2VO4A

Glutathione transferase from glycine max
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
219
structure length
219
Chain Sequence
MQDEVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPSDPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2,4-D INDUCIBLE GLUTATHIONE S-TRANSFERASE
publication title Crystallographic and Functional Characterization of the Fluorodifen-Inducible Glutathione Transferase from Glycine Max Reveals an Active Site Topography Suited for Diphenylether Herbicides and a Novel L-Site.
pubmed doi rcsb
total genus 83
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vo4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vo4A01
2RM5A 3C73A 3G7YA 4EO3A 2FA8A 4Q5FA 3HA9A 1O73A 2H6YA 1I9DA 5IOXA 3H8QA 3VI5A 3HZ4A 5DAKA 4XIHA 5DCHA 3Q18A 5B7CA 5G1LA 1GLQA 1B4QA 1T8EB 3HDCA 4GLTA 4EXJA 3DWVA 4I2UA 2K8SA 1F2EA 1GTUA 2H71A 4ZB9A 1M7TA 2UZ8A 4E8HA 2N5FA 1JZWA 1M0UA 2CVKA 20GSA 4F9ZA 2K9FA 3G7JA 1GUHA 2C3TA 5F06A 4NPBA 3A2WA 5IO0A 2XHFA 1OC3A 4ZILA 1WWJA 1EP8A 1TI1A 2YANA 5KN0A 4EKZA 5D73A 3IPZA 1SKSB 1DE1A 5FT3A 2DJ1A 2OBIA 2IN3A 2BJXA 3FR6A 1K3LA 1X5DA 1V57A 3IR4A 4MJBA 2FGXA 3V1WA 5IQYA 19GSA 1O8WA 2CVBA 3PH9A 1PL2A 6GSUA 2IPAA 4TR3A 3ZFLA 2DIZA 2EC4A 1EGRA 1BQ7A 2LV3A 5C00A 2X8HA 4CW9A 3QOUA 2GQKA 2DMLA 4X0XA 1A24A 3I6AA 3FKFA 5JCUA 3VPQA 1B9YC 2IMIA 3EMXA 1GSFA 3RAZA 5ID2B 3GIXA 1R5PA 3KP8A 1PQNA 3TKPA 4K9ZA 2G2QA 4MJAA 1YY7A 2H01A 3TB2A 3CYNA 4L0UA 1SJ6A 3ZRDA 2HI7A 1VGLA 3CSHA 2KP2A 1OVNA 4P3YB 2R3XA 3I43A 1SK2A 1O81A 2H8LA 2WGRA 3IK7A 2H73A 4GSTA 1A2MA 3ZMKA 2MMAA 2P31A 4RI6A 3VLNA 1GSYA 22GSA 3GRXA 1H75A 4G9HA 3HKRA 2LUSA 4TOPA 2PPTA 2YN1A 4OFNA 2TIRA 3EE2A 4MF5A 3BJ5A 2IL3A 3HHVA 3VWXA 2FLSA 3NIVA 3CRUA 3TJBA 3RBTA 3TKSE 3VURA 1ACVA 2GQMA 1WP0A 2PU9C 2PMTA 1Z5YE 4PNGA 2F9SA 4ZL8A 2OA7A 1OYJA 3EYTA 4O7HA 3VWVA 2GSQA 3QPMA 5DCGA 3GMFA 2CQ9A 4V2MA 1PL1A 1E6BA 1TRWA 3NZNA 5ID2A 4TR4A 1XXUA 1YQ1A 2LQQA 5G2ZA 5J3RA 2H0HA 5B8AA 2YP6A 2JSYA 1FOVA 5G5EA 2F3MA 4O92A 10GSA 4YAVA 2AB6A 5IMAA 1X9SB 3L9SA 1WMJA 5ENUA 3U5RE 1F6MC 1TJDA 4MZBA 2H74A 3FEUA 3ZFBA 4PX1A 4MZCA 5IOWA 1G7OA 1DBYA 5EVOA 1E2YA 4HUAA 2AJQB 4JU5A 4JEDA 3R3EA 2H6ZA 1U3AA 2X99A 1AQXA 2NVLA 4POKA 1RQMA 3UL3A 3M1GA 1SKWB 4K6XA 4TRXA 3J7Yb 2R4VA 1EOGA 4TXOA 4PNFA 1TP9A 4FQUA 1GUMA 3GL3A 2IMDA 5J9BA 2DIYA 3E9JB 4MK3A 4G19A 4GXZA 4OCEA 3FZ9A 4KH7A 3L9UA 4HS1A 2FNOA 4YQVA 2VAFA 4G0IA 3P2AA 2E2MA 4ZL9A 1SL1B 1IYHA 3DVWA 4ZIJA 6GSSA 2H1DA 1ZYQB 1R5AA 2M80A 1DE2A 3IBHA 4EVMA 2R5GA 3DGQA 5FWGA 2N5AA 1TOFA 4RQXA 3QMXA 1GRXA 3AY8A 3ZMLA 4TR1B 1F3AA 3CTFA 3ZVJA 2NDOA 3LXZA 1S3DA 2YWOA 1BEDA 1UVZA 1XBSA 2HSYA 3GNJA 1CQGA 2H1GA 3HYPA 2E7PA 3QAGA 2O8VB 1GNWA 3DIEA 3HXSA 4NHZA 2C4JA 2GSTA 1Z3EA 3J7Yk 1V98A 1FW1A 4HOJA 1ST9A 1AC1A 4Q5QA 3DXBA 1TK0B 1LU4A 3W8JA 4D73B 1WJKA 4G2EA 3D4MA 2WJUA 4WR4A 3EINA 5A4VA 4FH8A 2VL2C 4RQRA 3MNGA 1FG4A 5H5RA 4BVXA 1RK4A 5ECIB 3IE3A 2Z9SA 2ON7A 2LSTA 3IAM2 5ECRB 2M46A 5D9XA 2RUEA 4WEYA 4JBBA 3A5WA 3M0FA 2AV4A 2PERA 12GSA 1YZXA 4EE0A 5GSTA 4TR1A 2VL2A 5ECHB 3P90A 3N5OA 2VCXA 2KUCA 4F03A 2WZ9A 4KCAA 2IWTA 3QFBC 2WS2A 4J56E 1T00A 2YWIA 1R7HA 2E2GA 1U3IA 2HZEA 2J9HA 1NSWA 5IPGA 4OO4A 4WF5A 4IW9A 3DMLA 1OKTA 2CZ3A 1JLVA 3K8NA 3GURA 4HQSA 3TRPA 2VM1A 4FIWA 1I5GA 5GAPD 5AN1A 2O87A 5F8BA 4N30A 3GV1A 3ZL5A 2A2SA 2B1KA 1EGOA 3OR5A 2XC2A 4HI7A 1XZOA 5G31A 2DMMA 4N10A 4NV5A 2VIMA 3APQA 4ZBDA 4ISDA 4BL7B 4I97A 3F4TA 2RM6A 1PRXA 5CRDA 2HT9A 3LORA 4EL1A 5CNWA 5GAND 4JR6A 2LRTA 2H1BA 2HLSA 3IV4A 3EU3A 1B8XA 5D9TA 1Z9HA 2ALBA 4PTSA 3F0IA 2B7KA 1MD3A 2O7KA 4WBRD 2B5YA 3TDGA 3HVVA 1JHBA 4Q5RA 4J2FA 2IJYA 1M2BA 3RHCA 1GSDA 2WULA 4IBPA 3H4KA 1V2AA 5CRHA 3ZLPA 3EVIA 3C1SA 13GSA 5E59A 1Y6EA 2KOKA 2L59A 3TKSC 4J57E 1A23A 2IFQB 4L5OA 5DDLA 4MJCA 4TN8A 1FVKA 1F9MA 3TOUA 2HRNA 2I3YA 4DSQA 4K7OA 3KM6A 1S3AA 3IOSA 4OD7A 3TRXA 1PD21 2LJKA 6GSXA 4ZBAA 3WGDA 1SJZA 3TKSA 1WOUA 4K0GA 3L78A 2H1AA 5GSSA 1G0TA 4BL7A 5CYYA 1K0NA 4JR4A 2VLVA 2X8GA 3HZ8A 3MWHA 2LKUA 2V32A 2YWNA 1OC8A 2YV9A 1GTIA 3TCOA 3IDVA 4K1FA 3GTUB 3Q6OA 4BWQA 2DJ0A 3HD5A 2OBKA 3RPNA 7GSSA 1VF2A 2XBQA 3D5JA 1FO5A 4IKHA 16GSA 3GA4A 4ZL7A 9GSSA 4ECCA 1HNAA 4FYBA 4NV2A 2VLTA 4MF6A 1V9WA 2H0GA 3KH7A 1SJIA 3IC4A 3UEMA 4V1Ag 3SBCA 4HJMA 1TK8B 4OCFA 4DVCA 4V2LA 4Z7XA 1DUGA 4ZB8A 2OJLA 4ML1A 1XVWA 1Z6MA 2FWGA 5LCZA 3EWLA 3GH6A 3A2VA 4OFTA 1HYUA 3EU4A 3RHBA 3UMAA 3D22A 4NWYA 1LBKA 2LNSA 2YNXA 2LRCA 1K0OA 2V1MA 4TKYA 3TKRA 2N5BA 4I5QA 2FWEA 4MJEA 1SYRA 4KDYA 2OACA 2O85A 3CBUA 5ECOB 1SD9A 3KZQA 4TXVA 1YJ6A 1EV9A 1OC9B 3IA1A 4HJ2A 6GSYA 4KF9A 5G1KA 1TRUA 2EIOA 5L71A 4E8EA 2QSIA 4TR0A 4DSSB 5DVBA 1M2DA 4ZXGA 2H66A 2WFCA 1M99A 1USBA 3ZTLA 4YQUA 1Z7PA 3C7MA 3APSA 3UAPA 1A8YA 2FWHA 2F51A 1JFUA 2TRCP 3GH9A 1J9BA 5B8BA 1GLPA 3QAVA 1M9BA 2VD1A 1N2AA 3DEXA 3FK8A 5CRGA 4WXTA 4HZ2A 11GSA 1GSQA 1FVJA 2DC5A 2ZNMA 1G6WA 4PUAA 2HSMB 4FYUA 4HDEA 1AUCA 3U6VA 4BA7A 1QQ2A 3IHQA 3GKXA 3GFKA 1TU7A 1Y25A 3CXGA 4GRFA 3FW2A 4WF4A 1A0RP 1HNCA 4POLA 3GKMA 3FYGA 1X5CA 3KIJA 1HNBA 2CX3A 2MYGA 3UARA 4NXIA 2MMZA 1T7PB 5ECNB 4WR5A 1GNEA 2CZ2A 4KAEA 5CP1A 2LS5A 1XW9A 3KEBA 2GZYA 2LTKA 4KSMA 1OC9A 3CMIA 1WPIA 2AUVA 2NPBA 4EF0A 3O6TA 5A4UA 4DSSA 1PKWA 3KXOA 3VFIA 1EZKA 2LEGA 3APOA 3M9JA 2VO4A 4I6XA 3RPPA 3LWAA 3I69A 1WIKA 1LJRA 4LMWA 1XCCA 4XS1A 5F07A 3VWWA 4LLRA 2MBSA 2JZRA 1PSQA 4AGSA 5D8IA 2GSRA 1A8LA 1MEKA 2GS3A 3KD0A 1XVQA 5IPHA 3LYPA 2B3SA 5B6NA 4K2DA 2FWFA 2XPDA 3MDKA 1VRSD 1A2JA 4XCSA 5J41A 4LL4B 3D0ZA 5H5SA 2P5QA 4KA0A 1NHYA 2OADA 2LJAA 5ECQB 3W8SA 1Q4JA 2HSMA 1GP1A 3L9VA 1EWXA 1YDKA 4XS6A 1N8JA 1FB0A 2OKAA 5JCWA 2REMA 3UVTA 2C80A 1XWBA 3CSIA 4KDUA 1QFNA 5DBQA 4K7IA 3TKQA 4GSNA 1B48A 3QD9A 2R37A 2JZTA 2HSNB 2EIQA 4PUFC 2HNLA 3TOTA 4MDCA 2GTUA 4QL7A 5DJLA 4GSSA 3E0UA 1T3BA 4N0VA 1G6YA 3IXRA 3LXTA 4HQZA 3UBKA 3O3TA 3QCPA 1ZMAA 2LNTA 5GZZB 1T4YA 1X5EA 4ECJA 3M3MA 3F4SA 1NHOA 1ON4A 4ID0A 4L8EA 2VCTA 3UVHA 2QKEA 3QDNA 1KTEA 1M2AA 5ELAA 2XBIA 1DSBA 4IQAA 1UN2A 3KCMA 2F8FA 4RUVA 2OE3A 4WBJA 4KSOA 4ECBA 3CRTA 3GSTA 2EIRA 2K18A 5IMFA 2X8CA 3VWUA 4ZB6A 4ACSA 4MLYA 1PKZA 3A3TA 3LQ7A 4KDXA 4XRDA 2ON5A 2HRFA 4FO5A 1HD2A 5D9VA 3FR3A 2H19A 4XS4B 4KUNA 17GSA 1SYXA 3GHAA 2B1LA 3UIWA 1HQOA 1R26A 3FRCA 1B9XC 3I9V2 2R2JA 4V2NA 1PA3A 3Q19A 1MDJA 1JZDA 3NOFA 1J08A 1JLWA 3JCML 3E3EA 3HVXA 2IMKA 3F8UA 3WGEA 2F8AA 5H5QA 4L5LA 5J4UA 5JWRB 1K0MA 4X43A 4G0KA 1BX9A 3D4TA 3IC8A 2VL9A 2DLXA 2JSZA 1UC7A 2WCIA 1GSSA 2FY6A 3ERWA 5COHA 1GWCA 4QQ7A 2HRAA 3TRQA 2BTOT 2PVOC 2CAQA 5IIZA 1EEJA 1K3OA 3F6FA 4GCIA 3GUSA 5DJMA 1KEBA 2HZFA 4KW6A 5DAKB 1T4ZA 1VF4A 2R6KA 1F37A 2JL4A 1NW2A 2GSSA 1K0CA 4RI7A 1Z6NA 5G30A 3O76A 2L4CA 1B4PA 4D73A 6GSVA 2OE0A 2PGTA 4OWYA 1QUWA 3N9JA 3US3A 4GQFA 1BG5A 3ZITA 1MTCA 4BWSA 3WT2A 1F3BA 4IP1A 1XWAA 3TUEA 4EUYA 5HFGA 3FHKA 4ECIA 1URMA 2GVPA 2BMXA 1G7EA 4NMUA 2GZZA 4G0LA 5B6MA 4L0WA 4OFMA 2V2GA 5AIXA 3ME7A 1ZGNA 4TW5A 4N11A 5HR3A 3VPTA 3F6DA 1V58A 1PN9A 2LJRA 3TJKA 1XIYA 3H1NA 5HQPA 2V6OA 3PR8A 18GSA 1WE0A 4MH2A 1TRVA 2C8UA 4POMA 3KP9A 1XOAA 2L57A 3F3RA 4N0ZA 1MDKA 1SKRB 3QAWA 1X9MB 5CO3A 2OE1A 5HR1A 1EV4A 4KGIA 1W89A 2KP1A 3TJFA 5D96A 3C8EA 2HSHA 3LYKA 1T1VA 3EURA 2B6MA 2H30A 2JZSA 1AW9A 2B5XA 4MH3A 2XPEA 2V6KA 5D9WA 3G7IA 1X9WB 2J23A 2H75A 4IELA 1TRSA 5ECKB 4KNDA 1XWCA 2MMOA 4Q5NA 3Q74A 4DEJA 3LEFA 3ME8A 1TTZA 3DRNA 2DJ2A 3QFAC 4EDYA 3M9KA 3D21A 3DYRA 3L0HA 5IMVA 1A2LA 3BOAA 2GT5A 1CQHA 2DSAA 4GF0A 2C0DA 2YJHA 3R2QA 3F4RA 1QXHA 1UA5A 3ZREA 4F0CA 1QK8A 3LJRA 1EP7A 1ML6A 4F0BA 1Q98A 2X64A 4LMVA 2JU5A 4GWRA 3BCIA 4FYCA 4TVEA 2YWMA 2QC7A 3EC3A 1ERUA 1XWKA 2GDRA 4IVFA 1ABAA 2FCHA 1PX7A 3ZIJA 2PN8A 3IK9A 4PXOA 1ZL9A 4PGTA 4YH2A 3TJJA 4JZQA 1GUKA 5AIVA 1SK1A 2IFQA 2FHEA 4ULXA 4EDZA 1TK5B 2K8VA 6GSWA 4V1Ap 4IN0A 4X1UA 4PQIA 2GZPA 2B7JA 1VF1A 1AAZA 3KTLA 3DVXA 3BBYA 4KE3A 2C0GA 1AIUA 3KH9A 4XTSA 2PUKC 3DD3A 5JCGA 1TDIA 2YOIA 2VCWA 1U6TA 4NHWA 2FD3A 2HYXA 2MZCA 1ERWA 4MMMA 3CTGA 5G5FA 3WT1A 3F3QA 1SL0B 1YEPA 3FY7A 2VCZA 5A4WA 3RDWA 3KMNA 3GX0A 5KN2A 2DJKA 2O89A 1K0AA 5JWOB 3MSZA 3GTUA 2NBSA 1RW1A 2PVQA 1X0RA 4OMVA 4NAXA 3W6GA 2ZUPA 2YPMA 2L6DA 1XWGA 1OE7A 1ZCPA 5DQSA 2PBJA 2ES7A 4IGJA 2YCDA 1OKDA 2MMNA 2VM2A 1XOBA 5IMDA 1EEMA 3L4NA 1M9AA 3KJYA 4WETA 3LFLA 1SENA 2P5RA 4TXOB 2CT6A 5HR2A 1YKAA 1XW6A 2V41A 1MD4A 1XPVA 1THOA 2DJJA 1IYIA 4H86A 1AXDA 3ZZXA 4KB3A 2GQLA 3DKSA 1BYEA 2QGVA 4YQMA 4USSA 5IMCA 2CVDA 5IM9A 1JZOA 1YEXA 1R4WA 2DJ3A 2LRNA 2L4QA 4IQ1A 1ZZYA 2I81A 4DSRA 5IO2A 1JZRA 5KN3A 3LG6A 3QR6A 3FZ5A 2AYTA 5ECSA 4G10A 5JWQB 2I9HA 3C1RA 4XHMA 1SL2B 1SK0A 3BCKA 8GSSA 4PQ1A 5KEJA 3ERFA 1O7UA 2G0FA 3PPUA 1ERVA 3C71A 3LGCA 1GULA 2H6XA 3GN3A 3WYWA 5A5KA 2L6CA 5ECLB 2KLXA 1TKDB 1U87A 3VK9A 3FR9A 1BJXA 1QGVA 5IMZA 1GTBA 1C72A 3GX8A 1SD8A 2C0FA 3HJOA 2AHEA 1PX6A 3PINA 4HZ4A 1TI3A 5D93A 3FZ4A 1FB6A 3H79A 2JADA 3ZYWA 4OO5A 1TU8A 2RLIA 1GTAA 3PGTA 2WRTA 4KX4A 5EL8A 4HU7A 2C3QA 2C3NA 1V40A 1ZYEA 1GH2A 1O85A 1YF1A 4EC0A 1W4VA 2HQTA 4ZBBA 3UJ1A 2FUG2 4AJ6A 3M8NA 1K0DA 1XW5A 5AGYA 3SWLA 4AJ7A 3UOMA 3G9BA 4CHSA 1THXA 4I8BA 1PGTA 5KN1A 3A2XA 2HE3A 4CDOA 3GYKA 4BPYA 3ED3A 1O6JA 2VOCA 4F82A 1A0FA 3IRAA 2P0GA 1J0FA 1GSEA 1FHEA 1NM3A 5DQYA 2NTOA 4IP6A 3KMOA 4BVXB 1QMVA 2D2ZA 2H70A 5EY6A 3KGKA 1KNGA 3TJGA 3GSSA 3HVSA 3GKKA 3HJPA 1AQVA 5ELGA 2M72A 2TRXA 3D6IA 4I2TA 14GSA 4MZWA 4LL1B 2YV7A 1WRYA 2VCVA 2YJ7A 3VI7A 4F2IA 3IAS2 5J5NA 2HFDA 2PWJA 2E0QA 2CX4A 4LA1A 4XRAA 1ERTA 2VL3A 3H93A 2MBTA 2A2RA 3GL5A 2HZEB 5LNKe 1YKCA 3P8WA 2C1YA 3BD2A 4MABA 4HEA2 2K6VA 1H4OA 5HR0A 2I4AA 2AAWA 4K8MA 1K0BA 1Z7RA 1PMTA 1GL8A 3CSJA 2VCQA 4GQCA 4GTUA 5DALB 1TW9A 1ZOFA 4BVYB 4POBA 5F05A 1TXXA 2RUFA 2LQOA 3HJMA 2CA8A 4MF7A 3MAKA 5ABRA 2CAIA 2RIIA 3S9FA 2IMEA 5E4WA 4PQHA 5HFIA 2GLRA 4MP4A 2HXKA 4IS0A 2DBCA 3GKNA 3F63A 2KHPA 2HRKB 3KTBA 2H0IA 1XFLA 5ECPB 1BAYA 2FA4A 1U88A 4MA9A 4K0NA 3FZAA 5FHIA 4QL9A 4WKWA 5BMUA 4IJ3A 3ZVJD 1EOHA 4PURA 6GSTA 4JRRA 1SU9A 4MPGA 3P7XA 1AQWA 4O5RA 2YZHA 2H76A 1VF3A 5INYA 2B5EA 1YF0A 2WB9A 3ISOA 3ZIVA 2GGTA 5CREA 3HCZA 4XS4A 5CAXA 2C0EA 4MPFA 3HY2A 2GT6A 2WDUA 2VD0A 5HFKA 3ERGA 5DALA 5C04A 4BVYA 3WGXA 2I1UA 5EPFA 4IJIA 5CRWA 3TGZA 5LD0A 1FAAA 4AJ8A 5ECMB 4ML6A 4K7NA 2IIYA 3UBLA 2VLUA 1OAZA 1ILOA 5F0GA 3EMPA 1KBNA 2JACA 4AF2A 4KCEA 1OE8A 2IMFA 2A4VA 4JE1A 2HRKA 2CV4A 1MDIA 4IHUA 2L5OA 4ILFA 1K3YA 3F9UA 4YAPA 3WD6A 2VUPA 1S3CA 5J9CA 1O8XA 5AISA 4HU9A 4MCUA 2YZUA 1GSUA 2H72A 4O32A 3LSZA 2L5LA 2ZCTA
