2PERA

Crystal structure of human chloride intracellular channel protein 2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
236
structure length
222
Chain Sequence
DPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Chloride intracellular channel protein 2
publication title The crystal structure of human chloride intracellular channel protein 2: A disulfide bond with functional implications.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 222
sequence length 236
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2perA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2perA01
2YJHA 16GSA 5ECPB 2O7KA 2HRKA 9GSSA 3Q74A 5CRGA 2B7JA 4FIWA 5HQPA 3EU3A 1O85A 1X5DA 5IMDA 3BOAA 3E0UA 1OYJA 2CV4A 3M0FA 4ZL8A 1WRYA 3GMFA 4L0WA 4HI7A 5B8BA 4PNFA 1OC8A 5GAPD 4POMA 4ML1A 2F8FA 3PGTA 1ERUA 1TK8B 2HYXA 1OE8A 4J56E 4Z7XA 1XPVA 2IWTA 5AN1A 4ECCA 1AAZA 1FG4A 4BWQA 2PN8A 1XVQA 4BVYA 2NPBA 5HFKA 2N5AA 1YF1A 5IQYA 3QFAC 2B5EA 2VCTA 5J9CA 1VRSD 4N0VA 3QCPA 2GT6A 1VF1A 4MJBA 5D93A 1PD21 5ECRB 2ZCTA 3EVIA 5GAND 4JZQA 10GSA 1DE2A 3LYKA 1CQHA 3DRNA 4LL4B 3QAVA 4X0XA 2YWNA 1WJKA 3ZFLA 3DWVA 2VL2A 4KB3A 2M46A 5HR2A 2X99A 2HT9A 5B7CA 2VL3A 1A8YA 4K2DA 4KNDA 3ZVJD 3LG6A 3A2VA 4G2EA 4TW5A 3EWLA 4L8EA 4EUYA 2H6XA 1YF0A 5DVBA 3VI7A 4MPFA 2JU5A 4OCFA 1GUMA 3VLNA 3MSZA 4YQMA 4TRXA 4QL9A 2VL9A 5A4VA 2VLTA 2LTKA 2VLUA 1SL2B 4OFTA 4I97A 3D4MA 2VAFA 3FZ4A 3P2AA 3L9SA 1GSUA 1HNAA 2HRAA 4ACSA 2V2GA 2YP6A 3VWVA 4F2IA 4JR4A 5GSSA 3MAKA 3IPZA 4RI7A 4MJCA 3AY8A 2GSTA 4PTSA 2YV9A 4YAVA 3I6AA 4XS1A 2C3TA 2XC2A 2EIRA 4IGJA 5F07A 1JLWA 1OKDA 17GSA 3GSTA 4F9ZA 2IMEA 5ECMB 3KIJA 1ZOFA 4K6XA 1OC9A 2DJ0A 4OMVA 2KOKA 3ZIJA 3DGQA 4KSMA 3ME7A 4JBBA 6GSSA 2IMFA 2N5BA 3IBHA 1U6TA 4ID0A 3L9VA 3KM6A 2GQMA 2DBCA 3RDWA 1BJXA 3GKMA 3PH9A 1A0RP 1Q4JA 3GKNA 3G7YA 4WR4A 4DSSA 2QGVA 1TRWA 1GLPA 1WMJA 3LJRA 5G31A 1PKZA 2NBSA 2OADA 7GSSA 4EXJA 4XTSA 5IO0A 3QAWA 2FA4A 3F6FA 2LJKA 3N5OA 1OC3A 2IFQA 1MD3A 4GQFA 5DQYA 5IPGA 2IN3A 5KN0A 1TK5B 1O73A 4MF5A 3I43A 4HUAA 4WBJA 1K0AA 2VM2A 2FGXA 2H75A 4E8HA 2WFCA 3R2QA 2R37A 3APSA 1NSWA 4WEYA 4OWYA 1A2LA 4TKYA 4ZIJA 2H71A 2IPAA 1ZL9A 1U3AA 3M9JA 2YWMA 1SKWB 4O92A 3H8QA 4IQ1A 3IAM2 1WPIA 1PSQA 2C0DA 1B9XC 4NHZA 5CAXA 3RHCA 3QAGA 4EL1A 3WD6A 13GSA 4N30A 3DIEA 4KW6A 3EMPA 2WRTA 1U87A 4V2LA 2CX3A 5DALA 1SKSB 1GUHA 3NIVA 4HU7A 4HJ2A 1ZYEA 1M2BA 2HZEB 3LXTA 4MK3A 2GTUA 1SL0B 4V2NA 5J41A 3D21A 3TKRA 4KAEA 2EIOA 2NTOA 2C3NA 2OACA 5FHIA 6GSTA 3VWWA 4ZL9A 5IIZA 2B5YA 2DLXA 3ZMKA 2AV4A 3E9JB 1S3DA 2JL4A 3F9UA 1E2YA 1ZYQB 1XXUA 1SK0A 4NXIA 3UARA 3ZREA 4IS0A 3HJPA 2RM6A 4K0GA 2JSZA 3ZRDA 1E6BA 5KEJA 1VF3A 4ML6A 5E59A 4ZILA 4K7IA 1TDIA 1R5PA 3APOA 4HZ2A 3DVXA 2JZRA 5B6NA 1MD4A 5G30A 4BA7A 3EC3A 1QMVA 1O7UA 1EGOA 4G19A 2M80A 3M1GA 1AQXA 2VCZA 1UN2A 2GS3A 5A4WA 4IVFA 1V9WA 1EV4A 1ZZYA 2A4VA 4JE1A 1ERTA 2FWEA 4JU5A 4G10A 1I9DA 5DDLA 2YZUA 4ZB9A 2DSAA 2YANA 1AW9A 1PL2A 4BVXA 5CRHA 2VL2C 2ZNMA 3TKPA 1FVJA 3MWHA 4IJIA 2KLXA 1YQ1A 2L57A 2C0FA 5CRWA 5ABRA 1TP9A 1XWGA 3KJYA 3RAZA 2YOIA 5D8IA 3D4TA 4TR1A 2V6OA 3APQA 3HVSA 1J08A 5EY6A 4ECIA 4AF2A 3A5WA 4Q5QA 1XWCA 5KN3A 4MJAA 2P0GA 1B48A 1DSBA 1TKDB 8GSSA 2F3MA 4OD7A 2WULA 18GSA 2L4QA 5DCGA 1XW9A 2H30A 2A2RA 1GLQA 1JFUA 3O3TA 2H1GA 4RQRA 1O6JA 1DBYA 3D5JA 1FW1A 3QFBC 3FRCA 1ON4A 1DUGA 3QR6A 1PGTA 1OAZA 4POKA 3GH9A 4N11A 4KF9A 1TRVA 2P5RA 1GH2A 1ERWA 3C71A 3IC8A 4K7NA 1QXHA 2OBKA 4BL7A 1GNWA 3UMAA 2K18A 2F9SA 3P8WA 2ON5A 2GZZA 1NM3A 2YNXA 4PQ1A 2WGRA 1T7PB 4PXOA 2VLVA 1Q98A 2HRKB 4G0LA 3JCML 2WB9A 3FY7A 1SD9A 3GL3A 1A0FA 3GTUA 3FKFA 2PGTA 4GCIA 2P31A 4OO5A 1Z9HA 1AC1A 1G7EA 1DE1A 4XS4B 4OO4A 1NW2A 3QD9A 2FNOA 1U88A 3TKQA 1O81A 3CSHA 1X5CA 3GIXA 2RIIA 1GULA 1M7TA 5KN1A 2RLIA 3TJJA 3J7Yk 1XIYA 3F4RA 4KX4A 3L78A 2HSMA 3ZITA 2CA8A 2IMIA 4IP6A 5H5RA 4KSOA 1PRXA 3FZ9A 5IMFA 2CT6A 3C73A 3FZ5A 4MZCA 3DD3A 2HNLA 2JZTA 4BVYB 3W6GA 3LQ7A 2V32A 1AQWA 1THOA 1EOHA 4RI6A 3TB2A 1KBNA 2HQTA 2QSIA 5ECKB 1JHBA 5L71A 4HQZA 1BG5A 5JCUA 3GKKA 3GKXA 5DJLA 4IELA 2PUKC 1MEKA 3MNGA 1TXXA 3ZL5A 1GTIA 2PPTA 2YPMA 4XS6A 3KMOA 3TJFA 3FR6A 2YZHA 4X43A 1UVZA 3TKSC 4K7OA 1HNCA 2E7PA 1GNEA 1PL1A 3ME8A 5J5NA 2GDRA 1M2AA 5HR3A 1Z6MA 1MDKA 2NVLA 5GSTA 4ISDA 3KCMA 1X0RA 4TR3A 4PUFC 1XVWA 3Q6OA 3GSSA 3GL5A 2H6YA 4OFMA 5CP1A 3HVXA 4TXVA 2XHFA 1AXDA 4TXOA 2VCWA 4GLTA 4MABA 4KGIA 2C8UA 1EP7A 4ILFA 3F8UA 1YZXA 5JWOB 12GSA 4J2FA 5D96A 3KEBA 3A3TA 4XRDA 3RHBA 3DEXA 5ECLB 3ERGA 2YN1A 3ZVJA 1YJ6A 1XOBA 3GV1A 4J57E 2V6KA 2B1LA 2V41A 3IV4A 2E2GA 2AJQB 1XCCA 3EURA 3HYPA 2L4CA 1PA3A 4HQSA 5ECNB 2VM1A 1OC9B 2A2SA 1WIKA 3ERFA 1NHYA 4G0KA 2N5FA 1BYEA 1XFLA 4GXZA 1W4VA 4IQAA 5EPFA 2DIYA 4K8MA 4HEA2 3TRQA 2OE3A 2GZYA 4IJ3A 4DSQA 3VWUA 19GSA 1TK0B 5JCGA 3P7XA 1BAYA 3CRTA 3KXOA 2VCXA 1SYRA 4DSSB 2PMTA 5F0GA 1BQ7A 2I9HA 4F0BA 1X5EA 3GH6A 2R2JA 2LEGA 3ZZXA 3TRPA 1Z3EA 4MP4A 5EVOA 3GRXA 1QQ2A 5CO3A 1EZKA 2IFQB 3HJOA 1GSFA 1X9WB 1FO5A 5D9VA 4EF0A 2H72A 1ABAA 1USBA 1S3AA 2LQQA 2VOCA 1UA5A 4F0CA 4WKWA 5ENUA 4NMUA 5J9BA 3IE3A 1TTZA 1V40A 4ZXGA 1SENA 1FHEA 5AISA 2K8VA 5G2ZA 5BMUA 5HR1A 4DEJA 4FH8A 3US3A 3KMNA 2B1KA 1V98A 2MMOA 2WCIA 4LLRA 1G6YA 2C1YA 2P5QA 3WGEA 5F8BA 3TJBA 2JACA 5IM9A 1OE7A 4MF6A 4PX1A 6GSVA 1SK1A 5F06A 2AYTA 5DAKA 3UAPA 3IK7A 3FK8A 1H75A 2QKEA 2IMDA 5G5FA 1VF4A 5DALB 2HFDA 2H76A 6GSXA 2R5GA 3GX8A 2PVQA 3CXGA 1UC7A 3IA1A 1J9BA 2C3QA 2E2MA 3TKSA 1N8JA 3ED3A 2L5LA 3TKSE 1Z7RA 5H5QA 3IAS2 1SD8A 2H1DA 1HNBA 3LSZA 1B8XA 3L0HA 2RUEA 1HQOA 4OFNA 3LGCA 4TR4A 1TU8A 1WOUA 4I5QA 1TW9A 3C1SA 3NZNA 2EIQA 2REMA 22GSA 3UVTA 3CBUA 4KE3A 3TJGA 1F3AA 4GQCA 4ZBBA 1KTEA 2KP1A 3RPPA 5ELAA 2VD1A 2WZ9A 4NHWA 4NAXA 3TOUA 3FW2A 3PINA 1XWAA 4HU9A 4HDEA 1F6MC 3EYTA 5ECOB 2H1BA 3NOFA 1JZWA 2PWJA 4MF7A 2VUPA 4TR0A 2V1MA 4ULXA 2H19A 1SJZA 3UEMA 4ZB8A 4PNGA 4POLA 3N9JA 1TRSA 2H0IA 5AIXA 4D73A 3KZQA 3TDGA 2VCVA 2OA7A 4TR1B 3ZYWA 1GSQA 5FT3A 1FB0A 1YDKA 5ID2A 1XZOA 4XIHA 2FLSA 1LJRA 3F63A 3WT1A 1FAAA 3L4NA 1R5AA 3QMXA 5LD0A 1T4YA 3IXRA 2D2ZA 4V1Ap 4P3YB 3H1NA 2C80A 2GGTA 3F0IA 5LNKe 5ECIB 2GZPA 4TVEA 4F82A 3S9FA 3ISOA 4KDUA 3TOTA 1QUWA 1SYXA 3LYPA 5D9TA 3CTGA 3KD0A 1O8XA 2FA8A 2I81A 3KGKA 4ZL7A 1ZGNA 2QC7A 1QFNA 3SWLA 2TRXA 1V2AA 2BTOT 2I3YA 1XW5A 1J0FA 3IHQA 1GSYA 1ZCPA 4ECBA 1M9AA 4EDZA 1SJIA 2FWFA 4AJ8A 3FYGA 4K0NA 1TOFA 5J3RA 4AJ7A 4KCAA 4I2TA 4BL7B 3F3RA 3G7IA 1K3YA 1B4PA 1F37A 5KN2A 2H0HA 2PU9C 1S3CA 5E4WA 1PN9A 2I1UA 2IL3A 2MBSA 4I8BA 1W89A 4GSTA 3GX0A 2DJ3A 1OVNA 4KUNA 5JWRB 1YEPA 2CX4A 1XWBA 3GTUB 3H4KA 1QGVA 4FO5A 2GSSA 2H74A 1M0UA 1ACVA 4TN8A 2WDUA 2O89A 3U6VA 3EMXA 1HYUA 5IPHA 3CTFA 3ZLPA 1A2JA 1GTAA 3H79A 4FYBA 2MMAA 4E8EA 1G0TA 2JADA 1FOVA 1TRUA 1VF2A 2CVBA 4PQIA 2K6VA 2HSMB 2LRNA 2O8VB 4FYUA 1WE0A 2XBIA 4FYCA 3HHVA 5G1KA 1AIUA 4XHMA 1B9YC 3HKRA 3GFKA 2H6ZA 3Q19A 4G9HA 2FHEA 3VPQA 3C8EA 3BCKA 1YKCA 2DIZA 5DBQA 1A24A 4PUAA 4GSSA 2J9HA 4MPGA 2HRNA 1URMA 1JLVA 1F9MA 5FWGA 2L5OA 3O6TA 3DXBA 1H4OA 4XS4A 2IIYA 4O5RA 1JZRA 2TIRA 3P90A 4MLYA 4GF0A 1WWJA 1BEDA 3TGZA 3M8NA 1EOGA 3F3QA 3F6DA 1ILOA 1SL1B 1FVKA 1T3BA 1NHOA 1B4QA 1V58A 3OR5A 4HS1A 3UL3A 5G1LA 4BPYA 1GSEA 1K0OA 3K8NA 1MDJA 2BMXA 2R3XA 5F05A 4Q5FA 2R6KA 4CHSA 4ECJA 5A4UA 4Q5NA 2NDOA 2CZ3A 2AHEA 5IOXA 2DJJA 2ALBA 1EWXA 3HJMA 6GSUA 5D73A 2XPDA 3WT2A 5HFGA 2HLSA 1GSDA 3GURA 2X8CA 1LBKA 4ZB6A 3BJ5A 1RK4A 2HZFA 1PX7A 4IP1A 2MZCA 4TXOB 3IC4A 2H66A 4PQHA 3PPUA 3KTBA 5D9WA 4HOJA 4HZ4A 2G0FA 2LSTA 3KH7A 2WJUA 1QK8A 2H73A 3SBCA 1XW6A 2GVPA 20GSA 3D0ZA 3BCIA 4YQUA 5CREA 3J7Yb 4WXTA 2YV7A 4EVMA 4O7HA 1HD2A 4LA1A 4K9ZA 4EE0A 2GSRA 4N10A 4BWSA 1T4ZA 2KUCA 4USSA 1EV9A 1T8EB 4K1FA 2B3SA 2YWOA 4XRAA 2BJXA 1WP0A 1XBSA 3ZIVA 1K0DA 3ZMLA 1A2MA 4NV5A 4PURA 1GP1A 1GTBA 1Z6NA 1K3OA 2HSYA 3WGXA 4EO3A 5C04A 2DC5A 3UBLA 4IBPA 3QDNA 2X64A 2LJAA 5ECSA 4PGTA 2TRCP 1Y25A 2F51A 2LNTA 4NV2A 2ON7A 2Z9SA 3DMLA 3GNJA 1ST9A 3VFIA 2DJ1A 2DMMA 1EEMA 1TJDA 4JR6A 2FWHA 2OKAA 4AJ6A 1BX9A 2IJYA 2LRCA 1GSSA 2VIMA 2C0GA 3M9KA 2HSHA 2OE1A 4GSNA 3HD5A 4JEDA 2I4AA 5B6MA 1GL8A 3IK9A 3VK9A 1IYIA 3QOUA 4KDYA 4V2MA 3G7JA 2G2QA 1YEXA 3I9V2 2MBTA 3PR8A 4O32A 5H5SA 4L5OA 2LV3A 3FR3A 1R7HA 3VI5A 2WS2A 2H01A 2YCDA 3I69A 5GZZB 1A23A 1PX6A 4GRFA 2C0EA 3GHAA 1RW1A 1X9MB 5IMAA 3W8JA 2LQOA 3MDKA 3VWXA 2PBJA 4KA0A 3TRXA 3ZTLA 1AUCA 4EDYA 2X8GA 5EL8A 3FZAA 1SJ6A 4ZBDA 2YWIA 3LFLA 3DKSA 3D6IA 4WF4A 5DAKB 4WETA 1EGRA 3WYWA 5C00A 1G7OA 2RM5A 4TOPA 2J23A 3FHKA 5B8AA 4I2UA 3M3MA 2DJ2A 2CQ9A 4YQVA 3O76A 1K0NA 4MH3A 3D22A 1GWCA 2HSNB 1Z7PA 2H1AA 3HDCA 1F2EA 1YKAA 2FUG2 2CZ2A 1ZMAA 4WR5A 3IOSA 2H8LA 3RPNA 1PMTA 2L6CA 4RQXA 3UIWA 1O8WA 2L6DA 2O85A 1N2AA 1M2DA 2LUSA 2L59A 2LNSA 2ZUPA 1GTUA 3F4TA 4CW9A 4EKZA 1JZDA 11GSA 3HZ4A 3LXZA 3W8SA 1T1VA 2C4JA 2MYGA 1KNGA 1OKTA 2X8HA 2HE3A 4LL1B 3IR4A 4LMWA 3FR9A 1CQGA 3EE2A 3HY2A 2M72A 3UJ1A 2CVDA 2KHPA 2CAIA 1KEBA 4IKHA 4MZWA 1T00A 2JZSA 4IW9A 4MA9A 1XOAA 4MDCA 1TI1A 5A5KA 1V57A 3F4SA 3C1RA 5IO2A 4YAPA 1R26A 5D9XA 1M99A 2FD3A 1EEJA 4NPBA 1G6WA 1TI3A 3UVHA 5IOWA 3L9UA 2HZEA 3CMIA 4OCEA 2VO4A 4F03A 1MDIA 5LCZA 2XBQA 2OE0A 4DSRA 1THXA 4RUVA 2GLRA 1JZOA 4WBRD 4L0UA 4D73B 1ERVA 2FY6A 5DJMA 2LRTA 2YJ7A 2FCHA 3GYKA 2O87A 3Q18A 4KH7A 4AGSA 5ECQB 4BVXB 5IMVA 3A2WA 5ID2B 5JWQB 3GUSA 1YY7A 3E3EA 4QQ7A 2PVOC 4FQUA 3R3EA 4ZBAA 4MZBA 2RUFA 5CRDA 5AGYA 3HCZA 4NWYA 1F3BA 1GUKA 4HJMA 3CRUA 3CSIA 3TUEA 3DYRA 4QL7A 2AB6A 2VD0A 2XPEA 5IMZA 6GSYA 4V1Ag 1SKRB 3RBTA 3HXSA 1R4WA 4GTUA 1XWKA 1TU7A 1EP8A 3G9BA 3VPTA 2K9FA 4YH2A 1A8LA 3LORA 5G5EA 4EC0A 3HVVA 3BBYA 5HFIA 3UOMA 5J4UA 3H93A 1K0BA 4KDXA 3KP9A 2CVKA 4POBA 3HA9A 1LU4A 3BD2A 4LMVA 3KP8A 1RQMA 2PERA 3EINA 3LEFA 5COHA 2HI7A 3A2XA 1Y6EA 5CNWA 2CAQA 2LJRA 4CDOA 2GQKA 3C7MA 2FWGA 2ES7A 4DVCA 4G0IA 3IRAA 5IMCA 2AUVA 3CYNA 2R4VA 3ZFBA 3CSJA 14GSA 2F8AA 3TJKA 3IDVA 3FEUA 4MMMA 2VCQA 3VURA 2GQLA 4WF5A 5DQSA 3V1WA 3UBKA 5ELGA 3ERWA 2KP2A 4Q5RA 2B5XA 3GN3A 1ML6A 2LS5A 2DMLA 2JSYA 2MMZA 3EU4A 4L5LA 2GSQA 1VGLA 1IYHA 1K3LA 4X1UA 2K8SA 1PKWA 3QPMA 2OJLA 5DCHA 2B6MA 2HRFA 1K0MA 2AAWA 3DVWA 4I6XA 2H0GA 5INYA 4MJEA 5AIVA 2IMKA 2MMNA 5CYYA 5HR0A 1I5GA 3GA4A 1X9SB 5JCWA 3LWAA 1U3IA 4IHUA 1PQNA 2OBIA 4IN0A 1M9BA 1FB6A 2H70A 2B7KA 4KCEA 4GWRA 2HXKA 4JRRA 4N0ZA 4XCSA 2UZ8A 3HZ8A 3WGDA 3TCOA 2DJKA 5ECHB 1SK2A 4MCUA 3U5RE 1AQVA 4H86A 1SU9A 6GSWA 3KTLA 4MH2A 1MTCA 2E0QA 3KH9A 2GT5A 1C72A 2LKUA 2EC4A 1Z5YE 1K0CA 1GRXA
