1BYEA

Glutathione s-transferase i from mais in complex with atrazine glutathione conjugate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
213
Chain Sequence
APMKLYGAVMSWNLTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERPSVQKVAALMKPSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Structures of herbicides in complex with their detoxifying enzyme glutathione S-transferase - explanations for the selectivity of the enzyme in plants.
pubmed doi rcsb
source organism Zea mays
total genus 65
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1byeA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1byeA01
2GSSA 5ENUA 2C0DA 1SJIA 3LXZA 3BCIA 3H8QA 2VCXA 1AIUA 4GSSA 3FZ4A 4DSSA 1VF2A 2OJLA 1A0FA 5CNWA 4PXOA 1TW9A 4ZB6A 3RBTA 1E2YA 2O87A 4OMVA 2NTOA 3APQA 4OO5A 3C73A 1AC1A 1K0OA 2F3MA 1TI1A 4IS0A 3IR4A 1A2MA 1ERWA 5C04A 3Q74A 2G0FA 4KDYA 3PH9A 4IJ3A 5AIVA 1ILOA 3VFIA 3WGEA 2H1GA 4OCFA 3LORA 4MABA 3KH7A 4FQUA 1K0CA 5IMFA 2YN1A 2DJJA 2GZPA 3KEBA 3A3TA 1FAAA 3O3TA 3ERFA 5GSTA 3GH9A 3KH9A 4IQAA 2DMMA 2WCIA 1YDKA 1PQNA 3HKRA 4D73A 4MF7A 1A8LA 4ILFA 1MTCA 2DJ3A 1EOGA 5F07A 3GMFA 3KGKA 1SKSB 3KD0A 2H6YA 4MJBA 1GTIA 4WKWA 4K6XA 1Z6NA 5IPGA 4OCEA 3ERGA 2YOIA 1O8WA 1QGVA 5HFKA 1RK4A 5HR0A 1M99A 3L78A 3ZLPA 3TOTA 3KXOA 3CRTA 4MP4A 2HRKB 5FWGA 2LTKA 2OACA 1B9XC 1EEJA 2FCHA 2DC5A 2MMAA 3GL3A 2GDRA 3SBCA 1JZWA 4O5RA 5G5FA 1GSUA 1M9AA 1V98A 2C3QA 5ECPB 1SK0A 5D96A 1FHEA 4QQ7A 5LCZA 3M9JA 3HHVA 4BVYB 4NHWA 2MMZA 1EGRA 4ZB9A 3GSTA 3HVXA 4IVFA 2HQTA 3WYWA 1QQ2A 3RPPA 3EMPA 3DKSA 2G2QA 2WZ9A 3TKSA 1TP9A 2OKAA 4L0WA 2H01A 4WEYA 1SYXA 3BD2A 3D0ZA 2GQMA 4N10A 3TKSC 2OBKA 1FVJA 3D6IA 4V1Ap 1OE7A 5CYYA 4PQIA 1ON4A 4IP6A 2WRTA 3LGCA 5E4WA 4V1Ag 2CVBA 1DUGA 2WGRA 3TKRA 4NV5A 1M0UA 1XIYA 3GRXA 4MZBA 4EUYA 3CMIA 3TJGA 1A0RP 3LYPA 4IELA 4PNFA 1XCCA 5DAKB 5ECMB 3DEXA 5GAPD 1S3AA 4HEA2 3NZNA 1QMVA 5D73A 1A24A 2HYXA 3D21A 2C0EA 3TKSE 3C7MA 2LKUA 1DE1A 1GTUA 1U3AA 1SL1B 