4DEJA

Crystal structure of glutathione transferase-like protein il0419 (target efi-501089) from idiomarina loihiensis l2tr
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
KRSVMTLYSGKDDLKSHQVRLVLAEKGVGVEITYVTDESTPEDLLQLNPYPEAKPTLVDRELVLYNAQIIMEYLDERFPHPPLMPVYPVARGTSRLMMYRIERDWYSLAEKIQKNDAQARQELKEGILSLAPIFADTPYFMSEEFSLVDCYLAPLLWRLPAYGIDLEGQGAKEIKQYMVRLFERKTFQDSLTEEEKELARNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase related protein
publication title Crystal Structure of Glutathione S-Transferase-Like Protein Il0419 from Idiomarina Loihiensis
rcsb
source organism Idiomarina loihiensis
total genus 62
structure length 202
sequence length 202
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4dejA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4dejA01
3SBCA 2NPBA 2YJ7A 5G1KA 2HRFA 5DAKB 4IGJA 3QFAC 3L4NA 2H01A 3GKNA 3LG6A 1TJDA 3A3TA 3MWHA 3DGQA 1OC3A 2RIIA 2H0HA 1S3AA 4HU7A 4XS6A 1XBSA 2RUEA 2PUKC 1W89A 1Z5YE 3F4TA 1XWCA 2AAWA 1VF3A 1U6TA 1GSQA 2LRTA 5HR1A 1EGOA 4LA1A 4FO5A 4CDOA 2CVDA 3HJPA 2HSHA 3UAPA 4V1Ap 4HOJA 17GSA 4CHSA 4O5RA 1TI1A 2KP2A 1UN2A 3IAM2 1K3YA 1OKDA 2V1MA 5B7CA 2YV7A 1V57A 2GZPA 4ML1A 4KDYA 1SYRA 4JBBA 3DKSA 1XOAA 3GKXA 2DJ0A 1ON4A 5C04A 4K7OA 1GP1A 4TN8A 1TU7A 1V40A 4DVCA 4MPFA 1WPIA 2IFQB 3GTUB 4WEYA 2IWTA 3EU4A 1SL0B 3PR8A 4PTSA 4IBPA 2CVKA 3KM6A 3TKQA 1O85A 4JE1A 2C1YA 4RQXA 4JR6A 2H0GA 5JWOB 1M9AA 4MA9A 1QXHA 5DBQA 4PX1A 4OCEA 1UC7A 4YAVA 4K0NA 2O85A 5ECIB 1XCCA 3RHCA 22GSA 2B3SA 1F3AA 1QUWA 4XHMA 3CXGA 1GLQA 4TXVA 4I2UA 4KA0A 2LQQA 4JR4A 3G7YA 4PNFA 2OACA 1ZGNA 1DE1A 1JHBA 1K3OA 2G0FA 1G7EA 4ULXA 2DJJA 2VCWA 2N5AA 4Z7XA 4PQHA 1M9BA 3BCIA 4KF9A 4FQUA 5D9TA 3EURA 3H8QA 2VOCA 1THXA 4FYUA 4PGTA 3KGKA 5D93A 3QDNA 3G7IA 1HD2A 1X5CA 1K0DA 2QKEA 1WE0A 1EP8A 1PKZA 3LYKA 4MMMA 3DEXA 2NTOA 3WGEA 4K8MA 2MMAA 1I5GA 2F8AA 3IOSA 5ECQB 5ELAA 4GCIA 5FT3A 1GL8A 2VAFA 2GT6A 2EC4A 8GSSA 1HQOA 1CQHA 3LYPA 5HFIA 4EDZA 2C0FA 2H72A 3ZZXA 2R2JA 2HFDA 2JZTA 2LNTA 5IMFA 3DVWA 5ECMB 3IC8A 4OWYA 5F07A 2DJKA 2PGTA 1O8WA 4RI6A 3EYTA 1B9XC 4MJCA 5HFKA 4XS4A 2OADA 4N0VA 2H73A 5DCHA 5JCUA 2O87A 4ISDA 1UA5A 1HNCA 3GMFA 1JLWA 3P90A 3HVSA 1ZMAA 4TRXA 2HXKA 4LL4B 2LJAA 5J9BA 1RK4A 3S9FA 2HSMA 3UL3A 2YV9A 5F06A 2FWGA 1SK0A 4TR1B 4POBA 3GN3A 1SKSB 2WZ9A 4XTSA 1WJKA 1YEPA 4NWYA 4ACSA 3M0FA 1OE7A 2DIYA 3US3A 4L8EA 3WGXA 2I81A 3EU3A 2VL2C 2HZEA 3HZ8A 2YOIA 1J08A 3ERGA 5F0GA 1N8JA 2CAIA 3TJKA 3IV4A 1MD4A 1I9DA 3ISOA 1OC9B 1ZYQB 1OVNA 1SJ6A 1J9BA 2FGXA 3LXZA 1GTIA 4NMUA 4KSOA 3TKRA 5B8AA 1PMTA 2LNSA 2YN1A 1VF1A 1GSFA 3KMOA 4TOPA 1QGVA 3HDCA 3IR4A 3AY8A 4AGSA 2GQLA 2ZNMA 3FY7A 3LWAA 2YZUA 3TRXA 2H1DA 2YWIA 2WJUA 2IN3A 3GFKA 4IJ3A 4GSSA 3ZYWA 2XBIA 3IC4A 3FRCA 4E8HA 5AN1A 4XRDA 4O92A 6GSXA 3A5WA 4L0UA 1R5AA 1VGLA 2FLSA 1YEXA 3IHQA 3TKSA 1A2LA 3I6AA 2YWOA 3VFIA 5HR0A 1NHYA 2MMOA 2CT6A 5E4WA 1A2MA 2VLTA 2JSYA 2PN8A 3KTLA 6GSUA 4WF5A 4BWQA 2B5EA 2FD3A 4X0XA 1YZXA 2B1LA 2H66A 1A24A 3IA1A 2ON5A 1V2AA 3VWUA 3CSIA 5F8BA 2WULA 1LBKA 2NDOA 3FZ9A 4HU9A 4MZWA 2X99A 2K8SA 5A4UA 2JZSA 4HJMA 2L4QA 1BYEA 1PSQA 1BG5A 3TCOA 5LNKe 3D4TA 1FVKA 3KXOA 1U3IA 3W6GA 2TRCP 5DJLA 2OBKA 1OYJA 4OD7A 1QMVA 3G7JA 1F37A 4ECBA 1X9WB 1Q4JA 3F3RA 2VCTA 3CBUA 1GSSA 1TKDB 5IMCA 4K7IA 3KIJA 1EZKA 3FW2A 2E7PA 3F0IA 4IQ1A 2VUPA 3OR5A 3W8SA 2LRCA 4J2FA 4LMWA 4IS0A 1Z7PA 4BL7A 2M80A 2ES7A 5DCGA 2I9HA 4YQUA 4TR0A 2D2ZA 1ST9A 2XC2A 2J23A 5HR3A 3U6VA 2B6MA 2FWHA 2IIYA 5LD0A 1A2JA 4NHWA 4HZ4A 4OO5A 4IQAA 1B4QA 3ZVJA 4WETA 1B4PA 4G0IA 13GSA 3QAGA 2HNLA 5LCZA 3D22A 3M9KA 1ACVA 1AQWA 4FIWA 4QL7A 3GA4A 2L4CA 3APOA 3QR6A 1ZL9A 2YWNA 1BX9A 2YP6A 1GUMA 1FW1A 3ME7A 3VPTA 5JWQB 3R3EA 1PGTA 2LRNA 5G31A 1TK8B 1E2YA 2HZFA 3MNGA 4IN0A 4IHUA 5CO3A 5AIVA 5B8BA 2EIOA 3QFBC 5KEJA 1MTCA 1U87A 4AF2A 3EMPA 3FR3A 1XOBA 4XS4B 4ZILA 2OKAA 2FY6A 3APQA 2GLRA 2VL9A 2UZ8A 3DIEA 3GKMA 3WD6A 1S3DA 4N10A 3WT1A 4LL1B 4KSMA 1JFUA 2OA7A 2HSMB 4V2NA 2EIQA 5AISA 1XFLA 2HT9A 1SU9A 1G0TA 2CVBA 3IK7A 4MP4A 3TOUA 4NPBA 4G0KA 7GSSA 1RQMA 5GSTA 4E8EA 3UARA 2DJ2A 1O7UA 1K0OA 2HZEB 3TJBA 3GKKA 5JWRB 3DRNA 1QQ2A 2VL3A 1M0UA 4OO4A 5D9WA 2GS3A 4KX4A 4YQMA 3ZFLA 6GSSA 2FCHA 2HSYA 2HYXA 1O6JA 5AIXA 2XBQA 1G6WA 3KMNA 2H6ZA 4MH2A 4WF4A 2J9HA 2HSNB 2K8VA 2QC7A 2B5XA 4WXTA 4ID0A 3KH9A 1ML6A 3HJOA 2H0IA 2I4AA 1YF1A 3L78A 1JLVA 3CTFA 4NHZA 5GAPD 1HNAA 3P8WA 4NAXA 2VIMA 4IW9A 3WT2A 3BJ5A 3HCZA 2LUSA 4ZBBA 1BQ7A 9GSSA 3UMAA 3JCML 1OAZA 3EINA 1SENA 4Q5RA 1LJRA 1C72A 3O3TA 1VRSD 2JL4A 4WBRD 1XWBA 3PPUA 3VLNA 1A8LA 5DJMA 2O7KA 1M99A 5ECKB 2VD0A 2TIRA 4DSSA 2X64A 2AB6A 2C3QA 1WOUA 4BA7A 3BBYA 3A2WA 4F0CA 5A4WA 5ECRB 1XW6A 1LU4A 3D4MA 3TKPA 3EVIA 1B48A 1KNGA 2KUCA 4DSRA 5CYYA 5COHA 3KEBA 2WDUA 2GSQA 2N5BA 1XW5A 3C71A 1E6BA 4L5OA 2X8HA 5KN2A 2WB9A 3C73A 2MMNA 3IK9A 3VWWA 5IMZA 4HS1A 4KW6A 1YQ1A 2H74A 1FHEA 1ILOA 3WGDA 4TVEA 2HLSA 4J57E 1MD3A 2AHEA 1SD9A 3KCMA 2V6KA 5CP1A 2YNXA 2YCDA 5DDLA 5CAXA 1ZCPA 1GSUA 2WRTA 3F9UA 5DVBA 1YJ6A 3KJYA 4HI7A 4ECCA 1YF0A 4F0BA 3EWLA 4YAPA 5IPHA 2L5LA 5EY6A 3D5JA 5IOWA 2GQMA 2L6CA 3H4KA 4I2TA 2RM5A 1GSEA 3IPZA 4Q5NA 4BL7B 4MPGA 2MZCA 4D73A 5EVOA 5IIZA 1PN9A 1K0BA 3KH7A 16GSA 3D6IA 4KH7A 1TK0B 4K0GA 1XVWA 1TK5B 1V58A 1BEDA 2IMDA 3GL3A 1GNWA 5CRHA 1OKTA 4GQCA 1R7HA 1EEMA 1FOVA 4MCUA 2I1UA 1XWAA 3TOTA 2P5QA 1M7TA 1YDKA 5G30A 3LGCA 3QOUA 3ZLPA 2FA8A 1TRSA 2C0EA 4CW9A 1Q98A 4HQZA 2YPMA 1X9SB 1OE8A 4USSA 3FZAA 4DEJA 3FYGA 1U3AA 1TRUA 4DSQA 2PMTA 1GNEA 4J56E 4H86A 1K3LA 2NBSA 12GSA 2H6YA 3LQ7A 4F2IA 4F82A 1IYIA 5ENUA 1R26A 3KP9A 3HVVA 2QGVA 6GSWA 1XWGA 2P0GA 3IRAA 4I8BA 5INYA 2C8UA 4EF0A 4XS1A 3TJFA 2LV3A 4IP1A 3HY2A 4KAEA 3UVHA 2DLXA 1FAAA 2JZRA 4K9ZA 1F2EA 3Q74A 2IMIA 3KD0A 3VWVA 6GSTA 2VCZA 4G2EA 4MABA 2L59A 2B5YA 2LQOA 4OCFA 3F6DA 4MF6A 3TUEA 2B7KA 2GTUA 1T3BA 2HRAA 1XVQA 5GSSA 3HZ4A 2OE1A 1J0FA 2GDRA 3TKSC 5GZZB 3TRPA 4TR4A 1GTAA 2FUG2 3GX0A 2YZHA 5JCWA 4EKZA 5D73A 2PU9C 2ON7A 3FR6A 1TP9A 3LSZA 3IXRA 5D9VA 4MDCA 3EMXA 1H4OA 2FWEA 2VLVA 4GTUA 3IE3A 10GSA 2L5OA 3QD9A 4GWRA 2A2RA 2BTOT 4I6XA 2VO4A 3VI5A 5EL8A 5DALA 3GH9A 1B8XA 3ME8A 2PVQA 5C00A 4JRRA 4L5LA 2DBCA 2R5GA 1FG4A 5IO2A 5IMDA 2QSIA 2M46A 4KCAA 3H79A 4EVMA 1WMJA 4IKHA 1SJIA 4DSSB 1SKRB 2DJ3A 2CAQA 2EIRA 4POMA 3FHKA 2RUFA 2HQTA 3TGZA 2L57A 2JACA 1PKWA 3M1GA 1YKCA 1MDIA 2IMEA 4ZB6A 3ZVJD 1H75A 2LSTA 3EC3A 1GRXA 3RDWA 2JADA 1Z6MA 4ML6A 5BMUA 4ZL9A 5IPGA 5J9CA 3LORA 5IQYA 3FK8A 5IOXA 4KUNA 2GSRA 1XIYA 5FHIA 1XZOA 3TJJA 3F4SA 3KZQA 1AQXA 2E0QA 1AQVA 5ECPB 1M2DA 3KP8A 3V1WA 1M2BA 6GSYA 2N5FA 4MLYA 5D9XA 4BWSA 4WR4A 1GSDA 5J3RA 4YQVA 5IO0A 1TRWA 4BVYA 1GUKA 4KCEA 2VCQA 4OFTA 2FNOA 2VCXA 5DQSA 2DC5A 4V2MA 3RPPA 3DVXA 1GWCA 2YWMA 1SL2B 4PUFC 3IAS2 2K18A 4POLA 5E59A 1QFNA 4MK3A 3CRTA 2PWJA 4D73B 3C7MA 4BVXA 3GHAA 1EP7A 5H5QA 4P3YB 2IMKA 3H1NA 1Z3EA 4X1UA 2A2SA 4MJEA 3A2VA 6GSVA 2MMZA 5B6NA 4PQIA 1XXUA 2PPTA 3PGTA 4O7HA 1Z6NA 3GIXA 3RAZA 3LFLA 2GZZA 4N11A 1W4VA 3CSJA 4V1Ag 4PURA 3TJGA 5KN0A 2ZUPA 2P31A 1WWJA 3PINA 3UVTA 5ECSA 2BMXA 1DSBA 2H76A 2LS5A 2LKUA 5KN1A 3VI7A 2PBJA 2FWFA 4TR3A 1A23A 18GSA 2V6OA 5CNWA 1BAYA 4MF5A 4Q5QA 4Q5FA 1O81A 5AGYA 1SKWB 3FR9A 4KDXA 3F6FA 1X5EA 2CV4A 5J41A 1GTUA 1T4YA 4HZ2A 5CREA 2F8FA 5ID2A 2OBIA 4ECJA 3HA9A 2OE3A 4N30A 3L9UA 3GV1A 2HRKA 3C8EA 5G5FA 1CQGA 4MH3A 5D96A 4N0ZA 3GL5A 4PXOA 2KOKA 1SK1A 5A4VA 5CRDA 4BPYA 3VURA 3M8NA 1S3CA 3ZFBA 3A2XA 1URMA 5IMVA 4KE3A 3TRQA 1R4WA 3U5RE 4RQRA 5CRGA 3DWVA 1TXXA 5CRWA 1FVJA 3P7XA 2I3YA 4XRAA 4G19A 4HEA2 1TU8A 3K8NA 3DD3A 1T1VA 2R4VA 2HI7A 3Q19A 3H93A 3F4RA 2CZ2A 5IM9A 3DXBA 1Z7RA 2CA8A 3BCKA 4F03A 1TW9A 5ABRA 3IBHA 4IJIA 4G9HA 2H1BA 2R6KA 1TRVA 2CZ3A 4FYBA 1HYUA 3F3QA 1Z9HA 1Y6EA 2O8VB 3GX8A 2H19A 4EDYA 2AYTA 2MYGA 5DALB 4I97A 4HJ2A 3VK9A 3N5OA 2Z9SA 2CX4A 3O6TA 1YKAA 3TKSE 2VCVA 2C0GA 3L9VA 2B7JA 3O76A 1EV9A 3WYWA 4ZL8A 1SL1B 4NXIA 2C80A 1X5DA 4ECIA 1B9YC 2A4VA 3L0HA 1PQNA 3GH6A 4K1FA 3NZNA 2X8GA 1T4ZA 2DMLA 2KLXA 3CMIA 1M2AA 1T7PB 2E2MA 3NIVA 1ERUA 3ZMLA 1XW9A 1OC8A 4AJ8A 4YH2A 3UBKA 14GSA 1V9WA 4KGIA 5ECHB 5J5NA 3QMXA 2FHEA 1NSWA 2PVOC 1A0FA 1K0MA 3HXSA 5ECLB 1MEKA 2GSSA 1AC1A 1ABAA 19GSA 1EV4A 3LJRA 2V32A 2WS2A 1GH2A 2AJQB 3CTGA 4IP6A 5F05A 1GTBA 1UVZA 4XIHA 3ZREA 1T00A 2NVLA 5FWGA 3E3EA 4ZBAA 4ZB9A 2WFCA 5H5RA 4G10A 4BVYB 2XPDA 2RLIA 3LEFA 2ALBA 3HYPA 1K0AA 2H75A 1PL1A 1EEJA 2IPAA 2JU5A 1A0RP 2XPEA 2JSZA 3ZRDA 3QPMA 2GT5A 3QAWA 1EGRA 5D8IA 2HE3A 1JZRA 2K6VA 4WKWA 3D21A 4ILFA 3M9JA 3F8UA 3E9JB 3I43A 4O32A 4BVXB 2H30A 1YY7A 2H8LA 1SJZA 1EWXA 1VF4A 2V2GA 3CRUA 1O73A 4I5QA 4ZXGA 4RI7A 3Q6OA 2LJKA 3GYKA 3N9JA 4GLTA 2LTKA 1BJXA 4JEDA 2G2QA 2YANA 4KB3A 1HNBA 3ZL5A 2WCIA 2DJ1A 4L0WA 3QCPA 2R3XA 3FZ5A 5EPFA 2P5RA 3APSA 1T8EB 1K0CA 4WBJA 4FH8A 4ZIJA 3TDGA 5ECNB 3TB2A 3E0UA 1Y25A 3MSZA 1QK8A 3NOFA 1PD21 4LLRA 2C3TA 3HD5A 1AAZA 4PUAA 2C4JA 1NM3A 2WGRA 4TXOA 5H5SA 1A8YA 3M3MA 4MZBA 5ID2B 2VL2A 1VF2A 2E2GA 2IL3A 5B6MA 3RBTA 3Q18A 2HRKB 3SWLA 3BOAA 3FKFA 2TRXA 2ZCTA 4QQ7A 2LEGA 3BD2A 1GULA 5DAKA 5ECOB 1U88A 4MF7A 2IJYA 1KBNA 1NHOA 5JCGA 11GSA 5HR2A 3W8JA 1PRXA 5L71A 3R2QA 4F9ZA 3L9SA 1AIUA 1ERTA 1GUHA 1V98A 4ZL7A 4IELA 1ZOFA 3RPNA 1O8XA 5IMAA 3GSTA 1EOHA 3I69A 20GSA 1N2AA 1SK2A 3GUSA 4WR5A 3C1SA 3DMLA 2M72A 2GVPA 4K6XA 4ZBDA 1WP0A 3D0ZA 1WRYA 4TW5A 1K0NA 1PA3A 2AV4A 2B1KA 3ERWA 1IYHA 1PX7A 3G9BA 4EO3A 2BJXA 3ED3A 1TTZA 5J4UA 3GNJA 4OFMA 1XPVA 3ZITA 2KHPA 2XHFA 4GXZA 2IFQA 3GTUA 1WIKA 4X43A 3MDKA 5G2ZA 3FEUA 5GAND 2DMMA 3UEMA 2F51A 2C3NA 4POKA 1GLPA 1AUCA 4XCSA 5HFGA 5HQPA 4G0LA 2VM1A 2F3MA 1PX6A 3ZMKA 3UJ1A 3HHVA 3ZIVA 1MDKA 1F3BA 2F9SA 4TKYA 4PQ1A 4FYCA 2GSTA 4HDEA 1JZDA 2GZYA 1F6MC 4GSTA 3DYRA 4EXJA 3MAKA 3CYNA 2MBSA 3C1RA 4QL9A 1DUGA 1USBA 3GSSA 1DBYA 5A5KA 1FB6A 2MBTA 2K9FA 1THOA 1PL2A 2YJHA 4AJ6A 5KN3A 4MZCA 2DSAA 3GURA 1KTEA 3HKRA 2CX3A 2VM2A 4GF0A 4ZB8A 2OE0A 1GSYA 1TI3A 4GQFA 4KDUA 3VWXA 4JU5A 4MJBA 1FB0A 4JZQA 2FA4A 4AJ7A 4EL1A 1ERVA 1JZOA 4LMVA 1F9MA 3IDVA 2V41A 4EC0A 5ELGA 2H71A 2RM6A 1RW1A 3FZ4A 1SD8A 4OMVA 1NW2A 5G1LA 4RUVA 4NV5A 2HRNA 4HUAA 4NV2A 1X0RA 1TOFA 3J7Yb 2H1GA 2GQKA 3UBLA 1X9MB 3UIWA 3I9V2 1SYXA 3EE2A 1EOGA 3J7Yk 3HVXA 1DE2A 1AW9A 1ZYEA 4EE0A 2IMFA 1FO5A 1ZZYA 3CSHA 2O89A 1XWKA 4KNDA 1MDJA 3GRXA 4V2LA 2DIZA 2L6DA 2AUVA 2C0DA 3F63A 3ZTLA 2VD1A 2CQ9A 2H6XA 4OFNA 4IVFA 4TR1A 4MJAA 3P2AA 2H1AA 1G7OA 1ERWA 2PERA 2R37A 4K7NA 3QAVA 3ERFA 3HJMA 2OJLA 1TDIA 2X8CA 2GGTA 3UOMA 1KEBA 4K2DA 3RHBA 1AXDA 4GSNA 3ZIJA 4TXOB 2LJRA 4GRFA 2KP1A 1OC9A 2H70A 4EUYA 2REMA 3PH9A 5DQYA 4PNGA 2VLUA 3KTBA 1JZWA 3VPQA 4HQSA 3LXTA 1R5PA 1G6YA 5G5EA
