4DEJA

Crystal structure of glutathione transferase-like protein il0419 (target efi-501089) from idiomarina loihiensis l2tr
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
KRSVMTLYSGKDDLKSHQVRLVLAEKGVGVEITYVTDESTPEDLLQLNPYPEAKPTLVDRELVLYNAQIIMEYLDERFPHPPLMPVYPVARGTSRLMMYRIERDWYSLAEKIQKNDAQARQELKEGILSLAPIFADTPYFMSEEFSLVDCYLAPLLWRLPAYGIDLEGQGAKEIKQYMVRLFERKTFQDSLTEEEKELARNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase related protein
publication title Crystal Structure of Glutathione S-Transferase-Like Protein Il0419 from Idiomarina Loihiensis
rcsb
source organism Idiomarina loihiensis
molecule tags Transferase
total genus 62
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4dejA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4dejA01
4D73B 1XW5A 2MMOA 5CREA 1PD21 1V58A 2YPMA 3ZL5A 19GSA 4ECCA 3HXSA 2VCWA 5G5FA 3ZMKA 1AC1A 1GSDA 2H1BA 4HOJA 3FZAA 3RPNA 3IV4A 2YNXA 4NV5A 1NHOA 3TDGA 4GQFA 2VM1A 3H93A 3ME7A 3A2WA 1TRUA 3HDCA 1SJIA 4X0XA 1OC9B 1TP9A 2H0IA 3FW2A 4KE3A 4NHWA 1YEPA 2H1GA 1V9WA 5AGYA 2DJ3A 3ZVJD 2DJ2A 2EC4A 1PRXA 3E3EA 3FRCA 3TJGA 2LUSA 3VI7A 3VWVA 2X8CA 4YAPA 5DBQA 2RIIA 2K8VA 5ELAA 1X5DA 3HJMA 1XBSA 2PBJA 3MWHA 2ON7A 4NWYA 3JCML 2XC2A 3W8SA 2IMEA 4L8EA 4N0VA 4GLTA 3P8WA 4E8EA 2JU5A 3M9KA 4KH7A 1EOGA 1ZZYA 1OC8A 3LYKA 1QUWA 1JLWA 2O7KA 2E0QA 2O85A 3GA4A 3CMIA 1PA3A 4GXZA 1T4YA 3L4NA 1VF3A 3UIWA 4PUAA 3ERFA 4IGJA 2PVOC 5HR0A 2CT6A 3C8EA 2EIQA 3ZIJA 1XOAA 5DCGA 2V41A 2RM5A 3IOSA 5AIXA 2L6DA 3TJFA 4MZBA 1EGRA 3ZREA 4GQCA 1Z9HA 1O8WA 4TR1A 3WT2A 1ACVA 2KP2A 2N5AA 1XVQA 1V40A 2DMMA 3GKMA 3ERWA 4G19A 5D73A 2GZYA 4POLA 4O7HA 4TR0A 3TJKA 5DALB 2WCIA 3I43A 1HNCA 4HQZA 2RLIA 2DLXA 1JHBA 1I5GA 4NMUA 2H66A 3GURA 2AUVA 4ECJA 2DMLA 4QL7A 2YP6A 4MK3A 1OC3A 3R3EA 5AISA 4EC0A 2ALBA 1FO5A 4OFMA 1T7PB 5F0GA 2O8VB 4HI7A 2E2GA 3ME8A 4TXOA 2EIRA 4ZIJA 1TDIA 1PKZA 1AIUA 2F51A 2CX3A 4K8MA 3H4KA 2HRNA 1CQGA 2QC7A 2J23A 3HHVA 3KH9A 3LYPA 3LFLA 4AJ8A 3GTUB 4LL4B 3VWWA 5ECKB 4K7IA 3PPUA 4ID0A 2L59A 3L9UA 1Z7PA 1Z6NA 3HYPA 5DDLA 5E4WA 2HXKA 4GCIA 1X0RA 3AY8A 4PX1A 3V1WA 2BJXA 2GS3A 5ECRB 2DIZA 5J4UA 1LBKA 4EXJA 3SWLA 2DC5A 3FZ9A 1N2AA 3MNGA 1AXDA 3IA1A 1PKWA 3LWAA 1G7OA 3L9VA 1SKRB 2CAQA 2C4JA 1B9YC 3BCKA 4BWQA 4I97A 4PQHA 1TRWA 2GT5A 2OE0A 2A2SA 4ZXGA 4F82A 2GVPA 1M0UA 1XPVA 4IELA 2MBSA 3J7Yb 1GSYA 3O6TA 3DEXA 4ZL9A 4O92A 2X64A 1EZKA 3IE3A 5DVBA 3EWLA 4GRFA 1FOVA 1XXUA 1ML6A 5H5SA 2HNLA 4OO5A 2A4VA 2VCZA 1KNGA 2ZNMA 4JU5A 5INYA 1FHEA 3UARA 1THXA 2R5GA 2JZSA 3GKKA 2WGRA 3F63A 3CYNA 4NPBA 2Z9SA 3F8UA 2REMA 2GQKA 2DJKA 3WGXA 1GULA 6GSWA 1ERTA 3WT1A 2LQOA 3RPPA 2HSMB 3I9V2 5GAPD 3D4MA 3LXTA 2V1MA 3DYRA 3KXOA 1T8EB 1H4OA 1K3LA 5L71A 5DQSA 3D21A 1BEDA 1MDIA 1OKDA 1R26A 2JZTA 3EU3A 1GRXA 3CSHA 4IP1A 1UA5A 4Q5RA 3TUEA 1WWJA 3J7Yk 4KB3A 5ECQB 1HD2A 3I6AA 5D9XA 4RQXA 1WRYA 1YQ1A 2VM2A 1R4WA 4MH3A 2H30A 4TOPA 3UBKA 3IXRA 1TRVA 5C04A 5J9CA 2IMDA 1A2JA 1HYUA 2JZRA 1SL1B 4DVCA 3UAPA 3APQA 1RW1A 3DWVA 4FO5A 2VCQA 3S9FA 4K0GA 3EE2A 1T1VA 4GF0A 3DXBA 1SD9A 2H73A 4BL7A 2VCVA 4IJ3A 3IDVA 5CO3A 1A0RP 1OE8A 1SJZA 3D22A 1VGLA 4KGIA 1ZYQB 4N30A 1TI3A 3ZMLA 3A5WA 3ZYWA 3Q19A 1OVNA 2YV7A 3MDKA 3FZ4A 5IPHA 2HT9A 1UN2A 2GTUA 1GP1A 1O73A 4HZ4A 2FCHA 4JEDA 4GSNA 2LRTA 3TCOA 4O5RA 1G6WA 2TIRA 3U6VA 1EEMA 1M9AA 3GNJA 3OR5A 5D9WA 1TW9A 4J56E 1GTBA 3LSZA 4JZQA 2VAFA 2ZUPA 2VUPA 2F3MA 4F0BA 1ERVA 4XS6A 1EOHA 3BCIA 3TOTA 3Q18A 1QXHA 1O8XA 4AJ7A 3BOAA 1UC7A 5F05A 3HKRA 2K8SA 5JCWA 2C1YA 2B1LA 1Z7RA 2QSIA 4PGTA 1VF1A 3FZ5A 4ECIA 4X1UA 1M7TA 1URMA 2GSRA 2HRAA 2YCDA 4PTSA 1ERUA 2V32A 3LORA 4DSQA 2WFCA 3NIVA 2IL3A 5IOWA 1GUKA 1K0DA 1ZGNA 2G2QA 3UOMA 2IMIA 4YQVA 4BA7A 1GTAA 2PMTA 3UBLA 1J0FA 1GUHA 3TB2A 11GSA 2YN1A 2CAIA 2MMAA 2HSHA 2HQTA 2UZ8A 3BJ5A 5B8BA 2F8AA 3ZZXA 5C00A 3UVTA 3G7IA 3KEBA 4HU9A 2E7PA 2NBSA 3M1GA 1BJXA 17GSA 3U5RE 2I3YA 4BVYA 4HEA2 3ZITA 4EDYA 4ML6A 3L0HA 1SJ6A 3QD9A 2FGXA 1AQWA 1R5AA 3DMLA 2V6OA 3RHCA 2ES7A 1JZOA 2B5YA 2M80A 3F0IA 2HZEB 4HDEA 2CVDA 1WJKA 1A0FA 1XWAA 5G5EA 4USSA 3P7XA 2PUKC 2B5EA 1WP0A 1U87A 3QAWA 3QPMA 3WYWA 4HQSA 2XPDA 4ZB8A 3IBHA 2GDRA 1YKAA 1SL2B 5DALA 1W4VA 1X9WB 5ENUA 2DIYA 5J3RA 2PVQA 3CTFA 1HNBA 1MD4A 3F4TA 3FR3A 2KHPA 4ILFA 3KP8A 4Z7XA 1WPIA 3G7JA 1B8XA 5D9VA 2CV4A 1TK0B 5ID2B 3D6IA 2YWMA 4KCEA 4XTSA 3TRXA 5ECSA 4WBRD 2C8UA 1YJ6A 1TXXA 4CW9A 5IO0A 4EE0A 4HUAA 4OMVA 1O85A 4MZCA 1DE2A 4DSSB 3APOA 4NV2A 1A2MA 2CVBA 3D0ZA 2KLXA 1T00A 3IC4A 4MA9A 4FIWA 5JCUA 3GTUA 4XS4B 4Q5QA 3M9JA 1AQXA 3P90A 3C71A 3VWXA 1S3CA 2LNSA 1W89A 3HZ8A 1F37A 5G1LA 1EV4A 4JBBA 1B4QA 2B7KA 2E2MA 3CRTA 3C73A 5ECHB 1KBNA 3RDWA 3Q74A 4NXIA 1EV9A 5B6MA 2IN3A 4JR6A 2I81A 2B5XA 5ECLB 2OKAA 4G10A 4XS1A 1DBYA 1AAZA 3M0FA 4ZILA 1TOFA 2OBIA 4MMMA 4L0WA 1TTZA 4RUVA 5ECOB 1B9XC 2X8GA 3HA9A 4Q5FA 3GN3A 4ZBDA 5ECNB 3TKSC 5CNWA 5DQYA 2NDOA 4LMVA 5G30A 1GWCA 2C0DA 5CYYA 2ZCTA 2XBQA 2C3QA 3GH9A 3Q6OA 2CVKA 4F2IA 5A4UA 4LL1B 1YEXA 3E0UA 4IBPA 4BVXB 1ERWA 2YWOA 1GSFA 5JCGA 4EF0A 1TU7A 3IK7A 2MMNA 2P31A 2OACA 1ZYEA 1J08A 3GL5A 1I9DA 1K0MA 1RQMA 3CTGA 1PX7A 4KDXA 2B3SA 2GSSA 2L6CA 1QMVA 6GSSA 4EL1A 3US3A 1SK0A 2NVLA 2MMZA 1NSWA 3EC3A 3ISOA 4LA1A 2HSMA 2V6KA 2JL4A 4MLYA 3F6DA 3O76A 2YJ7A 4KW6A 5KN1A 4G2EA 4ZBBA 2LRCA 3GIXA 2L5OA 3C1SA 4LMWA 3O3TA 3EURA 3QMXA 1U6TA 5KN3A 2VL2C 2GZPA 3FKFA 1BYEA 2AHEA 3I69A 1XW6A 5EPFA 4F9ZA 3NOFA 2VCTA 1XWCA 1TK5B 2PWJA 3GV1A 3W6GA 3IK9A 2FWGA 3ZFBA 2NTOA 1SK2A 1XCCA 3FEUA 1S3AA 1SYRA 2JSYA 3UL3A 16GSA 2N5FA 5HFGA 4YAVA 4IN0A 1Y6EA 2R6KA 3QAVA 1UVZA 2DJJA 2FWEA 2H76A 2M72A 2P5QA 4KSMA 4WKWA 1FB6A 5IMAA 4G9HA 5E59A 1XOBA 3LEFA 3A3TA 1TK8B 1MD3A 3VPQA 5EL8A 2WJUA 5ECIB 1GLQA 5D93A 4PQIA 5A4VA 2G0FA 2LQQA 2OJLA 2VCXA 3FYGA 2PU9C 1RK4A 1WE0A 1K0BA 4K1FA 2H8LA 3TGZA 2MZCA 2VOCA 5BMUA 1QFNA 1K0NA 3KMOA 3F9UA 4WBJA 4ZBAA 9GSSA 1TJDA 1PMTA 1YDKA 3GX8A 2FA8A 3FR9A 3D4TA 4H86A 4X43A 5J9BA 4ZB6A 2KOKA 1XZOA 3GH6A 1M2DA 1Q4JA 2LRNA 6GSYA 1SKSB 3HY2A 4OCEA 4F03A 5B7CA 3F3RA 1JZWA 4PQ1A 4K0NA 1F9MA 2VL3A 4ISDA 4TR4A 3W8JA 4OWYA 4ZL7A 4TXOB 1HQOA 4YQUA 1GSUA 3HCZA 3ZTLA 1FG4A 4I6XA 2HRKB 3GKXA 1X5EA 1ABAA 5B8AA 3RAZA 1FB0A 4POKA 2YWNA 1X5CA 4KDYA 3QOUA 1BAYA 5IMCA 2WDUA 2R2JA 2AYTA 5D9TA 5AIVA 4K9ZA 2BTOT 2XBIA 1F2EA 1LJRA 1O7UA 4KCAA 3QCPA 3GRXA 1GTUA 4LLRA 3GYKA 4DSRA 2C3NA 1M9BA 4OFTA 2VD1A 3IC8A 1OKTA 1DUGA 1EEJA 1G0TA 1M2AA 1QK8A 1Y25A 3GMFA 3KH7A 1XWKA 1SD8A 3GSTA 2GSQA 5H5QA 2H72A 2R3XA 2C0GA 2I4AA 1IYHA 2IIYA 2MYGA 4V2NA 1X9MB 4MF6A 1MDKA 3IAM2 3UMAA 3BD2A 1EP8A 2TRCP 4J57E 4KUNA 1XW9A 2OADA 5ABRA 2DBCA 2IMKA 4IVFA 1TI1A 2HSNB 4PURA 2HZEA 3IRAA 5DAKB 2IFQA 2H71A 4XHMA 2WB9A 4MABA 2HZFA 2JSZA 3QFAC 1ST9A 6GSXA 4D73A 4MH2A 1V2AA 4GWRA 1PGTA 2CQ9A 2IMFA 2AB6A 2ON5A 1YY7A 1V57A 1AW9A 2HRFA 2LJRA 2OBKA 2KUCA 1Z3EA 2PN8A 4MPGA 6GSVA 1PL2A 2H6YA 3VI5A 2H6ZA 2RUEA 1QQ2A 4HJMA 1A8YA 4WF4A 1B48A 3HD5A 1FAAA 1LU4A 1OC9A 3KP9A 3F4SA 5HQPA 3QR6A 5HR2A 5HR1A 3KTLA 1THOA 3QFBC 4WETA 4WF5A 1A24A 2F9SA 4MZWA 3CSIA 4DSSA 5IOXA 5B6NA 2RM6A 1K0CA 2CZ2A 3VFIA 5CRWA 1TRSA 3DVWA 2FHEA 2M46A 2X99A 1M99A 3PR8A 3PINA 4XRAA 1BG5A 5F07A 4TW5A 4E8HA 2GGTA 5CP1A 1GLPA 4ECBA 1FVJA 4I8BA 2FA4A 1O81A 2FD3A 1VRSD 5A4WA 4IKHA 1Z6MA 4KNDA 4V2LA 4RQRA 3IAS2 1C72A 3LXZA 4QQ7A 5CRGA 1GNWA 2WS2A 1GSEA 4I5QA 5G1KA 1NW2A 2OE1A 3ZFLA 3M3MA 5F8BA 3TKRA 4YQMA 3KTBA 3KIJA 8GSSA 5J5NA 2DSAA 5CRHA 1XIYA 1ZOFA 5FHIA 5EY6A 2CA8A 4BVXA 1FW1A 5FWGA 3IR4A 2PGTA 5HFIA 2IPAA 1WMJA 5GSSA 1SYXA 3UJ1A 5IQYA 1PL1A 2C3TA 3BBYA 3DD3A 4MJEA 3CSJA 3DVXA 4ACSA 4N11A 4PUFC 1AUCA 2OA7A 3EMXA 4RI7A 3N5OA 3CBUA 4G0KA 4TRXA 13GSA 3FR6A 5ECMB 1YF0A 1GUMA 1E6BA 4WR5A 3VURA 5IIZA 2JADA 4DEJA 1JZRA 1PX6A 3L9SA 2K6VA 3A2VA 2VD0A 3TKPA 2L5LA 2NPBA 4AF2A 4EKZA 4IQAA 4AJ6A 3HZ4A 1MTCA 4WR4A 4FYCA 4F0CA 4JRRA 3FHKA 1K0AA 2K9FA 1X9SB 2LNTA 4J2FA 2FUG2 3HVVA 2L57A 1GTIA 2GT6A 3H8QA 4MF7A 3QAGA 3D5JA 3G7YA 1T3BA 4POMA 5JWRB 14GSA 3DIEA 4BVYB 2L4QA 4IQ1A 2J9HA 4FYUA 2GZZA 1T4ZA 3ED3A 1TU8A 2H19A 1M2BA 4GSTA 2GQMA 1GSSA 4K7OA 4CHSA 4I2UA 5J41A 12GSA 4MF5A 3TRQA 5IO2A 4KA0A 3MAKA 2GQLA 1GSQA 5HFKA 3KZQA 3TJBA 2VLUA 4ULXA 1JZDA 4G0IA 3M8NA 2PPTA 2FY6A 4NAXA 1K0OA 3P2AA 3R2QA 4MPFA 4OCFA 4OD7A 2X8HA 1VF2A 4MJAA 5DJLA 5GZZB 4EO3A 2O87A 4IS0A 4FYBA 3GKNA 2FWFA 3E9JB 3RHBA 1GH2A 4KX4A 4HJ2A 5DJMA 1O6JA 5G2ZA 3IPZA 3KD0A 5LCZA 5GSTA 3KM6A 2QGVA 3TOUA 3GX0A 1A23A 1WIKA 1NHYA 5KEJA 3G9BA 5LD0A 1EWXA 1XWBA 1JFUA 4TXVA 5IMDA 4K2DA 2YOIA 4WXTA 2HRKA 2YZHA 3C1RA 4O32A 1ZMAA 1E2YA 3VK9A 3TKSA 2VL9A 5ELGA 5D8IA 22GSA 3KJYA 4RI6A 5EVOA 2BMXA 2H74A 4TR3A 5F06A 4AGSA 2H6XA 4L5OA 1IYIA 1YKCA 3UVHA 18GSA 1DSBA 2VLTA 3DGQA 1JLVA 5FT3A 3HJOA 3APSA 3GHAA 5KN2A 1F3BA 3KMNA 4IHUA 3EYTA 2TRXA 4MDCA 2B1KA 2C80A 1NM3A 3MSZA 2PERA 3CRUA 2B7JA 4L5LA 2XHFA 4XRDA 1CQHA 2LKUA 2WULA 4TR1B 3IHQA 7GSSA 5DAKA 3H79A 3A2XA 2YZUA 3PH9A 3TJJA 1PSQA 1H75A 4P3YB 6GSUA 5IMFA 3SBCA 2H70A 2YANA 5ECPB 4PXOA 2VL2A 3LG6A 1U3AA 4FH8A 1KEBA 1MDJA 2I9HA 1ZCPA 2L4CA 3F4RA 3L78A 5D96A 3EU4A 1VF4A 2LS5A 1U3IA 2AJQB 3WD6A 4KDUA 1F3AA 3LGCA 3F6FA 2P0GA 2HYXA 1KTEA 3GFKA 3ZRDA 4KF9A 3EMPA 3PGTA 2QKEA 6GSTA 4IW9A 1XFLA 2R37A 2F8FA 3CXGA 1R7HA 1OAZA 3K8NA 5IPGA 4IP6A 4QL9A 4TKYA 4BWSA 1GL8A 2XPEA 1YF1A 5KN0A 3RBTA 1XWGA 1F6MC 2YJHA 2JACA 1EGOA 4MCUA 1EP7A 2K18A 3GSSA 1HNAA 2LSTA 4MJCA 4I2TA 2RUFA 5IM9A 4V1Ag 10GSA 1SL0B 2LTKA 4JE1A 2O89A 1N8JA 1YZXA 2VO4A 2H0GA 4HS1A 5COHA 2HFDA 4MJBA 2LV3A 3VWUA 5IMZA 2FWHA 5JWQB 4BPYA 3FY7A 4HU7A 5DCHA 3KCMA 2WZ9A 1BQ7A 2HLSA 2OE3A 4WEYA 2CX4A 4EVMA 4KAEA 5IMVA 5A5KA 2HE3A 1G7EA 2H1AA 3TKQA 3KGKA 3HVSA 5G31A 3HJPA 1QGVA 4XIHA 3ERGA 1OYJA 4ZB9A 2LEGA 3UEMA 1TKDB 1K3OA 3GL3A 3LJRA 1PQNA 3TRPA 3TKSE 3VPTA 4KSOA 3ZVJA 1Q98A 3ZIVA 4TVEA 2LJKA 2I1UA 3ZLPA 3EINA 1WOUA 1U88A 2HSYA 1MEKA 4YH2A 5GAND 5HR3A 1Z5YE 2FNOA 4L0UA 2A2RA 4IJIA 5ID2A 2H75A 4ZL8A 4OFNA 1DE1A 4GTUA 4ML1A 4FQUA 3DRNA 1PN9A 4CDOA 4TN8A 2H01A 1BX9A 5CRDA 2YV9A 2GSTA 1A2LA 2H0HA 5LNKe 4G0LA 1ON4A 5AN1A 2AV4A 1G6YA 3WGEA 2KP1A 3QDNA 2CZ3A 2AAWA 1V98A 4XS4A 2MBTA 2FLSA 4K6XA 2WRTA 1B4PA 1SENA 1XVWA 3DKSA 1R5PA 1J9BA 3VLNA 3GUSA 1A8LA 3C7MA 2VLVA 4V2MA 2B6MA 5H5RA 1FVKA 4N10A 5CAXA 1ILOA 1SK1A 2LJAA 3N9JA 2DJ1A 1ZL9A 3HVXA 4EUYA 4POBA 2DJ0A 2V2GA 3WGDA 2HI7A 2D2ZA 2YWIA 4MP4A 2R4VA 2H1DA 1SU9A 2C0FA 2IJYA 2EIOA 20GSA 4V1Ap 4PNGA 1GNEA 1OE7A 4HZ2A 3F3QA 1USBA 4N0ZA 5JWOB 2N5BA 4NHZA 4BL7B 1K3YA 4OO4A 4XCSA 1AQVA 3H1NA 2VIMA 3LQ7A 3NZNA 1SKWB 4K7NA 4PNFA 4Q5NA 4GSSA 2IFQB 3EVIA 2P5RA 4EDZA 2C0EA 2IWTA 2GLRA 4JR4A 1S3DA 3FK8A
