1BYEA

Glutathione s-transferase i from mais in complex with atrazine glutathione conjugate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
213
Chain Sequence
b'APMKLYGAVMSWNLTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERPSVQKVAALMKPSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Structures of herbicides in complex with their detoxifying enzyme glutathione S-transferase - explanations for the selectivity of the enzyme in plants.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 65
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1byeA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1byeA01
4PNFA 1WE0A 5IMVA 3UAPA 2N5FA 1T4ZA 1TTZA 3WGEA 4WF4A 1OE8A 3WD6A 2I1UA 3N5OA 3TKRA 3TRPA 2E0QA 4KB3A 5G1LA 4F0BA 1OC8A 4TRXA 2B1LA 3P7XA 3PPUA 3GL5A 2VM2A 2QSIA 5BMUA 1J9BA 1ST9A 4POMA 4N11A 1NHOA 4N10A 3IE3A 1ML6A 2LNTA 1VF2A 4V1Ag 2G2QA 3LQ7A 5EL8A 2P31A 4MZBA 4KX4A 1RK4A 3LYPA 2PPTA 2X99A 2C0GA 1OC9B 4I6XA 5IO0A 2WS2A 3HA9A 1XWGA 3H79A 4POBA 5DQYA 3O6TA 1GTAA 2OKAA 3HDCA 2F9SA 2IMDA 2DMLA 1OC9A 2NPBA 3LFLA 5AGYA 4O32A 1USBA 3F4TA 3FZAA 2B5EA 3HY2A 3KTLA 4K1FA 2OACA 1SU9A 2H72A 3HXSA 3VURA 4IJ3A 1X5DA 4TR3A 2VLTA 4Z7XA 5ABRA 2PVQA 3L0HA 1M7TA 3LYKA 3HVVA 2VCVA 4PTSA 1ACVA 3LJRA 3UBLA 1ILOA 2OE3A 2X8CA 3FR9A 1GULA 1F9MA 5ECOB 3DIEA 3HJMA 2H1GA 20GSA 1ZYEA 2DSAA 2YZHA 4XS4B 13GSA 2MZCA 12GSA 3F3QA 4EKZA 4KDYA 1BAYA 2WB9A 1X5CA 1M9AA 1G6WA 2C0DA 4KAEA 4EDYA 1O6JA 4XS4A 2K8VA 1GLQA 4G0KA 5D9XA 2VCWA 5JCUA 3ZVJA 2PGTA 1HNAA 2YANA 5ECKB 3TOTA 4N0ZA 5HFKA 4PURA 4BVYB 3IK7A 4MPGA 1GSFA 1JFUA 2HT9A 4I2TA 2MBSA 2GTUA 1XPVA 3BD2A 1YKAA 4IGJA 1N2AA 2DC5A 6GSTA 3UARA 4BVYA 3NIVA 3KMOA 3GNJA 3ISOA 1R5PA 4NAXA 1LJRA 1A24A 1TW9A 3CYNA 4ISDA 2I4AA 3H93A 1Z7RA 4OCFA 3DWVA 3S9FA 22GSA 4MDCA 1EGRA 1F37A 1K0AA 4ZBAA 2KOKA 3UVTA 4D73A 4MH3A 5JWRB 2VCQA 4MJEA 2FWHA 2IMIA 2YN1A 4MCUA 2PBJA 1FG4A 1GUHA 2LJRA 3GURA 1SD8A 3ZVJD 2I81A 3G7YA 3ERGA 4NHZA 2R4VA 4TXOB 3PGTA 3ERFA 3UEMA 5CRHA 1YDKA 5IM9A 1JZOA 4HS1A 1ZOFA 4BPYA 3QD9A 4PNGA 1X0RA 4EE0A 5AN1A 2IIYA 3CTFA 2H8LA 4PQHA 6GSYA 2JSYA 3RHCA 3ZFBA 4ULXA 3KMNA 2FNOA 3R2QA 4ACSA 3L9UA 1EV9A 2O8VB 2QKEA 2R5GA 1O8WA 3ZTLA 2N5AA 4I8BA 3OR5A 3M9JA 3UVHA 5KEJA 2R2JA 3HZ4A 4JRRA 2PN8A 4MMMA 2DIYA 1AQVA 1V57A 3KM6A 1GTBA 3FK8A 4N0VA 2CZ3A 3ZITA 4ID0A 3ZZXA 1WOUA 4DEJA 4L0UA 4ZL8A 1TI3A 1XXUA 2FCHA 1TU8A 2BJXA 3KP8A 2H75A 1T00A 1WRYA 3GA4A 4Q5NA 2LRNA 5KN1A 1F3BA 3VLNA 2OBKA 3FYGA 4BWQA 1XWAA 3GMFA 2N5BA 2CA8A 4GWRA 3LSZA 3ZRDA 5F06A 1QFNA 1SK1A 4IQAA 4USSA 4OMVA 2R37A 3VI5A 3WGDA 2CVDA 1F3AA 5IMCA 4K9ZA 5GZZB 4MP4A 4MA9A 1GLPA 2DBCA 4WXTA 2O87A 2QGVA 1Z5YE 2IMKA 1Y6EA 2LUSA 2KUCA 3LWAA 3BJ5A 3TKSE 4XRAA 3HZ8A 4OFMA 1PGTA 4JEDA 5G30A 2JSZA 2A2SA 2WGRA 1XW9A 6GSXA 4XCSA 3GHAA 5C00A 5B8BA 2LQQA 4ML6A 4J57E 4IP6A 1VF4A 4TR4A 4F9ZA 10GSA 5ECQB 1THOA 2F51A 5G1KA 5GAPD 6GSUA 3QDNA 2HRFA 3DYRA 5D73A 3GIXA 4KDUA 1AXDA 2DJ2A 1PKWA 2HYXA 4K8MA 3QR6A 5IPGA 5FT3A 3M3MA 2JU5A 3ED3A 1ERUA 3QFAC 3BCKA 2HSMB 3HVSA 3ZREA 3EWLA 2OE0A 1UC7A 1JZRA 2IMFA 2HSMA 1EEMA 4JBBA 1VRSD 5E59A 1U88A 2H6ZA 3GH6A 2TIRA 4X0XA 1PL1A 4NHWA 2J9HA 3SWLA 2FWGA 4DSSA 2ZUPA 1XBSA 1YY7A 3ZL5A 2H01A 1NM3A 2IJYA 2GT6A 1H4OA 2C3NA 3KH7A 1FVKA 2LQOA 2F3MA 5C04A 2FY6A 1BG5A 4G2EA 1PQNA 3DVXA 1AAZA 3VWWA 3F3RA 2R6KA 5DJMA 4K0NA 4F82A 2ZCTA 3IHQA 4WF5A 3JCML 1M9BA 4IQ1A 1WIKA 19GSA 3KCMA 3VWUA 3J7Yk 2F8FA 2VM1A 2IWTA 3IC4A 1SL2B 1VGLA 2VCXA 3D4TA 2VD0A 5AIXA 1O7UA 18GSA 3U6VA 2DJ3A 4TR1B 1UA5A 4K7NA 3GSSA 2HI7A 2C4JA 1DE1A 2C0EA 2GGTA 5ID2B 4Q5FA 1JLVA 3EYTA 4LA1A 5HFIA 5DDLA 4TR1A 2L6CA 4XS1A 2H0GA 5IMDA 1DBYA 5DJLA 1SL1B 7GSSA 3Q19A 2A4VA 1U3AA 1TRUA 5ID2A 3NOFA 2B5XA 3GL3A 3NZNA 2LSTA 3FZ9A 3TKSA 3TJGA 2FWFA 2H30A 2L4QA 2LRTA 1JZDA 4NMUA 3H4KA 5D9WA 1PA3A 3W6GA 1R4WA 1YJ6A 3EC3A 2P0GA 3US3A 2AYTA 2B7JA 5E4WA 1E2YA 1G0TA 2L57A 1OE7A 5AIVA 4RQRA 2C1YA 3RBTA 1YEXA 1PRXA 2YV9A 1AC1A 1XVQA 4BA7A 1SJIA 2IPAA 5HFGA 3F4SA 3CBUA 1THXA 4QL7A 4WEYA 4ZB9A 2VO4A 1A0FA 2RUEA 2K9FA 5J4UA 2MMZA 3HJOA 3GKMA 1EGOA 4F03A 3EU3A 3C71A 3MAKA 4LMWA 2M46A 2REMA 1B4PA 3GKXA 4GF0A 2AV4A 3I43A 4FYCA 2FWEA 2OE1A 1BQ7A 2GQLA 1JHBA 4AGSA 3APQA 1FW1A 4QQ7A 2O7KA 2GSQA 2ZNMA 4YH2A 2B6MA 1K0MA 2HE3A 3QAGA 4F0CA 3C73A 2WZ9A 1KNGA 1ZYQB 3LGCA 4IW9A 2A2RA 3EURA 3M9KA 4CW9A 1K0OA 4MH2A 4K7OA 2KP1A 3L9SA 1IYIA 1TJDA 5D8IA 4KW6A 5H5QA 2C3QA 3IBHA 1K0BA 1ERTA 1U6TA 3CTGA 4OFNA 1HD2A 3F0IA 2IMEA 4TW5A 4V2LA 4GQCA 1G7EA 4K7IA 2ES7A 1O73A 2VD1A 1CQHA 4J56E 3IXRA 2PMTA 1M2AA 5FWGA 2VIMA 3IAM2 2LS5A 5AISA 3CRTA 1T1VA 3LXZA 1PKZA 1EEJA 1YKCA 1ZCPA 1XWKA 2AAWA 5IO2A 1B9YC 1H75A 3LXTA 4ECIA 4MJAA 1TK5B 3P8WA 2VCTA 2V32A 5HR2A 1BX9A 2VLUA 5J9BA 2GS3A 1OC3A 3M0FA 3F9UA 2GVPA 4GSSA 5D9VA 4KNDA 1Z9HA 1OKTA 5CRWA 3EE2A 1DE2A 1FAAA 2OBIA 3KH9A 4BL7A 2JACA 1V40A 2H1DA 4EO3A 4FQUA 4YQMA 2GQKA 3DMLA 4HJ2A 4RQXA 1LU4A 1EP8A 5KN0A 2I3YA 4D73B 3C1SA 4V1Ap 5H5SA 1GNWA 4ZIJA 3K8NA 1GSEA 4MJCA 4IHUA 4WETA 1SD9A 3CSJA 1U3IA 4RUVA 2MBTA 4JU5A 4ML1A 5GAND 3Q18A 3UL3A 2YJ7A 2VL3A 5A4UA 2MMAA 1M2DA 2JZTA 2VL9A 2H76A 3QMXA 2YZUA 1X5EA 3BOAA 3ZIVA 3WT1A 2H70A 4ZL9A 2IFQA 2H71A 5B6NA 3L4NA 4JZQA 3QFBC 3EVIA 2V41A 1HYUA 1QGVA 5ELGA 5DCHA 3TRQA 5JWOB 1K0NA 1ON4A 1RW1A 2L59A 3ERWA 3APSA 3E9JB 1GSQA 2B1KA 3ZLPA 5B7CA 1K0CA 3VI7A 4Q5RA 3A3TA 1TKDB 3DRNA 3CSHA 1A8YA 3HCZA 3A2XA 4HUAA 4HI7A 2C8UA 4PQ1A 2GLRA 1BYEA 5ECNB 2ON7A 1JZWA 1GSYA 2P5RA 2ALBA 1S3CA 5J3RA 2X64A 3VWXA 2EIQA 2H1AA 1MD3A 1ERWA 3FHKA 4KCEA 4F2IA 2L5OA 3E0UA 1CQGA 4KDXA 5G5EA 5IPHA 2TRCP 4MJBA 4MZCA 4NPBA 1Z6NA 1WJKA 1B4QA 4XIHA 4GTUA 4L8EA 2E2MA 2H0HA 1K3LA 4G0LA 1XZOA 4WBRD 4K0GA 5H5RA 4MPFA 4OCEA 1S3DA 6GSSA 1TP9A 5EPFA 1C72A 1SJ6A 4X1UA 1ZGNA 1T4YA 2RM6A 4OFTA 1DUGA 4PGTA 2M72A 2DJJA 2YCDA 3D0ZA 1FB0A 2CAQA 3DKSA 3EMXA 4OD7A 1FOVA 3A5WA 1R7HA 2H66A 3D22A 1LBKA 2K18A 1O8XA 3RPNA 2DJ1A 4EC0A 4E8HA 3GSTA 2DJ0A 2I9HA 1QUWA 1T8EB 16GSA 2QC7A 3IC8A 1GL8A 2V1MA 2FUG2 1TDIA 3DGQA 5F05A 1QMVA 2KP2A 1G7OA 1SJZA 4ZBDA 1XCCA 4L0WA 1NW2A 3ZIJA 2ON5A 3D21A 1OVNA 4BVXA 1GUKA 4ECBA 1UN2A 4HQZA 3GH9A 2GT5A 5F07A 1TI1A 1TRVA 5CNWA 5IMZA 3GTUB 2YV7A 2K6VA 2KHPA 4ECJA 1SKRB 2TRXA 5B8AA 2CAIA 2AHEA 1MEKA 1TRWA 1J08A 1XW5A 5GSSA 3FW2A 3GTUA 1A23A 3KP9A 1XW6A 2K8SA 3PR8A 1KEBA 3D5JA 2L6DA 2HZFA 4TR0A 1GNEA 5KN3A 1M99A 2YWMA 4OO5A 2HRKB 3F4RA 2WCIA 1ZMAA 2VUPA 4H86A 1V9WA 2YWIA 1MTCA 4KSMA 2OADA 5ECLB 2HRKA 1XIYA 1EOGA 3QAVA 1J0FA 4NWYA 1GRXA 4I2UA 2NBSA 1Q4JA 3M1GA 1AQWA 2RUFA 4I5QA 3FRCA 2LJKA 4DSSB 3ME7A 3EMPA 4FYUA 3TKSC 5CREA 4NV5A 1PX7A 2YJHA 2X8HA 3PINA 1EV4A 1SKWB 2F8AA 2B7KA 4XS6A 4YAVA 5F8BA 3IAS2 5CO3A 2CVKA 4LMVA 2RIIA 2V6KA 3HD5A 5ELAA 3KIJA 1ABAA 1V2AA 2LJAA 1BJXA 3FR6A 1GSSA 5EVOA 1B9XC 3TJBA 4MF5A 3I6AA 3FEUA 1Z7PA 3KJYA 3C7MA 2FLSA 1YQ1A 2PERA 4IP1A 4MABA 4ZILA 3I69A 3FZ5A 1A0RP 1V98A 3KZQA 1Y25A 5HR3A 3UJ1A 1A2LA 3QAWA 5F0GA 2C0FA 2HRAA 1SL0B 3HHVA 2V2GA 2GQMA 3VFIA 4HZ2A 4NV2A 4GSTA 5G31A 1XVWA 3I9V2 1TK0B 2CX4A 4GRFA 17GSA 1S3AA 4E8EA 3ZMKA 4EDZA 4LLRA 2CZ2A 2HNLA 2E2GA 4WBJA 1YZXA 5LD0A 4WR5A 5IMAA 2RM5A 3GRXA 4AJ8A 2XPEA 3A2WA 3UOMA 3DXBA 4X43A 2MYGA 1G6YA 4IJIA 2XBQA 3TOUA 3A2VA 1SENA 3RHBA 1WWJA 3WGXA 3QCPA 3ZMLA 1HNCA 2UZ8A 2HXKA 1HNBA 3GYKA 3C8EA 1TOFA 3TJJA 4O5RA 5DALA 4HJMA 4POKA 3TKPA 3UIWA 2GDRA 3Q6OA 3MSZA 1NHYA 5EY6A 1TK8B 1I5GA 2L5LA 5ECHB 4ILFA 1UVZA 1Q98A 3KXOA 4TN8A 1SK2A 3WYWA 4GXZA 3GKNA 2Z9SA 3CRUA 4TVEA 1I9DA 3RAZA 2VCZA 2H19A 1W89A 4HZ4A 2PWJA 3TJKA 1XOBA 2FGXA 5CAXA 1XFLA 5D93A 2OA7A 4GQFA 5FHIA 4L5OA 2CX3A 2VL2A 4PXOA 4N30A 2GZYA 4LL4B 1A8LA 2GZPA 3ME8A 4HOJA 5IOWA 3W8JA 3GX8A 5A5KA 3TCOA 4G0IA 4G9HA 4XRDA 1GTUA 4KF9A 1YF0A 5JCWA 3IOSA 2B5YA 2GSTA 4HDEA 1WP0A 3CXGA 1Z6MA 1SYXA 4WKWA 4IELA 4ECCA 1ZZYA 2OJLA 1SK0A 4DSQA 1U87A 2O89A 2FHEA 1ZL9A 5DBQA 2HSHA 1PL2A 3LG6A 3GX0A 3HYPA 2HSYA 4ZB8A 1K3YA 5HQPA 5ECRB 5G2ZA 1DSBA 2FA4A 3KGKA 3IA1A 4KE3A 4MK3A 3CMIA 3G9BA 2EC4A 4EVMA 2H6XA 3U5RE 3DD3A 5DCGA 6GSVA 1X9WB 3FZ4A 1GH2A 4V2NA 3G7JA 4J2FA 3TUEA 2VOCA 2X8GA 3W8SA 5ECMB 2IL3A 4BL7B 1GWCA 1F6MC 4G10A 2L4CA 3KD0A 4FIWA 2LTKA 5IMFA 3TKQA 1FO5A 3KTBA 3SBCA 5A4WA 3C1RA 2DMMA 4KA0A 1SKSB 2JZSA 4ZBBA 2HRNA 2AJQB 2JL4A 3IK9A 2LNSA 1EOHA 3BCIA 4ZL7A 2D2ZA 2WDUA 3GKKA 2C3TA 4P3YB 1OKDA 5DAKB 2NDOA 1RQMA 3HKRA 1T3BA 2KLXA 4RI6A 5CYYA 4WR4A 2YOIA 5DAKA 5G5FA 2IFQB 1MDIA 1KTEA 2XBIA 3GFKA 5J5NA 2CV4A 2EIRA 3VWVA 4Q5QA 1VF1A 4RI7A 4TOPA 4HU7A 1WMJA 2BTOT 2YPMA 5COHA 1FB6A 1ERVA 4MF6A 3UMAA 4YQUA 4JE1A 1V58A 14GSA 1XWCA 4AF2A 4JR6A 3LEFA 11GSA 1FHEA 1AQXA 3VPQA 4FYBA 3V1WA 2HSNB 1T7PB 4G19A 5LCZA 1PMTA 5JCGA 1EZKA 4OWYA 4KCAA 1NSWA 2FA8A 2CQ9A 3EU4A 3ZYWA 3TJFA 5IOXA 1GSDA 1PN9A 2EIOA 2GSSA 2LEGA 4XHMA 3HVXA 2YP6A 4TXOA 2MMOA 1A2JA 2O85A 5ECIB 3AY8A 4JR4A 1JLWA 4GSNA 1URMA 3L78A 1SYRA 2XC2A 3HJPA 3MWHA 3DVWA 5JWQB 4YQVA 3RDWA 4TXVA 3DEXA 1OYJA 3F63A 4HQSA 1R5AA 3FKFA 2DIZA 5HR0A 4TKYA 3GUSA 1PD21 1N8JA 2V6OA 3O3TA 4LL1B 4MZWA 4GLTA 1EP7A 3PH9A 1R26A 1VF3A 1GUMA 4AJ6A 3H8QA 4EL1A 3TDGA 4K6XA 2LKUA 2YWNA 1AW9A 1AIUA 5D96A 2WFCA 2JADA 1Z3EA 1GSUA 5ENUA 1XOAA 5ECSA 2B3SA 1GP1A 4L5LA 5CP1A 1YEPA 5L71A 5J9CA 1XWBA 4BVXB 3MDKA 1PSQA 3D6IA 8GSSA 5J41A 3F6FA 3P2AA 4IKHA 4DSRA 3H1NA 2VLVA 2NVLA 3EINA 3G7IA 3TGZA 3IPZA 5IIZA 1TU7A 2CVBA 2H1BA 5DQSA 1X9MB 2IN3A 2H0IA 5A4VA 1W4VA 3N9JA 5INYA 3IDVA 2AUVA 1B8XA 3BBYA 4IBPA 2YNXA 4IN0A 5B6MA 5LNKe 3APOA 4AJ7A 1KBNA 2FD3A 2HLSA 3VPTA 1BEDA 1O85A 9GSSA 3VK9A 3Q74A 2LV3A 5KN2A 1QQ2A 4KGIA 4PUAA 2G0FA 2WRTA 4MLYA 4MF7A 4NXIA 3P90A 3E3EA 1PX6A 2XPDA 3F8UA 4QL9A 2RLIA 4O7HA 2HZEB 1EWXA 1X9SB 3IV4A 4KSOA 4IVFA 2PUKC 2MMNA 3WT2A 1E6BA 3LORA 2LRCA 1MD4A 2YWOA 2HZEA 2CT6A 2J23A 3QOUA 1AUCA 2HQTA 1HQOA 1A2MA 1WPIA 1GTIA 4PX1A 4ZXGA 3IR4A 4YAPA 1TRSA 3O76A 5DVBA 1M0UA 4ZB6A 4O92A 3RPPA 2VAFA 2WJUA 2DJKA 4DVCA 4V2MA 4I97A 3TRXA 4KH7A 3TB2A 2GZZA 2R3XA 1F2EA 4CHSA 2PU9C 2WULA 2AB6A 3GN3A 3FR3A 2H74A 1YF1A 4KUNA 2M80A 2HFDA 4PUFC 1QK8A 4EUYA 1QXHA 5ECPB 2C80A 5HR1A 2H6YA 5GSTA 4FH8A 2P5QA 1K3OA 3GV1A 3MNGA 1K0DA 2XHFA 2GSRA 4HEA2 1OAZA 3M8NA 3L9VA 3CSIA 4BWSA 2VL2C 4PQIA 3IRAA 3F6DA 3ZFLA 3J7Yb 2NTOA 1TXXA 4HU9A 2JZRA 5IQYA 2H73A 5CRGA 3FY7A 4K2DA 4POLA 1B48A 3QPMA 3R3EA 4EXJA 5D9TA 1IYHA 6GSWA 2E7PA 1O81A 5DALB 3D4MA 5CRDA 4FO5A 2PVOC 2BMXA 1FVJA 4XTSA 3UBKA 4IS0A 1M2BA 4EF0A 1MDJA 3KEBA 2DLXA 4GCIA 4OO4A 1MDKA 4CDOA