chains in the Genus database with same CATH superfamily
2YJHA 16GSA 5ECPB 2O7KA 2HRKA 9GSSA 3Q74A 5CRGA 2B7JA 4FIWA 5HQPA 3EU3A 1O85A 1X5DA 5IMDA 3BOAA 3E0UA 1OYJA 2CV4A 3M0FA 4ZL8A 1WRYA 3GMFA 4L0WA 4HI7A 5B8BA 4PNFA 1OC8A 5GAPD 4POMA 4ML1A 1PFOA 2F8FA 3PGTA 5J47A 1ERUA 4PHZC 1TK8B 2H1LA 2HYXA 1OE8A 4J56E 4Z7XA 1XPVA 2IWTA 5AN1A 4ECCA 1AAZA 1FG4A 4BWQA 2PN8A 1XVQA 4BVYA 1XG8A 2NPBA 5HFKA 2N5AA 1YF1A 5IQYA 3QFAC 2B5EA 2VCTA 5J9CA 1VRSD 4N0VA 3QCPA 2GT6A 5A5HB 1VF1A 4MJBA 5D93A 1PD21 5ECRB 2ZCTA 3EVIA 5GAND 4JZQA 10GSA 1DE2A 3LYKA 1CQHA 3DRNA 4LL4B 3QAVA 4X0XA 2WW1A 2YWNA 1WJKA 3EPTA 3ZFLA 3DWVA 2VL2A 2O5VA 4KB3A 2M46A 5HR2A 2R0CA 2X99A 2HT9A 5B7CA 2VL3A 1A8YA 4K2DA 4KNDA 3ZVJD 3LG6A 3A2VA 4G2EA 4TW5A 3EWLA 4L8EA 4EUYA 2H6XA 1YF0A 5DVBA 3VI7A 4MPFA 2JU5A 4OCFA 1GUMA 3VLNA 3MSZA 4YQMA 4TRXA 4QL9A 2VL9A 5A4VA 2VLTA 2LTKA 2VLUA 1SL2B 4OFTA 4I97A 3D4MA 2VAFA 3FZ4A 3P2AA 3L9SA 1GSUA 1HNAA 2HRAA 4ACSA 2V2GA 2YP6A 3VWVA 4F2IA 4JR4A 2O36A 5GSSA 3MAKA 3IPZA 4RI7A 4MJCA 3AY8A 2GSTA 4PTSA 2YV9A 4YAVA 3I6AA 4XS1A 2C3TA 2XC2A 2EIRA 4IGJA 5F07A 1JLWA 1OKDA 17GSA 3GSTA 4F9ZA 2IMEA 5ECMB 3KIJA 1ZOFA 4K6XA 1OC9A 2DJ0A 4OMVA 2KOKA 3ZIJA 3DGQA 4KSMA 3RGBC 3ME7A 4JBBA 6GSSA 2IMFA 2N5BA 3IBHA 1U6TA 4ID0A 3L9VA 3KM6A 2GQMA 2DBCA 3RDWA 1BJXA 3GKMA 2R0PA 3PH9A 1A0RP 1Q4JA 3GKNA 3G7YA 4WR4A 4X4JA 4DSSA 2QGVA 5BRTA 1TRWA 1GLPA 1WMJA 3LJRA 5G31A 1PKZA 4AKIA 2NBSA 2OADA 7GSSA 4EXJA 4EIQA 4XTSA 5IO0A 3QAWA 2FA4A 3F6FA 2LJKA 3N5OA 1OC3A 2IFQA 1MD3A 4GQFA 5DQYA 5IPGA 2IN3A 5KN0A 1TK5B 4ZB7A 1O73A 4MF5A 3I43A 4HUAA 2WVZA 4WBJA 1K0AA 2VM2A 2FGXA 2H75A 4E8HA 2WFCA 3R2QA 2R37A 3APSA 1NSWA 4WEYA 4OWYA 1A2LA 2R0GA 4TKYA 4ZIJA 2H71A 2IPAA 1ZL9A 1U3AA 3M9JA 2YWMA 1SKWB 4YKGA 4O92A 3H8QA 4IQ1A 3IAM2 1WPIA 1PSQA 2C0DA 1B9XC 4NHZA 5CAXA 3RHCA 3QAGA 4EL1A 3WD6A 13GSA 4N30A 3DIEA 4KW6A 3EMPA 2WRTA 1U87A 4V2LA 2CX3A 5DALA 1SKSB 1GUHA 3NIVA 4HU7A 4HJ2A 1ZYEA 1M2BA 2HZEB 3LXTA 4MK3A 2GTUA 1SL0B 4V2NA 5J41A 3D21A 3TKRA 4KAEA 4FXYP 2EIOA 2NTOA 2C3NA 2OACA 5FHIA 2OT3A 6GSTA 3VWWA 4ZL9A 5IIZA 2B5YA 2DLXA 3ZMKA 2AV4A 3E9JB 1S3DA 2JL4A 3F9UA 1E2YA 1ZYQB 1XXUA 1SK0A 4NXIA 3UARA 3ZREA 4IS0A 3HJPA 2RM6A 4K0GA 2JSZA 3ZRDA 1E6BA 5KEJA 1VF3A 4ML6A 5E59A 4ZILA 4K7IA 1TDIA 1R5PA 3APOA 4HZ2A 3DVXA 2JZRA 5B6NA 1MD4A 5G30A 4BA7A 3EC3A 1QMVA 2O3EA 1O7UA 1EGOA 4G19A 2M80A 3M1GA 1AQXA 2VCZA 1UN2A 2GS3A 5A4WA 4IVFA 1V9WA 1EV4A 1ZZYA 2A4VA 4JE1A 3MYDA 1ERTA 2FWEA 4JU5A 4G10A 1I9DA 5DDLA 2YZUA 4ZB9A 2DSAA 2YANA 1AW9A 1PL2A 4BVXA 5CRHA 2VL2C 2ZNMA 4O5UA 3TKPA 1FVJA 4YKFA 3MWHA 4IJIA 2KLXA 1YQ1A 2L57A 2C0FA 5CRWA 5ABRA 1TP9A 1XWGA 3KJYA 3RAZA 2YOIA 5D8IA 3D4TA 4TR1A 2V6OA 3APQA 3HVSA 1J08A 5EY6A 4ECIA 4AF2A 3A5WA 4Q5QA 1XWCA 5KN3A 4MJAA 2P0GA 1B48A 1DSBA 2A2PA 1TKDB 8GSSA 2F3MA 4OD7A 2WULA 18GSA 2L4QA 5DCGA 1XW9A 2H30A 2A2RA 1GLQA 1JFUA 3O3TA 2H1GA 4O5QA 4RQRA 1O6JA 1DBYA 3D5JA 1FW1A 3QFBC 3FRCA 1ON4A 1DUGA 3QR6A 1PGTA 1OAZA 4POKA 3GH9A 4N11A 4KF9A 1TRVA 2P5RA 1GH2A 1ERWA 3C71A 3IC8A 5A34A 4K7NA 3IHGA 1QXHA 2OBKA 4BL7A 1GNWA 4W66A 3UMAA 2K18A 2F9SA 3P8WA 2ON5A 2GZZA 1NM3A 1S4BP 2YNXA 4PQ1A 2WGRA 1T7PB 4PXOA 2VLVA 1Q98A 2HRKB 4G0LA 3JCML 2WB9A 3FY7A 1SD9A 3GL3A 1A0FA 3GTUA 3FKFA 2PGTA 4GCIA 2P31A 4OO5A 1Z9HA 1AC1A 1G7EA 1DE1A 4XS4B 4OO4A 1NW2A 2WVYA 3QD9A 2FNOA 1U88A 3TKQA 1O81A 3CSHA 1BG1A 1X5CA 3GIXA 2RIIA 1GULA 1M7TA 5KN1A 2RLIA 3TJJA 1YVLA 3J7Yk 1XIYA 3F4RA 4KX4A 3L78A 2HSMA 3ZITA 2CA8A 2IMIA 4IP6A 5H5RA 4KSOA 1PRXA 3FZ9A 5IMFA 2CT6A 3C73A 3FZ5A 4MZCA 3DD3A 2HNLA 2JZTA 2A4HA 4BVYB 3W6GA 3LQ7A 2V32A 1AQWA 1THOA 1EOHA 4RI6A 3TB2A 1KBNA 2HQTA 2QSIA 4K5RA 4AKXB 5ECKB 1JHBA 5L71A 4HQZA 1BG5A 1FOHA 5JCUA 3GKKA 4N3ZA 3GKXA 5DJLA 4IELA 2PUKC 1MEKA 3MNGA 1TXXA 3ZL5A 1GTIA 2PPTA 2YPMA 4XS6A 3KMOA 3TJFA 3FR6A 2YZHA 4X43A 1SVLA 1UVZA 3TKSC 4K7OA 1HNCA 2E7PA 1GNEA 1PL1A 3ME8A 5J5NA 2GDRA 1M2AA 5HR3A 1Z6MA 1MDKA 2NVLA 5GSTA 4ISDA 3KCMA 1X0RA 2X4AA 4TR3A 4PUFC 1XVWA 3Q6OA 3GSSA 3GL5A 2H6YA 1N25A 4OFMA 5KOWA 5CP1A 3HVXA 4TXVA 2XHFA 1AXDA 4TXOA 2DKHA 2VCWA 4GLTA 4MABA 4KGIA 2C8UA 1EP7A 4ILFA 3F8UA 1YZXA 5JWOB 12GSA 4J2FA 2WVXA 5D96A 3KEBA 3A3TA 4XRDA 3RHBA 3DEXA 5ECLB 3ERGA 2YN1A 3ZVJA 1YJ6A 1XOBA 3GV1A 4J57E 2VKZG 2V6KA 2B1LA 2V41A 3IV4A 2E2GA 2AJQB 1XCCA 3EURA 3HYPA 2L4CA 1PA3A 4HQSA 5ECNB 2VM1A 1OC9B 2A2SA 1WIKA 3ERFA 1NHYA 4G0KA 2N5FA 1BYEA 1XFLA 4GXZA 1W4VA 4IQAA 5EPFA 2DIYA 4K8MA 4HEA2 3TRQA 2OE3A 2GZYA 4IJ3A 4DSQA 3VWUA 19GSA 1TK0B 5JCGA 3P7XA 1BAYA 3CRTA 3KXOA 2VCXA 1SYRA 4DSSB 1SVOA 2PMTA 5F0GA 1BQ7A 3MIXA 2I9HA 4F0BA 1X5EA 3GH6A 2R2JA 2LEGA 3ZZXA 3TRPA 4E68A 1Z3EA 4MP4A 5EVOA 3GRXA 1QQ2A 5CO3A 1EZKA 2IFQB 3HJOA 1GSFA 1X9WB 1FO5A 5D9VA 4EF0A 2H72A 1ABAA 1USBA 1S3AA 2LQQA 2VOCA 1UA5A 4F0CA 4WKWA 5ENUA 4NMUA 5J9BA 3IE3A 1TTZA 1V40A 4ZXGA 1SENA 1FHEA 5AISA 2K8VA 5G2ZA 5BMUA 1M3IA 5HR1A 4DEJA 4FH8A 3US3A 3KMNA 2B1KA 1V98A 2MMOA 2WCIA 4LLRA 1G6YA 2C1YA 2P5QA 3WGEA 5F8BA 3TJBA 2JACA 5IM9A 1OE7A 4CY6A 4MF6A 4PX1A 6GSVA 1SK1A 5F06A 2AYTA 5DAKA 3UAPA 3IK7A 3FK8A 1H75A 2QKEA 2IMDA 5G5FA 4AKHA 1VF4A 4PI2C 5DALB 2HFDA 1S3RA 2H76A 6GSXA 2WZSA 2R5GA 3GX8A 2PVQA 3CXGA 1UC7A 3IA1A 1J9BA 2C3QA 2HSNA 2E2MA 3LW9A 3TKSA 1N8JA 3ED3A 2L5LA 3TKSE 1Z7RA 5H5QA 3IAS2 1SD8A 2H1DA 1HNBA 3LSZA 1B8XA 3L0HA 2RUEA 1HQOA 4OFNA 3LGCA 4TR4A 1TU8A 3FMWA 1WOUA 4I5QA 1TW9A 3C1SA 3NZNA 2EIQA 2REMA 22GSA 3UVTA 3CBUA 4KE3A 1TXUA 3TJGA 3RFRC 1F3AA 4GQCA 4ZBBA 5A1NA 1KTEA 2KP1A 3RPPA 5ELAA 2VD1A 1ZYPA 2WZ9A 5J40A 4NHWA 4NAXA 3TOUA 2WW3A 3FW2A 3PINA 1XWAA 4HU9A 4HDEA 1F6MC 3EYTA 5ECOB 2H1BA 3NOFA 1JZWA 2PWJA 4MF7A 2VUPA 4TR0A 2V1MA 4ULXA 2H19A 1SJZA 3UEMA 4HSCX 4ZB8A 4PNGA 4POLA 3N9JA 1TRSA 2H0IA 5AIXA 4D73A 3KZQA 4G01A 3TDGA 2VCVA 2OA7A 4TR1B 3ZYWA 1GSQA 5FT3A 1FB0A 1YDKA 5ID2A 1XZOA 4XIHA 2FLSA 1LJRA 3F63A 3WT1A 1FAAA 3HVNA 3L4NA 1R5AA 3QMXA 5LD0A 1T4YA 3IXRA 2D2ZA 4V1Ap 4P3YB 3H1NA 2C80A 2GGTA 3F0IA 5LNKe 5ECIB 2GZPA 4TVEA 4F82A 4PI0C 3S9FA 3ISOA 4KDUA 3TOTA 1QUWA 1SYXA 4A5PA 3LYPA 5D9TA 3CTGA 3KD0A 1O8XA 2FA8A 2I81A 3KGKA 4ZL7A 1ZGNA 2QC7A 1QFNA 3SWLA 2TRXA 1V2AA 2BTOT 2I3YA 1XW5A 1J0FA 3IHQA 1GSYA 1ZCPA 4ECBA 1M9AA 4EDZA 1SJIA 2FWFA 5A34B 5J4VA 4AJ8A 3FYGA 4K0NA 1TOFA 5J3RA 4AJ7A 4KCAA 4I2TA 4BL7B 3F3RA 3G7IA 1K3YA 1B4PA 1F37A 2QA1A 2H0HA 5KN2A 2PU9C 1S3CA 5E4WA 1PN9A 2WW2A 2I1UA 2IL3A 2MBSA 4I8BA 1W89A 4GSTA 3GX0A 2DJ3A 1OVNA 4KUNA 5JWRB 1YEPA 2CX4A 1XWBA 3GTUB 3H4KA 1QGVA 4FO5A 2GSSA 2H74A 1M0UA 1ACVA 4TN8A 2WDUA 2O89A 3U6VA 3EMXA 1HYUA 5IPHA 3CTFA 3ZLPA 1A2JA 1GTAA 3H79A 4FYBA 2MMAA 4E8EA 1G0TA 2JADA 1FOVA 1TRUA 1VF2A 2CVBA 4PQIA 2K6VA 2HSMB 2LRNA 2O8VB 4FYUA 1WE0A 2XBIA 4FYCA 3HHVA 5G1KA 1AIUA 4XHMA 1B9YC 3HKRA 3GFKA 2H6ZA 3Q19A 4G9HA 2FHEA 3VPQA 3C8EA 5KOXA 3BCKA 1YKCA 2DIZA 5DBQA 1A24A 4PUAA 4GSSA 2J9HA 4MPGA 2HRNA 1URMA 1JLVA 1F9MA 5FWGA 2L5OA 3O6TA 3DXBA 1H4OA 4XS4A 2IIYA 4O5RA 1JZRA 2TIRA 1M3JA 3P90A 4MLYA 4GF0A 1WWJA 1BEDA 3TGZA 3M8NA 1EOGA 3F3QA 3F6DA 1ILOA 1SL1B 1FVKA 1T3BA 1PN0A 1NHOA 1B4QA 1V58A 3OR5A 4HS1A 3UL3A 5G1LA 4BPYA 1GSEA 1K0OA 3K8NA 1MDJA 1Y1UA 2BMXA 2R3XA 5F05A 5J4YA 4Q5FA 2R6KA 4CHSA 4ECJA 5A4UA 4Q5NA 2NDOA 2CZ3A 2AHEA 5IOXA 2DJJA 2ALBA 1EWXA 3HJMA 6GSUA 5D73A 2XPDA 3WT2A 5HFGA 2HLSA 1GSDA 3GURA 2QA2A 2X8CA 1LBKA 4ZB6A 3BJ5A 1RK4A 2HZFA 1PX7A 4IP1A 2MZCA 4TXOB 3IC4A 2H66A 4PQHA 3PPUA 3KTBA 5D9WA 4HOJA 4HZ4A 5A5HA 2LSTA 2G0FA 3KH7A 2WJUA 1QK8A 2H73A 3SBCA 4MNNA 1XW6A 2GVPA 20GSA 2WVXB 3D0ZA 3BCIA 4YQUA 5CREA 3J7Yb 4WXTA 2YV7A 4EVMA 4O7HA 4ICYA 1HD2A 4LA1A 4K9ZA 4EE0A 2GSRA 4N10A 4BWSA 1T4ZA 2KUCA 4USSA 1EV9A 1T8EB 4K1FA 2B3SA 2YWOA 4XRAA 2BJXA 1WP0A 4Z2TA 1XBSA 3ZIVA 1K0DA 2EFCA 3ZMLA 1A2MA 4NV5A 4PURA 1GP1A 1GTBA 3CWGA 1Z6NA 1K3OA 2HSYA 3WGXA 4EO3A 5C04A 2DC5A 3UBLA 4IBPA 3QDNA 2X64A 2LJAA 5ECSA 4PGTA 1YEWC 2TRCP 1Y25A 2F51A 2LNTA 4NV2A 2ON7A 2Z9SA 3DMLA 3GNJA 1ST9A 3VFIA 2DJ1A 2DMMA 1EEMA 1TJDA 1SVMA 4JR6A 2FWHA 2OKAA 4AJ6A 1BX9A 2IJYA 2LRCA 1GSSA 2VIMA 2C0GA 3M9KA 2HSHA 2OE1A 4GSNA 3HD5A 4JEDA 2I4AA 5B6MA 4EIPA 1GL8A 3IK9A 3VK9A 1IYIA 3QOUA 4KDYA 4V2MA 1BF5A 3G7JA 2G2QA 1YEXA 3I9V2 2MBTA 3PR8A 4O32A 5H5SA 4L5OA 2LV3A 3FR3A 1R7HA 3VI5A 5BMUB 2WS2A 2H01A 2YCDA 3I69A 5GZZB 1A23A 1PX6A 4GRFA 2C0EA 3GHAA 1RW1A 1X9MB 5IMAA 3W8JA 2LQOA 3MDKA 3VWXA 2PBJA 4KA0A 4AKGA 3TRXA 3ZTLA 1AUCA 4EDYA 2X8GA 5EL8A 3FZAA 1SJ6A 4ZBDA 2YWIA 3LFLA 3DKSA 3D6IA 4WF4A 5DAKB 4CY8A 4WETA 1EGRA 3WYWA 5C00A 1G7OA 2RM5A 4TOPA 2J23A 3FHKA 5B8AA 4I2UA 3M3MA 2DJ2A 2CQ9A 4YQVA 3O76A 1K0NA 4MH3A 3D22A 1GWCA 2HSNB 1Z7PA 2H1AA 3HDCA 1F2EA 1YKAA 2FUG2 2CZ2A 1ZMAA 4WR5A 3IOSA 2H8LA 3RPNA 1PMTA 2L6CA 3A5IA 4RQXA 3UIWA 1O8WA 2L6DA 2O85A 1N2AA 1M2DA 2LUSA 2L59A 2LNSA 2ZUPA 1GTUA 3F4TA 4CW9A 4EKZA 1JZDA 11GSA 3HZ4A 3LXZA 3W8SA 1T1VA 2C4JA 2MYGA 1KNGA 1OKTA 2X8HA 2HE3A 4LL1B 3IR4A 4LMWA 3FR9A 1CQGA 3EE2A 3HY2A 2M72A 3UJ1A 4K5SA 2CVDA 2KHPA 2CAIA 1KEBA 4IKHA 4MZWA 1T00A 2JZSA 4IW9A 1ZYNA 4MA9A 5A1NB 1XOAA 4MDCA 