3GV1A 3IAS2 1SKRB 4MJCA 3EU3A 2EIQA 1QFNA 2C0GA 2F9SA 1XOBA 1PKZA 1HYUA 4YQMA 2GSTA 3H93A 4K8MA 2LRTA 2E7PA 4LLRA 1FOVA 4MCUA 2C80A 2GVPA 2KHPA 3FEUA 5HQPA 1GUHA 3QAGA 3L9UA 5D9VA 2H74A 5ECSA 3KIJA 4HQSA 2CT6A 4G10A 4ML6A 3GA4A 1XOAA 1U6TA 4FH8A 3IOSA 4NPBA 5B6NA 1AQXA 12GSA 2H0GA 2ZCTA 4ZBDA 1YKCA 2X8HA 1SKWB 5B8AA 1NW2A 1RW1A 4MH2A 4TKYA 4HJMA 5C00A 3F0IA 1X9SB 4MK3A 3UARA 2DJ1A 2VCWA 5A4UA 5IMAA 1WP0A 2B1KA 2JZRA 5D9WA 2JSZA 4MLYA 3L9VA 3LEFA 3ZVJA 22GSA 3GX8A 1BX9A 3E0UA 3P2AA 2GS3A 2K8SA 2YPMA 2FLSA 1R7HA 2OE3A 2WS2A 1EP8A 2B5EA 2CQ9A 4PURA 2VCTA 2HRKA 4ZBBA 2YNXA 3VLNA 3APSA 3ZL5A 2IJYA 2K6VA 3OR5A 1JZOA 5J3RA 3KM6A 4MDCA 2F51A 5ECLB 1B48A 7GSSA 2UZ8A 2YWIA 3GFKA 1KNGA 2V2GA 1XZOA 2XHFA 1NHYA 4EKZA 9GSSA 2DLXA 2OA7A 4BVYA 1R5PA 3MNGA 3DWVA 2XBQA 4I2TA 1QK8A 5F06A 4ECJA 2H6ZA 4PQ1A 4I97A 5B6MA 3O6TA 4DSQA 3QAWA 4ML1A 2HSMB 1MDIA 4ULXA 3DXBA 3TKPA 1Q98A 3IA1A 1PA3A 2YV7A 1PRXA 2RUEA 4USSA 2DSAA 1GNWA 4KUNA 3C8EA 5JWQB 4V2LA 2KP1A 2KUCA 4OD7A 1JLVA 4TR4A 5ECQB 5LNKe 1B9YC 3GKKA 5IPHA 6GSTA 3HYPA 2P0GA 1GSDA 2FY6A 2C4JA 4JR6A 1F37A 2YJHA 3L0HA 2YWMA 5HFGA 1H4OA 2NVLA 2B5YA 2LQOA 4BVXB 2VLUA 1EV9A 4JRRA 1V58A 4LL1B 1SYRA 3VWWA 4GCIA 2X64A 4JU5A 2RIIA 2PVQA 5HR2A 4KH7A 5DAKA 1WJKA 3G7IA 2NPBA 5F8BA 4EC0A 5G30A 2AUVA 1F6MC 3LWAA 20GSA 4MJEA 3KP8A 2YZUA 5H5RA 5AISA 5EY6A 3HDCA 2VO4A 4BL7B 2L5OA 4TXOB 3CRUA 3UBLA 3ZITA 4ECBA 1ZOFA 2MMNA 1MDKA 3F8UA 1SK2A 3F3RA 1FVKA 3LG6A 3TGZA 1TU7A 1Z7RA 5JWRB 2H66A 1OKTA 2FA8A 5G31A 2LEGA 6GSXA 5JCWA 2VL2A 1M2DA 3WT1A 2H73A 2DIYA 2H0IA 1EV4A 3LJRA 4X1UA 3VPTA 2EC4A 3ZTLA 4ISDA 2V6KA 4PUAA 3G7JA 3IAM2 1R4WA 3R2QA 1XWBA 2TRXA 4JE1A 4EDYA 2M46A 3C1RA 1N8JA 4K7NA 4O92A 3DRNA 5EVOA 1DSBA 6GSVA 3UMAA 4N0VA 2CA8A 4POMA 1HNAA 3HD5A 4TR1B 1G6WA 3IC8A 4OFMA 3ZMKA 4K7IA 3VI7A 3TOUA 2IMDA 3DMLA 1TDIA 2RM5A 1BG5A 3Q6OA 4JR4A 1GLQA 1F3AA 5CRWA 1GUKA 1OYJA 5F0GA 1UN2A 1YEPA 1JZDA 3EVIA 1WRYA 4AJ8A 2TIRA 5J4UA 2V32A 2CAQA 1PKWA 4HJ2A 