chains in the Genus database with same CATH superfamily
2RM5A 3C73A 3G7YA 4EO3A 2FA8A 4Q5FA 1SVLA 3HA9A 1O73A 2H6YA 1I9DA 5IOXA 3H8QA 3VI5A 3HZ4A 5DAKA 4XIHA 5DCHA 3Q18A 5B7CA 5G1LA 1GLQA 1B4QA 1T8EB 3HDCA 4GLTA 4EXJA 3DWVA 4I2UA 2K8SA 1F2EA 1GTUA 5A1NB 2H71A 4ZB9A 1M7TA 2UZ8A 4E8HA 5KOWA 2N5FA 1JZWA 1M0UA 2CVKA 20GSA 4F9ZA 2K9FA 3G7JA 1GUHA 2C3TA 5F06A 4NPBA 3A2WA 5IO0A 2XHFA 1OC3A 4ZILA 1WWJA 1EP8A 1TI1A 2YANA 5KN0A 4EKZA 5D73A 3IPZA 1SKSB 1DE1A 5FT3A 2DJ1A 2OBIA 2IN3A 2BJXA 1SVMA 3FR6A 2WW1A 4EIQA 1K3LA 1X5DA 1V57A 3IR4A 4MJBA 2FGXA 3V1WA 5IQYA 1TXUA 19GSA 1O8WA 2CVBA 3PH9A 5J4VA 1PL2A 6GSUA 2IPAA 4TR3A 3ZFLA 2O36A 2DIZA 2EC4A 1EGRA 1BQ7A 2LV3A 4GDFA 5C00A 2X8HA 4CW9A 4HSCX 3QOUA 2GQKA 2DMLA 4X0XA 1A24A 3I6AA 3FKFA 5JCUA 3VPQA 1B9YC 2IMIA 3EMXA 1GSFA 3RAZA 5ID2B 3GIXA 1R5PA 3KP8A 1PQNA 3TKPA 4K9ZA 2G2QA 4MJAA 1YY7A 2H01A 3TB2A 3CYNA 4L0UA 1SJ6A 3ZRDA 2HI7A 1VGLA 3CSHA 2KP2A 1OVNA 4P3YB 2R3XA 3I43A 2UV8G 1SK2A 1O81A 2H8LA 2WGRA 3IK7A 2H73A 4GSTA 1A2MA 3ZMKA 2MMAA 2P31A 4RI6A 3VLNA 1GSYA 22GSA 3GRXA 1H75A 4G9HA 3HKRA 2LUSA 4TOPA 2PPTA 2YN1A 4OFNA 2TIRA 3EE2A 4MF5A 3BJ5A 2IL3A 3HHVA 3VWXA 2FLSA 3NIVA 3CRUA 3TJBA 3RBTA 3TKSE 3VURA 1ACVA 2GQMA 1WP0A 2PU9C 2PMTA 1Z5YE 4PNGA 2F9SA 4ZL8A 2OA7A 1OYJA 3EYTA 4O7HA 3VWVA 2GSQA 3QPMA 5DCGA 3GMFA 2CQ9A 4V2MA 1PL1A 1E6BA 1TRWA 3NZNA 5ID2A 4TR4A 1XXUA 1YQ1A 2LQQA 5G2ZA 5J3RA 2H0HA 5B8AA 2YP6A 2JSYA 1FOVA 5G5EA 2F3MA 4O92A 10GSA 4YAVA 2AB6A 5IMAA 1X9SB 3L9SA 1WMJA 5ENUA 3U5RE 1F6MC 1TJDA 4MZBA 2H74A 3FEUA 3ZFBA 4PX1A 4MZCA 1YVLA 5IOWA 1G7OA 1DBYA 5EVOA 1E2YA 4HUAA 2AJQB 4JU5A 4JEDA 3R3EA 2H6ZA 1U3AA 2X99A 1AQXA 2NVLA 4POKA 1RQMA 5A5HB 5J4YA 3UL3A 5A34B 3M1GA 1SKWB 4K6XA 4TRXA 3J7Yb 2R4VA 1EOGA 4TXOA 4PNFA 1TP9A 4FQUA 1GUMA 3GL3A 2IMDA 5J9BA 2DIYA 3E9JB 4MK3A 4G19A 4GXZA 4OCEA 3FZ9A 4KH7A 3L9UA 4HS1A 2FNOA 4YQVA 2VAFA 4G0IA 4K2XA 3P2AA 2E2MA 4ZL9A 1SL1B 1IYHA 3DVWA 4ZIJA 6GSSA 2H1DA 1ZYQB 1R5AA 2M80A 1DE2A 3IBHA 4EVMA 2R5GA 3DGQA 4W66A 5FWGA 2N5AA 1TOFA 4RQXA 3QMXA 3LW9A 4Z2RA 1GRXA 3AY8A 3ZMLA 1S4BP 4TR1B 1F3AA 3CTFA 3ZVJA 2NDOA 3LXZA 1S3DA 5J40A 2YWOA 1BEDA 4CY6A 1UVZA 1XBSA 2HSYA 3GNJA 1CQGA 2H1GA 3HYPA 2E7PA 3QAGA 2O8VB 1GNWA 3DIEA 3HXSA 4NHZA 2C4JA 2GSTA 1Z3EA 3J7Yk 1V98A 1FW1A 4HOJA 1ST9A 1AC1A 4Q5QA 3DXBA 1TK0B 1LU4A 3W8JA 4YKGA 4D73B 1WJKA 4G2EA 3D4MA 4X4JA 2WJUA 4WR4A 3EINA 5A4VA 4FH8A 2VL2C 4RQRA 3MNGA 1FG4A 5H5RA 4BVXA 1RK4A 5ECIB 3IE3A 2A2PA 2Z9SA 2ON7A 2LSTA 3IAM2 5ECRB 2M46A 5D9XA 2RUEA 4WEYA 4JBBA 3A5WA 3M0FA 2AV4A 2PERA 12GSA 1YZXA 4EE0A 5GSTA 4TR1A 2VL2A 5ECHB 3P90A 3N5OA 2VCXA 2KUCA 4F03A 2WZ9A 4KCAA 2IWTA 3QFBC 2WS2A 2DKIA 4J56E 1T00A 2YWIA 1R7HA 2E2GA 1U3IA 2HZEA 2J9HA 1NSWA 5IPGA 4OO4A 4WF5A 4IW9A 3DMLA 4O5UA 1OKTA 2CZ3A 1JLVA 3K8NA 3GURA 4HQSA 3TRPA 2VM1A 4FIWA 1I5GA 5GAPD 5AN1A 2O87A 2QA1A 5F8BA 4N30A 3GV1A 3ZL5A 2A2SA 2B1KA 1EGOA 2H1LA 3OR5A 2XC2A 4ICYA 4HI7A 1XZOA 5G31A 2DMMA 4N10A 4NV5A 2VIMA 3APQA 4ZBDA 4ISDA 4BL7B 4I97A 3F4TA 2RM6A 1PRXA 5CRDA 2HT9A 3LORA 2EFCA 4EL1A 5CNWA 2X4AA 5GAND 4JR6A 2LRTA 2H1BA 2HLSA 3IV4A 3EU3A 1B8XA 4PI0C 5D9TA 1Z9HA 2ALBA 4PTSA 4E68A 3F0IA 2B7KA 1MD3A 2O7KA 4WBRD 2B5YA 3TDGA 3HVVA 1JHBA 4Q5RA 4J2FA 1YEWC 2IJYA 1M2BA 3RHCA 1GSDA 2WULA 4IBPA 3H4KA 1V2AA 5CRHA 3ZLPA 3EVIA 3C1SA 13GSA 5E59A 1Y6EA 2KOKA 2L59A 3TKSC 4J57E 1A23A 2IFQB 4L5OA 5DDLA 4MJCA 4TN8A 1FVKA 1F9MA 3TOUA 2HRNA 2I3YA 4DSQA 4K7OA 3KM6A 1S3AA 3IOSA 4OD7A 3TRXA 1PD21 2LJKA 6GSXA 4ZBAA 3WGDA 1SJZA 3TKSA 1WOUA 4K0GA 3L78A 2H1AA 5GSSA 1G0TA 4BL7A 5J47A 5CYYA 1K0NA 4JR4A 2VLVA 2X8GA 3HZ8A 3MWHA 2LKUA 2V32A 2YWNA 1OC8A 2YV9A 2R0GA 1GTIA 4PHZC 3TCOA 3IDVA 4K1FA 3GTUB 3Q6OA 4BWQA 1Y1UA 2DJ0A 3HD5A 2OBKA 3RPNA 7GSSA 4YKFA 1VF2A 2XBQA 3D5JA 1FO5A 4IKHA 3A5IA 16GSA 3GA4A 4ZL7A 9GSSA 4ECCA 1HNAA 4FYBA 4NV2A 2VLTA 4MF6A 1V9WA 2H0GA 3KH7A 1SJIA 3IC4A 3UEMA 4V1Ag 3SBCA 4HJMA 1TK8B 4OCFA 4DVCA 4V2LA 4Z7XA 1DUGA 4AKGA 4ZB8A 2OJLA 5A1NA 4ML1A 1XVWA 1Z6MA 2FWGA 5LCZA 3EWLA 3GH6A 3A2VA 4OFTA 1HYUA 3EU4A 3RHBA 3UMAA 3D22A 4NWYA 1LBKA 2LNSA 2YNXA 2LRCA 1K0OA 2V1MA 4TKYA 3TKRA 2N5BA 4I5QA 2FWEA 4MJEA 1SYRA 4KDYA 2OACA 2O85A 3CBUA 5ECOB 1SD9A 3KZQA 4TXVA 2WW0A 1YJ6A 1EV9A 1OC9B 3IA1A 4HJ2A 6GSYA 1M3JA 4KF9A 5G1KA 1TRUA 2EIOA 5L71A 4E8EA 2QSIA 4TR0A 4DSSB 5DVBA 1M2DA 4ZXGA 2H66A 2WFCA 1M99A 1USBA 3ZTLA 4YQUA 1Z7PA 3C7MA 3APSA 3UAPA 1A8YA 2FWHA 2F51A 1JFUA 2TRCP 3GH9A 1J9BA 5B8BA 1GLPA 3QAVA 1M9BA 2VD1A 1N2AA 3DEXA 3FK8A 5CRGA 4WXTA 4HZ2A 11GSA 1GSQA 1FVJA 2DC5A 2ZNMA 1G6WA 4PUAA 2HSMB 4FYUA 4HDEA 1AUCA 3U6VA 4BA7A 1QQ2A 3IHQA 3GKXA 3GFKA 1TU7A 1Y25A 3CXGA 4GRFA 3FW2A 4WF4A 1A0RP 1HNCA 4POLA 3GKMA 4AI6A 3FYGA 3RFRC 1X5CA 3KIJA 1HNBA 2CX3A 2MYGA 3UARA 4NXIA 2MMZA 1T7PB 5ECNB 4WR5A 1GNEA 2CZ2A 4KAEA 5CP1A 2LS5A 1XW9A 3KEBA 2GZYA 2LTKA 4KSMA 1OC9A 3CMIA 1WPIA 2AUVA 2NPBA 4EF0A 3O6TA 5A4UA 4DSSA 1PKWA 3KXOA 3VFIA 1EZKA 2LEGA 3APOA 3M9JA 2VO4A 4I6XA 3RPPA 3LWAA 4K5SA 3I69A 1WIKA 1LJRA 4LMWA 1XCCA 4XS1A 5F07A 3VWWA 4LLRA 2MBSA 2JZRA 1PSQA 4AGSA 5D8IA 2GSRA 1A8LA 1MEKA 1ZYPA 2GS3A 1XVQA 3KD0A 5IPHA 3LYPA 2B3SA 5B6NA 4K2DA 2FWFA 2XPDA 3MDKA 1VRSD 1A2JA 4XCSA 1SVOA 5J41A 4LL4B 3D0ZA 5H5SA 2P5QA 4KA0A 1NHYA 2OADA 2LJAA 5ECQB 3W8SA 1Q4JA 2HSMA 1GP1A 3L9VA 2WW2A 1YDKA 1EWXA 4XS6A 1N8JA 1FB0A 2OKAA 5JCWA 2REMA 3UVTA 2C80A 1XWBA 3CSIA 4KDUA 1QFNA 5DBQA 4K7IA 3TKQA 4GSNA 1B48A 3QD9A 2R37A 4AKXB 2JZTA 2HSNB 2EIQA 4PUFC 2HNLA 3TOTA 4MDCA 2GTUA 4QL7A 2O5VA 5DJLA 2EFEA 4GSSA 3E0UA 1T3BA 4N0VA 2EFHA 1G6YA 3IXRA 3LXTA 4HQZA 3UBKA 3O3TA 2R0PA 3QCPA 4G01A 1ZMAA 2LNTA 5GZZB 1T4YA 1X5EA 4ECJA 3M3MA 3F4SA 1NHOA 5A5HA 1ON4A 4ID0A 4L8EA 2VCTA 3UVHA 5A34A 2QKEA 3QDNA 1KTEA 1M2AA 5ELAA 2XBIA 1DSBA 5BMUB 4IQAA 1UN2A 2WVYA 3KCMA 2F8FA 4RUVA 2OE3A 4WBJA 4KSOA 4ECBA 3CRTA 3GSTA 2EIRA 2K18A 4MNNA 5IMFA 2X8CA 3VWUA 4ZB6A 4ACSA 4MLYA 1PKZA 3A3TA 3LQ7A 4KDXA 4XRDA 2ON5A 2HRFA 4FO5A 1HD2A 5D9VA 3FR3A 2H19A 4XS4B 4KUNA 17GSA 1SYXA 3GHAA 1ZYNA 1BF5A 2B1LA 3UIWA 1HQOA 1R26A 3FRCA 1B9XC 4CY8A 3I9V2 2R2JA 4V2NA 1PA3A 3Q19A 1MDJA 1JZDA 3NOFA 1J08A 1JLWA 3JCML 4AKIA 2HSNA 3E3EA 3HVXA 2IMKA 3F8UA 3WGEA 2F8AA 5H5QA 4L5LA 5J4UA 5JWRB 1K0MA 4X43A 4G0KA 1BX9A 3D4TA 3IC8A 2VL9A 3TU3B 2DLXA 2JSZA 1UC7A 2WCIA 1GSSA 2FY6A 4QMKA 3ERWA 5COHA 1GWCA 1S3RA 4QQ7A 2HRAA 3TRQA 2BTOT 2PVOC 2CAQA 5IIZA 1EEJA 1K3OA 4Z2TA 3F6FA 4GCIA 3GUSA 5DJMA 1KEBA 2HZFA 4KW6A 5DAKB 1T4ZA 1VF4A 2R6KA 1F37A 2JL4A 1NW2A 2GSSA 1I1IP 1K0CA 1BG1A 4RI7A 1Z6NA 5G30A 3O76A 2L4CA 1B4PA 4D73A 6GSVA 2OE0A 2PGTA 4OWYA 1QUWA 3N9JA 3US3A 4GQFA 1BG5A 3ZITA 1MTCA 4BWSA 3WT2A 1F3BA 4IP1A 1XWAA 3TUEA 4EUYA 5HFGA 3FHKA 4ECIA 1URMA 2GVPA 2BMXA 1G7EA 4NMUA 2GZZA 4G0LA 5B6MA 1PFOA 4L0WA 4OFMA 2V2GA 5AIXA 3ME7A 1ZGNA 4TW5A 4N11A 5HR3A 3VPTA 3F6DA 1V58A 2R0CA 1PN9A 2LJRA 3TJKA 1XIYA 3H1NA 5HQPA 2V6OA 3PR8A 18GSA 1WE0A 4MH2A 1TRVA 2WVZA 2C8UA 4POMA 3KP9A 1XOAA 2L57A 3F3RA 4N0ZA 1MDKA 1SKRB 3QAWA 1X9MB 5CO3A 2OE1A 5HR1A 1EV4A 4KGIA 1W89A 2KP1A 3TJFA 5D96A 3C8EA 2HSHA 3LYKA 1T1VA 3EURA 2B6MA 2H30A 2JZSA 1AW9A 2B5XA 4MH3A 2XPEA 2V6KA 5D9WA 3G7IA 1X9WB 4N3ZA 5KOXA 2J23A 2H75A 4IELA 1TRSA 5ECKB 4KNDA 1XWCA 2MMOA 4Q5NA 3Q74A 4DEJA 3LEFA 3ME8A 1TTZA 3DRNA 2DJ2A 3QFAC 4EDYA 3M9KA 3D21A 2O3EA 3DYRA 3L0HA 5IMVA 4ZB7A 1A2LA 3BOAA 2GT5A 1CQHA 3EPTA 2OT3A 2DSAA 4GF0A 2C0DA 2YJHA 3R2QA 3F4RA 1QXHA 1UA5A 3ZREA 4F0CA 1QK8A 3LJRA 1EP7A 5BRTA 1ML6A 4F0BA 1Q98A 2X64A 1PN0A 4LMVA 2JU5A 4GWRA 3BCIA 4FYCA 4PI2C 2YWMA 4TVEA 2QC7A 3EC3A 1ERUA 1XWKA 2GDRA 2WZSA 4IVFA 1ABAA 2FCHA 1PX7A 3ZIJA 2PN8A 3IK9A 4PXOA 1ZL9A 4PGTA 4YH2A 3TJJA 4JZQA 1GUKA 5AIVA 1SK1A 2IFQA 2FHEA 4ULXA 4EDZA 1TK5B 2K8VA 6GSWA 4V1Ap 4IN0A 4X1UA 4PQIA 2GZPA 2B7JA 1VF1A 1AAZA 3KTLA 3DVXA 3BBYA 4KE3A 2C0GA 1AIUA 2WVXB 3KH9A 3FMWA 4XTSA 1N25A 2PUKC 3DD3A 3HVNA 5JCGA 1TDIA 4BIKA 2YOIA 2VCWA 1U6TA 4NHWA 2FD3A 2HYXA 2MZCA 1ERWA 4MMMA 3CTGA 5G5FA 3WT1A 3F3QA 1SL0B 1YEPA 3FY7A 2VCZA 5A4WA 3RDWA 3KMNA 3GX0A 5KN2A 2DJKA 2O89A 1K0AA 5JWOB 3MSZA 3GTUA 2NBSA 1RW1A 2PVQA 1X0RA 4OMVA 4NAXA 3W6GA 2ZUPA 2YPMA 2L6DA 2DKHA 1XWGA 1OE7A 1ZCPA 5DQSA 2PBJA 2ES7A 4IGJA 2YCDA 2EFDA 1OKDA 2MMNA 2VM2A 1XOBA 5IMDA 1EEMA 3L4NA 1M9AA 3KJYA 4WETA 3LFLA 1SENA 2P5RA 4TXOB 2CT6A 5HR2A 1YKAA 1XW6A 2V41A 1MD4A 1XPVA 1THOA 2DJJA 4K5RA 1IYIA 4H86A 1AXDA 3ZZXA 4KB3A 2GQLA 3DKSA 1BYEA 2QGVA 4YQMA 2VKZG 4USSA 2WVXA 5IMCA 2CVDA 5IM9A 1JZOA 1YEXA 1R4WA 2DJ3A 2LRNA 2L4QA 4IQ1A 1ZZYA 2I81A 4DSRA 5IO2A 1JZRA 5KN3A 3LG6A 1FOHA 3QR6A 3FZ5A 2AYTA 5ECSA 2A4HA 4G10A 5JWQB 2I9HA 3C1RA 4XHMA 1SL2B 1SK0A 3BCKA 8GSSA 4PQ1A 5KEJA 3ERFA 1O7UA 2G0FA 3PPUA 1ERVA 3C71A 3LGCA 1GULA 2H6XA 3GN3A 3WYWA 5A5KA 2L6CA 5ECLB 2KLXA 1TKDB 1U87A 3VK9A 3FR9A 1BJXA 1QGVA 5IMZA 1GTBA 1C72A 3GX8A 1SD8A 2C0FA 1XG8A 3HJOA 2AHEA 1PX6A 3PINA 4HZ4A 1TI3A 5D93A 3FZ4A 1FB6A 3H79A 2JADA 3ZYWA 4OO5A 1TU8A 2RLIA 1GTAA 3PGTA 2WRTA 4KX4A 