1TI1A 5A5KA 1V57A 3F4SA 3C1RA 5IO2A 4YAPA 1R26A 5D9XA 1M99A 2FD3A 1EEJA 4NPBA 1G6WA 1TI3A 3UVHA 5IOWA 3L9UA 2HZEA 3CMIA 4OCEA 2VO4A 4F03A 2UV8G 2EFHA 4GDFA 1MDIA 5LCZA 2XBQA 2OE0A 4DSRA 1THXA 4RUVA 2GLRA 1JZOA 4WBRD 4L0UA 4D73B 1ERVA 2FY6A 5DJMA 2LRTA 2YJ7A 2FCHA 3GYKA 2O87A 3Q18A 4KH7A 4AGSA 3HMJG 5ECQB 4BVXB 4QMKA 5IMVA 3A2WA 5ID2B 5JWQB 3GUSA 1YY7A 3E3EA 4QQ7A 2PVOC 4FQUA 3R3EA 4ZBAA 4AI6A 4MZBA 2RUFA 5CRDA 5AGYA 3HCZA 4NWYA 1F3BA 1GUKA 4HJMA 3CRUA 3CSIA 3TUEA 3DYRA 4QL7A 2AB6A 2VD0A 2XPEA 5IMZA 6GSYA 4V1Ag 1SKRB 3RBTA 3HXSA 1R4WA 4GTUA 1XWKA 1TU7A 1EP8A 3G9BA 3VPTA 2K9FA 4YH2A 1A8LA 3LORA 5G5EA 4EC0A 3HVVA 3BBYA 5HFIA 3UOMA 5J4UA 3H93A 1K0BA 4KDXA 2X49A 3KP9A 2CVKA 3CQFA 4POBA 3HA9A 1LU4A 3BD2A 4LMVA 3KP8A 1RQMA 2PERA 3EINA 3LEFA 4BIKA 5COHA 2HI7A 3A2XA 1Y6EA 5CNWA 2CAQA 2LJRA 4CDOA 2GQKA 3C7MA 2FWGA 2ES7A 4DVCA 4G0IA 3IRAA 5IMCA 2EFDA 2AUVA 3CYNA 2R4VA 3ZFBA 3CSJA 14GSA 2F8AA 3TJKA 3IDVA 3CHXC 3FEUA 4MMMA 2VCQA 3VURA 2GQLA 4WF5A 5DQSA 3V1WA 3UBKA 5ELGA 3ERWA 2KP2A 4Q5RA 2EFEA 2B5XA 3GN3A 1ML6A 4Z2RA 2LS5A 2DMLA 2JSYA 2MMZA 3EU4A 4L5LA 2GSQA 2WW0A 1IYHA 1VGLA 1K3LA 4X1UA 2K8SA 1PKWA 3QPMA 2OJLA 1I1IP 5DCHA 2B6MA 2HRFA 1K0MA 2AAWA 3DVWA 4I6XA 2H0GA 5INYA 4MJEA 5AIVA 2IMKA 2MMNA 5CYYA 5HR0A 1I5GA 2DKIA 3GA4A 1X9SB 5JCWA 3LWAA 1U3IA 4IHUA 1PQNA 4Z2UA 2OBIA 4IN0A 1M9BA 1FB6A 2H70A 2B7KA 4KCEA 4K2XA 4GWRA 2HXKA 4JRRA 4N0ZA 3TU3B 4XCSA 2UZ8A 3HZ8A 3WGDA 3TCOA 2DJKA 5ECHB 1SK2A 4MCUA 3U5RE 1AQVA 4H86A 1SU9A 6GSWA 3KTLA 4MH2A 1MTCA 2E0QA 3KH9A 2GT5A 1C72A 2LKUA 2EC4A 1Z5YE 1K0CA 1GRXA
chains in the Genus database with same CATH topology
2YJHA 16GSA 5ECPB 2O7KA 2HRKA 9GSSA 3Q74A 5CRGA 2B7JA 4FIWA 5HQPA 3EU3A 1O85A 1X5DA 5IMDA 3BOAA 3E0UA 1OYJA 2CV4A 3M0FA 4ZL8A 1WRYA 3GMFA 4L0WA 4HI7A 5B8BA 4PNFA 1OC8A 5GAPD 4POMA 4ML1A 2F8FA 3PGTA 5J47A 1ERUA 1TK8B 2H1LA 2HYXA 1OE8A 4J56E 4Z7XA 1XPVA 2IWTA 5AN1A 4ECCA 1AAZA 1FG4A 4BWQA 2PN8A 1XVQA 4BVYA 2NPBA 5HFKA 2N5AA 1YF1A 5IQYA 3QFAC 2B5EA 2VCTA 5J9CA 1VRSD 4N0VA 3QCPA 2GT6A 5A5HB 1VF1A 4MJBA 5D93A 1PD21 5ECRB 2ZCTA 3EVIA 5GAND 4JZQA 10GSA 1DE2A 3LYKA 1CQHA 3DRNA 4LL4B 3QAVA 4X0XA 2YWNA 1WJKA 3EPTA 3ZFLA 3DWVA 2VL2A 2O5VA 4KB3A 2M46A 5HR2A 2R0CA 2X99A 2HT9A 5B7CA 2VL3A 1A8YA 4K2DA 4KNDA 3ZVJD 3LG6A 3A2VA 4G2EA 4TW5A 3EWLA 4L8EA 4EUYA 2H6XA 1YF0A 5DVBA 3VI7A 4MPFA 2JU5A 4OCFA 1GUMA 3VLNA 3MSZA 4YQMA 4TRXA 4QL9A 2VL9A 5A4VA 2VLTA 2LTKA 2VLUA 1SL2B 4OFTA 4I97A 3D4MA 2VAFA 3FZ4A 3P2AA 3L9SA 1GSUA 1HNAA 2HRAA 4ACSA 2V2GA 2YP6A 3VWVA 4F2IA 4JR4A 5GSSA 3MAKA 3IPZA 4RI7A 4MJCA 3AY8A 2GSTA 4PTSA 2YV9A 4YAVA 3I6AA 4XS1A 2C3TA 2XC2A 2EIRA 4IGJA 5F07A 1JLWA 1OKDA 17GSA 3GSTA 4F9ZA 2IMEA 5ECMB 3KIJA 1ZOFA 4K6XA 1OC9A 2DJ0A 4OMVA 2KOKA 3ZIJA 3DGQA 4KSMA 3ME7A 4JBBA 6GSSA 2IMFA 2N5BA 3IBHA 1U6TA 4ID0A 3L9VA 3KM6A 2GQMA 2DBCA 3RDWA 1BJXA 3GKMA 2R0PA 3PH9A 1A0RP 1Q4JA 3GKNA 3G7YA 4WR4A 4X4JA 4DSSA 2QGVA 5BRTA 1TRWA 1GLPA 1WMJA 3LJRA 5G31A 1PKZA 4AKIA 2NBSA 2OADA 7GSSA 4EXJA 4EIQA 4XTSA 5IO0A 3QAWA 2FA4A 3F6FA 2LJKA 3N5OA 1OC3A 2IFQA 1MD3A 4GQFA 5DQYA 5IPGA 2IN3A 5KN0A 1TK5B 4ZB7A 1O73A 4MF5A 3I43A 4HUAA 4WBJA 1K0AA 2VM2A 2FGXA 2H75A 4E8HA 2WFCA 3R2QA 2R37A 3APSA 1NSWA 4WEYA 4OWYA 1A2LA 2R0GA 4TKYA 4ZIJA 2H71A 2IPAA 1ZL9A 1U3AA 3M9JA 2YWMA 1SKWB 4YKGA 4O92A 3H8QA 4IQ1A 3IAM2 1WPIA 1PSQA 2C0DA 1B9XC 4NHZA 5CAXA 3RHCA 3QAGA 4EL1A 3WD6A 13GSA 4N30A 3DIEA 4KW6A 3EMPA 2WRTA 1U87A 4V2LA 2CX3A 5DALA 1SKSB 1GUHA 3NIVA 4HU7A 4HJ2A 1ZYEA 1M2BA 2HZEB 3LXTA 4MK3A 2GTUA 1SL0B 4V2NA 5J41A 3D21A 3TKRA 4KAEA 2EIOA 2NTOA 2C3NA 2OACA 5FHIA 2OT3A 6GSTA 3VWWA 4ZL9A 5IIZA 2B5YA 2DLXA 3ZMKA 2AV4A 3E9JB 1S3DA 2JL4A 3F9UA 1E2YA 1ZYQB 1XXUA 1SK0A 4NXIA 3UARA 3ZREA 4IS0A 3HJPA 2RM6A 4K0GA 2JSZA 3ZRDA 1E6BA 5KEJA 1VF3A 4ML6A 5E59A 4ZILA 4K7IA 1TDIA 1R5PA 3APOA 4HZ2A 3DVXA 2JZRA 5B6NA 1MD4A 5G30A 4BA7A 3EC3A 1QMVA 1O7UA 1EGOA 4G19A 2M80A 3M1GA 1AQXA 2VCZA 1UN2A 2GS3A 5A4WA 4IVFA 1V9WA 1EV4A 1ZZYA 2A4VA 4JE1A 3MYDA 1ERTA 2FWEA 4JU5A 4G10A 1I9DA 5DDLA 2YZUA 4ZB9A 2DSAA 2YANA 1AW9A 1PL2A 4BVXA 5CRHA 2VL2C 2ZNMA 4O5UA 3TKPA 1FVJA 4YKFA 3MWHA 4IJIA 2KLXA 1YQ1A 2L57A 2C0FA 5CRWA 5ABRA 1TP9A 1XWGA 3KJYA 3RAZA 2YOIA 5D8IA 3D4TA 4TR1A 2V6OA 3APQA 3HVSA 1J08A 5EY6A 4ECIA 4AF2A 3A5WA 4Q5QA 1XWCA 5KN3A 4MJAA 2P0GA 1B48A 1DSBA 2A2PA 1TKDB 8GSSA 2F3MA 4OD7A 2WULA 18GSA 2L4QA 5DCGA 1XW9A 2H30A 2A2RA 1GLQA 1JFUA 3O3TA 2H1GA 4O5QA 4RQRA 1O6JA 1DBYA 3D5JA 1FW1A 3QFBC 3FRCA 1ON4A 1DUGA 3QR6A 1PGTA 1OAZA 4POKA 3GH9A 4N11A 4KF9A 1TRVA 2P5RA 1GH2A 1ERWA 3C71A 3IC8A 5A34A 4K7NA 3IHGA 1QXHA 2OBKA 4BL7A 1GNWA 4W66A 3UMAA 2K18A 2F9SA 3P8WA 2ON5A 2GZZA 1NM3A 2YNXA 4PQ1A 2WGRA 1T7PB 4PXOA 2VLVA 1Q98A 2HRKB 4G0LA 3JCML 2WB9A 3FY7A 1SD9A 3GL3A 1A0FA 3GTUA 3FKFA 2PGTA 4GCIA 2P31A 4OO5A 1Z9HA 1AC1A 1G7EA 1DE1A 4XS4B 4OO4A 1NW2A 3QD9A 2FNOA 1U88A 3TKQA 1O81A 3CSHA 1BG1A 1X5CA 3GIXA 2RIIA 1GULA 1M7TA 5KN1A 2RLIA 3TJJA 1YVLA 3J7Yk 1XIYA 3F4RA 4KX4A 3L78A 2HSMA 3ZITA 2CA8A 2IMIA 4IP6A 5H5RA 4KSOA 1PRXA 3FZ9A 5IMFA 2CT6A 3C73A 3FZ5A 4MZCA 3DD3A 2HNLA 2JZTA 2A4HA 4BVYB 3W6GA 3LQ7A 2V32A 1AQWA 1THOA 1EOHA 4RI6A 3TB2A 1KBNA 2HQTA 2QSIA 4K5RA 4AKXB 5ECKB 1JHBA 5L71A 4HQZA 1BG5A 1FOHA 5JCUA 3GKKA 4N3ZA 3GKXA 5DJLA 4IELA 2PUKC 1MEKA 3MNGA 1TXXA 3ZL5A 1GTIA 2PPTA 2YPMA 4XS6A 3KMOA 3TJFA 3FR6A 2YZHA 4X43A 1SVLA 1UVZA 3TKSC 4K7OA 1HNCA 2E7PA 1GNEA 1PL1A 3ME8A 5J5NA 2GDRA 1M2AA 5HR3A 1Z6MA 1MDKA 2NVLA 5GSTA 4ISDA 3KCMA 1X0RA 2X4AA 4TR3A 4PUFC 1XVWA 3Q6OA 3GSSA 3GL5A 2H6YA 1N25A 4OFMA 5KOWA 5CP1A 3HVXA 4TXVA 2XHFA 1AXDA 4TXOA 2DKHA 2VCWA 4GLTA 4MABA 4KGIA 2C8UA 1EP7A 4ILFA 3F8UA 1YZXA 5JWOB 12GSA 4J2FA 5D96A 3KEBA 3A3TA 4XRDA 3RHBA 3DEXA 5ECLB 3ERGA 2YN1A 3ZVJA 1YJ6A 1XOBA 3GV1A 4J57E 2VKZG 2V6KA 2B1LA 2V41A 3IV4A 2E2GA 2AJQB 1XCCA 3EURA 3HYPA 2L4CA 1PA3A 4HQSA 5ECNB 2VM1A 1OC9B 2A2SA 1WIKA 3ERFA 1NHYA 4G0KA 2N5FA 1BYEA 1XFLA 4GXZA 1W4VA 4IQAA 5EPFA 2DIYA 4K8MA 4HEA2 3TRQA 2OE3A 2GZYA 4IJ3A 4DSQA 3VWUA 19GSA 1TK0B 5JCGA 3P7XA 1BAYA 3CRTA 3KXOA 2VCXA 1SYRA 4DSSB 1SVOA 2PMTA 5F0GA 1BQ7A 3MIXA 2I9HA 4F0BA 1X5EA 3GH6A 2R2JA 2LEGA 3ZZXA 3TRPA 4E68A 1Z3EA 4MP4A 5EVOA 3GRXA 1QQ2A 5CO3A 1EZKA 2IFQB 3HJOA 1GSFA 1X9WB 1FO5A 5D9VA 4EF0A 2H72A 1ABAA 1USBA 1S3AA 2LQQA 2VOCA 1UA5A 4F0CA 4WKWA 5ENUA 4NMUA 5J9BA 3IE3A 1TTZA 1V40A 4ZXGA 1SENA 1FHEA 5AISA 2K8VA 5G2ZA 5BMUA 5HR1A 4DEJA 4FH8A 3US3A 3KMNA 2B1KA 1V98A 2MMOA 2WCIA 4LLRA 1G6YA 2C1YA 2P5QA 3WGEA 5F8BA 3TJBA 2JACA 5IM9A 1OE7A 4CY6A 4MF6A 4PX1A 6GSVA 1SK1A 5F06A 2AYTA 5DAKA 3UAPA 3IK7A 3FK8A 1H75A 2QKEA 2IMDA 5G5FA 4AKHA 1VF4A 5DALB 2HFDA 2H76A 6GSXA 2R5GA 3GX8A 2PVQA 3CXGA 1UC7A 3IA1A 1J9BA 2C3QA 2HSNA 2E2MA 3LW9A 3TKSA 1N8JA 3ED3A 2L5LA 3TKSE 1Z7RA 5H5QA 3IAS2 1SD8A 2H1DA 1HNBA 3LSZA 1B8XA 3L0HA 2RUEA 1HQOA 4OFNA 3LGCA 4TR4A 1TU8A 3FMWA 1WOUA 4I5QA 1TW9A 3C1SA 3NZNA 2EIQA 2REMA 22GSA 3UVTA 3CBUA 4KE3A 1TXUA 3TJGA 1F3AA 4GQCA 4ZBBA 5A1NA 1KTEA 2KP1A 3RPPA 5ELAA 2VD1A 1ZYPA 2WZ9A 5J40A 4NHWA 4NAXA 3TOUA 3FW2A 3PINA 1XWAA 4HU9A 4HDEA 1F6MC 3EYTA 5ECOB 2H1BA 3NOFA 1JZWA 2PWJA 4MF7A 2VUPA 4TR0A 2V1MA 4ULXA 2H19A 1SJZA 3UEMA 4ZB8A 4PNGA 4POLA 3N9JA 1TRSA 2H0IA 5AIXA 4D73A 3KZQA 4G01A 3TDGA 2VCVA 2OA7A 4TR1B 3ZYWA 1GSQA 5FT3A 1FB0A 1YDKA 5ID2A 1XZOA 4XIHA 2FLSA 1LJRA 3F63A 3WT1A 1FAAA 3L4NA 1R5AA 3QMXA 5LD0A 1T4YA 3IXRA 2D2ZA 4V1Ap 4P3YB 3H1NA 2C80A 2GGTA 3F0IA 5LNKe 5ECIB 2GZPA 4TVEA 4F82A 3S9FA 3ISOA 4KDUA 3TOTA 1QUWA 1SYXA 4A5PA 3LYPA 5D9TA 3CTGA 3KD0A 1O8XA 2FA8A 2I81A 3KGKA 4ZL7A 1ZGNA 2QC7A 1QFNA 3SWLA 2TRXA 1V2AA 2BTOT 2I3YA 1XW5A 1J0FA 3IHQA 1GSYA 1ZCPA 4ECBA 1M9AA 4EDZA 1SJIA 2FWFA 5A34B 5J4VA 4AJ8A 3FYGA 4K0NA 1TOFA 5J3RA 4AJ7A 4KCAA 4I2TA 4BL7B 3F3RA 3G7IA 1K3YA 1B4PA 1F37A 2QA1A 2H0HA 5KN2A 2PU9C 1S3CA 5E4WA 1PN9A 2I1UA 2IL3A 2MBSA 4I8BA 1W89A 4GSTA 3GX0A 2DJ3A 1OVNA 4KUNA 5JWRB 1YEPA 2CX4A 1XWBA 3GTUB 3H4KA 1QGVA 4FO5A 2GSSA 2H74A 1M0UA 1ACVA 4TN8A 2WDUA 2O89A 3U6VA 3EMXA 1HYUA 5IPHA 3CTFA 3ZLPA 1A2JA 1GTAA 3H79A 4FYBA 2MMAA 4E8EA 1G0TA 2JADA 1FOVA 1TRUA 1VF2A 2CVBA 4PQIA 2K6VA 2HSMB 2LRNA 2O8VB 4FYUA 1WE0A 2XBIA 4FYCA 3HHVA 5G1KA 1AIUA 4XHMA 1B9YC 3HKRA 3GFKA 2H6ZA 3Q19A 4G9HA 2FHEA 3VPQA 3C8EA 5KOXA 3BCKA 1YKCA 2DIZA 5DBQA 1A24A 4PUAA 4GSSA 2J9HA 4MPGA 2HRNA 1URMA 1JLVA 1F9MA 5FWGA 2L5OA 3O6TA 3DXBA 1H4OA 4XS4A 2IIYA 4O5RA 1JZRA 2TIRA 3P90A 4MLYA 4GF0A 1WWJA 1BEDA 3TGZA 3M8NA 1EOGA 3F3QA 3F6DA 1ILOA 1SL1B 1FVKA 1T3BA 1PN0A 1NHOA 1B4QA 1V58A 3OR5A 4HS1A 3UL3A 5G1LA 4BPYA 1GSEA 1K0OA 3K8NA 1MDJA 1Y1UA 2BMXA 2R3XA 5F05A 5J4YA 4Q5FA 2R6KA 4CHSA 4ECJA 5A4UA 4Q5NA 2NDOA 2CZ3A 2AHEA 5IOXA 2DJJA 2ALBA 1EWXA 3HJMA 6GSUA 5D73A 2XPDA 3WT2A 5HFGA 2HLSA 1GSDA 3GURA 2QA2A 2X8CA 1LBKA 4ZB6A 3BJ5A 1RK4A 2HZFA 1PX7A 4IP1A 2MZCA 4TXOB 3IC4A 2H66A 4PQHA 3PPUA 3KTBA 5D9WA 4HOJA 4HZ4A 5A5HA 2LSTA 2G0FA 3KH7A 2WJUA 1QK8A 2H73A 3SBCA 4MNNA 1XW6A 2GVPA 20GSA 3D0ZA 3BCIA 4YQUA 5CREA 3J7Yb 4WXTA 2YV7A 4EVMA 4O7HA 4ICYA 1HD2A 4LA1A 4K9ZA 4EE0A 2GSRA 4N10A 4BWSA 1T4ZA 2KUCA 4USSA 1EV9A 1T8EB 4K1FA 2B3SA 2YWOA 4XRAA 2BJXA 1WP0A 4Z2TA 1XBSA 3ZIVA 1K0DA 2EFCA 3ZMLA 1A2MA 4NV5A 4PURA 1GP1A 1GTBA 3CWGA 1Z6NA 1K3OA 2HSYA 3WGXA 4EO3A 5C04A 2DC5A 3UBLA 4IBPA 3QDNA 2X64A 2LJAA 5ECSA 4PGTA 2TRCP 1Y25A 2F51A 2LNTA 4NV2A 2ON7A 2Z9SA 3DMLA 3GNJA 1ST9A 3VFIA 2DJ1A 2DMMA 1EEMA 1TJDA 1SVMA 4JR6A 2FWHA 2OKAA 4AJ6A 1BX9A 2IJYA 2LRCA 1GSSA 2VIMA 2C0GA 3M9KA 2HSHA 2OE1A 4GSNA 3HD5A 4JEDA 2I4AA 5B6MA 4EIPA 1GL8A 3IK9A 3VK9A 1IYIA 3QOUA 4KDYA 4V2MA 1BF5A 3G7JA 2G2QA 1YEXA 3I9V2 2MBTA 3PR8A 4O32A 5H5SA 4L5OA 2LV3A 3FR3A 1R7HA 3VI5A 5BMUB 2WS2A 2H01A 2YCDA 3I69A 5GZZB 1A23A 1PX6A 4GRFA 2C0EA 