chains in the Genus database with same CATH superfamily
3SBCA 2NPBA 2YJ7A 5G1KA 2HRFA 5DAKB 4IGJA 3QFAC 3L4NA 2H01A 3GKNA 2WVXA 3LG6A 1TJDA 3A3TA 3MWHA 3DGQA 1OC3A 2RIIA 1S3RA 2H0HA 1S3AA 4HU7A 4XS6A 1XBSA 2RUEA 2PUKC 1W89A 1Z5YE 4EIQA 3F4TA 1XWCA 2AAWA 1VF3A 1U6TA 1GSQA 2LRTA 5HR1A 1EGOA 4LA1A 4FO5A 4CDOA 2CVDA 3HJPA 2HSHA 3UAPA 4V1Ap 4HOJA 17GSA 4CHSA 4O5RA 1TI1A 2KP2A 3FMWA 1UN2A 3IAM2 1K3YA 2R0PA 1OKDA 2V1MA 5B7CA 2YV7A 1V57A 2GZPA 4ML1A 4KDYA 1SYRA 4JBBA 3DKSA 1XOAA 3GKXA 2DJ0A 1ON4A 5C04A 4K7OA 1GP1A 4TN8A 1TU7A 1V40A 1SVMA 4DVCA 4MPFA 1WPIA 2IFQB 3GTUB 4WEYA 4X4JA 2IWTA 3EU4A 1SL0B 3PR8A 4PTSA 4IBPA 2CVKA 3KM6A 3TKQA 1O85A 5J47A 4JE1A 2C1YA 4RQXA 4JR6A 5A34A 2H0GA 5JWOB 1M9AA 4MA9A 1QXHA 5DBQA 4PX1A 4OCEA 1UC7A 4YAVA 4K0NA 2O85A 5ECIB 1XCCA 3RHCA 22GSA 2B3SA 1F3AA 1QUWA 4XHMA 3CXGA 1GLQA 4TXVA 4I2UA 4KA0A 2LQQA 4JR4A 3G7YA 4PNFA 2OACA 1ZGNA 1DE1A 1JHBA 1K3OA 2G0FA 4K5RA 1G7EA 4ULXA 2DJJA 2VCWA 2N5AA 4Z7XA 4PQHA 1M9BA 3BCIA 4KF9A 4FQUA 5D9TA 3EURA 3H8QA 2VOCA 1THXA 4FYUA 4PGTA 3KGKA 5D93A 3QDNA 3G7IA 1HD2A 1X5CA 1K0DA 2QKEA 1WE0A 1EP8A 1PKZA 3LYKA 4MMMA 3DEXA 2NTOA 3WGEA 4K8MA 2MMAA 1I5GA 2F8AA 3IOSA 5J40A 5ECQB 5ELAA 4GCIA 5FT3A 1GL8A 2VAFA 2GT6A 2EC4A 8GSSA 1HQOA 1CQHA 3LYPA 5HFIA 4EDZA 2C0FA 2H72A 3ZZXA 2R2JA 2HFDA 2JZTA 2LNTA 5IMFA 3DVWA 5ECMB 3IC8A 4OWYA 5F07A 2DJKA 2PGTA 1O8WA 4RI6A 3EYTA 1B9XC 4MJCA 5HFKA 4XS4A 2OADA 4N0VA 3A5IA 2H73A 5DCHA 5JCUA 2O87A 4ISDA 1UA5A 1HNCA 3GMFA 1JLWA 3P90A 3HVSA 1ZMAA 4TRXA 2HXKA 4LL4B 2LJAA 5J9BA 1RK4A 3S9FA 2HSMA 3UL3A 2YV9A 5BRTA 5F06A 2FWGA 1SK0A 1SVLA 4TR1B 4POBA 3GN3A 1SKSB 2WZ9A 4XTSA 1WJKA 1YEPA 4NWYA 4ACSA 1OE7A 3M0FA 2DIYA 3US3A 4L8EA 3WGXA 2I81A 3EU3A 2VL2C 2HZEA 3HZ8A 2YOIA 1J08A 3ERGA 5F0GA 1N8JA 2CAIA 3TJKA 3IV4A 1MD4A 1I9DA 3ISOA 1OC9B 1ZYQB 1OVNA 1SJ6A 1J9BA 2FGXA 3LXZA 1GTIA 4NMUA 4KSOA 3TKRA 5B8AA 1PMTA 2HSNA 2LNSA 2YN1A 1VF1A 1GSFA 3KMOA 4TOPA 1QGVA 3HDCA 3IR4A 3AY8A 4AGSA 2GQLA 2ZNMA 3FY7A 3LWAA 2WVXB 2YZUA 3TRXA 2H1DA 4N3ZA 2YWIA 2WJUA 2IN3A 3GFKA 4IJ3A 4GSSA 4Z2TA 3ZYWA 2XBIA 3IC4A 3FRCA 4E8HA 1FOHA 5AN1A 4XRDA 4O92A 6GSXA 3A5WA 4L0UA 1R5AA 1VGLA 2FLSA 1YEXA 3IHQA 3TKSA 1A2LA 3I6AA 2YWOA 3VFIA 5HR0A 1NHYA 2MMOA 2CT6A 5E4WA 1A2MA 2VLTA 2JSYA 2PN8A 3KTLA 6GSUA 4WF5A 4BWQA 2B5EA 2QA1A 2FD3A 4X0XA 1YZXA 4AKHA 2B1LA 2H66A 1A24A 3IA1A 2ON5A 1V2AA 3VWUA 3CSIA 5F8BA 2WULA 1LBKA 2NDOA 3FZ9A 4HU9A 4MZWA 2X99A 2K8SA 5A4UA 1M3JA 2JZSA 4HJMA 2L4QA 1BYEA 5A1NA 5J4VA 1PSQA 1BG5A 5A34B 3TCOA 5LNKe 3D4TA 1FVKA 3KXOA 1U3IA 3W6GA 2TRCP 5DJLA 2OBKA 1OYJA 4OD7A 1QMVA 3G7JA 1F37A 4ECBA 1X9WB 1Q4JA 3F3RA 2VCTA 3CBUA 1GSSA 1TKDB 5IMCA 4K7IA 3KIJA 1EZKA 3FW2A 2E7PA 3F0IA 4IQ1A 2VUPA 4E68A 3OR5A 3W8SA 2R0CA 4A5PA 2LRCA 4J2FA 4LMWA 4IS0A 1Z7PA 4BL7A 2M80A 2ES7A 5DCGA 2I9HA 4YQUA 4TR0A 2D2ZA 1ST9A 2XC2A 2J23A 5HR3A 3U6VA 2B6MA 2FWHA 2IIYA 5LD0A 1A2JA 4NHWA 4HZ4A 4OO5A 4IQAA 2WZSA 3ZVJA 1B4QA 4WETA 1B4PA 4G0IA 13GSA 3QAGA 2HNLA 5LCZA 3D22A 3M9KA 1ACVA 1AQWA 4FIWA 4QL7A 3GA4A 2L4CA 3APOA 3QR6A 1ZL9A 2YWNA 1BX9A 2YP6A 1GUMA 1FW1A 3ME7A 3VPTA 5JWQB 3R3EA 1PGTA 2LRNA 5G31A 1TK8B 1E2YA 2HZFA 3MNGA 1N25A 4IN0A 4IHUA 5CO3A 5AIVA 5B8BA 2EIOA 3QFBC 5KEJA 1MTCA 1U87A 4AF2A 3EMPA 3FR3A 1XOBA 4XS4B 2O3EA 4ZILA 2EFEA 2OKAA 2FY6A 3APQA 2GLRA 2EFCA 2VL9A 2UZ8A 3DIEA 3GKMA 3WD6A 1S3DA 4N10A 3WT1A 4LL1B 4KSMA 1JFUA 2OA7A 2HSMB 2WW0A 4V2NA 2EIQA 5AISA 1XFLA 2HT9A 1SU9A 1G0TA 2CVBA 3IK7A 4MP4A 3TOUA 4NPBA 4G0KA 7GSSA 1RQMA 5GSTA 4E8EA 3UARA 2DJ2A 1O7UA 1K0OA 2HZEB 3TJBA 3GKKA 5JWRB 3DRNA 1QQ2A 2VL3A 1M0UA 4OO4A 5D9WA 2GS3A 4KX4A 4YQMA 3ZFLA 6GSSA 2FCHA 2HSYA 2HYXA 1O6JA 5AIXA 2XBQA 1G6WA 3KMNA 2H6ZA 4MH2A 4WF4A 2J9HA 2HSNB 2K8VA 2QC7A 2B5XA 4WXTA 4ID0A 3KH9A 1ML6A 3HJOA 2H0IA 2I4AA 1YF1A 1M3IA 3IHGA 3L78A 1JLVA 4MNNA 3CTFA 4NHZA 2DKIA 5GAPD 1HNAA 3P8WA 4NAXA 2VIMA 4IW9A 3WT2A 3BJ5A 3HCZA 2LUSA 4ZBBA 1BQ7A 9GSSA 3UMAA 3JCML 1OAZA 3EINA 1SENA 4Q5RA 1LJRA 1C72A 3O3TA 1VRSD 2JL4A 4WBRD 1XWBA 3PPUA 3VLNA 1A8LA 5DJMA 2O7KA 1M99A 5ECKB 2A4HA 2VD0A 2TIRA 4HSCX 4DSSA 2EFHA 2X64A 2AB6A 2C3QA 1WOUA 4BA7A 3BBYA 3A2WA 4F0CA 5A4WA 5ECRB 1XW6A 4PHZC 1LU4A 3D4MA 3TKPA 3EVIA 1B48A 1KNGA 2KUCA 4DSRA 5CYYA 5COHA 3KEBA 2WDUA 2GSQA 2N5BA 3CQFA 1XW5A 3C71A 1E6BA 4L5OA 2X8HA 5KN2A 2WB9A 3C73A 4PI0C 2MMNA 3IK9A 3VWWA 5IMZA 4HS1A 4KW6A 1SVOA 1YQ1A 5A1NB 2H74A 1FHEA 1ILOA 4YKFA 3WGDA 4TVEA 2HLSA 4J57E 1MD3A 2AHEA 1SD9A 3KCMA 1YVLA 2V6KA 5CP1A 2YNXA 2YCDA 5DDLA 5CAXA 1ZCPA 1GSUA 2WRTA 2H1LA 3F9UA 5DVBA 1YJ6A 3KJYA 4HI7A 4ECCA 1YF0A 4F0BA 3EWLA 4YAPA 5IPHA 2L5LA 5EY6A 3D5JA 5IOWA 2GQMA 4ZB7A 2L6CA 3H4KA 4I2TA 1ZYNA 2RM5A 4K5SA 1GSEA 3IPZA 4Q5NA 3CHXC 4BL7B 4MPGA 2MZCA 4D73A 5EVOA 5IIZA 1PN9A 1K0BA 3KH7A 16GSA 1PFOA 3D6IA 4KH7A 1TK0B 4K0GA 1XVWA 1TK5B 1V58A 1BEDA 1TXUA 2IMDA 3GL3A 1GNWA 5CRHA 1OKTA 4GQCA 1R7HA 1EEMA 1FOVA 3CWGA 4MCUA 2I1UA 1XWAA 3TOTA 2P5QA 1M7TA 1YDKA 5G30A 3LGCA 3QOUA 3ZLPA 2FA8A 1TRSA 2C0EA 4CW9A 1Q98A 4HQZA 2YPMA 2O36A 1X9SB 4AI6A 1OE8A 4USSA 3FZAA 4DEJA 3FYGA 1U3AA 1TRUA 4DSQA 2PMTA 1GNEA 4AKIA 4J56E 4H86A 1K3LA 2NBSA 12GSA 2H6YA 3LQ7A 4F2IA 4F82A 1IYIA 5ENUA 1R26A 3KP9A 3HVVA 2QGVA 6GSWA 1XWGA 2P0GA 3IRAA 4I8BA 5INYA 2C8UA 4EF0A 4XS1A 3TJFA 2LV3A 4IP1A 3HY2A 4KAEA 3UVHA 2DLXA 1FAAA 2JZRA 4K9ZA 1F2EA 3Q74A 2IMIA 3KD0A 3VWVA 6GSTA 2VCZA 4G2EA 2WVYA 4MABA 2L59A 2B5YA 2LQOA 2WW3A 4OCFA 3F6DA 4MF6A 3TUEA 2B7KA 2GTUA 1T3BA 2HRAA 1XVQA 5GSSA 3HZ4A 2OE1A 1J0FA 2GDRA 3TKSC 5GZZB 3TRPA 4TR4A 1GTAA 2FUG2 3GX0A 2YZHA 5JCWA 4EKZA 5D73A 2PU9C 3RFRC 2ON7A 3FR6A 1TP9A 3LSZA 3IXRA 5D9VA 4MDCA 3EMXA 1H4OA 2FWEA 2VLVA 4GTUA 3IE3A 10GSA 2L5OA 4O5UA 3QD9A 4GWRA 2A2RA 2BTOT 4I6XA 2VO4A 3VI5A 5EL8A 5DALA 3GH9A 1B8XA 3ME8A 2PVQA 2X49A 5C00A 4JRRA 4L5LA 2DBCA 2R5GA 1FG4A 5IO2A 5IMDA 2QSIA 2M46A 4KCAA 3H79A 4EVMA 1WMJA 4IKHA 1SJIA 4DSSB 1SKRB 2DJ3A 2CAQA 2EIRA 4POMA 3FHKA 2RUFA 2HQTA 3TGZA 2L57A 2JACA 1PKWA 3M1GA 1YKCA 1MDIA 2IMEA 4ZB6A 3ZVJD 1H75A 2LSTA 3EC3A 1GRXA 3RDWA 3TU3B 2JADA 1Z6MA 4ML6A 5BMUA 4ZL9A 5IPGA 5J9CA 3LORA 5IQYA 3FK8A 5IOXA 4KUNA 2GSRA 1XIYA 5FHIA 1XZOA 3TJJA 3F4SA 3KZQA 1AQXA 2E0QA 1AQVA 5ECPB 1M2DA 3KP8A 3V1WA 1M2BA 6GSYA 2N5FA 4MLYA 4AKXB 5D9XA 4BWSA 4WR4A 1GSDA 5J3RA 4YQVA 5IO0A 1TRWA 4BVYA 1GUKA 4KCEA 2VCQA 4OFTA 2FNOA 2VCXA 5DQSA 2DC5A 4V2MA 5A5HA 3RPPA 3DVXA 1GWCA 2YWMA 1SL2B 2QA2A 4PUFC 3IAS2 2K18A 4POLA 5E59A 1QFNA 4MK3A 3CRTA 2PWJA 1S4BP 1PN0A 4D73B 3C7MA 4BVXA 3GHAA 1EP7A 4FXYP 5H5QA 4P3YB 2IMKA 3H1NA 1Z3EA 4X1UA 2A2SA 4MJEA 3A2VA 6GSVA 2MMZA 5B6NA 4PQIA 1XXUA 2PPTA 3PGTA 4O7HA 1Z6NA 3GIXA 3RAZA 3LFLA 2GZZA 4N11A 1W4VA 3CSJA 4V1Ag 4PURA 3TJGA 5KN0A 2ZUPA 2P31A 1WWJA 3HMJG 3PINA 3UVTA 5ECSA 2BMXA 1DSBA 2H76A 2LS5A 2LKUA 5KN1A 2WVZA 3VI7A 2PBJA 2FWFA 4TR3A 1A23A 18GSA 2V6OA 5CNWA 1BAYA 4MF5A 4Q5QA 4Q5FA 1O81A 5AGYA 1SKWB 3FR9A 4KDXA 3F6FA 1X5EA 2CV4A 5J41A 1GTUA 1T4YA 4HZ2A 5CREA 2EFDA 2F8FA 5ID2A 2OBIA 4ECJA 3HA9A 2OE3A 4N30A 3L9UA 3GV1A 2HRKA 3C8EA 5G5FA 1CQGA 4GDFA 4MH3A 5D96A 4N0ZA 3GL5A 4PXOA 2KOKA 1SK1A 5A4VA 2WW1A 5CRDA 3VURA 4BPYA 3M8NA 1S3CA 3ZFBA 3A2XA 1URMA 5IMVA 4KE3A 3TRQA 1R4WA 3U5RE 4RQRA 2A2PA 5CRGA 3DWVA 1TXXA 5CRWA 1FVJA 4CY6A 3P7XA 2I3YA 4XRAA 4G19A 4HEA2 1TU8A 3K8NA 3DD3A 1YEWC 1T1VA 2R4VA 2HI7A 3Q19A 3H93A 3F4RA 2CZ2A 5IM9A 3DXBA 4EIPA 1Z7RA 4PI2C 2CA8A 3BCKA 4F03A 1TW9A 5ABRA 3IBHA 4IJIA 4G9HA 2H1BA 2R6KA 4CY8A 1TRVA 2CZ3A 4FYBA 1HYUA 3F3QA 1Z9HA 1Y6EA 4Z2RA 2O8VB 3GX8A 2H19A 4EDYA 2AYTA 2MYGA 5DALB 4I97A 4HJ2A 3VK9A 3N5OA 2Z9SA 2CX4A 3O6TA 1YKAA 3TKSE 2VCVA 2C0GA 3L9VA 2B7JA 3O76A 1EV9A 3WYWA 4ZL8A 1SL1B 3LW9A 4NXIA 1I1IP 2C80A 1X5DA 4ECIA 1B9YC 2A4VA 3L0HA 1PQNA 3GH6A 4K1FA 3NZNA 2X8GA 1T4ZA 2DMLA 4K2XA 2KLXA 3CMIA 1M2AA 1T7PB 2E2MA 3NIVA 1ERUA 3ZMLA 1XW9A 1OC8A 4AJ8A 4YH2A 3UBKA 14GSA 5BMUB 1V9WA 4KGIA 5ECHB 5J5NA 3QMXA 2FHEA 1NSWA 2PVOC 1A0FA 1K0MA 3HXSA 5ECLB 1MEKA 2GSSA 1AC1A 1ABAA 19GSA 1EV4A 3LJRA 2V32A 2WS2A 2R0GA 1GH2A 2AJQB 3CTGA 4IP6A 5F05A 1GTBA 1UVZA 4XIHA 3ZREA 1T00A 2NVLA 5FWGA 3E3EA 4ZBAA 4ZB9A 2WFCA 5H5RA 4G10A 4BVYB 2XPDA 2RLIA 3LEFA 2O5VA 2ALBA 3HYPA 1K0AA 2H75A 1PL1A 1EEJA 2IPAA 2JU5A 1A0RP 2XPEA 5A5HB 2JSZA 3ZRDA 4Z2UA 3QPMA 2GT5A 3QAWA 1EGRA 5D8IA 3MIXA 2HE3A 1JZRA 2K6VA 4WKWA 3D21A 4ILFA 3M9JA 3F8UA 3E9JB 3I43A 4O32A 4BVXB 2H30A 1YY7A 2H8LA 1SJZA 4YKGA 1EWXA 1VF4A 2V2GA 3CRUA 1O73A 4I5QA 4ZXGA 4RI7A 4G01A 3Q6OA 2LJKA 3GYKA 2UV8G 3N9JA 4GLTA 2LTKA 3RGBC 1BJXA 4JEDA 2G2QA 2YANA 4KB3A 1HNBA 3ZL5A 2WCIA 2DJ1A 4L0WA 3QCPA 2R3XA 3FZ5A 5EPFA 2P5RA 3APSA 1T8EB 1K0CA 4WBJA 4FH8A 4ZIJA 3TDGA 5ECNB 3TB2A 3E0UA 1Y25A 3MSZA 1QK8A 3NOFA 1PD21 4LLRA 2C3TA 3HD5A 1AAZA 4PUAA 2C4JA 1NM3A 2WGRA 3EPTA 4TXOA 5H5SA 1A8YA 3M3MA 4MZBA 5ID2B 2VL2A 1VF2A 2E2GA 2IL3A 4O5QA 5B6MA 3RBTA 3Q18A 2HRKB 3SWLA 3BOAA 