5EL8A 4HU7A 2C3QA 2C3NA 1V40A 1ZYEA 1GH2A 1O85A 1YF1A 4EC0A 1W4VA 2HQTA 4ZBBA 3UJ1A 2FUG2 4A5PA 4AJ6A 3M8NA 1K0DA 1XW5A 5AGYA 3SWLA 4AJ7A 3UOMA 3G9BA 4CHSA 1THXA 4I8BA 1PGTA 5KN1A 3A2XA 2HE3A 4CDOA 3GYKA 4BPYA 3ED3A 1O6JA 2VOCA 4F82A 1A0FA 3IRAA 2P0GA 1J0FA 1GSEA 1FHEA 1NM3A 5DQYA 2NTOA 4IP6A 3CQFA 3KMOA 4BVXB 1QMVA 2D2ZA 2H70A 5EY6A 3KGKA 1KNGA 3TJGA 3GSSA 4Z2UA 3HVSA 3GKKA 3HJPA 1AQVA 5ELGA 3RGBC 2M72A 2TRXA 3D6IA 4I2TA 14GSA 4MZWA 4LL1B 2YV7A 1WRYA 2VCVA 2YJ7A 4FXYP 3VI7A 4F2IA 3IAS2 5J5NA 2HFDA 2PWJA 2E0QA 2CX4A 3HMJG 4LA1A 4XRAA 1ERTA 2VL3A 3H93A 2MBTA 2A2RA 3GL5A 2HZEB 5LNKe 1YKCA 3P8WA 2C1YA 3BD2A 4MABA 4HEA2 2K6VA 1H4OA 5HR0A 2I4AA 2AAWA 4K8MA 1M3IA 1K0BA 1Z7RA 1PMTA 4AKHA 3CSJA 1GL8A 2VCQA 4GQCA 4GTUA 5DALB 1TW9A 1ZOFA 4BVYB 4POBA 5F05A 1TXXA 2RUFA 2LQOA 3HJMA 2CA8A 4MF7A 3MAKA 5ABRA 2CAIA 4EIPA 2RIIA 3S9FA 2IMEA 5E4WA 4PQHA 5HFIA 2GLRA 4MP4A 2HXKA 4IS0A 2DBCA 3GKNA 3F63A 2KHPA 2HRKB 3KTBA 2H0IA 1XFLA 5ECPB 1BAYA 2FA4A 1U88A 4MA9A 4K0NA 3FZAA 5FHIA 4QL9A 3CHXC 4WKWA 5BMUA 4IJ3A 3ZVJD 1EOHA 4PURA 6GSTA 4JRRA 1SU9A 4MPGA 3P7XA 1AQWA 4O5RA 2YZHA 2H76A 1VF3A 5INYA 2B5EA 1YF0A 2WB9A 3ISOA 3ZIVA 3IHGA 2GGTA 5CREA 3HCZA 4XS4A 5CAXA 3MIXA 2C0EA 4MPFA 3HY2A 2GT6A 2WDUA 2VD0A 5HFKA 3ERGA 5DALA 2X49A 5C04A 4BVYA 3WGXA 2I1UA 5EPFA 4IJIA 5CRWA 3TGZA 5LD0A 1FAAA 4AJ8A 5ECMB 4ML6A 2WW3A 2IIYA 4K7NA 4O5QA 3UBLA 2VLUA 1OAZA 1ILOA 5F0GA 3EMPA 3MYDA 1KBNA 2JACA 4AF2A 4KCEA 1OE8A 2IMFA 2A4VA 4JE1A 2HRKA 2CV4A 1MDIA 4IHUA 2L5OA 1K3YA 4ILFA 3F9UA 4YAPA 3WD6A 2VUPA 1S3CA 5J9CA 1O8XA 5AISA 4HU9A 4MCUA 3CWGA 2YZUA 2QA2A 1GSUA 2H72A 4O32A 3LSZA 2L5LA 2ZCTA
chains in the Genus database with same CATH topology
2RM5A 3C73A 3G7YA 4EO3A 2FA8A 4Q5FA 1SVLA 3HA9A 1O73A 2H6YA 1I9DA 5IOXA 3H8QA 3VI5A 3HZ4A 5DAKA 4XIHA 5DCHA 3Q18A 5B7CA 5G1LA 1GLQA 1B4QA 1T8EB 3HDCA 4GLTA 4EXJA 3DWVA 4I2UA 2K8SA 1F2EA 1GTUA 5A1NB 2H71A 4ZB9A 1M7TA 2UZ8A 4E8HA 5KOWA 2N5FA 1JZWA 1M0UA 2CVKA 20GSA 4F9ZA 2K9FA 3G7JA 1GUHA 2C3TA 5F06A 4NPBA 3A2WA 5IO0A 2XHFA 1OC3A 4ZILA 1WWJA 1EP8A 1TI1A 2YANA 5KN0A 4EKZA 5D73A 3IPZA 1SKSB 1DE1A 5FT3A 2DJ1A 2OBIA 2IN3A 2BJXA 1SVMA 3FR6A 4EIQA 1K3LA 1X5DA 1V57A 3IR4A 4MJBA 2FGXA 3V1WA 5IQYA 1TXUA 19GSA 1O8WA 2CVBA 3PH9A 5J4VA 1PL2A 6GSUA 2IPAA 4TR3A 3ZFLA 2DIZA 2EC4A 1EGRA 1BQ7A 2LV3A 4GDFA 5C00A 2X8HA 4CW9A 3QOUA 2GQKA 2DMLA 4X0XA 1A24A 3I6AA 3FKFA 5JCUA 3VPQA 1B9YC 2IMIA 3EMXA 1GSFA 3RAZA 5ID2B 3GIXA 1R5PA 3KP8A 1PQNA 3TKPA 4K9ZA 2G2QA 4MJAA 1YY7A 2H01A 3TB2A 3CYNA 4L0UA 1SJ6A 3ZRDA 2HI7A 1VGLA 3CSHA 2KP2A 1OVNA 4P3YB 2R3XA 3I43A 2UV8G 1SK2A 1O81A 2H8LA 2WGRA 3IK7A 2H73A 4GSTA 1A2MA 3ZMKA 2MMAA 2P31A 4RI6A 3VLNA 1GSYA 22GSA 3GRXA 1H75A 4G9HA 3HKRA 2LUSA 4TOPA 2PPTA 2YN1A 4OFNA 2TIRA 3EE2A 4MF5A 3BJ5A 2IL3A 3HHVA 3VWXA 2FLSA 3NIVA 3CRUA 3TJBA 3RBTA 3TKSE 3VURA 1ACVA 2GQMA 1WP0A 2PU9C 2PMTA 1Z5YE 4PNGA 2F9SA 4ZL8A 2OA7A 1OYJA 3EYTA 4O7HA 3VWVA 2GSQA 3QPMA 5DCGA 3GMFA 2CQ9A 4V2MA 1PL1A 1E6BA 1TRWA 3NZNA 5ID2A 4TR4A 1XXUA 1YQ1A 2LQQA 5G2ZA 5J3RA 2H0HA 5B8AA 2YP6A 2JSYA 1FOVA 5G5EA 2F3MA 4O92A 10GSA 4YAVA 2AB6A 5IMAA 1X9SB 3L9SA 1WMJA 5ENUA 3U5RE 1F6MC 1TJDA 4MZBA 2H74A 3FEUA 3ZFBA 4PX1A 4MZCA 1YVLA 5IOWA 1G7OA 1DBYA 5EVOA 1E2YA 4HUAA 2AJQB 4JU5A 4JEDA 3R3EA 2H6ZA 1U3AA 2X99A 1AQXA 2NVLA 4POKA 1RQMA 5A5HB 5J4YA 3UL3A 5A34B 3M1GA 1SKWB 4K6XA 4TRXA 3J7Yb 2R4VA 1EOGA 4TXOA 4PNFA 1TP9A 4FQUA 1GUMA 3GL3A 2IMDA 5J9BA 2DIYA 3E9JB 4MK3A 4G19A 4GXZA 4OCEA 3FZ9A 4KH7A 3L9UA 4HS1A 2FNOA 4YQVA 2VAFA 4G0IA 4K2XA 3P2AA 2E2MA 4ZL9A 1SL1B 1IYHA 3DVWA 4ZIJA 6GSSA 2H1DA 1ZYQB 1R5AA 2M80A 1DE2A 3IBHA 4EVMA 2R5GA 3DGQA 4W66A 5FWGA 2N5AA 1TOFA 4RQXA 3QMXA 3LW9A 4Z2RA 1GRXA 3AY8A 3ZMLA 4TR1B 1F3AA 3CTFA 3ZVJA 2NDOA 3LXZA 1S3DA 5J40A 2YWOA 1BEDA 4CY6A 1UVZA 1XBSA 2HSYA 3GNJA 1CQGA 2H1GA 3HYPA 2E7PA 3QAGA 2O8VB 1GNWA 3DIEA 3HXSA 4NHZA 2C4JA 2GSTA 1Z3EA 3J7Yk 1V98A 1FW1A 4HOJA 1ST9A 1AC1A 4Q5QA 3DXBA 1TK0B 1LU4A 3W8JA 4YKGA 4D73B 1WJKA 4G2EA 3D4MA 4X4JA 2WJUA 4WR4A 3EINA 5A4VA 4FH8A 2VL2C 4RQRA 3MNGA 1FG4A 5H5RA 4BVXA 1RK4A 5ECIB 3IE3A 2A2PA 2Z9SA 2ON7A 2LSTA 3IAM2 5ECRB 2M46A 5D9XA 2RUEA 4WEYA 4JBBA 3A5WA 3M0FA 2AV4A 2PERA 12GSA 1YZXA 4EE0A 5GSTA 4TR1A 2VL2A 5ECHB 3P90A 3N5OA 2VCXA 2KUCA 4F03A 2WZ9A 4KCAA 2IWTA 3QFBC 2WS2A 2DKIA 4J56E 1T00A 2YWIA 1R7HA 2E2GA 1U3IA 2HZEA 2J9HA 1NSWA 5IPGA 4OO4A 4WF5A 4IW9A 3DMLA 4O5UA 1OKTA 2CZ3A 1JLVA 3K8NA 3GURA 4HQSA 3TRPA 2VM1A 4FIWA 1I5GA 5GAPD 5AN1A 2O87A 2QA1A 5F8BA 4N30A 3GV1A 3ZL5A 2A2SA 2B1KA 1EGOA 2H1LA 3OR5A 2XC2A 4ICYA 4HI7A 1XZOA 5G31A 2DMMA 4N10A 4NV5A 2VIMA 3APQA 4ZBDA 4ISDA 4BL7B 4I97A 3F4TA 2RM6A 1PRXA 5CRDA 2HT9A 3LORA 2EFCA 4EL1A 5CNWA 2X4AA 5GAND 4JR6A 2LRTA 2H1BA 2HLSA 3IV4A 3EU3A 1B8XA 5D9TA 1Z9HA 2ALBA 4PTSA 4E68A 3F0IA 2B7KA 1MD3A 2O7KA 4WBRD 2B5YA 3TDGA 3HVVA 1JHBA 4Q5RA 4J2FA 2IJYA 1M2BA 3RHCA 1GSDA 2WULA 4IBPA 3H4KA 1V2AA 5CRHA 3ZLPA 3EVIA 3C1SA 13GSA 5E59A 1Y6EA 2KOKA 2L59A 3TKSC 4J57E 1A23A 2IFQB 4L5OA 5DDLA 4MJCA 4TN8A 1FVKA 1F9MA 3TOUA 2HRNA 2I3YA 4DSQA 4K7OA 3KM6A 1S3AA 3IOSA 4OD7A 3TRXA 1PD21 2LJKA 6GSXA 4ZBAA 3WGDA 1SJZA 3TKSA 1WOUA 4K0GA 3L78A 2H1AA 5GSSA 1G0TA 4BL7A 5J47A 5CYYA 1K0NA 4JR4A 2VLVA 2X8GA 3HZ8A 3MWHA 2LKUA 2V32A 2YWNA 1OC8A 2YV9A 2R0GA 1GTIA 3TCOA 3IDVA 4K1FA 3GTUB 3Q6OA 4BWQA 1Y1UA 2DJ0A 3HD5A 2OBKA 3RPNA 7GSSA 4YKFA 1VF2A 2XBQA 3D5JA 1FO5A 4IKHA 3A5IA 16GSA 3GA4A 4ZL7A 9GSSA 4ECCA 1HNAA 4FYBA 4NV2A 2VLTA 4MF6A 1V9WA 2H0GA 3KH7A 1SJIA 3IC4A 3UEMA 4V1Ag 3SBCA 4HJMA 1TK8B 4OCFA 4DVCA 4V2LA 4Z7XA 1DUGA 4AKGA 4ZB8A 2OJLA 5A1NA 4ML1A 1XVWA 1Z6MA 2FWGA 5LCZA 3EWLA 3GH6A 3A2VA 4OFTA 1HYUA 3EU4A 3RHBA 3UMAA 3D22A 4NWYA 1LBKA 2LNSA 2YNXA 2LRCA 1K0OA 2V1MA 4TKYA 3TKRA 2N5BA 4I5QA 2FWEA 4MJEA 1SYRA 4KDYA 2OACA 2O85A 3CBUA 5ECOB 1SD9A 3KZQA 4TXVA 1YJ6A 1EV9A 1OC9B 3IA1A 4HJ2A 6GSYA 4KF9A 5G1KA 1TRUA 2EIOA 5L71A 4E8EA 2QSIA 4TR0A 4DSSB 5DVBA 1M2DA 4ZXGA 2H66A 2WFCA 1M99A 1USBA 3ZTLA 4YQUA 1Z7PA 3C7MA 3APSA 3UAPA 1A8YA 2FWHA 2F51A 1JFUA 2TRCP 3GH9A 1J9BA 5B8BA 1GLPA 3QAVA 1M9BA 2VD1A 1N2AA 3DEXA 3FK8A 5CRGA 4WXTA 4HZ2A 11GSA 1GSQA 1FVJA 2DC5A 2ZNMA 1G6WA 4PUAA 2HSMB 4FYUA 4HDEA 1AUCA 3U6VA 4BA7A 1QQ2A 3IHQA 3GKXA 3GFKA 1TU7A 1Y25A 3CXGA 4GRFA 3FW2A 4WF4A 1A0RP 1HNCA 4POLA 3GKMA 4AI6A 3FYGA 1X5CA 3KIJA 1HNBA 2CX3A 2MYGA 3UARA 4NXIA 2MMZA 1T7PB 5ECNB 4WR5A 1GNEA 2CZ2A 4KAEA 5CP1A 2LS5A 1XW9A 3KEBA 2GZYA 2LTKA 4KSMA 1OC9A 3CMIA 1WPIA 2AUVA 2NPBA 4EF0A 3O6TA 5A4UA 4DSSA 1PKWA 3KXOA 3VFIA 1EZKA 2LEGA 3APOA 3M9JA 2VO4A 4I6XA 3RPPA 3LWAA 4K5SA 3I69A 1WIKA 1LJRA 4LMWA 1XCCA 4XS1A 5F07A 3VWWA 4LLRA 2MBSA 2JZRA 1PSQA 4AGSA 5D8IA 2GSRA 1A8LA 1MEKA 1ZYPA 2GS3A 1XVQA 3KD0A 5IPHA 3LYPA 2B3SA 5B6NA 4K2DA 2FWFA 2XPDA 3MDKA 1VRSD 1A2JA 4XCSA 1SVOA 5J41A 4LL4B 3D0ZA 5H5SA 2P5QA 4KA0A 1NHYA 2OADA 2LJAA 5ECQB 3W8SA 1Q4JA 2HSMA 1GP1A 3L9VA 1EWXA 1YDKA 4XS6A 1N8JA 1FB0A 2OKAA 5JCWA 2REMA 3UVTA 2C80A 1XWBA 3CSIA 4KDUA 1QFNA 5DBQA 4K7IA 3TKQA 4GSNA 1B48A 3QD9A 2R37A 4AKXB 2JZTA 2HSNB 2EIQA 4PUFC 2HNLA 3TOTA 4MDCA 2GTUA 4QL7A 2O5VA 5DJLA 2EFEA 4GSSA 3E0UA 1T3BA 4N0VA 2EFHA 1G6YA 3IXRA 3LXTA 4HQZA 3UBKA 3O3TA 2R0PA 3QCPA 4G01A 1ZMAA 2LNTA 5GZZB 1T4YA 1X5EA 4ECJA 3M3MA 3F4SA 1NHOA 5A5HA 1ON4A 4ID0A 4L8EA 2VCTA 3UVHA 5A34A 2QKEA 3QDNA 1KTEA 1M2AA 5ELAA 2XBIA 1DSBA 5BMUB 4IQAA 1UN2A 3KCMA 2F8FA 4RUVA 2OE3A 4WBJA 4KSOA 4ECBA 3CRTA 3GSTA 2EIRA 2K18A 4MNNA 5IMFA 2X8CA 3VWUA 4ZB6A 4ACSA 4MLYA 1PKZA 3A3TA 3LQ7A 4KDXA 4XRDA 2ON5A 2HRFA 4FO5A 1HD2A 5D9VA 3FR3A 2H19A 4XS4B 4KUNA 17GSA 1SYXA 3GHAA 1ZYNA 1BF5A 2B1LA 3UIWA 1HQOA 1R26A 3FRCA 1B9XC 4CY8A 3I9V2 2R2JA 4V2NA 1PA3A 3Q19A 1MDJA 1JZDA 3NOFA 1J08A 1JLWA 3JCML 4AKIA 2HSNA 3E3EA 3HVXA 2IMKA 3F8UA 3WGEA 2F8AA 5H5QA 4L5LA 5J4UA 5JWRB 1K0MA 4X43A 4G0KA 1BX9A 3D4TA 3IC8A 2VL9A 3TU3B 2DLXA 2JSZA 1UC7A 2WCIA 1GSSA 2FY6A 4QMKA 3ERWA 5COHA 1GWCA 4QQ7A 2HRAA 3TRQA 2BTOT 2PVOC 2CAQA 5IIZA 1EEJA 1K3OA 4Z2TA 3F6FA 4GCIA 3GUSA 5DJMA 1KEBA 2HZFA 4KW6A 5DAKB 1T4ZA 1VF4A 2R6KA 1F37A 2JL4A 1NW2A 2GSSA 1K0CA 1BG1A 4RI7A 1Z6NA 5G30A 3O76A 2L4CA 1B4PA 4D73A 6GSVA 2OE0A 2PGTA 4OWYA 1QUWA 3N9JA 3US3A 4GQFA 1BG5A 3ZITA 1MTCA 4BWSA 3WT2A 1F3BA 4IP1A 1XWAA 3TUEA 4EUYA 5HFGA 3FHKA 4ECIA 1URMA 2GVPA 2BMXA 1G7EA 4NMUA 2GZZA 4G0LA 5B6MA 4L0WA 4OFMA 2V2GA 5AIXA 3ME7A 1ZGNA 4TW5A 4N11A 5HR3A 3VPTA 3F6DA 1V58A 2R0CA 1PN9A 2LJRA 3TJKA 1XIYA 3H1NA 5HQPA 2V6OA 3PR8A 18GSA 1WE0A 4MH2A 1TRVA 2C8UA 4POMA 3KP9A 1XOAA 2L57A 3F3RA 4N0ZA 1MDKA 1SKRB 3QAWA 1X9MB 5CO3A 2OE1A 5HR1A 1EV4A 4KGIA 1W89A 2KP1A 3TJFA 5D96A 3C8EA 2HSHA 3LYKA 1T1VA 3EURA 2B6MA 2H30A 2JZSA 1AW9A 2B5XA 4MH3A 2XPEA 2V6KA 5D9WA 3G7IA 1X9WB 4N3ZA 5KOXA 2J23A 2H75A 4IELA 1TRSA 5ECKB 4KNDA 1XWCA 2MMOA 4Q5NA 3Q74A 4DEJA 3LEFA 3ME8A 1TTZA 3DRNA 2DJ2A 3QFAC 4EDYA 3M9KA 3D21A 3DYRA 3L0HA 5IMVA 4ZB7A 1A2LA 3BOAA 2GT5A 1CQHA 3EPTA 2OT3A 2DSAA 4GF0A 2C0DA 2YJHA 3R2QA 3F4RA 1QXHA 1UA5A 3ZREA 4F0CA 1QK8A 3LJRA 1EP7A 5BRTA 1ML6A 4F0BA 1Q98A 2X64A 1PN0A 4LMVA 2JU5A 4GWRA 3BCIA 4FYCA 4TVEA 2YWMA 2QC7A 3EC3A 1ERUA 1XWKA 2GDRA 4IVFA 1ABAA 2FCHA 1PX7A 3ZIJA 2PN8A 3IK9A 4PXOA 1ZL9A 4PGTA 4YH2A 3TJJA 4JZQA 1GUKA 5AIVA 1SK1A 2IFQA 2FHEA 4ULXA 4EDZA 1TK5B 2K8VA 6GSWA 4V1Ap 4IN0A 4X1UA 4PQIA 2GZPA 2B7JA 1VF1A 1AAZA 3KTLA 3DVXA 3BBYA 4KE3A 2C0GA 1AIUA 3KH9A 3FMWA 4XTSA 1N25A 2PUKC 3DD3A 5JCGA 1TDIA 2YOIA 2VCWA 1U6TA 4NHWA 2FD3A 2HYXA 2MZCA 1ERWA 4MMMA 3CTGA 5G5FA 3WT1A 3F3QA 1SL0B 1YEPA 3FY7A 2VCZA 5A4WA 3RDWA 3KMNA 3GX0A 5KN2A 2DJKA 2O89A 1K0AA 5JWOB 3MSZA 3GTUA 2NBSA 1RW1A 2PVQA 1X0RA 4OMVA 4NAXA 3W6GA 2ZUPA 2YPMA 2L6DA 2DKHA 1XWGA 1OE7A 1ZCPA 5DQSA 2PBJA 2ES7A 4IGJA 2YCDA 2EFDA 1OKDA 2MMNA 2VM2A 