chains in the Genus database with same CATH superfamily
4D73B 1XW5A 2MMOA 3CWGA 5CREA 1PD21 1V58A 2YPMA 3ZL5A 19GSA 4ECCA 3HXSA 2VCWA 5G5FA 3ZMKA 1AC1A 1GSDA 2H1BA 4HOJA 3FZAA 3RPNA 3IV4A 2YNXA 4NV5A 1NHOA 3TDGA 4CY6A 4GQFA 2VM1A 3H93A 3ME7A 3A2WA 1TRUA 3HDCA 1SJIA 4X0XA 1OC9B 1TP9A 2H0IA 3FW2A 4KE3A 4NHWA 1YEPA 2H1GA 1V9WA 5AGYA 2DJ3A 3ZVJD 2DJ2A 2EC4A 1PRXA 3E3EA 3FRCA 3IHGA 2LUSA 3TJGA 3VI7A 3VWVA 2X8CA 4YAPA 5DBQA 2RIIA 2K8VA 5ELAA 1X5DA 3HJMA 1XBSA 2PBJA 3MWHA 2ON7A 4NWYA 3JCML 2XC2A 3W8SA 2IMEA 4L8EA 4N0VA 4GLTA 3P8WA 4E8EA 2JU5A 3M9KA 4KH7A 4AKXB 1EOGA 1ZZYA 1OC8A 3LYKA 1QUWA 1JLWA 2O7KA 2E0QA 2O85A 2EFCA 3GA4A 3CMIA 1PA3A 4GXZA 2WVYA 5A34B 1T4YA 3L4NA 1VF3A 3UIWA 4PUAA 3ERFA 4IGJA 2PVOC 5HR0A 2CT6A 3C8EA 2EIQA 3ZIJA 1XOAA 5J4YA 5DCGA 2V41A 2RM5A 3IOSA 5AIXA 2L6DA 3TJFA 4MZBA 1EGRA 3ZREA 2A4HA 4GQCA 1Z9HA 1O8WA 4TR1A 3WT2A 1ACVA 2KP2A 2N5AA 3FMWA 1XVQA 1V40A 2DMMA 3GKMA 3ERWA 4G19A 5D73A 2GZYA 4POLA 4O7HA 4TR0A 3TJKA 5DALB 2WCIA 3I43A 1HNCA 4HQZA 2RLIA 2DLXA 1JHBA 1I5GA 4NMUA 4N3ZA 2H66A 3GURA 2AUVA 4ECJA 2DMLA 4QL7A 2YP6A 4MK3A 1OC3A 3R3EA 5AISA 4EC0A 2ALBA 1FO5A 4OFMA 1T7PB 5F0GA 2O8VB 4HI7A 5KOXA 2E2GA 3ME8A 4TXOA 2EIRA 4ZIJA 3HMJG 1TDIA 1PKZA 1AIUA 2F51A 2CX3A 4K8MA 3H4KA 2HRNA 1YVLA 1CQGA 2QC7A 2J23A 3HHVA 3KH9A 3LYPA 3LFLA 4AJ8A 3GTUB 4E68A 4LL4B 3VWWA 2EFEA 5ECKB 2A2PA 3PPUA 4ID0A 2L59A 4K7IA 3L9UA 1Z7PA 4O5QA 1Z6NA 3HYPA 5DDLA 5E4WA 2HXKA 4GCIA 1X0RA 3AY8A 4PX1A 3RGBC 3V1WA 2BJXA 2GS3A 5ECRB 2DIZA 5J4UA 1LBKA 4EXJA 3SWLA 2DC5A 3FZ9A 1N2AA 3MNGA 1AXDA 3IA1A 1PKWA 3LWAA 1G7OA 3L9VA 1SKRB 2CAQA 2C4JA 1B9YC 3BCKA 4BWQA 4I97A 4PQHA 1TRWA 2GT5A 2OE0A 2A2SA 4ZXGA 4F82A 2GVPA 1M0UA 1XPVA 4IELA 2MBSA 3J7Yb 1GSYA 3O6TA 3DEXA 2HSNA 4ZL9A 4O92A 2X64A 1EZKA 3IE3A 5DVBA 3EWLA 4GRFA 1FOVA 1XXUA 1ML6A 1S3RA 2QA2A 5H5SA 2HNLA 4OO5A 2A4VA 2VCZA 1KNGA 2ZNMA 4JU5A 5INYA 1FHEA 3UARA 1THXA 2R5GA 2JZSA 3GKKA 2WGRA 3F63A 3CYNA 4NPBA 2Z9SA 3F8UA 2REMA 2GQKA 2DJKA 3WGXA 1GULA 6GSWA 5J47A 1ERTA 3WT1A 2LQOA 3RPPA 1FOHA 2HSMB 3I9V2 5GAPD 3D4MA 3LXTA 2V1MA 2WVZA 3DYRA 3KXOA 1T8EB 1H4OA 1K3LA 5L71A 5DQSA 3D21A 1BEDA 1MDIA 1OKDA 1R26A 2JZTA 3EU3A 1GRXA 3CSHA 4IP1A 1UA5A 2VKZG 4Q5RA 3TUEA 1WWJA 3J7Yk 4KB3A 5ECQB 1HD2A 3I6AA 5D9XA 4RQXA 1WRYA 1YQ1A 2VM2A 1R4WA 4MH3A 2H30A 4TOPA 3UBKA 3IXRA 1TRVA 5C04A 5J9CA 2IMDA 1A2JA 1HYUA 2JZRA 3EPTA 1SL1B 4DVCA 3UAPA 3APQA 1RW1A 3DWVA 4FO5A 2VCQA 3S9FA 4K0GA 1M3JA 3EE2A 1T1VA 4GF0A 3DXBA 1SD9A 2H73A 4BL7A 2VCVA 4IJ3A 3IDVA 5CO3A 1A0RP 1OE8A 1SJZA 3D22A 1VGLA 4KGIA 1ZYQB 5BMUB 4N30A 1TI3A 3ZMLA 3A5WA 3ZYWA 3Q19A 1OVNA 2YV7A 3MDKA 3FZ4A 5IPHA 2HT9A 1UN2A 2GTUA 1GP1A 1O73A 4O5UA 4HZ4A 2FCHA 4JEDA 4GSNA 2LRTA 3TCOA 4O5RA 1G6WA 2TIRA 3U6VA 1EEMA 1M9AA 3GNJA 3OR5A 5D9WA 1TW9A 4J56E 1GTBA 3LSZA 4JZQA 2VAFA 2ZUPA 2VUPA 2F3MA 4F0BA 1ERVA 4XS6A 1EOHA 3BCIA 3TOTA 3Q18A 1QXHA 1O8XA 4AJ7A 2O36A 3BOAA 1UC7A 5F05A 3HKRA 2K8SA 5JCWA 4PHZC 2B1LA 2C1YA 1Z7RA 2QSIA 4PGTA 1VF1A 3FZ5A 4ECIA 4X1UA 1M7TA 1URMA 2GSRA 2HRAA 2YCDA 4PTSA 1ERUA 2V32A 3LORA 1S4BP 4DSQA 2WFCA 3NIVA 2IL3A 5IOWA 1GUKA 1K0DA 1ZGNA 2G2QA 3UOMA 2IMIA 4YQVA 4BA7A 1GTAA 2PMTA 3UBLA 1J0FA 1GUHA 3TB2A 11GSA 2YN1A 2CAIA 2MMAA 2HSHA 2HQTA 2UZ8A 3BJ5A 5B8BA 2F8AA 3ZZXA 5C00A 3UVTA 3G7IA 3KEBA 2WVXB 1SVOA 4HU9A 2E7PA 2NBSA 5A34A 3M1GA 1BJXA 17GSA 3U5RE 2I3YA 4BVYA 4HEA2 3ZITA 3CHXC 4EDYA 4ML6A 3L0HA 1SJ6A 3QD9A 2FGXA 1AQWA 1R5AA 3DMLA 2V6OA 3RHCA 3MIXA 2ES7A 1JZOA 2B5YA 4AKIA 2M80A 3F0IA 2HZEB 4HDEA 2CVDA 1WJKA 1A0FA 1XWAA 5G5EA 4USSA 3P7XA 2PUKC 2B5EA 1SVLA 1WP0A 1U87A 3QAWA 3QPMA 3WYWA 4HQSA 2XPDA 4ZB8A 3IBHA 2GDRA 1YKAA 1SL2B 5DALA 1W4VA 1X9WB 5ENUA 2DIYA 5J3RA 2PVQA 3CTFA 1HNBA 1MD4A 3F4TA 2WW0A 3FR3A 2KHPA 4ILFA 3KP8A 4Z7XA 1WPIA 4AKHA 3G7JA 1B8XA 5D9VA 2CV4A 1TK0B 5ID2B 3D6IA 2YWMA 4KCEA 4XTSA 3TRXA 5ECSA 4WBRD 2C8UA 1YJ6A 1TXXA 4CW9A 5A5HB 5IO0A 4EE0A 4HUAA 4OMVA 1O85A 4MZCA 1DE2A 4DSSB 3APOA 4NV2A 1A2MA 2CVBA 3D0ZA 2KLXA 1T00A 3IC4A 4MA9A 4FIWA 5JCUA 3GTUA 4XS4B 4AKGA 4AI6A 4Q5QA 3M9JA 1AQXA 4K5RA 3P90A 3C71A 3VWXA 1S3CA 2LNSA 1W89A 3HZ8A 1F37A 5G1LA 1EV4A 4JBBA 1B4QA 2B7KA 2E2MA 3CRTA 1SVMA 3C73A 5ECHB 1KBNA 3RDWA 3Q74A 4NXIA 1EV9A 5B6MA 2IN3A 4JR6A 2I81A 2B5XA 5ECLB 2OKAA 4G10A 4XS1A 1DBYA 1AAZA 3M0FA 4ZILA 1TOFA 2OBIA 4MMMA 4L0WA 1TTZA 4RUVA 5ECOB 1B9XC 2X8GA 3HA9A 4Q5FA 3GN3A 4ZBDA 5ECNB 3TKSC 5CNWA 5DQYA 2NDOA 4YKGA 4LMVA 5G30A 1GWCA 2C0DA 5CYYA 3LW9A 2ZCTA 2XBQA 2X4AA 2C3QA 3GH9A 3Q6OA 2CVKA 4F2IA 5A4UA 4GDFA 1YEXA 4LL1B 3E0UA 4IBPA 4BVXB 4ZB7A 1ERWA 2YWOA 1GSFA 5JCGA 4EF0A 1TU7A 3IK7A 2MMNA 2P31A 2OACA 1ZYEA 1J08A 3GL5A 1I9DA 1K0MA 1RQMA 3CTGA 1PX7A 4KDXA 2B3SA 2GSSA 2L6CA 1QMVA 6GSSA 4EL1A 3US3A 1SK0A 2NVLA 2MMZA 1NSWA 3EC3A 3ISOA 4LA1A 2HSMA 2V6KA 2JL4A 4MLYA 3F6DA 3O76A 2YJ7A 4KW6A 5KN1A 2X49A 4G2EA 4ZBBA 2LRCA 1N25A 3GIXA 2L5OA 1PN0A 3C1SA 4LMWA 3O3TA 3EURA 3QMXA 1U6TA 5KN3A 2VL2C 2GZPA 3FKFA 1BYEA 2AHEA 3I69A 1XW6A 5EPFA 4F9ZA 3NOFA 2VCTA 1XWCA 1TK5B 2PWJA 4Z2RA 3GV1A 3W6GA 3IK9A 2FWGA 3ZFBA 2NTOA 1SK2A 1XCCA 5KOWA 3FEUA 1S3AA 1SYRA 2JSYA 2O3EA 3UL3A 16GSA 2N5FA 5HFGA 4YAVA 4IN0A 1Y6EA 2R6KA 3QAVA 1UVZA 1YEWC 2DJJA 2FWEA 2H76A 2M72A 2P5QA 4KSMA 4WKWA 1FB6A 5IMAA 4G9HA 5E59A 1XOBA 3LEFA 1M3IA 3A3TA 1TK8B 1MD3A 3VPQA 5EL8A 4A5PA 2WJUA 5ECIB 1GLQA 5D93A 4PQIA 5A4VA 2G0FA 2LQQA 2OJLA 2VCXA 3FYGA 5J40A 2PU9C 1RK4A 1WE0A 1K0BA 4K1FA 4EIQA 2H8LA 3TGZA 2MZCA 2VOCA 5BMUA 1QFNA 1K0NA 3KMOA 3F9UA 4WBJA 2WZSA 4ZBAA 9GSSA 1TJDA 1PMTA 1YDKA 3GX8A 1BG1A 2FA8A 3FR9A 3D4TA 4H86A 4X43A 5J9BA 4ZB6A 2KOKA 1XZOA 3GH6A 1M2DA 1Q4JA 2LRNA 6GSYA 1SKSB 3HY2A 4OCEA 4F03A 5B7CA 3F3RA 1JZWA 2WW3A 4PQ1A 4K0NA 5BRTA 1F9MA 2VL3A 4ISDA 4TR4A 3W8JA 4OWYA 4ZL7A 4TXOB 1HQOA 4YQUA 1GSUA 3HCZA 3ZTLA 1FG4A 4I6XA 2HRKB 3GKXA 1X5EA 1ABAA 5B8AA 3RAZA 1FB0A 4POKA 2YWNA 1X5CA 4KDYA 3QOUA 1BAYA 5IMCA 2WDUA 2R2JA 2AYTA 5D9TA 5AIVA 4K9ZA 2BTOT 2XBIA 1F2EA 1LJRA 1O7UA 4KCAA 3QCPA 3GRXA 1GTUA 4LLRA 3GYKA 4DSRA 2C3NA 1M9BA 4OFTA 2VD1A 3IC8A 1OKTA 1DUGA 1EEJA 2WVXA 1G0TA 1M2AA 1QK8A 1Y25A 3GMFA 3KH7A 1XWKA 1SD8A 3GSTA 2GSQA 5H5QA 2H72A 2R3XA 2C0GA 2I4AA 1IYHA 2IIYA 2MYGA 4V2NA 1X9MB 4MF6A 1MDKA 3IAM2 3UMAA 3BD2A 1EP8A 2TRCP 4J57E 4KUNA 1XW9A 2OADA 5ABRA 4FXYP 2DBCA 2IMKA 4IVFA 1TI1A 2HSNB 3IRAA 4PURA 1BF5A 5DAKB 2HZEA 2IFQA 2H71A 4MNNA 4XHMA 2WB9A 4MABA 2HZFA 2JSZA 3QFAC 1ST9A 6GSXA 4D73A 4MH2A 1V2AA 4GWRA 1PGTA 2CQ9A 2IMFA 2AB6A 2ON5A 1YY7A 1V57A 1AW9A 2HRFA 2LJRA 2OBKA 4YKFA 2KUCA 1Z3EA 2PN8A 4MPGA 6GSVA 1PL2A 2H6YA 3VI5A 2H6ZA 2RUEA 1QQ2A 4HJMA 2WW1A 1A8YA 4WF4A 1B48A 3HD5A 1FAAA 1LU4A 1OC9A 3KP9A 3F4SA 5HQPA 3QR6A 5HR2A 5HR1A 3KTLA 5A5HA 1THOA 3QFBC 4WETA 4WF5A 1A24A 2F9SA 4MZWA 3CSIA 4DSSA 4K5SA 5IOXA 4BIKA 5B6NA 2RM6A 1K0CA 1I1IP 2CZ2A 3VFIA 5CRWA 1TRSA 3DVWA 2EFDA 2FHEA 2M46A 2X99A 1M99A 3PR8A 3PINA 4XRAA 1BG5A 4PI0C 5F07A 4TW5A 4E8HA 2GGTA 1TXUA 5CP1A 1GLPA 4ECBA 1XG8A 1FVJA 4I8BA 4EIPA 2FA4A 1O81A 2FD3A 1VRSD 5A4WA 4IKHA 2H1LA 1Z6MA 4KNDA 4V2LA 4RQRA 3IAS2 1C72A 3LXZA 4QQ7A 5CRGA 1GNWA 2WS2A 1GSEA 4I5QA 5G1KA 1NW2A 2OE1A 3ZFLA 3M3MA 5F8BA 3TKRA 4YQMA 3KTBA 3KIJA 8GSSA 5J5NA 2DSAA 5CRHA 2WW2A 1XIYA 1ZOFA 5FHIA 5EY6A 2CA8A 4BVXA 1FW1A 5FWGA 3IR4A 2PGTA 5HFIA 2IPAA 1WMJA 5GSSA 1SYXA 3UJ1A 5IQYA 1PL1A 2C3TA 3BBYA 3DD3A 4MJEA 3CSJA 3DVXA 4ACSA 4N11A 4PUFC 1AUCA 2OA7A 3EMXA 4RI7A 3N5OA 3CBUA 4G0KA 4TRXA 13GSA 3FR6A 5ECMB 1YF0A 1GUMA 1E6BA 4WR5A 2DKHA 3VURA 5IIZA 2JADA 4DEJA 1JZRA 1PX6A 3L9SA 2K6VA 3A2VA 2VD0A 3TKPA 2L5LA 2NPBA 4AF2A 4EKZA 4IQAA 4AJ6A 3HZ4A 1MTCA 4WR4A 4FYCA 4F0CA 4JRRA 3FHKA 1K0AA 2K9FA 1X9SB 2LNTA 4J2FA 2FUG2 3HVVA 2L57A 1GTIA 2GT6A 3H8QA 4MF7A 3QAGA 3D5JA 3G7YA 1T3BA 4POMA 5JWRB 5A1NB 14GSA 3DIEA 4BVYB 2L4QA 4IQ1A 2J9HA 4FYUA 2GZZA 1T4ZA 3ED3A 1TU8A 2H19A 1M2BA 3RFRC 4GSTA 2GQMA 1GSSA 4K7OA 4CHSA 4I2UA 5J41A 12GSA 4MF5A 3TRQA 5IO2A 4KA0A 3MAKA 2GQLA 1GSQA 5HFKA 3KZQA 3TJBA 2VLUA 4ULXA 1JZDA 4G0IA 3M8NA 2PPTA 2FY6A 4NAXA 1K0OA 3P2AA 3R2QA 4MPFA 2QA1A 4OCFA 4OD7A 2X8HA 1VF2A 4MJAA 5DJLA 5GZZB 4EO3A 2O87A 4IS0A 2R0CA 4FYBA 1Y1UA 3GKNA 4ICYA 2FWFA 3E9JB 3RHBA 1GH2A 4KX4A 4HJ2A 5DJMA 1O6JA 5G2ZA 3IPZA 3KD0A 5LCZA 5GSTA 3KM6A 2QGVA 3TOUA 3GX0A 1A23A 1WIKA 1ZYNA 1NHYA 5KEJA 3G9BA 5LD0A 1EWXA 1XWBA 1JFUA 4TXVA 5IMDA 4K2DA 2YOIA 4WXTA 2HRKA 2YZHA 3C1RA 4O32A 1ZMAA 1E2YA 3VK9A 3TKSA 2VL9A 5ELGA 5D8IA 4HSCX 22GSA 3KJYA 4RI6A 2R0GA 5EVOA 2BMXA 2H74A 4TR3A 5F06A 4AGSA 3MYDA 2H6XA 4L5OA 1IYIA 1YKCA 3UVHA 18GSA 1DSBA 2VLTA 3DGQA 1JLVA 5FT3A 3HJOA 3APSA 3GHAA 5KN2A 2R0PA 1F3BA 3KMNA 4IHUA 3EYTA 2TRXA 4MDCA 2B1KA 2C80A 1NM3A 3MSZA 2PERA 3CRUA 2B7JA 4L5LA 4CY8A 3A5IA 2XHFA 4XRDA 1CQHA 2LKUA 2WULA 4TR1B 3IHQA 7GSSA 2UV8G 5DAKA 3H79A 3A2XA 2YZUA 3PH9A 3TJJA 1PSQA 4K2XA 1H75A 4P3YB 6GSUA 5IMFA 3SBCA 2H70A 2YANA 5ECPB 4PXOA 