3FY7A 1SU9A 4TW5A 5AGYA 5J9CA 5CRDA 2B1LA 2XPDA 2GLRA 3CSIA 1SD9A 1WE0A 3KTBA 4LA1A 3BBYA 4POBA 3FZ9A 1AXDA 3RPNA 3G9BA 2LSTA 3ZZXA 4KCEA 2FA4A 4JEDA 4PQHA 3N5OA 1ZYEA 3UEMA 3Q19A 2K18A 3TB2A 4NAXA 3IK9A 2GZYA 2I3YA 3QOUA 2F8AA 4ID0A 1ZL9A 1M2AA 2L57A 5LD0A 2R37A 1CQGA 1IYHA 5ABRA 3UOMA 1SL0B 4DEJA 1FB0A 3FKFA 3GHAA 2HSMA 1LBKA 4WETA 1T1VA 2L59A 3ZREA 1FG4A 4EXJA 1PMTA 2B6MA 1AAZA 1JZRA 3KCMA 1FB6A 3QFAC 4GSTA 3SWLA 3U5RE 3LSZA 3EC3A 3KP9A 4XS4A 3IC4A 4MMMA 1GSFA 5ECKB 4KW6A 5D8IA 3WGDA 1THOA 2VCQA 4Q5FA 3RHBA 2VL3A 2K8VA 3J7Yb 6GSYA 4BPYA 3TJBA 4BVXA 3H4KA 1IYIA 4FO5A 1YEXA 3E9JB 4HZ2A 4HU7A 1GL8A 1K3LA 13GSA 1MEKA 2O7KA 14GSA 3QD9A 4G9HA 1ACVA 1Z9HA 1BAYA 4QL7A 1XWKA 3QR6A 2HRFA 1HQOA 5ECNB 1Z7PA 2FGXA 2VD1A 3MSZA 5JCGA 5CREA 5AIXA 3DVWA 3F6FA 4BL7A 2RUFA 1YY7A 4TXOA 2ES7A 1GSSA 3IBHA 5IOWA 5GSSA 2WB9A 1WIKA 2FD3A 4NMUA 1YJ6A 3F9UA 3FYGA 2TRCP 1J0FA 3U6VA 1K0AA 2CX3A 2R2JA 2K9FA 2I81A 1TK8B 2P5QA 2ZUPA 3ZFBA 2QKEA 1SENA 4G2EA 2LJRA 3AY8A 2C1YA 3LXTA 1I5GA 5G5EA 1G6YA 5H5SA 1U3IA 3UBKA 4OWYA 4F2IA 2HNLA 3EU4A 4N11A 1M2BA 4TR1A 1EZKA 1ZCPA 4WBRD 3HVVA 4MZWA 5H5QA 1YF1A 1ST9A 1ERUA 4L5OA 2LRNA 4NWYA 4JZQA 4O7HA 4XRAA 4F9ZA 2J9HA 1N2AA 4X0XA 1ERTA 1OC3A 5IO2A 1DBYA 5ELAA 5JWOB 5CO3A 2B7KA 2FWHA 1ZGNA 2JADA 2ZNMA 4IP1A 3IPZA 4WR4A 1T7PB 2HFDA 3GSSA 4KAEA 3TKQA 3A2XA 1HD2A 1AUCA 1PD21 3P90A 2QSIA 3W6GA 4E8HA 1G7EA 2AHEA 4KGIA 5D9TA 4K1FA 2WJUA 1G7OA 1O85A 2L6DA 4MH3A 1F9MA 4AJ6A 4YAPA 4XCSA 2HLSA 2PWJA 3HCZA 2P5RA 4IN0A 4TR3A 1B4PA 3ISOA 3GNJA 4TN8A 4TXVA 2IL3A 3FR6A 2BJXA 4K2DA 3TJKA 1K0NA 6GSWA 3TJFA 3MWHA 3WD6A 4CDOA 5J5NA 4GSNA 4MZCA 4YH2A 1R5AA 2A4VA 4GF0A 2JU5A 2QC7A 5KN2A 1VF1A 1GSYA 1O7UA 5A5KA 2D2ZA 3TUEA 1J08A 1GWCA 1VF3A 1EOHA 5DJMA 1CQHA 4FIWA 3UVTA 2CZ2A 5D93A 4WXTA 5ELGA 3PPUA 5J9BA 4J57E 2HSNB 1K0BA 4K7OA 3QAVA 3D4MA 2LJAA 2V6OA 2JZTA 1OC8A 2IWTA 4N30A 2JSYA 5ECOB 1QUWA 2B3SA 2V41A 2B5XA 4XS1A 2GGTA 3QCPA 5A4VA 3S9FA 4K0GA 2QGVA 2KLXA 4YQUA 