1XOBA 5IMDA 1EEMA 3L4NA 1M9AA 3KJYA 4WETA 3LFLA 1SENA 2P5RA 4TXOB 2CT6A 5HR2A 1YKAA 1XW6A 2V41A 1MD4A 1XPVA 1THOA 2DJJA 4K5RA 1IYIA 4H86A 1AXDA 3ZZXA 4KB3A 2GQLA 3DKSA 1BYEA 2QGVA 4YQMA 2VKZG 4USSA 5IMCA 2CVDA 5IM9A 1JZOA 1YEXA 1R4WA 2DJ3A 2LRNA 2L4QA 4IQ1A 1ZZYA 2I81A 4DSRA 5IO2A 1JZRA 5KN3A 3LG6A 1FOHA 3QR6A 3FZ5A 2AYTA 5ECSA 2A4HA 4G10A 5JWQB 2I9HA 3C1RA 4XHMA 1SL2B 1SK0A 3BCKA 8GSSA 4PQ1A 5KEJA 3ERFA 1O7UA 2G0FA 3PPUA 1ERVA 3C71A 3LGCA 1GULA 2H6XA 3GN3A 3WYWA 5A5KA 2L6CA 5ECLB 2KLXA 1TKDB 1U87A 3VK9A 3FR9A 1BJXA 1QGVA 5IMZA 1GTBA 1C72A 3GX8A 1SD8A 2C0FA 3HJOA 2AHEA 1PX6A 3PINA 4HZ4A 1TI3A 5D93A 3FZ4A 1FB6A 3H79A 2JADA 3ZYWA 4OO5A 1TU8A 2RLIA 1GTAA 3PGTA 2WRTA 4KX4A 5EL8A 4HU7A 2C3QA 2C3NA 1V40A 1ZYEA 1GH2A 1O85A 1YF1A 4EC0A 1W4VA 2HQTA 4ZBBA 3UJ1A 2FUG2 4A5PA 4AJ6A 3M8NA 1K0DA 1XW5A 5AGYA 3SWLA 4AJ7A 3UOMA 3G9BA 4CHSA 1THXA 4I8BA 1PGTA 5KN1A 3A2XA 2HE3A 4CDOA 3GYKA 4BPYA 3ED3A 1O6JA 2VOCA 4F82A 1A0FA 3IRAA 2P0GA 1J0FA 1GSEA 1FHEA 1NM3A 5DQYA 2NTOA 4IP6A 3KMOA 4BVXB 1QMVA 2D2ZA 2H70A 5EY6A 3KGKA 1KNGA 3TJGA 3GSSA 4Z2UA 3HVSA 3GKKA 3HJPA 1AQVA 5ELGA 2M72A 2TRXA 3D6IA 4I2TA 14GSA 4MZWA 4LL1B 2YV7A 1WRYA 2VCVA 2YJ7A 3VI7A 4F2IA 3IAS2 5J5NA 2HFDA 2PWJA 2E0QA 2CX4A 3HMJG 4LA1A 4XRAA 1ERTA 2VL3A 3H93A 2MBTA 2A2RA 3GL5A 2HZEB 5LNKe 1YKCA 3P8WA 2C1YA 3BD2A 4MABA 4HEA2 2K6VA 1H4OA 5HR0A 2I4AA 2AAWA 4K8MA 1K0BA 1Z7RA 1PMTA 4AKHA 3CSJA 1GL8A 2VCQA 4GQCA 4GTUA 5DALB 1TW9A 1ZOFA 4BVYB 4POBA 5F05A 1TXXA 2RUFA 2LQOA 3HJMA 2CA8A 4MF7A 3MAKA 5ABRA 2CAIA 4EIPA 2RIIA 3S9FA 2IMEA 5E4WA 4PQHA 5HFIA 2GLRA 4MP4A 2HXKA 4IS0A 2DBCA 3GKNA 3F63A 2KHPA 2HRKB 3KTBA 2H0IA 1XFLA 5ECPB 1BAYA 2FA4A 1U88A 4MA9A 4K0NA 3FZAA 5FHIA 4QL9A 4WKWA 5BMUA 4IJ3A 3ZVJD 1EOHA 4PURA 6GSTA 4JRRA 1SU9A 4MPGA 3P7XA 1AQWA 4O5RA 2YZHA 2H76A 1VF3A 5INYA 2B5EA 1YF0A 2WB9A 3ISOA 3ZIVA 3IHGA 2GGTA 5CREA 3HCZA 4XS4A 5CAXA 3MIXA 2C0EA 4MPFA 3HY2A 2GT6A 2WDUA 2VD0A 5HFKA 3ERGA 5DALA 2X49A 5C04A 4BVYA 3WGXA 2I1UA 5EPFA 4IJIA 5CRWA 3TGZA 5LD0A 1FAAA 4AJ8A 5ECMB 4ML6A 4K7NA 2IIYA 4O5QA 3UBLA 2VLUA 1OAZA 1ILOA 5F0GA 3EMPA 3MYDA 1KBNA 2JACA 4AF2A 4KCEA 1OE8A 2IMFA 2A4VA 4JE1A 2HRKA 2CV4A 1MDIA 4IHUA 2L5OA 1K3YA 4ILFA 3F9UA 4YAPA 3WD6A 2VUPA 1S3CA 5J9CA 1O8XA 5AISA 4HU9A 4MCUA 3CWGA 2YZUA 2QA2A 1GSUA 2H72A 4O32A 3LSZA 2L5LA 2ZCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RM5 A;  3C73 A;  3G7Y A;  4EO3 A;  2FA8 A;  4Q5F A;  3HA9 A;  1O73 A;  2H6Y A;  1I9D A;  5IOX A;  3H8Q A;  3VI5 A;  3HZ4 A;  5DAK A;  4XIH A;  5DCH A;  3Q18 A;  5B7C A;  5G1L A;  1GLQ A;  1B4Q A;  1T8E B;  3HDC A;  4GLT A;  4EXJ A;  3DWV A;  4I2U A;  2K8S A;  1F2E A;  1GTU A;  2H71 A;  4ZB9 A;  1M7T A;  2UZ8 A;  4E8H A;  2N5F A;  1JZW A;  1M0U A;  2CVK A;  20GS A;  4F9Z A;  2K9F A;  3G7J A;  1GUH A;  2C3T A;  5F06 A;  4NPB A;  3A2W A;  5IO0 A;  2XHF A;  1OC3 A;  4ZIL A;  1WWJ A;  1EP8 A;  1TI1 A;  2YAN A;  5KN0 A;  4EKZ A;  5D73 A;  3IPZ A;  1SKS B;  1DE1 A;  5FT3 A;  2DJ1 A;  2OBI A;  2IN3 A;  2BJX A;  3FR6 A;  1K3L A;  1X5D A;  1V57 A;  3IR4 A;  4MJB A;  2FGX A;  3V1W A;  5IQY A;  19GS A;  1O8W A;  2CVB A;  3PH9 A;  1PL2 A;  6GSU A;  2IPA A;  4TR3 A;  3ZFL A;  2DIZ A;  2EC4 A;  1EGR A;  1BQ7 A;  2LV3 A;  5C00 A;  2X8H A;  4CW9 A;  3QOU A;  2GQK A;  2DML A;  4X0X A;  1A24 A;  3I6A A;  3FKF A;  5JCU A;  3VPQ A;  1B9Y C;  2IMI A;  3EMX A;  1GSF A;  3RAZ A;  5ID2 B;  3GIX A;  1R5P A;  3KP8 A;  1PQN A;  3TKP A;  4K9Z A;  2G2Q A;  4MJA A;  1YY7 A;  2H01 A;  3TB2 A;  3CYN A;  4L0U A;  1SJ6 A;  3ZRD A;  2HI7 A;  1VGL A;  3CSH A;  2KP2 A;  1OVN A;  4P3Y B;  2R3X A;  3I43 A;  1SK2 A;  1O81 A;  2H8L A;  2WGR A;  3IK7 A;  2H73 A;  4GST A;  1A2M A;  3ZMK A;  2MMA A;  2P31 A;  4RI6 A;  3VLN A;  1GSY A;  22GS A;  3GRX A;  1H75 A;  4G9H A;  3HKR A;  2LUS A;  4TOP A;  2PPT A;  2YN1 A;  4OFN A;  2TIR A;  3EE2 A;  4MF5 A;  3BJ5 A;  2IL3 A;  3HHV A;  3VWX A;  2FLS A;  3NIV A;  3CRU A;  3TJB A;  3RBT A;  3TKS E;  3VUR A;  1ACV A;  2GQM A;  1WP0 A;  2PU9 C;  2PMT A;  1Z5Y E;  4PNG A;  2F9S A;  4ZL8 A;  2OA7 A;  1OYJ A;  3EYT A;  4O7H A;  3VWV A;  2GSQ A;  3QPM A;  5DCG A;  3GMF A;  2CQ9 A;  4V2M A;  1PL1 A;  1E6B A;  1TRW A;  3NZN A;  5ID2 A;  4TR4 A;  1XXU A;  1YQ1 A;  2LQQ A;  5G2Z A;  5J3R A;  2H0H A;  5B8A A;  2YP6 A;  2JSY A;  1FOV A;  5G5E A;  2F3M A;  4O92 A;  10GS A;  4YAV A;  2AB6 A;  5IMA A;  1X9S B;  3L9S A;  1WMJ A;  5ENU A;  3U5R E;  1F6M C;  1TJD A;  4MZB A;  2H74 A;  3FEU A;  3ZFB A;  4PX1 A;  4MZC A;  5IOW A;  1G7O A;  1DBY A;  5EVO A;  1E2Y A;  4HUA A;  2AJQ B;  4JU5 A;  4JED A;  3R3E A;  2H6Z A;  1U3A A;  2X99 A;  1AQX A;  2NVL A;  4POK A;  1RQM A;  3UL3 A;  3M1G A;  1SKW B;  4K6X A;  4TRX A;  3J7Y b;  2R4V A;  1EOG A;  4TXO A;  4PNF A;  1TP9 A;  4FQU A;  1GUM A;  3GL3 A;  2IMD A;  5J9B A;  2DIY A;  3E9J B;  4MK3 A;  4G19 A;  4GXZ A;  4OCE A;  3FZ9 A;  4KH7 A;  3L9U A;  4HS1 A;  2FNO A;  4YQV A;  2VAF A;  4G0I A;  3P2A A;  2E2M A;  4ZL9 A;  1SL1 B;  1IYH A;  3DVW A;  4ZIJ A;  6GSS A;  2H1D A;  1ZYQ B;  1R5A A;  2M80 A;  1DE2 A;  3IBH A;  4EVM A;  2R5G A;  3DGQ A;  5FWG A;  2N5A A;  1TOF A;  4RQX A;  3QMX A;  1GRX A;  3AY8 A;  3ZML A;  4TR1 B;  1F3A A;  3CTF A;  3ZVJ A;  2NDO A;  3LXZ A;  1S3D A;  2YWO A;  1BED A;  1UVZ A;  1XBS A;  2HSY A;  3GNJ A;  1CQG A;  2H1G A;  3HYP A;  2E7P A;  3QAG A;  2O8V B;  1GNW A;  3DIE A;  3HXS A;  4NHZ A;  2C4J A;  2GST A;  1Z3E A;  3J7Y k;  1V98 A;  1FW1 A;  4HOJ A;  1ST9 A;  1AC1 A;  4Q5Q A;  3DXB A;  1TK0 B;  1LU4 A;  3W8J A;  4D73 B;  1WJK A;  4G2E A;  3D4M A;  2WJU A;  4WR4 A;  3EIN A;  5A4V A;  4FH8 A;  2VL2 C;  4RQR A;  3MNG A;  1FG4 A;  5H5R A;  4BVX A;  1RK4 A;  5ECI B;  3IE3 A;  2Z9S A;  2ON7 A;  2LST A;  3IAM 2;  5ECR B;  2M46 A;  5D9X A;  2RUE A;  4WEY A;  4JBB A;  3A5W A;  3M0F A;  2AV4 A;  2PER A;  12GS A;  1YZX A;  4EE0 A;  5GST A;  4TR1 A;  2VL2 A;  5ECH B;  3P90 A;  3N5O A;  2VCX A;  2KUC A;  4F03 A;  2WZ9 A;  4KCA A;  2IWT A;  3QFB C;  2WS2 A;  4J56 E;  1T00 A;  2YWI A;  1R7H A;  2E2G A;  1U3I A;  2HZE A;  2J9H A;  1NSW A;  5IPG A;  4OO4 A;  4WF5 A;  4IW9 A;  3DML A;  1OKT A;  2CZ3 A;  1JLV A;  3K8N A;  3GUR A;  4HQS A;  3TRP A;  2VM1 A;  4FIW A;  1I5G A;  5GAP D;  5AN1 A;  2O87 A;  5F8B A;  4N30 A;  3GV1 A;  3ZL5 A;  2A2S A;  2B1K A;  1EGO A;  3OR5 A;  2XC2 A;  4HI7 A;  1XZO A;  5G31 A;  2DMM A;  4N10 A;  4NV5 A;  2VIM A;  3APQ A;  4ZBD A;  4ISD A;  4BL7 B;  4I97 A;  3F4T A;  2RM6 A;  1PRX A;  5CRD A;  2HT9 A;  3LOR A;  4EL1 A;  5CNW A;  5GAN D;  4JR6 A;  2LRT A;  2H1B A;  2HLS A;  3IV4 A;  3EU3 A;  1B8X A;  5D9T A;  1Z9H A;  2ALB A;  4PTS A;  3F0I A;  2B7K A;  1MD3 A;  2O7K A;  4WBR D;  2B5Y A;  3TDG A;  3HVV A;  1JHB A;  4Q5R A;  4J2F A;  2IJY A;  1M2B A;  3RHC A;  1GSD A;  2WUL A;  4IBP A;  3H4K A;  1V2A A;  5CRH A;  3ZLP A;  3EVI A;  3C1S A;  13GS A;  5E59 A;  1Y6E A;  2KOK A;  2L59 A;  3TKS C;  4J57 E;  1A23 A;  2IFQ B;  4L5O A;  5DDL A;  4MJC A;  4TN8 A;  1FVK A;  1F9M A;  3TOU A;  2HRN A;  2I3Y A;  4DSQ A;  4K7O A;  3KM6 A;  1S3A A;  3IOS A;  4OD7 A;  3TRX A;  1PD2 1;  2LJK A;  6GSX A;  4ZBA A;  3WGD A;  1SJZ A;  3TKS A;  1WOU A;  4K0G A;  3L78 A;  2H1A A;  5GSS A;  1G0T A;  4BL7 A;  5CYY A;  1K0N A;  4JR4 A;  2VLV A;  2X8G A;  3HZ8 A;  3MWH A;  2LKU A;  2V32 A;  2YWN A;  1OC8 A;  2YV9 A;  1GTI A;  3TCO A;  3IDV A;  4K1F A;  3GTU B;  3Q6O A;  4BWQ A;  2DJ0 A;  3HD5 A;  2OBK A;  3RPN A;  7GSS A;  1VF2 A;  2XBQ A;  3D5J A;  1FO5 A;  4IKH A;  16GS A;  3GA4 A;  4ZL7 A;  9GSS A;  4ECC A;  1HNA A;  4FYB A;  4NV2 A;  2VLT A;  4MF6 A;  1V9W A;  2H0G A;  3KH7 A;  1SJI A;  3IC4 A;  3UEM A;  4V1A g;  3SBC A;  4HJM A;  1TK8 B;  4OCF A;  4DVC A;  4V2L A;  4Z7X A;  1DUG A;  4ZB8 A;  2OJL A;  4ML1 A;  1XVW A;  1Z6M A;  2FWG A;  5LCZ A;  3EWL A;  3GH6 A;  3A2V A;  4OFT A;  1HYU A;  3EU4 A;  3RHB A;  3UMA A;  3D22 A;  4NWY A;  1LBK A;  2LNS A;  2YNX A;  2LRC A;  1K0O A;  2V1M A;  4TKY A;  3TKR A;  2N5B A;  4I5Q A;  2FWE A;  4MJE A;  1SYR A;  4KDY A;  2OAC A;  2O85 A;  3CBU A;  5ECO B;  1SD9 A;  3KZQ A;  4TXV A;  1YJ6 A;  1EV9 A;  1OC9 B;  3IA1 A;  4HJ2 A;  6GSY A;  4KF9 A;  5G1K A;  1TRU A;  2EIO A;  5L71 A;  4E8E A;  2QSI A;  4TR0 A;  4DSS B;  5DVB A;  1M2D A;  4ZXG A;  2H66 A;  2WFC A;  1M99 A;  1USB A;  3ZTL A;  4YQU A;  1Z7P A;  3C7M A;  3APS A;  3UAP A;  1A8Y A;  2FWH A;  2F51 A;  1JFU A;  2TRC P;  3GH9 A;  1J9B A;  5B8B A;  1GLP A;  3QAV A;  1M9B A;  2VD1 A;  1N2A A;  3DEX A;  3FK8 A;  5CRG A;  4WXT A;  4HZ2 A;  11GS A;  1GSQ A;  1FVJ A;  2DC5 A;  2ZNM A;  1G6W A;  4PUA A;  2HSM B;  4FYU A;  4HDE A;  1AUC A;  3U6V A;  4BA7 A;  1QQ2 A;  3IHQ A;  3GKX A;  3GFK A;  1TU7 A;  1Y25 A;  3CXG A;  4GRF A;  3FW2 A;  4WF4 A;  1A0R P;  1HNC A;  4POL A;  3GKM A;  3FYG A;  1X5C A;  3KIJ A;  1HNB A;  2CX3 A;  2MYG A;  3UAR A;  4NXI A;  2MMZ A;  1T7P B;  5ECN B;  4WR5 A;  1GNE A;  2CZ2 A;  4KAE A;  5CP1 A;  2LS5 A;  1XW9 A;  3KEB A;  2GZY A;  2LTK A;  4KSM A;  1OC9 A;  3CMI A;  1WPI A;  2AUV A;  2NPB A;  4EF0 A;  3O6T A;  5A4U A;  4DSS A;  1PKW A;  3KXO A;  3VFI A;  1EZK A;  2LEG A;  3APO A;  3M9J A;  2VO4 A;  4I6X A;  3RPP A;  3LWA A;  3I69 A;  1WIK A;  1LJR A;  4LMW A;  1XCC A;  4XS1 A;  5F07 A;  3VWW A;  4LLR A;  2MBS A;  2JZR A;  1PSQ A;  4AGS A;  5D8I A;  2GSR A;  1A8L A;  1MEK A;  2GS3 A;  3KD0 A;  1XVQ A;  5IPH A;  3LYP A;  2B3S A;  5B6N A;  4K2D A;  2FWF A;  2XPD A;  3MDK A;  1VRS D;  1A2J A;  4XCS A;  5J41 A;  4LL4 B;  3D0Z A;  5H5S A;  2P5Q A;  4KA0 A;  1NHY A;  2OAD A;  2LJA A;  5ECQ B;  