3FKFA 2TRXA 5J4YA 4QQ7A 2ZCTA 2LEGA 3BD2A 1GULA 5DAKA 1ZYPA 5ECOB 1U88A 4MF7A 4QMKA 2IJYA 1KBNA 1NHOA 5JCGA 11GSA 5HR2A 3W8JA 1PRXA 5L71A 3R2QA 4F9ZA 3L9SA 1AIUA 1ERTA 1GUHA 1V98A 4ZL7A 4IELA 1ZOFA 3RPNA 1O8XA 5IMAA 3GSTA 1EOHA 3I69A 20GSA 1N2AA 1SK2A 5KOXA 4W66A 3GUSA 4WR5A 3C1SA 3DMLA 1BG1A 2M72A 2GVPA 4K6XA 4ZBDA 1WP0A 3D0ZA 1WRYA 4TW5A 1K0NA 1PA3A 2AV4A 2B1KA 3ERWA 1IYHA 1PX7A 3G9BA 4EO3A 2BJXA 3ED3A 1TTZA 5J4UA 3GNJA 4OFMA 1XPVA 3ZITA 2KHPA 2XHFA 4GXZA 2IFQA 3GTUA 1WIKA 4X43A 3MDKA 5G2ZA 3FEUA 5GAND 2DMMA 4ICYA 1XG8A 3UEMA 2F51A 2C3NA 4POKA 1GLPA 1AUCA 4XCSA 5HFGA 5HQPA 4G0LA 2VM1A 2F3MA 1PX6A 3ZMKA 3UJ1A 3HHVA 3ZIVA 1MDKA 1F3BA 2F9SA 4TKYA 4PQ1A 4FYCA 2GSTA 4HDEA 1JZDA 2GZYA 1F6MC 4GSTA 3DYRA 4EXJA 3MAKA 4AKGA 3CYNA 2MBSA 3C1RA 3MYDA 4QL9A 1DUGA 1USBA 3GSSA 1DBYA 5A5KA 1FB6A 2MBTA 2K9FA 1THOA 1PL2A 2YJHA 2WW2A 4AJ6A 5KN3A 4MZCA 2DSAA 3GURA 1KTEA 3HKRA 2CX3A 2VM2A 4GF0A 4ZB8A 2OE0A 1GSYA 1TI3A 4GQFA 4KDUA 3VWXA 4JU5A 4MJBA 1FB0A 4JZQA 2FA4A 4AJ7A 4EL1A 1ERVA 1JZOA 4LMVA 1F9MA 5KOWA 3IDVA 2V41A 4EC0A 5ELGA 2H71A 2RM6A 1RW1A 3FZ4A 1SD8A 4OMVA 1NW2A 5G1LA 4RUVA 4NV5A 2HRNA 4HUAA 4NV2A 1X0RA 1TOFA 2DKHA 3J7Yb 2H1GA 2GQKA 3UBLA 1X9MB 3UIWA 3I9V2 1SYXA 3EE2A 1EOGA 3J7Yk 1BF5A 3HVXA 1DE2A 1AW9A 1ZYEA 4EE0A 2IMFA 1FO5A 1ZZYA 3CSHA 2O89A 1XWKA 4KNDA 1MDJA 3GRXA 4V2LA 2DIZA 2L6DA 2AUVA 2C0DA 1Y1UA 3F63A 2VKZG 3ZTLA 2VD1A 2CQ9A 2H6XA 4OFNA 4IVFA 4TR1A 4MJAA 3P2AA 4BIKA 2H1AA 1G7OA 1ERWA 2PERA 2R37A 4K7NA 3QAVA 3ERFA 3HJMA 2OJLA 1TDIA 2X8CA 2GGTA 3UOMA 1KEBA 4K2DA 3RHBA 1AXDA 4GSNA 3ZIJA 4TXOB 2LJRA 4GRFA 2KP1A 1OC9A 2H70A 4EUYA 2REMA 3PH9A 5DQYA 4PNGA 2VLUA 3KTBA 1JZWA 3VPQA 2X4AA 4HQSA 3LXTA 2OT3A 3HVNA 1R5PA 1G6YA 5G5EA
chains in the Genus database with same CATH topology
3SBCA 2NPBA 2YJ7A 5G1KA 2HRFA 5DAKB 4IGJA 3QFAC 3L4NA 2H01A 3GKNA 3LG6A 1TJDA 3A3TA 3MWHA 3DGQA 1OC3A 2RIIA 2H0HA 1S3AA 4HU7A 4XS6A 1XBSA 2RUEA 2PUKC 1W89A 1Z5YE 4EIQA 3F4TA 1XWCA 2AAWA 1VF3A 1U6TA 1GSQA 2LRTA 5HR1A 1EGOA 4LA1A 4FO5A 4CDOA 2CVDA 3HJPA 2HSHA 3UAPA 4V1Ap 4HOJA 17GSA 4CHSA 4O5RA 1TI1A 2KP2A 3FMWA 1UN2A 3IAM2 1K3YA 2R0PA 1OKDA 2V1MA 5B7CA 2YV7A 1V57A 2GZPA 4ML1A 4KDYA 1SYRA 4JBBA 3DKSA 1XOAA 3GKXA 2DJ0A 1ON4A 5C04A 4K7OA 1GP1A 4TN8A 1TU7A 1V40A 1SVMA 4DVCA 4MPFA 1WPIA 2IFQB 3GTUB 4WEYA 4X4JA 2IWTA 3EU4A 1SL0B 3PR8A 4PTSA 4IBPA 2CVKA 3KM6A 3TKQA 1O85A 5J47A 4JE1A 2C1YA 4RQXA 4JR6A 5A34A 2H0GA 5JWOB 1M9AA 4MA9A 1QXHA 5DBQA 4PX1A 4OCEA 1UC7A 4YAVA 4K0NA 2O85A 5ECIB 1XCCA 3RHCA 22GSA 2B3SA 1F3AA 1QUWA 4XHMA 3CXGA 1GLQA 4TXVA 4I2UA 4KA0A 2LQQA 4JR4A 3G7YA 4PNFA 2OACA 1ZGNA 1DE1A 1JHBA 1K3OA 2G0FA 4K5RA 1G7EA 4ULXA 2DJJA 2VCWA 2N5AA 4Z7XA 4PQHA 1M9BA 3BCIA 4KF9A 4FQUA 5D9TA 3EURA 3H8QA 2VOCA 1THXA 4FYUA 4PGTA 3KGKA 5D93A 3QDNA 3G7IA 1HD2A 1X5CA 1K0DA 2QKEA 1WE0A 1EP8A 1PKZA 3LYKA 4MMMA 3DEXA 2NTOA 3WGEA 4K8MA 2MMAA 1I5GA 2F8AA 3IOSA 5J40A 5ECQB 5ELAA 4GCIA 5FT3A 1GL8A 2VAFA 2GT6A 2EC4A 8GSSA 1HQOA 1CQHA 3LYPA 5HFIA 4EDZA 2C0FA 2H72A 3ZZXA 2R2JA 2HFDA 2JZTA 2LNTA 5IMFA 3DVWA 5ECMB 3IC8A 4OWYA 5F07A 2DJKA 2PGTA 1O8WA 4RI6A 3EYTA 1B9XC 4MJCA 5HFKA 4XS4A 2OADA 4N0VA 3A5IA 2H73A 5DCHA 5JCUA 2O87A 4ISDA 1UA5A 1HNCA 3GMFA 1JLWA 3P90A 3HVSA 1ZMAA 4TRXA 2HXKA 4LL4B 2LJAA 5J9BA 1RK4A 3S9FA 2HSMA 3UL3A 2YV9A 5BRTA 5F06A 2FWGA 1SK0A 1SVLA 4TR1B 4POBA 3GN3A 1SKSB 2WZ9A 4XTSA 1WJKA 1YEPA 4NWYA 4ACSA 3M0FA 1OE7A 2DIYA 3US3A 4L8EA 3WGXA 2I81A 3EU3A 2VL2C 2HZEA 3HZ8A 2YOIA 1J08A 3ERGA 5F0GA 1N8JA 2CAIA 3TJKA 3IV4A 1MD4A 1I9DA 3ISOA 1OC9B 1ZYQB 1OVNA 1SJ6A 1J9BA 2FGXA 3LXZA 1GTIA 4NMUA 4KSOA 3TKRA 5B8AA 1PMTA 2HSNA 2LNSA 2YN1A 1VF1A 1GSFA 3KMOA 4TOPA 1QGVA 3HDCA 3IR4A 3AY8A 4AGSA 2GQLA 2ZNMA 3FY7A 3LWAA 2YZUA 3TRXA 2H1DA 4N3ZA 2YWIA 2WJUA 2IN3A 3GFKA 4IJ3A 4GSSA 4Z2TA 3ZYWA 2XBIA 3IC4A 3FRCA 4E8HA 1FOHA 5AN1A 4XRDA 4O92A 6GSXA 3A5WA 4L0UA 1R5AA 1VGLA 2FLSA 1YEXA 3IHQA 3TKSA 1A2LA 3I6AA 2YWOA 3VFIA 5HR0A 1NHYA 2MMOA 2CT6A 5E4WA 1A2MA 2VLTA 2JSYA 2PN8A 3KTLA 6GSUA 4WF5A 4BWQA 2B5EA 2QA1A 2FD3A 4X0XA 1YZXA 4AKHA 2B1LA 2H66A 1A24A 3IA1A 2ON5A 1V2AA 3VWUA 3CSIA 5F8BA 2WULA 1LBKA 2NDOA 3FZ9A 4HU9A 4MZWA 2X99A 2K8SA 5A4UA 2JZSA 4HJMA 2L4QA 1BYEA 5A1NA 5J4VA 1PSQA 1BG5A 5A34B 3TCOA 5LNKe 3D4TA 1FVKA 3KXOA 1U3IA 3W6GA 2TRCP 5DJLA 2OBKA 1OYJA 4OD7A 1QMVA 3G7JA 1F37A 4ECBA 1X9WB 1Q4JA 3F3RA 2VCTA 3CBUA 1GSSA 1TKDB 5IMCA 4K7IA 3KIJA 1EZKA 3FW2A 2E7PA 3F0IA 4IQ1A 2VUPA 4E68A 3OR5A 3W8SA 2R0CA 4A5PA 2LRCA 4J2FA 4LMWA 4IS0A 1Z7PA 4BL7A 2M80A 2ES7A 5DCGA 2I9HA 4YQUA 4TR0A 2D2ZA 1ST9A 2XC2A 2J23A 5HR3A 3U6VA 2B6MA 2FWHA 2IIYA 5LD0A 1A2JA 4NHWA 4HZ4A 4OO5A 4IQAA 1B4QA 3ZVJA 4WETA 1B4PA 4G0IA 13GSA 3QAGA 2HNLA 5LCZA 3D22A 3M9KA 1ACVA 1AQWA 4FIWA 4QL7A 3GA4A 2L4CA 3APOA 3QR6A 1ZL9A 2YWNA 1BX9A 2YP6A 1GUMA 1FW1A 3ME7A 3VPTA 5JWQB 3R3EA 1PGTA 2LRNA 5G31A 1TK8B 1E2YA 2HZFA 3MNGA 1N25A 4IN0A 4IHUA 5CO3A 5AIVA 5B8BA 2EIOA 3QFBC 5KEJA 1MTCA 1U87A 4AF2A 3EMPA 3FR3A 1XOBA 4XS4B 4ZILA 2EFEA 2OKAA 2FY6A 3APQA 2GLRA 2EFCA 2VL9A 2UZ8A 3DIEA 3GKMA 3WD6A 1S3DA 4N10A 3WT1A 4LL1B 4KSMA 1JFUA 2OA7A 2HSMB 4V2NA 2EIQA 5AISA 1XFLA 2HT9A 1SU9A 1G0TA 2CVBA 3IK7A 4MP4A 3TOUA 4NPBA 4G0KA 7GSSA 1RQMA 5GSTA 4E8EA 3UARA 2DJ2A 1O7UA 1K0OA 2HZEB 3TJBA 3GKKA 5JWRB 3DRNA 1QQ2A 2VL3A 1M0UA 4OO4A 5D9WA 2GS3A 4KX4A 4YQMA 3ZFLA 6GSSA 2FCHA 2HSYA 2HYXA 1O6JA 5AIXA 2XBQA 1G6WA 3KMNA 2H6ZA 4MH2A 4WF4A 2J9HA 2HSNB 2K8VA 2QC7A 2B5XA 4WXTA 4ID0A 3KH9A 1ML6A 3HJOA 2H0IA 2I4AA 1YF1A 3IHGA 3L78A 1JLVA 4MNNA 3CTFA 4NHZA 2DKIA 5GAPD 1HNAA 3P8WA 4NAXA 2VIMA 4IW9A 3WT2A 3BJ5A 3HCZA 2LUSA 4ZBBA 1BQ7A 9GSSA 3UMAA 3JCML 1OAZA 3EINA 1SENA 4Q5RA 1LJRA 1C72A 3O3TA 1VRSD 2JL4A 4WBRD 1XWBA 3PPUA 3VLNA 1A8LA 5DJMA 2O7KA 1M99A 5ECKB 2A4HA 2VD0A 2TIRA 4DSSA 2EFHA 2X64A 2AB6A 2C3QA 1WOUA 4BA7A 3BBYA 3A2WA 4F0CA 5A4WA 5ECRB 1XW6A 1LU4A 3D4MA 3TKPA 3EVIA 1B48A 1KNGA 2KUCA 4DSRA 5CYYA 5COHA 3KEBA 2WDUA 2GSQA 2N5BA 1XW5A 3C71A 1E6BA 4L5OA 2X8HA 5KN2A 2WB9A 3C73A 2MMNA 3IK9A 3VWWA 5IMZA 4HS1A 4KW6A 1SVOA 1YQ1A 5A1NB 2H74A 1FHEA 1ILOA 4YKFA 3WGDA 4TVEA 2HLSA 4J57E 1MD3A 2AHEA 1SD9A 3KCMA 1YVLA 2V6KA 5CP1A 2YNXA 2YCDA 5DDLA 5CAXA 1ZCPA 1GSUA 2WRTA 2H1LA 3F9UA 5DVBA 1YJ6A 3KJYA 4HI7A 4ECCA 1YF0A 4F0BA 3EWLA 4YAPA 5IPHA 2L5LA 5EY6A 3D5JA 5IOWA 2GQMA 4ZB7A 2L6CA 3H4KA 4I2TA 1ZYNA 2RM5A 4K5SA 1GSEA 3IPZA 4Q5NA 4BL7B 4MPGA 2MZCA 4D73A 5EVOA 5IIZA 1PN9A 1K0BA 3KH7A 16GSA 3D6IA 4KH7A 1TK0B 4K0GA 1XVWA 1TK5B 1V58A 1BEDA 1TXUA 2IMDA 3GL3A 1GNWA 5CRHA 1OKTA 4GQCA 1R7HA 1EEMA 1FOVA 3CWGA 4MCUA 2I1UA 1XWAA 3TOTA 2P5QA 1M7TA 1YDKA 5G30A 3LGCA 3QOUA 3ZLPA 2FA8A 1TRSA 2C0EA 4CW9A 1Q98A 4HQZA 2YPMA 1X9SB 4AI6A 1OE8A 4USSA 3FZAA 4DEJA 3FYGA 1U3AA 1TRUA 4DSQA 2PMTA 1GNEA 4AKIA 4J56E 4H86A 1K3LA 2NBSA 12GSA 2H6YA 3LQ7A 4F2IA 4F82A 1IYIA 5ENUA 1R26A 3KP9A 3HVVA 2QGVA 6GSWA 1XWGA 2P0GA 3IRAA 4I8BA 5INYA 2C8UA 4EF0A 4XS1A 3TJFA 2LV3A 4IP1A 3HY2A 4KAEA 3UVHA 2DLXA 1FAAA 2JZRA 4K9ZA 1F2EA 3Q74A 2IMIA 3KD0A 3VWVA 6GSTA 2VCZA 4G2EA 4MABA 2L59A 2B5YA 2LQOA 4OCFA 3F6DA 4MF6A 3TUEA 2B7KA 2GTUA 1T3BA 2HRAA 1XVQA 5GSSA 3HZ4A 2OE1A 1J0FA 2GDRA 3TKSC 5GZZB 3TRPA 4TR4A 1GTAA 2FUG2 3GX0A 2YZHA 5JCWA 4EKZA 5D73A 2PU9C 2ON7A 3FR6A 1TP9A 3LSZA 3IXRA 5D9VA 4MDCA 3EMXA 1H4OA 2FWEA 2VLVA 4GTUA 3IE3A 10GSA 2L5OA 4O5UA 3QD9A 4GWRA 2A2RA 2BTOT 4I6XA 2VO4A 3VI5A 5EL8A 5DALA 3GH9A 1B8XA 3ME8A 2PVQA 2X49A 5C00A 4JRRA 4L5LA 2DBCA 2R5GA 1FG4A 5IO2A 5IMDA 2QSIA 2M46A 4KCAA 3H79A 4EVMA 1WMJA 4IKHA 1SJIA 4DSSB 1SKRB 2DJ3A 2CAQA 2EIRA 4POMA 3FHKA 2RUFA 2HQTA 3TGZA 2L57A 2JACA 1PKWA 3M1GA 1YKCA 1MDIA 2IMEA 4ZB6A 3ZVJD 1H75A 2LSTA 3EC3A 1GRXA 3RDWA 3TU3B 2JADA 1Z6MA 4ML6A 5BMUA 4ZL9A 5IPGA 5J9CA 3LORA 5IQYA 3FK8A 5IOXA 4KUNA 2GSRA 1XIYA 5FHIA 1XZOA 3TJJA 3F4SA 3KZQA 1AQXA 2E0QA 1AQVA 5ECPB 1M2DA 3KP8A 3V1WA 1M2BA 6GSYA 2N5FA 4MLYA 4AKXB 5D9XA 4BWSA 4WR4A 1GSDA 5J3RA 4YQVA 5IO0A 1TRWA 4BVYA 1GUKA 4KCEA 2VCQA 4OFTA 2FNOA 2VCXA 5DQSA 2DC5A 4V2MA 5A5HA 3RPPA 3DVXA 1GWCA 2YWMA 1SL2B 2QA2A 4PUFC 3IAS2 2K18A 4POLA 5E59A 1QFNA 4MK3A 3CRTA 2PWJA 1PN0A 4D73B 3C7MA 4BVXA 3GHAA 1EP7A 5H5QA 4P3YB 2IMKA 3H1NA 1Z3EA 4X1UA 2A2SA 4MJEA 3A2VA 6GSVA 2MMZA 5B6NA 4PQIA 1XXUA 2PPTA 3PGTA 4O7HA 1Z6NA 3GIXA 3RAZA 3LFLA 2GZZA 4N11A 1W4VA 3CSJA 4V1Ag 4PURA 3TJGA 5KN0A 2ZUPA 2P31A 1WWJA 3HMJG 3PINA 3UVTA 5ECSA 2BMXA 1DSBA 2H76A 2LS5A 2LKUA 5KN1A 3VI7A 2PBJA 2FWFA 4TR3A 1A23A 18GSA 2V6OA 5CNWA 1BAYA 4MF5A 4Q5QA 4Q5FA 1O81A 5AGYA 1SKWB 3FR9A 4KDXA 3F6FA 1X5EA 2CV4A 5J41A 1GTUA 1T4YA 4HZ2A 5CREA 2EFDA 2F8FA 5ID2A 2OBIA 4ECJA 3HA9A 2OE3A 4N30A 3L9UA 3GV1A 2HRKA 3C8EA 5G5FA 1CQGA 4GDFA 4MH3A 5D96A 4N0ZA 3GL5A 4PXOA 2KOKA 1SK1A 5A4VA 5CRDA 4BPYA 3VURA 3M8NA 1S3CA 3ZFBA 3A2XA 1URMA 5IMVA 4KE3A 3TRQA 1R4WA 3U5RE 4RQRA 2A2PA 5CRGA 3DWVA 1TXXA 5CRWA 1FVJA 4CY6A 3P7XA 2I3YA 4XRAA 4G19A 4HEA2 1TU8A 3K8NA 3DD3A 1T1VA 2R4VA 2HI7A 3Q19A 3H93A 3F4RA 2CZ2A 5IM9A 3DXBA 4EIPA 1Z7RA 2CA8A 3BCKA 4F03A 1TW9A 5ABRA 3IBHA 4IJIA 4G9HA 2H1BA 2R6KA 4CY8A 1TRVA 2CZ3A 4FYBA 1HYUA 3F3QA 1Z9HA 1Y6EA 4Z2RA 2O8VB 3GX8A 2H19A 4EDYA 2AYTA 2MYGA 5DALB 4I97A 4HJ2A 3VK9A 3N5OA 2Z9SA 2CX4A 3O6TA 1YKAA 3TKSE 2VCVA 2C0GA 3L9VA 2B7JA 3O76A 1EV9A 3WYWA 4ZL8A 1SL1B 3LW9A 4NXIA 2C80A 1X5DA 4ECIA 1B9YC 2A4VA 3L0HA 1PQNA 3GH6A 4K1FA 3NZNA 2X8GA 1T4ZA 2DMLA 4K2XA 2KLXA 3CMIA 1M2AA 1T7PB 2E2MA 3NIVA 1ERUA 3ZMLA 1XW9A 1OC8A 4AJ8A 4YH2A 3UBKA 14GSA 5BMUB 1V9WA 4KGIA 5ECHB 5J5NA 3QMXA 2FHEA 1NSWA 2PVOC 1A0FA 1K0MA 3HXSA 5ECLB 1MEKA 2GSSA 1AC1A 1ABAA 19GSA 1EV4A 3LJRA 2V32A 2WS2A 2R0GA 1GH2A 2AJQB 3CTGA 4IP6A 5F05A 1GTBA 1UVZA 4XIHA 3ZREA 1T00A 2NVLA 5FWGA 3E3EA 4ZBAA 4ZB9A 2WFCA 5H5RA 4G10A 4BVYB 2XPDA 2RLIA 3LEFA 