chains in the Genus database with same CATH superfamily
4PNFA 1WE0A 5IMVA 3UAPA 3RFRC 2N5FA 1T4ZA 1TTZA 3WGEA 4WF4A 1OE8A 3WD6A 2I1UA 3N5OA 3TKRA 3TRPA 2E0QA 4KB3A 5G1LA 4F0BA 1OC8A 4TRXA 2B1LA 3P7XA 3PPUA 4GDFA 2VM2A 3GL5A 2QSIA 5BMUA 1J9BA 1ST9A 4POMA 4N11A 1NHOA 4N10A 3IE3A 1ML6A 2LNTA 1VF2A 4V1Ag 2G2QA 3LQ7A 5EL8A 4O5QA 2P31A 4MZBA 4KX4A 1RK4A 3LYPA 2X4AA 2PPTA 2X99A 2C0GA 1OC9B 4I6XA 5IO0A 2WS2A 3HA9A 1XWGA 3H79A 4POBA 5DQYA 3O6TA 1GTAA 2OKAA 3HDCA 2F9SA 2IMDA 2DMLA 1OC9A 2NPBA 3LFLA 5AGYA 4O32A 1USBA 3F4TA 3FZAA 2B5EA 3HY2A 3KTLA 4K1FA 2OACA 1SU9A 2H72A 3HXSA 3VURA 4IJ3A 1X5DA 4TR3A 2VLTA 4Z7XA 5ABRA 2PVQA 3L0HA 1M7TA 3LYKA 4O5UA 3HVVA 2VCVA 4PTSA 1ACVA 3LJRA 3UBLA 1ILOA 2OE3A 2X8CA 3FR9A 1GULA 1F9MA 5ECOB 5J47A 3DIEA 3HJMA 2H1GA 20GSA 1ZYEA 2DSAA 2YZHA 4XS4B 13GSA 2MZCA 12GSA 3F3QA 4EKZA 4KDYA 1BAYA 2WB9A 1X5CA 1M9AA 1G6WA 2C0DA 4KAEA 4EDYA 1O6JA 4XS4A 2EFDA 2K8VA 1GLQA 4G0KA 5D9XA 2VCWA 5JCUA 3ZVJA 2PGTA 1HNAA 2YANA 5ECKB 3TOTA 4N0ZA 5HFKA 4PURA 4BVYB 3IK7A 4MPGA 1GSFA 1JFUA 2HT9A 4I2TA 2MBSA 2GTUA 1XPVA 3BD2A 1YKAA 4IGJA 1N2AA 2DC5A 6GSTA 3UARA 4BVYA 3NIVA 3KMOA 3GNJA 3ISOA 1R5PA 4A5PA 4NAXA 1LJRA 1A24A 1TW9A 3CYNA 4ISDA 2I4AA 3H93A 1Z7RA 4OCFA 3DWVA 3S9FA 22GSA 4MDCA 1EGRA 1F37A 1K0AA 4ZBAA 2KOKA 4N3ZA 3UVTA 4D73A 4MH3A 5JWRB 2VCQA 4MJEA 2FWHA 2IMIA 2YN1A 4MCUA 2PBJA 1FG4A 1GUHA 2LJRA 3GURA 1SD8A 3ZVJD 2I81A 3G7YA 3ERGA 4NHZA 2R4VA 4TXOB 3PGTA 3ERFA 3UEMA 2WW2A 5CRHA 1YDKA 5IM9A 1JZOA 4HS1A 1ZOFA 4G01A 4BPYA 3QD9A 4PNGA 1X0RA 4EE0A 5AN1A 2IIYA 3CTFA 5A5HB 2H8LA 4PQHA 6GSYA 2JSYA 3RHCA 3ZFBA 4ULXA 3KMNA 2FNOA 3R2QA 5A5HA 4ACSA 4HSCX 3L9UA 1EV9A 2O8VB 2QKEA 2R5GA 1O8WA 3ZTLA 2N5AA 4I8BA 3OR5A 3M9JA 3UVHA 5KEJA 2R2JA 3HZ4A 4JRRA 2PN8A 4MMMA 2DIYA 1AQVA 5KOXA 1V57A 3KM6A 1GTBA 3FK8A 2WVZA 4N0VA 2CZ3A 3ZITA 4ID0A 3ZZXA 1WOUA 4DEJA 4L0UA 4ZL8A 1TI3A 1FOHA 1XXUA 2FCHA 1TU8A 4FXYP 2BJXA 3KP8A 2H75A 1T00A 1WRYA 3GA4A 4Q5NA 2LRNA 5KN1A 1F3BA 3VLNA 2OBKA 3FYGA 4BWQA 1XWAA 3GMFA 2N5BA 2CA8A 4GWRA 3LSZA 5A1NB 3ZRDA 5F06A 1QFNA 1SK1A 4IQAA 4USSA 4OMVA 2R37A 3VI5A 3WGDA 2CVDA 1F3AA 5IMCA 4K9ZA 5A1NA 5GZZB 4MP4A 4MA9A 1GLPA 2DBCA 4WXTA 2O87A 2QGVA 1Z5YE 2IMKA 1Y6EA 2LUSA 2KUCA 3LWAA 3BJ5A 3TKSE 4XRAA 3HZ8A 4OFMA 1PGTA 4JEDA 5G30A 2JSZA 2A2SA 2WGRA 1XW9A 6GSXA 4XCSA 3GHAA 5C00A 5B8BA 2LQQA 4ML6A 4J57E 4IP6A 1VF4A 4TR4A 4F9ZA 10GSA 5ECQB 4AKIA 1THOA 2F51A 5G1KA 5GAPD 2O5VA 6GSUA 3QDNA 2HRFA 3DYRA 5D73A 3GIXA 4KDUA 1AXDA 2DJ2A 1PKWA 2HYXA 4K8MA 3QR6A 5IPGA 5FT3A 1BG1A 3M3MA 2JU5A 4EIQA 3ED3A 1ERUA 3QFAC 3BCKA 2HSMB 3HVSA 3ZREA 3EWLA 2OE0A 1UC7A 1JZRA 2IMFA 2HSMA 1EEMA 2WVYA 4JBBA 1VRSD 5E59A 1U88A 2H6ZA 3GH6A 2TIRA 4X0XA 1PL1A 4NHWA 2J9HA 3SWLA 2FWGA 4DSSA 2A4HA 2ZUPA 1XBSA 1YY7A 3ZL5A 2H01A 1NM3A 2IJYA 2GT6A 1H4OA 2C3NA 3KH7A 1FVKA 2LQOA 2F3MA 5C04A 2FY6A 1BG5A 4G2EA 1PQNA 3DVXA 1AAZA 3VWWA 3F3RA 2R6KA 5DJMA 4K0NA 4F82A 2ZCTA 3IHQA 4WF5A 3JCML 1M9BA 4IQ1A 1WIKA 19GSA 3KCMA 3VWUA 3J7Yk 1SVLA 2F8FA 2VM1A 2IWTA 3IC4A 1SL2B 1VGLA 2VCXA 3D4TA 2X49A 2VD0A 5AIXA 1O7UA 18GSA 3U6VA 2DJ3A 4TR1B 1UA5A 4K7NA 3GSSA 2HI7A 2C4JA 5BRTA 2C0EA 1DE1A 2GGTA 4Z2TA 5ID2B 4Q5FA 1JLVA 3EYTA 4LA1A 5HFIA 5DDLA 4TR1A 2L6CA 4XS1A 2H0GA 5IMDA 1DBYA 5DJLA 1SL1B 7GSSA 3Q19A 1YVLA 2A4VA 1U3AA 1TRUA 5ID2A 3NOFA 2B5XA 2DKIA 3GL3A 2A2PA 3NZNA 2LSTA 3FZ9A 3TKSA 3TJGA 2FWFA 2H30A 2L4QA 2LRTA 1JZDA 2QA1A 3H4KA 4NMUA 5D9WA 1PA3A 3W6GA 1R4WA 5BMUB 1YJ6A 3EC3A 2P0GA 3US3A 2AYTA 2B7JA 5E4WA 1E2YA 1G0TA 2L57A 1OE7A 5AIVA 4RQRA 2C1YA 3RBTA 1YEXA 4PHZC 1PRXA 2YV9A 1AC1A 1XVQA 4BA7A 1SJIA 2IPAA 5HFGA 3F4SA 3CBUA 1S3RA 2EFEA 1THXA 4QL7A 4WEYA 4ZB9A 2VO4A 1A0FA 2RUEA 2K9FA 5J4UA 2MMZA 3HJOA 4MNNA 3GKMA 1EGOA 4F03A 3EU3A 3C71A 3MAKA 4LMWA 2M46A 2REMA 1B4PA 3GKXA 1SVMA 4GF0A 2AV4A 3I43A 4FYCA 2FWEA 2OE1A 1BQ7A 2GQLA 1JHBA 4AGSA 3APQA 1FW1A 4QQ7A 2O7KA 2GSQA 2ZNMA 3FMWA 4YH2A 2B6MA 1K0MA 2HE3A 3QAGA 4F0CA 3C73A 2WZ9A 1KNGA 1ZYQB 3LGCA 4IW9A 2A2RA 3EURA 3M9KA 4CW9A 1K0OA 4MH2A 2WZSA 4K7OA 2KP1A 3L9SA 1IYIA 1TJDA 5D8IA 4KW6A 5H5QA 2C3QA 3IBHA 1K0BA 1ERTA 1U6TA 3CTGA 4OFNA 1HD2A 3F0IA 2IMEA 4TW5A 4V2LA 4GQCA 1G7EA 4K7IA 2ES7A 1O73A 2VD1A 1CQHA 4J56E 3IXRA 2PMTA 1M2AA 5FWGA 2VIMA 3IAM2 2LS5A 5AISA 3CRTA 1T1VA 3LXZA 1PKZA 1EEJA 1YKCA 1ZCPA 1XWKA 2AAWA 5IO2A 5J4YA 1N25A 1B9YC 1ZYNA 1H75A 3LXTA 4ECIA 4MJAA 1TK5B 3P8WA 2VCTA 2V32A 5HR2A 1BX9A 4PI2C 2VLUA 5J9BA 2GS3A 1OC3A 3M0FA 3F9UA 2GVPA 4GSSA 5D9VA 4KNDA 1M3IA 1Z9HA 1OKTA 5CRWA 3EE2A 1DE2A 1FAAA 2OBIA 3KH9A 4BL7A 2JACA 1V40A 2H1DA 4EO3A 4FQUA 2OT3A 4YQMA 2GQKA 3DMLA 4HJ2A 4RQXA 1LU4A 1EP8A 5KN0A 2I3YA 4D73B 3C1SA 4V1Ap 5H5SA 1GNWA 4ZIJA 3K8NA 1GSEA 4MJCA 4IHUA 4WETA 1SD9A 3CSJA 1U3IA 4RUVA 2MBTA 4JU5A 1XG8A 4ML1A 5GAND 3Q18A 3UL3A 2YJ7A 2VL3A 5A4UA 2MMAA 1I1IP 4K5SA 1M2DA 2WW1A 2VL9A 2JZTA 2H76A 3QMXA 2YZUA 1X5EA 4ZB7A 3BOAA 3ZIVA 4AKXB 2H70A 3WT1A 4ZL9A 2IFQA 2H71A 5B6NA 3L4NA 4JZQA 3QFBC 3EVIA 2V41A 1HYUA 1QGVA 5ELGA 5DCHA 3TRQA 5JWOB 1K0NA 1ON4A 1RW1A 2L59A 3ERWA 3APSA 3E9JB 1GSQA 2B1KA 3EPTA 3ZLPA 5B7CA 1K0CA 3VI7A 4Q5RA 3A3TA 1TKDB 3DRNA 3CSHA 1A8YA 3HCZA 3A2XA 4HUAA 4HI7A 2C8UA 4AI6A 4PQ1A 2GLRA 1BYEA 5ECNB 2ON7A 1JZWA 2HSNA 1GSYA 1M3JA 2P5RA 2ALBA 1S3CA 5J3RA 2X64A 3VWXA 2EIQA 2H1AA 1MD3A 1ERWA 3FHKA 4KCEA 4F2IA 2L5OA 3E0UA 1CQGA 4KDXA 5G5EA 5IPHA 2TRCP 4MJBA 4MZCA 4NPBA 1Z6NA 3TU3B 1WJKA 1B4QA 4XIHA 4GTUA 4L8EA 2E2MA 2H0HA 1K3LA 4G0LA 1XZOA 4WBRD 4K0GA 3A5IA 5H5RA 4MPFA 4OCEA 1S3DA 6GSSA 4AKHA 1TP9A 5EPFA 1C72A 1SJ6A 4X1UA 1ZGNA 1T4YA 2RM6A 4OFTA 1DUGA 4PGTA 2M72A 2DJJA 2YCDA 3D0ZA 1FB0A 2CAQA 3DKSA 3EMXA 4CY6A 4OD7A 1FOVA 3A5WA 1R7HA 2H66A 3D22A 1LBKA 2K18A 1O8XA 3RPNA 2DJ1A 4EC0A 4E8HA 3GSTA 2DJ0A 2I9HA 1QUWA 1T8EB 16GSA 2QC7A 3IC8A 1GL8A 2V1MA 2FUG2 1TDIA 3DGQA 5F05A 1QMVA 2KP2A 1G7OA 1SJZA 4ZBDA 1XCCA 4L0WA 1NW2A 3ZIJA 2ON5A 3D21A 1OVNA 4BVXA 1GUKA 4ECBA 1UN2A 4HQZA 3GH9A 2GT5A 5F07A 1Y1UA 1TI1A 1TRVA 5CNWA 5IMZA 3GTUB 2YV7A 2K6VA 2KHPA 4ECJA 1SKRB 2TRXA 5B8AA 2CAIA 2AHEA 1MEKA 1PFOA 1TRWA 1J08A 1XW5A 5GSSA 3FW2A 3GTUA 1A23A 3KP9A 1XW6A 2K8SA 3PR8A 1KEBA 3D5JA 2L6DA 2HZFA 4TR0A 1GNEA 5KN3A 1M99A 2YWMA 3HVNA 4OO5A 2HRKB 3F4RA 2WCIA 1ZMAA 2VUPA 4H86A 1V9WA 2YWIA 1MTCA 4KSMA 2OADA 5ECLB 2HRKA 1XIYA 1EOGA 3QAVA 4K2XA 1J0FA 4W66A 4NWYA 1GRXA 4I2UA 2NBSA 1Q4JA 3M1GA 2DKHA 1AQWA 2RUFA 4I5QA 3FRCA 2LJKA 4DSSB 3ME7A 3EMPA 4FYUA 3TKSC 5CREA 4NV5A 1PX7A 2YJHA 2X8HA 3PINA 1EV4A 1SKWB 2R0PA 2F8AA 2B7KA 4XS6A 4YAVA 5F8BA 3IAS2 5CO3A 2CVKA 4LMVA 2RIIA 2V6KA 3HD5A 5ELAA 3KIJA 1ABAA 1V2AA 2LJAA 1BJXA 3FR6A 1GSSA 5EVOA 1B9XC 3TJBA 4MF5A 3I6AA 5A34B 3FEUA 1Z7PA 1ZYPA 3KJYA 3C7MA 2FLSA 1YQ1A 2PERA 4IP1A 4MABA 4YKFA 2WVXB 4ZILA 3I69A 3FZ5A 1A0RP 1V98A 3KZQA 1Y25A 5HR3A 3UJ1A 1A2LA 5A34A 1SVOA 3QAWA 5F0GA 2C0FA 2HRAA 1SL0B 2WVXA 2V2GA 3HHVA 2GQMA 3VFIA 4HZ2A 4NV2A 4GSTA 5G31A 1XVWA 3I9V2 1TK0B 2CX4A 4GRFA 17GSA 1TXUA 1S3AA 4E8EA 3ZMKA 4EDZA 4LLRA 2CZ2A 2HNLA 2E2GA 4WBJA 1BF5A 1YZXA 5LD0A 4WR5A 5IMAA 2RM5A 3GRXA 4AJ8A 2XPEA 3A2WA 3UOMA 3DXBA 4X43A 2MYGA 1G6YA 4IJIA 2XBQA 3TOUA 3A2VA 1SENA 3RHBA 1WWJA 3WGXA 3QCPA 3ZMLA 1HNCA 2UZ8A 2HXKA 1HNBA 3GYKA 3C8EA 1TOFA 3TJJA 4O5RA 5DALA 4HJMA 4POKA 3TKPA 3UIWA 4QMKA 2GDRA 3Q6OA 3IHGA 3CQFA 3MSZA 1NHYA 5EY6A 1TK8B 1I5GA 2L5LA 4Z2RA 5ECHB 4ILFA 1UVZA 1Q98A 3KXOA 4TN8A 1SK2A 3WYWA 4GXZA 3GKNA 2Z9SA 4CY8A 3CRUA 4TVEA 1I9DA 3RAZA 2VCZA 2H19A 1W89A 4HZ4A 2PWJA 3TJKA 1XOBA 2FGXA 5CAXA 1XFLA 5D93A 2OA7A 4GQFA 5FHIA 4L5OA 2CX3A 2VL2A 4PXOA 4N30A 2GZYA 4LL4B 1A8LA 2GZPA 3ME8A 4HOJA 5IOWA 3W8JA 3GX8A 5A5KA 3TCOA 4G0IA 4G9HA 4XRDA 1GTUA 4KF9A 2EFCA 1YF0A 5JCWA 1S4BP 3IOSA 2B5YA 2GSTA 4HDEA 1WP0A 3CXGA 1Z6MA 1SYXA 4WKWA 4IELA 4ECCA 1ZZYA 2OJLA 1SK0A 4DSQA 4BIKA 1U87A 2O89A 2FHEA 1ZL9A 5DBQA 2HSHA 1PL2A 3LG6A 3GX0A 3HYPA 2HSYA 4ZB8A 1K3YA 5HQPA 5ECRB 5G2ZA 2H1LA 1DSBA 2FA4A 3KGKA 3IA1A 3HMJG 4KE3A 4MK3A 3CMIA 3G9BA 2EC4A 2WW3A 4EVMA 2H6XA 3U5RE 3DD3A 5DCGA 6GSVA 1X9WB 3FZ4A 1GH2A 4V2NA 3G7JA 4J2FA 3TUEA 2VOCA 2X8GA 3W8SA 5ECMB 2IL3A 4BL7B 1GWCA 1F6MC 4G10A 2R0CA 2L4CA 5J4VA 3KD0A 4FIWA 2LTKA 5IMFA 3TKQA 1FO5A 3KTBA 3SBCA 5A4WA 3C1RA 2DMMA 4KA0A 1SKSB 4Z2UA 2JZSA 4ZBBA 2HRNA 2AJQB 2JL4A 3IK9A 2LNSA 3LW9A 1EOHA 3BCIA 4ZL7A 2D2ZA 2WDUA 2WW0A 3GKKA 2C3TA 4P3YB 1OKDA 5DAKB 2NDOA 1RQMA 3HKRA 1T3BA 2KLXA 1YEWC 4RI6A 5CYYA 4WR4A 2YOIA 5DAKA 4PI0C 5G5FA 2IFQB 1MDIA 1KTEA 2XBIA 3GFKA 5J5NA 2CV4A 5J40A 2EIRA 3VWVA 4Q5QA 1VF1A 4RI7A 4TOPA 4HU7A 1WMJA 2BTOT 2YPMA 5COHA 1FB6A 4ICYA 1ERVA 4MF6A 3UMAA 4YQUA 4JE1A 1V58A 14GSA 1XWCA 4AF2A 4JR6A 3LEFA 11GSA 1FHEA 1AQXA 3VPQA 4FYBA 3V1WA 2HSNB 1T7PB 4G19A 5LCZA 1PMTA 5JCGA 1EZKA 4OWYA 4KCAA 1NSWA 2FA8A 2CQ9A 3EU4A 3ZYWA 3TJFA 5IOXA 1GSDA 5KOWA 1PN9A 2EIOA 2GSSA 2LEGA 4XHMA 3HVXA 2YP6A 4TXOA 2MMOA 1A2JA 2O85A 5ECIB 3AY8A 4JR4A 1JLWA 4GSNA 1URMA 3L78A 1SYRA 2XC2A 3HJPA 3MWHA 3DVWA 5JWQB 4YQVA 3RDWA 4TXVA 3DEXA 1OYJA 3F63A 