3W8S A;  1Q4J A;  2HSM A;  1GP1 A;  3L9V A;  1EWX A;  1YDK A;  4XS6 A;  1N8J A;  1FB0 A;  2OKA A;  5JCW A;  2REM A;  3UVT A;  2C80 A;  1XWB A;  3CSI A;  4KDU A;  1QFN A;  5DBQ A;  4K7I A;  3TKQ A;  4GSN A;  1B48 A;  3QD9 A;  2R37 A;  2JZT A;  2HSN B;  2EIQ A;  4PUF C;  2HNL A;  3TOT A;  4MDC A;  2GTU A;  4QL7 A;  5DJL A;  4GSS A;  3E0U A;  1T3B A;  4N0V A;  1G6Y A;  3IXR A;  3LXT A;  4HQZ A;  3UBK A;  3O3T A;  3QCP A;  1ZMA A;  2LNT A;  5GZZ B;  1T4Y A;  1X5E A;  4ECJ A;  3M3M A;  3F4S A;  1NHO A;  1ON4 A;  4ID0 A;  4L8E A;  2VCT A;  3UVH A;  2QKE A;  3QDN A;  1KTE A;  1M2A A;  5ELA A;  2XBI A;  1DSB A;  4IQA A;  1UN2 A;  3KCM A;  2F8F A;  4RUV A;  2OE3 A;  4WBJ A;  4KSO A;  4ECB A;  3CRT A;  3GST A;  2EIR A;  2K18 A;  5IMF A;  2X8C A;  3VWU A;  4ZB6 A;  4ACS A;  4MLY A;  1PKZ A;  3A3T A;  3LQ7 A;  4KDX A;  4XRD A;  2ON5 A;  2HRF A;  4FO5 A;  1HD2 A;  5D9V A;  3FR3 A;  2H19 A;  4XS4 B;  4KUN A;  17GS A;  1SYX A;  3GHA A;  2B1L A;  3UIW A;  1HQO A;  1R26 A;  3FRC A;  1B9X C;  3I9V 2;  2R2J A;  4V2N A;  1PA3 A;  3Q19 A;  1MDJ A;  1JZD A;  3NOF A;  1J08 A;  1JLW A;  3JCM L;  3E3E A;  3HVX A;  2IMK A;  3F8U A;  3WGE A;  2F8A A;  5H5Q A;  4L5L A;  5J4U A;  5JWR B;  1K0M A;  4X43 A;  4G0K A;  1BX9 A;  3D4T A;  3IC8 A;  2VL9 A;  2DLX A;  2JSZ A;  1UC7 A;  2WCI A;  1GSS A;  2FY6 A;  3ERW A;  5COH A;  1GWC A;  4QQ7 A;  2HRA A;  3TRQ A;  2BTO T;  2PVO C;  2CAQ A;  5IIZ A;  1EEJ A;  1K3O A;  3F6F A;  4GCI A;  3GUS A;  5DJM A;  1KEB A;  2HZF A;  4KW6 A;  5DAK B;  1T4Z A;  1VF4 A;  2R6K A;  1F37 A;  2JL4 A;  1NW2 A;  2GSS A;  1K0C A;  4RI7 A;  1Z6N A;  5G30 A;  3O76 A;  2L4C A;  1B4P A;  4D73 A;  6GSV A;  2OE0 A;  2PGT A;  4OWY A;  1QUW A;  3N9J A;  3US3 A;  4GQF A;  1BG5 A;  3ZIT A;  1MTC A;  4BWS A;  3WT2 A;  1F3B A;  4IP1 A;  1XWA A;  3TUE A;  4EUY A;  5HFG A;  3FHK A;  4ECI A;  1URM A;  2GVP A;  2BMX A;  1G7E A;  4NMU A;  2GZZ A;  4G0L A;  5B6M A;  4L0W A;  4OFM A;  2V2G A;  5AIX A;  3ME7 A;  1ZGN A;  4TW5 A;  4N11 A;  5HR3 A;  3VPT A;  3F6D A;  1V58 A;  1PN9 A;  2LJR A;  3TJK A;  1XIY A;  3H1N A;  5HQP A;  2V6O A;  3PR8 A;  18GS A;  1WE0 A;  4MH2 A;  1TRV A;  2C8U A;  4POM A;  3KP9 A;  1XOA A;  2L57 A;  3F3R A;  4N0Z A;  1MDK A;  1SKR B;  3QAW A;  1X9M B;  5CO3 A;  2OE1 A;  5HR1 A;  1EV4 A;  4KGI A;  1W89 A;  2KP1 A;  3TJF A;  5D96 A;  3C8E A;  2HSH A;  3LYK A;  1T1V A;  3EUR A;  2B6M A;  2H30 A;  2JZS A;  1AW9 A;  2B5X A;  4MH3 A;  2XPE A;  2V6K A;  5D9W A;  3G7I A;  1X9W B;  2J23 A;  2H75 A;  4IEL A;  1TRS A;  5ECK B;  4KND A;  1XWC A;  2MMO A;  4Q5N A;  3Q74 A;  4DEJ A;  3LEF A;  3ME8 A;  1TTZ A;  3DRN A;  2DJ2 A;  3QFA C;  4EDY A;  3M9K A;  3D21 A;  3DYR A;  3L0H A;  5IMV A;  1A2L A;  3BOA A;  2GT5 A;  1CQH A;  2DSA A;  4GF0 A;  2C0D A;  2YJH A;  3R2Q A;  3F4R A;  1QXH A;  1UA5 A;  3ZRE A;  4F0C A;  1QK8 A;  3LJR A;  1EP7 A;  1ML6 A;  4F0B A;  1Q98 A;  2X64 A;  4LMV A;  2JU5 A;  4GWR A;  3BCI A;  4FYC A;  4TVE A;  2YWM A;  2QC7 A;  3EC3 A;  1ERU A;  1XWK A;  2GDR A;  4IVF A;  1ABA A;  2FCH A;  1PX7 A;  3ZIJ A;  2PN8 A;  3IK9 A;  4PXO A;  1ZL9 A;  4PGT A;  4YH2 A;  3TJJ A;  4JZQ A;  1GUK A;  5AIV A;  1SK1 A;  2IFQ A;  2FHE A;  4ULX A;  4EDZ A;  1TK5 B;  2K8V A;  6GSW A;  4V1A p;  4IN0 A;  4X1U A;  4PQI A;  2GZP A;  2B7J A;  1VF1 A;  1AAZ A;  3KTL A;  3DVX A;  3BBY A;  4KE3 A;  2C0G A;  1AIU A;  3KH9 A;  4XTS A;  2PUK C;  3DD3 A;  5JCG A;  1TDI A;  2YOI A;  2VCW A;  1U6T A;  4NHW A;  2FD3 A;  2HYX A;  2MZC A;  1ERW A;  4MMM A;  3CTG A;  5G5F A;  3WT1 A;  3F3Q A;  1SL0 B;  1YEP A;  3FY7 A;  2VCZ A;  5A4W A;  3RDW A;  3KMN A;  3GX0 A;  5KN2 A;  2DJK A;  2O89 A;  1K0A A;  5JWO B;  3MSZ A;  3GTU A;  2NBS A;  1RW1 A;  2PVQ A;  1X0R A;  4OMV A;  4NAX A;  3W6G A;  2ZUP A;  2YPM A;  2L6D A;  1XWG A;  1OE7 A;  1ZCP A;  5DQS A;  2PBJ A;  2ES7 A;  4IGJ A;  2YCD A;  1OKD A;  2MMN A;  2VM2 A;  1XOB A;  5IMD A;  1EEM A;  3L4N A;  1M9A A;  3KJY A;  4WET A;  3LFL A;  1SEN A;  2P5R A;  4TXO B;  2CT6 A;  5HR2 A;  1YKA A;  1XW6 A;  2V41 A;  1MD4 A;  1XPV A;  1THO A;  2DJJ A;  1IYI A;  4H86 A;  1AXD A;  3ZZX A;  4KB3 A;  2GQL A;  3DKS A;  1BYE A;  2QGV A;  4YQM A;  4USS A;  5IMC A;  2CVD A;  5IM9 A;  1JZO A;  1YEX A;  1R4W A;  2DJ3 A;  2LRN A;  2L4Q A;  4IQ1 A;  1ZZY A;  2I81 A;  4DSR A;  5IO2 A;  1JZR A;  5KN3 A;  3LG6 A;  3QR6 A;  3FZ5 A;  2AYT A;  5ECS A;  4G10 A;  5JWQ B;  2I9H A;  3C1R A;  4XHM A;  1SL2 B;  1SK0 A;  3BCK A;  8GSS A;  4PQ1 A;  5KEJ A;  3ERF A;  1O7U A;  2G0F A;  3PPU A;  1ERV A;  3C71 A;  3LGC A;  1GUL A;  2H6X A;  3GN3 A;  3WYW A;  5A5K A;  2L6C A;  5ECL B;  2KLX A;  1TKD B;  1U87 A;  3VK9 A;  3FR9 A;  1BJX A;  1QGV A;  5IMZ A;  1GTB A;  1C72 A;  3GX8 A;  1SD8 A;  2C0F A;  3HJO A;  2AHE A;  1PX6 A;  3PIN A;  4HZ4 A;  1TI3 A;  5D93 A;  3FZ4 A;  1FB6 A;  3H79 A;  2JAD A;  3ZYW A;  4OO5 A;  1TU8 A;  2RLI A;  1GTA A;  3PGT A;  2WRT A;  4KX4 A;  5EL8 A;  4HU7 A;  2C3Q A;  2C3N A;  1V40 A;  1ZYE A;  1GH2 A;  1O85 A;  1YF1 A;  4EC0 A;  1W4V A;  2HQT A;  4ZBB A;  3UJ1 A;  2FUG 2;  4AJ6 A;  3M8N A;  1K0D A;  1XW5 A;  5AGY A;  3SWL A;  4AJ7 A;  3UOM A;  3G9B A;  4CHS A;  1THX A;  4I8B A;  1PGT A;  5KN1 A;  3A2X A;  2HE3 A;  4CDO A;  3GYK A;  4BPY A;  3ED3 A;  1O6J A;  2VOC A;  4F82 A;  1A0F A;  3IRA A;  2P0G A;  1J0F A;  1GSE A;  1FHE A;  1NM3 A;  5DQY A;  2NTO A;  4IP6 A;  3KMO A;  4BVX B;  1QMV A;  2D2Z A;  2H70 A;  5EY6 A;  3KGK A;  1KNG A;  3TJG A;  3GSS A;  3HVS A;  3GKK A;  3HJP A;  1AQV A;  5ELG A;  2M72 A;  2TRX A;  3D6I A;  4I2T A;  14GS A;  4MZW A;  4LL1 B;  2YV7 A;  1WRY A;  2VCV A;  2YJ7 A;  3VI7 A;  4F2I A;  3IAS 2;  5J5N A;  2HFD A;  2PWJ A;  2E0Q A;  2CX4 A;  4LA1 A;  4XRA A;  1ERT A;  2VL3 A;  3H93 A;  2MBT A;  2A2R A;  3GL5 A;  2HZE B;  5LNK e;  1YKC A;  3P8W A;  2C1Y A;  3BD2 A;  4MAB A;  4HEA 2;  2K6V A;  1H4O A;  5HR0 A;  2I4A A;  2AAW A;  4K8M A;  1K0B A;  1Z7R A;  1PMT A;  1GL8 A;  3CSJ A;  2VCQ A;  4GQC A;  4GTU A;  5DAL B;  1TW9 A;  1ZOF A;  4BVY B;  4POB A;  5F05 A;  1TXX A;  2RUF A;  2LQO A;  3HJM A;  2CA8 A;  4MF7 A;  3MAK A;  5ABR A;  2CAI A;  2RII A;  3S9F A;  2IME A;  5E4W A;  4PQH A;  5HFI A;  2GLR A;  4MP4 A;  2HXK A;  4IS0 A;  2DBC A;  3GKN A;  3F63 A;  2KHP A;  2HRK B;  3KTB A;  2H0I A;  1XFL A;  5ECP B;  1BAY A;  2FA4 A;  1U88 A;  4MA9 A;  4K0N A;  3FZA A;  5FHI A;  4QL9 A;  4WKW A;  5BMU A;  4IJ3 A;  3ZVJ D;  1EOH A;  4PUR A;  6GST A;  4JRR A;  1SU9 A;  4MPG A;  3P7X A;  1AQW A;  4O5R A;  2YZH A;  2H76 A;  1VF3 A;  5INY A;  2B5E A;  1YF0 A;  2WB9 A;  3ISO A;  3ZIV A;  2GGT A;  5CRE A;  3HCZ A;  4XS4 A;  5CAX A;  2C0E A;  4MPF A;  3HY2 A;  2GT6 A;  2WDU A;  2VD0 A;  5HFK A;  3ERG A;  5DAL A;  5C04 A;  4BVY A;  3WGX A;  2I1U A;  5EPF A;  4IJI A;  5CRW A;  3TGZ A;  5LD0 A;  1FAA A;  4AJ8 A;  5ECM B;  4ML6 A;  4K7N A;  2IIY A;  3UBL A;  2VLU A;  1OAZ A;  1ILO A;  5F0G A;  3EMP A;  1KBN A;  2JAC A;  4AF2 A;  4KCE A;  1OE8 A;  2IMF A;  2A4V A;  4JE1 A;  2HRK A;  2CV4 A;  1MDI A;  4IHU A;  2L5O A;  4ILF A;  1K3Y A;  3F9U A;  4YAP A;  3WD6 A;  2VUP A;  1S3C A;  5J9C A;  1O8X A;  5AIS A;  4HU9 A;  4MCU A;  2YZU A;  1GSU A;  2H72 A;  4O32 A;  3LSZ A;  2L5L A;  2ZCT A; 
#chains in the Genus database with same CATH topology
 2RM5 A;  3C73 A;  3G7Y A;  4EO3 A;  2FA8 A;  4Q5F A;  1SVL A;  3HA9 A;  1O73 A;  2H6Y A;  1I9D A;  5IOX A;  3H8Q A;  3VI5 A;  3HZ4 A;  5DAK A;  4XIH A;  5DCH A;  3Q18 A;  5B7C A;  5G1L A;  1GLQ A;  1B4Q A;  1T8E B;  3HDC A;  4GLT A;  4EXJ A;  3DWV A;  4I2U A;  2K8S A;  1F2E A;  1GTU A;  5A1N B;  2H71 A;  4ZB9 A;  1M7T A;  2UZ8 A;  4E8H A;  5KOW A;  2N5F A;  1JZW A;  1M0U A;  2CVK A;  20GS A;  4F9Z A;  2K9F A;  3G7J A;  1GUH A;  2C3T A;  5F06 A;  4NPB A;  3A2W A;  5IO0 A;  2XHF A;  1OC3 A;  4ZIL A;  1WWJ A;  1EP8 A;  1TI1 A;  2YAN A;  5KN0 A;  4EKZ A;  5D73 A;  3IPZ A;  1SKS B;  1DE1 A;  5FT3 A;  2DJ1 A;  2OBI A;  2IN3 A;  2BJX A;  1SVM A;  3FR6 A;  2WW1 A;  4EIQ A;  1K3L A;  1X5D A;  1V57 A;  3IR4 A;  4MJB A;  2FGX A;  3V1W A;  5IQY A;  1TXU A;  19GS A;  1O8W A;  2CVB A;  3PH9 A;  5J4V A;  1PL2 A;  6GSU A;  2IPA A;  4TR3 A;  3ZFL A;  2O36 A;  2DIZ A;  2EC4 A;  1EGR A;  1BQ7 A;  2LV3 A;  4GDF A;  5C00 A;  2X8H A;  4CW9 A;  4HSC X;  3QOU A;  2GQK A;  2DML A;  4X0X A;  1A24 A;  3I6A A;  3FKF A;  5JCU A;  3VPQ A;  1B9Y C;  2IMI A;  3EMX A;  1GSF A;  3RAZ A;  5ID2 B;  3GIX A;  1R5P A;  3KP8 A;  1PQN A;  3TKP A;  4K9Z A;  2G2Q A;  4MJA A;  1YY7 A;  2H01 A;  3TB2 A;  3CYN A;  4L0U A;  1SJ6 A;  3ZRD A;  2HI7 A;  1VGL A;  3CSH A;  2KP2 A;  1OVN A;  4P3Y B;  2R3X A;  3I43 A;  2UV8 G;  1SK2 A;  1O81 A;  2H8L A;  2WGR A;  3IK7 A;  2H73 A;  4GST A;  1A2M A;  3ZMK A;  2MMA A;  2P31 A;  4RI6 A;  3VLN A;  1GSY A;  22GS A;  3GRX A;  1H75 A;  4G9H A;  3HKR A;  2LUS A;  4TOP A;  2PPT A;  2YN1 A;  4OFN A;  2TIR A;  3EE2 A;  4MF5 A;  3BJ5 A;  2IL3 A;  3HHV A;  3VWX A;  2FLS A;  3NIV A;  3CRU A;  3TJB A;  3RBT A;  3TKS E;  3VUR A;  1ACV A;  2GQM A;  1WP0 A;  2PU9 C;  2PMT A;  1Z5Y E;  4PNG A;  2F9S A;  4ZL8 A;  2OA7 A;  1OYJ A;  3EYT A;  4O7H A;  3VWV A;  2GSQ A;  3QPM A;  5DCG A;  3GMF A;  2CQ9 A;  4V2M A;  1PL1 A;  1E6B A;  1TRW A;  3NZN A;  5ID2 A;  4TR4 A;  1XXU A;  1YQ1 A;  2LQQ A;  5G2Z A;  5J3R A;  2H0H A;  5B8A A;  2YP6 A;  2JSY A;  1FOV A;  5G5E A;  2F3M A;  4O92 A;  10GS A;  4YAV A;  2AB6 A;  5IMA A;  1X9S B;  3L9S A;  1WMJ A;  5ENU A;  3U5R E;  1F6M C;  1TJD A;  4MZB A;  2H74 A;  3FEU A;  3ZFB A;  4PX1 A;  4MZC A;  1YVL A;  