2O5VA 2ALBA 3HYPA 1K0AA 2H75A 1PL1A 1EEJA 2IPAA 2JU5A 1A0RP 2XPEA 5A5HB 2JSZA 3ZRDA 4Z2UA 3QPMA 2GT5A 3QAWA 1EGRA 5D8IA 3MIXA 2HE3A 1JZRA 2K6VA 4WKWA 3D21A 4ILFA 3M9JA 3F8UA 3E9JB 3I43A 4O32A 4BVXB 2H30A 1YY7A 2H8LA 1SJZA 4YKGA 1EWXA 1VF4A 2V2GA 3CRUA 1O73A 4I5QA 4ZXGA 4RI7A 4G01A 3Q6OA 2LJKA 3GYKA 2UV8G 3N9JA 4GLTA 2LTKA 1BJXA 4JEDA 2G2QA 2YANA 4KB3A 1HNBA 3ZL5A 2WCIA 2DJ1A 4L0WA 3QCPA 2R3XA 3FZ5A 5EPFA 2P5RA 3APSA 1T8EB 1K0CA 4WBJA 4FH8A 4ZIJA 3TDGA 5ECNB 3TB2A 3E0UA 1Y25A 3MSZA 1QK8A 3NOFA 1PD21 4LLRA 2C3TA 3HD5A 1AAZA 4PUAA 2C4JA 1NM3A 2WGRA 3EPTA 4TXOA 5H5SA 1A8YA 3M3MA 4MZBA 5ID2B 2VL2A 1VF2A 2E2GA 2IL3A 4O5QA 5B6MA 3RBTA 3Q18A 2HRKB 3SWLA 3BOAA 3FKFA 2TRXA 5J4YA 4QQ7A 2ZCTA 2LEGA 3BD2A 1GULA 5DAKA 1ZYPA 5ECOB 1U88A 4MF7A 4QMKA 2IJYA 1KBNA 1NHOA 5JCGA 11GSA 5HR2A 3W8JA 1PRXA 5L71A 3R2QA 4F9ZA 3L9SA 1AIUA 1ERTA 1GUHA 1V98A 4ZL7A 4IELA 1ZOFA 3RPNA 1O8XA 5IMAA 3GSTA 1EOHA 3I69A 20GSA 1N2AA 1SK2A 5KOXA 4W66A 3GUSA 4WR5A 3C1SA 3DMLA 1BG1A 2M72A 2GVPA 4K6XA 4ZBDA 1WP0A 3D0ZA 1WRYA 4TW5A 1K0NA 1PA3A 2AV4A 2B1KA 3ERWA 1IYHA 1PX7A 3G9BA 4EO3A 2BJXA 3ED3A 1TTZA 5J4UA 3GNJA 4OFMA 1XPVA 3ZITA 2KHPA 2XHFA 4GXZA 2IFQA 3GTUA 1WIKA 4X43A 3MDKA 5G2ZA 3FEUA 5GAND 2DMMA 4ICYA 3UEMA 2F51A 2C3NA 4POKA 1GLPA 1AUCA 4XCSA 5HFGA 5HQPA 4G0LA 2VM1A 2F3MA 1PX6A 3ZMKA 3UJ1A 3HHVA 3ZIVA 1MDKA 1F3BA 2F9SA 4TKYA 4PQ1A 4FYCA 2GSTA 4HDEA 1JZDA 2GZYA 1F6MC 4GSTA 3DYRA 4EXJA 3MAKA 4AKGA 3CYNA 2MBSA 3C1RA 3MYDA 4QL9A 1DUGA 1USBA 3GSSA 1DBYA 5A5KA 1FB6A 2MBTA 2K9FA 1THOA 1PL2A 2YJHA 4AJ6A 5KN3A 4MZCA 2DSAA 3GURA 1KTEA 3HKRA 2CX3A 2VM2A 4GF0A 4ZB8A 2OE0A 1GSYA 1TI3A 4GQFA 4KDUA 3VWXA 4JU5A 4MJBA 1FB0A 4JZQA 2FA4A 4AJ7A 4EL1A 1ERVA 1JZOA 4LMVA 1F9MA 5KOWA 3IDVA 2V41A 4EC0A 5ELGA 2H71A 2RM6A 1RW1A 3FZ4A 1SD8A 4OMVA 1NW2A 5G1LA 4RUVA 4NV5A 2HRNA 4HUAA 4NV2A 1X0RA 1TOFA 2DKHA 3J7Yb 2H1GA 2GQKA 3UBLA 1X9MB 3UIWA 3I9V2 1SYXA 3EE2A 1EOGA 3J7Yk 1BF5A 3HVXA 1DE2A 1AW9A 1ZYEA 4EE0A 2IMFA 1FO5A 1ZZYA 3CSHA 2O89A 1XWKA 4KNDA 1MDJA 3GRXA 4V2LA 2DIZA 2L6DA 2AUVA 2C0DA 1Y1UA 3F63A 2VKZG 3ZTLA 2VD1A 2CQ9A 2H6XA 4OFNA 4IVFA 4TR1A 4MJAA 3P2AA 2H1AA 1G7OA 1ERWA 2PERA 2R37A 4K7NA 3QAVA 3ERFA 3HJMA 2OJLA 1TDIA 2X8CA 2GGTA 3UOMA 1KEBA 4K2DA 3RHBA 1AXDA 4GSNA 3ZIJA 4TXOB 2LJRA 4GRFA 2KP1A 1OC9A 2H70A 4EUYA 2REMA 3PH9A 5DQYA 4PNGA 2VLUA 3KTBA 1JZWA 3VPQA 2X4AA 4HQSA 3LXTA 2OT3A 1R5PA 1G6YA 5G5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBC A;  2NPB A;  2YJ7 A;  5G1K A;  2HRF A;  5DAK B;  4IGJ A;  3QFA C;  3L4N A;  2H01 A;  3GKN A;  3LG6 A;  1TJD A;  3A3T A;  3MWH A;  3DGQ A;  1OC3 A;  2RII A;  2H0H A;  1S3A A;  4HU7 A;  4XS6 A;  1XBS A;  2RUE A;  2PUK C;  1W89 A;  1Z5Y E;  3F4T A;  1XWC A;  2AAW A;  1VF3 A;  1U6T A;  1GSQ A;  2LRT A;  5HR1 A;  1EGO A;  4LA1 A;  4FO5 A;  4CDO A;  2CVD A;  3HJP A;  2HSH A;  3UAP A;  4V1A p;  4HOJ A;  17GS A;  4CHS A;  4O5R A;  1TI1 A;  2KP2 A;  1UN2 A;  3IAM 2;  1K3Y A;  1OKD A;  2V1M A;  5B7C A;  2YV7 A;  1V57 A;  2GZP A;  4ML1 A;  4KDY A;  1SYR A;  4JBB A;  3DKS A;  1XOA A;  3GKX A;  2DJ0 A;  1ON4 A;  5C04 A;  4K7O A;  1GP1 A;  4TN8 A;  1TU7 A;  1V40 A;  4DVC A;  4MPF A;  1WPI A;  2IFQ B;  3GTU B;  4WEY A;  2IWT A;  3EU4 A;  1SL0 B;  3PR8 A;  4PTS A;  4IBP A;  2CVK A;  3KM6 A;  3TKQ A;  1O85 A;  4JE1 A;  2C1Y A;  4RQX A;  4JR6 A;  2H0G A;  5JWO B;  1M9A A;  4MA9 A;  1QXH A;  5DBQ A;  4PX1 A;  4OCE A;  1UC7 A;  4YAV A;  4K0N A;  2O85 A;  5ECI B;  1XCC A;  3RHC A;  22GS A;  2B3S A;  1F3A A;  1QUW A;  4XHM A;  3CXG A;  1GLQ A;  4TXV A;  4I2U A;  4KA0 A;  2LQQ A;  4JR4 A;  3G7Y A;  4PNF A;  2OAC A;  1ZGN A;  1DE1 A;  1JHB A;  1K3O A;  2G0F A;  1G7E A;  4ULX A;  2DJJ A;  2VCW A;  2N5A A;  4Z7X A;  4PQH A;  1M9B A;  3BCI A;  4KF9 A;  4FQU A;  5D9T A;  3EUR A;  3H8Q A;  2VOC A;  1THX A;  4FYU A;  4PGT A;  3KGK A;  5D93 A;  3QDN A;  3G7I A;  1HD2 A;  1X5C A;  1K0D A;  2QKE A;  1WE0 A;  1EP8 A;  1PKZ A;  3LYK A;  4MMM A;  3DEX A;  2NTO A;  3WGE A;  4K8M A;  2MMA A;  1I5G A;  2F8A A;  3IOS A;  5ECQ B;  5ELA A;  4GCI A;  5FT3 A;  1GL8 A;  2VAF A;  2GT6 A;  2EC4 A;  8GSS A;  1HQO A;  1CQH A;  3LYP A;  5HFI A;  4EDZ A;  2C0F A;  2H72 A;  3ZZX A;  2R2J A;  2HFD A;  2JZT A;  2LNT A;  5IMF A;  3DVW A;  5ECM B;  3IC8 A;  4OWY A;  5F07 A;  2DJK A;  2PGT A;  1O8W A;  4RI6 A;  3EYT A;  1B9X C;  4MJC A;  5HFK A;  4XS4 A;  2OAD A;  4N0V A;  2H73 A;  5DCH A;  5JCU A;  2O87 A;  4ISD A;  1UA5 A;  1HNC A;  3GMF A;  1JLW A;  3P90 A;  3HVS A;  1ZMA A;  4TRX A;  2HXK A;  4LL4 B;  2LJA A;  5J9B A;  1RK4 A;  3S9F A;  2HSM A;  3UL3 A;  2YV9 A;  5F06 A;  2FWG A;  1SK0 A;  4TR1 B;  4POB A;  3GN3 A;  1SKS B;  2WZ9 A;  4XTS A;  1WJK A;  1YEP A;  4NWY A;  4ACS A;  3M0F A;  1OE7 A;  2DIY A;  3US3 A;  4L8E A;  3WGX A;  2I81 A;  3EU3 A;  2VL2 C;  2HZE A;  3HZ8 A;  2YOI A;  1J08 A;  3ERG A;  5F0G A;  1N8J A;  2CAI A;  3TJK A;  3IV4 A;  1MD4 A;  1I9D A;  3ISO A;  1OC9 B;  1ZYQ B;  1OVN A;  1SJ6 A;  1J9B A;  2FGX A;  3LXZ A;  1GTI A;  4NMU A;  4KSO A;  3TKR A;  5B8A A;  1PMT A;  2LNS A;  2YN1 A;  1VF1 A;  1GSF A;  3KMO A;  4TOP A;  1QGV A;  3HDC A;  3IR4 A;  3AY8 A;  4AGS A;  2GQL A;  2ZNM A;  3FY7 A;  3LWA A;  2YZU A;  3TRX A;  2H1D A;  2YWI A;  2WJU A;  2IN3 A;  3GFK A;  4IJ3 A;  4GSS A;  3ZYW A;  2XBI A;  3IC4 A;  3FRC A;  4E8H A;  5AN1 A;  4XRD A;  4O92 A;  6GSX A;  3A5W A;  4L0U A;  1R5A A;  1VGL A;  2FLS A;  1YEX A;  3IHQ A;  3TKS A;  1A2L A;  3I6A A;  2YWO A;  3VFI A;  5HR0 A;  1NHY A;  2MMO A;  2CT6 A;  5E4W A;  1A2M A;  2VLT A;  2JSY A;  2PN8 A;  3KTL A;  6GSU A;  4WF5 A;  4BWQ A;  2B5E A;  2FD3 A;  4X0X A;  1YZX A;  2B1L A;  2H66 A;  1A24 A;  3IA1 A;  2ON5 A;  1V2A A;  3VWU A;  3CSI A;  5F8B A;  2WUL A;  1LBK A;  2NDO A;  3FZ9 A;  4HU9 A;  4MZW A;  2X99 A;  2K8S A;  5A4U A;  2JZS A;  4HJM A;  2L4Q A;  1BYE A;  1PSQ A;  1BG5 A;  3TCO A;  5LNK e;  3D4T A;  1FVK A;  3KXO A;  1U3I A;  3W6G A;  2TRC P;  5DJL A;  2OBK A;  1OYJ A;  4OD7 A;  1QMV A;  3G7J A;  1F37 A;  4ECB A;  1X9W B;  1Q4J A;  3F3R A;  2VCT A;  3CBU A;  1GSS A;  1TKD B;  5IMC A;  4K7I A;  3KIJ A;  1EZK A;  3FW2 A;  2E7P A;  3F0I A;  4IQ1 A;  2VUP A;  3OR5 A;  3W8S A;  2LRC A;  4J2F A;  4LMW A;  4IS0 A;  1Z7P A;  4BL7 A;  2M80 A;  2ES7 A;  5DCG A;  2I9H A;  4YQU A;  4TR0 A;  2D2Z A;  1ST9 A;  2XC2 A;  2J23 A;  5HR3 A;  3U6V A;  2B6M A;  2FWH A;  2IIY A;  5LD0 A;  1A2J A;  4NHW A;  4HZ4 A;  4OO5 A;  4IQA A;  1B4Q A;  3ZVJ A;  4WET A;  1B4P A;  4G0I A;  13GS A;  3QAG A;  2HNL A;  5LCZ A;  3D22 A;  3M9K A;  1ACV A;  1AQW A;  4FIW A;  4QL7 A;  3GA4 A;  2L4C A;  3APO A;  3QR6 A;  1ZL9 A;  2YWN A;  1BX9 A;  2YP6 A;  1GUM A;  1FW1 A;  3ME7 A;  3VPT A;  5JWQ B;  3R3E A;  1PGT A;  2LRN A;  5G31 A;  1TK8 B;  1E2Y A;  2HZF A;  3MNG A;  4IN0 A;  4IHU A;  5CO3 A;  5AIV A;  5B8B A;  2EIO A;  3QFB C;  5KEJ A;  1MTC A;  1U87 A;  4AF2 A;  3EMP A;  3FR3 A;  1XOB A;  4XS4 B;  4ZIL A;  2OKA A;  2FY6 A;  3APQ A;  2GLR A;  2VL9 A;  2UZ8 A;  3DIE A;  3GKM A;  3WD6 A;  1S3D A;  4N10 A;  3WT1 A;  4LL1 B;  4KSM A;  1JFU A;  2OA7 A;  2HSM B;  4V2N A;  2EIQ A;  5AIS A;  1XFL A;  2HT9 A;  1SU9 A;  1G0T A;  2CVB A;  3IK7 A;  4MP4 A;  3TOU A;  4NPB A;  4G0K A;  7GSS A;  1RQM A;  5GST A;  4E8E A;  3UAR A;  2DJ2 A;  1O7U A;  1K0O A;  2HZE B;  3TJB A;  3GKK A;  5JWR B;  3DRN A;  1QQ2 A;  2VL3 A;  1M0U A;  4OO4 A;  5D9W A;  2GS3 A;  4KX4 A;  4YQM A;  3ZFL A;  6GSS A;  2FCH A;  2HSY A;  2HYX A;  1O6J A;  5AIX A;  2XBQ A;  1G6W A;  3KMN A;  2H6Z A;  4MH2 A;  4WF4 A;  2J9H A;  2HSN B;  2K8V A;  2QC7 A;  2B5X A;  4WXT A;  4ID0 A;  3KH9 A;  1ML6 A;  3HJO A;  2H0I A;  2I4A A;  1YF1 A;  3L78 A;  1JLV A;  3CTF A;  4NHZ A;  5GAP D;  1HNA A;  3P8W A;  4NAX A;  2VIM A;  4IW9 A;  3WT2 A;  3BJ5 A;  3HCZ A;  2LUS A;  4ZBB A;  1BQ7 A;  9GSS A;  3UMA A;  3JCM L;  1OAZ A;  3EIN A;  1SEN A;  4Q5R A;  1LJR A;  1C72 A;  3O3T A;  1VRS D;  2JL4 A;  4WBR D;  1XWB A;  3PPU A;  3VLN A;  1A8L A;  5DJM A;  2O7K A;  1M99 A;  5ECK B;  2VD0 A;  2TIR A;  4DSS A;  2X64 A;  2AB6 A;  2C3Q A;  1WOU A;  4BA7 A;  3BBY A;  3A2W A;  4F0C A;  5A4W A;  5ECR B;  1XW6 A;  1LU4 A;  3D4M A;  3TKP A;  3EVI A;  1B48 A;  1KNG A;  2KUC A;  4DSR A;  5CYY A;  5COH A;  3KEB A;  2WDU A;  2GSQ A;  2N5B A;  1XW5 A;  3C71 A;  1E6B A;  4L5O A;  2X8H A;  5KN2 A;  2WB9 A;  3C73 A;  2MMN A;  3IK9 A;  3VWW A;  5IMZ A;  4HS1 A;  4KW6 A;  1YQ1 A;  2H74 A;  1FHE A;  1ILO A;  3WGD A;  4TVE A;  2HLS A;  4J57 E;  1MD3 A;  2AHE A;  1SD9 A;  3KCM A;  2V6K A;  5CP1 A;  2YNX A;  2YCD A;  5DDL A;  5CAX A;  1ZCP A;  1GSU A;  2WRT A;  3F9U A;  5DVB A;  1YJ6 A;  3KJY A;  4HI7 A;  4ECC A;  1YF0 A;  4F0B A;  3EWL A;  4YAP A;  5IPH A;  2L5L A;  5EY6 A;  3D5J A;  5IOW A;  2GQM A;  2L6C A;  3H4K A;  4I2T A;  2RM5 A;  1GSE A;  3IPZ A;  4Q5N A;  4BL7 B;  4MPG A;  2MZC A;  4D73 A;  5EVO A;  5IIZ A;  1PN9 A;  1K0B A;  3KH7 A;  16GS A;  3D6I A;  4KH7 A;  1TK0 B;  4K0G A;  1XVW A;  1TK5 B;  1V58 A;  1BED A;  2IMD A;  3GL3 A;  1GNW A;  5CRH A;  1OKT A;  4GQC A;  1R7H A;  1EEM A;  1FOV A;  4MCU A;  2I1U A;  1XWA A;  3TOT A;  2P5Q A;  1M7T A;  1YDK A;  5G30 A;  3LGC A;  3QOU A;  3ZLP A;  2FA8 A;  1TRS A;  2C0E A;  4CW9 A;  1Q98 A;  4HQZ A;  2YPM A;  1X9S B;  1OE8 A;  4USS A;  3FZA A;  4DEJ A;  3FYG A;  1U3A A;  1TRU A;  4DSQ A;  2PMT A;  1GNE A;  4J56 E;  4H86 A;  1K3L A;  2NBS A;  12GS A;  2H6Y A;  3LQ7 A;  4F2I A;  4F82 A;  1IYI A;  5ENU A;  1R26 A;  3KP9 A;  3HVV A;  2QGV A;  6GSW A;  1XWG A;  2P0G A;  3IRA A;  4I8B A;  5INY A;  2C8U A;  4EF0 A;  4XS1 A;  3TJF A;  