2EFHA 4HQSA 1R5AA 3FKFA 2DIZA 5HR0A 4TKYA 3GUSA 1PD21 1N8JA 2V6OA 3O3TA 4LL1B 4MZWA 4GLTA 1EP7A 3PH9A 1R26A 1VF3A 2UV8G 1GUMA 4AJ6A 3H8QA 4EL1A 3TDGA 4K6XA 2LKUA 2YWNA 1AW9A 1AIUA 5D96A 2WFCA 2JADA 1Z3EA 1GSUA 5ENUA 1XOAA 5ECSA 2B3SA 1GP1A 4L5LA 5CP1A 1YEPA 5L71A 5J9CA 1XWBA 4BVXB 3MDKA 1PSQA 3D6IA 4AKGA 8GSSA 5J41A 3F6FA 3P2AA 4IKHA 4DSRA 3H1NA 2VLVA 4YKGA 2NVLA 3EINA 3G7IA 3TGZA 3IPZA 5IIZA 1TU7A 2CVBA 2H1BA 5DQSA 1X9MB 2IN3A 2H0IA 5A4VA 3CHXC 4E68A 1W4VA 3N9JA 5INYA 4X4JA 2VKZG 3IDVA 2AUVA 1B8XA 3BBYA 4IBPA 2YNXA 4IN0A 5B6MA 5LNKe 3APOA 4AJ7A 4K5RA 1KBNA 2FD3A 2HLSA 3VPTA 1BEDA 1O85A 9GSSA 3VK9A 2O3EA 3Q74A 2LV3A 5KN2A 1QQ2A 4KGIA 4PUAA 2G0FA 2WRTA 4MLYA 4MF7A 4NXIA 3P90A 3E3EA 1PX6A 2XPDA 3F8UA 4QL9A 2RLIA 3MIXA 4O7HA 2HZEB 1EWXA 1X9SB 3IV4A 4KSOA 4IVFA 2PUKC 2QA2A 4EIPA 2MMNA 3WT2A 1E6BA 3LORA 2LRCA 1MD4A 2YWOA 2HZEA 2CT6A 2J23A 3QOUA 1AUCA 2HQTA 1HQOA 1A2MA 1WPIA 1GTIA 4PX1A 4ZXGA 3IR4A 4YAPA 1TRSA 3O76A 1PN0A 5DVBA 1M0UA 4ZB6A 4O92A 3RPPA 2VAFA 2WJUA 2DJKA 4DVCA 4V2MA 4I97A 3TRXA 4KH7A 3TB2A 2GZZA 2R3XA 1F2EA 4CHSA 2PU9C 2WULA 2AB6A 3GN3A 3FR3A 2H74A 1YF1A 4KUNA 2M80A 2HFDA 4PUFC 1QK8A 4EUYA 1QXHA 5ECPB 2C80A 3CWGA 3MYDA 5HR1A 2H6YA 5GSTA 4FH8A 2P5QA 1K3OA 3GV1A 3MNGA 1K0DA 2XHFA 2GSRA 4HEA2 1OAZA 2O36A 3M8NA 3L9VA 3CSIA 4BWSA 3RGBC 2VL2C 4PQIA 3IRAA 3F6DA 3ZFLA 3J7Yb 2NTOA 1TXXA 4HU9A 2JZRA 2R0GA 5IQYA 2H73A 5CRGA 3FY7A 4K2DA 4POLA 1B48A 3R3EA 3QPMA 4EXJA 5D9TA 1IYHA 6GSWA 2E7PA 1O81A 5DALB 3D4MA 5CRDA 4FO5A 2PVOC 2BMXA 1FVJA 4XTSA 3UBKA 4IS0A 1M2BA 4EF0A 1MDJA 3KEBA 2DLXA 4GCIA 4OO4A 1MDKA 4CDOA
chains in the Genus database with same CATH topology
4PNFA 1WE0A 5IMVA 3UAPA 2N5FA 1T4ZA 1TTZA 3WGEA 4WF4A 1OE8A 3WD6A 2I1UA 3N5OA 3TKRA 3TRPA 2E0QA 4KB3A 5G1LA 4F0BA 1OC8A 4TRXA 2B1LA 3P7XA 3PPUA 4GDFA 2VM2A 3GL5A 2QSIA 5BMUA 1J9BA 1ST9A 4POMA 4N11A 1NHOA 4N10A 3IE3A 1ML6A 2LNTA 1VF2A 4V1Ag 2G2QA 3LQ7A 5EL8A 4O5QA 2P31A 4MZBA 4KX4A 1RK4A 3LYPA 2X4AA 2PPTA 2X99A 2C0GA 1OC9B 4I6XA 5IO0A 2WS2A 3HA9A 1XWGA 3H79A 4POBA 5DQYA 3O6TA 1GTAA 2OKAA 3HDCA 2F9SA 2IMDA 2DMLA 1OC9A 2NPBA 3LFLA 5AGYA 4O32A 1USBA 3F4TA 3FZAA 2B5EA 3HY2A 3KTLA 4K1FA 2OACA 1SU9A 2H72A 3HXSA 3VURA 4IJ3A 1X5DA 4TR3A 2VLTA 4Z7XA 5ABRA 2PVQA 3L0HA 1M7TA 3LYKA 4O5UA 3HVVA 2VCVA 4PTSA 1ACVA 3LJRA 3UBLA 1ILOA 2OE3A 2X8CA 3FR9A 1GULA 1F9MA 5ECOB 5J47A 3DIEA 3HJMA 2H1GA 20GSA 1ZYEA 2DSAA 2YZHA 4XS4B 13GSA 2MZCA 12GSA 3F3QA 4EKZA 4KDYA 1BAYA 2WB9A 1X5CA 1M9AA 1G6WA 2C0DA 4KAEA 4EDYA 1O6JA 4XS4A 2EFDA 2K8VA 1GLQA 4G0KA 5D9XA 2VCWA 5JCUA 3ZVJA 2PGTA 1HNAA 2YANA 5ECKB 3TOTA 4N0ZA 5HFKA 4PURA 4BVYB 3IK7A 4MPGA 1GSFA 1JFUA 2HT9A 4I2TA 2MBSA 2GTUA 1XPVA 3BD2A 1YKAA 4IGJA 1N2AA 2DC5A 6GSTA 3UARA 4BVYA 3NIVA 3KMOA 3GNJA 3ISOA 1R5PA 4A5PA 4NAXA 1LJRA 1A24A 1TW9A 3CYNA 4ISDA 2I4AA 3H93A 1Z7RA 4OCFA 3DWVA 3S9FA 22GSA 4MDCA 1EGRA 1F37A 1K0AA 4ZBAA 2KOKA 4N3ZA 3UVTA 4D73A 4MH3A 5JWRB 2VCQA 4MJEA 2FWHA 2IMIA 2YN1A 4MCUA 2PBJA 1FG4A 1GUHA 2LJRA 3GURA 1SD8A 3ZVJD 2I81A 3G7YA 3ERGA 4NHZA 2R4VA 4TXOB 3PGTA 3ERFA 3UEMA 5CRHA 1YDKA 5IM9A 1JZOA 4HS1A 1ZOFA 4G01A 4BPYA 3QD9A 4PNGA 1X0RA 4EE0A 5AN1A 2IIYA 3CTFA 5A5HB 2H8LA 4PQHA 6GSYA 2JSYA 3RHCA 3ZFBA 4ULXA 3KMNA 2FNOA 3R2QA 5A5HA 4ACSA 3L9UA 1EV9A 2O8VB 2QKEA 2R5GA 1O8WA 3ZTLA 2N5AA 4I8BA 3OR5A 3M9JA 3UVHA 5KEJA 2R2JA 3HZ4A 4JRRA 2PN8A 4MMMA 2DIYA 1AQVA 5KOXA 1V57A 3KM6A 1GTBA 3FK8A 4N0VA 2CZ3A 3ZITA 4ID0A 3ZZXA 1WOUA 4DEJA 4L0UA 4ZL8A 1TI3A 1FOHA 1XXUA 2FCHA 1TU8A 2BJXA 3KP8A 2H75A 1T00A 1WRYA 3GA4A 4Q5NA 2LRNA 5KN1A 1F3BA 3VLNA 2OBKA 3FYGA 4BWQA 1XWAA 3GMFA 2N5BA 2CA8A 4GWRA 3LSZA 5A1NB 3ZRDA 5F06A 1QFNA 1SK1A 4IQAA 4USSA 4OMVA 2R37A 3VI5A 3WGDA 2CVDA 1F3AA 5IMCA 4K9ZA 5A1NA 5GZZB 4MP4A 4MA9A 1GLPA 2DBCA 4WXTA 2O87A 2QGVA 1Z5YE 2IMKA 1Y6EA 2LUSA 2KUCA 3LWAA 3BJ5A 3TKSE 4XRAA 3HZ8A 4OFMA 1PGTA 4JEDA 5G30A 2JSZA 2A2SA 2WGRA 1XW9A 6GSXA 4XCSA 3GHAA 5C00A 5B8BA 2LQQA 4ML6A 4J57E 4IP6A 1VF4A 4TR4A 4F9ZA 10GSA 5ECQB 4AKIA 1THOA 2F51A 5G1KA 5GAPD 2O5VA 6GSUA 3QDNA 2HRFA 3DYRA 5D73A 3GIXA 4KDUA 1AXDA 2DJ2A 1PKWA 2HYXA 4K8MA 3QR6A 5IPGA 5FT3A 1BG1A 3M3MA 2JU5A 4EIQA 3ED3A 1ERUA 3QFAC 3BCKA 2HSMB 3HVSA 3ZREA 3EWLA 2OE0A 1UC7A 1JZRA 2IMFA 2HSMA 1EEMA 4JBBA 1VRSD 5E59A 1U88A 2H6ZA 3GH6A 2TIRA 4X0XA 1PL1A 4NHWA 2J9HA 3SWLA 2FWGA 4DSSA 2A4HA 2ZUPA 1XBSA 1YY7A 3ZL5A 2H01A 1NM3A 2IJYA 2GT6A 1H4OA 2C3NA 3KH7A 1FVKA 2LQOA 2F3MA 5C04A 2FY6A 1BG5A 4G2EA 1PQNA 3DVXA 1AAZA 3VWWA 3F3RA 2R6KA 5DJMA 4K0NA 4F82A 2ZCTA 3IHQA 4WF5A 3JCML 1M9BA 4IQ1A 1WIKA 19GSA 3KCMA 3VWUA 3J7Yk 1SVLA 2F8FA 2VM1A 2IWTA 3IC4A 1SL2B 1VGLA 2VCXA 3D4TA 2X49A 2VD0A 5AIXA 1O7UA 18GSA 3U6VA 2DJ3A 4TR1B 1UA5A 4K7NA 3GSSA 2HI7A 2C4JA 5BRTA 2C0EA 1DE1A 2GGTA 4Z2TA 5ID2B 4Q5FA 1JLVA 3EYTA 4LA1A 5HFIA 5DDLA 4TR1A 2L6CA 4XS1A 2H0GA 5IMDA 1DBYA 5DJLA 1SL1B 7GSSA 3Q19A 1YVLA 2A4VA 1U3AA 1TRUA 5ID2A 3NOFA 2B5XA 2DKIA 3GL3A 2A2PA 3NZNA 2LSTA 3FZ9A 3TKSA 3TJGA 2FWFA 2H30A 2L4QA 2LRTA 1JZDA 2QA1A 3H4KA 4NMUA 5D9WA 1PA3A 3W6GA 1R4WA 5BMUB 1YJ6A 3EC3A 2P0GA 3US3A 2AYTA 2B7JA 5E4WA 1E2YA 1G0TA 2L57A 1OE7A 5AIVA 4RQRA 2C1YA 3RBTA 1YEXA 1PRXA 2YV9A 1AC1A 1XVQA 4BA7A 1SJIA 2IPAA 5HFGA 3F4SA 3CBUA 2EFEA 1THXA 4QL7A 4WEYA 4ZB9A 2VO4A 1A0FA 2RUEA 2K9FA 5J4UA 2MMZA 3HJOA 4MNNA 3GKMA 1EGOA 4F03A 3EU3A 3C71A 3MAKA 4LMWA 2M46A 2REMA 1B4PA 3GKXA 1SVMA 4GF0A 2AV4A 3I43A 4FYCA 2FWEA 2OE1A 1BQ7A 2GQLA 1JHBA 4AGSA 3APQA 1FW1A 4QQ7A 2O7KA 2GSQA 2ZNMA 3FMWA 4YH2A 2B6MA 1K0MA 2HE3A 3QAGA 4F0CA 3C73A 2WZ9A 1KNGA 1ZYQB 3LGCA 4IW9A 3M9KA 2A2RA 3EURA 4CW9A 1K0OA 4MH2A 4K7OA 2KP1A 3L9SA 1IYIA 1TJDA 5D8IA 4KW6A 5H5QA 2C3QA 3IBHA 1K0BA 1ERTA 1U6TA 3CTGA 4OFNA 1HD2A 3F0IA 2IMEA 4TW5A 4V2LA 4GQCA 1G7EA 4K7IA 2ES7A 1O73A 2VD1A 1CQHA 4J56E 3IXRA 2PMTA 1M2AA 5FWGA 2VIMA 3IAM2 2LS5A 5AISA 3CRTA 1T1VA 3LXZA 1PKZA 1EEJA 1YKCA 1ZCPA 1XWKA 2AAWA 5IO2A 5J4YA 1N25A 1B9YC 1ZYNA 1H75A 3LXTA 4ECIA 4MJAA 1TK5B 3P8WA 2VCTA 2V32A 5HR2A 1BX9A 2VLUA 5J9BA 2GS3A 1OC3A 3M0FA 3F9UA 2GVPA 4GSSA 5D9VA 4KNDA 1Z9HA 1OKTA 5CRWA 3EE2A 1DE2A 1FAAA 2OBIA 3KH9A 4BL7A 2JACA 1V40A 2H1DA 4EO3A 4FQUA 2OT3A 4YQMA 2GQKA 3DMLA 4HJ2A 4RQXA 1LU4A 1EP8A 5KN0A 2I3YA 4D73B 3C1SA 4V1Ap 5H5SA 1GNWA 4ZIJA 3K8NA 1GSEA 4MJCA 4IHUA 4WETA 1SD9A 3CSJA 1U3IA 4RUVA 2MBTA 4JU5A 4ML1A 5GAND 3Q18A 3UL3A 2YJ7A 2VL3A 5A4UA 2MMAA 4K5SA 1M2DA 2JZTA 2VL9A 2H76A 3QMXA 2YZUA 1X5EA 4ZB7A 3BOAA 3ZIVA 4AKXB 2H70A 3WT1A 4ZL9A 2IFQA 2H71A 5B6NA 3L4NA 4JZQA 3QFBC 3EVIA 2V41A 1HYUA 1QGVA 5ELGA 5DCHA 3TRQA 5JWOB 1K0NA 1ON4A 1RW1A 2L59A 3ERWA 3APSA 3E9JB 1GSQA 2B1KA 3EPTA 3ZLPA 5B7CA 1K0CA 3VI7A 4Q5RA 3A3TA 1TKDB 3DRNA 3CSHA 1A8YA 3HCZA 3A2XA 4HUAA 4HI7A 2C8UA 4AI6A 4PQ1A 2GLRA 1BYEA 5ECNB 2ON7A 1JZWA 2HSNA 1GSYA 2P5RA 2ALBA 1S3CA 5J3RA 2X64A 3VWXA 2EIQA 2H1AA 1MD3A 1ERWA 3FHKA 4KCEA 4F2IA 2L5OA 3E0UA 1CQGA 4KDXA 5G5EA 5IPHA 2TRCP 4MJBA 4MZCA 4NPBA 1Z6NA 3TU3B 1WJKA 1B4QA 4XIHA 4GTUA 4L8EA 2E2MA 2H0HA 1K3LA 4G0LA 1XZOA 4WBRD 4K0GA 3A5IA 5H5RA 4MPFA 4OCEA 1S3DA 6GSSA 4AKHA 1TP9A 5EPFA 1C72A 1SJ6A 4X1UA 1ZGNA 1T4YA 2RM6A 4OFTA 1DUGA 4PGTA 2M72A 2DJJA 2YCDA 3D0ZA 1FB0A 2CAQA 3DKSA 3EMXA 4CY6A 4OD7A 1FOVA 3A5WA 1R7HA 2H66A 3D22A 1LBKA 2K18A 1O8XA 3RPNA 2DJ1A 4EC0A 4E8HA 3GSTA 2DJ0A 2I9HA 1QUWA 1T8EB 16GSA 2QC7A 3IC8A 1GL8A 2V1MA 2FUG2 1TDIA 3DGQA 5F05A 1QMVA 2KP2A 1G7OA 1SJZA 4ZBDA 1XCCA 4L0WA 1NW2A 3ZIJA 2ON5A 3D21A 1OVNA 4BVXA 1GUKA 4ECBA 1UN2A 4HQZA 3GH9A 2GT5A 5F07A 1Y1UA 1TI1A 1TRVA 5CNWA 5IMZA 3GTUB 2YV7A 2K6VA 2KHPA 4ECJA 1SKRB 2TRXA 5B8AA 2CAIA 2AHEA 1MEKA 1TRWA 1J08A 1XW5A 5GSSA 3FW2A 3GTUA 1A23A 3KP9A 1XW6A 2K8SA 3PR8A 1KEBA 3D5JA 2L6DA 2HZFA 4TR0A 1GNEA 5KN3A 1M99A 2YWMA 4OO5A 2HRKB 3F4RA 2WCIA 1ZMAA 2VUPA 4H86A 1V9WA 2YWIA 1MTCA 4KSMA 2OADA 5ECLB 2HRKA 1XIYA 1EOGA 3QAVA 4K2XA 1J0FA 4W66A 4NWYA 1GRXA 4I2UA 2NBSA 1Q4JA 3M1GA 2DKHA 1AQWA 2RUFA 4I5QA 3FRCA 2LJKA 4DSSB 3ME7A 3EMPA 4FYUA 3TKSC 5CREA 4NV5A 1PX7A 2YJHA 2X8HA 3PINA 1EV4A 1SKWB 2R0PA 2F8AA 2B7KA 4XS6A 4YAVA 5F8BA 3IAS2 5CO3A 2CVKA 4LMVA 2RIIA 2V6KA 3HD5A 5ELAA 3KIJA 1ABAA 1V2AA 2LJAA 1BJXA 3FR6A 1GSSA 5EVOA 1B9XC 3TJBA 4MF5A 3I6AA 5A34B 3FEUA 1Z7PA 1ZYPA 3KJYA 3C7MA 2FLSA 1YQ1A 2PERA 4IP1A 4MABA 4YKFA 4ZILA 3I69A 3FZ5A 1A0RP 1V98A 3KZQA 1Y25A 5HR3A 3UJ1A 1A2LA 5A34A 1SVOA 3QAWA 5F0GA 2C0FA 2HRAA 1SL0B 3HHVA 2V2GA 2GQMA 3VFIA 4HZ2A 4NV2A 4GSTA 5G31A 1XVWA 3I9V2 1TK0B 2CX4A 4GRFA 17GSA 1TXUA 1S3AA 4E8EA 3ZMKA 4EDZA 4LLRA 2CZ2A 2HNLA 2E2GA 4WBJA 1BF5A 1YZXA 5LD0A 4WR5A 5IMAA 2RM5A 3GRXA 4AJ8A 2XPEA 3A2WA 3UOMA 3DXBA 4X43A 2MYGA 1G6YA 4IJIA 2XBQA 3TOUA 3A2VA 1SENA 3RHBA 1WWJA 3WGXA 3QCPA 3ZMLA 1HNCA 2UZ8A 2HXKA 1HNBA 3GYKA 3C8EA 1TOFA 3TJJA 4O5RA 5DALA 4HJMA 4POKA 3TKPA 3UIWA 4QMKA 2GDRA 3Q6OA 3IHGA 3MSZA 1NHYA 5EY6A 1TK8B 1I5GA 2L5LA 4Z2RA 5ECHB 4ILFA 1UVZA 1Q98A 3KXOA 4TN8A 1SK2A 3WYWA 4GXZA 3GKNA 2Z9SA 4CY8A 3CRUA 4TVEA 1I9DA 3RAZA 2VCZA 2H19A 1W89A 4HZ4A 2PWJA 3TJKA 1XOBA 2FGXA 5CAXA 1XFLA 5D93A 2OA7A 4GQFA 5FHIA 4L5OA 2CX3A 2VL2A 4PXOA 4N30A 2GZYA 4LL4B 1A8LA 2GZPA 3ME8A 4HOJA 5IOWA 3W8JA 3GX8A 5A5KA 3TCOA 4G0IA 4G9HA 4XRDA 1GTUA 4KF9A 2EFCA 1YF0A 5JCWA 3IOSA 2B5YA 2GSTA 4HDEA 1WP0A 3CXGA 1Z6MA 1SYXA 4WKWA 4IELA 4ECCA 1ZZYA 2OJLA 1SK0A 4DSQA 1U87A 2O89A 2FHEA 1ZL9A 5DBQA 2HSHA 1PL2A 3LG6A 3GX0A 3HYPA 2HSYA 4ZB8A 1K3YA 5HQPA 5ECRB 5G2ZA 2H1LA 1DSBA 2FA4A 3KGKA 3IA1A 3HMJG 4KE3A 4MK3A 3CMIA 3G9BA 2EC4A 4EVMA 2H6XA 3U5RE 3DD3A 5DCGA 6GSVA 1X9WB 3FZ4A 1GH2A 4V2NA 3G7JA 4J2FA 3TUEA 2VOCA 2X8GA 3W8SA 5ECMB 2IL3A 4BL7B 1GWCA 1F6MC 4G10A 2R0CA 2L4CA 5J4VA 3KD0A 4FIWA 2LTKA 5IMFA 3TKQA 1FO5A 3KTBA 3SBCA 5A4WA 3C1RA 2DMMA 4KA0A 1SKSB 4Z2UA 2JZSA 4ZBBA 