3GHAA 1RW1A 1X9MB 5IMAA 3W8JA 2LQOA 3MDKA 3VWXA 2PBJA 4KA0A 4AKGA 3TRXA 3ZTLA 1AUCA 4EDYA 2X8GA 5EL8A 3FZAA 1SJ6A 4ZBDA 2YWIA 3LFLA 3DKSA 3D6IA 4WF4A 5DAKB 4CY8A 4WETA 1EGRA 3WYWA 5C00A 1G7OA 2RM5A 4TOPA 2J23A 3FHKA 5B8AA 4I2UA 3M3MA 2DJ2A 2CQ9A 4YQVA 3O76A 1K0NA 4MH3A 3D22A 1GWCA 2HSNB 1Z7PA 2H1AA 3HDCA 1F2EA 1YKAA 2FUG2 2CZ2A 1ZMAA 4WR5A 3IOSA 2H8LA 3RPNA 1PMTA 2L6CA 3A5IA 4RQXA 3UIWA 1O8WA 2L6DA 2O85A 1N2AA 1M2DA 2LUSA 2L59A 2LNSA 2ZUPA 1GTUA 3F4TA 4CW9A 4EKZA 1JZDA 11GSA 3HZ4A 3LXZA 3W8SA 1T1VA 2C4JA 2MYGA 1KNGA 1OKTA 2X8HA 2HE3A 4LL1B 3IR4A 4LMWA 3FR9A 1CQGA 3EE2A 3HY2A 2M72A 3UJ1A 4K5SA 2CVDA 2KHPA 2CAIA 1KEBA 4IKHA 4MZWA 1T00A 2JZSA 4IW9A 1ZYNA 4MA9A 5A1NB 1XOAA 4MDCA 1TI1A 5A5KA 1V57A 3F4SA 3C1RA 5IO2A 4YAPA 1R26A 5D9XA 1M99A 2FD3A 1EEJA 4NPBA 1G6WA 1TI3A 3UVHA 5IOWA 3L9UA 2HZEA 3CMIA 4OCEA 2VO4A 4F03A 2UV8G 2EFHA 4GDFA 1MDIA 5LCZA 2XBQA 2OE0A 4DSRA 1THXA 4RUVA 2GLRA 1JZOA 4WBRD 4L0UA 4D73B 1ERVA 2FY6A 5DJMA 2LRTA 2YJ7A 2FCHA 3GYKA 2O87A 3Q18A 4KH7A 4AGSA 3HMJG 5ECQB 4BVXB 4QMKA 5IMVA 3A2WA 5ID2B 5JWQB 3GUSA 1YY7A 3E3EA 4QQ7A 2PVOC 4FQUA 3R3EA 4ZBAA 4AI6A 4MZBA 2RUFA 5CRDA 5AGYA 3HCZA 4NWYA 1F3BA 1GUKA 4HJMA 3CRUA 3CSIA 3TUEA 3DYRA 4QL7A 2AB6A 2VD0A 2XPEA 5IMZA 6GSYA 4V1Ag 1SKRB 3RBTA 3HXSA 1R4WA 4GTUA 1XWKA 1TU7A 1EP8A 3G9BA 3VPTA 2K9FA 4YH2A 1A8LA 3LORA 5G5EA 4EC0A 3HVVA 3BBYA 5HFIA 3UOMA 5J4UA 3H93A 1K0BA 4KDXA 2X49A 3KP9A 2CVKA 4POBA 3HA9A 1LU4A 3BD2A 4LMVA 3KP8A 1RQMA 2PERA 3EINA 3LEFA 5COHA 2HI7A 3A2XA 1Y6EA 5CNWA 2CAQA 2LJRA 4CDOA 2GQKA 3C7MA 2FWGA 2ES7A 4DVCA 4G0IA 3IRAA 5IMCA 2EFDA 2AUVA 3CYNA 2R4VA 3ZFBA 3CSJA 14GSA 2F8AA 3TJKA 3IDVA 3FEUA 4MMMA 2VCQA 3VURA 2GQLA 4WF5A 5DQSA 3V1WA 3UBKA 5ELGA 3ERWA 2KP2A 4Q5RA 2EFEA 2B5XA 3GN3A 1ML6A 4Z2RA 2LS5A 2DMLA 2JSYA 2MMZA 3EU4A 4L5LA 2GSQA 1VGLA 1IYHA 1K3LA 4X1UA 2K8SA 1PKWA 3QPMA 2OJLA 5DCHA 2B6MA 2HRFA 1K0MA 2AAWA 3DVWA 4I6XA 2H0GA 5INYA 4MJEA 5AIVA 2IMKA 2MMNA 5CYYA 5HR0A 1I5GA 2DKIA 3GA4A 1X9SB 5JCWA 3LWAA 1U3IA 4IHUA 1PQNA 4Z2UA 2OBIA 4IN0A 1M9BA 1FB6A 2H70A 2B7KA 4KCEA 4K2XA 4GWRA 2HXKA 4JRRA 4N0ZA 3TU3B 4XCSA 2UZ8A 3HZ8A 3WGDA 3TCOA 2DJKA 5ECHB 1SK2A 4MCUA 3U5RE 1AQVA 4H86A 1SU9A 6GSWA 3KTLA 4MH2A 1MTCA 2E0QA 3KH9A 2GT5A 1C72A 2LKUA 2EC4A 1Z5YE 1K0CA 1GRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJH A;  16GS A;  5ECP B;  2O7K A;  2HRK A;  9GSS A;  3Q74 A;  5CRG A;  2B7J A;  4FIW A;  5HQP A;  3EU3 A;  1O85 A;  1X5D A;  5IMD A;  3BOA A;  3E0U A;  1OYJ A;  2CV4 A;  3M0F A;  4ZL8 A;  1WRY A;  3GMF A;  4L0W A;  4HI7 A;  5B8B A;  4PNF A;  1OC8 A;  5GAP D;  4POM A;  4ML1 A;  2F8F A;  3PGT A;  1ERU A;  1TK8 B;  2HYX A;  1OE8 A;  4J56 E;  4Z7X A;  1XPV A;  2IWT A;  5AN1 A;  4ECC A;  1AAZ A;  1FG4 A;  4BWQ A;  2PN8 A;  1XVQ A;  4BVY A;  2NPB A;  5HFK A;  2N5A A;  1YF1 A;  5IQY A;  3QFA C;  2B5E A;  2VCT A;  5J9C A;  1VRS D;  4N0V A;  3QCP A;  2GT6 A;  1VF1 A;  4MJB A;  5D93 A;  1PD2 1;  5ECR B;  2ZCT A;  3EVI A;  5GAN D;  4JZQ A;  10GS A;  1DE2 A;  3LYK A;  1CQH A;  3DRN A;  4LL4 B;  3QAV A;  4X0X A;  2YWN A;  1WJK A;  3ZFL A;  3DWV A;  2VL2 A;  4KB3 A;  2M46 A;  5HR2 A;  2X99 A;  2HT9 A;  5B7C A;  2VL3 A;  1A8Y A;  4K2D A;  4KND A;  3ZVJ D;  3LG6 A;  3A2V A;  4G2E A;  4TW5 A;  3EWL A;  4L8E A;  4EUY A;  2H6X A;  1YF0 A;  5DVB A;  3VI7 A;  4MPF A;  2JU5 A;  4OCF A;  1GUM A;  3VLN A;  3MSZ A;  4YQM A;  4TRX A;  4QL9 A;  2VL9 A;  5A4V A;  2VLT A;  2LTK A;  2VLU A;  1SL2 B;  4OFT A;  4I97 A;  3D4M A;  2VAF A;  3FZ4 A;  3P2A A;  3L9S A;  1GSU A;  1HNA A;  2HRA A;  4ACS A;  2V2G A;  2YP6 A;  3VWV A;  4F2I A;  4JR4 A;  5GSS A;  3MAK A;  3IPZ A;  4RI7 A;  4MJC A;  3AY8 A;  2GST A;  4PTS A;  2YV9 A;  4YAV A;  3I6A A;  4XS1 A;  2C3T A;  2XC2 A;  2EIR A;  4IGJ A;  5F07 A;  1JLW A;  1OKD A;  17GS A;  3GST A;  4F9Z A;  2IME A;  5ECM B;  3KIJ A;  1ZOF A;  4K6X A;  1OC9 A;  2DJ0 A;  4OMV A;  2KOK A;  3ZIJ A;  3DGQ A;  4KSM A;  3ME7 A;  4JBB A;  6GSS A;  2IMF A;  2N5B A;  3IBH A;  1U6T A;  4ID0 A;  3L9V A;  3KM6 A;  2GQM A;  2DBC A;  3RDW A;  1BJX A;  3GKM A;  3PH9 A;  1A0R P;  1Q4J A;  3GKN A;  3G7Y A;  4WR4 A;  4DSS A;  2QGV A;  1TRW A;  1GLP A;  1WMJ A;  3LJR A;  5G31 A;  1PKZ A;  2NBS A;  2OAD A;  7GSS A;  4EXJ A;  4XTS A;  5IO0 A;  3QAW A;  2FA4 A;  3F6F A;  2LJK A;  3N5O A;  1OC3 A;  2IFQ A;  1MD3 A;  4GQF A;  5DQY A;  5IPG A;  2IN3 A;  5KN0 A;  1TK5 B;  1O73 A;  4MF5 A;  3I43 A;  4HUA A;  4WBJ A;  1K0A A;  2VM2 A;  2FGX A;  2H75 A;  4E8H A;  2WFC A;  3R2Q A;  2R37 A;  3APS A;  1NSW A;  4WEY A;  4OWY A;  1A2L A;  4TKY A;  4ZIJ A;  2H71 A;  2IPA A;  1ZL9 A;  1U3A A;  3M9J A;  2YWM A;  1SKW B;  4O92 A;  3H8Q A;  4IQ1 A;  3IAM 2;  1WPI A;  1PSQ A;  2C0D A;  1B9X C;  4NHZ A;  5CAX A;  3RHC A;  3QAG A;  4EL1 A;  3WD6 A;  13GS A;  4N30 A;  3DIE A;  4KW6 A;  3EMP A;  2WRT A;  1U87 A;  4V2L A;  2CX3 A;  5DAL A;  1SKS B;  1GUH A;  3NIV A;  4HU7 A;  4HJ2 A;  1ZYE A;  1M2B A;  2HZE B;  3LXT A;  4MK3 A;  2GTU A;  1SL0 B;  4V2N A;  5J41 A;  3D21 A;  3TKR A;  4KAE A;  2EIO A;  2NTO A;  2C3N A;  2OAC A;  5FHI A;  6GST A;  3VWW A;  4ZL9 A;  5IIZ A;  2B5Y A;  2DLX A;  3ZMK A;  2AV4 A;  3E9J B;  1S3D A;  2JL4 A;  3F9U A;  1E2Y A;  1ZYQ B;  1XXU A;  1SK0 A;  4NXI A;  3UAR A;  3ZRE A;  4IS0 A;  3HJP A;  2RM6 A;  4K0G A;  2JSZ A;  3ZRD A;  1E6B A;  5KEJ A;  1VF3 A;  4ML6 A;  5E59 A;  4ZIL A;  4K7I A;  1TDI A;  1R5P A;  3APO A;  4HZ2 A;  3DVX A;  2JZR A;  5B6N A;  1MD4 A;  5G30 A;  4BA7 A;  3EC3 A;  1QMV A;  1O7U A;  1EGO A;  4G19 A;  2M80 A;  3M1G A;  1AQX A;  2VCZ A;  1UN2 A;  2GS3 A;  5A4W A;  4IVF A;  1V9W A;  1EV4 A;  1ZZY A;  2A4V A;  4JE1 A;  1ERT A;  2FWE A;  4JU5 A;  4G10 A;  1I9D A;  5DDL A;  2YZU A;  4ZB9 A;  2DSA A;  2YAN A;  1AW9 A;  1PL2 A;  4BVX A;  5CRH A;  2VL2 C;  2ZNM A;  3TKP A;  1FVJ A;  3MWH A;  4IJI A;  2KLX A;  1YQ1 A;  2L57 A;  2C0F A;  5CRW A;  5ABR A;  1TP9 A;  1XWG A;  3KJY A;  3RAZ A;  2YOI A;  5D8I A;  3D4T A;  4TR1 A;  2V6O A;  3APQ A;  3HVS A;  1J08 A;  5EY6 A;  4ECI A;  4AF2 A;  3A5W A;  4Q5Q A;  1XWC A;  5KN3 A;  4MJA A;  2P0G A;  1B48 A;  1DSB A;  1TKD B;  8GSS A;  2F3M A;  4OD7 A;  2WUL A;  18GS A;  2L4Q A;  5DCG A;  1XW9 A;  2H30 A;  2A2R A;  1GLQ A;  1JFU A;  3O3T A;  2H1G A;  4RQR A;  1O6J A;  1DBY A;  3D5J A;  1FW1 A;  3QFB C;  3FRC A;  1ON4 A;  1DUG A;  3QR6 A;  1PGT A;  1OAZ A;  4POK A;  3GH9 A;  4N11 A;  4KF9 A;  1TRV A;  2P5R A;  1GH2 A;  1ERW A;  3C71 A;  3IC8 A;  4K7N A;  1QXH A;  2OBK A;  4BL7 A;  1GNW A;  3UMA A;  2K18 A;  2F9S A;  3P8W A;  2ON5 A;  2GZZ A;  1NM3 A;  2YNX A;  4PQ1 A;  2WGR A;  1T7P B;  4PXO A;  2VLV A;  1Q98 A;  2HRK B;  4G0L A;  3JCM L;  2WB9 A;  3FY7 A;  1SD9 A;  3GL3 A;  1A0F A;  3GTU A;  3FKF A;  2PGT A;  4GCI A;  2P31 A;  4OO5 A;  1Z9H A;  1AC1 A;  1G7E A;  1DE1 A;  4XS4 B;  4OO4 A;  1NW2 A;  3QD9 A;  2FNO A;  1U88 A;  3TKQ A;  1O81 A;  3CSH A;  1X5C A;  3GIX A;  2RII A;  1GUL A;  1M7T A;  5KN1 A;  2RLI A;  3TJJ A;  3J7Y k;  1XIY A;  3F4R A;  4KX4 A;  3L78 A;  2HSM A;  3ZIT A;  2CA8 A;  2IMI A;  4IP6 A;  5H5R A;  4KSO A;  1PRX A;  3FZ9 A;  5IMF A;  2CT6 A;  3C73 A;  3FZ5 A;  4MZC A;  3DD3 A;  2HNL A;  2JZT A;  4BVY B;  3W6G A;  3LQ7 A;  2V32 A;  1AQW A;  1THO A;  1EOH A;  4RI6 A;  3TB2 A;  1KBN A;  2HQT A;  2QSI A;  5ECK B;  1JHB A;  5L71 A;  4HQZ A;  1BG5 A;  5JCU A;  3GKK A;  3GKX A;  5DJL A;  4IEL A;  2PUK C;  1MEK A;  3MNG A;  1TXX A;  3ZL5 A;  1GTI A;  2PPT A;  2YPM A;  4XS6 A;  3KMO A;  3TJF A;  3FR6 A;  2YZH A;  4X43 A;  1UVZ A;  3TKS C;  4K7O A;  1HNC A;  2E7P A;  1GNE A;  1PL1 A;  3ME8 A;  5J5N A;  2GDR A;  1M2A A;  5HR3 A;  1Z6M A;  1MDK A;  2NVL A;  5GST A;  4ISD A;  3KCM A;  1X0R A;  4TR3 A;  4PUF C;  1XVW A;  3Q6O A;  3GSS A;  3GL5 A;  2H6Y A;  4OFM A;  5CP1 A;  3HVX A;  4TXV A;  2XHF A;  1AXD A;  4TXO A;  2VCW A;  4GLT A;  4MAB A;  4KGI A;  2C8U A;  1EP7 A;  4ILF A;  3F8U A;  1YZX A;  5JWO B;  12GS A;  4J2F A;  5D96 A;  3KEB A;  3A3T A;  4XRD A;  3RHB A;  3DEX A;  5ECL B;  3ERG A;  2YN1 A;  3ZVJ A;  1YJ6 A;  1XOB A;  3GV1 A;  4J57 E;  2V6K A;  2B1L A;  2V41 A;  3IV4 A;  2E2G A;  2AJQ B;  1XCC A;  3EUR A;  3HYP A;  2L4C A;  1PA3 A;  4HQS A;  5ECN B;  2VM1 A;  1OC9 B;  2A2S A;  1WIK A;  3ERF A;  1NHY A;  4G0K A;  2N5F A;  1BYE A;  1XFL A;  4GXZ A;  1W4V A;  4IQA A;  5EPF A;  2DIY A;  4K8M A;  4HEA 2;  3TRQ A;  2OE3 A;  2GZY A;  4IJ3 A;  4DSQ A;  3VWU A;  19GS A;  1TK0 B;  5JCG A;  3P7X A;  1BAY A;  3CRT A;  3KXO A;  2VCX A;  1SYR A;  4DSS B;  2PMT A;  5F0G A;  1BQ7 A;  2I9H A;  4F0B A;  1X5E A;  3GH6 A;  2R2J A;  2LEG A;  3ZZX A;  3TRP A;  1Z3E A;  4MP4 A;  5EVO A;  3GRX A;  1QQ2 A;  5CO3 A;  1EZK A;  2IFQ B;  3HJO A;  1GSF A;  1X9W B;  1FO5 A;  5D9V A;  4EF0 A;  2H72 A;  1ABA A;  1USB A;  1S3A A;  2LQQ A;  2VOC A;  1UA5 A;  4F0C A;  4WKW A;  5ENU A;  4NMU A;  5J9B A;  3IE3 A;  1TTZ A;  1V40 A;  4ZXG A;  1SEN A;  1FHE A;  5AIS A;  2K8V A;  5G2Z A;  5BMU A;  5HR1 A;  4DEJ A;  4FH8 A;  3US3 A;  3KMN A;  2B1K A;  1V98 A;  2MMO A;  2WCI A;  4LLR A;  1G6Y A;  2C1Y A;  2P5Q A;  3WGE A;  5F8B A;  3TJB A;  2JAC A;  5IM9 A;  1OE7 A;  4MF6 A;  4PX1 A;  6GSV A;  1SK1 A;  5F06 A;  2AYT A;  5DAK A;  3UAP A;  3IK7 A;  3FK8 A;  1H75 A;  2QKE A;  2IMD A;  5G5F A;  1VF4 A;  5DAL B;  2HFD A;  2H76 A;  6GSX A;  2R5G A;  3GX8 A;  2PVQ A;  3CXG A;  1UC7 A;  3IA1 A;  1J9B A;  2C3Q A;  2E2M A;  3TKS A;  1N8J A;  3ED3 A;  2L5L A;  3TKS E;  1Z7R A;  5H5Q A;  3IAS 2;  1SD8 A;  2H1D A;  1HNB A;  3LSZ A;  1B8X A;  3L0H A;  2RUE A;  1HQO A;  