CO3 A;  4J2F A;  2ZNM A;  1K3Y A;  4ID0 A;  1FAA A;  1LJR A;  1OE8 A;  2OAC A;  4NPB A;  3A5W A;  2DC5 A;  3R2Q A;  3EC3 A;  1GUK A;  5D9X A;  2L4C A;  2DML A;  3KEB A;  2H73 A;  4OMV A;  1TI3 A;  4HQZ A;  4KDX A;  2E2M A;  4MZC A;  1U88 A;  1ABA A;  5D9V A;  2NVL A;  3L9S A;  1ZCP A;  3TDG A;  2J9H A;  3TRX A;  5A1N B;  4YQU A;  4G19 A;  3S9F A;  1A0F A;  2GQL A;  4K5R A;  3OR5 A;  4ZB8 A;  4O5R A;  1EGR A;  5D93 A;  1O8X A;  2YJH A;  1ZZY A;  1QUW A;  2IME A;  4OCE A;  2PUK C;  4V1A g;  4AKG A;  2X99 A;  1VF2 A;  3M9J A;  3D21 A;  2V6K A;  3M8N A;  4TOP A;  1Z5Y E;  1IYH A;  5HR2 A;  4J57 E;  1JFU A;  1XFL A;  4JR6 A;  3UJ1 A;  4E68 A;  2L4Q A;  2DKI A;  2GGT A;  2GT6 A;  3GYK A;  2LKU A;  3IDV A;  2B5Y A;  3L9V A;  2DJ3 A;  2OE1 A;  1KTE A;  2L5L A;  1W89 A;  4HUA A;  2DIY A;  4X1U A;  1O73 A;  1HD2 A;  4MNN A;  3GFK A;  2M72 A;  2VAF A;  2H76 A;  3ZFL A;  3HZ4 A;  2KLX A;  1DE2 A;  2C0F A;  1R5P A;  1RQM A;  3FK8 A;  2C80 A;  2DSA A;  2LV3 A;  1UVZ A;  4FH8 A;  4CY8 A;  4NV5 A;  5J4Y A;  1ILO A;  2YAN A;  3EMP A;  3M9K A;  2H1L A;  3TJF A;  4L5O A;  1FVJ A;  3KP8 A;  2VCX A;  1F9M A;  1XWA A;  3UVH A;  5G5E A;  4ILF A;  3CRT A;  3CMI A;  4OO5 A;  2R0C A;  3EVI A;  4MA9 A;  4X0X A;  3WT2 A;  3C7M A;  4WR5 A;  3RGB C;  3BBY A;  1GSE A;  3EUR A;  1K0B A;  2IIY A;  3DML A;  2FA8 A;  2O85 A;  3TCO A;  4KW6 A;  1FG4 A;  4IN0 A;  1YF0 A;  2EC4 A;  3GUR A;  5GAP D;  2B1L A;  4AKX B;  3CBU A;  1T7P B;  2PGT A;  1N8J A;  2N5F A;  4CHS A;  3IV4 A;  4MP4 A;  1BJX A;  1Z6N A;  3CSH A;  2EFH A;  3M1G A;  5H5Q A;  1GUL A;  2HNL A;  1SJ6 A;  3UBK A;  2WRT A;  9GSS A;  2WW3 A;  2JSY A;  4XRD A;  3ZIV A;  1Y25 A;  1AW9 A;  5C00 A;  5DJM A;  2V2G A;  2VLU A;  1FB0 A;  4RUV A;  1EV9 A;  2FGX A;  2EIQ A;  3TRQ A;  1HNB A;  4OO4 A;  4G01 A;  1S3C A;  2JZR A;  3IC8 A;  3IC4 A;  5HR3 A;  5LCZ A;  4CW9 A;  2C3N A;  4XS4 A;  2DJ0 A;  4N10 A;  3KTB A;  3BD2 A;  3LG6 A;  3LJR A;  4Q5Q A;  3DYR A;  3VK9 A;  4MK3 A;  1MDI A;  1USB A;  3F63 A;  2YZU A;  5A5H B;  2O87 A;  4NHW A;  4MJB A;  3ZLP A;  5HR0 A;  5B8A A;  2CVK A;  2FA4 A;  1Y6E A;  3KMO A;  3IA1 A;  3LGC A;  2HZF A;  4MF6 A;  4HU9 A;  2QKE A;  4IP1 A;  1GTI A;  2UZ8 A;  3O6T A;  3GH6 A;  1WPI A;  1PSQ A;  2YJ7 A;  4PTS A;  4DEJ A;  2FLS A;  2OKA A;  1Z3E A;  1OE7 A;  5DVB A;  4O7H A;  5A34 B;  4AKI A;  4YH2 A;  1M3I A;  3QD9 A;  1TTZ A;  5CRE A;  5BMU B;  3KMN A;  5ECS A;  2CVD A;  4F9Z A;  3DGQ A;  3M0F A;  1S3D A;  3VI5 A;  4DSQ A;  1ERU A;  3ZTL A;  3CYN A;  1KNG A;  5A4U A;  1GRX A;  2HRA A;  1FOH A;  3GNJ A;  1Q4J A;  6GSU A;  5A34 A;  4XS6 A;  6GSV A;  5E59 A;  4AF2 A;  1XVQ A;  1TXU A;  1ZYN A;  1ACV A;  3VWW A;  2MMN A;  2HFD A;  3L9U A;  3ME7 A;  2LJR A;  3GIX A;  1IYI A;  1K3O A;  4ECJ A;  4GQC A;  3FKF A;  4PX1 A;  5INY A;  5GST A;  1E6B A;  1XZO A;  4F0B A;  5H5S A;  4Z7X A;  3PPU A;  1GSY A;  4ZB6 A;  3EWL A;  3A2W A;  1TRW A;  1M9B A;  4YAP A;  3ZVJ A;  2N5B A;  1TDI A;  2M46 A;  1E2Y A;  4MLY A;  1QMV A;  3FHK A;  4ECC A;  1A2M A;  4G0I A;  3TGZ A;  2ZUP A;  20GS A;  5D9W A;  5A5K A;  4KH7 A;  4BVY A;  2YWI A;  4KE3 A;  1M2D A;  4TRX A;  3TKS A;  3WGD A;  5CP1 A;  4L0U A;  1MDJ A;  1Z7R A;  4P3Y B;  2YWO A;  1ERW A;  2XHF A;  1YDK A;  1G6Y A;  3CHX C;  1TRU A;  2WUL A;  4EUY A;  3CTG A;  1NHO A;  2HRN A;  5CRW A;  4LL4 B;  1TK5 B;  4MZB A;  2MBT A;  2VO4 A;  3O3T A;  2GZZ A;  1PKZ A;  1GH2 A;  4IEL A;  3MNG A;  1Z6M A;  1YZX A;  4BA7 A;  3F3R A;  4N0V A;  2PN8 A;  1FHE A;  1A23 A;  1X5D A;  1XWC A;  1VF1 A;  