2HRNA 2AJQB 2JL4A 3IK9A 2LNSA 3LW9A 1EOHA 3BCIA 4ZL7A 2D2ZA 2WDUA 3GKKA 2C3TA 4P3YB 1OKDA 5DAKB 2NDOA 1RQMA 3HKRA 1T3BA 2KLXA 4RI6A 5CYYA 4WR4A 2YOIA 5DAKA 5G5FA 2IFQB 1MDIA 1KTEA 2XBIA 3GFKA 5J5NA 2CV4A 5J40A 2EIRA 3VWVA 4Q5QA 1VF1A 4RI7A 4TOPA 4HU7A 1WMJA 2BTOT 2YPMA 5COHA 1FB6A 4ICYA 1ERVA 4MF6A 3UMAA 4YQUA 4JE1A 1V58A 14GSA 1XWCA 4AF2A 4JR6A 3LEFA 11GSA 1FHEA 1AQXA 3VPQA 4FYBA 3V1WA 2HSNB 1T7PB 4G19A 5LCZA 1PMTA 5JCGA 1EZKA 4OWYA 4KCAA 1NSWA 2FA8A 2CQ9A 3EU4A 3ZYWA 3TJFA 5IOXA 1GSDA 5KOWA 1PN9A 2EIOA 2GSSA 2LEGA 4XHMA 3HVXA 2YP6A 4TXOA 2MMOA 1A2JA 2O85A 5ECIB 3AY8A 4JR4A 1JLWA 4GSNA 1URMA 3L78A 1SYRA 2XC2A 3HJPA 3MWHA 3DVWA 5JWQB 4YQVA 3RDWA 4TXVA 3DEXA 1OYJA 3F63A 2EFHA 4HQSA 1R5AA 3FKFA 2DIZA 5HR0A 4TKYA 3GUSA 1PD21 1N8JA 2V6OA 3O3TA 4LL1B 4MZWA 4GLTA 1EP7A 3PH9A 1R26A 1VF3A 2UV8G 1GUMA 4AJ6A 3H8QA 4EL1A 3TDGA 4K6XA 2LKUA 2YWNA 1AW9A 1AIUA 5D96A 2WFCA 2JADA 1Z3EA 1GSUA 5ENUA 1XOAA 5ECSA 2B3SA 1GP1A 4L5LA 5CP1A 1YEPA 5L71A 5J9CA 1XWBA 4BVXB 3MDKA 1PSQA 3D6IA 4AKGA 8GSSA 5J41A 3F6FA 3P2AA 4IKHA 4DSRA 3H1NA 2VLVA 4YKGA 2NVLA 3EINA 3G7IA 3TGZA 3IPZA 5IIZA 1TU7A 2CVBA 2H1BA 5DQSA 1X9MB 2IN3A 2H0IA 5A4VA 4E68A 1W4VA 3N9JA 5INYA 4X4JA 2VKZG 3IDVA 2AUVA 1B8XA 3BBYA 4IBPA 2YNXA 4IN0A 5B6MA 5LNKe 3APOA 4AJ7A 4K5RA 1KBNA 2FD3A 2HLSA 3VPTA 1BEDA 1O85A 9GSSA 3VK9A 3Q74A 2LV3A 5KN2A 1QQ2A 4KGIA 4PUAA 2G0FA 2WRTA 4MLYA 4MF7A 4NXIA 3P90A 3E3EA 1PX6A 2XPDA 3F8UA 4QL9A 2RLIA 3MIXA 4O7HA 2HZEB 1EWXA 1X9SB 3IV4A 4KSOA 4IVFA 2PUKC 2QA2A 4EIPA 2MMNA 3WT2A 1E6BA 3LORA 2LRCA 1MD4A 2YWOA 2HZEA 2CT6A 2J23A 3QOUA 1AUCA 2HQTA 1HQOA 1A2MA 1WPIA 1GTIA 4PX1A 4ZXGA 3IR4A 4YAPA 1TRSA 3O76A 1PN0A 5DVBA 1M0UA 4ZB6A 4O92A 3RPPA 2VAFA 2WJUA 2DJKA 4DVCA 4V2MA 4I97A 3TRXA 4KH7A 3TB2A 2GZZA 2R3XA 1F2EA 4CHSA 2PU9C 2WULA 2AB6A 3GN3A 3FR3A 2H74A 1YF1A 4KUNA 2M80A 2HFDA 4PUFC 1QK8A 4EUYA 1QXHA 5ECPB 2C80A 3CWGA 3MYDA 5HR1A 2H6YA 5GSTA 4FH8A 2P5QA 1K3OA 3GV1A 3MNGA 1K0DA 2XHFA 2GSRA 4HEA2 1OAZA 3M8NA 3L9VA 3CSIA 4BWSA 2VL2C 4PQIA 3IRAA 3F6DA 3ZFLA 3J7Yb 2NTOA 1TXXA 4HU9A 2JZRA 2R0GA 5IQYA 2H73A 5CRGA 3FY7A 4K2DA 4POLA 1B48A 3R3EA 3QPMA 4EXJA 5D9TA 1IYHA 6GSWA 2E7PA 1O81A 5DALB 3D4MA 5CRDA 4FO5A 2PVOC 2BMXA 1FVJA 4XTSA 3UBKA 4IS0A 1M2BA 4EF0A 1MDJA 3KEBA 2DLXA 4GCIA 4OO4A 1MDKA 4CDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNF A;  1WE0 A;  5IMV A;  3UAP A;  2N5F A;  1T4Z A;  1TTZ A;  3WGE A;  4WF4 A;  1OE8 A;  3WD6 A;  2I1U A;  3N5O A;  3TKR A;  3TRP A;  2E0Q A;  4KB3 A;  5G1L A;  4F0B A;  1OC8 A;  4TRX A;  2B1L A;  3P7X A;  3PPU A;  3GL5 A;  2VM2 A;  2QSI A;  5BMU A;  1J9B A;  1ST9 A;  4POM A;  4N11 A;  1NHO A;  4N10 A;  3IE3 A;  1ML6 A;  2LNT A;  1VF2 A;  4V1A g;  2G2Q A;  3LQ7 A;  5EL8 A;  2P31 A;  4MZB A;  4KX4 A;  1RK4 A;  3LYP A;  2PPT A;  2X99 A;  2C0G A;  1OC9 B;  4I6X A;  5IO0 A;  2WS2 A;  3HA9 A;  1XWG A;  3H79 A;  4POB A;  5DQY A;  3O6T A;  1GTA A;  2OKA A;  3HDC A;  2F9S A;  2IMD A;  2DML A;  1OC9 A;  2NPB A;  3LFL A;  5AGY A;  4O32 A;  1USB A;  3F4T A;  3FZA A;  2B5E A;  3HY2 A;  3KTL A;  4K1F A;  2OAC A;  1SU9 A;  2H72 A;  3HXS A;  3VUR A;  4IJ3 A;  1X5D A;  4TR3 A;  2VLT A;  4Z7X A;  5ABR A;  2PVQ A;  3L0H A;  1M7T A;  3LYK A;  3HVV A;  2VCV A;  4PTS A;  1ACV A;  3LJR A;  3UBL A;  1ILO A;  2OE3 A;  2X8C A;  3FR9 A;  1GUL A;  1F9M A;  5ECO B;  3DIE A;  3HJM A;  2H1G A;  20GS A;  1ZYE A;  2DSA A;  2YZH A;  4XS4 B;  13GS A;  2MZC A;  12GS A;  3F3Q A;  4EKZ A;  4KDY A;  1BAY A;  2WB9 A;  1X5C A;  1M9A A;  1G6W A;  2C0D A;  4KAE A;  4EDY A;  1O6J A;  4XS4 A;  2K8V A;  1GLQ A;  4G0K A;  5D9X A;  2VCW A;  5JCU A;  3ZVJ A;  2PGT A;  1HNA A;  2YAN A;  5ECK B;  3TOT A;  4N0Z A;  5HFK A;  4PUR A;  4BVY B;  3IK7 A;  4MPG A;  1GSF A;  1JFU A;  2HT9 A;  4I2T A;  2MBS A;  2GTU A;  1XPV A;  3BD2 A;  1YKA A;  4IGJ A;  1N2A A;  2DC5 A;  6GST A;  3UAR A;  4BVY A;  3NIV A;  3KMO A;  3GNJ A;  3ISO A;  1R5P A;  4NAX A;  1LJR A;  1A24 A;  1TW9 A;  3CYN A;  4ISD A;  2I4A A;  3H93 A;  1Z7R A;  4OCF A;  3DWV A;  3S9F A;  22GS A;  4MDC A;  1EGR A;  1F37 A;  1K0A A;  4ZBA A;  2KOK A;  3UVT A;  4D73 A;  4MH3 A;  5JWR B;  2VCQ A;  4MJE A;  2FWH A;  2IMI A;  2YN1 A;  4MCU A;  2PBJ A;  1FG4 A;  1GUH A;  2LJR A;  3GUR A;  1SD8 A;  3ZVJ D;  2I81 A;  3G7Y A;  3ERG A;  4NHZ A;  2R4V A;  4TXO B;  3PGT A;  3ERF A;  3UEM A;  5CRH A;  1YDK A;  5IM9 A;  1JZO A;  4HS1 A;  1ZOF A;  4BPY A;  3QD9 A;  4PNG A;  1X0R A;  4EE0 A;  5AN1 A;  2IIY A;  3CTF A;  2H8L A;  4PQH A;  6GSY A;  2JSY A;  3RHC A;  3ZFB A;  4ULX A;  3KMN A;  2FNO A;  3R2Q A;  4ACS A;  3L9U A;  1EV9 A;  2O8V B;  2QKE A;  2R5G A;  1O8W A;  3ZTL A;  2N5A A;  4I8B A;  3OR5 A;  3M9J A;  3UVH A;  5KEJ A;  2R2J A;  3HZ4 A;  4JRR A;  2PN8 A;  4MMM A;  2DIY A;  1AQV A;  1V57 A;  3KM6 A;  1GTB A;  3FK8 A;  4N0V A;  2CZ3 A;  3ZIT A;  4ID0 A;  3ZZX A;  1WOU A;  4DEJ A;  4L0U A;  4ZL8 A;  1TI3 A;  1XXU A;  2FCH A;  1TU8 A;  2BJX A;  3KP8 A;  2H75 A;  1T00 A;  1WRY A;  3GA4 A;  4Q5N A;  2LRN A;  5KN1 A;  1F3B A;  3VLN A;  2OBK A;  3FYG A;  4BWQ A;  1XWA A;  3GMF A;  2N5B A;  2CA8 A;  4GWR A;  3LSZ A;  3ZRD A;  5F06 A;  1QFN A;  1SK1 A;  4IQA A;  4USS A;  4OMV A;  2R37 A;  3VI5 A;  3WGD A;  2CVD A;  1F3A A;  5IMC A;  4K9Z A;  5GZZ B;  4MP4 A;  4MA9 A;  1GLP A;  2DBC A;  4WXT A;  2O87 A;  2QGV A;  1Z5Y E;  2IMK A;  1Y6E A;  2LUS A;  2KUC A;  3LWA A;  3BJ5 A;  3TKS E;  4XRA A;  3HZ8 A;  4OFM A;  1PGT A;  4JED A;  5G30 A;  2JSZ A;  2A2S A;  2WGR A;  1XW9 A;  6GSX A;  4XCS A;  3GHA A;  5C00 A;  5B8B A;  2LQQ A;  4ML6 A;  4J57 E;  4IP6 A;  1VF4 A;  4TR4 A;  4F9Z A;  10GS A;  5ECQ B;  1THO A;  2F51 A;  5G1K A;  5GAP D;  6GSU A;  3QDN A;  2HRF A;  3DYR A;  5D73 A;  3GIX A;  4KDU A;  1AXD A;  2DJ2 A;  1PKW A;  2HYX A;  4K8M A;  3QR6 A;  5IPG A;  5FT3 A;  3M3M A;  2JU5 A;  3ED3 A;  1ERU A;  3QFA C;  3BCK A;  2HSM B;  3HVS A;  3ZRE A;  3EWL A;  2OE0 A;  1UC7 A;  1JZR A;  2IMF A;  2HSM A;  1EEM A;  4JBB A;  1VRS D;  5E59 A;  1U88 A;  2H6Z A;  3GH6 A;  2TIR A;  4X0X A;  1PL1 A;  4NHW A;  2J9H A;  3SWL A;  2FWG A;  4DSS A;  2ZUP A;  1XBS A;  1YY7 A;  3ZL5 A;  2H01 A;  1NM3 A;  2IJY A;  2GT6 A;  1H4O A;  2C3N A;  3KH7 A;  1FVK A;  2LQO A;  2F3M A;  5C04 A;  2FY6 A;  1BG5 A;  4G2E A;  1PQN A;  3DVX A;  1AAZ A;  3VWW A;  3F3R A;  2R6K A;  5DJM A;  4K0N A;  4F82 A;  2ZCT A;  3IHQ A;  4WF5 A;  3JCM L;  1M9B A;  4IQ1 A;  1WIK A;  19GS A;  3KCM A;  3VWU A;  3J7Y k;  2F8F A;  2VM1 A;  2IWT A;  3IC4 A;  1SL2 B;  1VGL A;  2VCX A;  3D4T A;  2VD0 A;  5AIX A;  1O7U A;  18GS A;  3U6V A;  2DJ3 A;  4TR1 B;  1UA5 A;  4K7N A;  3GSS A;  2HI7 A;  2C4J A;  1DE1 A;  2C0E A;  2GGT A;  5ID2 B;  4Q5F A;  1JLV A;  3EYT A;  4LA1 A;  5HFI A;  5DDL A;  4TR1 A;  2L6C A;  4XS1 A;  2H0G A;  5IMD A;  1DBY A;  5DJL A;  1SL1 B;  7GSS A;  3Q19 A;  2A4V A;  1U3A A;  1TRU A;  5ID2 A;  3NOF A;  2B5X A;  3GL3 A;  3NZN A;  2LST A;  3FZ9 A;  3TKS A;  3TJG A;  2FWF A;  2H30 A;  2L4Q A;  2LRT A;  1JZD A;  4NMU A;  3H4K A;  5D9W A;  1PA3 A;  3W6G A;  1R4W A;  1YJ6 A;  3EC3 A;  2P0G A;  3US3 A;  2AYT A;  2B7J A;  5E4W A;  1E2Y A;  1G0T A;  2L57 A;  1OE7 A;  5AIV A;  4RQR A;  2C1Y A;  3RBT A;  1YEX A;  1PRX A;  2YV9 A;  1AC1 A;  1XVQ A;  4BA7 A;  1SJI A;  2IPA A;  5HFG A;  3F4S A;  3CBU A;  1THX A;  4QL7 A;  4WEY A;  4ZB9 A;  2VO4 A;  1A0F A;  2RUE A;  2K9F A;  5J4U A;  2MMZ A;  3HJO A;  3GKM A;  1EGO A;  4F03 A;  3EU3 A;  3C71 A;  3MAK A;  4LMW A;  2M46 A;  2REM A;  1B4P A;  3GKX A;  4GF0 A;  2AV4 A;  3I43 A;  4FYC A;  2FWE A;  2OE1 A;  1BQ7 A;  2GQL A;  1JHB A;  4AGS A;  3APQ A;  1FW1 A;  4QQ7 A;  2O7K A;  2GSQ A;  2ZNM A;  4YH2 A;  2B6M A;  1K0M A;  2HE3 A;  3QAG A;  4F0C A;  3C73 A;  2WZ9 A;  1KNG A;  1ZYQ B;  3LGC A;  4IW9 A;  2A2R A;  3EUR A;  3M9K A;  4CW9 A;  1K0O A;  4MH2 A;  4K7O A;  2KP1 A;  3L9S A;  1IYI A;  1TJD A;  5D8I A;  4KW6 A;  5H5Q A;  2C3Q A;  3IBH A;  1K0B A;  1ERT A;  1U6T A;  3CTG A;  4OFN A;  1HD2 A;  3F0I A;  2IME A;  4TW5 A;  4V2L A;  4GQC A;  1G7E A;  4K7I A;  2ES7 A;  1O73 A;  2VD1 A;  1CQH A;  4J56 E;  3IXR A;  2PMT A;  1M2A A;  5FWG A;  2VIM A;  3IAM 2;  2LS5 A;  5AIS A;  3CRT A;  1T1V A;  3LXZ A;  1PKZ A;  1EEJ A;  1YKC A;  1ZCP A;  1XWK A;  2AAW A;  5IO2 A;  1B9Y C;  1H75 A;  3LXT A;  4ECI A;  4MJA A;  1TK5 B;  3P8W A;  2VCT A;  2V32 A;  5HR2 A;  1BX9 A;  2VLU A;  5J9B A;  2GS3 A;  1OC3 A;  3M0F A;  3F9U A;  2GVP A;  4GSS A;  5D9V A;  4KND A;  1Z9H A;  1OKT A;  5CRW A;  3EE2 A;  1DE2 A;  1FAA A;  2OBI A;  3KH9 A;  4BL7 A;  2JAC A;  1V40 A;  2H1D A;  4EO3 A;  4FQU A;  4YQM A;  2GQK A;  3DML A;  4HJ2 A;  4RQX A;  1LU4 A;  1EP8 A;  5KN0 A;  2I3Y A;  4D73 B;  3C1S A;  4V1A p;  5H5S A;  1GNW A;  4ZIJ A;  3K8N A;  1GSE A;  4MJC A;  4IHU A;  4WET A;  1SD9 A;  3CSJ A;  1U3I A;  4RUV A;  2MBT A;  4JU5 A;  4ML1 A;  5GAN D;  3Q18 A;  3UL3 A;  2YJ7 A;  2VL3 A;  5A4U A;  2MMA A;  1M2D A;  2JZT A;  2VL9 A;  2H76 A;  3QMX A;  2YZU A;  1X5E A;  3BOA A;  3ZIV A;  3WT1 A;  2H70 A;  4ZL9 A;  2IFQ A;  2H71 A;  5B6N A;  3L4N A;  4JZQ A;  3QFB C;  3EVI A;  2V41 A;  1HYU A;  1QGV A;  5ELG A;  5DCH A;  3TRQ A;  5JWO B;  1K0N A;  1ON4 A;  1RW1 A;  2L59 A;  3ERW A;  3APS A;  3E9J B;  1GSQ A;  2B1K A;  3ZLP A;  5B7C A;  1K0C A;  3VI7 A;  4Q5R A;  3A3T A;  1TKD B;  3DRN A;  3CSH A;  1A8Y A;  3HCZ A;  3A2X A;  4HUA A;  4HI7 A;  2C8U A;  4PQ1 A;  2GLR A;  1BYE A;  5ECN B;  2ON7 A;  1JZW A;  1GSY A;  2P5R A;  2ALB A;  1S3C A;  5J3R A;  2X64 A;  3VWX A;  2EIQ A;  2H1A A;  1MD3 A;  1ERW A;  3FHK A;  4KCE