4OFN A;  3LGC A;  4TR4 A;  1TU8 A;  1WOU A;  4I5Q A;  1TW9 A;  3C1S A;  3NZN A;  2EIQ A;  2REM A;  22GS A;  3UVT A;  3CBU A;  4KE3 A;  3TJG A;  1F3A A;  4GQC A;  4ZBB A;  1KTE A;  2KP1 A;  3RPP A;  5ELA A;  2VD1 A;  2WZ9 A;  4NHW A;  4NAX A;  3TOU A;  3FW2 A;  3PIN A;  1XWA A;  4HU9 A;  4HDE A;  1F6M C;  3EYT A;  5ECO B;  2H1B A;  3NOF A;  1JZW A;  2PWJ A;  4MF7 A;  2VUP A;  4TR0 A;  2V1M A;  4ULX A;  2H19 A;  1SJZ A;  3UEM A;  4ZB8 A;  4PNG A;  4POL A;  3N9J A;  1TRS A;  2H0I A;  5AIX A;  4D73 A;  3KZQ A;  3TDG A;  2VCV A;  2OA7 A;  4TR1 B;  3ZYW A;  1GSQ A;  5FT3 A;  1FB0 A;  1YDK A;  5ID2 A;  1XZO A;  4XIH A;  2FLS A;  1LJR A;  3F63 A;  3WT1 A;  1FAA A;  3L4N A;  1R5A A;  3QMX A;  5LD0 A;  1T4Y A;  3IXR A;  2D2Z A;  4V1A p;  4P3Y B;  3H1N A;  2C80 A;  2GGT A;  3F0I A;  5LNK e;  5ECI B;  2GZP A;  4TVE A;  4F82 A;  3S9F A;  3ISO A;  4KDU A;  3TOT A;  1QUW A;  1SYX A;  3LYP A;  5D9T A;  3CTG A;  3KD0 A;  1O8X A;  2FA8 A;  2I81 A;  3KGK A;  4ZL7 A;  1ZGN A;  2QC7 A;  1QFN A;  3SWL A;  2TRX A;  1V2A A;  2BTO T;  2I3Y A;  1XW5 A;  1J0F A;  3IHQ A;  1GSY A;  1ZCP A;  4ECB A;  1M9A A;  4EDZ A;  1SJI A;  2FWF A;  4AJ8 A;  3FYG A;  4K0N A;  1TOF A;  5J3R A;  4AJ7 A;  4KCA A;  4I2T A;  4BL7 B;  3F3R A;  3G7I A;  1K3Y A;  1B4P A;  1F37 A;  5KN2 A;  2H0H A;  2PU9 C;  1S3C A;  5E4W A;  1PN9 A;  2I1U A;  2IL3 A;  2MBS A;  4I8B A;  1W89 A;  4GST A;  3GX0 A;  2DJ3 A;  1OVN A;  4KUN A;  5JWR B;  1YEP A;  2CX4 A;  1XWB A;  3GTU B;  3H4K A;  1QGV A;  4FO5 A;  2GSS A;  2H74 A;  1M0U A;  1ACV A;  4TN8 A;  2WDU A;  2O89 A;  3U6V A;  3EMX A;  1HYU A;  5IPH A;  3CTF A;  3ZLP A;  1A2J A;  1GTA A;  3H79 A;  4FYB A;  2MMA A;  4E8E A;  1G0T A;  2JAD A;  1FOV A;  1TRU A;  1VF2 A;  2CVB A;  4PQI A;  2K6V A;  2HSM B;  2LRN A;  2O8V B;  4FYU A;  1WE0 A;  2XBI A;  4FYC A;  3HHV A;  5G1K A;  1AIU A;  4XHM A;  1B9Y C;  3HKR A;  3GFK A;  2H6Z A;  3Q19 A;  4G9H A;  2FHE A;  3VPQ A;  3C8E A;  3BCK A;  1YKC A;  2DIZ A;  5DBQ A;  1A24 A;  4PUA A;  4GSS A;  2J9H A;  4MPG A;  2HRN A;  1URM A;  1JLV A;  1F9M A;  5FWG A;  2L5O A;  3O6T A;  3DXB A;  1H4O A;  4XS4 A;  2IIY A;  4O5R A;  1JZR A;  2TIR A;  3P90 A;  4MLY A;  4GF0 A;  1WWJ A;  1BED A;  3TGZ A;  3M8N A;  1EOG A;  3F3Q A;  3F6D A;  1ILO A;  1SL1 B;  1FVK A;  1T3B A;  1NHO A;  1B4Q A;  1V58 A;  3OR5 A;  4HS1 A;  3UL3 A;  5G1L A;  4BPY A;  1GSE A;  1K0O A;  3K8N A;  1MDJ A;  2BMX A;  2R3X A;  5F05 A;  4Q5F A;  2R6K A;  4CHS A;  4ECJ A;  5A4U A;  4Q5N A;  2NDO A;  2CZ3 A;  2AHE A;  5IOX A;  2DJJ A;  2ALB A;  1EWX A;  3HJM A;  6GSU A;  5D73 A;  2XPD A;  3WT2 A;  5HFG A;  2HLS A;  1GSD A;  3GUR A;  2X8C A;  1LBK A;  4ZB6 A;  3BJ5 A;  1RK4 A;  2HZF A;  1PX7 A;  4IP1 A;  2MZC A;  4TXO B;  3IC4 A;  2H66 A;  4PQH A;  3PPU A;  3KTB A;  5D9W A;  4HOJ A;  4HZ4 A;  2G0F A;  2LST A;  3KH7 A;  2WJU A;  1QK8 A;  2H73 A;  3SBC A;  1XW6 A;  2GVP A;  20GS A;  3D0Z A;  3BCI A;  4YQU A;  5CRE A;  3J7Y b;  4WXT A;  2YV7 A;  4EVM A;  4O7H A;  1HD2 A;  4LA1 A;  4K9Z A;  4EE0 A;  2GSR A;  4N10 A;  4BWS A;  1T4Z A;  2KUC A;  4USS A;  1EV9 A;  1T8E B;  4K1F A;  2B3S A;  2YWO A;  4XRA A;  2BJX A;  1WP0 A;  1XBS A;  3ZIV A;  1K0D A;  3ZML A;  1A2M A;  4NV5 A;  4PUR A;  1GP1 A;  1GTB A;  1Z6N A;  1K3O A;  2HSY A;  3WGX A;  4EO3 A;  5C04 A;  2DC5 A;  3UBL A;  4IBP A;  3QDN A;  2X64 A;  2LJA A;  5ECS A;  4PGT A;  2TRC P;  1Y25 A;  2F51 A;  2LNT A;  4NV2 A;  2ON7 A;  2Z9S A;  3DML A;  3GNJ A;  1ST9 A;  3VFI A;  2DJ1 A;  2DMM A;  1EEM A;  1TJD A;  4JR6 A;  2FWH A;  2OKA A;  4AJ6 A;  1BX9 A;  2IJY A;  2LRC A;  1GSS A;  2VIM A;  2C0G A;  3M9K A;  2HSH A;  2OE1 A;  4GSN A;  3HD5 A;  4JED A;  2I4A A;  5B6M A;  1GL8 A;  3IK9 A;  3VK9 A;  1IYI A;  3QOU A;  4KDY A;  4V2M A;  3G7J A;  2G2Q A;  1YEX A;  3I9V 2;  2MBT A;  3PR8 A;  4O32 A;  5H5S A;  4L5O A;  2LV3 A;  3FR3 A;  1R7H A;  3VI5 A;  2WS2 A;  2H01 A;  2YCD A;  3I69 A;  5GZZ B;  1A23 A;  1PX6 A;  4GRF A;  2C0E A;  3GHA A;  1RW1 A;  1X9M B;  5IMA A;  3W8J A;  2LQO A;  3MDK A;  3VWX A;  2PBJ A;  4KA0 A;  3TRX A;  3ZTL A;  1AUC A;  4EDY A;  2X8G A;  5EL8 A;  3FZA A;  1SJ6 A;  4ZBD A;  2YWI A;  3LFL A;  3DKS A;  3D6I A;  4WF4 A;  5DAK B;  4WET A;  1EGR A;  3WYW A;  5C00 A;  1G7O A;  2RM5 A;  4TOP A;  2J23 A;  3FHK A;  5B8A A;  4I2U A;  3M3M A;  2DJ2 A;  2CQ9 A;  4YQV A;  3O76 A;  1K0N A;  4MH3 A;  3D22 A;  1GWC A;  2HSN B;  1Z7P A;  2H1A A;  3HDC A;  1F2E A;  1YKA A;  2FUG 2;  2CZ2 A;  1ZMA A;  4WR5 A;  3IOS A;  2H8L A;  3RPN A;  1PMT A;  2L6C A;  4RQX A;  3UIW A;  1O8W A;  2L6D A;  2O85 A;  1N2A A;  1M2D A;  2LUS A;  2L59 A;  2LNS A;  2ZUP A;  1GTU A;  3F4T A;  4CW9 A;  4EKZ A;  1JZD A;  11GS A;  3HZ4 A;  3LXZ A;  3W8S A;  1T1V A;  2C4J A;  2MYG A;  1KNG A;  1OKT A;  2X8H A;  2HE3 A;  4LL1 B;  3IR4 A;  4LMW A;  3FR9 A;  1CQG A;  3EE2 A;  3HY2 A;  2M72 A;  3UJ1 A;  2CVD A;  2KHP A;  2CAI A;  1KEB A;  4IKH A;  4MZW A;  1T00 A;  2JZS A;  4IW9 A;  4MA9 A;  1XOA A;  4MDC A;  1TI1 A;  5A5K A;  1V57 A;  3F4S A;  3C1R A;  5IO2 A;  4YAP A;  1R26 A;  5D9X A;  1M99 A;  2FD3 A;  1EEJ A;  4NPB A;  1G6W A;  1TI3 A;  3UVH A;  5IOW A;  3L9U A;  2HZE A;  3CMI A;  4OCE A;  2VO4 A;  4F03 A;  1MDI A;  5LCZ A;  2XBQ A;  2OE0 A;  4DSR A;  1THX A;  4RUV A;  2GLR A;  1JZO A;  4WBR D;  4L0U A;  4D73 B;  1ERV A;  2FY6 A;  5DJM A;  2LRT A;  2YJ7 A;  2FCH A;  3GYK A;  2O87 A;  3Q18 A;  4KH7 A;  4AGS A;  5ECQ B;  4BVX B;  5IMV A;  3A2W A;  5ID2 B;  5JWQ B;  3GUS A;  1YY7 A;  3E3E A;  4QQ7 A;  2PVO C;  4FQU A;  3R3E A;  4ZBA A;  4MZB A;  2RUF A;  5CRD A;  5AGY A;  3HCZ A;  4NWY A;  1F3B A;  1GUK A;  4HJM A;  3CRU A;  3CSI A;  3TUE A;  3DYR A;  4QL7 A;  2AB6 A;  2VD0 A;  2XPE A;  5IMZ A;  6GSY A;  4V1A g;  1SKR B;  3RBT A;  3HXS A;  1R4W A;  4GTU A;  1XWK A;  1TU7 A;  1EP8 A;  3G9B A;  3VPT A;  2K9F A;  4YH2 A;  1A8L A;  3LOR A;  5G5E A;  4EC0 A;  3HVV A;  3BBY A;  5HFI A;  3UOM A;  5J4U A;  3H93 A;  1K0B A;  4KDX A;  3KP9 A;  2CVK A;  4POB A;  3HA9 A;  1LU4 A;  3BD2 A;  4LMV A;  3KP8 A;  1RQM A;  2PER A;  3EIN A;  3LEF A;  5COH A;  2HI7 A;  3A2X A;  1Y6E A;  5CNW A;  2CAQ A;  2LJR A;  4CDO A;  2GQK A;  3C7M A;  2FWG A;  2ES7 A;  4DVC A;  4G0I A;  3IRA A;  5IMC A;  2AUV A;  3CYN A;  2R4V A;  3ZFB A;  3CSJ A;  14GS A;  2F8A A;  3TJK A;  3IDV A;  3FEU A;  4MMM A;  2VCQ A;  3VUR A;  2GQL A;  4WF5 A;  5DQS A;  3V1W A;  3UBK A;  5ELG A;  3ERW A;  2KP2 A;  4Q5R A;  2B5X A;  3GN3 A;  1ML6 A;  2LS5 A;  2DML A;  2JSY A;  2MMZ A;  3EU4 A;  4L5L A;  2GSQ A;  1VGL A;  1IYH A;  1K3L A;  4X1U A;  2K8S A;  1PKW A;  3QPM A;  2OJL A;  5DCH A;  2B6M A;  2HRF A;  1K0M A;  2AAW A;  3DVW A;  4I6X A;  2H0G A;  5INY A;  4MJE A;  5AIV A;  2IMK A;  2MMN A;  5CYY A;  5HR0 A;  1I5G A;  3GA4 A;  1X9S B;  5JCW A;  3LWA A;  1U3I A;  4IHU A;  1PQN A;  2OBI A;  4IN0 A;  1M9B A;  1FB6 A;  2H70 A;  2B7K A;  4KCE A;  4GWR A;  2HXK A;  4JRR A;  4N0Z A;  4XCS A;  2UZ8 A;  3HZ8 A;  3WGD A;  3TCO A;  2DJK A;  5ECH B;  1SK2 A;  4MCU A;  3U5R E;  1AQV A;  4H86 A;  1SU9 A;  6GSW A;  3KTL A;  4MH2 A;  1MTC A;  2E0Q A;  3KH9 A;  2GT5 A;  1C72 A;  2LKU A;  2EC4 A;  1Z5Y E;  1K0C A;  1GRX A; 
#chains in the Genus database with same CATH topology
 2YJH A;  16GS A;  5ECP B;  2O7K A;  2HRK A;  9GSS A;  3Q74 A;  5CRG A;  2B7J A;  4FIW A;  5HQP A;  3EU3 A;  1O85 A;  1X5D A;  5IMD A;  3BOA A;  3E0U A;  1OYJ A;  2CV4 A;  3M0F A;  4ZL8 A;  1WRY A;  3GMF A;  4L0W A;  4HI7 A;  5B8B A;  4PNF A;  1OC8 A;  5GAP D;  4POM A;  4ML1 A;  1PFO A;  2F8F A;  3PGT A;  5J47 A;  1ERU A;  4PHZ C;  1TK8 B;  2H1L A;  2HYX A;  1OE8 A;  4J56 E;  4Z7X A;  1XPV A;  2IWT A;  5AN1 A;  4ECC A;  1AAZ A;  1FG4 A;  4BWQ A;  2PN8 A;  1XVQ A;  4BVY A;  1XG8 A;  2NPB A;  5HFK A;  2N5A A;  1YF1 A;  5IQY A;  3QFA C;  2B5E A;  2VCT A;  5J9C A;  1VRS D;  4N0V A;  3QCP A;  2GT6 A;  5A5H B;  1VF1 A;  4MJB A;  5D93 A;  1PD2 1;  5ECR B;  2ZCT A;  3EVI A;  5GAN D;  4JZQ A;  10GS A;  1DE2 A;  3LYK A;  1CQH A;  3DRN A;  4LL4 B;  3QAV A;  4X0X A;  2WW1 A;  2YWN A;  1WJK A;  3EPT A;  3ZFL A;  3DWV A;  2VL2 A;  2O5V A;  4KB3 A;  2M46 A;  5HR2 A;  2R0C A;  2X99 A;  2HT9 A;  5B7C A;  2VL3 A;  1A8Y A;  4K2D A;  4KND A;  3ZVJ D;  3LG6 A;  3A2V A;  4G2E A;  4TW5 A;  3EWL A;  4L8E A;  4EUY A;  2H6X A;  1YF0 A;  5DVB A;  3VI7 A;  4MPF A;  2JU5 A;  4OCF A;  1GUM A;  3VLN A;  3MSZ A;  4YQM A;  4TRX A;  4QL9 A;  2VL9 A;  5A4V A;  2VLT A;  2LTK A;  2VLU A;  1SL2 B;  4OFT A;  4I97 A;  3D4M A;  2VAF A;  3FZ4 A;  3P2A A;  3L9S A;  1GSU A;  1HNA A;  2HRA A;  4ACS A;  2V2G A;  2YP6 A;  3VWV A;  4F2I A;  4JR4 A;  2O36 A;  5GSS A;  3MAK A;  3IPZ A;  4RI7 A;  4MJC A;  3AY8 A;  2GST A;  4PTS A;  2YV9 A;  4YAV A;  3I6A A;  4XS1 A;  2C3T A;  2XC2 A;  2EIR A;  4IGJ A;  5F07 A;  1JLW A;  1OKD A;  17GS A;  3GST A;  4F9Z A;  2IME A;  5ECM B;  3KIJ A;  1ZOF A;  4K6X A;  1OC9 A;  2DJ0 A;  4OMV A;  2KOK A;  3ZIJ A;  3DGQ A;  4KSM A;  3RGB C;  3ME7 A;  4JBB A;  6GSS A;  2IMF A;  2N5B A;  3IBH A;  1U6T A;  4ID0 A;  3L9V A;  3KM6 A;  2GQM A;  2DBC A;  3RDW A;  1BJX A;  3GKM A;  2R0P A;  3PH9 A;  1A0R P;  1Q4J A;  3GKN A;  3G7Y A;  4WR4 A;  4X4J A;  4DSS A;  2QGV A;  5BRT A;  1TRW A;  1GLP A;  1WMJ A;  3LJR A;  5G31 A;  1PKZ A;  4AKI A;  2NBS A;  2OAD A;  7GSS A;  4EXJ A;  4EIQ A;  4XTS A;  5IO0 A;  3QAW A;  2FA4 A;  3F6F A;  2LJK A;  3N5O A;  1OC3 A;  2IFQ A;  1MD3 A;  4GQF A;  5DQY A;  5IPG A;  2IN3 A;  5KN0 A;  1TK5 B;  4ZB7 A;  1O73 A;  4MF5 A;  3I43 A;  4HUA A;  