1EGO A;  3TJJ A;  1NHY A;  4WBR D;  3SWL A;  4BPY A;  2YCD A;  3KIJ A;  2VL2 A;  5A4V A;  2C0G A;  4USS A;  2B1K A;  3TJB A;  4JBB A;  3FZ4 A;  4KA0 A;  3G7J A;  1M0U A;  5EL8 A;  5IO2 A;  1T4Z A;  5IOW A;  5IM9 A;  3F6F A;  1C72 A;  4X4J A;  3NZN A;  2WCI A;  5CRD A;  3LOR A;  3RAZ A;  5AGY A;  2L6D A;  2R0G A;  2YWM A;  4ZB9 A;  1U3I A;  5DDL A;  3FMW A;  4NXI A;  1VF3 A;  4N30 A;  2IL3 A;  2WDU A;  4LA1 A;  4MPF A;  2H6Y A;  5F0G A;  3UAR A;  1G7O A;  5A4W A;  1ZMA A;  4E8H A;  5HFG A;  4G0L A;  3A5I A;  4ML1 A;  1BED A;  3IBH A;  1A8Y A;  3UL3 A;  1A8L A;  5CYY A;  4PGT A;  14GS A;  4RI7 A;  4V2N A;  4MPG A;  1GNE A;  1SL2 B;  2WVZ A;  3IOS A;  5COH A;  4TXO B;  3UOM A;  2WS2 A;  1OYJ A;  2F51 A;  2H01 A;  1GP1 A;  4FQU A;  4TR1 B;  4POM A;  2LST A;  2AYT A;  4CY6 A;  3C1S A;  2X4A A;  1CQG A;  4EXJ A;  2KHP A;  2I9H A;  3F4T A;  1YVL A;  1URM A;  1FOV A;  1U87 A;  2V41 A;  4BVX B;  4EF0 A;  3EIN A;  5D73 A;  2IFQ A;  1EP7 A;  4IQ1 A;  3HVX A;  3LWA A;  3TJG A;  1Z9H A;  1MD3 A;  5KN2 A;  3F0I A;  1KEB A;  2GQM A;  5G30 A;  2DJ2 A;  3US3 A;  22GS A;  19GS A;  2WVX A;  4D73 A;  4WF4 A;  1SKS B;  2CX4 A;  2XC2 A;  2GSS A;  3TKQ A;  4ZL7 A;  4BVX A;  4AJ7 A;  3C1R A;  2XBI A;  5KOW A;  1PGT A;  1O7U A;  4MMM A;  3LW9 A;  3QOU A;  2ES7 A;  1H4O A;  2A2P A;  5C04 A;  3GUS A;  3APQ A;  3L0H A;  2TRC P;  1ML6 A;  4Q5N A;  3TJK A;  1EEM A;  4F82 A;  3LEF A;  2JSZ A;  4BL7 B;  2HXK A;  2R37 A;  1A2J A;  3DVW A;  3GX0 A;  1SK1 A;  3HVS A;  4K2X A;  2D2Z A;  1O85 A;  2TIR A;  3FR9 A;  4PNG A;  2JZT A;  1BX9 A;  4XTS A;  4IJ3 A;  4FYB A;  4CDO A;  2MBS A;  5HFK A;  2IMK A;  2WJU A;  5ABR A;  4Q5F A;  5J4U A;  3A2V A;  2VCZ A;  2X49 A;  4EE0 A;  2CAQ A;  2FY6 A;  3GX8 A;  2HSM B;  2XPE A;  1MD4 A;  1Y1U A;  2PBJ A;  1BF5 A;  4BWS A;  1K0D A;  4PHZ C;  5ID2 B;  4K7O A;  1SVL A;  2PVO C;  1SVM A;  1PKW A;  5DJL A;  1Z7P A;  2JZS A;  2VIM A;  1X9S B;  4POK A;  1K0M A;  3GKM A;  2QA2 A;  3JCM L;  5JWR B;  1SU9 A;  1M99 A;  2OE3 A;  2VCV A;  3KH7 A;  3H93 A;  1M2B A;  2HSM A;  1G7E A;  4OFT A;  1YEP A;  5A1N A;  4EIP A;  1PD2 1;  3TUE A;  2QSI A;  1TRS A;  2BMX A;  3VFI A;  1N2A A;  4OD7 A;  2OA7 A;  5ID2 A;  5ECM B;  2YPM A;  1XW6 A;  2WGR A;  3GSS A;  5DAL B;  5J47 A;  4WF5 A;  2A2R A;  1G6W A;  2VD1 A;  2B5X A;  4NHZ A;  4EDY A;  1O8W A;  4KF9 A;  5DAK B;  1JZO A;  1CQH A;  2HSH A;  2C3T A;  5EPF A;  3VPQ A;  1XPV A;  2P5Q A;  2BJX A;  4PI2 C;  1T1V A;  2FUG 2;  4MJE A;  1J9B A;  4YQV A;  4HSC X;  4AJ8 A;  2FD3 A;  3Q18 A;  2HE3 A;  2DKH A;  1EP8 A;  2E7P A;  1R7H A;  5IMA A;  3VWV A;  3ME8 A;  3TU3 B;  2BTO T;  1AC1 A;  1EV4 A;  1FW1 A;  5EVO A;  3HJO A;  2UV8 G;  2GSQ A;  3BJ5 A;  3G7I A;  1HNC A;  4N11 A;  4JU5 A;  1I1I P;  4YKF A;  4FIW A;  4J56 E;  2L5O A;  4JRR A;  4DSR A;  4ZBB A;  1W4V A;  2GDR A;  3FZA A;  2IWT A;  2P0G A;  3WD6 A;  1GSF A;  5EY6 A;  3UAP A;  2B5E A;  2L59 A;  2E2G A;  1EZK A;  4PUF C;  1GTB A;  18GS A;  1VGL A;  3W8J A;  4PQI A;  3KP9 A;  3GTU B;  1SD8 A;  3F9U A;  2H1D A;  2H6X A;  4AGS A;  3LQ7 A;  2WFC A;  4DVC A;  5IIZ A;  3BCK A;  1DUG A;  1V58 A;  4GDF A;  3VWU A;  1TJD A;  4BIK A;  1M9A A;  4FXY P;  4YAV A;  2AAW A;  5J41 A;  1EWX A;  1K0A A;  1ERT A;  3LXZ A;  2EIR A;  2F3M A;  2DJJ A;  3G7Y A;  2ZCT A;  3HJM A;  2LJA A;  3GV1 A;  1SL0 B;  2H70 A;  2CV4 A;  1B4Q A;  10GS A;  1VF4 A;  2OBI A;  1QQ2 A;  3ERG A;  2H0I A;  2YZH A;  1OC8 A;  1G0T A;  1AQW A;  1XWG A;  2KP1 A;  5IMZ A;  2HLS A;  1AQX A;  1SL1 B;  3GKX A;  5HR1 A;  1H75 A;  