1XW5A 1GNEA 4FYCA 5J41A 2IN3A 1PX6A 2ON7A 2GTUA 2CAIA 2JACA 3APOA 1K0MA 4BA7A 1X5DA 4X43A 4RUVA 3VWVA 3GTUB 4HU9A 1GTAA 5IOXA 4V2MA 4EL1A 5B8BA 1YZXA 1KBNA 1XFLA 1HNCA 3DVXA 1XVQA 4TOPA 4GLTA 2GQKA 1SK1A 3HVSA 2PGTA 2DJ0A 5E59A 2X8GA 4Q5NA 2H71A 5G1KA 1OE8A 1B8XA 2VLVA 4IGJA 2VAFA 5IMCA 2WFCA 1PN9A 4RQXA 1GUMA 4HI7A 1GSEA 5IMDA 4XS4B 1O81A 2GT6A 2GZZA 3ZMLA 2BTOT 3PINA 1V40A 4O32A 2VD0A 5L71A 3D4TA 1URMA 1JLWA 4MF5A 4OO4A 4L0UA 4K9ZA 4GXZA 3A5WA 3UAPA 4I8BA 4GQFA 4DSRA 3W8SA 3FR9A 4N0ZA 3US3A 1VRSD 3LQ7A 2AB6A 4IW9A 4AJ7A 2YZHA 2HT9A 4I5QA 1T8EB 3ZIJA 1KEBA 4XHMA 2I4AA 1UC7A 5DCHA 4MJAA 1FW1A 1I9DA 1FO5A 2R4VA 4Z7XA 3IK7A 1SD8A 2H30A 3E3EA 2KOKA 2OBIA 1GH2A 1M7TA 3EYTA 1U87A 2VM1A 4AGSA 1PSQA 2C0FA 2AAWA 1SJ6A 2PVOC 1F3BA 1Q4JA 1C72A 2YCDA 4HQZA 5IIZA 2HSYA 2IMIA 4XRDA 5ECHB 3ME7A 4AF2A 2HZEB 2PU9C 2FHEA 2LV3A 1JHBA 5F05A 4HDEA 1LU4A 1J9BA 3D22A 1XXUA 2HRNA 2B7JA 5CAXA 1SJZA 5BMUA 2FUG2 4ZBAA 1XWGA 1WWJA 5A4WA 2JL4A 1TTZA 1T4YA 1BQ7A 5D9XA 1GLPA 1YF0A 4NHZA 1XW6A 4K0NA 4IHUA 4KDUA 1W89A 3EMXA 1EWXA 2H6XA 3HY2A 3A2VA 3VWXA 5ID2A 1M9BA 6GSUA 1TI3A 5IMVA 4F82A 4OFTA 2M80A 4F0BA 2CVDA 2A2RA 3KJYA 2C8UA 1VF4A 5KN0A 3BOAA 3HJOA 2VOCA 2Z9SA 3QFBC 3H79A 5AN1A 1ABAA 3FW2A 5KN3A 2DIZA 3JCML 3IE3A 1ERVA 4L5LA 5DALA 2LJKA 1GRXA 3UJ1A 1T00A 4KNDA 5G1LA 5HR3A 1PGTA 2XPEA 2L5LA 1V2AA 2H70A 4PX1A 1NSWA 2VUPA 4CW9A 5DCGA 2H1DA 3RDWA 2H1AA 3DD3A 2PPTA 3HA9A 1YKAA 1QXHA 2EIOA 1S3CA 4HS1A 3HJPA 4PNGA 4I2UA 3GTUA 5DDLA 5CRGA 6GSSA 1G0TA 4KE3A 2MZCA 2L4QA 2LNTA 1MDJA 1OVNA 3GYKA 2CVKA 5EPFA 3HZ8A 1Z5YE 4TR0A 4FYBA 2P31A 4G0IA 4IJIA 1RQMA 4F03A 2YWNA 1R26A 1OAZA 1NM3A 2HXKA 4GRFA 4PUFC 2DMLA 2VCVA 1JFUA 2YP6A 3GKMA 2RM6A 1V57A 2R6KA 5DVBA 1W4VA 8GSSA 3ZIVA 3F4TA 3I69A 3TRXA 10GSA 5FHIA 1NHOA 1AQVA 4H86A 2A2SA 2FNOA 3GURA 4XS6A 3EURA 3KMOA 4ZL7A 3UVHA 3CTFA 3FZ5A 11GSA 1ZZYA 3TJJA 1OKDA 1TRUA 2H19A 3ME8A 2HZFA 5GAND 1LJRA 4KDXA 3F6DA 4KSOA 4WF5A 1HNBA 1O8XA 3W8JA 2O89A 