5IOW A;  1G7O A;  1DBY A;  5EVO A;  1E2Y A;  4HUA A;  2AJQ B;  4JU5 A;  4JED A;  3R3E A;  2H6Z A;  1U3A A;  2X99 A;  1AQX A;  2NVL A;  4POK A;  1RQM A;  5A5H B;  5J4Y A;  3UL3 A;  5A34 B;  3M1G A;  1SKW B;  4K6X A;  4TRX A;  3J7Y b;  2R4V A;  1EOG A;  4TXO A;  4PNF A;  1TP9 A;  4FQU A;  1GUM A;  3GL3 A;  2IMD A;  5J9B A;  2DIY A;  3E9J B;  4MK3 A;  4G19 A;  4GXZ A;  4OCE A;  3FZ9 A;  4KH7 A;  3L9U A;  4HS1 A;  2FNO A;  4YQV A;  2VAF A;  4G0I A;  4K2X A;  3P2A A;  2E2M A;  4ZL9 A;  1SL1 B;  1IYH A;  3DVW A;  4ZIJ A;  6GSS A;  2H1D A;  1ZYQ B;  1R5A A;  2M80 A;  1DE2 A;  3IBH A;  4EVM A;  2R5G A;  3DGQ A;  4W66 A;  5FWG A;  2N5A A;  1TOF A;  4RQX A;  3QMX A;  3LW9 A;  4Z2R A;  1GRX A;  3AY8 A;  3ZML A;  1S4B P;  4TR1 B;  1F3A A;  3CTF A;  3ZVJ A;  2NDO A;  3LXZ A;  1S3D A;  5J40 A;  2YWO A;  1BED A;  4CY6 A;  1UVZ A;  1XBS A;  2HSY A;  3GNJ A;  1CQG A;  2H1G A;  3HYP A;  2E7P A;  3QAG A;  2O8V B;  1GNW A;  3DIE A;  3HXS A;  4NHZ A;  2C4J A;  2GST A;  1Z3E A;  3J7Y k;  1V98 A;  1FW1 A;  4HOJ A;  1ST9 A;  1AC1 A;  4Q5Q A;  3DXB A;  1TK0 B;  1LU4 A;  3W8J A;  4YKG A;  4D73 B;  1WJK A;  4G2E A;  3D4M A;  4X4J A;  2WJU A;  4WR4 A;  3EIN A;  5A4V A;  4FH8 A;  2VL2 C;  4RQR A;  3MNG A;  1FG4 A;  5H5R A;  4BVX A;  1RK4 A;  5ECI B;  3IE3 A;  2A2P A;  2Z9S A;  2ON7 A;  2LST A;  3IAM 2;  5ECR B;  2M46 A;  5D9X A;  2RUE A;  4WEY A;  4JBB A;  3A5W A;  3M0F A;  2AV4 A;  2PER A;  12GS A;  1YZX A;  4EE0 A;  5GST A;  4TR1 A;  2VL2 A;  5ECH B;  3P90 A;  3N5O A;  2VCX A;  2KUC A;  4F03 A;  2WZ9 A;  4KCA A;  2IWT A;  3QFB C;  2WS2 A;  2DKI A;  4J56 E;  1T00 A;  2YWI A;  1R7H A;  2E2G A;  1U3I A;  2HZE A;  2J9H A;  1NSW A;  5IPG A;  4OO4 A;  4WF5 A;  4IW9 A;  3DML A;  4O5U A;  1OKT A;  2CZ3 A;  1JLV A;  3K8N A;  3GUR A;  4HQS A;  3TRP A;  2VM1 A;  4FIW A;  1I5G A;  5GAP D;  5AN1 A;  2O87 A;  2QA1 A;  5F8B A;  4N30 A;  3GV1 A;  3ZL5 A;  2A2S A;  2B1K A;  1EGO A;  2H1L A;  3OR5 A;  2XC2 A;  4ICY A;  4HI7 A;  1XZO A;  5G31 A;  2DMM A;  4N10 A;  4NV5 A;  2VIM A;  3APQ A;  4ZBD A;  4ISD A;  4BL7 B;  4I97 A;  3F4T A;  2RM6 A;  1PRX A;  5CRD A;  2HT9 A;  3LOR A;  2EFC A;  4EL1 A;  5CNW A;  2X4A A;  5GAN D;  4JR6 A;  2LRT A;  2H1B A;  2HLS A;  3IV4 A;  3EU3 A;  1B8X A;  4PI0 C;  5D9T A;  1Z9H A;  2ALB A;  4PTS A;  4E68 A;  3F0I A;  2B7K A;  1MD3 A;  2O7K A;  4WBR D;  2B5Y A;  3TDG A;  3HVV A;  1JHB A;  4Q5R A;  4J2F A;  1YEW C;  2IJY A;  1M2B A;  3RHC A;  1GSD A;  2WUL A;  4IBP A;  3H4K A;  1V2A A;  5CRH A;  3ZLP A;  3EVI A;  3C1S A;  13GS A;  5E59 A;  1Y6E A;  2KOK A;  2L59 A;  3TKS C;  4J57 E;  1A23 A;  2IFQ B;  4L5O A;  5DDL A;  4MJC A;  4TN8 A;  1FVK A;  1F9M A;  3TOU A;  2HRN A;  2I3Y A;  4DSQ A;  4K7O A;  3KM6 A;  1S3A A;  3IOS A;  4OD7 A;  3TRX A;  1PD2 1;  2LJK A;  6GSX A;  4ZBA A;  3WGD A;  1SJZ A;  3TKS A;  1WOU A;  4K0G A;  3L78 A;  2H1A A;  5GSS A;  1G0T A;  4BL7 A;  5J47 A;  5CYY A;  1K0N A;  4JR4 A;  2VLV A;  2X8G A;  3HZ8 A;  3MWH A;  2LKU A;  2V32 A;  2YWN A;  1OC8 A;  2YV9 A;  2R0G A;  1GTI A;  4PHZ C;  3TCO A;  3IDV A;  4K1F A;  3GTU B;  3Q6O A;  4BWQ A;  1Y1U A;  2DJ0 A;  3HD5 A;  2OBK A;  3RPN A;  7GSS A;  4YKF A;  1VF2 A;  2XBQ A;  3D5J A;  1FO5 A;  4IKH A;  3A5I A;  16GS A;  3GA4 A;  4ZL7 A;  9GSS A;  4ECC A;  1HNA A;  4FYB A;  4NV2 A;  2VLT A;  4MF6 A;  1V9W A;  2H0G A;  3KH7 A;  1SJI A;  3IC4 A;  3UEM A;  4V1A g;  3SBC A;  4HJM A;  1TK8 B;  4OCF A;  4DVC A;  4V2L A;  4Z7X A;  1DUG A;  4AKG A;  4ZB8 A;  2OJL A;  5A1N A;  4ML1 A;  1XVW A;  1Z6M A;  2FWG A;  5LCZ A;  3EWL A;  3GH6 A;  3A2V A;  4OFT A;  1HYU A;  3EU4 A;  3RHB A;  3UMA A;  3D22 A;  4NWY A;  1LBK A;  2LNS A;  2YNX A;  2LRC A;  1K0O A;  2V1M A;  4TKY A;  3TKR A;  2N5B A;  4I5Q A;  2FWE A;  4MJE A;  1SYR A;  4KDY A;  2OAC A;  2O85 A;  3CBU A;  5ECO B;  1SD9 A;  3KZQ A;  4TXV A;  2WW0 A;  1YJ6 A;  1EV9 A;  1OC9 B;  3IA1 A;  4HJ2 A;  6GSY A;  1M3J A;  4KF9 A;  5G1K A;  1TRU A;  2EIO A;  5L71 A;  4E8E A;  2QSI A;  4TR0 A;  4DSS B;  5DVB A;  1M2D A;  4ZXG A;  2H66 A;  2WFC A;  1M99 A;  1USB A;  3ZTL A;  4YQU A;  1Z7P A;  3C7M A;  3APS A;  3UAP A;  1A8Y A;  2FWH A;  2F51 A;  1JFU A;  2TRC P;  3GH9 A;  1J9B A;  5B8B A;  1GLP A;  3QAV A;  1M9B A;  2VD1 A;  1N2A A;  3DEX A;  3FK8 A;  5CRG A;  4WXT A;  4HZ2 A;  11GS A;  1GSQ A;  1FVJ A;  2DC5 A;  2ZNM A;  1G6W A;  4PUA A;  2HSM B;  4FYU A;  4HDE A;  1AUC A;  3U6V A;  4BA7 A;  1QQ2 A;  3IHQ A;  3GKX A;  3GFK A;  1TU7 A;  1Y25 A;  3CXG A;  4GRF A;  3FW2 A;  4WF4 A;  1A0R P;  1HNC A;  4POL A;  3GKM A;  4AI6 A;  3FYG A;  3RFR C;  1X5C A;  3KIJ A;  1HNB A;  2CX3 A;  2MYG A;  3UAR A;  4NXI A;  2MMZ A;  1T7P B;  5ECN B;  4WR5 A;  1GNE A;  2CZ2 A;  4KAE A;  5CP1 A;  2LS5 A;  1XW9 A;  3KEB A;  2GZY A;  2LTK A;  4KSM A;  1OC9 A;  3CMI A;  1WPI A;  2AUV A;  2NPB A;  4EF0 A;  3O6T A;  5A4U A;  4DSS A;  1PKW A;  3KXO A;  3VFI A;  1EZK A;  2LEG A;  3APO A;  3M9J A;  2VO4 A;  4I6X A;  3RPP A;  3LWA A;  4K5S A;  3I69 A;  1WIK A;  1LJR A;  4LMW A;  1XCC A;  4XS1 A;  5F07 A;  3VWW A;  4LLR A;  2MBS A;  2JZR A;  1PSQ A;  4AGS A;  5D8I A;  2GSR A;  1A8L A;  1MEK A;  1ZYP A;  2GS3 A;  1XVQ A;  3KD0 A;  5IPH A;  3LYP A;  2B3S A;  5B6N A;  4K2D A;  2FWF A;  2XPD A;  3MDK A;  1VRS D;  1A2J A;  4XCS A;  1SVO A;  5J41 A;  4LL4 B;  3D0Z A;  5H5S A;  2P5Q A;  4KA0 A;  1NHY A;  2OAD A;  2LJA A;  5ECQ B;  3W8S A;  1Q4J A;  2HSM A;  1GP1 A;  3L9V A;  2WW2 A;  1YDK A;  1EWX A;  4XS6 A;  1N8J A;  1FB0 A;  2OKA A;  5JCW A;  2REM A;  3UVT A;  2C80 A;  1XWB A;  3CSI A;  4KDU A;  1QFN A;  5DBQ A;  4K7I A;  3TKQ A;  4GSN A;  1B48 A;  3QD9 A;  2R37 A;  4AKX B;  2JZT A;  2HSN B;  2EIQ A;  4PUF C;  2HNL A;  3TOT A;  4MDC A;  2GTU A;  4QL7 A;  2O5V A;  5DJL A;  2EFE A;  4GSS A;  3E0U A;  1T3B A;  4N0V A;  2EFH A;  1G6Y A;  3IXR A;  3LXT A;  4HQZ A;  3UBK A;  3O3T A;  2R0P A;  3QCP A;  4G01 A;  1ZMA A;  2LNT A;  5GZZ B;  1T4Y A;  1X5E A;  4ECJ A;  3M3M A;  3F4S A;  1NHO A;  5A5H A;  1ON4 A;  4ID0 A;  4L8E A;  2VCT A;  3UVH A;  5A34 A;  2QKE A;  3QDN A;  1KTE A;  1M2A A;  5ELA A;  2XBI A;  1DSB A;  5BMU B;  4IQA A;  1UN2 A;  2WVY A;  3KCM A;  2F8F A;  4RUV A;  2OE3 A;  4WBJ A;  4KSO A;  4ECB A;  3CRT A;  3GST A;  2EIR A;  2K18 A;  4MNN A;  5IMF A;  2X8C A;  3VWU A;  4ZB6 A;  4ACS A;  4MLY A;  1PKZ A;  3A3T A;  3LQ7 A;  4KDX A;  4XRD A;  2ON5 A;  2HRF A;  4FO5 A;  1HD2 A;  5D9V A;  3FR3 A;  2H19 A;  4XS4 B;  4KUN A;  17GS A;  1SYX A;  3GHA A;  1ZYN A;  1BF5 A;  2B1L A;  3UIW A;  1HQO A;  1R26 A;  3FRC A;  1B9X C;  4CY8 A;  3I9V 2;  2R2J A;  4V2N A;  1PA3 A;  3Q19 A;  1MDJ A;  1JZD A;  3NOF A;  1J08 A;  1JLW A;  3JCM L;  4AKI A;  2HSN A;  3E3E A;  3HVX A;  2IMK A;  3F8U A;  3WGE A;  2F8A A;  5H5Q A;  4L5L A;  5J4U A;  5JWR B;  1K0M A;  4X43 A;  4G0K A;  1BX9 A;  3D4T A;  3IC8 A;  2VL9 A;  3TU3 B;  2DLX A;  2JSZ A;  1UC7 A;  2WCI A;  1GSS A;  2FY6 A;  4QMK A;  3ERW A;  5COH A;  1GWC A;  1S3R A;  4QQ7 A;  2HRA A;  3TRQ A;  2BTO T;  2PVO C;  2CAQ A;  5IIZ A;  1EEJ A;  1K3O A;  4Z2T A;  3F6F A;  4GCI A;  3GUS A;  5DJM A;  1KEB A;  2HZF A;  4KW6 A;  5DAK B;  1T4Z A;  1VF4 A;  2R6K A;  1F37 A;  2JL4 A;  1NW2 A;  2GSS A;  1I1I P;  1K0C A;  1BG1 A;  4RI7 A;  1Z6N A;  5G30 A;  3O76 A;  2L4C A;  1B4P A;  4D73 A;  6GSV A;  2OE0 A;  2PGT A;  4OWY A;  1QUW A;  3N9J A;  3US3 A;  4GQF A;  1BG5 A;  3ZIT A;  1MTC A;  4BWS A;  3WT2 A;  1F3B A;  4IP1 A;  1XWA A;  3TUE A;  4EUY A;  5HFG A;  3FHK A;  4ECI A;  1URM A;  2GVP A;  2BMX A;  1G7E A;  4NMU A;  2GZZ A;  4G0L A;  5B6M A;  1PFO A;  4L0W A;  4OFM A;  2V2G A;  5AIX A;  3ME7 A;  1ZGN A;  4TW5 A;  4N11 A;  5HR3 A;  3VPT A;  3F6D A;  1V58 A;  2R0C A;  1PN9 A;  2LJR A;  3TJK A;  1XIY A;  3H1N A;  5HQP A;  2V6O A;  3PR8 A;  18GS A;  1WE0 A;  4MH2 A;  1TRV A;  2WVZ A;  2C8U A;  4POM A;  3KP9 A;  1XOA A;  2L57 A;  3F3R A;  4N0Z A;  1MDK A;  1SKR B;  3QAW A;  1X9M B;  5CO3 A;  2OE1 A;  5HR1 A;  1EV4 A;  4KGI A;  1W89 A;  2KP1 A;  3TJF A;  5D96 A;  3C8E A;  2HSH A;  3LYK A;  1T1V A;  3EUR A;  2B6M A;  2H30 A;  2JZS A;  1AW9 A;  2B5X A;  4MH3 A;  2XPE A;  2V6K A;  5D9W A;  3G7I A;  1X9W B;  4N3Z A;  5KOX A;  2J23 A;  2H75 A;  4IEL A;  1TRS A;  5ECK B;  4KND A;  1XWC A;  2MMO A;  4Q5N A;  3Q74 A;  4DEJ A;  3LEF A;  3ME8 A;  1TTZ A;  3DRN A;  2DJ2 A;  3QFA C;  4EDY A;  3M9K A;  3D21 A;  2O3E A;  3DYR A;  3L0H A;  5IMV A;  4ZB7 A;  1A2L A;  3BOA A;  2GT5 A;  1CQH A;  3EPT A;  2OT3 A;  2DSA A;  4GF0 A;  2C0D A;  2YJH A;  3R2Q A;  3F4R A;  1QXH A;  1UA5 A;  3ZRE A;  4F0C A;  1QK8 A;  3LJR A;  1EP7 A;  5BRT A;  1ML6 A;  4F0B A;  1Q98 A;  2X64 A;  1PN0 A;  4LMV A;  2JU5 A;  4GWR A;  3BCI A;  4FYC A;  4PI2 C;  2YWM A;  4TVE A;  2QC7 A;  3EC3 A;  1ERU A;  1XWK A;  2GDR A;  2WZS A;  4IVF A;  1ABA A;  2FCH A;  1PX7 A;  3ZIJ A;  2PN8 A;  3IK9 A;  4PXO A;  1ZL9 A;  4PGT A;  4YH2 A;  3TJJ A;  4JZQ A;  1GUK A;  5AIV A;  1SK1 A;  2IFQ A;  2FHE A;  4ULX A;  4EDZ A;  1TK5 B;  2K8V A;  6GSW A;  4V1A p;  4IN0 A;  4X1U A;  4PQI A;  2GZP A;  2B7J A;  1VF1 A;  1AAZ A;  3KTL A;  3DVX A;  3BBY A;  4KE3 A;  2C0G A;  1AIU A;  2WVX B;  3KH9 A;  3FMW A;  4XTS A;  1N25 A;  2PUK C;  3DD3 A;  3HVN A;  5JCG A;  1TDI A;  4BIK A;  2YOI A;  2VCW A;  1U6T A;  4NHW A;  2FD3 A;  2HYX A;  2MZC A;  1ERW A;  4MMM A;  3CTG A;  5G5F A;  3WT1 A;  3F3Q A;  1SL0 B;  1YEP A;  3FY7 A;  2VCZ A;  5A4W A;  3RDW A;  3KMN A;  3GX0 A;  5KN2 A;  2DJK A;  2O89 A;  1K0A A;  5JWO B;  3MSZ A;  3GTU A;  2NBS A;  1RW1 A;  2PVQ A;  