2VCT A;  3ZYW A;  3UEM A;  3KGK A;  1TKD B;  3DKS A;  5ECK B;  2V6O A;  1WMJ A;  4MH2 A;  1F3B A;  1TW9 A;  1XWK A;  3IPZ A;  3BCI A;  1V2A A;  3ZML A;  3WT1 A;  1JZD A;  4IW9 A;  4KB3 A;  1T4Y A;  1PA3 A;  2OBK A;  4G2E A;  2N5A A;  4I6X A;  1ON4 A;  2H19 A;  4LLR A;  2QA1 A;  3HY2 A;  4OWY A;  5IMC A;  6GSW A;  1PN0 A;  4HI7 A;  3WGE A;  1Q98 A;  1ST9 A;  3RHC A;  6GSY A;  2WB9 A;  3F8U A;  4MCU A;  4ML6 A;  5ECR B;  2IJY A;  1T00 A;  4ISD A;  3FZ9 A;  1RW1 A;  5A5H A;  1AAZ A;  4GCI A;  4JR4 A;  2HSY A;  1YY7 A;  2O3E A;  1R26 A;  1I9D A;  3RBT A;  1TI1 A;  3A3T A;  2ALB A;  3HVN A;  3KTL A;  3GRX A;  3O76 A;  4NAX A;  2F8F A;  5JWO B;  1SD9 A;  3Q19 A;  5LD0 A;  2R6K A;  4X43 A;  4I2U A;  4I2T A;  3P8W A;  4EDZ A;  4V1A p;  1K0C A;  3U5R E;  2GST A;  4TR4 A;  3CSJ A;  2DIZ A;  3ERW A;  5B7C A;  5JCG A;  2HZE B;  2VUP A;  3RFR C;  2GT5 A;  1M7T A;  5GZZ B;  5G1L A;  5BMU A;  5B6M A;  2PVQ A;  3BOA A;  4HOJ A;  1V9W A;  2R4V A;  5HQP A;  3IHG A;  3J7Y b;  4AI6 A;  4K6X A;  3EU3 A;  2ON7 A;  4LL1 B;  2VCQ A;  2C8U A;  2A4H A;  2LNS A;  4Z2T A;  3IXR A;  4N3Z A;  2LQQ A;  4TR0 A;  5E4W A;  4KDU A;  2DBC A;  1TP9 A;  8GSS A;  3N5O A;  1OVN A;  3MYD A;  2H1A A;  2EFD A;  1FVK A;  2CVB A;  1TU7 A;  3LXT A;  4LMW A;  3L78 A;  3VLN A;  5IMV A;  2K8S A;  3P2A A;  2K6V A;  3GMF A;  3ERF A;  4ZB7 A;  5CNW A;  5D9T A;  4OFN A;  1WE0 A;  1S3A A;  2IMD A;  4MH3 A;  3HKR A;  3P7X A;  2R2J A;  3EPT A;  1AQV A;  4GLT A;  1VRS D;  2VLV A;  1SKR B;  3L4N A;  3ISO A;  4ECI A;  2LRT A;  1GUH A;  1OKT A;  4FO5 A;  5AN1 A;  3D5J A;  4G10 A;  3IHQ A;  2OT3 A;  1B48 A;  1SVO A;  1YQ1 A;  3DIE A;  3CTF A;  1QGV A;  3IAM 2;  1GUM A;  2PER A;  3ZRD A;  1GNW A;  2H0G A;  2IN3 A;  1EOG A;  3UVT A;  1KBN A;  2G2Q A;  2VL9 A;  5FHI A;  2R0P A;  4K2D A;  4HZ4 A;  4GSN A;  3MDK A;  1TOF A;  1K3L A;  3I6A A;  4NV2 A;  3FYG A;  1SJZ A;  5G5F A;  5ECI B;  1ZOF A;  3FZ5 A;  3HD5 A;  5L71 A;  2LRC A;  3QDN A;  4ZL8 A;  1WRY A;  3F4S A;  2RUE A;  2MMA A;  2C3Q A;  2A2S A;  1SYX A;  2WZS A;  5IMF A;  3RHB A;  3HA9 A;  4HQS A;  5F05 A;  1HYU A;  1JLW A;  3IK7 A;  2AHE A;  1XOB A;  3ZVJ D;  1F2E A;  2CT6 A;  5ELA A;  4FYC A;  1T8E B;  1A24 A;  4O32 A;  4IBP A;  2J23 A;  3QAG A;  2X8G A;  3KXO A;  1LBK A;  1LU4 A;  2H1G A;  3AY8 A;  2WW0 A;  3D0Z A;  2JAD A;  2AUV A;  4MAB A;  2PU9 C;  1AXD A;  3HDC A;  1O6J A;  2P5R A;  3GKK A;  2H71 A;  2JU5 A;  5G2Z A;  2AV4 A;  2EIO A;  1BYE A;  4Q5R A;  2VM1 A;  2AB6 A;  2VOC A;  2R5G A;  2C1Y A;  2C0D A;  1NSW A;  5G1K A;  4L0W A;  2DJ1 A;  4POB A;  5CAX A;  1BG5 A;  3DRN A;  3KM6 A;  2F9S A;  4TXO A;  3C8E A;  3PGT A;  1TRV A;  1XBS A;  5DQY A;  5G31 A;  2CX3 A;  2JL4 A;  4GSS A;  3IK9 A;  1B9X C;  5IOX A;  4HJM A;  4QMK A;  3GHA A;  3UIW A;  4TR1 A;  2IMF A;  1B8X A;  3A2X A;  4K1F A;  5JCU A;  1R5A A;  6GSX A;  3DD3 A;  1F3A A;  2GZY A;  2ON5 A;  4WXT A;  4HEA 2;  3IR4 A;  4EIQ A;  3FW2 A;  1XW9 A;  4FYU A;  4E8E A;  2IMI A;  2IPA A;  3KD0 A;  4OCF A;  2I1U A;  1O81 A;  1BAY A;  1OC9 B;  4TXV A;  2GQK A;  4ICY A;  1SYR A;  5BRT A;  4K0N A;  1JLV A;  1X9W B;  4QL9 A;  4JE1 A;  1PN9 A;  2FHE A;  1R4W A;  3ZRE A;  2LNT A;  3TKP A;  1X0R A;  2CZ3 A;  3LYK A;  3HVV A;  3LFL A;  1YKC A;  3ZIT A;  3D6I A;  1DSB A;  3QFA C;  5KN0 A;  3N9J A;  2X8H A;  3SBC A;  5IO0 A;  2HQT A;  3K8N A;  2HYX A;  1YKA A;  5ECH B;  2O89 A;  3H79 A;  4IP6 A;  2C0E A;  2REM A;  1GSU A;  2MZC A;  2CA8 A;  4GST A;  2LJK A;  3HXS A;  1WJK A;  5DQS A;  4BL7 A;  5J9C A;  3HHV A;  1PFO A;  