2VL2A 3LG6A 4G01A 1U3AA 4FH8A 1KEBA 1MDJA 2I9HA 1ZCPA 2L4CA 3F4RA 3L78A 5D96A 3EU4A 1VF4A 2LS5A 1U3IA 2AJQB 3WD6A 2O5VA 4KDUA 1F3AA 3LGCA 3F6FA 2P0GA 2HYXA 1KTEA 4PI2C 3GFKA 3ZRDA 4KF9A 3EMPA 3PGTA 2QKEA 6GSTA 4IW9A 1XFLA 2R37A 2F8FA 3CXGA 1R7HA 1OAZA 3K8NA 5IPGA 4IP6A 4QL9A 4TKYA 4BWSA 1GL8A 2XPEA 1YF1A 5KN0A 3RBTA 5J4VA 1XWGA 1F6MC 2YJHA 2JACA 1EGOA 4MCUA 1EP7A 2K18A 3HVNA 3GSSA 1HNAA 2LSTA 4MJCA 4I2TA 2RUFA 4X4JA 5IM9A 4V1Ag 10GSA 1SL0B 2DKIA 2LTKA 1PFOA 4QMKA 4JE1A 2O89A 1N8JA 1YZXA 2VO4A 2OT3A 1ZYPA 2H0GA 4HS1A 5COHA 2HFDA 4MJBA 2LV3A 3VWUA 5IMZA 2FWHA 5JWQB 4BPYA 3FY7A 4HU7A 5DCHA 3KCMA 2WZ9A 1BQ7A 2HLSA 2OE3A 4WEYA 2CX4A 4Z2UA 4EVMA 4KAEA 5IMVA 5A5KA 2HE3A 1G7EA 3TU3B 2H1AA 3TKQA 3KGKA 3HVSA 5G31A 3HJPA 1QGVA 4Z2TA 4XIHA 3ERGA 1OYJA 4ZB9A 2LEGA 3UEMA 1TKDB 1K3OA 3GL3A 3LJRA 1PQNA 3TRPA 3TKSE 3VPTA 4KSOA 3ZVJA 1Q98A 3ZIVA 4W66A 4TVEA 2LJKA 2I1UA 3ZLPA 3EINA 1WOUA 1U88A 2HSYA 1MEKA 4YH2A 5GAND 5HR3A 1Z5YE 2FNOA 4L0UA 2A2RA 4IJIA 5ID2A 2H75A 4ZL8A 4OFNA 1DE1A 4GTUA 4ML1A 4FQUA 3DRNA 1PN9A 4CDOA 4TN8A 2H01A 1BX9A 2EFHA 5CRDA 2YV9A 2GSTA 1A2LA 2H0HA 5LNKe 4G0LA 1ON4A 5AN1A 2AV4A 1G6YA 3WGEA 2KP1A 3QDNA 2CZ3A 2AAWA 1V98A 4XS4A 2MBTA 2FLSA 4K6XA 2WRTA 1B4PA 1SENA 1XVWA 3DKSA 1R5PA 1J9BA 3VLNA 3GUSA 1A8LA 3C7MA 2VLVA 4V2MA 2B6MA 5H5RA 1FVKA 4N10A 5CAXA 1ILOA 1SK1A 2LJAA 3N9JA 2DJ1A 1ZL9A 3HVXA 4EUYA 4POBA 2DJ0A 2V2GA 3WGDA 2HI7A 2D2ZA 2YWIA 4MP4A 2R4VA 2H1DA 1SU9A 2C0FA 2IJYA 2EIOA 20GSA 4V1Ap 4PNGA 1GNEA 5A1NA 1OE7A 4HZ2A 3F3QA 1USBA 4N0ZA 5JWOB 2N5BA 4NHZA 4BL7B 1K3YA 4OO4A 4XCSA 1AQVA 3H1NA 2VIMA 3LQ7A 3NZNA 1SKWB 4K7NA 4PNFA 4Q5NA 4GSSA 2IFQB 3EVIA 2P5RA 4EDZA 2C0EA 2IWTA 2GLRA 3CQFA 4JR4A 1S3DA 3FK8A
chains in the Genus database with same CATH topology
4D73B 1XW5A 2MMOA 3CWGA 5CREA 1PD21 1V58A 2YPMA 3ZL5A 19GSA 4ECCA 3HXSA 2VCWA 5G5FA 3ZMKA 1AC1A 1GSDA 2H1BA 4HOJA 3FZAA 3RPNA 3IV4A 2YNXA 4NV5A 1NHOA 3TDGA 4CY6A 4GQFA 2VM1A 3H93A 3ME7A 3A2WA 1TRUA 3HDCA 1SJIA 4X0XA 1OC9B 1TP9A 2H0IA 3FW2A 4KE3A 4NHWA 1YEPA 2H1GA 1V9WA 5AGYA 2DJ3A 3ZVJD 2DJ2A 2EC4A 1PRXA 3E3EA 3FRCA 3IHGA 2LUSA 3TJGA 3VI7A 3VWVA 2X8CA 4YAPA 5DBQA 2RIIA 2K8VA 5ELAA 1X5DA 3HJMA 1XBSA 2PBJA 3MWHA 2ON7A 4NWYA 3JCML 2XC2A 3W8SA 2IMEA 4L8EA 4N0VA 4GLTA 3P8WA 4E8EA 2JU5A 3M9KA 4KH7A 4AKXB 1EOGA 1ZZYA 1OC8A 3LYKA 1QUWA 1JLWA 2O7KA 2E0QA 2O85A 2EFCA 3GA4A 3CMIA 1PA3A 4GXZA 5A34B 1T4YA 3L4NA 1VF3A 3UIWA 4PUAA 3ERFA 4IGJA 2PVOC 5HR0A 2CT6A 3C8EA 2EIQA 3ZIJA 1XOAA 5J4YA 5DCGA 2V41A 2RM5A 3IOSA 5AIXA 2L6DA 3TJFA 4MZBA 1EGRA 3ZREA 2A4HA 4GQCA 1Z9HA 1O8WA 4TR1A 3WT2A 1ACVA 2KP2A 2N5AA 3FMWA 1XVQA 1V40A 2DMMA 3GKMA 3ERWA 4G19A 5D73A 2GZYA 4POLA 4O7HA 4TR0A 3TJKA 5DALB 2WCIA 3I43A 1HNCA 4HQZA 2RLIA 2DLXA 1JHBA 1I5GA 4NMUA 4N3ZA 2H66A 3GURA 2AUVA 4ECJA 2DMLA 4QL7A 2YP6A 4MK3A 1OC3A 3R3EA 5AISA 4EC0A 2ALBA 1FO5A 4OFMA 1T7PB 5F0GA 2O8VB 4HI7A 5KOXA 2E2GA 3ME8A 4TXOA 2EIRA 4ZIJA 3HMJG 1TDIA 1PKZA 1AIUA 2F51A 2CX3A 4K8MA 3H4KA 2HRNA 1YVLA 1CQGA 2QC7A 2J23A 3HHVA 3KH9A 3LYPA 3LFLA 4AJ8A 3GTUB 4E68A 4LL4B 3VWWA 2EFEA 5ECKB 2A2PA 3PPUA 4ID0A 2L59A 4K7IA 3L9UA 1Z7PA 4O5QA 1Z6NA 3HYPA 5DDLA 5E4WA 2HXKA 4GCIA 1X0RA 3AY8A 4PX1A 3V1WA 2BJXA 2GS3A 5ECRB 2DIZA 5J4UA 1LBKA 4EXJA 3SWLA 2DC5A 3FZ9A 1N2AA 3MNGA 1AXDA 3IA1A 1PKWA 3LWAA 1G7OA 3L9VA 1SKRB 2CAQA 2C4JA 1B9YC 3BCKA 4BWQA 4I97A 4PQHA 1TRWA 2GT5A 2OE0A 2A2SA 4ZXGA 4F82A 2GVPA 1M0UA 1XPVA 4IELA 2MBSA 3J7Yb 1GSYA 3O6TA 3DEXA 2HSNA 4ZL9A 4O92A 2X64A 1EZKA 3IE3A 5DVBA 3EWLA 4GRFA 1FOVA 1XXUA 1ML6A 2QA2A 5H5SA 2HNLA 4OO5A 2A4VA 2VCZA 1KNGA 2ZNMA 4JU5A 5INYA 1FHEA 3UARA 1THXA 2R5GA 2JZSA 3GKKA 2WGRA 3F63A 3CYNA 4NPBA 2Z9SA 3F8UA 2REMA 2GQKA 2DJKA 3WGXA 1GULA 6GSWA 5J47A 1ERTA 3WT1A 2LQOA 3RPPA 1FOHA 2HSMB 3I9V2 5GAPD 3D4MA 3LXTA 2V1MA 3DYRA 3KXOA 1T8EB 1H4OA 1K3LA 5L71A 5DQSA 3D21A 1BEDA 1MDIA 1OKDA 1R26A 2JZTA 3EU3A 1GRXA 3CSHA 4IP1A 1UA5A 2VKZG 4Q5RA 3TUEA 1WWJA 3J7Yk 4KB3A 5ECQB 1HD2A 3I6AA 5D9XA 4RQXA 1WRYA 1YQ1A 2VM2A 1R4WA 4MH3A 2H30A 4TOPA 3UBKA 3IXRA 1TRVA 5C04A 5J9CA 2IMDA 1A2JA 1HYUA 2JZRA 3EPTA 1SL1B 4DVCA 3UAPA 3APQA 1RW1A 3DWVA 4FO5A 2VCQA 3S9FA 4K0GA 3EE2A 1T1VA 4GF0A 3DXBA 1SD9A 2H73A 4BL7A 2VCVA 4IJ3A 3IDVA 5CO3A 1A0RP 1OE8A 1SJZA 3D22A 1VGLA 4KGIA 1ZYQB 5BMUB 4N30A 1TI3A 3ZMLA 3A5WA 3ZYWA 3Q19A 1OVNA 2YV7A 3MDKA 3FZ4A 5IPHA 2HT9A 1UN2A 2GTUA 1GP1A 1O73A 4O5UA 4HZ4A 2FCHA 4JEDA 4GSNA 2LRTA 3TCOA 4O5RA 1G6WA 2TIRA 3U6VA 1EEMA 1M9AA 3GNJA 3OR5A 5D9WA 1TW9A 4J56E 1GTBA 3LSZA 4JZQA 2VAFA 2ZUPA 2VUPA 2F3MA 4F0BA 1ERVA 4XS6A 1EOHA 3BCIA 3TOTA 3Q18A 1QXHA 1O8XA 4AJ7A 3BOAA 1UC7A 5F05A 3HKRA 2K8SA 5JCWA 2C1YA 2B1LA 1Z7RA 2QSIA 4PGTA 1VF1A 3FZ5A 4ECIA 4X1UA 1M7TA 1URMA 2GSRA 2HRAA 2YCDA 4PTSA 1ERUA 2V32A 3LORA 4DSQA 2WFCA 3NIVA 2IL3A 5IOWA 1GUKA 1K0DA 1ZGNA 2G2QA 3UOMA 2IMIA 4YQVA 4BA7A 1GTAA 2PMTA 3UBLA 1J0FA 1GUHA 3TB2A 11GSA 2YN1A 2CAIA 2MMAA 2HSHA 2HQTA 2UZ8A 3BJ5A 5B8BA 2F8AA 3ZZXA 5C00A 3UVTA 3G7IA 3KEBA 1SVOA 4HU9A 2E7PA 2NBSA 5A34A 3M1GA 1BJXA 17GSA 3U5RE 2I3YA 4BVYA 4HEA2 3ZITA 4EDYA 4ML6A 3L0HA 1SJ6A 3QD9A 2FGXA 1AQWA 1R5AA 3DMLA 2V6OA 3RHCA 3MIXA 2ES7A 1JZOA 2B5YA 4AKIA 2M80A 3F0IA 2HZEB 4HDEA 2CVDA 1WJKA 1A0FA 1XWAA 5G5EA 4USSA 3P7XA 2PUKC 2B5EA 1SVLA 1WP0A 1U87A 3QAWA 3QPMA 3WYWA 4HQSA 2XPDA 4ZB8A 3IBHA 2GDRA 1YKAA 1SL2B 5DALA 1W4VA 1X9WB 5ENUA 2DIYA 5J3RA 2PVQA 3CTFA 1HNBA 1MD4A 3F4TA 3FR3A 2KHPA 4ILFA 3KP8A 4Z7XA 1WPIA 4AKHA 3G7JA 1B8XA 5D9VA 2CV4A 1TK0B 5ID2B 3D6IA 2YWMA 4KCEA 4XTSA 3TRXA 5ECSA 4WBRD 2C8UA 1YJ6A 1TXXA 4CW9A 5A5HB 5IO0A 4EE0A 4HUAA 4OMVA 1O85A 4MZCA 1DE2A 4DSSB 3APOA 4NV2A 1A2MA 2CVBA 3D0ZA 2KLXA 1T00A 3IC4A 4MA9A 4FIWA 5JCUA 3GTUA 4XS4B 4AKGA 4AI6A 4Q5QA 3M9JA 1AQXA 4K5RA 3P90A 3C71A 3VWXA 1S3CA 2LNSA 1W89A 3HZ8A 1F37A 5G1LA 1EV4A 4JBBA 1B4QA 2B7KA 2E2MA 3CRTA 1SVMA 3C73A 5ECHB 1KBNA 3RDWA 3Q74A 4NXIA 1EV9A 5B6MA 2IN3A 4JR6A 2I81A 2B5XA 5ECLB 2OKAA 4G10A 4XS1A 1DBYA 1AAZA 3M0FA 4ZILA 1TOFA 2OBIA 4MMMA 4L0WA 1TTZA 4RUVA 5ECOB 1B9XC 2X8GA 3HA9A 4Q5FA 3GN3A 4ZBDA 5ECNB 3TKSC 5CNWA 5DQYA 2NDOA 4YKGA 4LMVA 5G30A 1GWCA 2C0DA 5CYYA 3LW9A 2ZCTA 2XBQA 2X4AA 2C3QA 3GH9A 3Q6OA 2CVKA 4F2IA 5A4UA 4GDFA 1YEXA 4LL1B 3E0UA 4IBPA 4BVXB 4ZB7A 1ERWA 2YWOA 1GSFA 5JCGA 4EF0A 1TU7A 3IK7A 2MMNA 2P31A 2OACA 1ZYEA 1J08A 3GL5A 1I9DA 1K0MA 1RQMA 3CTGA 1PX7A 4KDXA 2B3SA 2GSSA 2L6CA 1QMVA 6GSSA 4EL1A 3US3A 1SK0A 2NVLA 2MMZA 1NSWA 3EC3A 3ISOA 4LA1A 2HSMA 2V6KA 2JL4A 4MLYA 3F6DA 3O76A 2YJ7A 4KW6A 5KN1A 2X49A 4G2EA 4ZBBA 2LRCA 1N25A 3GIXA 2L5OA 1PN0A 3C1SA 4LMWA 3O3TA 3EURA 3QMXA 1U6TA 5KN3A 2VL2C 2GZPA 3FKFA 1BYEA 2AHEA 3I69A 1XW6A 5EPFA 4F9ZA 3NOFA 2VCTA 1XWCA 1TK5B 2PWJA 4Z2RA 3GV1A 3W6GA 3IK9A 2FWGA 3ZFBA 2NTOA 1SK2A 1XCCA 5KOWA 3FEUA 1S3AA 1SYRA 2JSYA 3UL3A 16GSA 2N5FA 5HFGA 4YAVA 4IN0A 1Y6EA 2R6KA 3QAVA 1UVZA 2DJJA 2FWEA 2H76A 2M72A 2P5QA 4KSMA 4WKWA 1FB6A 5IMAA 4G9HA 5E59A 1XOBA 3LEFA 3A3TA 1TK8B 1MD3A 3VPQA 5EL8A 4A5PA 2WJUA 5ECIB 1GLQA 5D93A 4PQIA 5A4VA 2G0FA 2LQQA 2OJLA 2VCXA 3FYGA 5J40A 2PU9C 1RK4A 1WE0A 1K0BA 4K1FA 4EIQA 2H8LA 3TGZA 2MZCA 2VOCA 5BMUA 1QFNA 1K0NA 3KMOA 3F9UA 4WBJA 4ZBAA 9GSSA 1TJDA 1PMTA 1YDKA 3GX8A 1BG1A 2FA8A 3FR9A 3D4TA 4H86A 4X43A 5J9BA 4ZB6A 2KOKA 1XZOA 3GH6A 1M2DA 1Q4JA 2LRNA 6GSYA 1SKSB 3HY2A 4OCEA 4F03A 5B7CA 3F3RA 1JZWA 4PQ1A 4K0NA 5BRTA 1F9MA 2VL3A 4ISDA 4TR4A 3W8JA 4OWYA 4ZL7A 4TXOB 1HQOA 4YQUA 1GSUA 3HCZA 3ZTLA 1FG4A 4I6XA 2HRKB 3GKXA 1X5EA 1ABAA 5B8AA 3RAZA 1FB0A 4POKA 2YWNA 1X5CA 4KDYA 3QOUA 1BAYA 5IMCA 2WDUA 2R2JA 2AYTA 5D9TA 5AIVA 4K9ZA 2BTOT 2XBIA 1F2EA 1LJRA 1O7UA 4KCAA 3QCPA 3GRXA 1GTUA 4LLRA 3GYKA 4DSRA 2C3NA 1M9BA 4OFTA 2VD1A 3IC8A 1OKTA 1DUGA 1EEJA 1G0TA 1M2AA 1QK8A 1Y25A 3GMFA 3KH7A 1XWKA 1SD8A 3GSTA 2GSQA 5H5QA 2H72A 2R3XA 2C0GA 2I4AA 1IYHA 2IIYA 2MYGA 4V2NA 1X9MB 4MF6A 1MDKA 3IAM2 3UMAA 3BD2A 1EP8A 2TRCP 4J57E 4KUNA 1XW9A 2OADA 5ABRA 2DBCA 2IMKA 4IVFA 1TI1A 2HSNB 3IRAA 4PURA 1BF5A 5DAKB 2HZEA 2IFQA 2H71A 4MNNA 4XHMA 2WB9A 4MABA 2HZFA 2JSZA 3QFAC 1ST9A 6GSXA 4D73A 4MH2A 1V2AA 4GWRA 1PGTA 2CQ9A 2IMFA 2AB6A 2ON5A 1YY7A 1V57A 1AW9A 2HRFA 2LJRA 2OBKA 4YKFA 2KUCA 1Z3EA 2PN8A 4MPGA 6GSVA 1PL2A 2H6YA 3VI5A 2H6ZA 2RUEA 1QQ2A 4HJMA 1A8YA 4WF4A 1B48A 3HD5A 1FAAA 1LU4A 1OC9A 3KP9A 3F4SA 5HQPA 3QR6A 5HR2A 5HR1A 3KTLA 5A5HA 1THOA 3QFBC 4WETA 4WF5A 1A24A 2F9SA 4MZWA 3CSIA 4DSSA 4K5SA 5IOXA 5B6NA 2RM6A 1K0CA 2CZ2A 3VFIA 5CRWA 1TRSA 3DVWA 2EFDA 2FHEA 2M46A 2X99A 1M99A 3PR8A 3PINA 4XRAA 1BG5A 5F07A 4TW5A 4E8HA 2GGTA 1TXUA 5CP1A 1GLPA 4ECBA 1FVJA 4I8BA 4EIPA 2FA4A 1O81A 2FD3A 1VRSD 5A4WA 4IKHA 2H1LA 1Z6MA 4KNDA 4V2LA 4RQRA 3IAS2 1C72A 3LXZA 4QQ7A 5CRGA 1GNWA 2WS2A 1GSEA 4I5QA 5G1KA 1NW2A 2OE1A 3ZFLA 3M3MA 5F8BA 3TKRA 4YQMA 3KTBA 3KIJA 8GSSA 5J5NA 2DSAA 5CRHA 1XIYA 1ZOFA 5FHIA 5EY6A 2CA8A 4BVXA 1FW1A 5FWGA 3IR4A 2PGTA 5HFIA 2IPAA 1WMJA 5GSSA 1SYXA 3UJ1A 5IQYA 1PL1A 2C3TA 3BBYA 3DD3A 4MJEA 3CSJA 3DVXA 4ACSA 4N11A 4PUFC 1AUCA 2OA7A 3EMXA 4RI7A 3N5OA 3CBUA 4G0KA 4TRXA 13GSA 3FR6A 5ECMB 1YF0A 1GUMA 1E6BA 4WR5A 2DKHA 3VURA 5IIZA 2JADA 4DEJA 1JZRA 1PX6A 3L9SA 2K6VA 3A2VA 2VD0A 3TKPA 2L5LA 2NPBA 4AF2A 4EKZA 4IQAA 4AJ6A 3HZ4A 1MTCA 4WR4A 4FYCA 4F0CA 4JRRA 3FHKA 1K0AA 2K9FA 1X9SB 2LNTA 4J2FA 2FUG2 3HVVA 2L57A 1GTIA 2GT6A 3H8QA 4MF7A 3QAGA 3D5JA 3G7YA 1T3BA 4POMA 5JWRB 5A1NB 14GSA 3DIEA 4BVYB 2L4QA 4IQ1A 2J9HA 4FYUA 2GZZA 1T4ZA 3ED3A 1TU8A 2H19A 1M2BA 4GSTA 2GQMA 1GSSA 4K7OA 4CHSA 4I2UA 5J41A 12GSA 4MF5A 3TRQA 5IO2A 4KA0A 3MAKA 2GQLA 1GSQA 5HFKA 3KZQA 3TJBA 2VLUA 4ULXA 1JZDA 4G0IA 3M8NA 2PPTA 2FY6A 4NAXA 1K0OA 3P2AA 3R2QA 4MPFA 2QA1A 4OCFA 4OD7A 2X8HA 1VF2A 4MJAA 5DJLA 5GZZB 4EO3A 2O87A 4IS0A 2R0CA 4FYBA 1Y1UA 3GKNA 4ICYA 2FWFA 3E9JB 