2LV3 A;  4IP1 A;  3HY2 A;  4KAE A;  3UVH A;  2DLX A;  1FAA A;  2JZR A;  4K9Z A;  1F2E A;  3Q74 A;  2IMI A;  3KD0 A;  3VWV A;  6GST A;  2VCZ A;  4G2E A;  4MAB A;  2L59 A;  2B5Y A;  2LQO A;  4OCF A;  3F6D A;  4MF6 A;  3TUE A;  2B7K A;  2GTU A;  1T3B A;  2HRA A;  1XVQ A;  5GSS A;  3HZ4 A;  2OE1 A;  1J0F A;  2GDR A;  3TKS C;  5GZZ B;  3TRP A;  4TR4 A;  1GTA A;  2FUG 2;  3GX0 A;  2YZH A;  5JCW A;  4EKZ A;  5D73 A;  2PU9 C;  2ON7 A;  3FR6 A;  1TP9 A;  3LSZ A;  3IXR A;  5D9V A;  4MDC A;  3EMX A;  1H4O A;  2FWE A;  2VLV A;  4GTU A;  3IE3 A;  10GS A;  2L5O A;  3QD9 A;  4GWR A;  2A2R A;  2BTO T;  4I6X A;  2VO4 A;  3VI5 A;  5EL8 A;  5DAL A;  3GH9 A;  1B8X A;  3ME8 A;  2PVQ A;  5C00 A;  4JRR A;  4L5L A;  2DBC A;  2R5G A;  1FG4 A;  5IO2 A;  5IMD A;  2QSI A;  2M46 A;  4KCA A;  3H79 A;  4EVM A;  1WMJ A;  4IKH A;  1SJI A;  4DSS B;  1SKR B;  2DJ3 A;  2CAQ A;  2EIR A;  4POM A;  3FHK A;  2RUF A;  2HQT A;  3TGZ A;  2L57 A;  2JAC A;  1PKW A;  3M1G A;  1YKC A;  1MDI A;  2IME A;  4ZB6 A;  3ZVJ D;  1H75 A;  2LST A;  3EC3 A;  1GRX A;  3RDW A;  2JAD A;  1Z6M A;  4ML6 A;  5BMU A;  4ZL9 A;  5IPG A;  5J9C A;  3LOR A;  5IQY A;  3FK8 A;  5IOX A;  4KUN A;  2GSR A;  1XIY A;  5FHI A;  1XZO A;  3TJJ A;  3F4S A;  3KZQ A;  1AQX A;  2E0Q A;  1AQV A;  5ECP B;  1M2D A;  3KP8 A;  3V1W A;  1M2B A;  6GSY A;  2N5F A;  4MLY A;  5D9X A;  4BWS A;  4WR4 A;  1GSD A;  5J3R A;  4YQV A;  5IO0 A;  1TRW A;  4BVY A;  1GUK A;  4KCE A;  2VCQ A;  4OFT A;  2FNO A;  2VCX A;  5DQS A;  2DC5 A;  4V2M A;  3RPP A;  3DVX A;  1GWC A;  2YWM A;  1SL2 B;  4PUF C;  3IAS 2;  2K18 A;  4POL A;  5E59 A;  1QFN A;  4MK3 A;  3CRT A;  2PWJ A;  4D73 B;  3C7M A;  4BVX A;  3GHA A;  1EP7 A;  5H5Q A;  4P3Y B;  2IMK A;  3H1N A;  1Z3E A;  4X1U A;  2A2S A;  4MJE A;  3A2V A;  6GSV A;  2MMZ A;  5B6N A;  4PQI A;  1XXU A;  2PPT A;  3PGT A;  4O7H A;  1Z6N A;  3GIX A;  3RAZ A;  3LFL A;  2GZZ A;  4N11 A;  1W4V A;  3CSJ A;  4V1A g;  4PUR A;  3TJG A;  5KN0 A;  2ZUP A;  2P31 A;  1WWJ A;  3PIN A;  3UVT A;  5ECS A;  2BMX A;  1DSB A;  2H76 A;  2LS5 A;  2LKU A;  5KN1 A;  3VI7 A;  2PBJ A;  2FWF A;  4TR3 A;  1A23 A;  18GS A;  2V6O A;  5CNW A;  1BAY A;  4MF5 A;  4Q5Q A;  4Q5F A;  1O81 A;  5AGY A;  1SKW B;  3FR9 A;  4KDX A;  3F6F A;  1X5E A;  2CV4 A;  5J41 A;  1GTU A;  1T4Y A;  4HZ2 A;  5CRE A;  2F8F A;  5ID2 A;  2OBI A;  4ECJ A;  3HA9 A;  2OE3 A;  4N30 A;  3L9U A;  3GV1 A;  2HRK A;  3C8E A;  5G5F A;  1CQG A;  4MH3 A;  5D96 A;  4N0Z A;  3GL5 A;  4PXO A;  2KOK A;  1SK1 A;  5A4V A;  5CRD A;  4BPY A;  3VUR A;  3M8N A;  1S3C A;  3ZFB A;  3A2X A;  1URM A;  5IMV A;  4KE3 A;  3TRQ A;  1R4W A;  3U5R E;  4RQR A;  5CRG A;  3DWV A;  1TXX A;  5CRW A;  1FVJ A;  3P7X A;  2I3Y A;  4XRA A;  4G19 A;  4HEA 2;  1TU8 A;  3K8N A;  3DD3 A;  1T1V A;  2R4V A;  2HI7 A;  3Q19 A;  3H93 A;  3F4R A;  2CZ2 A;  5IM9 A;  3DXB A;  1Z7R A;  2CA8 A;  3BCK A;  4F03 A;  1TW9 A;  5ABR A;  3IBH A;  4IJI A;  4G9H A;  2H1B A;  2R6K A;  1TRV A;  2CZ3 A;  4FYB A;  1HYU A;  3F3Q A;  1Z9H A;  1Y6E A;  2O8V B;  3GX8 A;  2H19 A;  4EDY A;  2AYT A;  2MYG A;  5DAL B;  4I97 A;  4HJ2 A;  3VK9 A;  3N5O A;  2Z9S A;  2CX4 A;  3O6T A;  1YKA A;  3TKS E;  2VCV A;  2C0G A;  3L9V A;  2B7J A;  3O76 A;  1EV9 A;  3WYW A;  4ZL8 A;  1SL1 B;  4NXI A;  2C80 A;  1X5D A;  4ECI A;  1B9Y C;  2A4V A;  3L0H A;  1PQN A;  3GH6 A;  4K1F A;  3NZN A;  2X8G A;  1T4Z A;  2DML A;  2KLX A;  3CMI A;  1M2A A;  1T7P B;  2E2M A;  3NIV A;  1ERU A;  3ZML A;  1XW9 A;  1OC8 A;  4AJ8 A;  4YH2 A;  3UBK A;  14GS A;  1V9W A;  4KGI A;  5ECH B;  5J5N A;  3QMX A;  2FHE A;  1NSW A;  2PVO C;  1A0F A;  1K0M A;  3HXS A;  5ECL B;  1MEK A;  2GSS A;  1AC1 A;  1ABA A;  19GS A;  1EV4 A;  3LJR A;  2V32 A;  2WS2 A;  1GH2 A;  2AJQ B;  3CTG A;  4IP6 A;  5F05 A;  1GTB A;  1UVZ A;  4XIH A;  3ZRE A;  1T00 A;  2NVL A;  5FWG A;  3E3E A;  4ZBA A;  4ZB9 A;  2WFC A;  5H5R A;  4G10 A;  4BVY B;  2XPD A;  2RLI A;  3LEF A;  2ALB A;  3HYP A;  1K0A A;  2H75 A;  1PL1 A;  1EEJ A;  2IPA A;  2JU5 A;  1A0R P;  2XPE A;  2JSZ A;  3ZRD A;  3QPM A;  2GT5 A;  3QAW A;  1EGR A;  5D8I A;  2HE3 A;  1JZR A;  2K6V A;  4WKW A;  3D21 A;  4ILF A;  3M9J A;  3F8U A;  3E9J B;  3I43 A;  4O32 A;  4BVX B;  2H30 A;  1YY7 A;  2H8L A;  1SJZ A;  1EWX A;  1VF4 A;  2V2G A;  3CRU A;  1O73 A;  4I5Q A;  4ZXG A;  4RI7 A;  3Q6O A;  2LJK A;  3GYK A;  3N9J A;  4GLT A;  2LTK A;  1BJX A;  4JED A;  2G2Q A;  2YAN A;  4KB3 A;  1HNB A;  3ZL5 A;  2WCI A;  2DJ1 A;  4L0W A;  3QCP A;  2R3X A;  3FZ5 A;  5EPF A;  2P5R A;  3APS A;  1T8E B;  1K0C A;  4WBJ A;  4FH8 A;  4ZIJ A;  3TDG A;  5ECN B;  3TB2 A;  3E0U A;  1Y25 A;  3MSZ A;  1QK8 A;  3NOF A;  1PD2 1;  4LLR A;  2C3T A;  3HD5 A;  1AAZ A;  4PUA A;  2C4J A;  1NM3 A;  2WGR A;  4TXO A;  5H5S A;  1A8Y A;  3M3M A;  4MZB A;  5ID2 B;  2VL2 A;  1VF2 A;  2E2G A;  2IL3 A;  5B6M A;  3RBT A;  3Q18 A;  2HRK B;  3SWL A;  3BOA A;  3FKF A;  2TRX A;  2ZCT A;  4QQ7 A;  2LEG A;  3BD2 A;  1GUL A;  5DAK A;  5ECO B;  1U88 A;  4MF7 A;  2IJY A;  1KBN A;  1NHO A;  5JCG A;  11GS A;  5HR2 A;  3W8J A;  1PRX A;  5L71 A;  3R2Q A;  4F9Z A;  3L9S A;  1AIU A;  1ERT A;  1GUH A;  1V98 A;  4ZL7 A;  4IEL A;  1ZOF A;  3RPN A;  1O8X A;  5IMA A;  3GST A;  1EOH A;  3I69 A;  20GS A;  1N2A A;  1SK2 A;  3GUS A;  4WR5 A;  3C1S A;  3DML A;  2M72 A;  2GVP A;  4K6X A;  4ZBD A;  1WP0 A;  3D0Z A;  1WRY A;  4TW5 A;  1K0N A;  1PA3 A;  2AV4 A;  2B1K A;  3ERW A;  1IYH A;  1PX7 A;  3G9B A;  4EO3 A;  2BJX A;  3ED3 A;  1TTZ A;  5J4U A;  3GNJ A;  4OFM A;  1XPV A;  3ZIT A;  2KHP A;  2XHF A;  4GXZ A;  2IFQ A;  3GTU A;  1WIK A;  4X43 A;  3MDK A;  5G2Z A;  3FEU A;  5GAN D;  2DMM A;  3UEM A;  2F51 A;  2C3N A;  4POK A;  1GLP A;  1AUC A;  4XCS A;  5HFG A;  5HQP A;  4G0L A;  2VM1 A;  2F3M A;  1PX6 A;  3ZMK A;  3UJ1 A;  3HHV A;  3ZIV A;  1MDK A;  1F3B A;  2F9S A;  4TKY A;  4PQ1 A;  4FYC A;  2GST A;  4HDE A;  1JZD A;  2GZY A;  1F6M C;  4GST A;  3DYR A;  4EXJ A;  3MAK A;  3CYN A;  2MBS A;  3C1R A;  4QL9 A;  1DUG A;  1USB A;  3GSS A;  1DBY A;  5A5K A;  1FB6 A;  2MBT A;  2K9F A;  1THO A;  1PL2 A;  2YJH A;  4AJ6 A;  5KN3 A;  4MZC A;  2DSA A;  3GUR A;  1KTE A;  3HKR A;  2CX3 A;  2VM2 A;  4GF0 A;  4ZB8 A;  2OE0 A;  1GSY A;  1TI3 A;  4GQF A;  4KDU A;  3VWX A;  4JU5 A;  4MJB A;  1FB0 A;  4JZQ A;  2FA4 A;  4AJ7 A;  4EL1 A;  1ERV A;  1JZO A;  4LMV A;  1F9M A;  3IDV A;  2V41 A;  4EC0 A;  5ELG A;  2H71 A;  2RM6 A;  1RW1 A;  3FZ4 A;  1SD8 A;  4OMV A;  1NW2 A;  5G1L A;  4RUV A;  4NV5 A;  2HRN A;  4HUA A;  4NV2 A;  1X0R A;  1TOF A;  3J7Y b;  2H1G A;  2GQK A;  3UBL A;  1X9M B;  3UIW A;  3I9V 2;  1SYX A;  3EE2 A;  1EOG A;  3J7Y k;  3HVX A;  1DE2 A;  1AW9 A;  1ZYE A;  4EE0 A;  2IMF A;  1FO5 A;  1ZZY A;  3CSH A;  2O89 A;  1XWK A;  4KND A;  1MDJ A;  3GRX A;  4V2L A;  2DIZ A;  2L6D A;  2AUV A;  2C0D A;  3F63 A;  3ZTL A;  2VD1 A;  2CQ9 A;  2H6X A;  4OFN A;  4IVF A;  4TR1 A;  4MJA A;  3P2A A;  2H1A A;  1G7O A;  1ERW A;  2PER A;  2R37 A;  4K7N A;  3QAV A;  3ERF A;  3HJM A;  2OJL A;  1TDI A;  2X8C A;  2GGT A;  3UOM A;  1KEB A;  4K2D A;  3RHB A;  1AXD A;  4GSN A;  3ZIJ A;  4TXO B;  2LJR A;  4GRF A;  2KP1 A;  1OC9 A;  2H70 A;  4EUY A;  2REM A;  3PH9 A;  5DQY A;  4PNG A;  2VLU A;  3KTB A;  1JZW A;  3VPQ A;  4HQS A;  3LXT A;  1R5P A;  1G6Y A;  5G5E A; 
#chains in the Genus database with same CATH topology
 3SBC A;  2NPB A;  2YJ7 A;  5G1K A;  2HRF A;  5DAK B;  4IGJ A;  3QFA C;  3L4N A;  2H01 A;  3GKN A;  2WVX A;  3LG6 A;  1TJD A;  3A3T A;  3MWH A;  3DGQ A;  1OC3 A;  2RII A;  1S3R A;  2H0H A;  1S3A A;  4HU7 A;  4XS6 A;  1XBS A;  2RUE A;  2PUK C;  1W89 A;  1Z5Y E;  4EIQ A;  3F4T A;  1XWC A;  2AAW A;  1VF3 A;  1U6T A;  1GSQ A;  2LRT A;  5HR1 A;  1EGO A;  4LA1 A;  4FO5 A;  4CDO A;  2CVD A;  3HJP A;  2HSH A;  3UAP A;  4V1A p;  4HOJ A;  17GS A;  4CHS A;  4O5R A;  1TI1 A;  2KP2 A;  3FMW A;  1UN2 A;  3IAM 2;  1K3Y A;  2R0P A;  1OKD A;  2V1M A;  5B7C A;  2YV7 A;  1V57 A;  2GZP A;  4ML1 A;  4KDY A;  1SYR A;  4JBB A;  3DKS A;  1XOA A;  3GKX A;  2DJ0 A;  1ON4 A;  5C04 A;  4K7O A;  1GP1 A;  4TN8 A;  1TU7 A;  1V40 A;  1SVM A;  4DVC A;  4MPF A;  1WPI A;  2IFQ B;  3GTU B;  4WEY A;  4X4J A;  2IWT A;  3EU4 A;  1SL0 B;  3PR8 A;  4PTS A;  4IBP A;  2CVK A;  3KM6 A;  3TKQ A;  1O85 A;  5J47 A;  4JE1 A;  2C1Y A;  4RQX A;  4JR6 A;  5A34 A;  2H0G A;  5JWO B;  1M9A A;  4MA9 A;  1QXH A;  5DBQ A;  4PX1 A;  4OCE A;  1UC7 A;  4YAV A;  4K0N A;  2O85 A;  5ECI B;  1XCC A;  3RHC A;  22GS A;  2B3S A;  1F3A A;  1QUW A;  4XHM A;  3CXG A;  1GLQ A;  4TXV A;  4I2U A;  4KA0 A;  2LQQ A;  4JR4 A;  3G7Y A;  4PNF A;  2OAC A;  1ZGN A;  1DE1 A;  1JHB A;  1K3O A;  2G0F A;  4K5R A;  1G7E A;  4ULX A;  2DJJ A;  2VCW A;  2N5A A;  4Z7X A;  4PQH A;  1M9B A;  3BCI A;  4KF9 A;  4FQU A;  5D9T A;  3EUR A;  3H8Q A;  2VOC A;  1THX A;  4FYU A;  4PGT A;  3KGK A;  5D93 A;  3QDN A;  3G7I A;  1HD2 A;  1X5C A;  1K0D A;  2QKE A;  1WE0 A;  1EP8 A;  1PKZ A;  3LYK A;  4MMM A;  3DEX A;  2NTO A;  3WGE A;  4K8M A;  2MMA A;  1I5G A;  2F8A A;  3IOS A;  5J40 A;  5ECQ B;  5ELA A;  4GCI A;  5FT3 A;  1GL8 A;  2VAF A;  2GT6 A;  2EC4 A;  8GSS A;  1HQO A;  1CQH A;  3LYP A;  5HFI A;  4EDZ A;  2C0F A;  2H72 A;  3ZZX A;  2R2J A;  2HFD A;  2JZT A;  2LNT A;  5IMF A;  3DVW A;  5ECM B;  3IC8 A;  4OWY A;  5F07 A;  2DJK A;  2PGT A;  1O8W A;  4RI6 A;  3EYT A;  1B9X C;  4MJC A;  5HFK A;  4XS4 A;  2OAD A;  4N0V A;  3A5I A;  2H73 A;  5DCH A;  5JCU A;  2O87 A;  4ISD A;  1UA5 A;  1HNC A;  3GMF A;  1JLW A;  3P90 A;  3HVS A;  1ZMA A;  4TRX A;  2HXK A;  4LL4 B;  2LJA A;  5J9B