4O5Q A;  4OFM A;  5CRG A;  17GS A;  2RM6 A;  3ZZX A;  3H4K A;  5DBQ A;  3VPT A;  1V57 A;  2H72 A;  2H30 A;  2EFE A;  3TOT A;  3VI7 A;  1FB6 A;  4TR3 A;  4H86 A;  2CQ9 A;  1XG8 A;  2H74 A;  2MMZ A;  2H0H A;  3V1W A;  2K8V A;  1YF1 A;  3QMX A;  1XIY A;  5CRH A;  4ECB A;  2YV7 A;  3APS A;  4K7N A;  3ED3 A;  3W6G A;  1XXU A;  3QCP A;  2YN1 A;  4YQM A;  3CRU A;  1XWB A;  2G0F A;  4WEY A;  1SK2 A;  4XIH A;  1S4B P;  3ZFB A;  6GSS A;  2HI7 A;  1UC7 A;  4K9Z A;  5DCG A;  2PMT A;  2K18 A;  4XHM A;  3E0U A;  4I8B A;  2HSN B;  5FT3 A;  3QPM A;  4V2M A;  5DCH A;  3FR6 A;  4KND A;  4XCS A;  5KN3 A;  2X8C A;  2B6M A;  4WKW A;  4TKY A;  3LYP A;  5J5N A;  4RQR A;  1SKW B;  4MZW A;  2GVP A;  5DAL A;  2PWJ A;  5DAK A;  2YWN A;  3CQF A;  3UBL A;  2HSN A;  2E0Q A;  3ZMK A;  2DJK A;  2FNO A;  1OAZ A;  1WWJ A;  4V2L A;  1YJ6 A;  4XS1 A;  1YEX A;  3Q74 A;  2H66 A;  1M2A A;  1SEN A;  2LTK A;  2NTO A;  4ZXG A;  1U6T A;  5D96 A;  1ZGN A;  4MJC A;  2K9F A;  2NBS A;  4PQH A;  3TOU A;  5JCW A;  4G9H A;  1WP0 A;  1J0F A;  4MF7 A;  1YEW C;  4PQ1 A;  2L57 A;  1V98 A;  5IPH A;  5GAN D;  2WVY A;  1NW2 A;  4MF5 A;  2I3Y A;  1ERV A;  3GN3 A;  2HRK B;  4PXO A;  4WET A;  4TN8 A;  3PR8 A;  2WW1 A;  1OC3 A;  1PQN A;  1MTC A;  2EFC A;  3KJY A;  1WIK A;  3F3Q A;  3I9V 2;  3GTU A;  2V32 A;  4GXZ A;  4IVF A;  1QK8 A;  3M3M A;  2HRF A;  3RPP A;  3NIV A;  4JED A;  1UN2 A;  4KCA A;  4NMU A;  1B9Y C;  1PL2 A;  4IJI A;  2HRK A;  1MDK A;  1RK4 A;  3D22 A;  4L5L A;  5ELG A;  4XS4 B;  4KAE A;  3DVX A;  4PI0 C;  3E9J B;  2X64 A;  2GTU A;  4KUN A;  2FCH A;  3D4M A;  3GL3 A;  3MAK A;  5ECL B;  3CXG A;  2RLI A;  1GL8 A;  4GRF A;  4IGJ A;  2OAD A;  2O8V B;  5IPG A;  2CZ2 A;  1XW5 A;  3TKS E;  3KZQ A;  1JHB A;  1N25 A;  4IQA A;  1JZW A;  5ENU A;  2C4J A;  1DE1 A;  5KOX A;  2CAI A;  3VUR A;  4PUA A;  2B7K A;  5IMD A;  2MYG A;  4DSS B;  2VL3 A;  3H1N A;  2DLX A;  3I43 A;  1GSS A;  2RII A;  3FRC A;  1K0O A;  4TW5 A;  3FR3 A;  1I5G A;  3TB2 A;  3APO A;  5FWG A;  1F37 A;  7GSS A;  4YKG A;  4WR4 A;  4K7I A;  4EL1 A;  2LRN A;  1XVW A;  2PPT A;  5KN1 A;  1S3R A;  4O5U A;  5J9B A;  3UMA A;  3HYP A;  4I97 A;  1SK0 A;  3C71 A;  5AIS A;  3GA4 A;  1AIU A;  4RQX A;  4DSS A;  3RPN A;  3EMX A;  2GLR A;  1PRX A;  4AKH A;  4EO3 A;  1T3B A;  3DXB A;  5AIX A;  4ZIJ A;  3EU4 A;  1HNA A;  2NDO A;  1PX7 A;  2Z9S A;  4LMV A;  4BWQ A;  5ECQ B;  4QL7 A;  3F6D A;  5B8B A;  5J3R A;  5B6N A;  4F03 A;  3EYT A;  2VD0 A;  1THO A;  3RDW A;  1QFN A;  4KDY A;  2QC7 A;  1GWC A; 
#chains in the Genus database with same CATH homology
 3KH9 A;  4Z2R A;  2V1M A;  2GSR A;  2AJQ B;  3TKR A;  3WYW A;  2MMO A;  4PNF A;  3NOF A;  2HZE A;  4GTU A;  3MIX A;  2RUF A;  3WGX A;  2H8L A;  4O92 A;  2L6C A;  3DWV A;  2O5V A;  5ECO B;  4L8E A;  4KSM A;  3J7Y k;  1ZYQ B;  2XPD A;  3D4T A;  5AIV A;  4BVY B;  3GL5 A;  1GLP A;  1BQ7 A;  2YOI A;  5J4V A;  1BG1 A;  3U6V A;  1GSQ A;  3HMJ G;  4G0K A;  1XCC A;  4ULX A;  4F0C A;  1TU8 A;  4IKH A;  2M80 A;  3DEX A;  5GSS A;  5LNK e;  2O7K A;  2JAC A;  1QXH A;  3C73 A;  1SJI A;  1X5C A;  1K0N A;  4NWY A;  6GST A;  1MEK A;  4I5Q A;  1FO5 A;  4HU7 A;  3MSZ A;  4KSO A;  4K5S A;  13GS A;  3TRP A;  4IS0 A;  12GS A;  3IAS 2;  4K8M A;  5J40 A;  4MJA A;  1AUC A;  3GKN A;  16GS A;  4ZBA A;  1U3A A;  3IRA A;  4EKZ A;  2TRX A;  4ZL9 A;  3HCZ A;  3ZIJ A;  2KOK A;  1J08 A;  3QAW A;  4MDC A;  1OKD A;  1ZYE A;  1F6M C;  3PH9 A;  3QAV A;  1XOA A;  3PIN A;  4K0G A;  1PMT A;  4A5P A;  4Z2U A;  5ECP B;  4PUR A;  2A4V A;  1GTA A;  2P31 A;  5IQY