3RHBA 1GH2A 4KX4A 4HJ2A 5DJMA 1O6JA 5G2ZA 3IPZA 3KD0A 5LCZA 5GSTA 3KM6A 2QGVA 3TOUA 3GX0A 1A23A 1WIKA 1ZYNA 1NHYA 5KEJA 3G9BA 5LD0A 1EWXA 1XWBA 1JFUA 4TXVA 5IMDA 4K2DA 2YOIA 4WXTA 2HRKA 2YZHA 3C1RA 4O32A 1ZMAA 1E2YA 3VK9A 3TKSA 2VL9A 5ELGA 5D8IA 22GSA 3KJYA 4RI6A 2R0GA 5EVOA 2BMXA 2H74A 4TR3A 5F06A 4AGSA 3MYDA 2H6XA 4L5OA 1IYIA 1YKCA 3UVHA 18GSA 1DSBA 2VLTA 3DGQA 1JLVA 5FT3A 3HJOA 3APSA 3GHAA 5KN2A 2R0PA 1F3BA 3KMNA 4IHUA 3EYTA 2TRXA 4MDCA 2B1KA 2C80A 1NM3A 3MSZA 2PERA 3CRUA 2B7JA 4L5LA 4CY8A 3A5IA 2XHFA 4XRDA 1CQHA 2LKUA 2WULA 4TR1B 3IHQA 7GSSA 2UV8G 5DAKA 3H79A 3A2XA 2YZUA 3PH9A 3TJJA 1PSQA 4K2XA 1H75A 4P3YB 6GSUA 5IMFA 3SBCA 2H70A 2YANA 5ECPB 4PXOA 2VL2A 3LG6A 4G01A 1U3AA 4FH8A 1KEBA 1MDJA 2I9HA 1ZCPA 2L4CA 3F4RA 3L78A 5D96A 3EU4A 1VF4A 2LS5A 1U3IA 2AJQB 3WD6A 2O5VA 4KDUA 1F3AA 3LGCA 3F6FA 2P0GA 2HYXA 1KTEA 3GFKA 3ZRDA 4KF9A 3EMPA 3PGTA 2QKEA 6GSTA 4IW9A 1XFLA 2R37A 2F8FA 3CXGA 1R7HA 1OAZA 3K8NA 5IPGA 4IP6A 4QL9A 4TKYA 4BWSA 1GL8A 2XPEA 1YF1A 5KN0A 3RBTA 5J4VA 1XWGA 1F6MC 2YJHA 2JACA 1EGOA 4MCUA 1EP7A 2K18A 3GSSA 1HNAA 2LSTA 4MJCA 4I2TA 2RUFA 4X4JA 5IM9A 4V1Ag 10GSA 1SL0B 2DKIA 2LTKA 4QMKA 4JE1A 2O89A 1N8JA 1YZXA 2VO4A 2OT3A 1ZYPA 2H0GA 4HS1A 5COHA 2HFDA 4MJBA 2LV3A 3VWUA 5IMZA 2FWHA 5JWQB 4BPYA 3FY7A 4HU7A 5DCHA 3KCMA 2WZ9A 1BQ7A 2HLSA 2OE3A 4WEYA 2CX4A 4Z2UA 4EVMA 4KAEA 5IMVA 5A5KA 2HE3A 1G7EA 3TU3B 2H1AA 3TKQA 3KGKA 3HVSA 5G31A 3HJPA 1QGVA 4Z2TA 4XIHA 3ERGA 1OYJA 4ZB9A 2LEGA 3UEMA 1TKDB 1K3OA 3GL3A 3LJRA 1PQNA 3TRPA 3TKSE 3VPTA 4KSOA 3ZVJA 1Q98A 3ZIVA 4W66A 4TVEA 2LJKA 2I1UA 3ZLPA 3EINA 1WOUA 1U88A 2HSYA 1MEKA 4YH2A 5GAND 5HR3A 1Z5YE 2FNOA 4L0UA 2A2RA 4IJIA 5ID2A 2H75A 4ZL8A 4OFNA 1DE1A 4GTUA 4ML1A 4FQUA 3DRNA 1PN9A 4CDOA 4TN8A 2H01A 1BX9A 2EFHA 5CRDA 2YV9A 2GSTA 1A2LA 2H0HA 5LNKe 4G0LA 1ON4A 5AN1A 2AV4A 1G6YA 3WGEA 2KP1A 3QDNA 2CZ3A 2AAWA 1V98A 4XS4A 2MBTA 2FLSA 4K6XA 2WRTA 1B4PA 1SENA 1XVWA 3DKSA 1R5PA 1J9BA 3VLNA 3GUSA 1A8LA 3C7MA 2VLVA 4V2MA 2B6MA 5H5RA 1FVKA 4N10A 5CAXA 1ILOA 1SK1A 2LJAA 3N9JA 2DJ1A 1ZL9A 3HVXA 4EUYA 4POBA 2DJ0A 2V2GA 3WGDA 2HI7A 2D2ZA 2YWIA 4MP4A 2R4VA 2H1DA 1SU9A 2C0FA 2IJYA 2EIOA 20GSA 4V1Ap 4PNGA 1GNEA 5A1NA 1OE7A 4HZ2A 3F3QA 1USBA 4N0ZA 5JWOB 2N5BA 4NHZA 4BL7B 1K3YA 4OO4A 4XCSA 1AQVA 3H1NA 2VIMA 3LQ7A 3NZNA 1SKWB 4K7NA 4PNFA 4Q5NA 4GSSA 2IFQB 3EVIA 2P5RA 4EDZA 2C0EA 2IWTA 2GLRA 4JR4A 1S3DA 3FK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D73 B;  1XW5 A;  2MMO A;  5CRE A;  1PD2 1;  1V58 A;  2YPM A;  3ZL5 A;  19GS A;  4ECC A;  3HXS A;  2VCW A;  5G5F A;  3ZMK A;  1AC1 A;  1GSD A;  2H1B A;  4HOJ A;  3FZA A;  3RPN A;  3IV4 A;  2YNX A;  4NV5 A;  1NHO A;  3TDG A;  4GQF A;  2VM1 A;  3H93 A;  3ME7 A;  3A2W A;  1TRU A;  3HDC A;  1SJI A;  4X0X A;  1OC9 B;  1TP9 A;  2H0I A;  3FW2 A;  4KE3 A;  4NHW A;  1YEP A;  2H1G A;  1V9W A;  5AGY A;  2DJ3 A;  3ZVJ D;  2DJ2 A;  2EC4 A;  1PRX A;  3E3E A;  3FRC A;  3TJG A;  2LUS A;  3VI7 A;  3VWV A;  2X8C A;  4YAP A;  5DBQ A;  2RII A;  2K8V A;  5ELA A;  1X5D A;  3HJM A;  1XBS A;  2PBJ A;  3MWH A;  2ON7 A;  4NWY A;  3JCM L;  2XC2 A;  3W8S A;  2IME A;  4L8E A;  4N0V A;  4GLT A;  3P8W A;  4E8E A;  2JU5 A;  3M9K A;  4KH7 A;  1EOG A;  1ZZY A;  1OC8 A;  3LYK A;  1QUW A;  1JLW A;  2O7K A;  2E0Q A;  2O85 A;  3GA4 A;  3CMI A;  1PA3 A;  4GXZ A;  1T4Y A;  3L4N A;  1VF3 A;  3UIW A;  4PUA A;  3ERF A;  4IGJ A;  2PVO C;  5HR0 A;  2CT6 A;  3C8E A;  2EIQ A;  3ZIJ A;  1XOA A;  5DCG A;  2V41 A;  2RM5 A;  3IOS A;  5AIX A;  2L6D A;  3TJF A;  4MZB A;  1EGR A;  3ZRE A;  4GQC A;  1Z9H A;  1O8W A;  4TR1 A;  3WT2 A;  1ACV A;  2KP2 A;  2N5A A;  1XVQ A;  1V40 A;  2DMM A;  3GKM A;  3ERW A;  4G19 A;  5D73 A;  2GZY A;  4POL A;  4O7H A;  4TR0 A;  3TJK A;  5DAL B;  2WCI A;  3I43 A;  1HNC A;  4HQZ A;  2RLI A;  2DLX A;  1JHB A;  1I5G A;  4NMU A;  2H66 A;  3GUR A;  2AUV A;  4ECJ A;  2DML A;  4QL7 A;  2YP6 A;  4MK3 A;  1OC3 A;  3R3E A;  5AIS A;  4EC0 A;  2ALB A;  1FO5 A;  4OFM A;  1T7P B;  5F0G A;  2O8V B;  4HI7 A;  2E2G A;  3ME8 A;  4TXO A;  2EIR A;  4ZIJ A;  1TDI A;  1PKZ A;  1AIU A;  2F51 A;  2CX3 A;  4K8M A;  3H4K A;  2HRN A;  1CQG A;  2QC7 A;  2J23 A;  3HHV A;  3KH9 A;  3LYP A;  3LFL A;  4AJ8 A;  3GTU B;  4LL4 B;  3VWW A;  5ECK B;  4K7I A;  3PPU A;  4ID0 A;  2L59 A;  3L9U A;  1Z7P A;  1Z6N A;  3HYP A;  5DDL A;  5E4W A;  2HXK A;  4GCI A;  1X0R A;  3AY8 A;  4PX1 A;  3V1W A;  2BJX A;  2GS3 A;  5ECR B;  2DIZ A;  5J4U A;  1LBK A;  4EXJ A;  3SWL A;  2DC5 A;  3FZ9 A;  1N2A A;  3MNG A;  1AXD A;  3IA1 A;  1PKW A;  3LWA A;  1G7O A;  3L9V A;  1SKR B;  2CAQ A;  2C4J A;  1B9Y C;  3BCK A;  4BWQ A;  4I97 A;  4PQH A;  1TRW A;  2GT5 A;  2OE0 A;  2A2S A;  4ZXG A;  4F82 A;  2GVP A;  1M0U A;  1XPV A;  4IEL A;  2MBS A;  3J7Y b;  1GSY A;  3O6T A;  3DEX A;  4ZL9 A;  4O92 A;  2X64 A;  1EZK A;  3IE3 A;  5DVB A;  3EWL A;  4GRF A;  1FOV A;  1XXU A;  1ML6 A;  5H5S A;  2HNL A;  4OO5 A;  2A4V A;  2VCZ A;  1KNG A;  2ZNM A;  4JU5 A;  5INY A;  1FHE A;  3UAR A;  1THX A;  2R5G A;  2JZS A;  3GKK A;  2WGR A;  3F63 A;  3CYN A;  4NPB A;  2Z9S A;  3F8U A;  2REM A;  2GQK A;  2DJK A;  3WGX A;  1GUL A;  6GSW A;  1ERT A;  3WT1 A;  2LQO A;  3RPP A;  2HSM B;  3I9V 2;  5GAP D;  3D4M A;  3LXT A;  2V1M A;  3DYR A;  3KXO A;  1T8E B;  1H4O A;  1K3L A;  5L71 A;  5DQS A;  3D21 A;  1BED A;  1MDI A;  1OKD A;  1R26 A;  2JZT A;  3EU3 A;  1GRX A;  3CSH A;  4IP1 A;  1UA5 A;  4Q5R A;  3TUE A;  1WWJ A;  3J7Y k;  4KB3 A;  5ECQ B;  1HD2 A;  3I6A A;  5D9X A;  4RQX A;  1WRY A;  1YQ1 A;  2VM2 A;  1R4W A;  4MH3 A;  2H30 A;  4TOP A;  3UBK A;  3IXR A;  1TRV A;  5C04 A;  5J9C A;  2IMD A;  1A2J A;  1HYU A;  2JZR A;  1SL1 B;  4DVC A;  3UAP A;  3APQ A;  1RW1 A;  3DWV A;  4FO5 A;  2VCQ A;  3S9F A;  4K0G A;  3EE2 A;  1T1V A;  4GF0 A;  3DXB A;  1SD9 A;  2H73 A;  4BL7 A;  2VCV A;  4IJ3 A;  3IDV A;  5CO3 A;  1A0R P;  1OE8 A;  1SJZ A;  3D22 A;  1VGL A;  4KGI A;  1ZYQ B;  4N30 A;  1TI3 A;  3ZML A;  3A5W A;  3ZYW A;  3Q19 A;  1OVN A;  2YV7 A;  3MDK A;  3FZ4 A;  5IPH A;  2HT9 A;  1UN2 A;  2GTU A;  1GP1 A;  1O73 A;  4HZ4 A;  2FCH A;  4JED A;  4GSN A;  2LRT A;  3TCO A;  4O5R A;  1G6W A;  2TIR A;  3U6V A;  1EEM A;  1M9A A;  3GNJ A;  3OR5 A;  5D9W A;  1TW9 A;  4J56 E;  1GTB A;  3LSZ A;  4JZQ A;  2VAF A;  2ZUP A;  2VUP A;  2F3M A;  4F0B A;  1ERV A;  4XS6 A;  1EOH A;  3BCI A;  3TOT A;  3Q18 A;  1QXH A;  1O8X A;  4AJ7 A;  3BOA A;  1UC7 A;  5F05 A;  3HKR A;  2K8S A;  5JCW A;  2C1Y A;  2B1L A;  1Z7R A;  2QSI A;  4PGT A;  1VF1 A;  3FZ5 A;  4ECI A;  4X1U A;  1M7T A;  1URM A;  2GSR A;  2HRA A;  2YCD A;  4PTS A;  1ERU A;  2V32 A;  3LOR A;  4DSQ A;  2WFC A;  3NIV A;  2IL3 A;  5IOW A;  1GUK A;  1K0D A;  1ZGN A;  2G2Q A;  3UOM A;  2IMI A;  4YQV A;  4BA7 A;  1GTA A;  2PMT A;  3UBL A;  1J0F A;  1GUH A;  3TB2 A;  11GS A;  2YN1 A;  2CAI A;  2MMA A;  2HSH A;  2HQT A;  2UZ8 A;  3BJ5 A;  5B8B A;  2F8A A;  3ZZX A;  5C00 A;  3UVT A;  3G7I A;  3KEB A;  4HU9 A;  2E7P A;  2NBS A;  3M1G A;  1BJX A;  17GS A;  3U5R E;  2I3Y A;  4BVY A;  4HEA 2;  3ZIT A;  4EDY A;  4ML6 A;  3L0H A;  1SJ6 A;  3QD9 A;  2FGX A;  1AQW A;  1R5A A;  3DML A;  2V6O A;  3RHC A;  2ES7 A;  1JZO A;  2B5Y A;  2M80 A;  3F0I A;  2HZE B;  4HDE A;  2CVD A;  1WJK A;  1A0F A;  1XWA A;  5G5E A;  4USS A;  3P7X A;  2PUK C;  2B5E A;  1WP0 A;  1U87 A;  3QAW A;  3QPM A;  3WYW A;  4HQS A;  2XPD A;  4ZB8 A;  3IBH A;  2GDR A;  1YKA A;  1SL2 B;  5DAL A;  1W4V A;  1X9W B;  5ENU A;  2DIY A;  5J3R A;  2PVQ A;  3CTF A;  1HNB A;  1MD4 A;  3F4T A;  3FR3 A;  2KHP A;  4ILF A;  3KP8 A;  4Z7X A;  1WPI A;  3G7J A;  1B8X A;  5D9V A;  2CV4 A;  1TK0 B;  5ID2 B;  3D6I A;  2YWM A;  4KCE A;  4XTS A;  3TRX A;  5ECS A;  4WBR D;  2C8U A;  1YJ6 A;  1TXX A;  4CW9 A;  5IO0 A;  4EE0 A;  4HUA A;  4OMV A;  1O85 A;  4MZC A;  1DE2 A;  4DSS B;  3APO A;  4NV2 A;  1A2M A;  2CVB A;  3D0Z A;  2KLX A;  1T00 A;  3IC4 A;  4MA9 A;  4FIW A;  5JCU A;  3GTU A;  4XS4 B;  4Q5Q A;  3M9J A;  1AQX A;  3P90 A;  3C71 A;  3VWX A;  1S3C A;  2LNS A;  1W89 A;  3HZ8 A;  1F37 A;  5G1L A;  1EV4 A;  4JBB A;  1B4Q A;  2B7K A;  2E2M A;  3CRT A;  3C73 A;  5ECH B;  1KBN A;  3RDW A;  3Q74 A;  4NXI A;  1EV9 A;  5B6M A;  2IN3 A;  4JR6 A;  2I81 A;  2B5X A;  5ECL B;  2OKA A;  4G10 A;  4XS1 A;  1DBY A;  1AAZ A;  3M0F A;  4ZIL A;  1TOF A;  2OBI A;  4MMM A;  4L0W A;  1TTZ A;  4RUV A;  5ECO B;  1B9X C;  2X8G A;  3HA9 A;  4Q5F A;  3GN3 A;  4ZBD A;  5ECN B;  3TKS C;  5CNW A;  5DQY A;  2NDO A;  4LMV A;  5G30 A;  1GWC A;  2C0D A;  5CYY A;  2ZCT A;  2XBQ A;  2C3Q A;  3GH9 A;  3Q6O A;  2CVK A;  4F2I A;  5A4U A;  4LL1 B;  1YEX A;  3E0U A;  4IBP A;  4BVX B;  1ERW A;  2YWO A;  1GSF A;  5JCG A;  4EF0 A;  1TU7 A;  3IK7 A;  2MMN A;  2P31 A;  2OAC A;  1ZYE A;  1J08 A;  3GL5 A;  1I9D A;  1K0M A;  1RQM A;  3CTG A;  1PX7 A;  4KDX A;  2B3S A;  2GSS A;  2L6C A;  1QMV A;  6GSS A;  4EL1 A;  3US3 A;  1SK0 A;  2NVL A;  2MMZ A;  1NSW A;  3EC3 A;  3ISO A;  4LA1 A;  2HSM A;  2V6K A;  2JL4 A;  4MLY A;  3F6D A;  3O76 A;  2YJ7 A;  4KW6 A;  5KN1 A;  4G2E A;  4ZBB A;  2LRC A;  3GIX A;  2L5O A;  3C1S A;  4LMW A;  3O3T A;  3EUR A;  3QMX A;  1U6T A;  5KN3 A;  2VL2 C;  2GZP A;  3FKF A;  1BYE A;  2AHE A;  3I69 A;  1XW6 A;  5EPF A;  4F9Z A;  3NOF A;  2VCT A;  1XWC A;  1TK5 B;  2PWJ A;  3GV1 A;  3W6G A;  3IK9 A;  2FWG A;  3ZFB A;  2NTO A;  1SK2 A;  1XCC A;  3FEU A;  1S3A A;  1SYR A;  2JSY A;  3UL3 A;  16GS A;  2N5F A;  5HFG A;  4YAV A;  4IN0 A;  1Y6E A;  2R6K A;  3QAV A;  1UVZ A;  2DJJ A;  2FWE A;  2H76 A;  2M72 A;  2P5Q A;  4KSM A;  4WKW A;  1FB6 A;  5IMA A;  4G9H A;  5E59 A;  1XOB A;  