A;  1RK4 A;  3S9F A;  2HSM A;  3UL3 A;  2YV9 A;  5BRT A;  5F06 A;  2FWG A;  1SK0 A;  1SVL A;  4TR1 B;  4POB A;  3GN3 A;  1SKS B;  2WZ9 A;  4XTS A;  1WJK A;  1YEP A;  4NWY A;  4ACS A;  1OE7 A;  3M0F A;  2DIY A;  3US3 A;  4L8E A;  3WGX A;  2I81 A;  3EU3 A;  2VL2 C;  2HZE A;  3HZ8 A;  2YOI A;  1J08 A;  3ERG A;  5F0G A;  1N8J A;  2CAI A;  3TJK A;  3IV4 A;  1MD4 A;  1I9D A;  3ISO A;  1OC9 B;  1ZYQ B;  1OVN A;  1SJ6 A;  1J9B A;  2FGX A;  3LXZ A;  1GTI A;  4NMU A;  4KSO A;  3TKR A;  5B8A A;  1PMT A;  2HSN A;  2LNS A;  2YN1 A;  1VF1 A;  1GSF A;  3KMO A;  4TOP A;  1QGV A;  3HDC A;  3IR4 A;  3AY8 A;  4AGS A;  2GQL A;  2ZNM A;  3FY7 A;  3LWA A;  2WVX B;  2YZU A;  3TRX A;  2H1D A;  4N3Z A;  2YWI A;  2WJU A;  2IN3 A;  3GFK A;  4IJ3 A;  4GSS A;  4Z2T A;  3ZYW A;  2XBI A;  3IC4 A;  3FRC A;  4E8H A;  1FOH A;  5AN1 A;  4XRD A;  4O92 A;  6GSX A;  3A5W A;  4L0U A;  1R5A A;  1VGL A;  2FLS A;  1YEX A;  3IHQ A;  3TKS A;  1A2L A;  3I6A A;  2YWO A;  3VFI A;  5HR0 A;  1NHY A;  2MMO A;  2CT6 A;  5E4W A;  1A2M A;  2VLT A;  2JSY A;  2PN8 A;  3KTL A;  6GSU A;  4WF5 A;  4BWQ A;  2B5E A;  2QA1 A;  2FD3 A;  4X0X A;  1YZX A;  4AKH A;  2B1L A;  2H66 A;  1A24 A;  3IA1 A;  2ON5 A;  1V2A A;  3VWU A;  3CSI A;  5F8B A;  2WUL A;  1LBK A;  2NDO A;  3FZ9 A;  4HU9 A;  4MZW A;  2X99 A;  2K8S A;  5A4U A;  1M3J A;  2JZS A;  4HJM A;  2L4Q A;  1BYE A;  5A1N A;  5J4V A;  1PSQ A;  1BG5 A;  5A34 B;  3TCO A;  5LNK e;  3D4T A;  1FVK A;  3KXO A;  1U3I A;  3W6G A;  2TRC P;  5DJL A;  2OBK A;  1OYJ A;  4OD7 A;  1QMV A;  3G7J A;  1F37 A;  4ECB A;  1X9W B;  1Q4J A;  3F3R A;  2VCT A;  3CBU A;  1GSS A;  1TKD B;  5IMC A;  4K7I A;  3KIJ A;  1EZK A;  3FW2 A;  2E7P A;  3F0I A;  4IQ1 A;  2VUP A;  4E68 A;  3OR5 A;  3W8S A;  2R0C A;  4A5P A;  2LRC A;  4J2F A;  4LMW A;  4IS0 A;  1Z7P A;  4BL7 A;  2M80 A;  2ES7 A;  5DCG A;  2I9H A;  4YQU A;  4TR0 A;  2D2Z A;  1ST9 A;  2XC2 A;  2J23 A;  5HR3 A;  3U6V A;  2B6M A;  2FWH A;  2IIY A;  5LD0 A;  1A2J A;  4NHW A;  4HZ4 A;  4OO5 A;  4IQA A;  2WZS A;  3ZVJ A;  1B4Q A;  4WET A;  1B4P A;  4G0I A;  13GS A;  3QAG A;  2HNL A;  5LCZ A;  3D22 A;  3M9K A;  1ACV A;  1AQW A;  4FIW A;  4QL7 A;  3GA4 A;  2L4C A;  3APO A;  3QR6 A;  1ZL9 A;  2YWN A;  1BX9 A;  2YP6 A;  1GUM A;  1FW1 A;  3ME7 A;  3VPT A;  5JWQ B;  3R3E A;  1PGT A;  2LRN A;  5G31 A;  1TK8 B;  1E2Y A;  2HZF A;  3MNG A;  1N25 A;  4IN0 A;  4IHU A;  5CO3 A;  5AIV A;  5B8B A;  2EIO A;  3QFB C;  5KEJ A;  1MTC A;  1U87 A;  4AF2 A;  3EMP A;  3FR3 A;  1XOB A;  4XS4 B;  2O3E A;  4ZIL A;  2EFE A;  2OKA A;  2FY6 A;  3APQ A;  2GLR A;  2EFC A;  2VL9 A;  2UZ8 A;  3DIE A;  3GKM A;  3WD6 A;  1S3D A;  4N10 A;  3WT1 A;  4LL1 B;  4KSM A;  1JFU A;  2OA7 A;  2HSM B;  2WW0 A;  4V2N A;  2EIQ A;  5AIS A;  1XFL A;  2HT9 A;  1SU9 A;  1G0T A;  2CVB A;  3IK7 A;  4MP4 A;  3TOU A;  4NPB A;  4G0K A;  7GSS A;  1RQM A;  5GST A;  4E8E A;  3UAR A;  2DJ2 A;  1O7U A;  1K0O A;  2HZE B;  3TJB A;  3GKK A;  5JWR B;  3DRN A;  1QQ2 A;  2VL3 A;  1M0U A;  4OO4 A;  5D9W A;  2GS3 A;  4KX4 A;  4YQM A;  3ZFL A;  6GSS A;  2FCH A;  2HSY A;  2HYX A;  1O6J A;  5AIX A;  2XBQ A;  1G6W A;  3KMN A;  2H6Z A;  4MH2 A;  4WF4 A;  2J9H A;  2HSN B;  2K8V A;  2QC7 A;  2B5X A;  4WXT A;  4ID0 A;  3KH9 A;  1ML6 A;  3HJO A;  2H0I A;  2I4A A;  1YF1 A;  1M3I A;  3IHG A;  3L78 A;  1JLV A;  4MNN A;  3CTF A;  4NHZ A;  2DKI A;  5GAP D;  1HNA A;  3P8W A;  4NAX A;  2VIM A;  4IW9 A;  3WT2 A;  3BJ5 A;  3HCZ A;  2LUS A;  4ZBB A;  1BQ7 A;  9GSS A;  3UMA A;  3JCM L;  1OAZ A;  3EIN A;  1SEN A;  4Q5R A;  1LJR A;  1C72 A;  3O3T A;  1VRS D;  2JL4 A;  4WBR D;  1XWB A;  3PPU A;  3VLN A;  1A8L A;  5DJM A;  2O7K A;  1M99 A;  5ECK B;  2A4H A;  2VD0 A;  2TIR A;  4HSC X;  4DSS A;  2EFH A;  2X64 A;  2AB6 A;  2C3Q A;  1WOU A;  4BA7 A;  3BBY A;  3A2W A;  4F0C A;  5A4W A;  5ECR B;  1XW6 A;  4PHZ C;  1LU4 A;  3D4M A;  3TKP A;  3EVI A;  1B48 A;  1KNG A;  2KUC A;  4DSR A;  5CYY A;  5COH A;  3KEB A;  2WDU A;  2GSQ A;  2N5B A;  3CQF A;  1XW5 A;  3C71 A;  1E6B A;  4L5O A;  2X8H A;  5KN2 A;  2WB9 A;  3C73 A;  4PI0 C;  2MMN A;  3IK9 A;  3VWW A;  5IMZ A;  4HS1 A;  4KW6 A;  1SVO A;  1YQ1 A;  5A1N B;  2H74 A;  1FHE A;  1ILO A;  4YKF A;  3WGD A;  4TVE A;  2HLS A;  4J57 E;  1MD3 A;  2AHE A;  1SD9 A;  3KCM A;  1YVL A;  2V6K A;  5CP1 A;  2YNX A;  2YCD A;  5DDL A;  5CAX A;  1ZCP A;  1GSU A;  2WRT A;  2H1L A;  3F9U A;  5DVB A;  1YJ6 A;  3KJY A;  4HI7 A;  4ECC A;  1YF0 A;  4F0B A;  3EWL A;  4YAP A;  5IPH A;  2L5L A;  5EY6 A;  3D5J A;  5IOW A;  2GQM A;  4ZB7 A;  2L6C A;  3H4K A;  4I2T A;  1ZYN A;  2RM5 A;  4K5S A;  1GSE A;  3IPZ A;  4Q5N A;  3CHX C;  4BL7 B;  4MPG A;  2MZC A;  4D73 A;  5EVO A;  5IIZ A;  1PN9 A;  1K0B A;  3KH7 A;  16GS A;  1PFO A;  3D6I A;  4KH7 A;  1TK0 B;  4K0G A;  1XVW A;  1TK5 B;  1V58 A;  1BED A;  1TXU A;  2IMD A;  3GL3 A;  1GNW A;  5CRH A;  1OKT A;  4GQC A;  1R7H A;  1EEM A;  1FOV A;  3CWG A;  4MCU A;  2I1U A;  1XWA A;  3TOT A;  2P5Q A;  1M7T A;  1YDK A;  5G30 A;  3LGC A;  3QOU A;  3ZLP A;  2FA8 A;  1TRS A;  2C0E A;  4CW9 A;  1Q98 A;  4HQZ A;  2YPM A;  2O36 A;  1X9S B;  4AI6 A;  1OE8 A;  4USS A;  3FZA A;  4DEJ A;  3FYG A;  1U3A A;  1TRU A;  4DSQ A;  2PMT A;  1GNE A;  4AKI A;  4J56 E;  4H86 A;  1K3L A;  2NBS A;  12GS A;  2H6Y A;  3LQ7 A;  4F2I A;  4F82 A;  1IYI A;  5ENU A;  1R26 A;  3KP9 A;  3HVV A;  2QGV A;  6GSW A;  1XWG A;  2P0G A;  3IRA A;  4I8B A;  5INY A;  2C8U A;  4EF0 A;  4XS1 A;  3TJF A;  2LV3 A;  4IP1 A;  3HY2 A;  4KAE A;  3UVH A;  2DLX A;  1FAA A;  2JZR A;  4K9Z A;  1F2E A;  3Q74 A;  2IMI A;  3KD0 A;  3VWV A;  6GST A;  2VCZ A;  4G2E A;  2WVY A;  4MAB A;  2L59 A;  2B5Y A;  2LQO A;  2WW3 A;  4OCF A;  3F6D A;  4MF6 A;  3TUE A;  2B7K A;  2GTU A;  1T3B A;  2HRA A;  1XVQ A;  5GSS A;  3HZ4 A;  2OE1 A;  1J0F A;  2GDR A;  3TKS C;  5GZZ B;  3TRP A;  4TR4 A;  1GTA A;  2FUG 2;  3GX0 A;  2YZH A;  5JCW A;  4EKZ A;  5D73 A;  2PU9 C;  3RFR C;  2ON7 A;  3FR6 A;  1TP9 A;  3LSZ A;  3IXR A;  5D9V A;  4MDC A;  3EMX A;  1H4O A;  2FWE A;  2VLV A;  4GTU A;  3IE3 A;  10GS A;  2L5O A;  4O5U A;  3QD9 A;  4GWR A;  2A2R A;  2BTO T;  4I6X A;  2VO4 A;  3VI5 A;  5EL8 A;  5DAL A;  3GH9 A;  1B8X A;  3ME8 A;  2PVQ A;  2X49 A;  5C00 A;  4JRR A;  4L5L A;  2DBC A;  2R5G A;  1FG4 A;  5IO2 A;  5IMD A;  2QSI A;  2M46 A;  4KCA A;  3H79 A;  4EVM A;  1WMJ A;  4IKH A;  1SJI A;  4DSS B;  1SKR B;  2DJ3 A;  2CAQ A;  2EIR A;  4POM A;  3FHK A;  2RUF A;  2HQT A;  3TGZ A;  2L57 A;  2JAC A;  1PKW A;  3M1G A;  1YKC A;  1MDI A;  2IME A;  4ZB6 A;  3ZVJ D;  1H75 A;  2LST A;  3EC3 A;  1GRX A;  3RDW A;  3TU3 B;  2JAD A;  1Z6M A;  4ML6 A;  5BMU A;  4ZL9 A;  5IPG A;  5J9C A;  3LOR A;  5IQY A;  3FK8 A;  5IOX A;  4KUN A;  2GSR A;  1XIY A;  5FHI A;  1XZO A;  3TJJ A;  3F4S A;  3KZQ A;  1AQX A;  2E0Q A;  1AQV A;  5ECP B;  1M2D A;  3KP8 A;  3V1W A;  1M2B A;  6GSY A;  2N5F A;  4MLY A;  4AKX B;  5D9X A;  4BWS A;  4WR4 A;  1GSD A;  5J3R A;  4YQV A;  5IO0 A;  1TRW A;  4BVY A;  1GUK A;  4KCE A;  2VCQ A;  4OFT A;  2FNO A;  2VCX A;  5DQS A;  2DC5 A;  4V2M A;  5A5H A;  3RPP A;  3DVX A;  1GWC A;  2YWM A;  1SL2 B;  2QA2 A;  4PUF C;  3IAS 2;  2K18 A;  4POL A;  5E59 A;  1QFN A;  4MK3 A;  3CRT A;  2PWJ A;  1S4B P;  1PN0 A;  4D73 B;  3C7M A;  4BVX A;  3GHA A;  1EP7 A;  4FXY P;  5H5Q A;  4P3Y B;  2IMK A;  3H1N A;  1Z3E A;  4X1U A;  2A2S A;  4MJE A;  3A2V A;  6GSV A;  2MMZ A;  5B6N A;  4PQI A;  1XXU A;  2PPT A;  3PGT A;  4O7H A;  1Z6N A;  3GIX A;  3RAZ A;  3LFL A;  2GZZ A;  4N11 A;  1W4V A;  3CSJ A;  4V1A g;  4PUR A;  3TJG A;  5KN0 A;  2ZUP A;  2P31 A;  1WWJ A;  3HMJ G;  3PIN A;  3UVT A;  5ECS A;  2BMX A;  1DSB A;  2H76 A;  2LS5 A;  2LKU A;  5KN1 A;  2WVZ A;  3VI7 A;  2PBJ A;  2FWF A;  4TR3 A;  1A23 A;  18GS A;  2V6O A;  5CNW A;  1BAY A;  4MF5 A;  4Q5Q A;  4Q5F A;  1O81 A;  5AGY A;  1SKW B;  3FR9 A;  4KDX A;  3F6F A;  1X5E A;  2CV4 A;  5J41 A;  1GTU A;  1T4Y A;  4HZ2 A;  5CRE A;  2EFD A;  2F8F A;  5ID2 A;  2OBI A;  4ECJ A;  3HA9 A;  2OE3 A;  4N30 A;  3L9U A;  3GV1 A;  2HRK A;  3C8E A;  5G5F A;  1CQG A;  4GDF A;  4MH3 A;  5D96 A;  4N0Z A;  3GL5 A;  4PXO A;  2KOK A;  1SK1 A;  5A4V A;  2WW1 A;  5CRD A;  3VUR A;  4BPY A;  3M8N A;  1S3C A;  3ZFB A;  3A2X A;  1URM A;  5IMV A;  4KE3 A;  3TRQ A;  1R4W A;  3U5R E;  4RQR A;  2A2P A;  5CRG A;  3DWV A;  1TXX A;  5CRW A;  1FVJ A;  4CY6 A;  3P7X A;  2I3Y A;  4XRA A;  4G19 A;  4HEA 2;  1TU8 A;  3K8N A;  3DD3 A;  1YEW C;  1T1V A;  2R4V A;  2HI7 A;  3Q19 A;  3H93 A;  3F4R A;  2CZ2 A;  5IM9 A;  3DXB A;  4EIP A;  1Z7R A;  4PI2 C;  2CA8 A;  3BCK A;  4F03 A;  1TW9 A;  5ABR A;  3IBH A;  4IJI A;  4G9H A;  2H1B A;  2R6K A;  4CY8 A;  1TRV A;  2CZ3 A;  4FYB A;  1HYU A;  3F3Q A;  1Z9H A;  1Y6E A;  4Z2R A;  2O8V B;  3GX8 A;  2H19 A;  4EDY A;  2AYT A;  2MYG A;  5DAL B;  4I97 A;  4HJ2 A;  3VK9 A;  3N5O A;  2Z9S A;  2CX4 A;  3O6T A;  1YKA A;  3TKS E;  2VCV A;  2C0G A;  3L9V A;  2B7J A;  3O76 A;  1EV9 A;  3WYW A;  4ZL8 A;  1SL1 B;  3LW9 A;  4NXI A;  1I1I P;  2C80 A;  1X5D A;  4ECI A;  1B9Y C;  2A4V A;  3L0H A;  1PQN A;  3GH6 A;  4K1F A;  3NZN A;  2X8G A;  1T4Z A;  2DML A;  4K2X A;  2KLX A;  3CMI A;  1M2A A;  1T7P B;  2E2M A;  3NIV A;  1ERU A;  3ZML A;  1XW9 A;  1OC8 A;  4AJ8 A;  4YH2 A;  3UBK A;  14GS A;  5BMU B;  1V9W A;  4KGI A;  5ECH B;  5J5N A;  3QMX A;  2FHE A;  1NSW A;  2PVO C;  1A0F A;  1K0M A;  3HXS A;  5ECL B;  1MEK A;  2GSS A;  1AC1 A;  1ABA A;  19GS A;  1EV4 A;  3LJR A;  2V32 A;  2WS2 A;  2R0G A;  1GH2 A;  2AJQ B;  3CTG A;  4IP6 A;  5F05 A;  1GTB A;  1UVZ A;  4XIH A;  