A;  4F2I A;  2L5O A;  3E0U A;  1CQG A;  4KDX A;  5G5E A;  5IPH A;  2TRC P;  4MJB A;  4MZC A;  4NPB A;  1Z6N A;  1WJK A;  1B4Q A;  4XIH A;  4GTU A;  4L8E A;  2E2M A;  2H0H A;  1K3L A;  4G0L A;  1XZO A;  4WBR D;  4K0G A;  5H5R A;  4MPF A;  4OCE A;  1S3D A;  6GSS A;  1TP9 A;  5EPF A;  1C72 A;  1SJ6 A;  4X1U A;  1ZGN A;  1T4Y A;  2RM6 A;  4OFT A;  1DUG A;  4PGT A;  2M72 A;  2DJJ A;  2YCD A;  3D0Z A;  1FB0 A;  2CAQ A;  3DKS A;  3EMX A;  4OD7 A;  1FOV A;  3A5W A;  1R7H A;  2H66 A;  3D22 A;  1LBK A;  2K18 A;  1O8X A;  3RPN A;  2DJ1 A;  4EC0 A;  4E8H A;  3GST A;  2DJ0 A;  2I9H A;  1QUW A;  1T8E B;  16GS A;  2QC7 A;  3IC8 A;  1GL8 A;  2V1M A;  2FUG 2;  1TDI A;  3DGQ A;  5F05 A;  1QMV A;  2KP2 A;  1G7O A;  1SJZ A;  4ZBD A;  1XCC A;  4L0W A;  1NW2 A;  3ZIJ A;  2ON5 A;  3D21 A;  1OVN A;  4BVX A;  1GUK A;  4ECB A;  1UN2 A;  4HQZ A;  3GH9 A;  2GT5 A;  5F07 A;  1TI1 A;  1TRV A;  5CNW A;  5IMZ A;  3GTU B;  2YV7 A;  2K6V A;  2KHP A;  4ECJ A;  1SKR B;  2TRX A;  5B8A A;  2CAI A;  2AHE A;  1MEK A;  1TRW A;  1J08 A;  1XW5 A;  5GSS A;  3FW2 A;  3GTU A;  1A23 A;  3KP9 A;  1XW6 A;  2K8S A;  3PR8 A;  1KEB A;  3D5J A;  2L6D A;  2HZF A;  4TR0 A;  1GNE A;  5KN3 A;  1M99 A;  2YWM A;  4OO5 A;  2HRK B;  3F4R A;  2WCI A;  1ZMA A;  2VUP A;  4H86 A;  1V9W A;  2YWI A;  1MTC A;  4KSM A;  2OAD A;  5ECL B;  2HRK A;  1XIY A;  1EOG A;  3QAV A;  1J0F A;  4NWY A;  1GRX A;  4I2U A;  2NBS A;  1Q4J A;  3M1G A;  1AQW A;  2RUF A;  4I5Q A;  3FRC A;  2LJK A;  4DSS B;  3ME7 A;  3EMP A;  4FYU A;  3TKS C;  5CRE A;  4NV5 A;  1PX7 A;  2YJH A;  2X8H A;  3PIN A;  1EV4 A;  1SKW B;  2F8A A;  2B7K A;  4XS6 A;  4YAV A;  5F8B A;  3IAS 2;  5CO3 A;  2CVK A;  4LMV A;  2RII A;  2V6K A;  3HD5 A;  5ELA A;  3KIJ A;  1ABA A;  1V2A A;  2LJA A;  1BJX A;  3FR6 A;  1GSS A;  5EVO A;  1B9X C;  3TJB A;  4MF5 A;  3I6A A;  3FEU A;  1Z7P A;  3KJY A;  3C7M A;  2FLS A;  1YQ1 A;  2PER A;  4IP1 A;  4MAB A;  4ZIL A;  3I69 A;  3FZ5 A;  1A0R P;  1V98 A;  3KZQ A;  1Y25 A;  5HR3 A;  3UJ1 A;  1A2L A;  3QAW A;  5F0G A;  2C0F A;  2HRA A;  1SL0 B;  3HHV A;  2V2G A;  2GQM A;  3VFI A;  4HZ2 A;  4NV2 A;  4GST A;  5G31 A;  1XVW A;  3I9V 2;  1TK0 B;  2CX4 A;  4GRF A;  17GS A;  1S3A A;  4E8E A;  3ZMK A;  4EDZ A;  4LLR A;  2CZ2 A;  2HNL A;  2E2G A;  4WBJ A;  1YZX A;  5LD0 A;  4WR5 A;  5IMA A;  2RM5 A;  3GRX A;  4AJ8 A;  2XPE A;  3A2W A;  3UOM A;  3DXB A;  4X43 A;  2MYG A;  1G6Y A;  4IJI A;  2XBQ A;  3TOU A;  3A2V A;  1SEN A;  3RHB A;  1WWJ A;  3WGX A;  3QCP A;  3ZML A;  1HNC A;  2UZ8 A;  2HXK A;  1HNB A;  3GYK A;  3C8E A;  1TOF A;  3TJJ A;  4O5R A;  5DAL A;  4HJM A;  4POK A;  3TKP A;  3UIW A;  2GDR A;  3Q6O A;  3MSZ A;  1NHY A;  5EY6 A;  1TK8 B;  1I5G A;  2L5L A;  5ECH B;  4ILF A;  1UVZ A;  1Q98 A;  3KXO A;  4TN8 A;  1SK2 A;  3WYW A;  4GXZ A;  3GKN A;  2Z9S A;  3CRU A;  4TVE A;  1I9D A;  3RAZ A;  2VCZ A;  2H19 A;  1W89 A;  4HZ4 A;  2PWJ A;  3TJK A;  1XOB A;  2FGX A;  5CAX A;  1XFL A;  5D93 A;  2OA7 A;  4GQF A;  5FHI A;  4L5O A;  2CX3 A;  2VL2 A;  4PXO A;  4N30 A;  2GZY A;  4LL4 B;  1A8L A;  2GZP A;  3ME8 A;  4HOJ A;  5IOW A;  3W8J A;  3GX8 A;  5A5K A;  3TCO A;  4G0I A;  4G9H A;  4XRD A;  1GTU A;  4KF9 A;  1YF0 A;  5JCW A;  3IOS A;  2B5Y A;  2GST A;  4HDE A;  1WP0 A;  3CXG A;  1Z6M A;  1SYX A;  4WKW A;  4IEL A;  4ECC A;  1ZZY A;  2OJL A;  1SK0 A;  4DSQ A;  1U87 A;  2O89 A;  2FHE A;  1ZL9 A;  5DBQ A;  2HSH A;  1PL2 A;  3LG6 A;  3GX0 A;  3HYP A;  2HSY A;  4ZB8 A;  1K3Y A;  5HQP A;  5ECR B;  5G2Z A;  1DSB A;  2FA4 A;  3KGK A;  3IA1 A;  4KE3 A;  4MK3 A;  3CMI A;  3G9B A;  2EC4 A;  4EVM A;  2H6X A;  3U5R E;  3DD3 A;  5DCG A;  6GSV A;  1X9W B;  3FZ4 A;  1GH2 A;  4V2N A;  3G7J A;  4J2F A;  3TUE A;  2VOC A;  2X8G A;  3W8S A;  5ECM B;  2IL3 A;  4BL7 B;  1GWC A;  1F6M C;  4G10 A;  2L4C A;  3KD0 A;  4FIW A;  2LTK A;  5IMF A;  3TKQ A;  1FO5 A;  3KTB A;  3SBC A;  5A4W A;  3C1R A;  2DMM A;  4KA0 A;  1SKS B;  2JZS A;  4ZBB A;  2HRN A;  2AJQ B;  2JL4 A;  3IK9 A;  2LNS A;  1EOH A;  3BCI A;  4ZL7 A;  2D2Z A;  2WDU A;  3GKK A;  2C3T A;  4P3Y B;  1OKD A;  5DAK B;  2NDO A;  1RQM A;  3HKR A;  1T3B A;  2KLX A;  4RI6 A;  5CYY A;  4WR4 A;  2YOI A;  5DAK A;  5G5F A;  2IFQ B;  1MDI A;  1KTE A;  2XBI A;  3GFK A;  5J5N A;  2CV4 A;  2EIR A;  3VWV A;  4Q5Q A;  1VF1 A;  4RI7 A;  4TOP A;  4HU7 A;  1WMJ A;  2BTO T;  2YPM A;  5COH A;  1FB6 A;  1ERV A;  4MF6 A;  3UMA A;  4YQU A;  4JE1 A;  1V58 A;  14GS A;  1XWC A;  4AF2 A;  4JR6 A;  3LEF A;  11GS A;  1FHE A;  1AQX A;  3VPQ A;  4FYB A;  3V1W A;  2HSN B;  1T7P B;  4G19 A;  5LCZ A;  1PMT A;  5JCG A;  1EZK A;  4OWY A;  4KCA A;  1NSW A;  2FA8 A;  2CQ9 A;  3EU4 A;  3ZYW A;  3TJF A;  5IOX A;  1GSD A;  1PN9 A;  2EIO A;  2GSS A;  2LEG A;  4XHM A;  3HVX A;  2YP6 A;  4TXO A;  2MMO A;  1A2J A;  2O85 A;  5ECI B;  3AY8 A;  4JR4 A;  1JLW A;  4GSN A;  1URM A;  3L78 A;  1SYR A;  2XC2 A;  3HJP A;  3MWH A;  3DVW A;  5JWQ B;  4YQV A;  3RDW A;  4TXV A;  3DEX A;  1OYJ A;  3F63 A;  4HQS A;  1R5A A;  3FKF A;  2DIZ A;  5HR0 A;  4TKY A;  3GUS A;  1PD2 1;  1N8J A;  2V6O A;  3O3T A;  4LL1 B;  4MZW A;  4GLT A;  1EP7 A;  3PH9 A;  1R26 A;  1VF3 A;  1GUM A;  4AJ6 A;  3H8Q A;  4EL1 A;  3TDG A;  4K6X A;  2LKU A;  2YWN A;  1AW9 A;  1AIU A;  5D96 A;  2WFC A;  2JAD A;  1Z3E A;  1GSU A;  5ENU A;  1XOA A;  5ECS A;  2B3S A;  1GP1 A;  4L5L A;  5CP1 A;  1YEP A;  5L71 A;  5J9C A;  1XWB A;  4BVX B;  3MDK A;  1PSQ A;  3D6I A;  8GSS A;  5J41 A;  3F6F A;  3P2A A;  4IKH A;  4DSR A;  3H1N A;  2VLV A;  2NVL A;  3EIN A;  3G7I A;  3TGZ A;  3IPZ A;  5IIZ A;  1TU7 A;  2CVB A;  2H1B A;  5DQS A;  1X9M B;  2IN3 A;  2H0I A;  5A4V A;  1W4V A;  3N9J A;  5INY A;  3IDV A;  2AUV A;  1B8X A;  3BBY A;  4IBP A;  2YNX A;  4IN0 A;  5B6M A;  5LNK e;  3APO A;  4AJ7 A;  1KBN A;  2FD3 A;  2HLS A;  3VPT A;  1BED A;  1O85 A;  9GSS A;  3VK9 A;  3Q74 A;  2LV3 A;  5KN2 A;  1QQ2 A;  4KGI A;  4PUA A;  2G0F A;  2WRT A;  4MLY A;  4MF7 A;  4NXI A;  3P90 A;  3E3E A;  1PX6 A;  2XPD A;  3F8U A;  4QL9 A;  2RLI A;  4O7H A;  2HZE B;  1EWX A;  1X9S B;  3IV4 A;  4KSO A;  4IVF A;  2PUK C;  2MMN A;  3WT2 A;  1E6B A;  3LOR A;  2LRC A;  1MD4 A;  2YWO A;  2HZE A;  2CT6 A;  2J23 A;  3QOU A;  1AUC A;  2HQT A;  1HQO A;  1A2M A;  1WPI A;  1GTI A;  4PX1 A;  4ZXG A;  3IR4 A;  4YAP A;  1TRS A;  3O76 A;  5DVB A;  1M0U A;  4ZB6 A;  4O92 A;  3RPP A;  2VAF A;  2WJU A;  2DJK A;  4DVC A;  4V2M A;  4I97 A;  3TRX A;  4KH7 A;  3TB2 A;  2GZZ A;  2R3X A;  1F2E A;  4CHS A;  2PU9 C;  2WUL A;  2AB6 A;  3GN3 A;  3FR3 A;  2H74 A;  1YF1 A;  4KUN A;  2M80 A;  2HFD A;  4PUF C;  1QK8 A;  4EUY A;  1QXH A;  5ECP B;  2C80 A;  5HR1 A;  2H6Y A;  5GST A;  4FH8 A;  2P5Q A;  1K3O A;  3GV1 A;  3MNG A;  1K0D A;  2XHF A;  2GSR A;  4HEA 2;  1OAZ A;  3M8N A;  3L9V A;  3CSI A;  4BWS A;  2VL2 C;  4PQI A;  3IRA A;  3F6D A;  3ZFL A;  3J7Y b;  2NTO A;  1TXX A;  4HU9 A;  2JZR A;  5IQY A;  2H73 A;  5CRG A;  3FY7 A;  4K2D A;  4POL A;  1B48 A;  3QPM A;  3R3E A;  4EXJ A;  5D9T A;  1IYH A;  6GSW A;  2E7P A;  1O81 A;  5DAL B;  3D4M A;  5CRD A;  4FO5 A;  2PVO C;  2BMX A;  1FVJ A;  4XTS A;  3UBK A;  4IS0 A;  1M2B A;  4EF0 A;  1MDJ A;  3KEB A;  2DLX A;  4GCI A;  4OO4 A;  1MDK A;  4CDO A; 
#chains in the Genus database with same CATH topology
 4PNF A;  1WE0 A;  5IMV A;  3UAP A;  3RFR C;  2N5F A;  1T4Z A;  1TTZ A;  3WGE A;  4WF4 A;  1OE8 A;  3WD6 A;  2I1U A;  3N5O A;  3TKR A;  3TRP A;  2E0Q A;  4KB3 A;  5G1L A;  4F0B A;  1OC8 A;  4TRX A;  2B1L A;  3P7X A;  3PPU A;  4GDF A;  2VM2 A;  3GL5 A;  2QSI A;  5BMU A;  1J9B A;  1ST9 A;  4POM A;  4N11 A;  1NHO A;  4N10 A;  3IE3 A;  1ML6 A;  2LNT A;  1VF2 A;  4V1A g;  2G2Q A;  3LQ7 A;  5EL8 A;  4O5Q A;  2P31 A;  4MZB A;  4KX4 A;  1RK4 A;  3LYP A;  2X4A A;  2PPT A;  2X99 A;  2C0G A;  1OC9 B;  4I6X A;  5IO0 A;  2WS2 A;  3HA9 A;  1XWG A;  3H79 A;  4POB A;  5DQY A;  3O6T A;  1GTA A;  2OKA A;  3HDC A;  2F9S A;  2IMD A;  2DML A;  1OC9 A;  2NPB A;  3LFL A;  5AGY A;  4O32 A;  1USB A;  3F4T A;  3FZA A;  2B5E A;  3HY2 A;  3KTL A;  4K1F A;  2OAC A;  1SU9 A;  2H72 A;  3HXS A;  3VUR A;  4IJ3 A;  1X5D A;  4TR3 A;  2VLT A;  4Z7X A;  5ABR A;  2PVQ A;  3L0H A;  1M7T A;  3LYK A;  4O5U A;  3HVV A;  2VCV A;  4PTS A;  1ACV A;  3LJR A;  3UBL A;  1ILO A;  2OE3 A;  2X8C A;  3FR9 A;  1GUL A;  1F9M A;  5ECO B;  5J47 A;  3DIE A;  3HJM A;  2H1G A;  20GS A;  1ZYE A;  2DSA A;  2YZH A;  4XS4 B;  13GS A;  2MZC A;  12GS A;  3F3Q A;  4EKZ A;  4KDY A;  1BAY A;  2WB9 A;  1X5C A;  1M9A A;  1G6W A;  2C0D A;  4KAE A;  4EDY A;  1O6J A;  4XS4 A;  2EFD A;  2K8V A;  1GLQ A;  4G0K A;  5D9X A;  2VCW A;  5JCU A;  3ZVJ A;  2PGT A;  1HNA A;  2YAN A;  5ECK B;  3TOT A;  4N0Z A;  5HFK A;  4PUR A;  4BVY B;  3IK7 A;  4MPG A;  1GSF A;  1JFU A;  2HT9 A;  4I2T A;  2MBS A;  2GTU A;  1XPV A;  3BD2 A;  1YKA A;  4IGJ A;  1N2A A;  2DC5 A;  6GST A;  3UAR A;  4BVY A;  3NIV A;  3KMO A;  3GNJ A;  3ISO A;  1R5P A;  4A5P A;  4NAX A;  1LJR A;  1A24 A;  1TW9 A;  3CYN A;  4ISD A;  2I4A A;  3H93 A;  1Z7R A;  4OCF A;  3DWV A;  3S9F A;  22GS A;  4MDC A;  1EGR A;  1F37 A;  1K0A A;  4ZBA A;  2KOK A;  4N3Z A;  3UVT A;  4D73 A;  4MH3 A;  5JWR B;  2VCQ A;  4MJE A;  2FWH A;  2IMI A;  2YN1 A;  4MCU A;  2PBJ A;  1FG4 A;  1GUH A;  2LJR A;  3GUR A;  1SD8 A;  3ZVJ D;  2I81 A;  3G7Y A;  3ERG A;  4NHZ A;  2R4V A;  4TXO B;  3PGT A;  3ERF A;  3UEM A;  2WW2 A;  5CRH A;  1YDK A;  5IM9 A;  1JZO A;  4HS1 A;  1ZOF A;  4G01 A;  4BPY A;  3QD9 A;  4PNG A;  1X0R A;  4EE0 A;  5AN1 A;  2IIY A;  3CTF A;  5A5H B;  2H8L A;  4PQH