3LEF A;  3A3T A;  1TK8 B;  1MD3 A;  3VPQ A;  5EL8 A;  2WJU A;  5ECI B;  1GLQ A;  5D93 A;  4PQI A;  5A4V A;  2G0F A;  2LQQ A;  2OJL A;  2VCX A;  3FYG A;  2PU9 C;  1RK4 A;  1WE0 A;  1K0B A;  4K1F A;  2H8L A;  3TGZ A;  2MZC A;  2VOC A;  5BMU A;  1QFN A;  1K0N A;  3KMO A;  3F9U A;  4WBJ A;  4ZBA A;  9GSS A;  1TJD A;  1PMT A;  1YDK A;  3GX8 A;  2FA8 A;  3FR9 A;  3D4T A;  4H86 A;  4X43 A;  5J9B A;  4ZB6 A;  2KOK A;  1XZO A;  3GH6 A;  1M2D A;  1Q4J A;  2LRN A;  6GSY A;  1SKS B;  3HY2 A;  4OCE A;  4F03 A;  5B7C A;  3F3R A;  1JZW A;  4PQ1 A;  4K0N A;  1F9M A;  2VL3 A;  4ISD A;  4TR4 A;  3W8J A;  4OWY A;  4ZL7 A;  4TXO B;  1HQO A;  4YQU A;  1GSU A;  3HCZ A;  3ZTL A;  1FG4 A;  4I6X A;  2HRK B;  3GKX A;  1X5E A;  1ABA A;  5B8A A;  3RAZ A;  1FB0 A;  4POK A;  2YWN A;  1X5C A;  4KDY A;  3QOU A;  1BAY A;  5IMC A;  2WDU A;  2R2J A;  2AYT A;  5D9T A;  5AIV A;  4K9Z A;  2BTO T;  2XBI A;  1F2E A;  1LJR A;  1O7U A;  4KCA A;  3QCP A;  3GRX A;  1GTU A;  4LLR A;  3GYK A;  4DSR A;  2C3N A;  1M9B A;  4OFT A;  2VD1 A;  3IC8 A;  1OKT A;  1DUG A;  1EEJ A;  1G0T A;  1M2A A;  1QK8 A;  1Y25 A;  3GMF A;  3KH7 A;  1XWK A;  1SD8 A;  3GST A;  2GSQ A;  5H5Q A;  2H72 A;  2R3X A;  2C0G A;  2I4A A;  1IYH A;  2IIY A;  2MYG A;  4V2N A;  1X9M B;  4MF6 A;  1MDK A;  3IAM 2;  3UMA A;  3BD2 A;  1EP8 A;  2TRC P;  4J57 E;  4KUN A;  1XW9 A;  2OAD A;  5ABR A;  2DBC A;  2IMK A;  4IVF A;  1TI1 A;  2HSN B;  4PUR A;  2HZE A;  3IRA A;  5DAK B;  2IFQ A;  2H71 A;  4XHM A;  2WB9 A;  4MAB A;  2HZF A;  2JSZ A;  3QFA C;  1ST9 A;  6GSX A;  4D73 A;  4MH2 A;  1V2A A;  4GWR A;  1PGT A;  2CQ9 A;  2IMF A;  2AB6 A;  2ON5 A;  1YY7 A;  1V57 A;  1AW9 A;  2HRF A;  2LJR A;  2OBK A;  2KUC A;  1Z3E A;  2PN8 A;  4MPG A;  6GSV A;  1PL2 A;  2H6Y A;  3VI5 A;  2H6Z A;  2RUE A;  1QQ2 A;  4HJM A;  1A8Y A;  4WF4 A;  1B48 A;  3HD5 A;  1FAA A;  1LU4 A;  1OC9 A;  3KP9 A;  3F4S A;  5HQP A;  3QR6 A;  5HR2 A;  5HR1 A;  3KTL A;  1THO A;  3QFB C;  4WET A;  4WF5 A;  1A24 A;  2F9S A;  4MZW A;  3CSI A;  4DSS A;  5IOX A;  5B6N A;  2RM6 A;  1K0C A;  2CZ2 A;  3VFI A;  5CRW A;  1TRS A;  3DVW A;  2FHE A;  2M46 A;  2X99 A;  1M99 A;  3PR8 A;  3PIN A;  4XRA A;  1BG5 A;  5F07 A;  4TW5 A;  4E8H A;  2GGT A;  5CP1 A;  1GLP A;  4ECB A;  1FVJ A;  4I8B A;  2FA4 A;  1O81 A;  2FD3 A;  1VRS D;  5A4W A;  4IKH A;  1Z6M A;  4KND A;  4V2L A;  4RQR A;  3IAS 2;  1C72 A;  3LXZ A;  4QQ7 A;  5CRG A;  1GNW A;  2WS2 A;  1GSE A;  4I5Q A;  5G1K A;  1NW2 A;  2OE1 A;  3ZFL A;  3M3M A;  5F8B A;  3TKR A;  4YQM A;  3KTB A;  3KIJ A;  8GSS A;  5J5N A;  2DSA A;  5CRH A;  1XIY A;  1ZOF A;  5FHI A;  5EY6 A;  2CA8 A;  4BVX A;  1FW1 A;  5FWG A;  3IR4 A;  2PGT A;  5HFI A;  2IPA A;  1WMJ A;  5GSS A;  1SYX A;  3UJ1 A;  5IQY A;  1PL1 A;  2C3T A;  3BBY A;  3DD3 A;  4MJE A;  3CSJ A;  3DVX A;  4ACS A;  4N11 A;  4PUF C;  1AUC A;  2OA7 A;  3EMX A;  4RI7 A;  3N5O A;  3CBU A;  4G0K A;  4TRX A;  13GS A;  3FR6 A;  5ECM B;  1YF0 A;  1GUM A;  1E6B A;  4WR5 A;  3VUR A;  5IIZ A;  2JAD A;  4DEJ A;  1JZR A;  1PX6 A;  3L9S A;  2K6V A;  3A2V A;  2VD0 A;  3TKP A;  2L5L A;  2NPB A;  4AF2 A;  4EKZ A;  4IQA A;  4AJ6 A;  3HZ4 A;  1MTC A;  4WR4 A;  4FYC A;  4F0C A;  4JRR A;  3FHK A;  1K0A A;  2K9F A;  1X9S B;  2LNT A;  4J2F A;  2FUG 2;  3HVV A;  2L57 A;  1GTI A;  2GT6 A;  3H8Q A;  4MF7 A;  3QAG A;  3D5J A;  3G7Y A;  1T3B A;  4POM A;  5JWR B;  14GS A;  3DIE A;  4BVY B;  2L4Q A;  4IQ1 A;  2J9H A;  4FYU A;  2GZZ A;  1T4Z A;  3ED3 A;  1TU8 A;  2H19 A;  1M2B A;  4GST A;  2GQM A;  1GSS A;  4K7O A;  4CHS A;  4I2U A;  5J41 A;  12GS A;  4MF5 A;  3TRQ A;  5IO2 A;  4KA0 A;  3MAK A;  2GQL A;  1GSQ A;  5HFK A;  3KZQ A;  3TJB A;  2VLU A;  4ULX A;  1JZD A;  4G0I A;  3M8N A;  2PPT A;  2FY6 A;  4NAX A;  1K0O A;  3P2A A;  3R2Q A;  4MPF A;  4OCF A;  4OD7 A;  2X8H A;  1VF2 A;  4MJA A;  5DJL A;  5GZZ B;  4EO3 A;  2O87 A;  4IS0 A;  4FYB A;  3GKN A;  2FWF A;  3E9J B;  3RHB A;  1GH2 A;  4KX4 A;  4HJ2 A;  5DJM A;  1O6J A;  5G2Z A;  3IPZ A;  3KD0 A;  5LCZ A;  5GST A;  3KM6 A;  2QGV A;  3TOU A;  3GX0 A;  1A23 A;  1WIK A;  1NHY A;  5KEJ A;  3G9B A;  5LD0 A;  1EWX A;  1XWB A;  1JFU A;  4TXV A;  5IMD A;  4K2D A;  2YOI A;  4WXT A;  2HRK A;  2YZH A;  3C1R A;  4O32 A;  1ZMA A;  1E2Y A;  3VK9 A;  3TKS A;  2VL9 A;  5ELG A;  5D8I A;  22GS A;  3KJY A;  4RI6 A;  5EVO A;  2BMX A;  2H74 A;  4TR3 A;  5F06 A;  4AGS A;  2H6X A;  4L5O A;  1IYI A;  1YKC A;  3UVH A;  18GS A;  1DSB A;  2VLT A;  3DGQ A;  1JLV A;  5FT3 A;  3HJO A;  3APS A;  3GHA A;  5KN2 A;  1F3B A;  3KMN A;  4IHU A;  3EYT A;  2TRX A;  4MDC A;  2B1K A;  2C80 A;  1NM3 A;  3MSZ A;  2PER A;  3CRU A;  2B7J A;  4L5L A;  2XHF A;  4XRD A;  1CQH A;  2LKU A;  2WUL A;  4TR1 B;  3IHQ A;  7GSS A;  5DAK A;  3H79 A;  3A2X A;  2YZU A;  3PH9 A;  3TJJ A;  1PSQ A;  1H75 A;  4P3Y B;  6GSU A;  5IMF A;  3SBC A;  2H70 A;  2YAN A;  5ECP B;  4PXO A;  2VL2 A;  3LG6 A;  1U3A A;  4FH8 A;  1KEB A;  1MDJ A;  2I9H A;  1ZCP A;  2L4C A;  3F4R A;  3L78 A;  5D96 A;  3EU4 A;  1VF4 A;  2LS5 A;  1U3I A;  2AJQ B;  3WD6 A;  4KDU A;  1F3A A;  3LGC A;  3F6F A;  2P0G A;  2HYX A;  1KTE A;  3GFK A;  3ZRD A;  4KF9 A;  3EMP A;  3PGT A;  2QKE A;  6GST A;  4IW9 A;  1XFL A;  2R37 A;  2F8F A;  3CXG A;  1R7H A;  1OAZ A;  3K8N A;  5IPG A;  4IP6 A;  4QL9 A;  4TKY A;  4BWS A;  1GL8 A;  2XPE A;  1YF1 A;  5KN0 A;  3RBT A;  1XWG A;  1F6M C;  2YJH A;  2JAC A;  1EGO A;  4MCU A;  1EP7 A;  2K18 A;  3GSS A;  1HNA A;  2LST A;  4MJC A;  4I2T A;  2RUF A;  5IM9 A;  4V1A g;  10GS A;  1SL0 B;  2LTK A;  4JE1 A;  2O89 A;  1N8J A;  1YZX A;  2VO4 A;  2H0G A;  4HS1 A;  5COH A;  2HFD A;  4MJB A;  2LV3 A;  3VWU A;  5IMZ A;  2FWH A;  5JWQ B;  4BPY A;  3FY7 A;  4HU7 A;  5DCH A;  3KCM A;  2WZ9 A;  1BQ7 A;  2HLS A;  2OE3 A;  4WEY A;  2CX4 A;  4EVM A;  4KAE A;  5IMV A;  5A5K A;  2HE3 A;  1G7E A;  2H1A A;  3TKQ A;  3KGK A;  3HVS A;  5G31 A;  3HJP A;  1QGV A;  4XIH A;  3ERG A;  1OYJ A;  4ZB9 A;  2LEG A;  3UEM A;  1TKD B;  1K3O A;  3GL3 A;  3LJR A;  1PQN A;  3TRP A;  3TKS E;  3VPT A;  4KSO A;  3ZVJ A;  1Q98 A;  3ZIV A;  4TVE A;  2LJK A;  2I1U A;  3ZLP A;  3EIN A;  1WOU A;  1U88 A;  2HSY A;  1MEK A;  4YH2 A;  5GAN D;  5HR3 A;  1Z5Y E;  2FNO A;  4L0U A;  2A2R A;  4IJI A;  5ID2 A;  2H75 A;  4ZL8 A;  4OFN A;  1DE1 A;  4GTU A;  4ML1 A;  4FQU A;  3DRN A;  1PN9 A;  4CDO A;  4TN8 A;  2H01 A;  1BX9 A;  5CRD A;  2YV9 A;  2GST A;  1A2L A;  2H0H A;  5LNK e;  4G0L A;  1ON4 A;  5AN1 A;  2AV4 A;  1G6Y A;  3WGE A;  2KP1 A;  3QDN A;  2CZ3 A;  2AAW A;  1V98 A;  4XS4 A;  2MBT A;  2FLS A;  4K6X A;  2WRT A;  1B4P A;  1SEN A;  1XVW A;  3DKS A;  1R5P A;  1J9B A;  3VLN A;  3GUS A;  1A8L A;  3C7M A;  2VLV A;  4V2M A;  2B6M A;  5H5R A;  1FVK A;  4N10 A;  5CAX A;  1ILO A;  1SK1 A;  2LJA A;  3N9J A;  2DJ1 A;  1ZL9 A;  3HVX A;  4EUY A;  4POB A;  2DJ0 A;  2V2G A;  3WGD A;  2HI7 A;  2D2Z A;  2YWI A;  4MP4 A;  2R4V A;  2H1D A;  1SU9 A;  2C0F A;  2IJY A;  2EIO A;  20GS A;  4V1A p;  4PNG A;  1GNE A;  1OE7 A;  4HZ2 A;  3F3Q A;  1USB A;  4N0Z A;  5JWO B;  2N5B A;  4NHZ A;  4BL7 B;  1K3Y A;  4OO4 A;  4XCS A;  1AQV A;  3H1N A;  2VIM A;  3LQ7 A;  3NZN A;  1SKW B;  4K7N A;  4PNF A;  4Q5N A;  4GSS A;  2IFQ B;  3EVI A;  2P5R A;  4EDZ A;  2C0E A;  2IWT A;  2GLR A;  4JR4 A;  1S3D A;  3FK8 A; 
#chains in the Genus database with same CATH topology
 4D73 B;  1XW5 A;  2MMO A;  3CWG A;  5CRE A;  1PD2 1;  1V58 A;  2YPM A;  3ZL5 A;  19GS A;  4ECC A;  3HXS A;  2VCW A;  5G5F A;  3ZMK A;  1AC1 A;  1GSD A;  2H1B A;  4HOJ A;  3FZA A;  3RPN A;  3IV4 A;  2YNX A;  4NV5 A;  1NHO A;  3TDG A;  4CY6 A;  4GQF A;  2VM1 A;  3H93 A;  3ME7 A;  3A2W A;  1TRU A;  3HDC A;  1SJI A;  4X0X A;  1OC9 B;  1TP9 A;  2H0I A;  3FW2 A;  4KE3 A;  4NHW A;  1YEP A;  2H1G A;  1V9W A;  5AGY A;  2DJ3 A;  3ZVJ D;  2DJ2 A;  2EC4 A;  1PRX A;  3E3E A;  3FRC A;  3IHG A;  2LUS A;  3TJG A;  3VI7 A;  3VWV A;  2X8C A;  4YAP A;  5DBQ A;  2RII A;  2K8V A;  5ELA A;  1X5D A;  3HJM A;  1XBS A;  2PBJ A;  3MWH A;  2ON7 A;  4NWY A;  3JCM L;  2XC2 A;  3W8S A;  2IME A;  4L8E A;  4N0V A;  4GLT A;  3P8W A;  4E8E A;  2JU5 A;  3M9K A;  4KH7 A;  4AKX B;  1EOG A;  1ZZY A;  1OC8 A;  3LYK A;  1QUW A;  1JLW A;  2O7K A;  2E0Q A;  2O85 A;  2EFC A;  3GA4 A;  3CMI A;  1PA3 A;  4GXZ A;  2WVY A;  5A34 B;  1T4Y A;  3L4N A;  1VF3 A;  3UIW A;  4PUA A;  3ERF A;  4IGJ A;  2PVO C;  5HR0 A;  2CT6 A;  3C8E A;  2EIQ A;  3ZIJ A;  1XOA A;  5J4Y A;  5DCG A;  2V41 A;  2RM5 A;  3IOS A;  5AIX A;  2L6D A;  3TJF A;  4MZB A;  1EGR A;  3ZRE A;  2A4H A;  4GQC A;  1Z9H A;  1O8W A;  4TR1 A;  3WT2 A;  1ACV A;  2KP2 A;  2N5A A;  3FMW A;  1XVQ A;  1V40 A;  2DMM A;  3GKM A;  3ERW A;  4G19 A;  5D73 A;  2GZY A;  4POL A;  4O7H A;  4TR0 A;  3TJK A;  5DAL B;  2WCI A;  3I43 A;  1HNC A;  4HQZ A;  2RLI A;  2DLX A;  1JHB A;  1I5G A;  4NMU A;  4N3Z A;  2H66 A;  3GUR A;  2AUV A;  4ECJ A;  2DML A;  4QL7 A;  2YP6 A;  4MK3 A;  1OC3 A;  3R3E A;  5AIS A;  4EC0 A;  2ALB A;  1FO5 A;  4OFM A;  1T7P B;  5F0G A;  2O8V B;  4HI7 A;  5KOX A;  2E2G A;  3ME8 A;  4TXO A;  2EIR A;  4ZIJ A;  3HMJ G;  1TDI A;  1PKZ A;  1AIU A;  2F51 A;  2CX3 A;  4K8M A;  3H4K A;  2HRN A;  1YVL A;  1CQG A;  2QC7 A;  2J23 A;  3HHV A;  3KH9 A;  3LYP A;  3LFL A;  4AJ8 A;  3GTU B;  4E68 A;  4LL4 B;  3VWW A;  2EFE A;  5ECK B;  2A2P A;  3PPU A;  4ID0 A;  2L59 A;  4K7I A;  3L9U A;  1Z7P A;  4O5Q A;  1Z6N A;  3HYP A;  5DDL A;  5E4W A;  2HXK A;  4GCI A;  1X0R A;  3AY8 A;  4PX1 A;  3RGB C;  3V1W A;  2BJX A;  2GS3 A;  5ECR B;  2DIZ A;  5J4U A;  1LBK A;  4EXJ A;  3SWL A;  2DC5 A;  