2ALBA 1XWCA 5FT3A 1A8YA 3I6AA 1WPIA 2YJ7A 2VM2A 4TVEA 4POKA 1OC9A 3PR8A 3M9KA 2M72A 3FK8A 2YV9A 3P8WA 3R3EA 1EEMA 4LMWA 2L6CA 2R5GA 4JBBA 5ECIB 1MD3A 1EP7A 2HZEA 3F4SA 2IMEA 4RI6A 4XTSA 3LYKA 3M0FA 2HI7A 4TRXA 2WULA 2E0QA 2BMXA 5HR1A 1TXXA 3IHQA 1X0RA 4ZIJA 2IPAA 2HE3A 3EE2A 4IKHA 19GSA 1GULA 4EF0A 5DQSA 2HRAA 4L8EA 2AV4A 4ZL8A 3HJMA 1BEDA 1WOUA 3C1SA 1K3YA 3H1NA 3CBUA 4NXIA 2GQLA 2LQQA 1Y6EA 2XC2A 4BWQA 3G7YA 3VK9A 4WR5A 4XIHA 1VGLA 4POLA 3M8NA 5HFIA 2CV4A 2H8LA 4MPGA 3L4NA 1GP1A 1ZYQB 2LS5A 3M3MA 3EINA 5GZZB 4ZB8A 3IXRA 1S3DA 4E8EA 2MBTA 1V9WA 2KP2A 5JCUA 4YAVA 3IRAA 3KZQA 3CXGA 3GN3A 3WGXA 1K0DA 3DYRA 2JZSA 1T4ZA 2OE1A 4I6XA 3DGQA 4ECIA 4ACSA 1BYEA 2MBSA 4EO3A 4KCAA 3ED3A 5IMZA 2H72A 2NDOA 1U88A 5IO0A 3VURA 2IFQB 2E2GA 2MMOA 2AJQB 5B7CA 4IQ1A 2AYTA 3I43A 3KMNA 1TK5B 1TKDB 1TOFA 3ZVJD 3IV4A 3CTGA 4KB3A 2N5FA 3EWLA 4ZXGA 2VCZA 1Z6MA 3GIXA 2YWOA 4NV2A 5ID2B 3CSHA 1E6BA 2IMFA 1UA5A 4DVCA 1A23A 2H1BA 2V1MA 2E2MA 4HOJA 2N5BA 1MD4A 4IBPA 2ON5A 2R3XA 1GTBA 3FHKA 3GKNA 5DQYA 3BJ5A 1O6JA 2X99A 4KSMA 3F3QA 2OADA 2O8VB 3UIWA 2EIRA 3FR3A 3KTLA 5DALB 4BWSA 1DE2A 1XVWA 4F0CA 17GSA 3LFLA 3NOFA 2LRCA 1TRWA 3A2WA 1AQWA 2GSQA 2J23A 5IM9A 4ECCA 3FZAA 1A2JA 2C3NA 1TU8A 3TDGA 2HSHA 3VWUA 1ML6A 4DSSB 4MF6A 2PUKC 4G0LA 4FYUA 4YQVA 4RI7A 4GTUA 5KN1A 1AW9A 3MAKA 1EGOA 1PL2A 5CRHA 2REMA 4KX4A 4KA0A 3ZFLA 3HZ4A 3MDKA 2OE0A 2PERA 3TRQA 3M1GA 3QPMA 1TRSA 18GSA 4MPFA 2FWEA 1KTEA 4QL9A 2IIYA 2C3TA 3L9SA 2DJ2A 2H0HA 2GSRA 4WF4A 3ERWA 3NIVA 3TRPA 4EDZA 2XBIA 1XW9A 1THXA 3J7Yk 4KF9A 1O73A 1BJXA 1XPVA 3IDVA 1X9MB 3GL5A 4PGTA 1GSQA 4D73B 1USBA 1PL1A 1SL2B 3VPQA 3ZYWA 2H76A 4G0KA 3CYNA 3TCOA 2VL9A 4WBJA 1X9WB 2DJKA 3HXSA 1YQ1A 3GX0A 3BCKA 4RQRA 3PGTA 2MYGA 4Q5QA 3VI5A 5KEJA 3O76A 5G2ZA 4G19A 2LNSA 2FWFA 1ZMAA 1TRVA 4P3YB 5DBQA 3C71A 1Z3EA 4LL4B 1A2LA 2H75A 1H75A 3K8NA 1OC9B 2X8CA 5EL8A 3RHCA 3ZRDA 4OFNA 3D5JA 5CP1A 4CHSA 2PN8A 2WDUA 4ZL9A 2I9HA 2NBSA 1X5EA 2IFQA 4V2NA 2RLIA 3CSJA 2YANA 