3ZRE A;  1T00 A;  2NVL A;  5FWG A;  3E3E A;  4ZBA A;  4ZB9 A;  2WFC A;  5H5R A;  4G10 A;  4BVY B;  2XPD A;  2RLI A;  3LEF A;  2O5V A;  2ALB A;  3HYP A;  1K0A A;  2H75 A;  1PL1 A;  1EEJ A;  2IPA A;  2JU5 A;  1A0R P;  2XPE A;  5A5H B;  2JSZ A;  3ZRD A;  4Z2U A;  3QPM A;  2GT5 A;  3QAW A;  1EGR A;  5D8I A;  3MIX A;  2HE3 A;  1JZR A;  2K6V A;  4WKW A;  3D21 A;  4ILF A;  3M9J A;  3F8U A;  3E9J B;  3I43 A;  4O32 A;  4BVX B;  2H30 A;  1YY7 A;  2H8L A;  1SJZ A;  4YKG A;  1EWX A;  1VF4 A;  2V2G A;  3CRU A;  1O73 A;  4I5Q A;  4ZXG A;  4RI7 A;  4G01 A;  3Q6O A;  2LJK A;  3GYK A;  2UV8 G;  3N9J A;  4GLT A;  2LTK A;  3RGB C;  1BJX A;  4JED A;  2G2Q A;  2YAN A;  4KB3 A;  1HNB A;  3ZL5 A;  2WCI A;  2DJ1 A;  4L0W A;  3QCP A;  2R3X A;  3FZ5 A;  5EPF A;  2P5R A;  3APS A;  1T8E B;  1K0C A;  4WBJ A;  4FH8 A;  4ZIJ A;  3TDG A;  5ECN B;  3TB2 A;  3E0U A;  1Y25 A;  3MSZ A;  1QK8 A;  3NOF A;  1PD2 1;  4LLR A;  2C3T A;  3HD5 A;  1AAZ A;  4PUA A;  2C4J A;  1NM3 A;  2WGR A;  3EPT A;  4TXO A;  5H5S A;  1A8Y A;  3M3M A;  4MZB A;  5ID2 B;  2VL2 A;  1VF2 A;  2E2G A;  2IL3 A;  4O5Q A;  5B6M A;  3RBT A;  3Q18 A;  2HRK B;  3SWL A;  3BOA A;  3FKF A;  2TRX A;  5J4Y A;  4QQ7 A;  2ZCT A;  2LEG A;  3BD2 A;  1GUL A;  5DAK A;  1ZYP A;  5ECO B;  1U88 A;  4MF7 A;  4QMK A;  2IJY A;  1KBN A;  1NHO A;  5JCG A;  11GS A;  5HR2 A;  3W8J A;  1PRX A;  5L71 A;  3R2Q A;  4F9Z A;  3L9S A;  1AIU A;  1ERT A;  1GUH A;  1V98 A;  4ZL7 A;  4IEL A;  1ZOF A;  3RPN A;  1O8X A;  5IMA A;  3GST A;  1EOH A;  3I69 A;  20GS A;  1N2A A;  1SK2 A;  5KOX A;  4W66 A;  3GUS A;  4WR5 A;  3C1S A;  3DML A;  1BG1 A;  2M72 A;  2GVP A;  4K6X A;  4ZBD A;  1WP0 A;  3D0Z A;  1WRY A;  4TW5 A;  1K0N A;  1PA3 A;  2AV4 A;  2B1K A;  3ERW A;  1IYH A;  1PX7 A;  3G9B A;  4EO3 A;  2BJX A;  3ED3 A;  1TTZ A;  5J4U A;  3GNJ A;  4OFM A;  1XPV A;  3ZIT A;  2KHP A;  2XHF A;  4GXZ A;  2IFQ A;  3GTU A;  1WIK A;  4X43 A;  3MDK A;  5G2Z A;  3FEU A;  5GAN D;  2DMM A;  4ICY A;  1XG8 A;  3UEM A;  2F51 A;  2C3N A;  4POK A;  1GLP A;  1AUC A;  4XCS A;  5HFG A;  5HQP A;  4G0L A;  2VM1 A;  2F3M A;  1PX6 A;  3ZMK A;  3UJ1 A;  3HHV A;  3ZIV A;  1MDK A;  1F3B A;  2F9S A;  4TKY A;  4PQ1 A;  4FYC A;  2GST A;  4HDE A;  1JZD A;  2GZY A;  1F6M C;  4GST A;  3DYR A;  4EXJ A;  3MAK A;  4AKG A;  3CYN A;  2MBS A;  3C1R A;  3MYD A;  4QL9 A;  1DUG A;  1USB A;  3GSS A;  1DBY A;  5A5K A;  1FB6 A;  2MBT A;  2K9F A;  1THO A;  1PL2 A;  2YJH A;  2WW2 A;  4AJ6 A;  5KN3 A;  4MZC A;  2DSA A;  3GUR A;  1KTE A;  3HKR A;  2CX3 A;  2VM2 A;  4GF0 A;  4ZB8 A;  2OE0 A;  1GSY A;  1TI3 A;  4GQF A;  4KDU A;  3VWX A;  4JU5 A;  4MJB A;  1FB0 A;  4JZQ A;  2FA4 A;  4AJ7 A;  4EL1 A;  1ERV A;  1JZO A;  4LMV A;  1F9M A;  5KOW A;  3IDV A;  2V41 A;  4EC0 A;  5ELG A;  2H71 A;  2RM6 A;  1RW1 A;  3FZ4 A;  1SD8 A;  4OMV A;  1NW2 A;  5G1L A;  4RUV A;  4NV5 A;  2HRN A;  4HUA A;  4NV2 A;  1X0R A;  1TOF A;  2DKH A;  3J7Y b;  2H1G A;  2GQK A;  3UBL A;  1X9M B;  3UIW A;  3I9V 2;  1SYX A;  3EE2 A;  1EOG A;  3J7Y k;  1BF5 A;  3HVX A;  1DE2 A;  1AW9 A;  1ZYE A;  4EE0 A;  2IMF A;  1FO5 A;  1ZZY A;  3CSH A;  2O89 A;  1XWK A;  4KND A;  1MDJ A;  3GRX A;  4V2L A;  2DIZ A;  2L6D A;  2AUV A;  2C0D A;  1Y1U A;  3F63 A;  2VKZ G;  3ZTL A;  2VD1 A;  2CQ9 A;  2H6X A;  4OFN A;  4IVF A;  4TR1 A;  4MJA A;  3P2A A;  4BIK A;  2H1A A;  1G7O A;  1ERW A;  2PER A;  2R37 A;  4K7N A;  3QAV A;  3ERF A;  3HJM A;  2OJL A;  1TDI A;  2X8C A;  2GGT A;  3UOM A;  1KEB A;  4K2D A;  3RHB A;  1AXD A;  4GSN A;  3ZIJ A;  4TXO B;  2LJR A;  4GRF A;  2KP1 A;  1OC9 A;  2H70 A;  4EUY A;  2REM A;  3PH9 A;  5DQY A;  4PNG A;  2VLU A;  3KTB A;  1JZW A;  3VPQ A;  2X4A A;  4HQS A;  3LXT A;  2OT3 A;  3HVN A;  1R5P A;  1G6Y A;  5G5E A; 
#chains in the Genus database with same CATH homology
 3SBC A;  2NPB A;  2YJ7 A;  5G1K A;  2HRF A;  5DAK B;  4IGJ A;  3QFA C;  3L4N A;  2H01 A;  3GKN A;  3LG6 A;  1TJD A;  3A3T A;  3MWH A;  3DGQ A;  1OC3 A;  2RII A;  2H0H A;  1S3A A;  4HU7 A;  4XS6 A;  1XBS A;  2RUE A;  2PUK C;  1W89 A;  1Z5Y E;  4EIQ A;  3F4T A;  1XWC A;  2AAW A;  1VF3 A;  1U6T A;  1GSQ A;  2LRT A;  5HR1 A;  1EGO A;  4LA1 A;  4FO5 A;  4CDO A;  2CVD A;  3HJP A;  2HSH A;  3UAP A;  4V1A p;  4HOJ A;  17GS A;  4CHS A;  4O5R A;  1TI1 A;  2KP2 A;  3FMW A;  1UN2 A;  3IAM 2;  1K3Y A;  2R0P A;  1OKD A;  2V1M A;  5B7C A;  2YV7 A;  1V57 A;  2GZP A;  4ML1 A;  4KDY A;  1SYR A;  4JBB A;  3DKS A;  1XOA A;  3GKX A;  2DJ0 A;  1ON4 A;  5C04 A;  4K7O A;  1GP1 A;  4TN8 A;  1TU7 A;  1V40 A;  1SVM A;  4DVC A;  4MPF A;  1WPI A;  2IFQ B;  3GTU B;  4WEY A;  4X4J A;  2IWT A;  3EU4 A;  1SL0 B;  3PR8 A;  4PTS A;  4IBP A;  2CVK A;  3KM6 A;  3TKQ A;  1O85 A;  5J47 A;  4JE1 A;  2C1Y A;  4RQX A;  4JR6 A;  5A34 A;  2H0G A;  5JWO B;  1M9A A;  4MA9 A;  1QXH A;  5DBQ A;  4PX1 A;  4OCE A;  1UC7 A;  4YAV A;  4K0N A;  2O85 A;  5ECI B;  1XCC A;  3RHC A;  22GS A;  2B3S A;  1F3A A;  1QUW A;  4XHM A;  3CXG A;  1GLQ A;  4TXV A;  4I2U A;  4KA0 A;  2LQQ A;  4JR4 A;  3G7Y A;  4PNF A;  2OAC A;  1ZGN A;  1DE1 A;  1JHB A;  1K3O A;  2G0F A;  4K5R A;  1G7E A;  4ULX A;  2DJJ A;  2VCW A;  2N5A A;  4Z7X A;  4PQH A;  1M9B A;  3BCI A;  4KF9 A;  4FQU A;  5D9T A;  3EUR A;  3H8Q A;  2VOC A;  1THX A;  4FYU A;  4PGT A;  3KGK A;  5D93 A;  3QDN A;  3G7I A;  1HD2 A;  1X5C A;  1K0D A;  2QKE A;  1WE0 A;  1EP8 A;  1PKZ A;  3LYK A;  4MMM A;  3DEX A;  2NTO A;  3WGE A;  4K8M A;  2MMA A;  1I5G A;  2F8A A;  3IOS A;  5J40 A;  5ECQ B;  5ELA A;  4GCI A;  5FT3 A;  1GL8 A;  2VAF A;  2GT6 A;  2EC4 A;  8GSS A;  1HQO A;  1CQH A;  3LYP A;  5HFI A;  4EDZ A;  2C0F A;  2H72 A;  3ZZX A;  2R2J A;  2HFD A;  2JZT A;  2LNT A;  5IMF A;  3DVW A;  5ECM B;  3IC8 A;  4OWY A;  5F07 A;  2DJK A;  2PGT A;  1O8W A;  4RI6 A;  3EYT A;  1B9X C;  4MJC A;  5HFK A;  4XS4 A;  2OAD A;  4N0V A;  3A5I A;  2H73 A;  5DCH A;  5JCU A;  2O87 A;  4ISD A;  1UA5 A;  1HNC A;  3GMF A;  1JLW A;  3P90 A;  3HVS A;  1ZMA A;  4TRX A;  2HXK A;  4LL4 B;  2LJA A;  5J9B A;  1RK4 A;  3S9F A;  2HSM A;  3UL3 A;  2YV9 A;  5BRT A;  5F06 A;  2FWG A;  1SK0 A;  1SVL A;  4TR1 B;  4POB A;  3GN3 A;  1SKS B;  2WZ9 A;  4XTS A;  1WJK A;  1YEP A;  4NWY A;  4ACS A;  3M0F A;  1OE7 A;  2DIY A;  3US3 A;  4L8E A;  3WGX A;  2I81 A;  3EU3 A;  2VL2 C;  2HZE A;  3HZ8 A;  2YOI A;  1J08 A;  3ERG A;  5F0G A;  1N8J A;  2CAI A;  3TJK A;  3IV4 A;  1MD4 A;  1I9D A;  3ISO A;  1OC9 B;  1ZYQ B;  1OVN A;  1SJ6 A;  1J9B A;  2FGX A;  3LXZ A;  1GTI A;  4NMU A;  4KSO A;  3TKR A;  5B8A A;  1PMT A;  2HSN A;  2LNS A;  2YN1 A;  1VF1 A;  1GSF A;  3KMO A;  4TOP A;  1QGV A;  3HDC A;  3IR4 A;  3AY8 A;  4AGS A;  2GQL A;  2ZNM A;  3FY7 A;  3LWA A;  2YZU A;  3TRX A;  2H1D A;  4N3Z A;  2YWI A;  2WJU A;  2IN3 A;  3GFK A;  4IJ3 A;  4GSS A;  4Z2T A;  3ZYW A;  2XBI A;  3IC4 A;  3FRC A;  4E8H A;  1FOH A;  5AN1 A;  4XRD A;  4O92 A;  6GSX A;  3A5W A;  4L0U A;  1R5A A;  1VGL A;  2FLS A;  1YEX A;  3IHQ A;  3TKS A;  1A2L A;  3I6A A;  2YWO A;  3VFI A;  5HR0 A;  1NHY A;  2MMO A;  2CT6 A;  5E4W A;  1A2M A;  2VLT A;  2JSY A;  2PN8 A;  3KTL A;  6GSU A;  4WF5 A;  4BWQ A;  2B5E A;  2QA1 A;  2FD3 A;  4X0X A;  1YZX A;  4AKH A;  2B1L A;  2H66 A;  1A24 A;  3IA1 A;  2ON5 A;  1V2A A;  3VWU A;  3CSI A;  5F8B A;  2WUL A;  1LBK A;  2NDO A;  3FZ9 A;  4HU9 A;  4MZW A;  2X99 A;  2K8S A;  5A4U A;  2JZS A;  4HJM A;  2L4Q A;  1BYE A;  5A1N A;  5J4V A;  1PSQ A;  1BG5 A;  5A34 B;  3TCO A;  5LNK e;  3D4T A;  1FVK A;  3KXO A;  1U3I A;  3W6G A;  2TRC P;  5DJL A;  2OBK A;  1OYJ A;  4OD7 A;  1QMV A;  3G7J A;  1F37 A;  4ECB A;  1X9W B;  1Q4J A;  3F3R A;  2VCT A;  3CBU A;  1GSS A;  1TKD B;  5IMC A;  4K7I A;  3KIJ A;  1EZK A;  3FW2 A;  2E7P A;  3F0I A;  4IQ1 A;  2VUP A;  4E68 A;  3OR5 A;  3W8S A;  2R0C A;  4A5P A;  2LRC A;  4J2F A;  4LMW A;  4IS0 A;  1Z7P A;  4BL7 A;  2M80 A;  2ES7 A;  5DCG A;  2I9H A;  4YQU A;  4TR0 A;  2D2Z A;  1ST9 A;  2XC2 A;  2J23 A;  5HR3 A;  3U6V A;  2B6M A;  2FWH A;  2IIY A;  5LD0 A;  1A2J A;  4NHW A;  4HZ4 A;  4OO5 A;  4IQA A;  1B4Q A;  3ZVJ A;  4WET A;  1B4P A;  4G0I A;  13GS A;  3QAG A;  2HNL A;  5LCZ A;  3D22 A;  3M9K A;  1ACV A;  1AQW A;  4FIW A;  4QL7 A;  3GA4 A;  2L4C A;  3APO A;  3QR6 A;  1ZL9 A;  2YWN A;  1BX9 A;  2YP6 A;  1GUM A;  1FW1 A;  3ME7 A;  3VPT A;  5JWQ B;  3R3E A;  1PGT A;  2LRN A;  5G31 A;  1TK8 B;  1E2Y A;  2HZF A;  3MNG A;  1N25 A;  4IN0 A;  4IHU A;  5CO3 A;  5AIV A;  5B8B A;  2EIO A;  3QFB C;  5KEJ A;  1MTC A;  1U87 A;  4AF2 A;  3EMP A;  3FR3 A;  1XOB A;  4XS4 B;  4ZIL A;  2EFE A;  2OKA A;  2FY6 A;  3APQ A;  2GLR A;  2EFC A;  2VL9 A;  2UZ8 A;  3DIE A;  3GKM A;  3WD6 A;  1S3D A;  4N10 A;  3WT1 A;  4LL1 B;  4KSM A;  1JFU A;  2OA7 A;  2HSM B;  4V2N A;  2EIQ A;  5AIS A;  1XFL A;  2HT9 A;  1SU9 A;  1G0T A;  2CVB A;  3IK7 A;  4MP4 A;  3TOU A;  4NPB A;  4G0K A;  7GSS A;  1RQM A;  5GST A;  4E8E A;  3UAR A;  2DJ2 A;  1O7U A;  1K0O A;  2HZE B;  3TJB A;  3GKK A;  5JWR B;  3DRN A;  1QQ2 A;  2VL3 A;  1M0U A;  4OO4 A;  5D9W A;  2GS3 A;  4KX4 A;  4YQM A;  3ZFL A;  6GSS A;  2FCH A;  2HSY A;  2HYX A;  1O6J A;  5AIX A;  2XBQ A;  1G6W A;  3KMN A;  2H6Z A;  4MH2 A;  4WF4 A;  2J9H A;  2HSN B;  2K8V A;  2QC7 A;  2B5X A;  4WXT A;  4ID0 A;  3KH9 A;  1ML6 A;  3HJO A;  2H0I A;  2I4A A;  1YF1 A;  3IHG A;  3L78 A;  1JLV A;  4MNN A;  3CTF A;  4NHZ A;  2DKI A;  5GAP D;  1HNA A;  3P8W A;  4NAX A;  2VIM A;  4IW9 A;  3WT2 A;  3BJ5 A;  3HCZ A;  2LUS A;  4ZBB A;  1BQ7 A;  9GSS A;  3UMA A;  3JCM L;  1OAZ A;  3EIN A;  1SEN A;  4Q5R A;  1LJR A;  1C72 A;  3O3T A;  1VRS D;  