3FZ9 A;  1N2A A;  3MNG A;  1AXD A;  3IA1 A;  1PKW A;  3LWA A;  1G7O A;  3L9V A;  1SKR B;  2CAQ A;  2C4J A;  1B9Y C;  3BCK A;  4BWQ A;  4I97 A;  4PQH A;  1TRW A;  2GT5 A;  2OE0 A;  2A2S A;  4ZXG A;  4F82 A;  2GVP A;  1M0U A;  1XPV A;  4IEL A;  2MBS A;  3J7Y b;  1GSY A;  3O6T A;  3DEX A;  2HSN A;  4ZL9 A;  4O92 A;  2X64 A;  1EZK A;  3IE3 A;  5DVB A;  3EWL A;  4GRF A;  1FOV A;  1XXU A;  1ML6 A;  1S3R A;  2QA2 A;  5H5S A;  2HNL A;  4OO5 A;  2A4V A;  2VCZ A;  1KNG A;  2ZNM A;  4JU5 A;  5INY A;  1FHE A;  3UAR A;  1THX A;  2R5G A;  2JZS A;  3GKK A;  2WGR A;  3F63 A;  3CYN A;  4NPB A;  2Z9S A;  3F8U A;  2REM A;  2GQK A;  2DJK A;  3WGX A;  1GUL A;  6GSW A;  5J47 A;  1ERT A;  3WT1 A;  2LQO A;  3RPP A;  1FOH A;  2HSM B;  3I9V 2;  5GAP D;  3D4M A;  3LXT A;  2V1M A;  2WVZ A;  3DYR A;  3KXO A;  1T8E B;  1H4O A;  1K3L A;  5L71 A;  5DQS A;  3D21 A;  1BED A;  1MDI A;  1OKD A;  1R26 A;  2JZT A;  3EU3 A;  1GRX A;  3CSH A;  4IP1 A;  1UA5 A;  2VKZ G;  4Q5R A;  3TUE A;  1WWJ A;  3J7Y k;  4KB3 A;  5ECQ B;  1HD2 A;  3I6A A;  5D9X A;  4RQX A;  1WRY A;  1YQ1 A;  2VM2 A;  1R4W A;  4MH3 A;  2H30 A;  4TOP A;  3UBK A;  3IXR A;  1TRV A;  5C04 A;  5J9C A;  2IMD A;  1A2J A;  1HYU A;  2JZR A;  3EPT A;  1SL1 B;  4DVC A;  3UAP A;  3APQ A;  1RW1 A;  3DWV A;  4FO5 A;  2VCQ A;  3S9F A;  4K0G A;  1M3J A;  3EE2 A;  1T1V A;  4GF0 A;  3DXB A;  1SD9 A;  2H73 A;  4BL7 A;  2VCV A;  4IJ3 A;  3IDV A;  5CO3 A;  1A0R P;  1OE8 A;  1SJZ A;  3D22 A;  1VGL A;  4KGI A;  1ZYQ B;  5BMU B;  4N30 A;  1TI3 A;  3ZML A;  3A5W A;  3ZYW A;  3Q19 A;  1OVN A;  2YV7 A;  3MDK A;  3FZ4 A;  5IPH A;  2HT9 A;  1UN2 A;  2GTU A;  1GP1 A;  1O73 A;  4O5U A;  4HZ4 A;  2FCH A;  4JED A;  4GSN A;  2LRT A;  3TCO A;  4O5R A;  1G6W A;  2TIR A;  3U6V A;  1EEM A;  1M9A A;  3GNJ A;  3OR5 A;  5D9W A;  1TW9 A;  4J56 E;  1GTB A;  3LSZ A;  4JZQ A;  2VAF A;  2ZUP A;  2VUP A;  2F3M A;  4F0B A;  1ERV A;  4XS6 A;  1EOH A;  3BCI A;  3TOT A;  3Q18 A;  1QXH A;  1O8X A;  4AJ7 A;  2O36 A;  3BOA A;  1UC7 A;  5F05 A;  3HKR A;  2K8S A;  5JCW A;  4PHZ C;  2B1L A;  2C1Y A;  1Z7R A;  2QSI A;  4PGT A;  1VF1 A;  3FZ5 A;  4ECI A;  4X1U A;  1M7T A;  1URM A;  2GSR A;  2HRA A;  2YCD A;  4PTS A;  1ERU A;  2V32 A;  3LOR A;  1S4B P;  4DSQ A;  2WFC A;  3NIV A;  2IL3 A;  5IOW A;  1GUK A;  1K0D A;  1ZGN A;  2G2Q A;  3UOM A;  2IMI A;  4YQV A;  4BA7 A;  1GTA A;  2PMT A;  3UBL A;  1J0F A;  1GUH A;  3TB2 A;  11GS A;  2YN1 A;  2CAI A;  2MMA A;  2HSH A;  2HQT A;  2UZ8 A;  3BJ5 A;  5B8B A;  2F8A A;  3ZZX A;  5C00 A;  3UVT A;  3G7I A;  3KEB A;  2WVX B;  1SVO A;  4HU9 A;  2E7P A;  2NBS A;  5A34 A;  3M1G A;  1BJX A;  17GS A;  3U5R E;  2I3Y A;  4BVY A;  4HEA 2;  3ZIT A;  3CHX C;  4EDY A;  4ML6 A;  3L0H A;  1SJ6 A;  3QD9 A;  2FGX A;  1AQW A;  1R5A A;  3DML A;  2V6O A;  3RHC A;  3MIX A;  2ES7 A;  1JZO A;  2B5Y A;  4AKI A;  2M80 A;  3F0I A;  2HZE B;  4HDE A;  2CVD A;  1WJK A;  1A0F A;  1XWA A;  5G5E A;  4USS A;  3P7X A;  2PUK C;  2B5E A;  1SVL A;  1WP0 A;  1U87 A;  3QAW A;  3QPM A;  3WYW A;  4HQS A;  2XPD A;  4ZB8 A;  3IBH A;  2GDR A;  1YKA A;  1SL2 B;  5DAL A;  1W4V A;  1X9W B;  5ENU A;  2DIY A;  5J3R A;  2PVQ A;  3CTF A;  1HNB A;  1MD4 A;  3F4T A;  2WW0 A;  3FR3 A;  2KHP A;  4ILF A;  3KP8 A;  4Z7X A;  1WPI A;  4AKH A;  3G7J A;  1B8X A;  5D9V A;  2CV4 A;  1TK0 B;  5ID2 B;  3D6I A;  2YWM A;  4KCE A;  4XTS A;  3TRX A;  5ECS A;  4WBR D;  2C8U A;  1YJ6 A;  1TXX A;  4CW9 A;  5A5H B;  5IO0 A;  4EE0 A;  4HUA A;  4OMV A;  1O85 A;  4MZC A;  1DE2 A;  4DSS B;  3APO A;  4NV2 A;  1A2M A;  2CVB A;  3D0Z A;  2KLX A;  1T00 A;  3IC4 A;  4MA9 A;  4FIW A;  5JCU A;  3GTU A;  4XS4 B;  4AKG A;  4AI6 A;  4Q5Q A;  3M9J A;  1AQX A;  4K5R A;  3P90 A;  3C71 A;  3VWX A;  1S3C A;  2LNS A;  1W89 A;  3HZ8 A;  1F37 A;  5G1L A;  1EV4 A;  4JBB A;  1B4Q A;  2B7K A;  2E2M A;  3CRT A;  1SVM A;  3C73 A;  5ECH B;  1KBN A;  3RDW A;  3Q74 A;  4NXI A;  1EV9 A;  5B6M A;  2IN3 A;  4JR6 A;  2I81 A;  2B5X A;  5ECL B;  2OKA A;  4G10 A;  4XS1 A;  1DBY A;  1AAZ A;  3M0F A;  4ZIL A;  1TOF A;  2OBI A;  4MMM A;  4L0W A;  1TTZ A;  4RUV A;  5ECO B;  1B9X C;  2X8G A;  3HA9 A;  4Q5F A;  3GN3 A;  4ZBD A;  5ECN B;  3TKS C;  5CNW A;  5DQY A;  2NDO A;  4YKG A;  4LMV A;  5G30 A;  1GWC A;  2C0D A;  5CYY A;  3LW9 A;  2ZCT A;  2XBQ A;  2X4A A;  2C3Q A;  3GH9 A;  3Q6O A;  2CVK A;  4F2I A;  5A4U A;  4GDF A;  1YEX A;  4LL1 B;  3E0U A;  4IBP A;  4BVX B;  4ZB7 A;  1ERW A;  2YWO A;  1GSF A;  5JCG A;  4EF0 A;  1TU7 A;  3IK7 A;  2MMN A;  2P31 A;  2OAC A;  1ZYE A;  1J08 A;  3GL5 A;  1I9D A;  1K0M A;  1RQM A;  3CTG A;  1PX7 A;  4KDX A;  2B3S A;  2GSS A;  2L6C A;  1QMV A;  6GSS A;  4EL1 A;  3US3 A;  1SK0 A;  2NVL A;  2MMZ A;  1NSW A;  3EC3 A;  3ISO A;  4LA1 A;  2HSM A;  2V6K A;  2JL4 A;  4MLY A;  3F6D A;  3O76 A;  2YJ7 A;  4KW6 A;  5KN1 A;  2X49 A;  4G2E A;  4ZBB A;  2LRC A;  1N25 A;  3GIX A;  2L5O A;  1PN0 A;  3C1S A;  4LMW A;  3O3T A;  3EUR A;  3QMX A;  1U6T A;  5KN3 A;  2VL2 C;  2GZP A;  3FKF A;  1BYE A;  2AHE A;  3I69 A;  1XW6 A;  5EPF A;  4F9Z A;  3NOF A;  2VCT A;  1XWC A;  1TK5 B;  2PWJ A;  4Z2R A;  3GV1 A;  3W6G A;  3IK9 A;  2FWG A;  3ZFB A;  2NTO A;  1SK2 A;  1XCC A;  5KOW A;  3FEU A;  1S3A A;  1SYR A;  2JSY A;  2O3E A;  3UL3 A;  16GS A;  2N5F A;  5HFG A;  4YAV A;  4IN0 A;  1Y6E A;  2R6K A;  3QAV A;  1UVZ A;  1YEW C;  2DJJ A;  2FWE A;  2H76 A;  2M72 A;  2P5Q A;  4KSM A;  4WKW A;  1FB6 A;  5IMA A;  4G9H A;  5E59 A;  1XOB A;  3LEF A;  1M3I A;  3A3T A;  1TK8 B;  1MD3 A;  3VPQ A;  5EL8 A;  4A5P A;  2WJU A;  5ECI B;  1GLQ A;  5D93 A;  4PQI A;  5A4V A;  2G0F A;  2LQQ A;  2OJL A;  2VCX A;  3FYG A;  5J40 A;  2PU9 C;  1RK4 A;  1WE0 A;  1K0B A;  4K1F A;  4EIQ A;  2H8L A;  3TGZ A;  2MZC A;  2VOC A;  5BMU A;  1QFN A;  1K0N A;  3KMO A;  3F9U A;  4WBJ A;  2WZS A;  4ZBA A;  9GSS A;  1TJD A;  1PMT A;  1YDK A;  3GX8 A;  1BG1 A;  2FA8 A;  3FR9 A;  3D4T A;  4H86 A;  4X43 A;  5J9B A;  4ZB6 A;  2KOK A;  1XZO A;  3GH6 A;  1M2D A;  1Q4J A;  2LRN A;  6GSY A;  1SKS B;  3HY2 A;  4OCE A;  4F03 A;  5B7C A;  3F3R A;  1JZW A;  2WW3 A;  4PQ1 A;  4K0N A;  5BRT A;  1F9M A;  2VL3 A;  4ISD A;  4TR4 A;  3W8J A;  4OWY A;  4ZL7 A;  4TXO B;  1HQO A;  4YQU A;  1GSU A;  3HCZ A;  3ZTL A;  1FG4 A;  4I6X A;  2HRK B;  3GKX A;  1X5E A;  1ABA A;  5B8A A;  3RAZ A;  1FB0 A;  4POK A;  2YWN A;  1X5C A;  4KDY A;  3QOU A;  1BAY A;  5IMC A;  2WDU A;  2R2J A;  2AYT A;  5D9T A;  5AIV A;  4K9Z A;  2BTO T;  2XBI A;  1F2E A;  1LJR A;  1O7U A;  4KCA A;  3QCP A;  3GRX A;  1GTU A;  4LLR A;  3GYK A;  4DSR A;  2C3N A;  1M9B A;  4OFT A;  2VD1 A;  3IC8 A;  1OKT A;  1DUG A;  1EEJ A;  2WVX A;  1G0T A;  1M2A A;  1QK8 A;  1Y25 A;  3GMF A;  3KH7 A;  1XWK A;  1SD8 A;  3GST A;  2GSQ A;  5H5Q A;  2H72 A;  2R3X A;  2C0G A;  2I4A A;  1IYH A;  2IIY A;  2MYG A;  4V2N A;  1X9M B;  4MF6 A;  1MDK A;  3IAM 2;  3UMA A;  3BD2 A;  1EP8 A;  2TRC P;  4J57 E;  4KUN A;  1XW9 A;  2OAD A;  5ABR A;  4FXY P;  2DBC A;  2IMK A;  4IVF A;  1TI1 A;  2HSN B;  3IRA A;  4PUR A;  1BF5 A;  5DAK B;  2HZE A;  2IFQ A;  2H71 A;  4MNN A;  4XHM A;  2WB9 A;  4MAB A;  2HZF A;  2JSZ A;  3QFA C;  1ST9 A;  6GSX A;  4D73 A;  4MH2 A;  1V2A A;  4GWR A;  1PGT A;  2CQ9 A;  2IMF A;  2AB6 A;  2ON5 A;  1YY7 A;  1V57 A;  1AW9 A;  2HRF A;  2LJR A;  2OBK A;  4YKF A;  2KUC A;  1Z3E A;  2PN8 A;  4MPG A;  6GSV A;  1PL2 A;  2H6Y A;  3VI5 A;  2H6Z A;  2RUE A;  1QQ2 A;  4HJM A;  2WW1 A;  1A8Y A;  4WF4 A;  1B48 A;  3HD5 A;  1FAA A;  1LU4 A;  1OC9 A;  3KP9 A;  3F4S A;  5HQP A;  3QR6 A;  5HR2 A;  5HR1 A;  3KTL A;  5A5H A;  1THO A;  3QFB C;  4WET A;  4WF5 A;  1A24 A;  2F9S A;  4MZW A;  3CSI A;  4DSS A;  4K5S A;  5IOX A;  4BIK A;  5B6N A;  2RM6 A;  1K0C A;  1I1I P;  2CZ2 A;  3VFI A;  5CRW A;  1TRS A;  3DVW A;  2EFD A;  2FHE A;  2M46 A;  2X99 A;  1M99 A;  3PR8 A;  3PIN A;  4XRA A;  1BG5 A;  4PI0 C;  5F07 A;  4TW5 A;  4E8H A;  2GGT A;  1TXU A;  5CP1 A;  1GLP A;  4ECB A;  1XG8 A;  1FVJ A;  4I8B A;  4EIP A;  2FA4 A;  1O81 A;  2FD3 A;  1VRS D;  5A4W A;  4IKH A;  2H1L A;  1Z6M A;  4KND A;  4V2L A;  4RQR A;  3IAS 2;  1C72 A;  3LXZ A;  4QQ7 A;  5CRG A;  1GNW A;  2WS2 A;  1GSE A;  4I5Q A;  5G1K A;  1NW2 A;  2OE1 A;  3ZFL A;  3M3M A;  5F8B A;  3TKR A;  4YQM A;  3KTB A;  3KIJ A;  8GSS A;  5J5N A;  2DSA A;  5CRH A;  2WW2 A;  1XIY A;  1ZOF A;  5FHI A;  5EY6 A;  2CA8 A;  4BVX A;  1FW1 A;  5FWG A;  3IR4 A;  2PGT A;  5HFI A;  2IPA A;  1WMJ A;  5GSS A;  1SYX A;  3UJ1 A;  5IQY A;  1PL1 A;  2C3T A;  3BBY A;  3DD3 A;  4MJE A;  3CSJ A;  3DVX A;  4ACS A;  4N11 A;  4PUF C;  1AUC A;  2OA7 A;  3EMX A;  4RI7 A;  3N5O A;  3CBU A;  4G0K A;  4TRX A;  13GS A;  3FR6 A;  5ECM B;  1YF0 A;  1GUM A;  1E6B A;  4WR5 A;  2DKH A;  3VUR A;  5IIZ A;  2JAD A;  4DEJ A;  1JZR A;  1PX6 A;  3L9S A;  2K6V A;  3A2V A;  2VD0 A;  3TKP A;  2L5L A;  2NPB A;  4AF2 A;  4EKZ A;  4IQA A;  4AJ6 A;  3HZ4 A;  1MTC A;  4WR4 A;  4FYC A;  4F0C A;  4JRR A;  3FHK A;  1K0A A;  2K9F A;  1X9S B;  2LNT A;  4J2F A;  2FUG 2;  3HVV A;  2L57 A;  1GTI A;  2GT6 A;  3H8Q A;  4MF7 A;  3QAG A;  3D5J A;  3G7Y A;  1T3B A;  4POM A;  5JWR B;  5A1N B;  14GS A;  3DIE A;  4BVY B;  2L4Q A;  4IQ1 A;  2J9H A;  4FYU A;  2GZZ A;  1T4Z A;  3ED3 A;  1TU8 A;  2H19 A;  1M2B A;  3RFR C;  4GST A;  2GQM A;  1GSS A;  4K7O A;  4CHS A;  4I2U A;  5J41 A;  12GS A;  4MF5 A;  3TRQ A;  5IO2 A;  4KA0 A;  3MAK A;  2GQL A;  1GSQ A;  5HFK A;  3KZQ A;  3TJB A;  2VLU A;  4ULX A;  1JZD A;  4G0I A;  3M8N A;  2PPT A;  2FY6 A;  4NAX A;  1K0O A;  3P2A A;  3R2Q A;  4MPF A;  2QA1 A;  4OCF A;  