A;  6GSY A;  2JSY A;  3RHC A;  3ZFB A;  4ULX A;  3KMN A;  2FNO A;  3R2Q A;  5A5H A;  4ACS A;  4HSC X;  3L9U A;  1EV9 A;  2O8V B;  2QKE A;  2R5G A;  1O8W A;  3ZTL A;  2N5A A;  4I8B A;  3OR5 A;  3M9J A;  3UVH A;  5KEJ A;  2R2J A;  3HZ4 A;  4JRR A;  2PN8 A;  4MMM A;  2DIY A;  1AQV A;  5KOX A;  1V57 A;  3KM6 A;  1GTB A;  3FK8 A;  2WVZ A;  4N0V A;  2CZ3 A;  3ZIT A;  4ID0 A;  3ZZX A;  1WOU A;  4DEJ A;  4L0U A;  4ZL8 A;  1TI3 A;  1FOH A;  1XXU A;  2FCH A;  1TU8 A;  4FXY P;  2BJX A;  3KP8 A;  2H75 A;  1T00 A;  1WRY A;  3GA4 A;  4Q5N A;  2LRN A;  5KN1 A;  1F3B A;  3VLN A;  2OBK A;  3FYG A;  4BWQ A;  1XWA A;  3GMF A;  2N5B A;  2CA8 A;  4GWR A;  3LSZ A;  5A1N B;  3ZRD A;  5F06 A;  1QFN A;  1SK1 A;  4IQA A;  4USS A;  4OMV A;  2R37 A;  3VI5 A;  3WGD A;  2CVD A;  1F3A A;  5IMC A;  4K9Z A;  5A1N A;  5GZZ B;  4MP4 A;  4MA9 A;  1GLP A;  2DBC A;  4WXT A;  2O87 A;  2QGV A;  1Z5Y E;  2IMK A;  1Y6E A;  2LUS A;  2KUC A;  3LWA A;  3BJ5 A;  3TKS E;  4XRA A;  3HZ8 A;  4OFM A;  1PGT A;  4JED A;  5G30 A;  2JSZ A;  2A2S A;  2WGR A;  1XW9 A;  6GSX A;  4XCS A;  3GHA A;  5C00 A;  5B8B A;  2LQQ A;  4ML6 A;  4J57 E;  4IP6 A;  1VF4 A;  4TR4 A;  4F9Z A;  10GS A;  5ECQ B;  4AKI A;  1THO A;  2F51 A;  5G1K A;  5GAP D;  2O5V A;  6GSU A;  3QDN A;  2HRF A;  3DYR A;  5D73 A;  3GIX A;  4KDU A;  1AXD A;  2DJ2 A;  1PKW A;  2HYX A;  4K8M A;  3QR6 A;  5IPG A;  5FT3 A;  1BG1 A;  3M3M A;  2JU5 A;  4EIQ A;  3ED3 A;  1ERU A;  3QFA C;  3BCK A;  2HSM B;  3HVS A;  3ZRE A;  3EWL A;  2OE0 A;  1UC7 A;  1JZR A;  2IMF A;  2HSM A;  1EEM A;  2WVY A;  4JBB A;  1VRS D;  5E59 A;  1U88 A;  2H6Z A;  3GH6 A;  2TIR A;  4X0X A;  1PL1 A;  4NHW A;  2J9H A;  3SWL A;  2FWG A;  4DSS A;  2A4H A;  2ZUP A;  1XBS A;  1YY7 A;  3ZL5 A;  2H01 A;  1NM3 A;  2IJY A;  2GT6 A;  1H4O A;  2C3N A;  3KH7 A;  1FVK A;  2LQO A;  2F3M A;  5C04 A;  2FY6 A;  1BG5 A;  4G2E A;  1PQN A;  3DVX A;  1AAZ A;  3VWW A;  3F3R A;  2R6K A;  5DJM A;  4K0N A;  4F82 A;  2ZCT A;  3IHQ A;  4WF5 A;  3JCM L;  1M9B A;  4IQ1 A;  1WIK A;  19GS A;  3KCM A;  3VWU A;  3J7Y k;  1SVL A;  2F8F A;  2VM1 A;  2IWT A;  3IC4 A;  1SL2 B;  1VGL A;  2VCX A;  3D4T A;  2X49 A;  2VD0 A;  5AIX A;  1O7U A;  18GS A;  3U6V A;  2DJ3 A;  4TR1 B;  1UA5 A;  4K7N A;  3GSS A;  2HI7 A;  2C4J A;  5BRT A;  2C0E A;  1DE1 A;  2GGT A;  4Z2T A;  5ID2 B;  4Q5F A;  1JLV A;  3EYT A;  4LA1 A;  5HFI A;  5DDL A;  4TR1 A;  2L6C A;  4XS1 A;  2H0G A;  5IMD A;  1DBY A;  5DJL A;  1SL1 B;  7GSS A;  3Q19 A;  1YVL A;  2A4V A;  1U3A A;  1TRU A;  5ID2 A;  3NOF A;  2B5X A;  2DKI A;  3GL3 A;  2A2P A;  3NZN A;  2LST A;  3FZ9 A;  3TKS A;  3TJG A;  2FWF A;  2H30 A;  2L4Q A;  2LRT A;  1JZD A;  2QA1 A;  3H4K A;  4NMU A;  5D9W A;  1PA3 A;  3W6G A;  1R4W A;  5BMU B;  1YJ6 A;  3EC3 A;  2P0G A;  3US3 A;  2AYT A;  2B7J A;  5E4W A;  1E2Y A;  1G0T A;  2L57 A;  1OE7 A;  5AIV A;  4RQR A;  2C1Y A;  3RBT A;  1YEX A;  4PHZ C;  1PRX A;  2YV9 A;  1AC1 A;  1XVQ A;  4BA7 A;  1SJI A;  2IPA A;  5HFG A;  3F4S A;  3CBU A;  1S3R A;  2EFE A;  1THX A;  4QL7 A;  4WEY A;  4ZB9 A;  2VO4 A;  1A0F A;  2RUE A;  2K9F A;  5J4U A;  2MMZ A;  3HJO A;  4MNN A;  3GKM A;  1EGO A;  4F03 A;  3EU3 A;  3C71 A;  3MAK A;  4LMW A;  2M46 A;  2REM A;  1B4P A;  3GKX A;  1SVM A;  4GF0 A;  2AV4 A;  3I43 A;  4FYC A;  2FWE A;  2OE1 A;  1BQ7 A;  2GQL A;  1JHB A;  4AGS A;  3APQ A;  1FW1 A;  4QQ7 A;  2O7K A;  2GSQ A;  2ZNM A;  3FMW A;  4YH2 A;  2B6M A;  1K0M A;  2HE3 A;  3QAG A;  4F0C A;  3C73 A;  2WZ9 A;  1KNG A;  1ZYQ B;  3LGC A;  4IW9 A;  2A2R A;  3EUR A;  3M9K A;  4CW9 A;  1K0O A;  4MH2 A;  2WZS A;  4K7O A;  2KP1 A;  3L9S A;  1IYI A;  1TJD A;  5D8I A;  4KW6 A;  5H5Q A;  2C3Q A;  3IBH A;  1K0B A;  1ERT A;  1U6T A;  3CTG A;  4OFN A;  1HD2 A;  3F0I A;  2IME A;  4TW5 A;  4V2L A;  4GQC A;  1G7E A;  4K7I A;  2ES7 A;  1O73 A;  2VD1 A;  1CQH A;  4J56 E;  3IXR A;  2PMT A;  1M2A A;  5FWG A;  2VIM A;  3IAM 2;  2LS5 A;  5AIS A;  3CRT A;  1T1V A;  3LXZ A;  1PKZ A;  1EEJ A;  1YKC A;  1ZCP A;  1XWK A;  2AAW A;  5IO2 A;  5J4Y A;  1N25 A;  1B9Y C;  1ZYN A;  1H75 A;  3LXT A;  4ECI A;  4MJA A;  1TK5 B;  3P8W A;  2VCT A;  2V32 A;  5HR2 A;  1BX9 A;  4PI2 C;  2VLU A;  5J9B A;  2GS3 A;  1OC3 A;  3M0F A;  3F9U A;  2GVP A;  4GSS A;  5D9V A;  4KND A;  1M3I A;  1Z9H A;  1OKT A;  5CRW A;  3EE2 A;  1DE2 A;  1FAA A;  2OBI A;  3KH9 A;  4BL7 A;  2JAC A;  1V40 A;  2H1D A;  4EO3 A;  4FQU A;  2OT3 A;  4YQM A;  2GQK A;  3DML A;  4HJ2 A;  4RQX A;  1LU4 A;  1EP8 A;  5KN0 A;  2I3Y A;  4D73 B;  3C1S A;  4V1A p;  5H5S A;  1GNW A;  4ZIJ A;  3K8N A;  1GSE A;  4MJC A;  4IHU A;  4WET A;  1SD9 A;  3CSJ A;  1U3I A;  4RUV A;  2MBT A;  4JU5 A;  1XG8 A;  4ML1 A;  5GAN D;  3Q18 A;  3UL3 A;  2YJ7 A;  2VL3 A;  5A4U A;  2MMA A;  1I1I P;  4K5S A;  1M2D A;  2WW1 A;  2VL9 A;  2JZT A;  2H76 A;  3QMX A;  2YZU A;  1X5E A;  4ZB7 A;  3BOA A;  3ZIV A;  4AKX B;  2H70 A;  3WT1 A;  4ZL9 A;  2IFQ A;  2H71 A;  5B6N A;  3L4N A;  4JZQ A;  3QFB C;  3EVI A;  2V41 A;  1HYU A;  1QGV A;  5ELG A;  5DCH A;  3TRQ A;  5JWO B;  1K0N A;  1ON4 A;  1RW1 A;  2L59 A;  3ERW A;  3APS A;  3E9J B;  1GSQ A;  2B1K A;  3EPT A;  3ZLP A;  5B7C A;  1K0C A;  3VI7 A;  4Q5R A;  3A3T A;  1TKD B;  3DRN A;  3CSH A;  1A8Y A;  3HCZ A;  3A2X A;  4HUA A;  4HI7 A;  2C8U A;  4AI6 A;  4PQ1 A;  2GLR A;  1BYE A;  5ECN B;  2ON7 A;  1JZW A;  2HSN A;  1GSY A;  1M3J A;  2P5R A;  2ALB A;  1S3C A;  5J3R A;  2X64 A;  3VWX A;  2EIQ A;  2H1A A;  1MD3 A;  1ERW A;  3FHK A;  4KCE A;  4F2I A;  2L5O A;  3E0U A;  1CQG A;  4KDX A;  5G5E A;  5IPH A;  2TRC P;  4MJB A;  4MZC A;  4NPB A;  1Z6N A;  3TU3 B;  1WJK A;  1B4Q A;  4XIH A;  4GTU A;  4L8E A;  2E2M A;  2H0H A;  1K3L A;  4G0L A;  1XZO A;  4WBR D;  4K0G A;  3A5I A;  5H5R A;  4MPF A;  4OCE A;  1S3D A;  6GSS A;  4AKH A;  1TP9 A;  5EPF A;  1C72 A;  1SJ6 A;  4X1U A;  1ZGN A;  1T4Y A;  2RM6 A;  4OFT A;  1DUG A;  4PGT A;  2M72 A;  2DJJ A;  2YCD A;  3D0Z A;  1FB0 A;  2CAQ A;  3DKS A;  3EMX A;  4CY6 A;  4OD7 A;  1FOV A;  3A5W A;  1R7H A;  2H66 A;  3D22 A;  1LBK A;  2K18 A;  1O8X A;  3RPN A;  2DJ1 A;  4EC0 A;  4E8H A;  3GST A;  2DJ0 A;  2I9H A;  1QUW A;  1T8E B;  16GS A;  2QC7 A;  3IC8 A;  1GL8 A;  2V1M A;  2FUG 2;  1TDI A;  3DGQ A;  5F05 A;  1QMV A;  2KP2 A;  1G7O A;  1SJZ A;  4ZBD A;  1XCC A;  4L0W A;  1NW2 A;  3ZIJ A;  2ON5 A;  3D21 A;  1OVN A;  4BVX A;  1GUK A;  4ECB A;  1UN2 A;  4HQZ A;  3GH9 A;  2GT5 A;  5F07 A;  1Y1U A;  1TI1 A;  1TRV A;  5CNW A;  5IMZ A;  3GTU B;  2YV7 A;  2K6V A;  2KHP A;  4ECJ A;  1SKR B;  2TRX A;  5B8A A;  2CAI A;  2AHE A;  1MEK A;  1PFO A;  1TRW A;  1J08 A;  1XW5 A;  5GSS A;  3FW2 A;  3GTU A;  1A23 A;  3KP9 A;  1XW6 A;  2K8S A;  3PR8 A;  1KEB A;  3D5J A;  2L6D A;  2HZF A;  4TR0 A;  1GNE A;  5KN3 A;  1M99 A;  2YWM A;  3HVN A;  4OO5 A;  2HRK B;  3F4R A;  2WCI A;  1ZMA A;  2VUP A;  4H86 A;  1V9W A;  2YWI A;  1MTC A;  4KSM A;  2OAD A;  5ECL B;  2HRK A;  1XIY A;  1EOG A;  3QAV A;  4K2X A;  1J0F A;  4W66 A;  4NWY A;  1GRX A;  4I2U A;  2NBS A;  1Q4J A;  3M1G A;  2DKH A;  1AQW A;  2RUF A;  4I5Q A;  3FRC A;  2LJK A;  4DSS B;  3ME7 A;  3EMP A;  4FYU A;  3TKS C;  5CRE A;  4NV5 A;  1PX7 A;  2YJH A;  2X8H A;  3PIN A;  1EV4 A;  1SKW B;  2R0P A;  2F8A A;  2B7K A;  4XS6 A;  4YAV A;  5F8B A;  3IAS 2;  5CO3 A;  2CVK A;  4LMV A;  2RII A;  2V6K A;  3HD5 A;  5ELA A;  3KIJ A;  1ABA A;  1V2A A;  2LJA A;  1BJX A;  3FR6 A;  1GSS A;  5EVO A;  1B9X C;  3TJB A;  4MF5 A;  3I6A A;  5A34 B;  3FEU A;  1Z7P A;  1ZYP A;  3KJY A;  3C7M A;  2FLS A;  1YQ1 A;  2PER A;  4IP1 A;  4MAB A;  4YKF A;  2WVX B;  4ZIL A;  3I69 A;  3FZ5 A;  1A0R P;  1V98 A;  3KZQ A;  1Y25 A;  5HR3 A;  3UJ1 A;  1A2L A;  5A34 A;  1SVO A;  3QAW A;  5F0G A;  2C0F A;  2HRA A;  1SL0 B;  2WVX A;  2V2G A;  3HHV A;  2GQM A;  3VFI A;  4HZ2 A;  4NV2 A;  4GST A;  5G31 A;  1XVW A;  3I9V 2;  1TK0 B;  2CX4 A;  4GRF A;  17GS A;  1TXU A;  1S3A A;  4E8E A;  3ZMK A;  4EDZ A;  4LLR A;  2CZ2 A;  2HNL A;  2E2G A;  4WBJ A;  1BF5 A;  1YZX A;  5LD0 A;  4WR5 A;  5IMA A;  2RM5 A;  3GRX A;  4AJ8 A;  2XPE A;  3A2W A;  3UOM A;  3DXB A;  4X43 A;  2MYG A;  1G6Y A;  4IJI A;  2XBQ A;  3TOU A;  3A2V A;  1SEN A;  3RHB A;  1WWJ A;  3WGX A;  3QCP A;  3ZML A;  1HNC A;  2UZ8 A;  2HXK A;  1HNB A;  3GYK A;  3C8E A;  1TOF A;  3TJJ A;  4O5R A;  5DAL A;  4HJM A;  4POK A;  3TKP A;  3UIW A;  4QMK A;  2GDR A;  3Q6O A;  3IHG A;  3CQF A;  3MSZ A;  1NHY A;  5EY6 A;  1TK8 B;  1I5G A;  2L5L A;  4Z2R A;  5ECH B;  4ILF A;  1UVZ A;  1Q98 A;  3KXO A;  4TN8 A;  1SK2 A;  3WYW A;  4GXZ A;  3GKN A;  2Z9S A;  4CY8 A;  3CRU A;  4TVE A;  1I9D A;  3RAZ A;  2VCZ A;  2H19 A;  1W89 A;  4HZ4 A;  2PWJ A;  3TJK A;  1XOB A;  2FGX A;  5CAX A;  1XFL A;  5D93 A;  2OA7 A;  4GQF A;  5FHI A;  4L5O A;  2CX3 A;  2VL2 A;  4PXO A;  4N30 A;  2GZY A;  4LL4 B;  1A8L A;  2GZP A;  3ME8 A;  4HOJ A;  5IOW A;  3W8J A;  3GX8 A;  5A5K A;  3TCO A;  4G0I A;  4G9H A;  4XRD A;  1GTU A;  4KF9 A;  2EFC A;  1YF0 A;  5JCW A;  1S4B P;  3IOS A;  2B5Y A;  2GST A;  4HDE A;  1WP0 A;  3CXG A;  1Z6M A;  1SYX A;  4WKW A;  4IEL A;  4ECC A;  1ZZY A;  2OJL A;  1SK0 A;  4DSQ A;  4BIK A;  1U87 A;  2O89 A;  2FHE A;  1ZL9 A;  5DBQ A;  2HSH A;  1PL2 A;  3LG6 A;  3GX0 A;  3HYP A;  2HSY A;  4ZB8 A;  1K3Y A;  5HQP A;  5ECR B;  5G2Z A;  2H1L A;  1DSB A;  2FA4 A;  3KGK A;  3IA1 A;  3HMJ G;  4KE3 A;  4MK3 A;  3CMI A;  3G9B A;  2EC4 A;  2WW3 A;  4EVM A;  2H6X A;  3U5R E;  3DD3 A;  5DCG A;  6GSV A;  1X9W B;  3FZ4 A;  1GH2 A;  4V2N A;  3G7J A;  4J2F A;  3TUE A;  2VOC A;  2X8G A;  3W8S A;  5ECM B;  