A;  2H1B A;  5HFI A;  3CWG A;  4KX4 A;  5F06 A;  3H8Q A;  5D8I A;  1DBY A;  1EEJ A;  4HZ2 A;  2YV9 A;  11GS A;  1B4P A;  1PX6 A;  5ECN B;  1A2L A;  2HT9 A;  2DMM A;  4HJ2 A;  2KP2 A;  5H5R A;  5F07 A;  4W66 A;  2VM2 A;  1TK0 B;  2FWF A;  2FWE A;  3W8S A;  2I81 A;  4GF0 A;  3G9B A;  2GS3 A;  2H6Z A;  1TXX A;  4EC0 A;  3KCM A;  2VCW A;  1GLQ A;  4XRA A;  1ZL9 A;  1GSD A;  1X9M B;  1JZR A;  4JZQ A;  4F2I A;  2LQO A;  3EE2 A;  2XBQ A;  3P90 A;  2B3S A;  2IFQ B;  2VKZ G;  3IE3 A;  3R3E A;  4KGI A;  4ZBD A;  3F4R A;  4ZIL A;  2WZ9 A;  2RM5 A;  2KUC A;  2NPB A;  3TKS C;  4RI6 A;  1WOU A;  2LUS A;  4ACS A;  2OJL A;  4TVE A;  4D73 B;  4GWR A;  2GZP A;  5JWQ B;  5F8B A;  2YP6 A;  3I69 A;  1A0R P;  1V40 A;  2FWG A;  1UA5 A;  3QR6 A;  4AJ6 A;  2B7J A;  3HZ8 A;  3LSZ A;  1GTU A;  3ZL5 A;  2F8A A;  3GH9 A;  4QQ7 A;  2LEG A;  2I4A A;  3Q6O A;  4KCE A;  4WBJ A;  2OE0 A;  2LS5 A;  3E3E A;  4POL A;  4GQF A;  3FEU A;  1HQO A;  1PL1 A;  3MWH A;  3CSI A;  4IHU A;  4N0Z A;  2R3X A;  5KEJ A;  1X5E A;  1NM3 A;  2QGV A;  3FY7 A;  2VLT A;  4EVM A;  3VWX A;  1ZYP A;  3QFB C;  2VL2 C;  3GST A;  1EOH A;  1TK8 B;  2H75 A;  4HDE A;  1THX A;  1OC9 A;  3HJP A;  2FWH A;  2YNX A;  4HS1 A;  5CO3 A;  4J2F A;  2ZNM A;  1K3Y A;  4ID0 A;  1FAA A;  1LJR A;  1OE8 A;  2OAC A;  4NPB A;  3A5W A;  2DC5 A;  3R2Q A;  3EC3 A;  1GUK A;  5D9X A;  2L4C A;  2DML A;  3KEB A;  2H73 A;  4OMV A;  1TI3 A;  4HQZ A;  4KDX A;  2E2M A;  4MZC A;  1U88 A;  1ABA A;  5D9V A;  2NVL A;  3L9S A;  1ZCP A;  3TDG A;  2J9H A;  3TRX A;  5A1N B;  4YQU A;  4G19 A;  3S9F A;  1A0F A;  2GQL A;  4K5R A;  3OR5 A;  4ZB8 A;  4O5R A;  1EGR A;  5D93 A;  1O8X A;  2YJH A;  1ZZY A;  1QUW A;  2IME A;  4OCE A;  2PUK C;  4V1A g;  4AKG A;  2X99 A;  1VF2 A;  3M9J A;  3D21 A;  2V6K A;  3M8N A;  4TOP A;  1Z5Y E;  1IYH A;  5HR2 A;  4J57 E;  1JFU A;  1XFL A;  4JR6 A;  3UJ1 A;  4E68 A;  2L4Q A;  2DKI A;  2GGT A;  2GT6 A;  3GYK A;  2LKU A;  3IDV A;  2B5Y A;  3L9V A;  2DJ3 A;  2OE1 A;  1KTE A;  2L5L A;  1W89 A;  4HUA A;  2DIY A;  4X1U A;  1O73 A;  1HD2 A;  4MNN A;  3GFK A;  2M72 A;  2VAF A;  2H76 A;  3ZFL A;  3HZ4 A;  2KLX A;  1DE2 A;  2C0F A;  1R5P A;  1RQM A;  3FK8 A;  2C80 A;  2DSA A;  2LV3 A;  1UVZ A;  4FH8 A;  4CY8 A;  4NV5 A;  5J4Y A;  1ILO A;  2YAN A;  3EMP A;  3M9K A;  2H1L A;  3TJF A;  4L5O A;  1FVJ A;  3KP8 A;  2VCX A;  1F9M A;  1XWA A;  3UVH A;  5G5E A;  4ILF A;  3CRT A;  3CMI A;  4OO5 A;  2R0C A;  3EVI A;  4MA9 A;  4X0X A;  3WT2 A;  3C7M A;  4WR5 A;  3BBY A;  1GSE A;  3EUR A;  1K0B A;  2IIY A;  3DML A;  2FA8 A;  2O85 A;  3TCO A;  4KW6 A;  1FG4 A;  4IN0 A;  1YF0 A;  2EC4 A;  3GUR A;  5GAP D;  2B1L A;  4AKX B;  3CBU A;  1T7P B;  2PGT A;  1N8J A;  2N5F A;  4CHS A;  3IV4 A;  4MP4 A;  1BJX A;  1Z6N A;  3CSH A;  2EFH A;  3M1G A;  5H5Q A;  1GUL A;  2HNL A;  1SJ6 A;  3UBK A;  2WRT A;  9GSS A;  2JSY A;  4XRD A;  3ZIV A;  1Y25 A;  1AW9 A;  5C00 A;  5DJM A;  2V2G A;  2VLU A;  1FB0 A;  4RUV A;  1EV9 A;  2FGX A;  2EIQ A;  3TRQ A;  1HNB A;  4OO4 A;  4G01 A;  1S3C A;  2JZR A;  3IC8 A;  3IC4 A;  5HR3 A;  5LCZ A;  4CW9 A;  2C3N A;  4XS4 A;  2DJ0 A;  4N10 A;  3KTB A;  3BD2 A;  3LG6 A;  3LJR A;  4Q5Q A;  3DYR A;  3VK9 A;  4MK3 A;  1MDI A;  1USB A;  3F63 A;  2YZU A;  5A5H B;  2O87 A;  4NHW A;  4MJB A;  3ZLP A;  5HR0 A;  5B8A A;  2CVK A;  2FA4 A;  1Y6E A;  3KMO A;  3IA1 A;  3LGC A;  2HZF A;  4MF6 A;  4HU9 A;  2QKE A;  4IP1 A;  1GTI A;  2UZ8 A;  3O6T A;  3GH6 A;  1WPI A;  1PSQ A;  2YJ7 A;  4PTS A;  4DEJ A;  2FLS A;  2OKA A;  1Z3E A;  1OE7 A;  5DVB A;  4O7H A;  5A34 