4OD7 A;  2X8H A;  1VF2 A;  4MJA A;  5DJL A;  5GZZ B;  4EO3 A;  2O87 A;  4IS0 A;  2R0C A;  4FYB A;  1Y1U A;  3GKN A;  4ICY A;  2FWF A;  3E9J B;  3RHB A;  1GH2 A;  4KX4 A;  4HJ2 A;  5DJM A;  1O6J A;  5G2Z A;  3IPZ A;  3KD0 A;  5LCZ A;  5GST A;  3KM6 A;  2QGV A;  3TOU A;  3GX0 A;  1A23 A;  1WIK A;  1ZYN A;  1NHY A;  5KEJ A;  3G9B A;  5LD0 A;  1EWX A;  1XWB A;  1JFU A;  4TXV A;  5IMD A;  4K2D A;  2YOI A;  4WXT A;  2HRK A;  2YZH A;  3C1R A;  4O32 A;  1ZMA A;  1E2Y A;  3VK9 A;  3TKS A;  2VL9 A;  5ELG A;  5D8I A;  4HSC X;  22GS A;  3KJY A;  4RI6 A;  2R0G A;  5EVO A;  2BMX A;  2H74 A;  4TR3 A;  5F06 A;  4AGS A;  3MYD A;  2H6X A;  4L5O A;  1IYI A;  1YKC A;  3UVH A;  18GS A;  1DSB A;  2VLT A;  3DGQ A;  1JLV A;  5FT3 A;  3HJO A;  3APS A;  3GHA A;  5KN2 A;  2R0P A;  1F3B A;  3KMN A;  4IHU A;  3EYT A;  2TRX A;  4MDC A;  2B1K A;  2C80 A;  1NM3 A;  3MSZ A;  2PER A;  3CRU A;  2B7J A;  4L5L A;  4CY8 A;  3A5I A;  2XHF A;  4XRD A;  1CQH A;  2LKU A;  2WUL A;  4TR1 B;  3IHQ A;  7GSS A;  2UV8 G;  5DAK A;  3H79 A;  3A2X A;  2YZU A;  3PH9 A;  3TJJ A;  1PSQ A;  4K2X A;  1H75 A;  4P3Y B;  6GSU A;  5IMF A;  3SBC A;  2H70 A;  2YAN A;  5ECP B;  4PXO A;  2VL2 A;  3LG6 A;  4G01 A;  1U3A A;  4FH8 A;  1KEB A;  1MDJ A;  2I9H A;  1ZCP A;  2L4C A;  3F4R A;  3L78 A;  5D96 A;  3EU4 A;  1VF4 A;  2LS5 A;  1U3I A;  2AJQ B;  3WD6 A;  2O5V A;  4KDU A;  1F3A A;  3LGC A;  3F6F A;  2P0G A;  2HYX A;  1KTE A;  4PI2 C;  3GFK A;  3ZRD A;  4KF9 A;  3EMP A;  3PGT A;  2QKE A;  6GST A;  4IW9 A;  1XFL A;  2R37 A;  2F8F A;  3CXG A;  1R7H A;  1OAZ A;  3K8N A;  5IPG A;  4IP6 A;  4QL9 A;  4TKY A;  4BWS A;  1GL8 A;  2XPE A;  1YF1 A;  5KN0 A;  3RBT A;  5J4V A;  1XWG A;  1F6M C;  2YJH A;  2JAC A;  1EGO A;  4MCU A;  1EP7 A;  2K18 A;  3HVN A;  3GSS A;  1HNA A;  2LST A;  4MJC A;  4I2T A;  2RUF A;  4X4J A;  5IM9 A;  4V1A g;  10GS A;  1SL0 B;  2DKI A;  2LTK A;  1PFO A;  4QMK A;  4JE1 A;  2O89 A;  1N8J A;  1YZX A;  2VO4 A;  2OT3 A;  1ZYP A;  2H0G A;  4HS1 A;  5COH A;  2HFD A;  4MJB A;  2LV3 A;  3VWU A;  5IMZ A;  2FWH A;  5JWQ B;  4BPY A;  3FY7 A;  4HU7 A;  5DCH A;  3KCM A;  2WZ9 A;  1BQ7 A;  2HLS A;  2OE3 A;  4WEY A;  2CX4 A;  4Z2U A;  4EVM A;  4KAE A;  5IMV A;  5A5K A;  2HE3 A;  1G7E A;  3TU3 B;  2H1A A;  3TKQ A;  3KGK A;  3HVS A;  5G31 A;  3HJP A;  1QGV A;  4Z2T A;  4XIH A;  3ERG A;  1OYJ A;  4ZB9 A;  2LEG A;  3UEM A;  1TKD B;  1K3O A;  3GL3 A;  3LJR A;  1PQN A;  3TRP A;  3TKS E;  3VPT A;  4KSO A;  3ZVJ A;  1Q98 A;  3ZIV A;  4W66 A;  4TVE A;  2LJK A;  2I1U A;  3ZLP A;  3EIN A;  1WOU A;  1U88 A;  2HSY A;  1MEK A;  4YH2 A;  5GAN D;  5HR3 A;  1Z5Y E;  2FNO A;  4L0U A;  2A2R A;  4IJI A;  5ID2 A;  2H75 A;  4ZL8 A;  4OFN A;  1DE1 A;  4GTU A;  4ML1 A;  4FQU A;  3DRN A;  1PN9 A;  4CDO A;  4TN8 A;  2H01 A;  1BX9 A;  2EFH A;  5CRD A;  2YV9 A;  2GST A;  1A2L A;  2H0H A;  5LNK e;  4G0L A;  1ON4 A;  5AN1 A;  2AV4 A;  1G6Y A;  3WGE A;  2KP1 A;  3QDN A;  2CZ3 A;  2AAW A;  1V98 A;  4XS4 A;  2MBT A;  2FLS A;  4K6X A;  2WRT A;  1B4P A;  1SEN A;  1XVW A;  3DKS A;  1R5P A;  1J9B A;  3VLN A;  3GUS A;  1A8L A;  3C7M A;  2VLV A;  4V2M A;  2B6M A;  5H5R A;  1FVK A;  4N10 A;  5CAX A;  1ILO A;  1SK1 A;  2LJA A;  3N9J A;  2DJ1 A;  1ZL9 A;  3HVX A;  4EUY A;  4POB A;  2DJ0 A;  2V2G A;  3WGD A;  2HI7 A;  2D2Z A;  2YWI A;  4MP4 A;  2R4V A;  2H1D A;  1SU9 A;  2C0F A;  2IJY A;  2EIO A;  20GS A;  4V1A p;  4PNG A;  1GNE A;  5A1N A;  1OE7 A;  4HZ2 A;  3F3Q A;  1USB A;  4N0Z A;  5JWO B;  2N5B A;  4NHZ A;  4BL7 B;  1K3Y A;  4OO4 A;  4XCS A;  1AQV A;  3H1N A;  2VIM A;  3LQ7 A;  3NZN A;  1SKW B;  4K7N A;  4PNF A;  4Q5N A;  4GSS A;  2IFQ B;  3EVI A;  2P5R A;  4EDZ A;  2C0E A;  2IWT A;  2GLR A;  3CQF A;  4JR4 A;  1S3D A;  3FK8 A; 
#chains in the Genus database with same CATH homology
 4D73 B;  1XW5 A;  2MMO A;  3CWG A;  5CRE A;  1PD2 1;  1V58 A;  2YPM A;  3ZL5 A;  19GS A;  4ECC A;  3HXS A;  2VCW A;  5G5F A;  3ZMK A;  1AC1 A;  1GSD A;  2H1B A;  4HOJ A;  3FZA A;  3RPN A;  3IV4 A;  2YNX A;  4NV5 A;  1NHO A;  3TDG A;  4CY6 A;  4GQF A;  2VM1 A;  3H93 A;  3ME7 A;  3A2W A;  1TRU A;  3HDC A;  1SJI A;  4X0X A;  1OC9 B;  1TP9 A;  2H0I A;  3FW2 A;  4KE3 A;  4NHW A;  1YEP A;  2H1G A;  1V9W A;  5AGY A;  2DJ3 A;  3ZVJ D;  2DJ2 A;  2EC4 A;  1PRX A;  3E3E A;  3FRC A;  3IHG A;  2LUS A;  3TJG A;  3VI7 A;  3VWV A;  2X8C A;  4YAP A;  5DBQ A;  2RII A;  2K8V A;  5ELA A;  1X5D A;  3HJM A;  1XBS A;  2PBJ A;  3MWH A;  2ON7 A;  4NWY A;  3JCM L;  2XC2 A;  3W8S A;  2IME A;  4L8E A;  4N0V A;  4GLT A;  3P8W A;  4E8E A;  2JU5 A;  3M9K A;  4KH7 A;  4AKX B;  1EOG A;  1ZZY A;  1OC8 A;  3LYK A;  1QUW A;  1JLW A;  2O7K A;  2E0Q A;  2O85 A;  2EFC A;  3GA4 A;  3CMI A;  1PA3 A;  4GXZ A;  5A34 B;  1T4Y A;  3L4N A;  1VF3 A;  3UIW A;  4PUA A;  3ERF A;  4IGJ A;  2PVO C;  5HR0 A;  2CT6 A;  3C8E A;  2EIQ A;  3ZIJ A;  1XOA A;  5J4Y A;  5DCG A;  2V41 A;  2RM5 A;  3IOS A;  5AIX A;  2L6D A;  3TJF A;  4MZB A;  1EGR A;  3ZRE A;  2A4H A;  4GQC A;  1Z9H A;  1O8W A;  4TR1 A;  3WT2 A;  1ACV A;  2KP2 A;  2N5A A;  3FMW A;  1XVQ A;  1V40 A;  2DMM A;  3GKM A;  3ERW A;  4G19 A;  5D73 A;  2GZY A;  4POL A;  4O7H A;  4TR0 A;  3TJK A;  5DAL B;  2WCI A;  3I43 A;  1HNC A;  4HQZ A;  2RLI A;  2DLX A;  1JHB A;  1I5G A;  4NMU A;  4N3Z A;  2H66 A;  3GUR A;  2AUV A;  4ECJ A;  2DML A;  4QL7 A;  2YP6 A;  4MK3 A;  1OC3 A;  3R3E A;  5AIS A;  4EC0 A;  2ALB A;  1FO5 A;  4OFM A;  1T7P B;  5F0G A;  2O8V B;  4HI7 A;  5KOX A;  2E2G A;  3ME8 A;  4TXO A;  2EIR A;  4ZIJ A;  3HMJ G;  1TDI A;  1PKZ A;  1AIU A;  2F51 A;  2CX3 A;  4K8M A;  3H4K A;  2HRN A;  1YVL A;  1CQG A;  2QC7 A;  2J23 A;  3HHV A;  3KH9 A;  3LYP A;  3LFL A;  4AJ8 A;  3GTU B;  4E68 A;  4LL4 B;  3VWW A;  2EFE A;  5ECK B;  2A2P A;  3PPU A;  4ID0 A;  2L59 A;  4K7I A;  3L9U A;  1Z7P A;  4O5Q A;  1Z6N A;  3HYP A;  5DDL A;  5E4W A;  2HXK A;  4GCI A;  1X0R A;  3AY8 A;  4PX1 A;  3V1W A;  2BJX A;  2GS3 A;  5ECR B;  2DIZ A;  5J4U A;  1LBK A;  4EXJ A;  3SWL A;  2DC5 A;  3FZ9 A;  1N2A A;  3MNG A;  1AXD A;  3IA1 A;  1PKW A;  3LWA A;  1G7O A;  3L9V A;  1SKR B;  2CAQ A;  2C4J A;  1B9Y C;  3BCK A;  4BWQ A;  4I97 A;  4PQH A;  1TRW A;  2GT5 A;  2OE0 A;  2A2S A;  4ZXG A;  4F82 A;  2GVP A;  1M0U A;  1XPV A;  4IEL A;  2MBS A;  3J7Y b;  1GSY A;  3O6T A;  3DEX A;  2HSN A;  4ZL9 A;  4O92 A;  2X64 A;  1EZK A;  3IE3 A;  5DVB A;  3EWL A;  4GRF A;  1FOV A;  1XXU A;  1ML6 A;  2QA2 A;  5H5S A;  2HNL A;  4OO5 A;  2A4V A;  2VCZ A;  1KNG A;  2ZNM A;  4JU5 A;  5INY A;  1FHE A;  3UAR A;  1THX A;  2R5G A;  2JZS A;  3GKK A;  2WGR A;  3F63 A;  3CYN A;  4NPB A;  2Z9S A;  3F8U A;  2REM A;  2GQK A;  2DJK A;  3WGX A;  1GUL A;  6GSW A;  5J47 A;  1ERT A;  3WT1 A;  2LQO A;  3RPP A;  1FOH A;  2HSM B;  3I9V 2;  5GAP D;  3D4M A;  3LXT A;  2V1M A;  3DYR A;  3KXO A;  1T8E B;  1H4O A;  1K3L A;  5L71 A;  5DQS A;  3D21 A;  1BED A;  1MDI A;  1OKD A;  1R26 A;  2JZT A;  3EU3 A;  1GRX A;  3CSH A;  4IP1 A;  1UA5 A;  2VKZ G;  4Q5R A;  3TUE A;  1WWJ A;  3J7Y k;  4KB3 A;  5ECQ B;  1HD2 A;  3I6A A;  5D9X A;  4RQX A;  1WRY A;  1YQ1 A;  2VM2 A;  1R4W A;  4MH3 A;  2H30 A;  4TOP A;  3UBK A;  3IXR A;  1TRV A;  5C04 A;  5J9C A;  2IMD A;  1A2J A;  1HYU A;  2JZR A;  3EPT A;  1SL1 B;  4DVC A;  3UAP A;  3APQ A;  1RW1 A;  3DWV A;  4FO5 A;  2VCQ A;  3S9F A;  4K0G A;  3EE2 A;  1T1V A;  4GF0 A;  3DXB A;  1SD9 A;  2H73 A;  4BL7 A;  2VCV A;  4IJ3 A;  3IDV A;  5CO3 A;  1A0R P;  1OE8 A;  1SJZ A;  3D22 A;  1VGL A;  4KGI A;  1ZYQ B;  5BMU B;  4N30 A;  1TI3 A;  3ZML A;  3A5W A;  3ZYW A;  3Q19 A;  1OVN A;  2YV7 A;  3MDK A;  3FZ4 A;  5IPH A;  2HT9 A;  1UN2 A;  2GTU A;  1GP1 A;  1O73 A;  4O5U A;  4HZ4 A;  2FCH A;  4JED A;  4GSN A;  2LRT A;  3TCO A;  4O5R A;  1G6W A;  2TIR A;  3U6V A;  1EEM A;  1M9A A;  3GNJ A;  3OR5 A;  5D9W A;  1TW9 A;  4J56 E;  1GTB A;  3LSZ A;  4JZQ A;  2VAF A;  2ZUP A;  2VUP A;  2F3M A;  4F0B A;  1ERV A;  4XS6 A;  1EOH A;  3BCI A;  3TOT A;  3Q18 A;  1QXH A;  1O8X A;  4AJ7 A;  3BOA A;  1UC7 A;  5F05 A;  3HKR A;  2K8S A;  5JCW A;  2C1Y A;  2B1L A;  1Z7R A;  2QSI A;  4PGT A;  1VF1 A;  3FZ5 A;  4ECI A;  4X1U A;  1M7T A;  1URM A;  2GSR A;  2HRA A;  2YCD A;  4PTS A;  1ERU A;  2V32 A;  3LOR A;  4DSQ A;  2WFC A;  3NIV A;  2IL3 A;  5IOW A;  1GUK A;  1K0D A;  1ZGN A;  2G2Q A;  3UOM A;  2IMI A;  4YQV A;  4BA7 A;  1GTA A;  2PMT A;  3UBL A;  1J0F A;  1GUH A;  3TB2 A;  11GS A;  2YN1 A;  2CAI A;  2MMA A;  2HSH A;  2HQT A;  2UZ8 A;  3BJ5 A;  5B8B A;  2F8A A;  3ZZX A;  5C00 A;  3UVT A;  3G7I A;  3KEB A;  1SVO A;  4HU9 A;  2E7P A;  2NBS A;  5A34 A;  3M1G A;  1BJX A;  17GS A;  3U5R E;  2I3Y A;  4BVY A;  4HEA 2;  3ZIT A;  4EDY A;  4ML6 A;  3L0H A;  1SJ6 A;  3QD9 A;  2FGX A;  1AQW A;  1R5A A;  3DML A;  2V6O A;  3RHC A;  3MIX A;  2ES7 A;  1JZO A;  2B5Y A;  4AKI A;  2M80 A;  3F0I A;  2HZE B;  4HDE A;  2CVD A;  1WJK A;  1A0F A;  1XWA A;  5G5E A;  4USS A;  3P7X A;  2PUK C;  2B5E A;  1SVL A;  1WP0 A;  1U87 A;  3QAW A;  3QPM A;  3WYW A;  4HQS A;  2XPD A;  4ZB8 A;  3IBH A;  2GDR A;  1YKA A;  1SL2 B;  5DAL A;  1W4V A;  1X9W B;  5ENU A;  2DIY A;  5J3R A;  2PVQ A;  3CTF A;  1HNB A;  1MD4 A;  3F4T A;  3FR3 A;  2KHP A;  4ILF A;  3KP8 A;  4Z7X A;  1WPI A;  4AKH A;  3G7J A;  1B8X A;  5D9V A;  2CV4 A;  1TK0 B;  5ID2 B;  3D6I A;  2YWM A;  4KCE A;  4XTS A;  3TRX A;  5ECS A;  4WBR D;  2C8U A;  1YJ6 A;  1TXX A;  4CW9 A;  5A5H B;  5IO0 A;  4EE0 A;  4HUA A;  4OMV A;  1O85 A;  4MZC A;  1DE2 A;  4DSS B;  3APO A;  4NV2 A;  1A2M A;  2CVB A;  3D0Z A;  2KLX A;  1T00 A;  3IC4 A;  4MA9 A;  4FIW