2IL3 A;  4BL7 B;  1GWC A;  1F6M C;  4G10 A;  2R0C A;  2L4C A;  5J4V A;  3KD0 A;  4FIW A;  2LTK A;  5IMF A;  3TKQ A;  1FO5 A;  3KTB A;  3SBC A;  5A4W A;  3C1R A;  2DMM A;  4KA0 A;  1SKS B;  4Z2U A;  2JZS A;  4ZBB A;  2HRN A;  2AJQ B;  2JL4 A;  3IK9 A;  2LNS A;  3LW9 A;  1EOH A;  3BCI A;  4ZL7 A;  2D2Z A;  2WDU A;  2WW0 A;  3GKK A;  2C3T A;  4P3Y B;  1OKD A;  5DAK B;  2NDO A;  1RQM A;  3HKR A;  1T3B A;  2KLX A;  1YEW C;  4RI6 A;  5CYY A;  4WR4 A;  2YOI A;  5DAK A;  4PI0 C;  5G5F A;  2IFQ B;  1MDI A;  1KTE A;  2XBI A;  3GFK A;  5J5N A;  2CV4 A;  5J40 A;  2EIR A;  3VWV A;  4Q5Q A;  1VF1 A;  4RI7 A;  4TOP A;  4HU7 A;  1WMJ A;  2BTO T;  2YPM A;  5COH A;  1FB6 A;  4ICY A;  1ERV A;  4MF6 A;  3UMA A;  4YQU A;  4JE1 A;  1V58 A;  14GS A;  1XWC A;  4AF2 A;  4JR6 A;  3LEF A;  11GS A;  1FHE A;  1AQX A;  3VPQ A;  4FYB A;  3V1W A;  2HSN B;  1T7P B;  4G19 A;  5LCZ A;  1PMT A;  5JCG A;  1EZK A;  4OWY A;  4KCA A;  1NSW A;  2FA8 A;  2CQ9 A;  3EU4 A;  3ZYW A;  3TJF A;  5IOX A;  1GSD A;  5KOW A;  1PN9 A;  2EIO A;  2GSS A;  2LEG A;  4XHM A;  3HVX A;  2YP6 A;  4TXO A;  2MMO A;  1A2J A;  2O85 A;  5ECI B;  3AY8 A;  4JR4 A;  1JLW A;  4GSN A;  1URM A;  3L78 A;  1SYR A;  2XC2 A;  3HJP A;  3MWH A;  3DVW A;  5JWQ B;  4YQV A;  3RDW A;  4TXV A;  3DEX A;  1OYJ A;  3F63 A;  2EFH A;  4HQS A;  1R5A A;  3FKF A;  2DIZ A;  5HR0 A;  4TKY A;  3GUS A;  1PD2 1;  1N8J A;  2V6O A;  3O3T A;  4LL1 B;  4MZW A;  4GLT A;  1EP7 A;  3PH9 A;  1R26 A;  1VF3 A;  2UV8 G;  1GUM A;  4AJ6 A;  3H8Q A;  4EL1 A;  3TDG A;  4K6X A;  2LKU A;  2YWN A;  1AW9 A;  1AIU A;  5D96 A;  2WFC A;  2JAD A;  1Z3E A;  1GSU A;  5ENU A;  1XOA A;  5ECS A;  2B3S A;  1GP1 A;  4L5L A;  5CP1 A;  1YEP A;  5L71 A;  5J9C A;  1XWB A;  4BVX B;  3MDK A;  1PSQ A;  3D6I A;  4AKG A;  8GSS A;  5J41 A;  3F6F A;  3P2A A;  4IKH A;  4DSR A;  3H1N A;  2VLV A;  4YKG A;  2NVL A;  3EIN A;  3G7I A;  3TGZ A;  3IPZ A;  5IIZ A;  1TU7 A;  2CVB A;  2H1B A;  5DQS A;  1X9M B;  2IN3 A;  2H0I A;  5A4V A;  3CHX C;  4E68 A;  1W4V A;  3N9J A;  5INY A;  4X4J A;  2VKZ G;  3IDV A;  2AUV A;  1B8X A;  3BBY A;  4IBP A;  2YNX A;  4IN0 A;  5B6M A;  5LNK e;  3APO A;  4AJ7 A;  4K5R A;  1KBN A;  2FD3 A;  2HLS A;  3VPT A;  1BED A;  1O85 A;  9GSS A;  3VK9 A;  2O3E A;  3Q74 A;  2LV3 A;  5KN2 A;  1QQ2 A;  4KGI A;  4PUA A;  2G0F A;  2WRT A;  4MLY A;  4MF7 A;  4NXI A;  3P90 A;  3E3E A;  1PX6 A;  2XPD A;  3F8U A;  4QL9 A;  2RLI A;  3MIX A;  4O7H A;  2HZE B;  1EWX A;  1X9S B;  3IV4 A;  4KSO A;  4IVF A;  2PUK C;  2QA2 A;  4EIP A;  2MMN A;  3WT2 A;  1E6B A;  3LOR A;  2LRC A;  1MD4 A;  2YWO A;  2HZE A;  2CT6 A;  2J23 A;  3QOU A;  1AUC A;  2HQT A;  1HQO A;  1A2M A;  1WPI A;  1GTI A;  4PX1 A;  4ZXG A;  3IR4 A;  4YAP A;  1TRS A;  3O76 A;  1PN0 A;  5DVB A;  1M0U A;  4ZB6 A;  4O92 A;  3RPP A;  2VAF A;  2WJU A;  2DJK A;  4DVC A;  4V2M A;  4I97 A;  3TRX A;  4KH7 A;  3TB2 A;  2GZZ A;  2R3X A;  1F2E A;  4CHS A;  2PU9 C;  2WUL A;  2AB6 A;  3GN3 A;  3FR3 A;  2H74 A;  1YF1 A;  4KUN A;  2M80 A;  2HFD A;  4PUF C;  1QK8 A;  4EUY A;  1QXH A;  5ECP B;  2C80 A;  3CWG A;  3MYD A;  5HR1 A;  2H6Y A;  5GST A;  4FH8 A;  2P5Q A;  1K3O A;  3GV1 A;  3MNG A;  1K0D A;  2XHF A;  2GSR A;  4HEA 2;  1OAZ A;  2O36 A;  3M8N A;  3L9V A;  3CSI A;  4BWS A;  3RGB C;  2VL2 C;  4PQI A;  3IRA A;  3F6D A;  3ZFL A;  3J7Y b;  2NTO A;  1TXX A;  4HU9 A;  2JZR A;  2R0G A;  5IQY A;  2H73 A;  5CRG A;  3FY7 A;  4K2D A;  4POL A;  1B48 A;  3R3E A;  3QPM A;  4EXJ A;  5D9T A;  1IYH A;  6GSW A;  2E7P A;  1O81 A;  5DAL B;  3D4M A;  5CRD A;  4FO5 A;  2PVO C;  2BMX A;  1FVJ A;  4XTS A;  3UBK A;  4IS0 A;  1M2B A;  4EF0 A;  1MDJ A;  3KEB A;  2DLX A;  4GCI A;  4OO4 A;  1MDK A;  4CDO A; 
#chains in the Genus database with same CATH homology
 4PNF A;  1WE0 A;  5IMV A;  3UAP A;  2N5F A;  1T4Z A;  1TTZ A;  3WGE A;  4WF4 A;  1OE8 A;  3WD6 A;  2I1U A;  3N5O A;  3TKR A;  3TRP A;  2E0Q A;  4KB3 A;  5G1L A;  4F0B A;  1OC8 A;  4TRX A;  2B1L A;  3P7X A;  3PPU A;  4GDF A;  2VM2 A;  3GL5 A;  2QSI A;  5BMU A;  1J9B A;  1ST9 A;  4POM A;  4N11 A;  1NHO A;  4N10 A;  3IE3 A;  1ML6 A;  2LNT A;  1VF2 A;  4V1A g;  2G2Q A;  3LQ7 A;  5EL8 A;  4O5Q A;  2P31 A;  4MZB A;  4KX4 A;  1RK4 A;  3LYP A;  2X4A A;  2PPT A;  2X99 A;  2C0G A;  1OC9 B;  4I6X A;  5IO0 A;  2WS2 A;  3HA9 A;  1XWG A;  3H79 A;  4POB A;  5DQY A;  3O6T A;  1GTA A;  2OKA A;  3HDC A;  2F9S A;  2IMD A;  2DML A;  1OC9 A;  2NPB A;  3LFL A;  5AGY A;  4O32 A;  1USB A;  3F4T A;  3FZA A;  2B5E A;  3HY2 A;  3KTL A;  4K1F A;  2OAC A;  1SU9 A;  2H72 A;  3HXS A;  3VUR A;  4IJ3 A;  1X5D A;  4TR3 A;  2VLT A;  4Z7X A;  5ABR A;  2PVQ A;  3L0H A;  1M7T A;  3LYK A;  4O5U A;  3HVV A;  2VCV A;  4PTS A;  1ACV A;  3LJR A;  3UBL A;  1ILO A;  2OE3 A;  2X8C A;  3FR9 A;  1GUL A;  1F9M A;  5ECO B;  5J47 A;  3DIE A;  3HJM A;  2H1G A;  20GS A;  1ZYE A;  2DSA A;  2YZH A;  4XS4 B;  13GS A;  2MZC A;  12GS A;  3F3Q A;  4EKZ A;  4KDY A;  1BAY A;  2WB9 A;  1X5C A;  1M9A A;  1G6W A;  2C0D A;  4KAE A;  4EDY A;  1O6J A;  4XS4 A;  2EFD A;  2K8V A;  1GLQ A;  4G0K A;  5D9X A;  2VCW A;  5JCU A;  3ZVJ A;  2PGT A;  1HNA A;  2YAN A;  5ECK B;  3TOT A;  4N0Z A;  5HFK A;  4PUR A;  4BVY B;  3IK7 A;  4MPG A;  1GSF A;  1JFU A;  2HT9 A;  4I2T A;  2MBS A;  2GTU A;  1XPV A;  3BD2 A;  1YKA A;  4IGJ A;  1N2A A;  2DC5 A;  6GST A;  3UAR A;  4BVY A;  3NIV A;  3KMO A;  3GNJ A;  3ISO A;  1R5P A;  4A5P A;  4NAX A;  1LJR A;  1A24 A;  1TW9 A;  3CYN A;  4ISD A;  2I4A A;  3H93 A;  1Z7R A;  4OCF A;  3DWV A;  3S9F A;  22GS A;  4MDC A;  1EGR A;  1F37 A;  1K0A A;  4ZBA A;  2KOK A;  4N3Z A;  3UVT A;  4D73 A;  4MH3 A;  5JWR B;  2VCQ A;  4MJE A;  2FWH A;  2IMI A;  2YN1 A;  4MCU A;  2PBJ A;  1FG4 A;  1GUH A;  2LJR A;  3GUR A;  1SD8 A;  3ZVJ D;  2I81 A;  3G7Y A;  3ERG A;  4NHZ A;  2R4V A;  4TXO B;  3PGT A;  3ERF A;  3UEM A;  5CRH A;  1YDK A;  5IM9 A;  1JZO A;  4HS1 A;  1ZOF A;  4G01 A;  4BPY A;  3QD9 A;  4PNG A;  1X0R A;  4EE0 A;  5AN1 A;  2IIY A;  3CTF A;  5A5H B;  2H8L A;  4PQH A;  6GSY A;  2JSY A;  3RHC A;  3ZFB A;  4ULX A;  3KMN A;  2FNO A;  3R2Q A;  5A5H A;  4ACS A;  3L9U A;  1EV9 A;  2O8V B;  2QKE A;  2R5G A;  1O8W A;  3ZTL A;  2N5A A;  4I8B A;  3OR5 A;  3M9J A;  3UVH A;  5KEJ A;  2R2J A;  3HZ4 A;  4JRR A;  2PN8 A;  4MMM A;  2DIY A;  1AQV A;  5KOX A;  1V57 A;  3KM6 A;  1GTB A;  3FK8 A;  4N0V A;  2CZ3 A;  3ZIT A;  4ID0 A;  3ZZX A;  1WOU A;  4DEJ A;  4L0U A;  4ZL8 A;  1TI3 A;  1FOH A;  1XXU A;  2FCH A;  1TU8 A;  2BJX A;  3KP8 A;  2H75 A;  1T00 A;  1WRY A;  3GA4 A;  4Q5N A;  2LRN A;  5KN1 A;  1F3B A;  3VLN A;  2OBK A;  3FYG A;  4BWQ A;  1XWA A;  3GMF A;  2N5B A;  2CA8 A;  4GWR A;  3LSZ A;  5A1N B;  3ZRD A;  5F06 A;  1QFN A;  1SK1 A;  4IQA A;  4USS A;  4OMV A;  2R37 A;  3VI5 A;  3WGD A;  2CVD A;  1F3A A;  5IMC A;  4K9Z A;  5A1N A;  5GZZ B;  4MP4 A;  4MA9 A;  1GLP A;  2DBC A;  4WXT A;  2O87 A;  2QGV A;  1Z5Y E;  2IMK A;  1Y6E A;  2LUS A;  2KUC A;  3LWA A;  3BJ5 A;  3TKS E;  4XRA A;  3HZ8 A;  4OFM A;  1PGT A;  4JED A;  5G30 A;  2JSZ A;  2A2S A;  2WGR A;  1XW9 A;  6GSX A;  4XCS A;  3GHA A;  5C00 A;  5B8B A;  2LQQ A;  4ML6 A;  4J57 E;  4IP6 A;  1VF4 A;  4TR4 A;  4F9Z A;  10GS A;  5ECQ B;  4AKI A;  1THO A;  2F51 A;  5G1K A;  5GAP D;  2O5V A;  6GSU A;  3QDN A;  2HRF A;  3DYR A;  5D73 A;  3GIX A;  4KDU A;  1AXD A;  2DJ2 A;  1PKW A;  2HYX A;  4K8M A;  3QR6 A;  5IPG A;  5FT3 A;  1BG1 A;  3M3M A;  2JU5 A;  4EIQ A;  3ED3 A;  1ERU A;  3QFA C;  3BCK A;  2HSM B;  3HVS A;  3ZRE A;  3EWL A;  2OE0 A;  1UC7 A;  1JZR A;  2IMF A;  2HSM A;  1EEM A;  4JBB A;  1VRS D;  5E59 A;  1U88 A;  2H6Z A;  3GH6 A;  2TIR A;  4X0X A;  1PL1 A;  4NHW A;  2J9H A;  3SWL A;  2FWG A;  4DSS A;  2A4H A;  2ZUP A;  1XBS A;  1YY7 A;  3ZL5 A;  2H01 A;  1NM3 A;  2IJY A;  2GT6 A;  1H4O A;  2C3N A;  3KH7 A;  1FVK A;  2LQO A;  2F3M A;  5C04 A;  2FY6 A;  1BG5 A;  4G2E A;  1PQN A;  3DVX A;  1AAZ A;  3VWW A;  3F3R A;  2R6K A;  5DJM A;  4K0N A;  4F82 A;  2ZCT A;  3IHQ A;  4WF5 A;  3JCM L;  1M9B A;  4IQ1 A;  1WIK A;  19GS A;  3KCM A;  3VWU A;  3J7Y k;  1SVL A;  2F8F A;  2VM1 A;  2IWT A;  3IC4 A;  1SL2 B;  1VGL A;  2VCX A;  3D4T A;  2X49 A;  2VD0 A;  5AIX A;  1O7U A;  18GS A;  3U6V A;  2DJ3 A;  4TR1 B;  1UA5 A;  4K7N A;  3GSS A;  2HI7 A;  2C4J A;  5BRT A;  2C0E A;  1DE1 A;  2GGT A;  4Z2T A;  5ID2 B;  4Q5F A;  1JLV A;  3EYT A;  4LA1 A;  5HFI A;  5DDL A;  4TR1 A;  2L6C A;  4XS1 A;  2H0G A;  5IMD A;  1DBY A;  5DJL A;  1SL1 B;  7GSS A;  3Q19 A;  1YVL A;  2A4V A;  1U3A A;  1TRU A;  5ID2 A;  3NOF A;  2B5X A;  2DKI A;  3GL3 A;  2A2P A;  3NZN A;  2LST A;  3FZ9 A;  3TKS A;  3TJG A;  2FWF A;  2H30 A;  2L4Q A;  2LRT A;  1JZD A;  2QA1 A;  3H4K A;  4NMU A;  5D9W A;  1PA3 A;  3W6G A;  1R4W A;  5BMU B;  1YJ6 A;  3EC3 A;  2P0G A;  3US3 A;  2AYT A;  2B7J A;  5E4W A;  1E2Y A;  1G0T A;  2L57 A;  1OE7 A;  5AIV A;  4RQR A;  2C1Y A;  3RBT A;  1YEX A;  1PRX A;  2YV9 A;  1AC1 A;  1XVQ A;  4BA7 A;  1SJI A;  2IPA A;  5HFG A;  3F4S A;  3CBU A;  2EFE A;  1THX A;  4QL7 A;  4WEY A;  4ZB9 A;  2VO4 A;  1A0F A;  2RUE A;  2K9F A;  5J4U A;  2MMZ A;  3HJO A;  4MNN A;  3GKM A;  1EGO A;  4F03 A;  3EU3 A;  3C71 A;  3MAK A;  4LMW A;  2M46 A;  2REM A;  1B4P A;  3GKX A;  1SVM A;  4GF0 A;  2AV4 A;  3I43 A;  4FYC A;  2FWE A;  2OE1 A;  1BQ7 A;  2GQL A;  1JHB A;  4AGS A;  3APQ A;  1FW1 A;  4QQ7 A;  2O7K A;  2GSQ A;  2ZNM A;  3FMW A;  4YH2 A;  2B6M A;  1K0M A;  2HE3 A;  3QAG A;  4F0C A;  3C73 A;  2WZ9 A;  1KNG A;  1ZYQ B;  3LGC A;  4IW9 A;  3M9K A;  2A2R A;  3EUR A;  