B;  4AKI A;  4YH2 A;  3QD9 A;  1TTZ A;  5CRE A;  5BMU B;  3KMN A;  5ECS A;  2CVD A;  4F9Z A;  3DGQ A;  3M0F A;  1S3D A;  3VI5 A;  4DSQ A;  1ERU A;  3ZTL A;  3CYN A;  1KNG A;  5A4U A;  1GRX A;  2HRA A;  1FOH A;  3GNJ A;  1Q4J A;  6GSU A;  5A34 A;  4XS6 A;  6GSV A;  5E59 A;  4AF2 A;  1XVQ A;  1TXU A;  1ZYN A;  1ACV A;  3VWW A;  2MMN A;  2HFD A;  3L9U A;  3ME7 A;  2LJR A;  3GIX A;  1IYI A;  1K3O A;  4ECJ A;  4GQC A;  3FKF A;  4PX1 A;  5INY A;  5GST A;  1E6B A;  1XZO A;  4F0B A;  5H5S A;  4Z7X A;  3PPU A;  1GSY A;  4ZB6 A;  3EWL A;  3A2W A;  1TRW A;  1M9B A;  4YAP A;  3ZVJ A;  2N5B A;  1TDI A;  2M46 A;  1E2Y A;  4MLY A;  1QMV A;  3FHK A;  4ECC A;  1A2M A;  4G0I A;  3TGZ A;  2ZUP A;  20GS A;  5D9W A;  5A5K A;  4KH7 A;  4BVY A;  2YWI A;  4KE3 A;  1M2D A;  4TRX A;  3TKS A;  3WGD A;  5CP1 A;  4L0U A;  1MDJ A;  1Z7R A;  4P3Y B;  2YWO A;  1ERW A;  2XHF A;  1YDK A;  1G6Y A;  2WUL A;  1TRU A;  4EUY A;  3CTG A;  1NHO A;  2HRN A;  5CRW A;  4LL4 B;  1TK5 B;  4MZB A;  2MBT A;  2VO4 A;  3O3T A;  2GZZ A;  1PKZ A;  1GH2 A;  4IEL A;  3MNG A;  1Z6M A;  1YZX A;  4BA7 A;  3F3R A;  4N0V A;  2PN8 A;  1FHE A;  1A23 A;  1X5D A;  1XWC A;  1VF1 A;  1EGO A;  3TJJ A;  1NHY A;  4WBR D;  3SWL A;  4BPY A;  2YCD A;  3KIJ A;  2VL2 A;  5A4V A;  2C0G A;  4USS A;  2B1K A;  3TJB A;  4JBB A;  3FZ4 A;  4KA0 A;  3G7J A;  1M0U A;  5EL8 A;  5IO2 A;  1T4Z A;  5IOW A;  5IM9 A;  3F6F A;  1C72 A;  4X4J A;  3NZN A;  2WCI A;  5CRD A;  3LOR A;  3RAZ A;  5AGY A;  2L6D A;  2R0G A;  2YWM A;  4ZB9 A;  1U3I A;  5DDL A;  3FMW A;  4NXI A;  1VF3 A;  4N30 A;  2IL3 A;  2WDU A;  4LA1 A;  4MPF A;  2H6Y A;  5F0G A;  3UAR A;  1G7O A;  5A4W A;  1ZMA A;  4E8H A;  5HFG A;  4G0L A;  3A5I A;  4ML1 A;  1BED A;  3IBH A;  1A8Y A;  3UL3 A;  1A8L A;  5CYY A;  4PGT A;  14GS A;  4RI7 A;  4V2N A;  4MPG A;  1GNE A;  1SL2 B;  3IOS A;  5COH A;  4TXO B;  3UOM A;  2WS2 A;  1OYJ A;  2F51 A;  2H01 A;  1GP1 A;  4FQU A;  4TR1 B;  4POM A;  2LST A;  2AYT A;  4CY6 A;  3C1S A;  2X4A A;  1CQG A;  4EXJ A;  2KHP A;  2I9H A;  3F4T A;  1YVL A;  1URM A;  1FOV A;  1U87 A;  2V41 A;  4BVX B;  4EF0 A;  3EIN A;  5D73 A;  2IFQ A;  1EP7 A;  4IQ1 A;  3HVX A;  3LWA A;  3TJG A;  1Z9H A;  1MD3 A;  5KN2 A;  3F0I A;  1KEB A;  2GQM A;  5G30 A;  2DJ2 A;  3US3 A;  22GS A;  19GS A;  4D73 A;  4WF4 A;  1SKS B;  2CX4 A;  2XC2 A;  2GSS A;  3TKQ A;  4ZL7 A;  4BVX A;  4AJ7 A;  3C1R A;  2XBI A;  5KOW A;  1PGT A;  1O7U A;  4MMM A;  3LW9 A;  3QOU A;  2ES7 A;  1H4O A;  2A2P A;  5C04 A;  3GUS A;  3APQ A;  3L0H A;  2TRC P;  1ML6 A;  4Q5N A;  3TJK A;  1EEM A;  4F82 A;  3LEF A;  2JSZ A;  4BL7 B;  2HXK A;  2R37 A;  1A2J A;  3DVW A;  3GX0 A;  1SK1 A;  3HVS A;  4K2X A;  2D2Z A;  1O85 A;  2TIR A;  3FR9 A;  4PNG A;  2JZT A;  1BX9 A;  4XTS A;  4IJ3 A;  4FYB A;  4CDO A;  2MBS A;  5HFK A;  2IMK A;  2WJU A;  5ABR A;  4Q5F A;  5J4U A;  3A2V A;  2VCZ A;  2X49 A;  4EE0 A;  2CAQ A;  2FY6 A;  3GX8 A;  2HSM B;  2XPE A;  1MD4 A;  1Y1U A;  2PBJ A;  1BF5 A;  4BWS A;  1K0D A;  5ID2 B;  4K7O A;  1SVL A;  2PVO C;  1SVM A;  1PKW A;  5DJL A;  1Z7P A;  2JZS A;  2VIM A;  1X9S B;  4POK A;  1K0M A;  3GKM A;  2QA2 A;  3JCM L;  5JWR B;  1SU9 A;  1M99 A;  2OE3 A;  2VCV A;  3KH7 A;  3H93 A;  1M2B A;  2HSM A;  1G7E A;  4OFT A;  1YEP A;  5A1N A;  4EIP A;  1PD2 1;  3TUE A;  2QSI A;  1TRS A;  2BMX A;  3VFI A;  1N2A A;  4OD7 A;  2OA7 A;  5ID2 A;  5ECM B;  2YPM A;  1XW6 A;  2WGR A;  3GSS A;  5DAL B;  5J47 A;  4WF5 A;  2A2R A;  1G6W A;  2VD1 A;  2B5X A;  4NHZ A;  4EDY A;  1O8W A;  4KF9 A;  5DAK B;  1JZO A;  1CQH A;  2HSH