A;  5JCU A;  3GTU A;  4XS4 B;  4AKG A;  4AI6 A;  4Q5Q A;  3M9J A;  1AQX A;  4K5R A;  3P90 A;  3C71 A;  3VWX A;  1S3C A;  2LNS A;  1W89 A;  3HZ8 A;  1F37 A;  5G1L A;  1EV4 A;  4JBB A;  1B4Q A;  2B7K A;  2E2M A;  3CRT A;  1SVM A;  3C73 A;  5ECH B;  1KBN A;  3RDW A;  3Q74 A;  4NXI A;  1EV9 A;  5B6M A;  2IN3 A;  4JR6 A;  2I81 A;  2B5X A;  5ECL B;  2OKA A;  4G10 A;  4XS1 A;  1DBY A;  1AAZ A;  3M0F A;  4ZIL A;  1TOF A;  2OBI A;  4MMM A;  4L0W A;  1TTZ A;  4RUV A;  5ECO B;  1B9X C;  2X8G A;  3HA9 A;  4Q5F A;  3GN3 A;  4ZBD A;  5ECN B;  3TKS C;  5CNW A;  5DQY A;  2NDO A;  4YKG A;  4LMV A;  5G30 A;  1GWC A;  2C0D A;  5CYY A;  3LW9 A;  2ZCT A;  2XBQ A;  2X4A A;  2C3Q A;  3GH9 A;  3Q6O A;  2CVK A;  4F2I A;  5A4U A;  4GDF A;  1YEX A;  4LL1 B;  3E0U A;  4IBP A;  4BVX B;  4ZB7 A;  1ERW A;  2YWO A;  1GSF A;  5JCG A;  4EF0 A;  1TU7 A;  3IK7 A;  2MMN A;  2P31 A;  2OAC A;  1ZYE A;  1J08 A;  3GL5 A;  1I9D A;  1K0M A;  1RQM A;  3CTG A;  1PX7 A;  4KDX A;  2B3S A;  2GSS A;  2L6C A;  1QMV A;  6GSS A;  4EL1 A;  3US3 A;  1SK0 A;  2NVL A;  2MMZ A;  1NSW A;  3EC3 A;  3ISO A;  4LA1 A;  2HSM A;  2V6K A;  2JL4 A;  4MLY A;  3F6D A;  3O76 A;  2YJ7 A;  4KW6 A;  5KN1 A;  2X49 A;  4G2E A;  4ZBB A;  2LRC A;  1N25 A;  3GIX A;  2L5O A;  1PN0 A;  3C1S A;  4LMW A;  3O3T A;  3EUR A;  3QMX A;  1U6T A;  5KN3 A;  2VL2 C;  2GZP A;  3FKF A;  1BYE A;  2AHE A;  3I69 A;  1XW6 A;  5EPF A;  4F9Z A;  3NOF A;  2VCT A;  1XWC A;  1TK5 B;  2PWJ A;  4Z2R A;  3GV1 A;  3W6G A;  3IK9 A;  2FWG A;  3ZFB A;  2NTO A;  1SK2 A;  1XCC A;  5KOW A;  3FEU A;  1S3A A;  1SYR A;  2JSY A;  3UL3 A;  16GS A;  2N5F A;  5HFG A;  4YAV A;  4IN0 A;  1Y6E A;  2R6K A;  3QAV A;  1UVZ A;  2DJJ A;  2FWE A;  2H76 A;  2M72 A;  2P5Q A;  4KSM A;  4WKW A;  1FB6 A;  5IMA A;  4G9H A;  5E59 A;  1XOB A;  3LEF A;  3A3T A;  1TK8 B;  1MD3 A;  3VPQ A;  5EL8 A;  4A5P A;  2WJU A;  5ECI B;  1GLQ A;  5D93 A;  4PQI A;  5A4V A;  2G0F A;  2LQQ A;  2OJL A;  2VCX A;  3FYG A;  5J40 A;  2PU9 C;  1RK4 A;  1WE0 A;  1K0B A;  4K1F A;  4EIQ A;  2H8L A;  3TGZ A;  2MZC A;  2VOC A;  5BMU A;  1QFN A;  1K0N A;  3KMO A;  3F9U A;  4WBJ A;  4ZBA A;  9GSS A;  1TJD A;  1PMT A;  1YDK A;  3GX8 A;  1BG1 A;  2FA8 A;  3FR9 A;  3D4T A;  4H86 A;  4X43 A;  5J9B A;  4ZB6 A;  2KOK A;  1XZO A;  3GH6 A;  1M2D A;  1Q4J A;  2LRN A;  6GSY A;  1SKS B;  3HY2 A;  4OCE A;  4F03 A;  5B7C A;  3F3R A;  1JZW A;  4PQ1 A;  4K0N A;  5BRT A;  1F9M A;  2VL3 A;  4ISD A;  4TR4 A;  3W8J A;  4OWY A;  4ZL7 A;  4TXO B;  1HQO A;  4YQU A;  1GSU A;  3HCZ A;  3ZTL A;  1FG4 A;  4I6X A;  2HRK B;  3GKX A;  1X5E A;  1ABA A;  5B8A A;  3RAZ A;  1FB0 A;  4POK A;  2YWN A;  1X5C A;  4KDY A;  3QOU A;  1BAY A;  5IMC A;  2WDU A;  2R2J A;  2AYT A;  5D9T A;  5AIV A;  4K9Z A;  2BTO T;  2XBI A;  1F2E A;  1LJR A;  1O7U A;  4KCA A;  3QCP A;  3GRX A;  1GTU A;  4LLR A;  3GYK A;  4DSR A;  2C3N A;  1M9B A;  4OFT A;  2VD1 A;  3IC8 A;  1OKT A;  1DUG A;  1EEJ A;  1G0T A;  1M2A A;  1QK8 A;  1Y25 A;  3GMF A;  3KH7 A;  1XWK A;  1SD8 A;  3GST A;  2GSQ A;  5H5Q A;  2H72 A;  2R3X A;  2C0G A;  2I4A A;  1IYH A;  2IIY A;  2MYG A;  4V2N A;  1X9M B;  4MF6 A;  1MDK A;  3IAM 2;  3UMA A;  3BD2 A;  1EP8 A;  2TRC P;  4J57 E;  4KUN A;  1XW9 A;  2OAD A;  5ABR A;  2DBC A;  2IMK A;  4IVF A;  1TI1 A;  2HSN B;  3IRA A;  4PUR A;  1BF5 A;  5DAK B;  2HZE A;  2IFQ A;  2H71 A;  4MNN A;  4XHM A;  2WB9 A;  4MAB A;  2HZF A;  2JSZ A;  3QFA C;  1ST9 A;  6GSX A;  4D73 A;  4MH2 A;  1V2A A;  4GWR A;  1PGT A;  2CQ9 A;  2IMF A;  2AB6 A;  2ON5 A;  1YY7 A;  1V57 A;  1AW9 A;  2HRF A;  2LJR A;  2OBK A;  4YKF A;  2KUC A;  1Z3E A;  2PN8 A;  4MPG A;  6GSV A;  1PL2 A;  2H6Y A;  3VI5 A;  2H6Z A;  2RUE A;  1QQ2 A;  4HJM A;  1A8Y A;  4WF4 A;  1B48 A;  3HD5 A;  1FAA A;  1LU4 A;  1OC9 A;  3KP9 A;  3F4S A;  5HQP A;  3QR6 A;  5HR2 A;  5HR1 A;  3KTL A;  5A5H A;  1THO A;  3QFB C;  4WET A;  4WF5 A;  1A24 A;  2F9S A;  4MZW A;  3CSI A;  4DSS A;  4K5S A;  5IOX A;  5B6N A;  2RM6 A;  1K0C A;  2CZ2 A;  3VFI A;  5CRW A;  1TRS A;  3DVW A;  2EFD A;  2FHE A;  2M46 A;  2X99 A;  1M99 A;  3PR8 A;  3PIN A;  4XRA A;  1BG5 A;  5F07 A;  4TW5 A;  4E8H A;  2GGT A;  1TXU A;  5CP1 A;  1GLP A;  4ECB A;  1FVJ A;  4I8B A;  4EIP A;  2FA4 A;  1O81 A;  2FD3 A;  1VRS D;  5A4W A;  4IKH A;  2H1L A;  1Z6M A;  4KND A;  4V2L A;  4RQR A;  3IAS 2;  1C72 A;  3LXZ A;  4QQ7 A;  5CRG A;  1GNW A;  2WS2 A;  1GSE A;  4I5Q A;  5G1K A;  1NW2 A;  2OE1 A;  3ZFL A;  3M3M A;  5F8B A;  3TKR A;  4YQM A;  3KTB A;  3KIJ A;  8GSS A;  5J5N A;  2DSA A;  5CRH A;  1XIY A;  1ZOF A;  5FHI A;  5EY6 A;  2CA8 A;  4BVX A;  1FW1 A;  5FWG A;  3IR4 A;  2PGT A;  5HFI A;  2IPA A;  1WMJ A;  5GSS A;  1SYX A;  3UJ1 A;  5IQY A;  1PL1 A;  2C3T A;  3BBY A;  3DD3 A;  4MJE A;  3CSJ A;  3DVX A;  4ACS A;  4N11 A;  4PUF C;  1AUC A;  2OA7 A;  3EMX A;  4RI7 A;  3N5O A;  3CBU A;  4G0K A;  4TRX A;  13GS A;  3FR6 A;  5ECM B;  1YF0 A;  1GUM A;  1E6B A;  4WR5 A;  2DKH A;  3VUR A;  5IIZ A;  2JAD A;  4DEJ A;  1JZR A;  1PX6 A;  3L9S A;  2K6V A;  3A2V A;  2VD0 A;  3TKP A;  2L5L A;  2NPB A;  4AF2 A;  4EKZ A;  4IQA A;  4AJ6 A;  3HZ4 A;  1MTC A;  4WR4 A;  4FYC A;  4F0C A;  4JRR A;  3FHK A;  1K0A A;  2K9F A;  1X9S B;  2LNT A;  4J2F A;  2FUG 2;  3HVV A;  2L57 A;  1GTI A;  2GT6 A;  3H8Q A;  4MF7 A;  3QAG A;  3D5J A;  3G7Y A;  1T3B A;  4POM A;  5JWR B;  5A1N B;  14GS A;  3DIE A;  4BVY B;  2L4Q A;  4IQ1 A;  2J9H A;  4FYU A;  2GZZ A;  1T4Z A;  3ED3 A;  1TU8 A;  2H19 A;  1M2B A;  4GST A;  2GQM A;  1GSS A;  4K7O A;  4CHS A;  4I2U A;  5J41 A;  12GS A;  4MF5 A;  3TRQ A;  5IO2 A;  4KA0 A;  3MAK A;  2GQL A;  1GSQ A;  5HFK A;  3KZQ A;  3TJB A;  2VLU A;  4ULX A;  1JZD A;  4G0I A;  3M8N A;  2PPT A;  2FY6 A;  4NAX A;  1K0O A;  3P2A A;  3R2Q A;  4MPF A;  2QA1 A;  4OCF A;  4OD7 A;  2X8H A;  1VF2 A;  4MJA A;  5DJL A;  5GZZ B;  4EO3 A;  2O87 A;  4IS0 A;  2R0C A;  4FYB A;  1Y1U A;  3GKN A;  4ICY A;  2FWF A;  3E9J B;  3RHB A;  1GH2 A;  4KX4 A;  4HJ2 A;  5DJM A;  1O6J A;  5G2Z A;  3IPZ A;  3KD0 A;  5LCZ A;  5GST A;  3KM6 A;  2QGV A;  3TOU A;  3GX0 A;  1A23 A;  1WIK A;  1ZYN A;  1NHY A;  5KEJ A;  3G9B A;  5LD0 A;  1EWX A;  1XWB A;  1JFU A;  4TXV A;  5IMD A;  4K2D A;  2YOI A;  4WXT A;  2HRK A;  2YZH A;  3C1R A;  4O32 A;  1ZMA A;  1E2Y A;  3VK9 A;  3TKS A;  2VL9 A;  5ELG A;  5D8I A;  22GS A;  3KJY A;  4RI6 A;  2R0G A;  5EVO A;  2BMX A;  2H74 A;  4TR3 A;  5F06 A;  4AGS A;  3MYD A;  2H6X A;  4L5O A;  1IYI A;  1YKC A;  3UVH A;  18GS A;  1DSB A;  2VLT A;  3DGQ A;  1JLV A;  5FT3 A;  3HJO A;  3APS A;  3GHA A;  5KN2 A;  2R0P A;  1F3B A;  3KMN A;  4IHU A;  3EYT A;  2TRX A;  4MDC A;  2B1K A;  2C80 A;  1NM3 A;  3MSZ A;  2PER A;  3CRU A;  2B7J A;  4L5L A;  4CY8 A;  3A5I A;  2XHF A;  4XRD A;  1CQH A;  2LKU A;  2WUL A;  4TR1 B;  3IHQ A;  7GSS A;  2UV8 G;  5DAK A;  3H79 A;  3A2X A;  2YZU A;  3PH9 A;  3TJJ A;  1PSQ A;  4K2X A;  1H75 A;  4P3Y B;  6GSU A;  5IMF A;  3SBC A;  2H70 A;  2YAN A;  5ECP B;  4PXO A;  2VL2 A;  3LG6 A;  4G01 A;  1U3A A;  4FH8 A;  1KEB A;  1MDJ A;  2I9H A;  1ZCP A;  2L4C A;  3F4R A;  3L78 A;  5D96 A;  3EU4 A;  1VF4 A;  2LS5 A;  1U3I A;  2AJQ B;  3WD6 A;  2O5V A;  4KDU A;  1F3A A;  3LGC A;  3F6F A;  2P0G A;  2HYX A;  1KTE A;  3GFK A;  3ZRD A;  4KF9 A;  3EMP A;  3PGT A;  2QKE A;  6GST A;  4IW9 A;  1XFL A;  2R37 A;  2F8F A;  3CXG A;  1R7H A;  1OAZ A;  3K8N A;  5IPG A;  4IP6 A;  4QL9 A;  4TKY A;  4BWS A;  1GL8 A;  2XPE A;  1YF1 A;  5KN0 A;  3RBT A;  5J4V A;  1XWG A;  1F6M C;  2YJH A;  2JAC A;  1EGO A;  4MCU A;  1EP7 A;  2K18 A;  3GSS A;  1HNA A;  2LST A;  4MJC A;  4I2T A;  2RUF A;  4X4J A;  5IM9 A;  4V1A g;  10GS A;  1SL0 B;  2DKI A;  2LTK A;  4QMK A;  4JE1 A;  2O89 A;  1N8J A;  1YZX A;  2VO4 A;  2OT3 A;  1ZYP A;  2H0G A;  4HS1 A;  5COH A;  2HFD A;  4MJB A;  2LV3 A;  3VWU A;  5IMZ A;  2FWH A;  5JWQ B;  4BPY A;  3FY7 A;  4HU7 A;  5DCH A;  3KCM A;  2WZ9 A;  1BQ7 A;  2HLS A;  2OE3 A;  4WEY A;  2CX4 A;  4Z2U A;  4EVM A;  4KAE A;  5IMV A;  5A5K A;  2HE3 A;  1G7E A;  3TU3 B;  2H1A A;  3TKQ A;  3KGK A;  3HVS A;  5G31 A;  3HJP A;  1QGV A;  4Z2T A;  4XIH A;  3ERG A;  1OYJ A;  4ZB9 A;  2LEG A;  3UEM A;  1TKD B;  1K3O A;  3GL3 A;  3LJR A;  1PQN A;  3TRP A;  3TKS E;  3VPT A;  4KSO A;  3ZVJ A;  1Q98 A;  3ZIV A;  4W66 A;  4TVE A;  2LJK A;  2I1U A;  3ZLP A;  3EIN A;  1WOU A;  1U88 A;  2HSY A;  1MEK A;  4YH2 A;  5GAN D;  5HR3 A;  1Z5Y E;  2FNO A;  4L0U A;  2A2R A;  4IJI A;  5ID2 A;  2H75 A;  4ZL8 A;  4OFN A;  1DE1 A;  4GTU A;  4ML1 A;  4FQU A;  3DRN A;  1PN9 A;  4CDO A;  4TN8 A;  2H01 A;  1BX9 A;  2EFH A;  5CRD A;  2YV9 A;  2GST A;  1A2L A;  2H0H A;  5LNK e;  4G0L A;  1ON4 A;  5AN1 A;  2AV4 A;  1G6Y A;  3WGE A;  2KP1 A;  3QDN A;  2CZ3 A;  2AAW A;  1V98 A;  4XS4 A;  2MBT A;  2FLS A;  4K6X A;  2WRT A;  1B4P A;  1SEN A;  1XVW A;  3DKS A;  1R5P A;  1J9B A;  3VLN A;  3GUS A;  1A8L A;  3C7M A;  2VLV A;  4V2M A;  2B6M A;  5H5R A;  1FVK A;  4N10 A;  5CAX A;  1ILO A;  1SK1 A;  2LJA A;  3N9J A;  2DJ1 A;  1ZL9 A;  3HVX A;  4EUY A;  4POB A;  2DJ0 A;  2V2G A;  3WGD A;  2HI7 A;  2D2Z A;  2YWI A;  4MP4 A;  2R4V A;  2H1D A;  1SU9 A;  2C0F A;  2IJY A;  2EIO A;  20GS A;  4V1A p;  4PNG A;  1GNE A;  5A1N A;  1OE7 A;  4HZ2 A;  3F3Q A;  1USB A;  4N0Z A;  5JWO B;  2N5B A;  4NHZ A;  4BL7 B;  1K3Y A;  4OO4 A;  4XCS A;  1AQV A;  3H1N A;  2VIM A;  3LQ7 A;  3NZN A;  1SKW B;  4K7N A;  4PNF A;  4Q5N A;  4GSS A;  2IFQ B;  3EVI A;  2P5R A;  4EDZ A;  2C0E A;  2IWT A;  2GLR A;  4JR4 A;  1S3D A;  3FK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...