4CW9 A;  1K0O A;  4MH2 A;  4K7O A;  2KP1 A;  3L9S A;  1IYI A;  1TJD A;  5D8I A;  4KW6 A;  5H5Q A;  2C3Q A;  3IBH A;  1K0B A;  1ERT A;  1U6T A;  3CTG A;  4OFN A;  1HD2 A;  3F0I A;  2IME A;  4TW5 A;  4V2L A;  4GQC A;  1G7E A;  4K7I A;  2ES7 A;  1O73 A;  2VD1 A;  1CQH A;  4J56 E;  3IXR A;  2PMT A;  1M2A A;  5FWG A;  2VIM A;  3IAM 2;  2LS5 A;  5AIS A;  3CRT A;  1T1V A;  3LXZ A;  1PKZ A;  1EEJ A;  1YKC A;  1ZCP A;  1XWK A;  2AAW A;  5IO2 A;  5J4Y A;  1N25 A;  1B9Y C;  1ZYN A;  1H75 A;  3LXT A;  4ECI A;  4MJA A;  1TK5 B;  3P8W A;  2VCT A;  2V32 A;  5HR2 A;  1BX9 A;  2VLU A;  5J9B A;  2GS3 A;  1OC3 A;  3M0F A;  3F9U A;  2GVP A;  4GSS A;  5D9V A;  4KND A;  1Z9H A;  1OKT A;  5CRW A;  3EE2 A;  1DE2 A;  1FAA A;  2OBI A;  3KH9 A;  4BL7 A;  2JAC A;  1V40 A;  2H1D A;  4EO3 A;  4FQU A;  2OT3 A;  4YQM A;  2GQK A;  3DML A;  4HJ2 A;  4RQX A;  1LU4 A;  1EP8 A;  5KN0 A;  2I3Y A;  4D73 B;  3C1S A;  4V1A p;  5H5S A;  1GNW A;  4ZIJ A;  3K8N A;  1GSE A;  4MJC A;  4IHU A;  4WET A;  1SD9 A;  3CSJ A;  1U3I A;  4RUV A;  2MBT A;  4JU5 A;  4ML1 A;  5GAN D;  3Q18 A;  3UL3 A;  2YJ7 A;  2VL3 A;  5A4U A;  2MMA A;  4K5S A;  1M2D A;  2JZT A;  2VL9 A;  2H76 A;  3QMX A;  2YZU A;  1X5E A;  4ZB7 A;  3BOA A;  3ZIV A;  4AKX B;  2H70 A;  3WT1 A;  4ZL9 A;  2IFQ A;  2H71 A;  5B6N A;  3L4N A;  4JZQ A;  3QFB C;  3EVI A;  2V41 A;  1HYU A;  1QGV A;  5ELG A;  5DCH A;  3TRQ A;  5JWO B;  1K0N A;  1ON4 A;  1RW1 A;  2L59 A;  3ERW A;  3APS A;  3E9J B;  1GSQ A;  2B1K A;  3EPT A;  3ZLP A;  5B7C A;  1K0C A;  3VI7 A;  4Q5R A;  3A3T A;  1TKD B;  3DRN A;  3CSH A;  1A8Y A;  3HCZ A;  3A2X A;  4HUA A;  4HI7 A;  2C8U A;  4AI6 A;  4PQ1 A;  2GLR A;  1BYE A;  5ECN B;  2ON7 A;  1JZW A;  2HSN A;  1GSY A;  2P5R A;  2ALB A;  1S3C A;  5J3R A;  2X64 A;  3VWX A;  2EIQ A;  2H1A A;  1MD3 A;  1ERW A;  3FHK A;  4KCE A;  4F2I A;  2L5O A;  3E0U A;  1CQG A;  4KDX A;  5G5E A;  5IPH A;  2TRC P;  4MJB A;  4MZC A;  4NPB A;  1Z6N A;  3TU3 B;  1WJK A;  1B4Q A;  4XIH A;  4GTU A;  4L8E A;  2E2M A;  2H0H A;  1K3L A;  4G0L A;  1XZO A;  4WBR D;  4K0G A;  3A5I A;  5H5R A;  4MPF A;  4OCE A;  1S3D A;  6GSS A;  4AKH A;  1TP9 A;  5EPF A;  1C72 A;  1SJ6 A;  4X1U A;  1ZGN A;  1T4Y A;  2RM6 A;  4OFT A;  1DUG A;  4PGT A;  2M72 A;  2DJJ A;  2YCD A;  3D0Z A;  1FB0 A;  2CAQ A;  3DKS A;  3EMX A;  4CY6 A;  4OD7 A;  1FOV A;  3A5W A;  1R7H A;  2H66 A;  3D22 A;  1LBK A;  2K18 A;  1O8X A;  3RPN A;  2DJ1 A;  4EC0 A;  4E8H A;  3GST A;  2DJ0 A;  2I9H A;  1QUW A;  1T8E B;  16GS A;  2QC7 A;  3IC8 A;  1GL8 A;  2V1M A;  2FUG 2;  1TDI A;  3DGQ A;  5F05 A;  1QMV A;  2KP2 A;  1G7O A;  1SJZ A;  4ZBD A;  1XCC A;  4L0W A;  1NW2 A;  3ZIJ A;  2ON5 A;  3D21 A;  1OVN A;  4BVX A;  1GUK A;  4ECB A;  1UN2 A;  4HQZ A;  3GH9 A;  2GT5 A;  5F07 A;  1Y1U A;  1TI1 A;  1TRV A;  5CNW A;  5IMZ A;  3GTU B;  2YV7 A;  2K6V A;  2KHP A;  4ECJ A;  1SKR B;  2TRX A;  5B8A A;  2CAI A;  2AHE A;  1MEK A;  1TRW A;  1J08 A;  1XW5 A;  5GSS A;  3FW2 A;  3GTU A;  1A23 A;  3KP9 A;  1XW6 A;  2K8S A;  3PR8 A;  1KEB A;  3D5J A;  2L6D A;  2HZF A;  4TR0 A;  1GNE A;  5KN3 A;  1M99 A;  2YWM A;  4OO5 A;  2HRK B;  3F4R A;  2WCI A;  1ZMA A;  2VUP A;  4H86 A;  1V9W A;  2YWI A;  1MTC A;  4KSM A;  2OAD A;  5ECL B;  2HRK A;  1XIY A;  1EOG A;  3QAV A;  4K2X A;  1J0F A;  4W66 A;  4NWY A;  1GRX A;  4I2U A;  2NBS A;  1Q4J A;  3M1G A;  2DKH A;  1AQW A;  2RUF A;  4I5Q A;  3FRC A;  2LJK A;  4DSS B;  3ME7 A;  3EMP A;  4FYU A;  3TKS C;  5CRE A;  4NV5 A;  1PX7 A;  2YJH A;  2X8H A;  3PIN A;  1EV4 A;  1SKW B;  2R0P A;  2F8A A;  2B7K A;  4XS6 A;  4YAV A;  5F8B A;  3IAS 2;  5CO3 A;  2CVK A;  4LMV A;  2RII A;  2V6K A;  3HD5 A;  5ELA A;  3KIJ A;  1ABA A;  1V2A A;  2LJA A;  1BJX A;  3FR6 A;  1GSS A;  5EVO A;  1B9X C;  3TJB A;  4MF5 A;  3I6A A;  5A34 B;  3FEU A;  1Z7P A;  1ZYP A;  3KJY A;  3C7M A;  2FLS A;  1YQ1 A;  2PER A;  4IP1 A;  4MAB A;  4YKF A;  4ZIL A;  3I69 A;  3FZ5 A;  1A0R P;  1V98 A;  3KZQ A;  1Y25 A;  5HR3 A;  3UJ1 A;  1A2L A;  5A34 A;  1SVO A;  3QAW A;  5F0G A;  2C0F A;  2HRA A;  1SL0 B;  3HHV A;  2V2G A;  2GQM A;  3VFI A;  4HZ2 A;  4NV2 A;  4GST A;  5G31 A;  1XVW A;  3I9V 2;  1TK0 B;  2CX4 A;  4GRF A;  17GS A;  1TXU A;  1S3A A;  4E8E A;  3ZMK A;  4EDZ A;  4LLR A;  2CZ2 A;  2HNL A;  2E2G A;  4WBJ A;  1BF5 A;  1YZX A;  5LD0 A;  4WR5 A;  5IMA A;  2RM5 A;  3GRX A;  4AJ8 A;  2XPE A;  3A2W A;  3UOM A;  3DXB A;  4X43 A;  2MYG A;  1G6Y A;  4IJI A;  2XBQ A;  3TOU A;  3A2V A;  1SEN A;  3RHB A;  1WWJ A;  3WGX A;  3QCP A;  3ZML A;  1HNC A;  2UZ8 A;  2HXK A;  1HNB A;  3GYK A;  3C8E A;  1TOF A;  3TJJ A;  4O5R A;  5DAL A;  4HJM A;  4POK A;  3TKP A;  3UIW A;  4QMK A;  2GDR A;  3Q6O A;  3IHG A;  3MSZ A;  1NHY A;  5EY6 A;  1TK8 B;  1I5G A;  2L5L A;  4Z2R A;  5ECH B;  4ILF A;  1UVZ A;  1Q98 A;  3KXO A;  4TN8 A;  1SK2 A;  3WYW A;  4GXZ A;  3GKN A;  2Z9S A;  4CY8 A;  3CRU A;  4TVE A;  1I9D A;  3RAZ A;  2VCZ A;  2H19 A;  1W89 A;  4HZ4 A;  2PWJ A;  3TJK A;  1XOB A;  2FGX A;  5CAX A;  1XFL A;  5D93 A;  2OA7 A;  4GQF A;  5FHI A;  4L5O A;  2CX3 A;  2VL2 A;  4PXO A;  4N30 A;  2GZY A;  4LL4 B;  1A8L A;  2GZP A;  3ME8 A;  4HOJ A;  5IOW A;  3W8J A;  3GX8 A;  5A5K A;  3TCO A;  4G0I A;  4G9H A;  4XRD A;  1GTU A;  4KF9 A;  2EFC A;  1YF0 A;  5JCW A;  3IOS A;  2B5Y A;  2GST A;  4HDE A;  1WP0 A;  3CXG A;  1Z6M A;  1SYX A;  4WKW A;  4IEL A;  4ECC A;  1ZZY A;  2OJL A;  1SK0 A;  4DSQ A;  1U87 A;  2O89 A;  2FHE A;  1ZL9 A;  5DBQ A;  2HSH A;  1PL2 A;  3LG6 A;  3GX0 A;  3HYP A;  2HSY A;  4ZB8 A;  1K3Y A;  5HQP A;  5ECR B;  5G2Z A;  2H1L A;  1DSB A;  2FA4 A;  3KGK A;  3IA1 A;  3HMJ G;  4KE3 A;  4MK3 A;  3CMI A;  3G9B A;  2EC4 A;  4EVM A;  2H6X A;  3U5R E;  3DD3 A;  5DCG A;  6GSV A;  1X9W B;  3FZ4 A;  1GH2 A;  4V2N A;  3G7J A;  4J2F A;  3TUE A;  2VOC A;  2X8G A;  3W8S A;  5ECM B;  2IL3 A;  4BL7 B;  1GWC A;  1F6M C;  4G10 A;  2R0C A;  2L4C A;  5J4V A;  3KD0 A;  4FIW A;  2LTK A;  5IMF A;  3TKQ A;  1FO5 A;  3KTB A;  3SBC A;  5A4W A;  3C1R A;  2DMM A;  4KA0 A;  1SKS B;  4Z2U A;  2JZS A;  4ZBB A;  2HRN A;  2AJQ B;  2JL4 A;  3IK9 A;  2LNS A;  3LW9 A;  1EOH A;  3BCI A;  4ZL7 A;  2D2Z A;  2WDU A;  3GKK A;  2C3T A;  4P3Y B;  1OKD A;  5DAK B;  2NDO A;  1RQM A;  3HKR A;  1T3B A;  2KLX A;  4RI6 A;  5CYY A;  4WR4 A;  2YOI A;  5DAK A;  5G5F A;  2IFQ B;  1MDI A;  1KTE A;  2XBI A;  3GFK A;  5J5N A;  2CV4 A;  5J40 A;  2EIR A;  3VWV A;  4Q5Q A;  1VF1 A;  4RI7 A;  4TOP A;  4HU7 A;  1WMJ A;  2BTO T;  2YPM A;  5COH A;  1FB6 A;  4ICY A;  1ERV A;  4MF6 A;  3UMA A;  4YQU A;  4JE1 A;  1V58 A;  14GS A;  1XWC A;  4AF2 A;  4JR6 A;  3LEF A;  11GS A;  1FHE A;  1AQX A;  3VPQ A;  4FYB A;  3V1W A;  2HSN B;  1T7P B;  4G19 A;  5LCZ A;  1PMT A;  5JCG A;  1EZK A;  4OWY A;  4KCA A;  1NSW A;  2FA8 A;  2CQ9 A;  3EU4 A;  3ZYW A;  3TJF A;  5IOX A;  1GSD A;  5KOW A;  1PN9 A;  2EIO A;  2GSS A;  2LEG A;  4XHM A;  3HVX A;  2YP6 A;  4TXO A;  2MMO A;  1A2J A;  2O85 A;  5ECI B;  3AY8 A;  4JR4 A;  1JLW A;  4GSN A;  1URM A;  3L78 A;  1SYR A;  2XC2 A;  3HJP A;  3MWH A;  3DVW A;  5JWQ B;  4YQV A;  3RDW A;  4TXV A;  3DEX A;  1OYJ A;  3F63 A;  2EFH A;  4HQS A;  1R5A A;  3FKF A;  2DIZ A;  5HR0 A;  4TKY A;  3GUS A;  1PD2 1;  1N8J A;  2V6O A;  3O3T A;  4LL1 B;  4MZW A;  4GLT A;  1EP7 A;  3PH9 A;  1R26 A;  1VF3 A;  2UV8 G;  1GUM A;  4AJ6 A;  3H8Q A;  4EL1 A;  3TDG A;  4K6X A;  2LKU A;  2YWN A;  1AW9 A;  1AIU A;  5D96 A;  2WFC A;  2JAD A;  1Z3E A;  1GSU A;  5ENU A;  1XOA A;  5ECS A;  2B3S A;  1GP1 A;  4L5L A;  5CP1 A;  1YEP A;  5L71 A;  5J9C A;  1XWB A;  4BVX B;  3MDK A;  1PSQ A;  3D6I A;  4AKG A;  8GSS A;  5J41 A;  3F6F A;  3P2A A;  4IKH A;  4DSR A;  3H1N A;  2VLV A;  4YKG A;  2NVL A;  3EIN A;  3G7I A;  3TGZ A;  3IPZ A;  5IIZ A;  1TU7 A;  2CVB A;  2H1B A;  5DQS A;  1X9M B;  2IN3 A;  2H0I A;  5A4V A;  4E68 A;  1W4V A;  3N9J A;  5INY A;  4X4J A;  2VKZ G;  3IDV A;  2AUV A;  1B8X A;  3BBY A;  4IBP A;  2YNX A;  4IN0 A;  5B6M A;  5LNK e;  3APO A;  4AJ7 A;  4K5R A;  1KBN A;  2FD3 A;  2HLS A;  3VPT A;  1BED A;  1O85 A;  9GSS A;  3VK9 A;  3Q74 A;  2LV3 A;  5KN2 A;  1QQ2 A;  4KGI A;  4PUA A;  2G0F A;  2WRT A;  4MLY A;  4MF7 A;  4NXI A;  3P90 A;  3E3E A;  1PX6 A;  2XPD A;  3F8U A;  4QL9 A;  2RLI A;  3MIX A;  4O7H A;  2HZE B;  1EWX A;  1X9S B;  3IV4 A;  4KSO A;  4IVF A;  2PUK C;  2QA2 A;  4EIP A;  2MMN A;  3WT2 A;  1E6B A;  3LOR A;  2LRC A;  1MD4 A;  2YWO A;  2HZE A;  2CT6 A;  2J23 A;  3QOU A;  1AUC A;  2HQT A;  1HQO A;  1A2M A;  1WPI A;  1GTI A;  4PX1 A;  4ZXG A;  3IR4 A;  4YAP A;  1TRS A;  3O76 A;  1PN0 A;  5DVB A;  1M0U A;  4ZB6 A;  4O92 A;  3RPP A;  2VAF A;  2WJU A;  2DJK A;  4DVC A;  4V2M A;  4I97 A;  3TRX A;  4KH7 A;  3TB2 A;  2GZZ A;  2R3X A;  1F2E A;  4CHS A;  2PU9 C;  2WUL A;  2AB6 A;  3GN3 A;  3FR3 A;  2H74 A;  1YF1 A;  4KUN A;  2M80 A;  2HFD A;  4PUF C;  1QK8 A;  4EUY A;  1QXH A;  5ECP B;  2C80 A;  3CWG A;  3MYD A;  5HR1 A;  2H6Y A;  5GST A;  4FH8 A;  2P5Q A;  1K3O A;  3GV1 A;  3MNG A;  1K0D A;  2XHF A;  2GSR A;  4HEA 2;  1OAZ A;  3M8N A;  3L9V A;  3CSI A;  4BWS A;  2VL2 C;  4PQI A;  3IRA A;  3F6D A;  3ZFL A;  3J7Y b;  2NTO A;  1TXX A;  4HU9 A;  2JZR A;  2R0G A;  5IQY A;  2H73 A;  5CRG A;  3FY7 A;  4K2D A;  4POL A;  1B48 A;  3R3E A;  3QPM A;  4EXJ A;  5D9T A;  1IYH A;  6GSW A;  2E7P A;  1O81 A;  5DAL B;  3D4M A;  5CRD A;  4FO5 A;  2PVO C;  2BMX A;  1FVJ A;  4XTS A;  3UBK A;  4IS0 A;  1M2B A;  4EF0 A;  1MDJ A;  3KEB A;  2DLX A;  4GCI A;  4OO4 A;  1MDK A;  4CDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...