2JL4 A;  4WBR D;  1XWB A;  3PPU A;  3VLN A;  1A8L A;  5DJM A;  2O7K A;  1M99 A;  5ECK B;  2A4H A;  2VD0 A;  2TIR A;  4DSS A;  2EFH A;  2X64 A;  2AB6 A;  2C3Q A;  1WOU A;  4BA7 A;  3BBY A;  3A2W A;  4F0C A;  5A4W A;  5ECR B;  1XW6 A;  1LU4 A;  3D4M A;  3TKP A;  3EVI A;  1B48 A;  1KNG A;  2KUC A;  4DSR A;  5CYY A;  5COH A;  3KEB A;  2WDU A;  2GSQ A;  2N5B A;  1XW5 A;  3C71 A;  1E6B A;  4L5O A;  2X8H A;  5KN2 A;  2WB9 A;  3C73 A;  2MMN A;  3IK9 A;  3VWW A;  5IMZ A;  4HS1 A;  4KW6 A;  1SVO A;  1YQ1 A;  5A1N B;  2H74 A;  1FHE A;  1ILO A;  4YKF A;  3WGD A;  4TVE A;  2HLS A;  4J57 E;  1MD3 A;  2AHE A;  1SD9 A;  3KCM A;  1YVL A;  2V6K A;  5CP1 A;  2YNX A;  2YCD A;  5DDL A;  5CAX A;  1ZCP A;  1GSU A;  2WRT A;  2H1L A;  3F9U A;  5DVB A;  1YJ6 A;  3KJY A;  4HI7 A;  4ECC A;  1YF0 A;  4F0B A;  3EWL A;  4YAP A;  5IPH A;  2L5L A;  5EY6 A;  3D5J A;  5IOW A;  2GQM A;  4ZB7 A;  2L6C A;  3H4K A;  4I2T A;  1ZYN A;  2RM5 A;  4K5S A;  1GSE A;  3IPZ A;  4Q5N A;  4BL7 B;  4MPG A;  2MZC A;  4D73 A;  5EVO A;  5IIZ A;  1PN9 A;  1K0B A;  3KH7 A;  16GS A;  3D6I A;  4KH7 A;  1TK0 B;  4K0G A;  1XVW A;  1TK5 B;  1V58 A;  1BED A;  1TXU A;  2IMD A;  3GL3 A;  1GNW A;  5CRH A;  1OKT A;  4GQC A;  1R7H A;  1EEM A;  1FOV A;  3CWG A;  4MCU A;  2I1U A;  1XWA A;  3TOT A;  2P5Q A;  1M7T A;  1YDK A;  5G30 A;  3LGC A;  3QOU A;  3ZLP A;  2FA8 A;  1TRS A;  2C0E A;  4CW9 A;  1Q98 A;  4HQZ A;  2YPM A;  1X9S B;  4AI6 A;  1OE8 A;  4USS A;  3FZA A;  4DEJ A;  3FYG A;  1U3A A;  1TRU A;  4DSQ A;  2PMT A;  1GNE A;  4AKI A;  4J56 E;  4H86 A;  1K3L A;  2NBS A;  12GS A;  2H6Y A;  3LQ7 A;  4F2I A;  4F82 A;  1IYI A;  5ENU A;  1R26 A;  3KP9 A;  3HVV A;  2QGV A;  6GSW A;  1XWG A;  2P0G A;  3IRA A;  4I8B A;  5INY A;  2C8U A;  4EF0 A;  4XS1 A;  3TJF A;  2LV3 A;  4IP1 A;  3HY2 A;  4KAE A;  3UVH A;  2DLX A;  1FAA A;  2JZR A;  4K9Z A;  1F2E A;  3Q74 A;  2IMI A;  3KD0 A;  3VWV A;  6GST A;  2VCZ A;  4G2E A;  4MAB A;  2L59 A;  2B5Y A;  2LQO A;  4OCF A;  3F6D A;  4MF6 A;  3TUE A;  2B7K A;  2GTU A;  1T3B A;  2HRA A;  1XVQ A;  5GSS A;  3HZ4 A;  2OE1 A;  1J0F A;  2GDR A;  3TKS C;  5GZZ B;  3TRP A;  4TR4 A;  1GTA A;  2FUG 2;  3GX0 A;  2YZH A;  5JCW A;  4EKZ A;  5D73 A;  2PU9 C;  2ON7 A;  3FR6 A;  1TP9 A;  3LSZ A;  3IXR A;  5D9V A;  4MDC A;  3EMX A;  1H4O A;  2FWE A;  2VLV A;  4GTU A;  3IE3 A;  10GS A;  2L5O A;  4O5U A;  3QD9 A;  4GWR A;  2A2R A;  2BTO T;  4I6X A;  2VO4 A;  3VI5 A;  5EL8 A;  5DAL A;  3GH9 A;  1B8X A;  3ME8 A;  2PVQ A;  2X49 A;  5C00 A;  4JRR A;  4L5L A;  2DBC A;  2R5G A;  1FG4 A;  5IO2 A;  5IMD A;  2QSI A;  2M46 A;  4KCA A;  3H79 A;  4EVM A;  1WMJ A;  4IKH A;  1SJI A;  4DSS B;  1SKR B;  2DJ3 A;  2CAQ A;  2EIR A;  4POM A;  3FHK A;  2RUF A;  2HQT A;  3TGZ A;  2L57 A;  2JAC A;  1PKW A;  3M1G A;  1YKC A;  1MDI A;  2IME A;  4ZB6 A;  3ZVJ D;  1H75 A;  2LST A;  3EC3 A;  1GRX A;  3RDW A;  3TU3 B;  2JAD A;  1Z6M A;  4ML6 A;  5BMU A;  4ZL9 A;  5IPG A;  5J9C A;  3LOR A;  5IQY A;  3FK8 A;  5IOX A;  4KUN A;  2GSR A;  1XIY A;  5FHI A;  1XZO A;  3TJJ A;  3F4S A;  3KZQ A;  1AQX A;  2E0Q A;  1AQV A;  5ECP B;  1M2D A;  3KP8 A;  3V1W A;  1M2B A;  6GSY A;  2N5F A;  4MLY A;  4AKX B;  5D9X A;  4BWS A;  4WR4 A;  1GSD A;  5J3R A;  4YQV A;  5IO0 A;  1TRW A;  4BVY A;  1GUK A;  4KCE A;  2VCQ A;  4OFT A;  2FNO A;  2VCX A;  5DQS A;  2DC5 A;  4V2M A;  5A5H A;  3RPP A;  3DVX A;  1GWC A;  2YWM A;  1SL2 B;  2QA2 A;  4PUF C;  3IAS 2;  2K18 A;  4POL A;  5E59 A;  1QFN A;  4MK3 A;  3CRT A;  2PWJ A;  1PN0 A;  4D73 B;  3C7M A;  4BVX A;  3GHA A;  1EP7 A;  5H5Q A;  4P3Y B;  2IMK A;  3H1N A;  1Z3E A;  4X1U A;  2A2S A;  4MJE A;  3A2V A;  6GSV A;  2MMZ A;  5B6N A;  4PQI A;  1XXU A;  2PPT A;  3PGT A;  4O7H A;  1Z6N A;  3GIX A;  3RAZ A;  3LFL A;  2GZZ A;  4N11 A;  1W4V A;  3CSJ A;  4V1A g;  4PUR A;  3TJG A;  5KN0 A;  2ZUP A;  2P31 A;  1WWJ A;  3HMJ G;  3PIN A;  3UVT A;  5ECS A;  2BMX A;  1DSB A;  2H76 A;  2LS5 A;  2LKU A;  5KN1 A;  3VI7 A;  2PBJ A;  2FWF A;  4TR3 A;  1A23 A;  18GS A;  2V6O A;  5CNW A;  1BAY A;  4MF5 A;  4Q5Q A;  4Q5F A;  1O81 A;  5AGY A;  1SKW B;  3FR9 A;  4KDX A;  3F6F A;  1X5E A;  2CV4 A;  5J41 A;  1GTU A;  1T4Y A;  4HZ2 A;  5CRE A;  2EFD A;  2F8F A;  5ID2 A;  2OBI A;  4ECJ A;  3HA9 A;  2OE3 A;  4N30 A;  3L9U A;  3GV1 A;  2HRK A;  3C8E A;  5G5F A;  1CQG A;  4GDF A;  4MH3 A;  5D96 A;  4N0Z A;  3GL5 A;  4PXO A;  2KOK A;  1SK1 A;  5A4V A;  5CRD A;  4BPY A;  3VUR A;  3M8N A;  1S3C A;  3ZFB A;  3A2X A;  1URM A;  5IMV A;  4KE3 A;  3TRQ A;  1R4W A;  3U5R E;  4RQR A;  2A2P A;  5CRG A;  3DWV A;  1TXX A;  5CRW A;  1FVJ A;  4CY6 A;  3P7X A;  2I3Y A;  4XRA A;  4G19 A;  4HEA 2;  1TU8 A;  3K8N A;  3DD3 A;  1T1V A;  2R4V A;  2HI7 A;  3Q19 A;  3H93 A;  3F4R A;  2CZ2 A;  5IM9 A;  3DXB A;  4EIP A;  1Z7R A;  2CA8 A;  3BCK A;  4F03 A;  1TW9 A;  5ABR A;  3IBH A;  4IJI A;  4G9H A;  2H1B A;  2R6K A;  4CY8 A;  1TRV A;  2CZ3 A;  4FYB A;  1HYU A;  3F3Q A;  1Z9H A;  1Y6E A;  4Z2R A;  2O8V B;  3GX8 A;  2H19 A;  4EDY A;  2AYT A;  2MYG A;  5DAL B;  4I97 A;  4HJ2 A;  3VK9 A;  3N5O A;  2Z9S A;  2CX4 A;  3O6T A;  1YKA A;  3TKS E;  2VCV A;  2C0G A;  3L9V A;  2B7J A;  3O76 A;  1EV9 A;  3WYW A;  4ZL8 A;  1SL1 B;  3LW9 A;  4NXI A;  2C80 A;  1X5D A;  4ECI A;  1B9Y C;  2A4V A;  3L0H A;  1PQN A;  3GH6 A;  4K1F A;  3NZN A;  2X8G A;  1T4Z A;  2DML A;  4K2X A;  2KLX A;  3CMI A;  1M2A A;  1T7P B;  2E2M A;  3NIV A;  1ERU A;  3ZML A;  1XW9 A;  1OC8 A;  4AJ8 A;  4YH2 A;  3UBK A;  14GS A;  5BMU B;  1V9W A;  4KGI A;  5ECH B;  5J5N A;  3QMX A;  2FHE A;  1NSW A;  2PVO C;  1A0F A;  1K0M A;  3HXS A;  5ECL B;  1MEK A;  2GSS A;  1AC1 A;  1ABA A;  19GS A;  1EV4 A;  3LJR A;  2V32 A;  2WS2 A;  2R0G A;  1GH2 A;  2AJQ B;  3CTG A;  4IP6 A;  5F05 A;  1GTB A;  1UVZ A;  4XIH A;  3ZRE A;  1T00 A;  2NVL A;  5FWG A;  3E3E A;  4ZBA A;  4ZB9 A;  2WFC A;  5H5R A;  4G10 A;  4BVY B;  2XPD A;  2RLI A;  3LEF A;  2O5V A;  2ALB A;  3HYP A;  1K0A A;  2H75 A;  1PL1 A;  1EEJ A;  2IPA A;  2JU5 A;  1A0R P;  2XPE A;  5A5H B;  2JSZ A;  3ZRD A;  4Z2U A;  3QPM A;  2GT5 A;  3QAW A;  1EGR A;  5D8I A;  3MIX A;  2HE3 A;  1JZR A;  2K6V A;  4WKW A;  3D21 A;  4ILF A;  3M9J A;  3F8U A;  3E9J B;  3I43 A;  4O32 A;  4BVX B;  2H30 A;  1YY7 A;  2H8L A;  1SJZ A;  4YKG A;  1EWX A;  1VF4 A;  2V2G A;  3CRU A;  1O73 A;  4I5Q A;  4ZXG A;  4RI7 A;  4G01 A;  3Q6O A;  2LJK A;  3GYK A;  2UV8 G;  3N9J A;  4GLT A;  2LTK A;  1BJX A;  4JED A;  2G2Q A;  2YAN A;  4KB3 A;  1HNB A;  3ZL5 A;  2WCI A;  2DJ1 A;  4L0W A;  3QCP A;  2R3X A;  3FZ5 A;  5EPF A;  2P5R A;  3APS A;  1T8E B;  1K0C A;  4WBJ A;  4FH8 A;  4ZIJ A;  3TDG A;  5ECN B;  3TB2 A;  3E0U A;  1Y25 A;  3MSZ A;  1QK8 A;  3NOF A;  1PD2 1;  4LLR A;  2C3T A;  3HD5 A;  1AAZ A;  4PUA A;  2C4J A;  1NM3 A;  2WGR A;  3EPT A;  4TXO A;  5H5S A;  1A8Y A;  3M3M A;  4MZB A;  5ID2 B;  2VL2 A;  1VF2 A;  2E2G A;  2IL3 A;  4O5Q A;  5B6M A;  3RBT A;  3Q18 A;  2HRK B;  3SWL A;  3BOA A;  3FKF A;  2TRX A;  5J4Y A;  4QQ7 A;  2ZCT A;  2LEG A;  3BD2 A;  1GUL A;  5DAK A;  1ZYP A;  5ECO B;  1U88 A;  4MF7 A;  4QMK A;  2IJY A;  1KBN A;  1NHO A;  5JCG A;  11GS A;  5HR2 A;  3W8J A;  1PRX A;  5L71 A;  3R2Q A;  4F9Z A;  3L9S A;  1AIU A;  1ERT A;  1GUH A;  1V98 A;  4ZL7 A;  4IEL A;  1ZOF A;  3RPN A;  1O8X A;  5IMA A;  3GST A;  1EOH A;  3I69 A;  20GS A;  1N2A A;  1SK2 A;  5KOX A;  4W66 A;  3GUS A;  4WR5 A;  3C1S A;  3DML A;  1BG1 A;  2M72 A;  2GVP A;  4K6X A;  4ZBD A;  1WP0 A;  3D0Z A;  1WRY A;  4TW5 A;  1K0N A;  1PA3 A;  2AV4 A;  2B1K A;  3ERW A;  1IYH A;  1PX7 A;  3G9B A;  4EO3 A;  2BJX A;  3ED3 A;  1TTZ A;  5J4U A;  3GNJ A;  4OFM A;  1XPV A;  3ZIT A;  2KHP A;  2XHF A;  4GXZ A;  2IFQ A;  3GTU A;  1WIK A;  4X43 A;  3MDK A;  5G2Z A;  3FEU A;  5GAN D;  2DMM A;  4ICY A;  3UEM A;  2F51 A;  2C3N A;  4POK A;  1GLP A;  1AUC A;  4XCS A;  5HFG A;  5HQP A;  4G0L A;  2VM1 A;  2F3M A;  1PX6 A;  3ZMK A;  3UJ1 A;  3HHV A;  3ZIV A;  1MDK A;  1F3B A;  2F9S A;  4TKY A;  4PQ1 A;  4FYC A;  2GST A;  4HDE A;  1JZD A;  2GZY A;  1F6M C;  4GST A;  3DYR A;  4EXJ A;  3MAK A;  4AKG A;  3CYN A;  2MBS A;  3C1R A;  3MYD A;  4QL9 A;  1DUG A;  1USB A;  3GSS A;  1DBY A;  5A5K A;  1FB6 A;  2MBT A;  2K9F A;  1THO A;  1PL2 A;  2YJH A;  4AJ6 A;  5KN3 A;  4MZC A;  2DSA A;  3GUR A;  1KTE A;  3HKR A;  2CX3 A;  2VM2 A;  4GF0 A;  4ZB8 A;  2OE0 A;  1GSY A;  1TI3 A;  4GQF A;  4KDU A;  3VWX A;  4JU5 A;  4MJB A;  1FB0 A;  4JZQ A;  2FA4 A;  4AJ7 A;  4EL1 A;  1ERV A;  1JZO A;  4LMV A;  1F9M A;  5KOW A;  3IDV A;  2V41 A;  4EC0 A;  5ELG A;  2H71 A;  2RM6 A;  1RW1 A;  3FZ4 A;  1SD8 A;  4OMV A;  1NW2 A;  5G1L A;  4RUV A;  4NV5 A;  2HRN A;  4HUA A;  4NV2 A;  1X0R A;  1TOF A;  2DKH A;  3J7Y b;  2H1G A;  2GQK A;  3UBL A;  1X9M B;  3UIW A;  3I9V 2;  1SYX A;  3EE2 A;  1EOG A;  3J7Y k;  1BF5 A;  3HVX A;  1DE2 A;  1AW9 A;  1ZYE A;  4EE0 A;  2IMF A;  1FO5 A;  1ZZY A;  3CSH A;  2O89 A;  1XWK A;  4KND A;  1MDJ A;  3GRX A;  4V2L A;  2DIZ A;  2L6D A;  2AUV A;  2C0D A;  1Y1U A;  3F63 A;  2VKZ G;  3ZTL A;  2VD1 A;  2CQ9 A;  2H6X A;  4OFN A;  4IVF A;  4TR1 A;  4MJA A;  3P2A A;  2H1A A;  1G7O A;  1ERW A;  2PER A;  2R37 A;  4K7N A;  3QAV A;  3ERF A;  3HJM A;  2OJL A;  1TDI A;  2X8C A;  2GGT A;  3UOM A;  1KEB A;  4K2D A;  3RHB A;  1AXD A;  4GSN A;  3ZIJ A;  4TXO B;  2LJR A;  4GRF A;  2KP1 A;  1OC9 A;  2H70 A;  4EUY A;  2REM A;  3PH9 A;  5DQY A;  4PNG A;  2VLU A;  3KTB A;  1JZW A;  3VPQ A;  2X4A A;  4HQS A;  3LXT A;  2OT3 A;  1R5P A;  1G6Y A;  5G5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...