A;  2C3T A;  5EPF A;  3VPQ A;  1XPV A;  2P5Q A;  2BJX A;  4MJE A;  1T1V A;  2FUG 2;  1J9B A;  4YQV A;  4AJ8 A;  2FD3 A;  3Q18 A;  2HE3 A;  2DKH A;  1EP8 A;  2E7P A;  1R7H A;  5IMA A;  3VWV A;  3ME8 A;  3TU3 B;  2BTO T;  1AC1 A;  1EV4 A;  1FW1 A;  5EVO A;  3HJO A;  2UV8 G;  2GSQ A;  3BJ5 A;  3G7I A;  1HNC A;  4N11 A;  4JU5 A;  4YKF A;  4FIW A;  4J56 E;  2L5O A;  4JRR A;  4DSR A;  4ZBB A;  1W4V A;  2GDR A;  3FZA A;  2IWT A;  2P0G A;  3WD6 A;  1GSF A;  5EY6 A;  3UAP A;  2B5E A;  2L59 A;  2E2G A;  1EZK A;  4PUF C;  1GTB A;  18GS A;  1VGL A;  3W8J A;  4PQI A;  3KP9 A;  3GTU B;  1SD8 A;  3F9U A;  2H1D A;  2H6X A;  4AGS A;  3LQ7 A;  2WFC A;  4DVC A;  5IIZ A;  3BCK A;  1DUG A;  1V58 A;  4GDF A;  3VWU A;  1TJD A;  1M9A A;  4YAV A;  2AAW A;  5J41 A;  1EWX A;  1K0A A;  1ERT A;  3LXZ A;  2EIR A;  2F3M A;  2DJJ A;  3G7Y A;  2ZCT A;  3HJM A;  2LJA A;  3GV1 A;  1SL0 B;  2H70 A;  2CV4 A;  1B4Q A;  10GS A;  1VF4 A;  2OBI A;  1QQ2 A;  3ERG A;  2H0I A;  2YZH A;  1OC8 A;  1G0T A;  1AQW A;  1XWG A;  2KP1 A;  5IMZ A;  2HLS A;  1AQX A;  1SL1 B;  3GKX A;  5HR1 A;  1H75 A;  2VCT A;  3ZYW A;  3UEM A;  3KGK A;  1TKD B;  3DKS A;  5ECK B;  2V6O A;  1WMJ A;  4MH2 A;  1F3B A;  1TW9 A;  1XWK A;  3IPZ A;  3BCI A;  1V2A A;  3ZML A;  3WT1 A;  1JZD A;  4IW9 A;  4KB3 A;  1T4Y A;  1PA3 A;  2OBK A;  4G2E A;  2N5A A;  4I6X A;  1ON4 A;  2H19 A;  4LLR A;  2QA1 A;  3HY2 A;  4OWY A;  5IMC A;  6GSW A;  1PN0 A;  4HI7 A;  3WGE A;  1Q98 A;  1ST9 A;  3RHC A;  6GSY A;  2WB9 A;  3F8U A;  4MCU A;  4ML6 A;  5ECR B;  2IJY A;  1T00 A;  4ISD A;  3FZ9 A;  1RW1 A;  5A5H A;  1AAZ A;  4GCI A;  4JR4 A;  2HSY A;  1YY7 A;  1R26 A;  1I9D A;  3RBT A;  1TI1 A;  3A3T A;  2ALB A;  3KTL A;  3GRX A;  3O76 A;  4NAX A;  2F8F A;  5JWO B;  1SD9 A;  3Q19 A;  5LD0 A;  2R6K A;  4X43 A;  4I2U A;  4I2T A;  3P8W A;  4EDZ A;  4V1A p;  1K0C A;  3U5R E;  2GST A;  4TR4 A;  3CSJ A;  2DIZ A;  3ERW A;  5B7C A;  5JCG A;  2HZE B;  2VUP A;  2GT5 A;  1M7T A;  5GZZ B;  5G1L A;  5BMU A;  5B6M A;  2PVQ A;  3BOA A;  4HOJ A;  1V9W A;  2R4V A;  5HQP A;  3IHG A;  3J7Y b;  4AI6 A;  4K6X A;  3EU3 A;  2ON7 A;  4LL1 B;  2VCQ A;  2C8U A;  2A4H A;  2LNS A;  4Z2T A;  3IXR A;  4N3Z A;  2LQQ A;  4TR0 A;  5E4W A;  4KDU A;  2DBC A;  1TP9 A;  8GSS A;  3N5O A;  1OVN A;  3MYD A;  2H1A A;  2EFD A;  1FVK A;  2CVB A;  1TU7 A;  3LXT A;  4LMW A;  3L78 A;  3VLN A;  5IMV A;  2K8S A;  3P2A A;  2K6V A;  3GMF A;  3ERF A;  4ZB7 A;  5CNW A;  5D9T A;  4OFN A;  1WE0 A;  1S3A A;  2IMD A;  4MH3 A;  3HKR A;  3P7X A;  2R2J A;  3EPT A;  1AQV A;  4GLT A;  1VRS D;  2VLV A;  1SKR B;  3L4N A;  3ISO A;  4ECI A;  2LRT A;  1GUH A;  1OKT A;  4FO5 A;  5AN1 A;  3D5J A;  4G10 A;  3IHQ A;  2OT3 A;  1B48 A;  1SVO A;  1YQ1 A;  3DIE A;  3CTF A;  1QGV A;  3IAM 2;  1GUM A;  2PER A;  3ZRD A;  1GNW A;  2H0G A;  2IN3 A;  1EOG A;  3UVT A;  1KBN A;  2G2Q A;  2VL9 A;  5FHI A;  2R0P A;  4K2D A;  4HZ4 A;  4GSN A;  3MDK A;  1TOF A;  1K3L A;  3I6A A;  4NV2 A;  3FYG A;  1SJZ A;  5G5F A;  5ECI B;  1ZOF A;  3FZ5 A;  3HD5 A;  5L71 A;  2LRC A;  3QDN A;  4ZL8 A;  1WRY A;  3F4S A;  2RUE A;  2MMA A;  2C3Q A;  2A2S A;  1SYX A;  5IMF A;  3RHB A;  3HA9 A;  4HQS A;  5F05 A;  1HYU A;  1JLW A;  3IK7 A;  2AHE A;  1XOB A;  3ZVJ D;  1F2E A;  2CT6 A;  5ELA A;  4FYC A;  1T8E B;  1A24 A;  4O32 A;  4IBP A;  2J23 A;  3QAG A;  2X8G A;  3KXO A;  1LBK A;  1LU4 A;  2H1G A;  3AY8 A;  3D0Z A;  2JAD A;  2AUV A;  4MAB A;  2PU9 C;  1AXD A;  3HDC A;  1O6J A;  2P5R A;  3GKK A;  2H71 A;  2JU5 A;  5G2Z A;  2AV4 A;  2EIO A;  1BYE A;  4Q5R A;  2VM1 