3F63A 4HUAA 3WT2A 2F8FA 16GSA 3UL3A 2CX4A 3GH6A 3QDNA 3GKXA 3GUSA 1WMJA 1F2EA 4ZILA 4PTSA 2VL2C 1UVZA 3QMXA 5COHA 3V1WA 1XWAA 3I9V2 3P7XA 4GQCA 1T3BA 3Q18A 3FRCA 2GT5A 4MA9A 2PMTA 5IQYA 5DJLA 2VIMA 1TK0B 1K3OA 5INYA 4EVMA 2FWGA 2PBJA 1X5CA 3F4RA 2IMKA 4J56E 4HZ4A 4EE0A 5ECRB 3DIEA 4Q5RA 4GWRA 1PX7A 2VLTA 2CZ3A 2N5AA 1XBSA 1Y25A 2L4CA 4LMVA 3N9JA 1B4QA 4J2FA 2O85A 2LUSA 2DBCA 3RAZA 1TJDA 2I1UA
chains in the Genus database with same CATH superfamily
2GSSA 5ENUA 2C0DA 1SJIA 3LXZA 3BCIA 3H8QA 2VCXA 1AIUA 4GSSA 5A5HA 3FZ4A 4DSSA 1VF2A 2OJLA 1A0FA 5CNWA 4PXOA 1TW9A 4ZB6A 3RBTA 1E2YA 2O87A 3CHXC 4OMVA 5BRTA 2NTOA 3APQA 4OO5A 3C73A 1AC1A 1K0OA 2F3MA 1TI1A 4IS0A 3IR4A 1A2MA 1ERWA 5C04A 3Q74A 2G0FA 4KDYA 3PH9A 4IJ3A 5AIVA 1ILOA 3VFIA 3WGEA 2H1GA 4OCFA 3LORA 4MABA 3KH7A 4FQUA 1K0CA 3LW9A 5IMFA 2H1LA 2YN1A 2DJJA 2GZPA 3KEBA 3A3TA 5KOWA 1FAAA 3O3TA 3ERFA 5GSTA 3GH9A 3KH9A 4IQAA 2DMMA 2WCIA 1YDKA 1PQNA 3HKRA 4D73A 4MF7A 1A8LA 4ILFA 1MTCA 2DJ3A 1EOGA 5F07A 3GMFA 3KGKA 1SKSB 3KD0A 2H6YA 4MJBA 1GTIA 4WKWA 4K6XA 1Z6NA 5IPGA 4OCEA 3ERGA 2YOIA 1O8WA 1QGVA 5HFKA 1RK4A 5HR0A 1M99A 3RFRC 3L78A 3ZLPA 3TOTA 3KXOA 4N3ZA 3CRTA 4MP4A 2HRKB 5FWGA 2LTKA 2OACA 1B9XC 1EEJA 2FCHA 2DC5A 2MMAA 3GL3A 2GDRA 3SBCA 1JZWA 4O5RA 5G5FA 1GSUA 1M9AA 1V98A 2C3QA 3RGBC 5ECPB 1SK0A 5D96A 1FHEA 4QQ7A 5LCZA 1S4BP 3M9JA 3HHVA 4BVYB 4NHWA 2MMZA 1EGRA 4ZB9A 3GSTA 3HVXA 4IVFA 2HQTA 1BG1A 3WYWA 1QQ2A 3RPPA 3EMPA 1ZYNA 4O5QA 3DKSA 2G2QA 2WZ9A 3TKSA 1TP9A 2OKAA 4L0WA 4AKHA 2H01A 4WEYA 1SYXA 3BD2A 3D0ZA 2GQMA 4N10A 3TKSC 2OBKA 1FVJA 4BIKA 3D6IA 4V1Ap 1OE7A 5CYYA 4PQIA 1ON4A 4IP6A 2WRTA 3LGCA 5E4WA 4V1Ag 2CVBA 1DUGA 2WGRA 3TKRA 4NV5A 1M0UA 1XIYA 3GRXA 4MZBA 4EUYA 3CMIA 3TJGA 1A0RP 3LYPA 4IELA 4PNFA 1XCCA 5DAKB 5ECMB 3DEXA 5GAPD 1S3AA 4HEA2 3NZNA 1QMVA 5D73A 1A24A 2HYXA 3D21A 2C0EA 3TKSE 3C7MA 2LKUA 1DE1A 1GTUA 1U3AA 1SL1B 3GV1A 3IAS2 1SKRB 4MJCA 3EU3A 2EIQA 1QFNA 2C0GA 2F9SA 1XOBA 1PKZA 1HYUA 4YQMA 2GSTA 