2WVZ A;  4WBJ A;  1K0A A;  2VM2 A;  2FGX A;  2H75 A;  4E8H A;  2WFC A;  3R2Q A;  2R37 A;  3APS A;  1NSW A;  4WEY A;  4OWY A;  1A2L A;  2R0G A;  4TKY A;  4ZIJ A;  2H71 A;  2IPA A;  1ZL9 A;  1U3A A;  3M9J A;  2YWM A;  1SKW B;  4YKG A;  4O92 A;  3H8Q A;  4IQ1 A;  3IAM 2;  1WPI A;  1PSQ A;  2C0D A;  1B9X C;  4NHZ A;  5CAX A;  3RHC A;  3QAG A;  4EL1 A;  3WD6 A;  13GS A;  4N30 A;  3DIE A;  4KW6 A;  3EMP A;  2WRT A;  1U87 A;  4V2L A;  2CX3 A;  5DAL A;  1SKS B;  1GUH A;  3NIV A;  4HU7 A;  4HJ2 A;  1ZYE A;  1M2B A;  2HZE B;  3LXT A;  4MK3 A;  2GTU A;  1SL0 B;  4V2N A;  5J41 A;  3D21 A;  3TKR A;  4KAE A;  4FXY P;  2EIO A;  2NTO A;  2C3N A;  2OAC A;  5FHI A;  2OT3 A;  6GST A;  3VWW A;  4ZL9 A;  5IIZ A;  2B5Y A;  2DLX A;  3ZMK A;  2AV4 A;  3E9J B;  1S3D A;  2JL4 A;  3F9U A;  1E2Y A;  1ZYQ B;  1XXU A;  1SK0 A;  4NXI A;  3UAR A;  3ZRE A;  4IS0 A;  3HJP A;  2RM6 A;  4K0G A;  2JSZ A;  3ZRD A;  1E6B A;  5KEJ A;  1VF3 A;  4ML6 A;  5E59 A;  4ZIL A;  4K7I A;  1TDI A;  1R5P A;  3APO A;  4HZ2 A;  3DVX A;  2JZR A;  5B6N A;  1MD4 A;  5G30 A;  4BA7 A;  3EC3 A;  1QMV A;  2O3E A;  1O7U A;  1EGO A;  4G19 A;  2M80 A;  3M1G A;  1AQX A;  2VCZ A;  1UN2 A;  2GS3 A;  5A4W A;  4IVF A;  1V9W A;  1EV4 A;  1ZZY A;  2A4V A;  4JE1 A;  3MYD A;  1ERT A;  2FWE A;  4JU5 A;  4G10 A;  1I9D A;  5DDL A;  2YZU A;  4ZB9 A;  2DSA A;  2YAN A;  1AW9 A;  1PL2 A;  4BVX A;  5CRH A;  2VL2 C;  2ZNM A;  4O5U A;  3TKP A;  1FVJ A;  4YKF A;  3MWH A;  4IJI A;  2KLX A;  1YQ1 A;  2L57 A;  2C0F A;  5CRW A;  5ABR A;  1TP9 A;  1XWG A;  3KJY A;  3RAZ A;  2YOI A;  5D8I A;  3D4T A;  4TR1 A;  2V6O A;  3APQ A;  3HVS A;  1J08 A;  5EY6 A;  4ECI A;  4AF2 A;  3A5W A;  4Q5Q A;  1XWC A;  5KN3 A;  4MJA A;  2P0G A;  1B48 A;  1DSB A;  2A2P A;  1TKD B;  8GSS A;  2F3M A;  4OD7 A;  2WUL A;  18GS A;  2L4Q A;  5DCG A;  1XW9 A;  2H30 A;  2A2R A;  1GLQ A;  1JFU A;  3O3T A;  2H1G A;  4O5Q A;  4RQR A;  1O6J A;  1DBY A;  3D5J A;  1FW1 A;  3QFB C;  3FRC A;  1ON4 A;  1DUG A;  3QR6 A;  1PGT A;  1OAZ A;  4POK A;  3GH9 A;  4N11 A;  4KF9 A;  1TRV A;  2P5R A;  1GH2 A;  1ERW A;  3C71 A;  3IC8 A;  5A34 A;  4K7N A;  3IHG A;  1QXH A;  2OBK A;  4BL7 A;  1GNW A;  4W66 A;  3UMA A;  2K18 A;  2F9S A;  3P8W A;  2ON5 A;  2GZZ A;  1NM3 A;  1S4B P;  2YNX A;  4PQ1 A;  2WGR A;  1T7P B;  4PXO A;  2VLV A;  1Q98 A;  2HRK B;  4G0L A;  3JCM L;  2WB9 A;  3FY7 A;  1SD9 A;  3GL3 A;  1A0F A;  3GTU A;  3FKF A;  2PGT A;  4GCI A;  2P31 A;  4OO5 A;  1Z9H A;  1AC1 A;  1G7E A;  1DE1 A;  4XS4 B;  4OO4 A;  1NW2 A;  2WVY A;  3QD9 A;  2FNO A;  1U88 A;  3TKQ A;  1O81 A;  3CSH A;  1BG1 A;  1X5C A;  3GIX A;  2RII A;  1GUL A;  1M7T A;  5KN1 A;  2RLI A;  3TJJ A;  1YVL A;  3J7Y k;  1XIY A;  3F4R A;  4KX4 A;  3L78 A;  2HSM A;  3ZIT A;  2CA8 A;  2IMI A;  4IP6 A;  5H5R A;  4KSO A;  1PRX A;  3FZ9 A;  5IMF A;  2CT6 A;  3C73 A;  3FZ5 A;  4MZC A;  3DD3 A;  2HNL A;  2JZT A;  2A4H A;  4BVY B;  3W6G A;  3LQ7 A;  2V32 A;  1AQW A;  1THO A;  1EOH A;  4RI6 A;  3TB2 A;  1KBN A;  2HQT A;  2QSI A;  4K5R A;  4AKX B;  5ECK B;  1JHB A;  5L71 A;  4HQZ A;  1BG5 A;  1FOH A;  5JCU A;  3GKK A;  4N3Z A;  3GKX A;  5DJL A;  4IEL A;  2PUK C;  1MEK A;  3MNG A;  1TXX A;  3ZL5 A;  1GTI A;  2PPT A;  2YPM A;  4XS6 A;  3KMO A;  3TJF A;  3FR6 A;  2YZH A;  4X43 A;  1SVL A;  1UVZ A;  3TKS C;  4K7O A;  1HNC A;  2E7P A;  1GNE A;  1PL1 A;  3ME8 A;  5J5N A;  2GDR A;  1M2A A;  5HR3 A;  1Z6M A;  1MDK A;  2NVL A;  5GST A;  4ISD A;  3KCM A;  1X0R A;  2X4A A;  4TR3 A;  4PUF C;  1XVW A;  3Q6O A;  3GSS A;  3GL5 A;  2H6Y A;  1N25 A;  4OFM A;  5KOW A;  5CP1 A;  3HVX A;  4TXV A;  2XHF A;  1AXD A;  4TXO A;  2DKH A;  2VCW A;  4GLT A;  4MAB A;  4KGI A;  2C8U A;  1EP7 A;  4ILF A;  3F8U A;  1YZX A;  5JWO B;  12GS A;  4J2F A;  2WVX A;  5D96 A;  3KEB A;  3A3T A;  4XRD A;  3RHB A;  3DEX A;  5ECL B;  3ERG A;  2YN1 A;  3ZVJ A;  1YJ6 A;  1XOB A;  3GV1 A;  4J57 E;  2VKZ G;  2V6K A;  2B1L A;  2V41 A;  3IV4 A;  2E2G A;  2AJQ B;  1XCC A;  3EUR A;  3HYP A;  2L4C A;  1PA3 A;  4HQS A;  5ECN B;  2VM1 A;  1OC9 B;  2A2S A;  1WIK A;  3ERF A;  1NHY A;  4G0K A;  2N5F A;  1BYE A;  1XFL A;  4GXZ A;  1W4V A;  4IQA A;  5EPF A;  2DIY A;  4K8M A;  4HEA 2;  3TRQ A;  2OE3 A;  2GZY A;  4IJ3 A;  4DSQ A;  3VWU A;  19GS A;  1TK0 B;  5JCG A;  3P7X A;  1BAY A;  3CRT A;  3KXO A;  2VCX A;  1SYR A;  4DSS B;  1SVO A;  2PMT A;  5F0G A;  1BQ7 A;  3MIX A;  2I9H A;  4F0B A;  1X5E A;  3GH6 A;  2R2J A;  2LEG A;  3ZZX A;  3TRP A;  4E68 A;  1Z3E A;  4MP4 A;  5EVO A;  3GRX A;  1QQ2 A;  5CO3 A;  1EZK A;  2IFQ B;  3HJO A;  1GSF A;  1X9W B;  1FO5 A;  5D9V A;  4EF0 A;  2H72 A;  1ABA A;  1USB A;  1S3A A;  2LQQ A;  2VOC A;  1UA5 A;  4F0C A;  4WKW A;  5ENU A;  4NMU A;  5J9B A;  3IE3 A;  1TTZ A;  1V40 A;  4ZXG A;  1SEN A;  1FHE A;  5AIS A;  2K8V A;  5G2Z A;  5BMU A;  1M3I A;  5HR1 A;  4DEJ A;  4FH8 A;  3US3 A;  3KMN A;  2B1K A;  1V98 A;  2MMO A;  2WCI A;  4LLR A;  1G6Y A;  2C1Y A;  2P5Q A;  3WGE A;  5F8B A;  3TJB A;  2JAC A;  5IM9 A;  1OE7 A;  4CY6 A;  4MF6 A;  4PX1 A;  6GSV A;  1SK1 A;  5F06 A;  2AYT A;  5DAK A;  3UAP A;  3IK7 A;  3FK8 A;  1H75 A;  2QKE A;  2IMD A;  5G5F A;  4AKH A;  1VF4 A;  4PI2 C;  5DAL B;  2HFD A;  1S3R A;  2H76 A;  6GSX A;  2WZS A;  2R5G A;  3GX8 A;  2PVQ A;  3CXG A;  1UC7 A;  3IA1 A;  1J9B A;  2C3Q A;  2HSN A;  2E2M A;  3LW9 A;  3TKS A;  1N8J A;  3ED3 A;  2L5L A;  3TKS E;  1Z7R A;  5H5Q A;  3IAS 2;  1SD8 A;  2H1D A;  1HNB A;  3LSZ A;  1B8X A;  3L0H A;  2RUE A;  1HQO A;  4OFN A;  3LGC A;  4TR4 A;  1TU8 A;  3FMW A;  1WOU A;  4I5Q A;  1TW9 A;  3C1S A;  3NZN A;  2EIQ A;  2REM A;  22GS A;  3UVT A;  3CBU A;  4KE3 A;  1TXU A;  3TJG A;  3RFR C;  1F3A A;  4GQC A;  4ZBB A;  5A1N A;  1KTE A;  2KP1 A;  3RPP A;  5ELA A;  2VD1 A;  1ZYP A;  2WZ9 A;  5J40 A;  4NHW A;  4NAX A;  3TOU A;  2WW3 A;  3FW2 A;  3PIN A;  1XWA A;  4HU9 A;  4HDE A;  1F6M C;  3EYT A;  5ECO B;  2H1B A;  3NOF A;  1JZW A;  2PWJ A;  4MF7 A;  2VUP A;  4TR0 A;  2V1M A;  4ULX A;  2H19 A;  1SJZ A;  3UEM A;  4HSC X;  4ZB8 A;  4PNG A;  4POL A;  3N9J A;  1TRS A;  2H0I A;  5AIX A;  4D73 A;  3KZQ A;  4G01 A;  3TDG A;  2VCV A;  2OA7 A;  4TR1 B;  3ZYW A;  1GSQ A;  5FT3 A;  1FB0 A;  1YDK A;  5ID2 A;  1XZO A;  4XIH A;  2FLS A;  1LJR A;  3F63 A;  3WT1 A;  1FAA A;  3HVN A;  3L4N A;  1R5A A;  3QMX A;  5LD0 A;  1T4Y A;  3IXR A;  2D2Z A;  4V1A p;  4P3Y B;  3H1N A;  2C80 A;  2GGT A;  3F0I A;  5LNK e;  5ECI B;  2GZP A;  4TVE A;  4F82 A;  4PI0 C;  3S9F A;  3ISO A;  4KDU A;  3TOT A;  1QUW A;  1SYX A;  4A5P A;  3LYP A;  5D9T A;  3CTG A;  3KD0 A;  1O8X A;  2FA8 A;  2I81 A;  3KGK A;  4ZL7 A;  1ZGN A;  2QC7 A;  1QFN A;  3SWL A;  2TRX A;  1V2A A;  2BTO T;  2I3Y A;  1XW5 A;  1J0F A;  3IHQ A;  1GSY A;  1ZCP A;  4ECB A;  1M9A A;  4EDZ A;  1SJI A;  2FWF A;  5A34 B;  5J4V A;  4AJ8 A;  3FYG A;  4K0N A;  1TOF A;  5J3R A;  4AJ7 A;  4KCA A;  4I2T A;  4BL7 B;  3F3R A;  3G7I A;  1K3Y A;  1B4P A;  1F37 A;  2QA1 A;  2H0H A;  5KN2 A;  2PU9 C;  1S3C A;  5E4W A;  1PN9 A;  2WW2 A;  2I1U A;  2IL3 A;  2MBS A;  4I8B A;  1W89 A;  4GST A;  3GX0 A;  2DJ3 A;  1OVN A;  4KUN A;  5JWR B;  1YEP A;  2CX4 A;  1XWB A;  3GTU B;  3H4K A;  1QGV A;  4FO5 A;  2GSS A;  2H74 A;  1M0U A;  1ACV A;  4TN8 A;  2WDU A;  2O89 A;  3U6V A;  3EMX A;  1HYU A;  5IPH A;  3CTF A;  3ZLP A;  1A2J A;  1GTA A;  3H79 A;  4FYB A;  2MMA A;  4E8E A;  1G0T A;  2JAD A;  1FOV A;  1TRU A;  1VF2 A;  2CVB A;  4PQI A;  2K6V A;  2HSM B;  2LRN A;  2O8V B;  4FYU A;  1WE0 A;  2XBI A;  4FYC A;  3HHV A;  5G1K A;  1AIU A;  4XHM A;  1B9Y C;  3HKR A;  3GFK A;  2H6Z A;  3Q19 A;  4G9H A;  2FHE A;  3VPQ A;  3C8E A;  5KOX A;  3BCK A;  1YKC A;  2DIZ A;  5DBQ A;  1A24 A;  4PUA A;  4GSS A;  2J9H A;  4MPG A;  2HRN A;  1URM A;  1JLV A;  1F9M A;  5FWG A;  2L5O A;  3O6T A;  3DXB A;  1H4O A;  4XS4 A;  2IIY A;  4O5R A;  1JZR A;  2TIR A;  1M3J A;  3P90 A;  4MLY A;  4GF0 A;  1WWJ A;  1BED A;  3TGZ A;  3M8N A;  1EOG A;  3F3Q A;  3F6D A;  1ILO A;  1SL1 B;  1FVK A;  1T3B A;  1PN0 A;  1NHO A;  1B4Q A;  1V58 A;  3OR5 A;  4HS1 A;  3UL3 A;  5G1L A;  4BPY A;  1GSE A;  1K0O A;  3K8N A;  1MDJ A;  1Y1U A;  2BMX A;  2R3X A;  5F05 A;  5J4Y A;  4Q5F A;  2R6K A;  4CHS A;  4ECJ A;  5A4U A;  4Q5N A;  2NDO A;  2CZ3 A;  2AHE A;  5IOX A;  2DJJ A;  2ALB A;  1EWX A;  3HJM A;  6GSU A;  5D73 A;  2XPD A;  3WT2 A;  5HFG A;  2HLS A;  1GSD A;  3GUR A;  2QA2 A;  2X8C A;  1LBK A;  4ZB6 A;  3BJ5 A;  1RK4 A;  2HZF A;  1PX7 A;  4IP1 A;  2MZC A;  4TXO B;  3IC4 A;  2H66 A;  4PQH A;  3PPU A;  3KTB A;  5D9W A;  4HOJ A;  4HZ4 A;  5A5H A;  2LST A;  2G0F A;  3KH7 A;  2WJU A;  1QK8 A;  2H73 A;  3SBC A;  4MNN A;  1XW6 A;  2GVP A;  20GS A;  2WVX B;  3D0Z A;  3BCI A;  4YQU A;  5CRE A;  3J7Y b;  4WXT A;  2YV7 A;  4EVM A;  4O7H A;  4ICY A;  1HD2 A;  4LA1 A;  4K9Z A;  4EE0 A;  2GSR A;  4N10 A;  4BWS A;  1T4Z A;  2KUC A;  4USS A;  1EV9 A;  1T8E B;  4K1F A;  2B3S A;  2YWO A;  4XRA A;  2BJX A;  1WP0 A;  4Z2T A;  1XBS A;  3ZIV A;  1K0D A;  2EFC A;  3ZML A;  1A2M A;  4NV5 A;  4PUR A;  1GP1 A;  1GTB A;  3CWG A;  1Z6N A;  1K3O A;  2HSY A;  3WGX A;  4EO3 A;  5C04 A;  2DC5 A;  3UBL A;  4IBP A;  3QDN A;  2X64 A;  2LJA A;  5ECS A;  4PGT A;  1YEW C;  2TRC P;  1Y25 A;  2F51 A;  2LNT A;  4NV2 A;  2ON7 A;  2Z9S A;  3DML A;  3GNJ A;  1ST9 A;  3VFI A;  2DJ1 A;  2DMM A;  1EEM A;  1TJD A;  1SVM A;  4JR6 A;  2FWH A;  2OKA A;  4AJ6 A;  1BX9 A;  2IJY A;  2LRC A;  1GSS A;  2VIM A;  2C0G A;  3M9K A;  2HSH A;  2OE1 A;  4GSN A;  3HD5 A;  4JED A;  2I4A A;  5B6M A;  4EIP A;  1GL8 A;  3IK9 A;  