1X0R A;  4OMV A;  4NAX A;  3W6G A;  2ZUP A;  2YPM A;  2L6D A;  2DKH A;  1XWG A;  1OE7 A;  1ZCP A;  5DQS A;  2PBJ A;  2ES7 A;  4IGJ A;  2YCD A;  2EFD A;  1OKD A;  2MMN A;  2VM2 A;  1XOB A;  5IMD A;  1EEM A;  3L4N A;  1M9A A;  3KJY A;  4WET A;  3LFL A;  1SEN A;  2P5R A;  4TXO B;  2CT6 A;  5HR2 A;  1YKA A;  1XW6 A;  2V41 A;  1MD4 A;  1XPV A;  1THO A;  2DJJ A;  4K5R A;  1IYI A;  4H86 A;  1AXD A;  3ZZX A;  4KB3 A;  2GQL A;  3DKS A;  1BYE A;  2QGV A;  4YQM A;  2VKZ G;  4USS A;  2WVX A;  5IMC A;  2CVD A;  5IM9 A;  1JZO A;  1YEX A;  1R4W A;  2DJ3 A;  2LRN A;  2L4Q A;  4IQ1 A;  1ZZY A;  2I81 A;  4DSR A;  5IO2 A;  1JZR A;  5KN3 A;  3LG6 A;  1FOH A;  3QR6 A;  3FZ5 A;  2AYT A;  5ECS A;  2A4H A;  4G10 A;  5JWQ B;  2I9H A;  3C1R A;  4XHM A;  1SL2 B;  1SK0 A;  3BCK A;  8GSS A;  4PQ1 A;  5KEJ A;  3ERF A;  1O7U A;  2G0F A;  3PPU A;  1ERV A;  3C71 A;  3LGC A;  1GUL A;  2H6X A;  3GN3 A;  3WYW A;  5A5K A;  2L6C A;  5ECL B;  2KLX A;  1TKD B;  1U87 A;  3VK9 A;  3FR9 A;  1BJX A;  1QGV A;  5IMZ A;  1GTB A;  1C72 A;  3GX8 A;  1SD8 A;  2C0F A;  1XG8 A;  3HJO A;  2AHE A;  1PX6 A;  3PIN A;  4HZ4 A;  1TI3 A;  5D93 A;  3FZ4 A;  1FB6 A;  3H79 A;  2JAD A;  3ZYW A;  4OO5 A;  1TU8 A;  2RLI A;  1GTA A;  3PGT A;  2WRT A;  4KX4 A;  5EL8 A;  4HU7 A;  2C3Q A;  2C3N A;  1V40 A;  1ZYE A;  1GH2 A;  1O85 A;  1YF1 A;  4EC0 A;  1W4V A;  2HQT A;  4ZBB A;  3UJ1 A;  2FUG 2;  4A5P A;  4AJ6 A;  3M8N A;  1K0D A;  1XW5 A;  5AGY A;  3SWL A;  4AJ7 A;  3UOM A;  3G9B A;  4CHS A;  1THX A;  4I8B A;  1PGT A;  5KN1 A;  3A2X A;  2HE3 A;  4CDO A;  3GYK A;  4BPY A;  3ED3 A;  1O6J A;  2VOC A;  4F82 A;  1A0F A;  3IRA A;  2P0G A;  1J0F A;  1GSE A;  1FHE A;  1NM3 A;  5DQY A;  2NTO A;  4IP6 A;  3CQF A;  3KMO A;  4BVX B;  1QMV A;  2D2Z A;  2H70 A;  5EY6 A;  3KGK A;  1KNG A;  3TJG A;  3GSS A;  4Z2U A;  3HVS A;  3GKK A;  3HJP A;  1AQV A;  5ELG A;  3RGB C;  2M72 A;  2TRX A;  3D6I A;  4I2T A;  14GS A;  4MZW A;  4LL1 B;  2YV7 A;  1WRY A;  2VCV A;  2YJ7 A;  4FXY P;  3VI7 A;  4F2I A;  3IAS 2;  5J5N A;  2HFD A;  2PWJ A;  2E0Q A;  2CX4 A;  3HMJ G;  4LA1 A;  4XRA A;  1ERT A;  2VL3 A;  3H93 A;  2MBT A;  2A2R A;  3GL5 A;  2HZE B;  5LNK e;  1YKC A;  3P8W A;  2C1Y A;  3BD2 A;  4MAB A;  4HEA 2;  2K6V A;  1H4O A;  5HR0 A;  2I4A A;  2AAW A;  4K8M A;  1M3I A;  1K0B A;  1Z7R A;  1PMT A;  4AKH A;  3CSJ A;  1GL8 A;  2VCQ A;  4GQC A;  4GTU A;  5DAL B;  1TW9 A;  1ZOF A;  4BVY B;  4POB A;  5F05 A;  1TXX A;  2RUF A;  2LQO A;  3HJM A;  2CA8 A;  4MF7 A;  3MAK A;  5ABR A;  2CAI A;  4EIP A;  2RII A;  3S9F A;  2IME A;  5E4W A;  4PQH A;  5HFI A;  2GLR A;  4MP4 A;  2HXK A;  4IS0 A;  2DBC A;  3GKN A;  3F63 A;  2KHP A;  2HRK B;  3KTB A;  2H0I A;  1XFL A;  5ECP B;  1BAY A;  2FA4 A;  1U88 A;  4MA9 A;  4K0N A;  3FZA A;  5FHI A;  4QL9 A;  3CHX C;  4WKW A;  5BMU A;  4IJ3 A;  3ZVJ D;  1EOH A;  4PUR A;  6GST A;  4JRR A;  1SU9 A;  4MPG A;  3P7X A;  1AQW A;  4O5R A;  2YZH A;  2H76 A;  1VF3 A;  5INY A;  2B5E A;  1YF0 A;  2WB9 A;  3ISO A;  3ZIV A;  3IHG A;  2GGT A;  5CRE A;  3HCZ A;  4XS4 A;  5CAX A;  3MIX A;  2C0E A;  4MPF A;  3HY2 A;  2GT6 A;  2WDU A;  2VD0 A;  5HFK A;  3ERG A;  5DAL A;  2X49 A;  5C04 A;  4BVY A;  3WGX A;  2I1U A;  5EPF A;  4IJI A;  5CRW A;  3TGZ A;  5LD0 A;  1FAA A;  4AJ8 A;  5ECM B;  4ML6 A;  2WW3 A;  2IIY A;  4K7N A;  4O5Q A;  3UBL A;  2VLU A;  1OAZ A;  1ILO A;  5F0G A;  3EMP A;  3MYD A;  1KBN A;  2JAC A;  4AF2 A;  4KCE A;  1OE8 A;  2IMF A;  2A4V A;  4JE1 A;  2HRK A;  2CV4 A;  1MDI A;  4IHU A;  2L5O A;  1K3Y A;  4ILF A;  3F9U A;  4YAP A;  3WD6 A;  2VUP A;  1S3C A;  5J9C A;  1O8X A;  5AIS A;  4HU9 A;  4MCU A;  3CWG A;  2YZU A;  2QA2 A;  1GSU A;  2H72 A;  4O32 A;  3LSZ A;  2L5L A;  2ZCT A; 
#chains in the Genus database with same CATH homology
 2RM5 A;  3C73 A;  3G7Y A;  4EO3 A;  2FA8 A;  4Q5F A;  1SVL A;  3HA9 A;  1O73 A;  2H6Y A;  1I9D A;  5IOX A;  3H8Q A;  3VI5 A;  3HZ4 A;  5DAK A;  4XIH A;  5DCH A;  3Q18 A;  5B7C A;  5G1L A;  1GLQ A;  1B4Q A;  1T8E B;  3HDC A;  4GLT A;  4EXJ A;  3DWV A;  4I2U A;  2K8S A;  1F2E A;  1GTU A;  5A1N B;  2H71 A;  4ZB9 A;  1M7T A;  2UZ8 A;  4E8H A;  5KOW A;  2N5F A;  1JZW A;  1M0U A;  2CVK A;  20GS A;  4F9Z A;  2K9F A;  3G7J A;  1GUH A;  2C3T A;  5F06 A;  4NPB A;  3A2W A;  5IO0 A;  2XHF A;  1OC3 A;  4ZIL A;  1WWJ A;  1EP8 A;  1TI1 A;  2YAN A;  5KN0 A;  4EKZ A;  5D73 A;  3IPZ A;  1SKS B;  1DE1 A;  5FT3 A;  2DJ1 A;  2OBI A;  2IN3 A;  2BJX A;  1SVM A;  3FR6 A;  4EIQ A;  1K3L A;  1X5D A;  1V57 A;  3IR4 A;  4MJB A;  2FGX A;  3V1W A;  5IQY A;  1TXU A;  19GS A;  1O8W A;  2CVB A;  3PH9 A;  5J4V A;  1PL2 A;  6GSU A;  2IPA A;  4TR3 A;  3ZFL A;  2DIZ A;  2EC4 A;  1EGR A;  1BQ7 A;  2LV3 A;  4GDF A;  5C00 A;  2X8H A;  4CW9 A;  3QOU A;  2GQK A;  2DML A;  4X0X A;  1A24 A;  3I6A A;  3FKF A;  5JCU A;  3VPQ A;  1B9Y C;  2IMI A;  3EMX A;  1GSF A;  3RAZ A;  5ID2 B;  3GIX A;  1R5P A;  3KP8 A;  1PQN A;  3TKP A;  4K9Z A;  2G2Q A;  4MJA A;  1YY7 A;  2H01 A;  3TB2 A;  3CYN A;  4L0U A;  1SJ6 A;  3ZRD A;  2HI7 A;  1VGL A;  3CSH A;  2KP2 A;  1OVN A;  4P3Y B;  2R3X A;  3I43 A;  2UV8 G;  1SK2 A;  1O81 A;  2H8L A;  2WGR A;  3IK7 A;  2H73 A;  4GST A;  1A2M A;  3ZMK A;  2MMA A;  2P31 A;  4RI6 A;  3VLN A;  1GSY A;  22GS A;  3GRX A;  1H75 A;  4G9H A;  3HKR A;  2LUS A;  4TOP A;  2PPT A;  2YN1 A;  4OFN A;  2TIR A;  3EE2 A;  4MF5 A;  3BJ5 A;  2IL3 A;  3HHV A;  3VWX A;  2FLS A;  3NIV A;  3CRU A;  3TJB A;  3RBT A;  3TKS E;  3VUR A;  1ACV A;  2GQM A;  1WP0 A;  2PU9 C;  2PMT A;  1Z5Y E;  4PNG A;  2F9S A;  4ZL8 A;  2OA7 A;  1OYJ A;  3EYT A;  4O7H A;  3VWV A;  2GSQ A;  3QPM A;  5DCG A;  3GMF A;  2CQ9 A;  4V2M A;  1PL1 A;  1E6B A;  1TRW A;  3NZN A;  5ID2 A;  4TR4 A;  1XXU A;  1YQ1 A;  2LQQ A;  5G2Z A;  5J3R A;  2H0H A;  5B8A A;  2YP6 A;  2JSY A;  1FOV A;  5G5E A;  2F3M A;  4O92 A;  10GS A;  4YAV A;  2AB6 A;  5IMA A;  1X9S B;  3L9S A;  1WMJ A;  5ENU A;  3U5R E;  1F6M C;  1TJD A;  4MZB A;  2H74 A;  3FEU A;  3ZFB A;  4PX1 A;  4MZC A;  1YVL A;  5IOW A;  1G7O A;  1DBY A;  5EVO A;  1E2Y A;  4HUA A;  2AJQ B;  4JU5 A;  4JED A;  3R3E A;  2H6Z A;  1U3A A;  2X99 A;  1AQX A;  2NVL A;  4POK A;  1RQM A;  5A5H B;  5J4Y A;  3UL3 A;  5A34 B;  3M1G A;  1SKW B;  4K6X A;  4TRX A;  3J7Y b;  2R4V A;  1EOG A;  4TXO A;  4PNF A;  1TP9 A;  4FQU A;  1GUM A;  3GL3 A;  2IMD A;  5J9B A;  2DIY A;  3E9J B;  4MK3 A;  4G19 A;  4GXZ A;  4OCE A;  3FZ9 A;  4KH7 A;  3L9U A;  4HS1 A;  2FNO A;  4YQV A;  2VAF A;  4G0I A;  4K2X A;  3P2A A;  2E2M A;  4ZL9 A;  1SL1 B;  1IYH A;  3DVW A;  4ZIJ A;  6GSS A;  2H1D A;  1ZYQ B;  1R5A A;  2M80 A;  1DE2 A;  3IBH A;  4EVM A;  2R5G A;  3DGQ A;  4W66 A;  5FWG A;  2N5A A;  1TOF A;  4RQX A;  3QMX A;  3LW9 A;  4Z2R A;  1GRX A;  3AY8 A;  3ZML A;  4TR1 B;  1F3A A;  3CTF A;  3ZVJ A;  2NDO A;  3LXZ A;  1S3D A;  5J40 A;  2YWO A;  1BED A;  4CY6 A;  1UVZ A;  1XBS A;  2HSY A;  3GNJ A;  1CQG A;  2H1G A;  3HYP A;  2E7P A;  3QAG A;  2O8V B;  1GNW A;  3DIE A;  3HXS A;  4NHZ A;  2C4J A;  2GST A;  1Z3E A;  3J7Y k;  1V98 A;  1FW1 A;  4HOJ A;  1ST9 A;  1AC1 A;  4Q5Q A;  3DXB A;  1TK0 B;  1LU4 A;  3W8J A;  4YKG A;  4D73 B;  1WJK A;  4G2E A;  3D4M A;  4X4J A;  2WJU A;  4WR4 A;  3EIN A;  5A4V A;  4FH8 A;  2VL2 C;  4RQR A;  3MNG A;  1FG4 A;  5H5R A;  4BVX A;  1RK4 A;  5ECI B;  3IE3 A;  2A2P A;  2Z9S A;  2ON7 A;  2LST A;  3IAM 2;  5ECR B;  2M46 A;  5D9X A;  2RUE A;  4WEY A;  4JBB A;  3A5W A;  3M0F A;  2AV4 A;  2PER A;  12GS A;  1YZX A;  4EE0 A;  5GST A;  4TR1 A;  2VL2 A;  5ECH B;  3P90 A;  3N5O A;  2VCX A;  2KUC A;  4F03 A;  2WZ9 A;  4KCA A;  2IWT A;  3QFB C;  2WS2 A;  2DKI A;  4J56 E;  1T00 A;  2YWI A;  1R7H A;  2E2G A;  1U3I A;  2HZE A;  2J9H A;  1NSW A;  5IPG A;  4OO4 A;  4WF5 A;  4IW9 A;  3DML A;  4O5U A;  1OKT A;  2CZ3 A;  1JLV A;  3K8N A;  3GUR A;  4HQS A;  3TRP A;  2VM1 A;  4FIW A;  1I5G A;  5GAP D;  5AN1 A;  2O87 A;  2QA1 A;  5F8B A;  4N30 A;  3GV1 A;  3ZL5 A;  2A2S A;  2B1K A;  1EGO A;  2H1L A;  3OR5 A;  2XC2 A;  4ICY A;  4HI7 A;  1XZO A;  5G31 A;  2DMM A;  4N10 A;  4NV5 A;  2VIM A;  3APQ A;  4ZBD A;  4ISD A;  4BL7 B;  4I97 A;  3F4T A;  2RM6 A;  1PRX A;  5CRD A;  2HT9 A;  3LOR A;  2EFC A;  4EL1 A;  5CNW A;  2X4A A;  5GAN D;  4JR6 A;  2LRT A;  2H1B A;  2HLS A;  3IV4 A;  3EU3 A;  1B8X A;  5D9T A;  1Z9H A;  2ALB A;  4PTS A;  4E68 A;  3F0I A;  2B7K A;  1MD3 A;  2O7K A;  4WBR D;  2B5Y A;  3TDG A;  3HVV A;  1JHB A;  4Q5R A;  4J2F A;  2IJY A;  1M2B A;  3RHC A;  1GSD A;  2WUL A;  4IBP A;  3H4K A;  1V2A A;  5CRH A;  3ZLP A;  3EVI A;  3C1S A;  13GS A;  5E59 A;  1Y6E A;  2KOK A;  2L59 A;  3TKS C;  4J57 E;  1A23 A;  2IFQ B;  4L5O A;  5DDL A;  4MJC A;  4TN8 A;  1FVK A;  1F9M A;  3TOU A;  2HRN A;  2I3Y A;  4DSQ A;  4K7O A;  3KM6 A;  1S3A A;  3IOS A;  4OD7 A;  3TRX A;  1PD2 1;  2LJK A;  6GSX A;  4ZBA A;  3WGD A;  1SJZ A;  3TKS A;  1WOU A;  4K0G A;  3L78 A;  2H1A A;  5GSS A;  1G0T A;  4BL7 A;  5J47 A;  5CYY A;  1K0N A;  4JR4 A;  2VLV A;  2X8G A;  3HZ8 A;  3MWH A;  2LKU A;  2V32 A;  2YWN A;  1OC8 A;  2YV9 A;  2R0G A;  1GTI A;  3TCO A;  3IDV A;  4K1F A;  3GTU B;  3Q6O A;  4BWQ A;  1Y1U A;  2DJ0 A;  3HD5 A;  2OBK A;  3RPN A;  7GSS A;  4YKF A;  1VF2 A;  2XBQ A;  3D5J A;  1FO5 A;  4IKH A;  3A5I A;  16GS A;  3GA4 A;  4ZL7 A;  9GSS A;  4ECC A;  1HNA A;  4FYB A;  4NV2 A;  2VLT A;  4MF6 A;  1V9W A;  2H0G A;  3KH7 A;  1SJI A;  3IC4 A;  3UEM A;  4V1A g;  3SBC A;  4HJM A;  1TK8 B;  4OCF A;  4DVC A;  4V2L A;  4Z7X A;  1DUG A;  4AKG A;  4ZB8 A;  2OJL A;  5A1N A;  4ML1 A;  1XVW A;  1Z6M A;  2FWG