3H93A 4K8MA 2LRTA 2E7PA 4LLRA 1FOVA 4MCUA 2C80A 2GVPA 1SVMA 1S3RA 2KHPA 3FEUA 5HQPA 1GUHA 3QAGA 3L9UA 5D9VA 2H74A 5ECSA 3KIJA 4HQSA 2CT6A 4G10A 4ML6A 3GA4A 1XOAA 1M3JA 1U6TA 3IOSA 4FH8A 4NPBA 5B6NA 1AQXA 12GSA 2H0GA 2ZCTA 4ZBDA 1YKCA 2X8HA 1SKWB 5B8AA 1NW2A 4QMKA 1RW1A 4MH2A 4TKYA 4HJMA 5C00A 3F0IA 1X9SB 2O5VA 4MK3A 3UARA 2DJ1A 2VCWA 5A4UA 5IMAA 1WP0A 2B1KA 2JZRA 5D9WA 2JSZA 4MLYA 3L9VA 2WW3A 3LEFA 3ZVJA 22GSA 3GX8A 1BX9A 3E0UA 3P2AA 2GS3A 2K8SA 2YPMA 2FLSA 1R7HA 2OE3A 2WS2A 1EP8A 2B5EA 2CQ9A 4PURA 2VCTA 2HRKA 1N25A 4ZBBA 2YNXA 3VLNA 3APSA 3ZL5A 2IJYA 2K6VA 3OR5A 1JZOA 5J3RA 3KM6A 4MDCA 2F51A 5ECLB 1B48A 7GSSA 2UZ8A 3CQFA 4Z2UA 2YWIA 3GFKA 5A34B 1KNGA 2V2GA 1XZOA 2XHFA 1NHYA 4EKZA 9GSSA 2DLXA 2OA7A 4BVYA 1R5PA 3MNGA 3DWVA 2WVYA 2XBQA 4I2TA 1QK8A 5F06A 4ECJA 2H6ZA 4PQ1A 4I97A 5B6MA 3O6TA 4DSQA 3QAWA 4ML1A 2HSMB 1MDIA 4ULXA 3DXBA 3TKPA 1Q98A 3IA1A 2O3EA 1PA3A 2YV7A 1PRXA 2RUEA 4USSA 2DSAA 1GNWA 4KUNA 3C8EA 5JWQB 4V2LA 2KP1A 2KUCA 4OD7A 1JLVA 4TR4A 4E68A 5ECQB 5LNKe 1B9YC 3GKKA 5IPHA 6GSTA 3HYPA 2P0GA 1GSDA 2FY6A 2C4JA 4JR6A 1F37A 2YJHA 3L0HA 2YWMA 5HFGA 1H4OA 2NVLA 2LQOA 2B5YA 4BVXB 2VLUA 1EV9A 4JRRA 1V58A 4LL1B 1SYRA 3VWWA 4GCIA 2X64A 4JU5A 2RIIA 2PVQA 5HR2A 4KH7A 5DAKA 1WJKA 3G7IA 2NPBA 5F8BA 1PFOA 4EC0A 5A1NB 5G30A 3EPTA 2AUVA 1F6MC 3LWAA 20GSA 4MJEA 3KP8A 2YZUA 5H5RA 5AISA 5EY6A 3HDCA 2VO4A 4BL7B 2L5OA 1YVLA 2O36A 4TXOB 3CRUA 3UBLA 3ZITA 4ECBA 1YEWC 1ZOFA 2MMNA 1MDKA 3F8UA 1SK2A 3F3RA 1FVKA 3LG6A 3TGZA 1TU7A 1Z7RA 5JWRB 2H66A 1OKTA 2FA8A 5G31A 2LEGA 6GSXA 5JCWA 2VL2A 1M2DA 3WT1A 2H73A 2DIYA 2H0IA 1EV4A 3LJRA 4X1UA 3VPTA 2EC4A 3ZTLA 4ISDA 2V6KA 3FMWA 4PUAA 3G7JA 3IAM2 1R4WA 3R2QA 1XWBA 2TRXA 4JE1A 4EDYA 2M46A 3C1RA 1N8JA 4K7NA 4O92A 3DRNA 5EVOA 1DSBA 6GSVA 3UMAA 4N0VA 2CA8A 4POMA 1HNAA 3HD5A 4TR1B 1G6WA 3IC8A 4OFMA 3ZMKA 4K7IA 3VI7A 3TOUA 2IMDA 3DMLA 1TDIA 2RM5A 1BG5A 3Q6OA 4JR4A 1ZYPA 1GLQA 4W66A 2WVXA 1F3AA 5CRWA 1GUKA 1OYJA 2HSNA 5F0GA 1UN2A 1YEPA 