3VK9 A;  1IYI A;  3QOU A;  4KDY A;  4V2M A;  1BF5 A;  3G7J A;  2G2Q A;  1YEX A;  3I9V 2;  2MBT A;  3PR8 A;  4O32 A;  5H5S A;  4L5O A;  2LV3 A;  3FR3 A;  1R7H A;  3VI5 A;  5BMU B;  2WS2 A;  2H01 A;  2YCD A;  3I69 A;  5GZZ B;  1A23 A;  1PX6 A;  4GRF A;  2C0E A;  3GHA A;  1RW1 A;  1X9M B;  5IMA A;  3W8J A;  2LQO A;  3MDK A;  3VWX A;  2PBJ A;  4KA0 A;  4AKG A;  3TRX A;  3ZTL A;  1AUC A;  4EDY A;  2X8G A;  5EL8 A;  3FZA A;  1SJ6 A;  4ZBD A;  2YWI A;  3LFL A;  3DKS A;  3D6I A;  4WF4 A;  5DAK B;  4CY8 A;  4WET A;  1EGR A;  3WYW A;  5C00 A;  1G7O A;  2RM5 A;  4TOP A;  2J23 A;  3FHK A;  5B8A A;  4I2U A;  3M3M A;  2DJ2 A;  2CQ9 A;  4YQV A;  3O76 A;  1K0N A;  4MH3 A;  3D22 A;  1GWC A;  2HSN B;  1Z7P A;  2H1A A;  3HDC A;  1F2E A;  1YKA A;  2FUG 2;  2CZ2 A;  1ZMA A;  4WR5 A;  3IOS A;  2H8L A;  3RPN A;  1PMT A;  2L6C A;  3A5I A;  4RQX A;  3UIW A;  1O8W A;  2L6D A;  2O85 A;  1N2A A;  1M2D A;  2LUS A;  2L59 A;  2LNS A;  2ZUP A;  1GTU A;  3F4T A;  4CW9 A;  4EKZ A;  1JZD A;  11GS A;  3HZ4 A;  3LXZ A;  3W8S A;  1T1V A;  2C4J A;  2MYG A;  1KNG A;  1OKT A;  2X8H A;  2HE3 A;  4LL1 B;  3IR4 A;  4LMW A;  3FR9 A;  1CQG A;  3EE2 A;  3HY2 A;  2M72 A;  3UJ1 A;  4K5S A;  2CVD A;  2KHP A;  2CAI A;  1KEB A;  4IKH A;  4MZW A;  1T00 A;  2JZS A;  4IW9 A;  1ZYN A;  4MA9 A;  5A1N B;  1XOA A;  4MDC A;  1TI1 A;  5A5K A;  1V57 A;  3F4S A;  3C1R A;  5IO2 A;  4YAP A;  1R26 A;  5D9X A;  1M99 A;  2FD3 A;  1EEJ A;  4NPB A;  1G6W A;  1TI3 A;  3UVH A;  5IOW A;  3L9U A;  2HZE A;  3CMI A;  4OCE A;  2VO4 A;  4F03 A;  2UV8 G;  2EFH A;  4GDF A;  1MDI A;  5LCZ A;  2XBQ A;  2OE0 A;  4DSR A;  1THX A;  4RUV A;  2GLR A;  1JZO A;  4WBR D;  4L0U A;  4D73 B;  1ERV A;  2FY6 A;  5DJM A;  2LRT A;  2YJ7 A;  2FCH A;  3GYK A;  2O87 A;  3Q18 A;  4KH7 A;  4AGS A;  3HMJ G;  5ECQ B;  4BVX B;  4QMK A;  5IMV A;  3A2W A;  5ID2 B;  5JWQ B;  3GUS A;  1YY7 A;  3E3E A;  4QQ7 A;  2PVO C;  4FQU A;  3R3E A;  4ZBA A;  4AI6 A;  4MZB A;  2RUF A;  5CRD A;  5AGY A;  3HCZ A;  4NWY A;  1F3B A;  1GUK A;  4HJM A;  3CRU A;  3CSI A;  3TUE A;  3DYR A;  4QL7 A;  2AB6 A;  2VD0 A;  2XPE A;  5IMZ A;  6GSY A;  4V1A g;  1SKR B;  3RBT A;  3HXS A;  1R4W A;  4GTU A;  1XWK A;  1TU7 A;  1EP8 A;  3G9B A;  3VPT A;  2K9F A;  4YH2 A;  1A8L A;  3LOR A;  5G5E A;  4EC0 A;  3HVV A;  3BBY A;  5HFI A;  3UOM A;  5J4U A;  3H93 A;  1K0B A;  4KDX A;  2X49 A;  3KP9 A;  2CVK A;  3CQF A;  4POB A;  3HA9 A;  1LU4 A;  3BD2 A;  4LMV A;  3KP8 A;  1RQM A;  2PER A;  3EIN A;  3LEF A;  4BIK A;  5COH A;  2HI7 A;  3A2X A;  1Y6E A;  5CNW A;  2CAQ A;  2LJR A;  4CDO A;  2GQK A;  3C7M A;  2FWG A;  2ES7 A;  4DVC A;  4G0I A;  3IRA A;  5IMC A;  2EFD A;  2AUV A;  3CYN A;  2R4V A;  3ZFB A;  3CSJ A;  14GS A;  2F8A A;  3TJK A;  3IDV A;  3CHX C;  3FEU A;  4MMM A;  2VCQ A;  3VUR A;  2GQL A;  4WF5 A;  5DQS A;  3V1W A;  3UBK A;  5ELG A;  3ERW A;  2KP2 A;  4Q5R A;  2EFE A;  2B5X A;  3GN3 A;  1ML6 A;  4Z2R A;  2LS5 A;  2DML A;  2JSY A;  2MMZ A;  3EU4 A;  4L5L A;  2GSQ A;  2WW0 A;  1IYH A;  1VGL A;  1K3L A;  4X1U A;  2K8S A;  1PKW A;  3QPM A;  2OJL A;  1I1I P;  5DCH A;  2B6M A;  2HRF A;  1K0M A;  2AAW A;  3DVW A;  4I6X A;  2H0G A;  5INY A;  4MJE A;  5AIV A;  2IMK A;  2MMN A;  5CYY A;  5HR0 A;  1I5G A;  2DKI A;  3GA4 A;  1X9S B;  5JCW A;  3LWA A;  1U3I A;  4IHU A;  1PQN A;  4Z2U A;  2OBI A;  4IN0 A;  1M9B A;  1FB6 A;  2H70 A;  2B7K A;  4KCE A;  4K2X A;  4GWR A;  2HXK A;  4JRR A;  4N0Z A;  3TU3 B;  4XCS A;  2UZ8 A;  3HZ8 A;  3WGD A;  3TCO A;  2DJK A;  5ECH B;  1SK2 A;  4MCU A;  3U5R E;  1AQV A;  4H86 A;  1SU9 A;  6GSW A;  3KTL A;  4MH2 A;  1MTC A;  2E0Q A;  3KH9 A;  2GT5 A;  1C72 A;  2LKU A;  2EC4 A;  1Z5Y E;  1K0C A;  1GRX A; 
#chains in the Genus database with same CATH homology
 2YJH A;  16GS A;  5ECP B;  2O7K A;  2HRK A;  9GSS A;  3Q74 A;  5CRG A;  2B7J A;  4FIW A;  5HQP A;  3EU3 A;  1O85 A;  1X5D A;  5IMD A;  3BOA A;  3E0U A;  1OYJ A;  2CV4 A;  3M0F A;  4ZL8 A;  1WRY A;  3GMF A;  4L0W A;  4HI7 A;  5B8B A;  4PNF A;  1OC8 A;  5GAP D;  4POM A;  4ML1 A;  2F8F A;  3PGT A;  5J47 A;  1ERU A;  1TK8 B;  2H1L A;  2HYX A;  1OE8 A;  4J56 E;  4Z7X A;  1XPV A;  2IWT A;  5AN1 A;  4ECC A;  1AAZ A;  1FG4 A;  4BWQ A;  2PN8 A;  1XVQ A;  4BVY A;  2NPB A;  5HFK A;  2N5A A;  1YF1 A;  5IQY A;  3QFA C;  2B5E A;  2VCT A;  5J9C A;  1VRS D;  4N0V A;  3QCP A;  2GT6 A;  5A5H B;  1VF1 A;  4MJB A;  5D93 A;  1PD2 1;  5ECR B;  2ZCT A;  3EVI A;  5GAN D;  4JZQ A;  10GS A;  1DE2 A;  3LYK A;  1CQH A;  3DRN A;  4LL4 B;  3QAV A;  4X0X A;  2YWN A;  1WJK A;  3EPT A;  3ZFL A;  3DWV A;  2VL2 A;  2O5V A;  4KB3 A;  2M46 A;  5HR2 A;  2R0C A;  2X99 A;  2HT9 A;  5B7C A;  2VL3 A;  1A8Y A;  4K2D A;  4KND A;  3ZVJ D;  3LG6 A;  3A2V A;  4G2E A;  4TW5 A;  3EWL A;  4L8E A;  4EUY A;  2H6X A;  1YF0 A;  5DVB A;  3VI7 A;  4MPF A;  2JU5 A;  4OCF A;  1GUM A;  3VLN A;  3MSZ A;  4YQM A;  4TRX A;  4QL9 A;  2VL9 A;  5A4V A;  2VLT A;  2LTK A;  2VLU A;  1SL2 B;  4OFT A;  4I97 A;  3D4M A;  2VAF A;  3FZ4 A;  3P2A A;  3L9S A;  1GSU A;  1HNA A;  2HRA A;  4ACS A;  2V2G A;  2YP6 A;  3VWV A;  4F2I A;  4JR4 A;  5GSS A;  3MAK A;  3IPZ A;  4RI7 A;  4MJC A;  3AY8 A;  2GST A;  4PTS A;  2YV9 A;  4YAV A;  3I6A A;  4XS1 A;  2C3T A;  2XC2 A;  2EIR A;  4IGJ A;  5F07 A;  1JLW A;  1OKD A;  17GS A;  3GST A;  4F9Z A;  2IME A;  5ECM B;  3KIJ A;  1ZOF A;  4K6X A;  1OC9 A;  2DJ0 A;  4OMV A;  2KOK A;  3ZIJ A;  3DGQ A;  4KSM A;  3ME7 A;  4JBB A;  6GSS A;  2IMF A;  2N5B A;  3IBH A;  1U6T A;  4ID0 A;  3L9V A;  3KM6 A;  2GQM A;  2DBC A;  3RDW A;  1BJX A;  3GKM A;  2R0P A;  3PH9 A;  1A0R P;  1Q4J A;  3GKN A;  3G7Y A;  4WR4 A;  4X4J A;  4DSS A;  2QGV A;  5BRT A;  1TRW A;  1GLP A;  1WMJ A;  3LJR A;  5G31 A;  1PKZ A;  4AKI A;  2NBS A;  2OAD A;  7GSS A;  4EXJ A;  4EIQ A;  4XTS A;  5IO0 A;  3QAW A;  2FA4 A;  3F6F A;  2LJK A;  3N5O A;  1OC3 A;  2IFQ A;  1MD3 A;  4GQF A;  5DQY A;  5IPG A;  2IN3 A;  5KN0 A;  1TK5 B;  4ZB7 A;  1O73 A;  4MF5 A;  3I43 A;  4HUA A;  4WBJ A;  1K0A A;  2VM2 A;  2FGX A;  2H75 A;  4E8H A;  2WFC A;  3R2Q A;  2R37 A;  3APS A;  1NSW A;  4WEY A;  4OWY A;  1A2L A;  2R0G A;  4TKY A;  4ZIJ A;  2H71 A;  2IPA A;  1ZL9 A;  1U3A A;  3M9J A;  2YWM A;  1SKW B;  4YKG A;  4O92 A;  3H8Q A;  4IQ1 A;  3IAM 2;  1WPI A;  1PSQ A;  2C0D A;  1B9X C;  4NHZ A;  5CAX A;  3RHC A;  3QAG A;  4EL1 A;  3WD6 A;  13GS A;  4N30 A;  3DIE A;  4KW6 A;  3EMP A;  2WRT A;  1U87 A;  4V2L A;  2CX3 A;  5DAL A;  1SKS B;  1GUH A;  3NIV A;  4HU7 A;  4HJ2 A;  1ZYE A;  1M2B A;  2HZE B;  3LXT A;  4MK3 A;  2GTU A;  1SL0 B;  4V2N A;  5J41 A;  3D21 A;  3TKR A;  4KAE A;  2EIO A;  2NTO A;  2C3N A;  2OAC A;  5FHI A;  2OT3 A;  6GST A;  3VWW A;  4ZL9 A;  5IIZ A;  2B5Y A;  2DLX A;  3ZMK A;  2AV4 A;  3E9J B;  1S3D A;  2JL4 A;  3F9U A;  1E2Y A;  1ZYQ B;  1XXU A;  1SK0 A;  4NXI A;  3UAR A;  3ZRE A;  4IS0 A;  3HJP A;  2RM6 A;  4K0G A;  2JSZ A;  3ZRD A;  1E6B A;  5KEJ A;  1VF3 A;  4ML6 A;  5E59 A;  4ZIL A;  4K7I A;  1TDI A;  1R5P A;  3APO A;  4HZ2 A;  3DVX A;  2JZR A;  5B6N A;  1MD4 A;  5G30 A;  4BA7 A;  3EC3 A;  1QMV A;  1O7U A;  1EGO A;  4G19 A;  2M80 A;  3M1G A;  1AQX A;  2VCZ A;  1UN2 A;  2GS3 A;  5A4W A;  4IVF A;  1V9W A;  1EV4 A;  1ZZY A;  2A4V A;  4JE1 A;  3MYD A;  1ERT A;  2FWE A;  4JU5 A;  4G10 A;  1I9D A;  5DDL A;  2YZU A;  4ZB9 A;  2DSA A;  2YAN A;  1AW9 A;  1PL2 A;  4BVX A;  5CRH A;  2VL2 C;  2ZNM A;  4O5U A;  3TKP A;  1FVJ A;  4YKF A;  3MWH A;  4IJI A;  2KLX A;  1YQ1 A;  2L57 A;  2C0F A;  5CRW A;  5ABR A;  1TP9 A;  1XWG A;  3KJY A;  3RAZ A;  2YOI A;  5D8I A;  3D4T A;  4TR1 A;  2V6O A;  3APQ A;  3HVS A;  1J08 A;  5EY6 A;  4ECI A;  4AF2 A;  3A5W A;  4Q5Q A;  1XWC A;  5KN3 A;  4MJA A;  2P0G A;  1B48 A;  1DSB A;  2A2P A;  1TKD B;  8GSS A;  2F3M A;  4OD7 A;  2WUL A;  18GS A;  2L4Q A;  5DCG A;  1XW9 A;  2H30 A;  2A2R A;  1GLQ A;  1JFU A;  3O3T A;  2H1G A;  4O5Q A;  4RQR A;  1O6J A;  1DBY A;  3D5J A;  1FW1 A;  3QFB C;  3FRC A;  1ON4 A;  1DUG A;  3QR6 A;  1PGT A;  1OAZ A;  4POK A;  3GH9 A;  4N11 A;  4KF9 A;  1TRV A;  2P5R A;  1GH2 A;  1ERW A;  3C71 A;  3IC8 A;  5A34 A;  4K7N A;  3IHG A;  1QXH A;  2OBK A;  4BL7 A;  1GNW A;  4W66 A;  3UMA A;  2K18 A;  2F9S A;  3P8W A;  2ON5 A;  2GZZ A;  1NM3 A;  2YNX A;  4PQ1 A;  2WGR A;  1T7P B;  4PXO A;  2VLV A;  1Q98 A;  2HRK B;  4G0L A;  3JCM L;  2WB9 A;  3FY7 A;  1SD9 A;  3GL3 A;  1A0F A;  3GTU A;  3FKF A;  2PGT A;  4GCI A;  2P31 A;  4OO5 A;  1Z9H A;  1AC1 A;  1G7E A;  1DE1 A;  4XS4 B;  4OO4 A;  1NW2 A;  3QD9 A;  2FNO A;  1U88 A;  3TKQ A;  1O81 A;  3CSH A;  1BG1 A;  1X5C A;  3GIX A;  2RII A;  1GUL A;  1M7T A;  5KN1 A;  2RLI A;  3TJJ A;  1YVL A;  3J7Y k;  1XIY A;  3F4R A;  4KX4 A;  3L78 A;  2HSM A;  3ZIT A;  2CA8 A;  2IMI A;  4IP6 A;  5H5R A;  4KSO A;  1PRX A;  3FZ9 A;  5IMF A;  2CT6 A;  3C73 A;  3FZ5 A;  4MZC A;  3DD3 A;  2HNL A;  2JZT A;  2A4H A;  4BVY B;  3W6G A;  3LQ7 A;  2V32 A;  1AQW A;  1THO A;  1EOH A;  4RI6 A;  3TB2 A;  1KBN A;  2HQT A;  2QSI A;  4K5R A;  4AKX B;  5ECK B;  1JHB A;  5L71 A;  4HQZ A;  1BG5 A;  1FOH A;  5JCU A;  3GKK A;  4N3Z A;  3GKX A;  5DJL A;  4IEL A;  2PUK C;  1MEK A;  3MNG A;  1TXX A;  3ZL5 A;  1GTI A;  2PPT A;  2YPM A;  4XS6 A;  3KMO A;  3TJF A;  3FR6 A;  2YZH A;  4X43 A;  1SVL A;  1UVZ A;  3TKS C;  4K7O A;  1HNC A;  2E7P A;  1GNE A;  1PL1 A;  3ME8 A;  5J5N A;  2GDR A;  1M2A A;  5HR3 A;  1Z6M A;  1MDK A;  2NVL A;  5GST A;  4ISD A;  3KCM A;  1X0R A;  2X4A A;  4TR3 A;  4PUF C;  1XVW A;  3Q6O A;  3GSS A;  3GL5 A;  2H6Y A;  1N25 A;  4OFM A;  5KOW