A;  5LCZ A;  3EWL A;  3GH6 A;  3A2V A;  4OFT A;  1HYU A;  3EU4 A;  3RHB A;  3UMA A;  3D22 A;  4NWY A;  1LBK A;  2LNS A;  2YNX A;  2LRC A;  1K0O A;  2V1M A;  4TKY A;  3TKR A;  2N5B A;  4I5Q A;  2FWE A;  4MJE A;  1SYR A;  4KDY A;  2OAC A;  2O85 A;  3CBU A;  5ECO B;  1SD9 A;  3KZQ A;  4TXV A;  1YJ6 A;  1EV9 A;  1OC9 B;  3IA1 A;  4HJ2 A;  6GSY A;  4KF9 A;  5G1K A;  1TRU A;  2EIO A;  5L71 A;  4E8E A;  2QSI A;  4TR0 A;  4DSS B;  5DVB A;  1M2D A;  4ZXG A;  2H66 A;  2WFC A;  1M99 A;  1USB A;  3ZTL A;  4YQU A;  1Z7P A;  3C7M A;  3APS A;  3UAP A;  1A8Y A;  2FWH A;  2F51 A;  1JFU A;  2TRC P;  3GH9 A;  1J9B A;  5B8B A;  1GLP A;  3QAV A;  1M9B A;  2VD1 A;  1N2A A;  3DEX A;  3FK8 A;  5CRG A;  4WXT A;  4HZ2 A;  11GS A;  1GSQ A;  1FVJ A;  2DC5 A;  2ZNM A;  1G6W A;  4PUA A;  2HSM B;  4FYU A;  4HDE A;  1AUC A;  3U6V A;  4BA7 A;  1QQ2 A;  3IHQ A;  3GKX A;  3GFK A;  1TU7 A;  1Y25 A;  3CXG A;  4GRF A;  3FW2 A;  4WF4 A;  1A0R P;  1HNC A;  4POL A;  3GKM A;  4AI6 A;  3FYG A;  1X5C A;  3KIJ A;  1HNB A;  2CX3 A;  2MYG A;  3UAR A;  4NXI A;  2MMZ A;  1T7P B;  5ECN B;  4WR5 A;  1GNE A;  2CZ2 A;  4KAE A;  5CP1 A;  2LS5 A;  1XW9 A;  3KEB A;  2GZY A;  2LTK A;  4KSM A;  1OC9 A;  3CMI A;  1WPI A;  2AUV A;  2NPB A;  4EF0 A;  3O6T A;  5A4U A;  4DSS A;  1PKW A;  3KXO A;  3VFI A;  1EZK A;  2LEG A;  3APO A;  3M9J A;  2VO4 A;  4I6X A;  3RPP A;  3LWA A;  4K5S A;  3I69 A;  1WIK A;  1LJR A;  4LMW A;  1XCC A;  4XS1 A;  5F07 A;  3VWW A;  4LLR A;  2MBS A;  2JZR A;  1PSQ A;  4AGS A;  5D8I A;  2GSR A;  1A8L A;  1MEK A;  1ZYP A;  2GS3 A;  1XVQ A;  3KD0 A;  5IPH A;  3LYP A;  2B3S A;  5B6N A;  4K2D A;  2FWF A;  2XPD A;  3MDK A;  1VRS D;  1A2J A;  4XCS A;  1SVO A;  5J41 A;  4LL4 B;  3D0Z A;  5H5S A;  2P5Q A;  4KA0 A;  1NHY A;  2OAD A;  2LJA A;  5ECQ B;  3W8S A;  1Q4J A;  2HSM A;  1GP1 A;  3L9V A;  1EWX A;  1YDK A;  4XS6 A;  1N8J A;  1FB0 A;  2OKA A;  5JCW A;  2REM A;  3UVT A;  2C80 A;  1XWB A;  3CSI A;  4KDU A;  1QFN A;  5DBQ A;  4K7I A;  3TKQ A;  4GSN A;  1B48 A;  3QD9 A;  2R37 A;  4AKX B;  2JZT A;  2HSN B;  2EIQ A;  4PUF C;  2HNL A;  3TOT A;  4MDC A;  2GTU A;  4QL7 A;  2O5V A;  5DJL A;  2EFE A;  4GSS A;  3E0U A;  1T3B A;  4N0V A;  2EFH A;  1G6Y A;  3IXR A;  3LXT A;  4HQZ A;  3UBK A;  3O3T A;  2R0P A;  3QCP A;  4G01 A;  1ZMA A;  2LNT A;  5GZZ B;  1T4Y A;  1X5E A;  4ECJ A;  3M3M A;  3F4S A;  1NHO A;  5A5H A;  1ON4 A;  4ID0 A;  4L8E A;  2VCT A;  3UVH A;  5A34 A;  2QKE A;  3QDN A;  1KTE A;  1M2A A;  5ELA A;  2XBI A;  1DSB A;  5BMU B;  4IQA A;  1UN2 A;  3KCM A;  2F8F A;  4RUV A;  2OE3 A;  4WBJ A;  4KSO A;  4ECB A;  3CRT A;  3GST A;  2EIR A;  2K18 A;  4MNN A;  5IMF A;  2X8C A;  3VWU A;  4ZB6 A;  4ACS A;  4MLY A;  1PKZ A;  3A3T A;  3LQ7 A;  4KDX A;  4XRD A;  2ON5 A;  2HRF A;  4FO5 A;  1HD2 A;  5D9V A;  3FR3 A;  2H19 A;  4XS4 B;  4KUN A;  17GS A;  1SYX A;  3GHA A;  1ZYN A;  1BF5 A;  2B1L A;  3UIW A;  1HQO A;  1R26 A;  3FRC A;  1B9X C;  4CY8 A;  3I9V 2;  2R2J A;  4V2N A;  1PA3 A;  3Q19 A;  1MDJ A;  1JZD A;  3NOF A;  1J08 A;  1JLW A;  3JCM L;  4AKI A;  2HSN A;  3E3E A;  3HVX A;  2IMK A;  3F8U A;  3WGE A;  2F8A A;  5H5Q A;  4L5L A;  5J4U A;  5JWR B;  1K0M A;  4X43 A;  4G0K A;  1BX9 A;  3D4T A;  3IC8 A;  2VL9 A;  3TU3 B;  2DLX A;  2JSZ A;  1UC7 A;  2WCI A;  1GSS A;  2FY6 A;  4QMK A;  3ERW A;  5COH A;  1GWC A;  4QQ7 A;  2HRA A;  3TRQ A;  2BTO T;  2PVO C;  2CAQ A;  5IIZ A;  1EEJ A;  1K3O A;  4Z2T A;  3F6F A;  4GCI A;  3GUS A;  5DJM A;  1KEB A;  2HZF A;  4KW6 A;  5DAK B;  1T4Z A;  1VF4 A;  2R6K A;  1F37 A;  2JL4 A;  1NW2 A;  2GSS A;  1K0C A;  1BG1 A;  4RI7 A;  1Z6N A;  5G30 A;  3O76 A;  2L4C A;  1B4P A;  4D73 A;  6GSV A;  2OE0 A;  2PGT A;  4OWY A;  1QUW A;  3N9J A;  3US3 A;  4GQF A;  1BG5 A;  3ZIT A;  1MTC A;  4BWS A;  3WT2 A;  1F3B A;  4IP1 A;  1XWA A;  3TUE A;  4EUY A;  5HFG A;  3FHK A;  4ECI A;  1URM A;  2GVP A;  2BMX A;  1G7E A;  4NMU A;  2GZZ A;  4G0L A;  5B6M A;  4L0W A;  4OFM A;  2V2G A;  5AIX A;  3ME7 A;  1ZGN A;  4TW5 A;  4N11 A;  5HR3 A;  3VPT A;  3F6D A;  1V58 A;  2R0C A;  1PN9 A;  2LJR A;  3TJK A;  1XIY A;  3H1N A;  5HQP A;  2V6O A;  3PR8 A;  18GS A;  1WE0 A;  4MH2 A;  1TRV A;  2C8U A;  4POM A;  3KP9 A;  1XOA A;  2L57 A;  3F3R A;  4N0Z A;  1MDK A;  1SKR B;  3QAW A;  1X9M B;  5CO3 A;  2OE1 A;  5HR1 A;  1EV4 A;  4KGI A;  1W89 A;  2KP1 A;  3TJF A;  5D96 A;  3C8E A;  2HSH A;  3LYK A;  1T1V A;  3EUR A;  2B6M A;  2H30 A;  2JZS A;  1AW9 A;  2B5X A;  4MH3 A;  2XPE A;  2V6K A;  5D9W A;  3G7I A;  1X9W B;  4N3Z A;  5KOX A;  2J23 A;  2H75 A;  4IEL A;  1TRS A;  5ECK B;  4KND A;  1XWC A;  2MMO A;  4Q5N A;  3Q74 A;  4DEJ A;  3LEF A;  3ME8 A;  1TTZ A;  3DRN A;  2DJ2 A;  3QFA C;  4EDY A;  3M9K A;  3D21 A;  3DYR A;  3L0H A;  5IMV A;  4ZB7 A;  1A2L A;  3BOA A;  2GT5 A;  1CQH A;  3EPT A;  2OT3 A;  2DSA A;  4GF0 A;  2C0D A;  2YJH A;  3R2Q A;  3F4R A;  1QXH A;  1UA5 A;  3ZRE A;  4F0C A;  1QK8 A;  3LJR A;  1EP7 A;  5BRT A;  1ML6 A;  4F0B A;  1Q98 A;  2X64 A;  1PN0 A;  4LMV A;  2JU5 A;  4GWR A;  3BCI A;  4FYC A;  4TVE A;  2YWM A;  2QC7 A;  3EC3 A;  1ERU A;  1XWK A;  2GDR A;  4IVF A;  1ABA A;  2FCH A;  1PX7 A;  3ZIJ A;  2PN8 A;  3IK9 A;  4PXO A;  1ZL9 A;  4PGT A;  4YH2 A;  3TJJ A;  4JZQ A;  1GUK A;  5AIV A;  1SK1 A;  2IFQ A;  2FHE A;  4ULX A;  4EDZ A;  1TK5 B;  2K8V A;  6GSW A;  4V1A p;  4IN0 A;  4X1U A;  4PQI A;  2GZP A;  2B7J A;  1VF1 A;  1AAZ A;  3KTL A;  3DVX A;  3BBY A;  4KE3 A;  2C0G A;  1AIU A;  3KH9 A;  3FMW A;  4XTS A;  1N25 A;  2PUK C;  3DD3 A;  5JCG A;  1TDI A;  2YOI A;  2VCW A;  1U6T A;  4NHW A;  2FD3 A;  2HYX A;  2MZC A;  1ERW A;  4MMM A;  3CTG A;  5G5F A;  3WT1 A;  3F3Q A;  1SL0 B;  1YEP A;  3FY7 A;  2VCZ A;  5A4W A;  3RDW A;  3KMN A;  3GX0 A;  5KN2 A;  2DJK A;  2O89 A;  1K0A A;  5JWO B;  3MSZ A;  3GTU A;  2NBS A;  1RW1 A;  2PVQ A;  1X0R A;  4OMV A;  4NAX A;  3W6G A;  2ZUP A;  2YPM A;  2L6D A;  2DKH A;  1XWG A;  1OE7 A;  1ZCP A;  5DQS A;  2PBJ A;  2ES7 A;  4IGJ A;  2YCD A;  2EFD A;  1OKD A;  2MMN A;  2VM2 A;  1XOB A;  5IMD A;  1EEM A;  3L4N A;  1M9A A;  3KJY A;  4WET A;  3LFL A;  1SEN A;  2P5R A;  4TXO B;  2CT6 A;  5HR2 A;  1YKA A;  1XW6 A;  2V41 A;  1MD4 A;  1XPV A;  1THO A;  2DJJ A;  4K5R A;  1IYI A;  4H86 A;  1AXD A;  3ZZX A;  4KB3 A;  2GQL A;  3DKS A;  1BYE A;  2QGV A;  4YQM A;  2VKZ G;  4USS A;  5IMC A;  2CVD A;  5IM9 A;  1JZO A;  1YEX A;  1R4W A;  2DJ3 A;  2LRN A;  2L4Q A;  4IQ1 A;  1ZZY A;  2I81 A;  4DSR A;  5IO2 A;  1JZR A;  5KN3 A;  3LG6 A;  1FOH A;  3QR6 A;  3FZ5 A;  2AYT A;  5ECS A;  2A4H A;  4G10 A;  5JWQ B;  2I9H A;  3C1R A;  4XHM A;  1SL2 B;  1SK0 A;  3BCK A;  8GSS A;  4PQ1 A;  5KEJ A;  3ERF A;  1O7U A;  2G0F A;  3PPU A;  1ERV A;  3C71 A;  3LGC A;  1GUL A;  2H6X A;  3GN3 A;  3WYW A;  5A5K A;  2L6C A;  5ECL B;  2KLX A;  1TKD B;  1U87 A;  3VK9 A;  3FR9 A;  1BJX A;  1QGV A;  5IMZ A;  1GTB A;  1C72 A;  3GX8 A;  1SD8 A;  2C0F A;  3HJO A;  2AHE A;  1PX6 A;  3PIN A;  4HZ4 A;  1TI3 A;  5D93 A;  3FZ4 A;  1FB6 A;  3H79 A;  2JAD A;  3ZYW A;  4OO5 A;  1TU8 A;  2RLI A;  1GTA A;  3PGT A;  2WRT A;  4KX4 A;  5EL8 A;  4HU7 A;  2C3Q A;  2C3N A;  1V40 A;  1ZYE A;  1GH2 A;  1O85 A;  1YF1 A;  4EC0 A;  1W4V A;  2HQT A;  4ZBB A;  3UJ1 A;  2FUG 2;  4A5P A;  4AJ6 A;  3M8N A;  1K0D A;  1XW5 A;  5AGY A;  3SWL A;  4AJ7 A;  3UOM A;  3G9B A;  4CHS A;  1THX A;  4I8B A;  1PGT A;  5KN1 A;  3A2X A;  2HE3 A;  4CDO A;  3GYK A;  4BPY A;  3ED3 A;  1O6J A;  2VOC A;  4F82 A;  1A0F A;  3IRA A;  2P0G A;  1J0F A;  1GSE A;  1FHE A;  1NM3 A;  5DQY A;  2NTO A;  4IP6 A;  3KMO A;  4BVX B;  1QMV A;  2D2Z A;  2H70 A;  5EY6 A;  3KGK A;  1KNG A;  3TJG A;  3GSS A;  4Z2U A;  3HVS A;  3GKK A;  3HJP A;  1AQV A;  5ELG A;  2M72 A;  2TRX A;  3D6I A;  4I2T A;  14GS A;  4MZW A;  4LL1 B;  2YV7 A;  1WRY A;  2VCV A;  2YJ7 A;  3VI7 A;  4F2I A;  3IAS 2;  5J5N A;  2HFD A;  2PWJ A;  2E0Q A;  2CX4 A;  3HMJ G;  4LA1 A;  4XRA A;  1ERT A;  2VL3 A;  3H93 A;  2MBT A;  2A2R A;  3GL5 A;  2HZE B;  5LNK e;  1YKC A;  3P8W A;  2C1Y A;  3BD2 A;  4MAB A;  4HEA 2;  2K6V A;  1H4O A;  5HR0 A;  2I4A A;  2AAW A;  4K8M A;  1K0B A;  1Z7R A;  1PMT A;  4AKH A;  3CSJ A;  1GL8 A;  2VCQ A;  4GQC A;  4GTU A;  5DAL B;  1TW9 A;  1ZOF A;  4BVY B;  4POB A;  5F05 A;  1TXX A;  2RUF A;  2LQO A;  3HJM A;  2CA8 A;  4MF7 A;  3MAK A;  5ABR A;  2CAI A;  4EIP A;  2RII A;  3S9F A;  2IME A;  5E4W A;  4PQH A;  5HFI A;  2GLR A;  4MP4 A;  2HXK A;  4IS0 A;  2DBC A;  3GKN A;  3F63 A;  2KHP A;  2HRK B;  3KTB A;  2H0I A;  1XFL A;  5ECP B;  1BAY A;  2FA4 A;  1U88 A;  4MA9 A;  4K0N A;  3FZA A;  5FHI A;  4QL9 A;  4WKW A;  5BMU A;  4IJ3 A;  3ZVJ D;  1EOH A;  4PUR A;  6GST A;  4JRR A;  1SU9 A;  4MPG A;  3P7X A;  1AQW A;  4O5R A;  2YZH A;  2H76 A;  1VF3 A;  5INY A;  2B5E A;  1YF0 A;  2WB9 A;  3ISO A;  3ZIV A;  3IHG A;  2GGT A;  5CRE A;  3HCZ A;  4XS4 A;  5CAX A;  3MIX A;  2C0E A;  4MPF A;  3HY2 A;  2GT6 A;  2WDU A;  2VD0 A;  5HFK A;  3ERG A;  5DAL A;  2X49 A;  5C04 A;  4BVY A;  3WGX A;  2I1U A;  5EPF A;  4IJI A;  5CRW A;  3TGZ A;  5LD0 A;  1FAA A;  4AJ8 A;  5ECM B;  4ML6 A;  4K7N A;  2IIY A;  4O5Q A;  3UBL A;  2VLU A;  1OAZ A;  1ILO A;  5F0G A;  3EMP A;  3MYD A;  1KBN A;  2JAC A;  4AF2 A;  4KCE A;  1OE8 A;  2IMF A;  2A4V A;  4JE1 A;  2HRK A;  2CV4 A;  1MDI A;  4IHU A;  2L5O A;  1K3Y A;  4ILF A;  3F9U A;  4YAP A;  3WD6 A;  2VUP A;  1S3C A;  5J9C A;  1O8X A;  5AIS A;  4HU9 A;  4MCU A;  3CWG A;  2YZU A;  2QA2 A;  1GSU A;  2H72 A;  4O32 A;  3LSZ A;  2L5L A;  2ZCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...