A;  2AB6 A;  2VOC A;  2R5G A;  2C1Y A;  2C0D A;  1NSW A;  5G1K A;  4L0W A;  2DJ1 A;  4POB A;  5CAX A;  1BG5 A;  3DRN A;  3KM6 A;  2F9S A;  4TXO A;  3C8E A;  3PGT A;  1TRV A;  1XBS A;  5DQY A;  5G31 A;  2CX3 A;  2JL4 A;  4GSS A;  3IK9 A;  1B9X C;  5IOX A;  4HJM A;  4QMK A;  3GHA A;  3UIW A;  4TR1 A;  2IMF A;  1B8X A;  3A2X A;  4K1F A;  5JCU A;  1R5A A;  6GSX A;  3DD3 A;  1F3A A;  2GZY A;  2ON5 A;  4WXT A;  4HEA 2;  3IR4 A;  4EIQ A;  3FW2 A;  1XW9 A;  4FYU A;  4E8E A;  2IMI A;  2IPA A;  3KD0 A;  4OCF A;  2I1U A;  1O81 A;  1BAY A;  1OC9 B;  4TXV A;  2GQK A;  4ICY A;  1SYR A;  5BRT A;  4K0N A;  1JLV A;  1X9W B;  4QL9 A;  4JE1 A;  1PN9 A;  2FHE A;  1R4W A;  3ZRE A;  2LNT A;  3TKP A;  1X0R A;  3LYK A;  2CZ3 A;  3HVV A;  3LFL A;  1YKC A;  3ZIT A;  3D6I A;  1DSB A;  3QFA C;  5KN0 A;  3N9J A;  2X8H A;  3SBC A;  5IO0 A;  2HQT A;  3K8N A;  2HYX A;  1YKA A;  5ECH B;  2O89 A;  3H79 A;  4IP6 A;  2C0E A;  2REM A;  1GSU A;  2MZC A;  2CA8 A;  4GST A;  2LJK A;  3HXS A;  1WJK A;  5DQS A;  4BL7 A;  5J9C A;  3HHV A;  4O5Q A;  4OFM A;  5CRG A;  17GS A;  2RM6 A;  3ZZX A;  3H4K A;  5DBQ A;  3VPT A;  1V57 A;  2H72 A;  2H30 A;  2EFE A;  3TOT A;  3VI7 A;  1FB6 A;  4TR3 A;  4H86 A;  2CQ9 A;  2H74 A;  2MMZ A;  2H0H A;  3V1W A;  2K8V A;  1YF1 A;  3QMX A;  1XIY A;  5CRH A;  4ECB A;  2YV7 A;  3APS A;  4K7N A;  3ED3 A;  3W6G A;  1XXU A;  3QCP A;  2YN1 A;  4YQM A;  3CRU A;  1XWB A;  2G0F A;  4WEY A;  1SK2 A;  4XIH A;  3ZFB A;  6GSS A;  2HI7 A;  1UC7 A;  4K9Z A;  5DCG A;  2PMT A;  2K18 A;  4XHM A;  3E0U A;  4I8B A;  2HSN B;  5FT3 A;  3QPM A;  4V2M A;  5DCH A;  3FR6 A;  4KND A;  4XCS A;  5KN3 A;  2X8C A;  2B6M A;  4WKW A;  4TKY A;  3LYP A;  5J5N A;  4RQR A;  1SKW B;  4MZW A;  2GVP A;  5DAL A;  2PWJ A;  5DAK A;  2YWN A;  3UBL A;  2HSN A;  2E0Q A;  3ZMK A;  2DJK A;  2FNO A;  1OAZ A;  1WWJ A;  4V2L A;  1YJ6 A;  4XS1 A;  1YEX A;  3Q74 A;  2H66 A;  1M2A A;  1SEN A;  2LTK A;  2NTO A;  4ZXG A;  1U6T A;  5D96 A;  1ZGN A;  4MJC A;  2K9F A;  2NBS A;  4PQH A;  3TOU A;  5JCW A;  4G9H A;  1WP0 A;  1J0F A;  4MF7 A;  4PQ1 A;  2L57 A;  1V98 A;  5IPH A;  5GAN D;  1NW2 A;  4MF5 A;  2I3Y A;  1ERV A;  3GN3 A;  2HRK B;  4PXO A;  4WET A;  4TN8 A;  3PR8 A;  1OC3 A;  1PQN A;  1MTC A;  2EFC A;  3KJY A;  1WIK A;  3F3Q A;  3I9V 2;  3GTU A;  2V32 A;  4GXZ A;  4IVF A;  1QK8 A;  3M3M A;  2HRF A;  3RPP A;  3NIV A;  4JED A;  1UN2 A;  4KCA A;  4NMU A;  1B9Y C;  1PL2 A;  4IJI A;  2HRK A;  1MDK A;  1RK4 A;  3D22 A;  4L5L A;  5ELG A;  4XS4 B;  4KAE A;  3DVX A;  3E9J B;  2X64 A;  2GTU A;  4KUN A;  2FCH A;  3D4M A;  3GL3 A;  3MAK A;  5ECL B;  3CXG A;  2RLI A;  1GL8 A;  4GRF A;  4IGJ A;  2OAD A;  2O8V B;  5IPG A;  2CZ2 A;  1XW5 A;  3TKS E;  3KZQ A;  1JHB A;  1N25 A;  4IQA A;  1JZW A;  5ENU A;  2C4J A;  1DE1 A;  5KOX A;  2CAI A;  3VUR A;  4PUA A;  2B7K A;  5IMD A;  2MYG A;  4DSS B;  2VL3 A;  3H1N A;  2DLX A;  3I43 A;  1GSS A;  2RII A;  3FRC A;  1K0O A;  4TW5 A;  3FR3 A;  1I5G A;  3TB2 A;  3APO A;  5FWG A;  1F37 A;  7GSS A;  4YKG A;  4WR4 A;  4K7I A;  4EL1 A;  2LRN A;  1XVW A;  2PPT A;  5KN1 A;  4O5U A;  5J9B A;  3UMA A;  3HYP A;  4I97 A;  1SK0 A;  3C71 A;  5AIS A;  3GA4 A;  1AIU A;  4RQX A;  4DSS A;  3RPN A;  3EMX A;  2GLR A;  1PRX A;  4AKH A;  4EO3 A;  1T3B A;  3DXB A;  5AIX A;  4ZIJ A;  3EU4 A;  1HNA A;  2NDO A;  1PX7 A;  2Z9S A;  4LMV A;  4BWQ A;  5ECQ B;  4QL7 A;  3F6D A;  5B8B A;  5J3R A;  5B6N A;  4F03 A;  3EYT A;  2VD0 A;  1THO A;  3RDW A;  1QFN A;  4KDY A;  2QC7 A;  1GWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...