A;  5CP1 A;  3HVX A;  4TXV A;  2XHF A;  1AXD A;  4TXO A;  2DKH A;  2VCW A;  4GLT A;  4MAB A;  4KGI A;  2C8U A;  1EP7 A;  4ILF A;  3F8U A;  1YZX A;  5JWO B;  12GS A;  4J2F A;  5D96 A;  3KEB A;  3A3T A;  4XRD A;  3RHB A;  3DEX A;  5ECL B;  3ERG A;  2YN1 A;  3ZVJ A;  1YJ6 A;  1XOB A;  3GV1 A;  4J57 E;  2VKZ G;  2V6K A;  2B1L A;  2V41 A;  3IV4 A;  2E2G A;  2AJQ B;  1XCC A;  3EUR A;  3HYP A;  2L4C A;  1PA3 A;  4HQS A;  5ECN B;  2VM1 A;  1OC9 B;  2A2S A;  1WIK A;  3ERF A;  1NHY A;  4G0K A;  2N5F A;  1BYE A;  1XFL A;  4GXZ A;  1W4V A;  4IQA A;  5EPF A;  2DIY A;  4K8M A;  4HEA 2;  3TRQ A;  2OE3 A;  2GZY A;  4IJ3 A;  4DSQ A;  3VWU A;  19GS A;  1TK0 B;  5JCG A;  3P7X A;  1BAY A;  3CRT A;  3KXO A;  2VCX A;  1SYR A;  4DSS B;  1SVO A;  2PMT A;  5F0G A;  1BQ7 A;  3MIX A;  2I9H A;  4F0B A;  1X5E A;  3GH6 A;  2R2J A;  2LEG A;  3ZZX A;  3TRP A;  4E68 A;  1Z3E A;  4MP4 A;  5EVO A;  3GRX A;  1QQ2 A;  5CO3 A;  1EZK A;  2IFQ B;  3HJO A;  1GSF A;  1X9W B;  1FO5 A;  5D9V A;  4EF0 A;  2H72 A;  1ABA A;  1USB A;  1S3A A;  2LQQ A;  2VOC A;  1UA5 A;  4F0C A;  4WKW A;  5ENU A;  4NMU A;  5J9B A;  3IE3 A;  1TTZ A;  1V40 A;  4ZXG A;  1SEN A;  1FHE A;  5AIS A;  2K8V A;  5G2Z A;  5BMU A;  5HR1 A;  4DEJ A;  4FH8 A;  3US3 A;  3KMN A;  2B1K A;  1V98 A;  2MMO A;  2WCI A;  4LLR A;  1G6Y A;  2C1Y A;  2P5Q A;  3WGE A;  5F8B A;  3TJB A;  2JAC A;  5IM9 A;  1OE7 A;  4CY6 A;  4MF6 A;  4PX1 A;  6GSV A;  1SK1 A;  5F06 A;  2AYT A;  5DAK A;  3UAP A;  3IK7 A;  3FK8 A;  1H75 A;  2QKE A;  2IMD A;  5G5F A;  4AKH A;  1VF4 A;  5DAL B;  2HFD A;  2H76 A;  6GSX A;  2R5G A;  3GX8 A;  2PVQ A;  3CXG A;  1UC7 A;  3IA1 A;  1J9B A;  2C3Q A;  2HSN A;  2E2M A;  3LW9 A;  3TKS A;  1N8J A;  3ED3 A;  2L5L A;  3TKS E;  1Z7R A;  5H5Q A;  3IAS 2;  1SD8 A;  2H1D A;  1HNB A;  3LSZ A;  1B8X A;  3L0H A;  2RUE A;  1HQO A;  4OFN A;  3LGC A;  4TR4 A;  1TU8 A;  3FMW A;  1WOU A;  4I5Q A;  1TW9 A;  3C1S A;  3NZN A;  2EIQ A;  2REM A;  22GS A;  3UVT A;  3CBU A;  4KE3 A;  1TXU A;  3TJG A;  1F3A A;  4GQC A;  4ZBB A;  5A1N A;  1KTE A;  2KP1 A;  3RPP A;  5ELA A;  2VD1 A;  1ZYP A;  2WZ9 A;  5J40 A;  4NHW A;  4NAX A;  3TOU A;  3FW2 A;  3PIN A;  1XWA A;  4HU9 A;  4HDE A;  1F6M C;  3EYT A;  5ECO B;  2H1B A;  3NOF A;  1JZW A;  2PWJ A;  4MF7 A;  2VUP A;  4TR0 A;  2V1M A;  4ULX A;  2H19 A;  1SJZ A;  3UEM A;  4ZB8 A;  4PNG A;  4POL A;  3N9J A;  1TRS A;  2H0I A;  5AIX A;  4D73 A;  3KZQ A;  4G01 A;  3TDG A;  2VCV A;  2OA7 A;  4TR1 B;  3ZYW A;  1GSQ A;  5FT3 A;  1FB0 A;  1YDK A;  5ID2 A;  1XZO A;  4XIH A;  2FLS A;  1LJR A;  3F63 A;  3WT1 A;  1FAA A;  3L4N A;  1R5A A;  3QMX A;  5LD0 A;  1T4Y A;  3IXR A;  2D2Z A;  4V1A p;  4P3Y B;  3H1N A;  2C80 A;  2GGT A;  3F0I A;  5LNK e;  5ECI B;  2GZP A;  4TVE A;  4F82 A;  3S9F A;  3ISO A;  4KDU A;  3TOT A;  1QUW A;  1SYX A;  4A5P A;  3LYP A;  5D9T A;  3CTG A;  3KD0 A;  1O8X A;  2FA8 A;  2I81 A;  3KGK A;  4ZL7 A;  1ZGN A;  2QC7 A;  1QFN A;  3SWL A;  2TRX A;  1V2A A;  2BTO T;  2I3Y A;  1XW5 A;  1J0F A;  3IHQ A;  1GSY A;  1ZCP A;  4ECB A;  1M9A A;  4EDZ A;  1SJI A;  2FWF A;  5A34 B;  5J4V A;  4AJ8 A;  3FYG A;  4K0N A;  1TOF A;  5J3R A;  4AJ7 A;  4KCA A;  4I2T A;  4BL7 B;  3F3R A;  3G7I A;  1K3Y A;  1B4P A;  1F37 A;  2QA1 A;  2H0H A;  5KN2 A;  2PU9 C;  1S3C A;  5E4W A;  1PN9 A;  2I1U A;  2IL3 A;  2MBS A;  4I8B A;  1W89 A;  4GST A;  3GX0 A;  2DJ3 A;  1OVN A;  4KUN A;  5JWR B;  1YEP A;  2CX4 A;  1XWB A;  3GTU B;  3H4K A;  1QGV A;  4FO5 A;  2GSS A;  2H74 A;  1M0U A;  1ACV A;  4TN8 A;  2WDU A;  2O89 A;  3U6V A;  3EMX A;  1HYU A;  5IPH A;  3CTF A;  3ZLP A;  1A2J A;  1GTA A;  3H79 A;  4FYB A;  2MMA A;  4E8E A;  1G0T A;  2JAD A;  1FOV A;  1TRU A;  1VF2 A;  2CVB A;  4PQI A;  2K6V A;  2HSM B;  2LRN A;  2O8V B;  4FYU A;  1WE0 A;  2XBI A;  4FYC A;  3HHV A;  5G1K A;  1AIU A;  4XHM A;  1B9Y C;  3HKR A;  3GFK A;  2H6Z A;  3Q19 A;  4G9H A;  2FHE A;  3VPQ A;  3C8E A;  5KOX A;  3BCK A;  1YKC A;  2DIZ A;  5DBQ A;  1A24 A;  4PUA A;  4GSS A;  2J9H A;  4MPG A;  2HRN A;  1URM A;  1JLV A;  1F9M A;  5FWG A;  2L5O A;  3O6T A;  3DXB A;  1H4O A;  4XS4 A;  2IIY A;  4O5R A;  1JZR A;  2TIR A;  3P90 A;  4MLY A;  4GF0 A;  1WWJ A;  1BED A;  3TGZ A;  3M8N A;  1EOG A;  3F3Q A;  3F6D A;  1ILO A;  1SL1 B;  1FVK A;  1T3B A;  1PN0 A;  1NHO A;  1B4Q A;  1V58 A;  3OR5 A;  4HS1 A;  3UL3 A;  5G1L A;  4BPY A;  1GSE A;  1K0O A;  3K8N A;  1MDJ A;  1Y1U A;  2BMX A;  2R3X A;  5F05 A;  5J4Y A;  4Q5F A;  2R6K A;  4CHS A;  4ECJ A;  5A4U A;  4Q5N A;  2NDO A;  2CZ3 A;  2AHE A;  5IOX A;  2DJJ A;  2ALB A;  1EWX A;  3HJM A;  6GSU A;  5D73 A;  2XPD A;  3WT2 A;  5HFG A;  2HLS A;  1GSD A;  3GUR A;  2QA2 A;  2X8C A;  1LBK A;  4ZB6 A;  3BJ5 A;  1RK4 A;  2HZF A;  1PX7 A;  4IP1 A;  2MZC A;  4TXO B;  3IC4 A;  2H66 A;  4PQH A;  3PPU A;  3KTB A;  5D9W A;  4HOJ A;  4HZ4 A;  5A5H A;  2LST A;  2G0F A;  3KH7 A;  2WJU A;  1QK8 A;  2H73 A;  3SBC A;  4MNN A;  1XW6 A;  2GVP A;  20GS A;  3D0Z A;  3BCI A;  4YQU A;  5CRE A;  3J7Y b;  4WXT A;  2YV7 A;  4EVM A;  4O7H A;  4ICY A;  1HD2 A;  4LA1 A;  4K9Z A;  4EE0 A;  2GSR A;  4N10 A;  4BWS A;  1T4Z A;  2KUC A;  4USS A;  1EV9 A;  1T8E B;  4K1F A;  2B3S A;  2YWO A;  4XRA A;  2BJX A;  1WP0 A;  4Z2T A;  1XBS A;  3ZIV A;  1K0D A;  2EFC A;  3ZML A;  1A2M A;  4NV5 A;  4PUR A;  1GP1 A;  1GTB A;  3CWG A;  1Z6N A;  1K3O A;  2HSY A;  3WGX A;  4EO3 A;  5C04 A;  2DC5 A;  3UBL A;  4IBP A;  3QDN A;  2X64 A;  2LJA A;  5ECS A;  4PGT A;  2TRC P;  1Y25 A;  2F51 A;  2LNT A;  4NV2 A;  2ON7 A;  2Z9S A;  3DML A;  3GNJ A;  1ST9 A;  3VFI A;  2DJ1 A;  2DMM A;  1EEM A;  1TJD A;  1SVM A;  4JR6 A;  2FWH A;  2OKA A;  4AJ6 A;  1BX9 A;  2IJY A;  2LRC A;  1GSS A;  2VIM A;  2C0G A;  3M9K A;  2HSH A;  2OE1 A;  4GSN A;  3HD5 A;  4JED A;  2I4A A;  5B6M A;  4EIP A;  1GL8 A;  3IK9 A;  3VK9 A;  1IYI A;  3QOU A;  4KDY A;  4V2M A;  1BF5 A;  3G7J A;  2G2Q A;  1YEX A;  3I9V 2;  2MBT A;  3PR8 A;  4O32 A;  5H5S A;  4L5O A;  2LV3 A;  3FR3 A;  1R7H A;  3VI5 A;  5BMU B;  2WS2 A;  2H01 A;  2YCD A;  3I69 A;  5GZZ B;  1A23 A;  1PX6 A;  4GRF A;  2C0E A;  3GHA A;  1RW1 A;  1X9M B;  5IMA A;  3W8J A;  2LQO A;  3MDK A;  3VWX A;  2PBJ A;  4KA0 A;  4AKG A;  3TRX A;  3ZTL A;  1AUC A;  4EDY A;  2X8G A;  5EL8 A;  3FZA A;  1SJ6 A;  4ZBD A;  2YWI A;  3LFL A;  3DKS A;  3D6I A;  4WF4 A;  5DAK B;  4CY8 A;  4WET A;  1EGR A;  3WYW A;  5C00 A;  1G7O A;  2RM5 A;  4TOP A;  2J23 A;  3FHK A;  5B8A A;  4I2U A;  3M3M A;  2DJ2 A;  2CQ9 A;  4YQV A;  3O76 A;  1K0N A;  4MH3 A;  3D22 A;  1GWC A;  2HSN B;  1Z7P A;  2H1A A;  3HDC A;  1F2E A;  1YKA A;  2FUG 2;  2CZ2 A;  1ZMA A;  4WR5 A;  3IOS A;  2H8L A;  3RPN A;  1PMT A;  2L6C A;  3A5I A;  4RQX A;  3UIW A;  1O8W A;  2L6D A;  2O85 A;  1N2A A;  1M2D A;  2LUS A;  2L59 A;  2LNS A;  2ZUP A;  1GTU A;  3F4T A;  4CW9 A;  4EKZ A;  1JZD A;  11GS A;  3HZ4 A;  3LXZ A;  3W8S A;  1T1V A;  2C4J A;  2MYG A;  1KNG A;  1OKT A;  2X8H A;  2HE3 A;  4LL1 B;  3IR4 A;  4LMW A;  3FR9 A;  1CQG A;  3EE2 A;  3HY2 A;  2M72 A;  3UJ1 A;  4K5S A;  2CVD A;  2KHP A;  2CAI A;  1KEB A;  4IKH A;  4MZW A;  1T00 A;  2JZS A;  4IW9 A;  1ZYN A;  4MA9 A;  5A1N B;  1XOA A;  4MDC A;  1TI1 A;  5A5K A;  1V57 A;  3F4S A;  3C1R A;  5IO2 A;  4YAP A;  1R26 A;  5D9X A;  1M99 A;  2FD3 A;  1EEJ A;  4NPB A;  1G6W A;  1TI3 A;  3UVH A;  5IOW A;  3L9U A;  2HZE A;  3CMI A;  4OCE A;  2VO4 A;  4F03 A;  2UV8 G;  2EFH A;  4GDF A;  1MDI A;  5LCZ A;  2XBQ A;  2OE0 A;  4DSR A;  1THX A;  4RUV A;  2GLR A;  1JZO A;  4WBR D;  4L0U A;  4D73 B;  1ERV A;  2FY6 A;  5DJM A;  2LRT A;  2YJ7 A;  2FCH A;  3GYK A;  2O87 A;  3Q18 A;  4KH7 A;  4AGS A;  3HMJ G;  5ECQ B;  4BVX B;  4QMK A;  5IMV A;  3A2W A;  5ID2 B;  5JWQ B;  3GUS A;  1YY7 A;  3E3E A;  4QQ7 A;  2PVO C;  4FQU A;  3R3E A;  4ZBA A;  4AI6 A;  4MZB A;  2RUF A;  5CRD A;  5AGY A;  3HCZ A;  4NWY A;  1F3B A;  1GUK A;  4HJM A;  3CRU A;  3CSI A;  3TUE A;  3DYR A;  4QL7 A;  2AB6 A;  2VD0 A;  2XPE A;  5IMZ A;  6GSY A;  4V1A g;  1SKR B;  3RBT A;  3HXS A;  1R4W A;  4GTU A;  1XWK A;  1TU7 A;  1EP8 A;  3G9B A;  3VPT A;  2K9F A;  4YH2 A;  1A8L A;  3LOR A;  5G5E A;  4EC0 A;  3HVV A;  3BBY A;  5HFI A;  3UOM A;  5J4U A;  3H93 A;  1K0B A;  4KDX A;  2X49 A;  3KP9 A;  2CVK A;  4POB A;  3HA9 A;  1LU4 A;  3BD2 A;  4LMV A;  3KP8 A;  1RQM A;  2PER A;  3EIN A;  3LEF A;  5COH A;  2HI7 A;  3A2X A;  1Y6E A;  5CNW A;  2CAQ A;  2LJR A;  4CDO A;  2GQK A;  3C7M A;  2FWG A;  2ES7 A;  4DVC A;  4G0I A;  3IRA A;  5IMC A;  2EFD A;  2AUV A;  3CYN A;  2R4V A;  3ZFB A;  3CSJ A;  14GS A;  2F8A A;  3TJK A;  3IDV A;  3FEU A;  4MMM A;  2VCQ A;  3VUR A;  2GQL A;  4WF5 A;  5DQS A;  3V1W A;  3UBK A;  5ELG A;  3ERW A;  2KP2 A;  4Q5R A;  2EFE A;  2B5X A;  3GN3 A;  1ML6 A;  4Z2R A;  2LS5 A;  2DML A;  2JSY A;  2MMZ A;  3EU4 A;  4L5L A;  2GSQ A;  1VGL A;  1IYH A;  1K3L A;  4X1U A;  2K8S A;  1PKW A;  3QPM A;  2OJL A;  5DCH A;  2B6M A;  2HRF A;  1K0M A;  2AAW A;  3DVW A;  4I6X A;  2H0G A;  5INY A;  4MJE A;  5AIV A;  2IMK A;  2MMN A;  5CYY A;  5HR0 A;  1I5G A;  2DKI A;  3GA4 A;  1X9S B;  5JCW A;  3LWA A;  1U3I A;  4IHU A;  1PQN A;  4Z2U A;  2OBI A;  4IN0 A;  1M9B A;  1FB6 A;  2H70 A;  2B7K A;  4KCE A;  4K2X A;  4GWR A;  2HXK A;  4JRR A;  4N0Z A;  3TU3 B;  4XCS A;  2UZ8 A;  3HZ8 A;  3WGD A;  3TCO A;  2DJK A;  5ECH B;  1SK2 A;  4MCU A;  3U5R E;  1AQV A;  4H86 A;  1SU9 A;  6GSW A;  3KTL A;  4MH2 A;  1MTC A;  2E0Q A;  3KH9 A;  2GT5 A;  1C72 A;  2LKU A;  2EC4 A;  1Z5Y E;  1K0C A;  1GRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...