1JZDA 3EVIA 1WRYA 4AJ8A 2TIRA 5J4UA 2V32A 2CAQA 1PKWA 2EFCA 4HJ2A 3FY7A 1SU9A 4TW5A 5AGYA 5J9CA 5CRDA 2B1LA 2XPDA 2GLRA 3CSIA 1SD9A 1WE0A 2X4AA 3KTBA 4LA1A 4X4JA 3BBYA 4POBA 3FZ9A 1AXDA 2WW2A 3RPNA 3G9BA 2LSTA 3ZZXA 4KCEA 2FA4A 4JEDA 4PQHA 3N5OA 1ZYEA 5A34A 3UEMA 3Q19A 2K18A 3TB2A 4NAXA 3IK9A 2GZYA 2I3YA 3QOUA 2F8AA 4ID0A 1ZL9A 1M2AA 3HVNA 2L57A 5LD0A 2R37A 1CQGA 1IYHA 5ABRA 3UOMA 1SL0B 4DEJA 1FB0A 4HSCX 3HMJG 3FKFA 3GHAA 2HSMA 1LBKA 4WETA 1T1VA 2L59A 3ZREA 1FG4A 4EXJA 1PMTA 2B6MA 1AAZA 1JZRA 3KCMA 1FB6A 3QFAC 4GSTA 3SWLA 3U5RE 3LSZA 3EC3A 3KP9A 4XS4A 3IC4A 4MMMA 1GSFA 5ECKB 4CY6A 4KW6A 5D8IA 3WGDA 1THOA 2VCQA 4Q5FA 3RHBA 2VL3A 2K8VA 3J7Yb 6GSYA 4BPYA 2A2PA 3TJBA 4BVXA 3H4KA 1IYIA 4FO5A 1YEXA 3E9JB 4HZ2A 4HU7A 1GL8A 1K3LA 13GSA 1MEKA 2O7KA 14GSA 3QD9A 5A1NA 4G9HA 1ACVA 1Z9HA 1BAYA 4QL7A 1XWKA 3QR6A 2HRFA 1HQOA 5ECNB 1Z7PA 2FGXA 2VD1A 3MSZA 5JCGA 4YKFA 5CREA 5AIXA 3DVWA 3F6FA 4BL7A 2RUFA 1YY7A 1BF5A 4TXOA 4O5UA 2ES7A 1GSSA 3IBHA 5IOWA 5GSSA 2WB9A 1WIKA 2FD3A 4NMUA 1YJ6A 3F9UA 3FYGA 4G01A 2TRCP 1J0FA 3U6VA 1K0AA 2CX3A 2R2JA 2K9FA 4CY8A 2I81A 1TK8B 2P5QA 2ZUPA 3ZFBA 2QKEA 1SENA 4G2EA 2LJRA 3AY8A 2C1YA 3LXTA 1I5GA 5G5EA 1G6YA 5H5SA 1U3IA 3UBKA 2DKHA 4OWYA 4F2IA 2HNLA 5KOXA 3EU4A 4N11A 1M2BA 4TR1A 1EZKA 1ZCPA 4WBRD 3HVVA 4MZWA 5H5QA 1YF1A 1ST9A 1ERUA 4L5OA 2LRNA 4NWYA 4JZQA 4O7HA 4XRAA 4F9ZA 2J9HA 1N2AA 4X0XA 1ERTA 1OC3A 5IO2A 1DBYA 5ELAA 5JWOB 5CO3A 2EFHA 2B7KA 4Z2TA 2FWHA 1ZGNA 2JADA 2ZNMA 4IP1A 3IPZA 4WR4A 1T7PB 4AKGA 2HFDA 3GSSA 4KAEA 3TKQA 3A2XA 1HD2A 1AUCA 1PD21 3P90A 2QSIA 3W6GA 4E8HA 1G7EA 2AHEA 4KGIA 5D9TA 4K1FA 2WJUA 1G7OA 1O85A 2L6DA 4MH3A 4YKGA 1F9MA 4AJ6A 4YAPA 4XCSA 2HLSA 2PWJA 3HCZA 2P5RA 4IN0A 4TR3A 1B4PA 3ISOA 3GNJA 4TN8A 4TXVA 2IL3A 3FR6A 2BJXA 4K2DA 3TJKA 1K0NA 6GSWA 3TJFA 2EFDA 3MWHA 3WD6A 4CDOA 5J5NA 4GSNA 4MZCA 4YH2A 1R5AA 2A4VA 4GF0A 2JU5A 5BMUB 2QC7A 5KN2A 1VF1A 4PI2C 1GSYA 1O7UA 3TU3B 5A5KA 2D2ZA 3TUEA 1J08A 1GWCA 1VF3A 1EOHA 5DJMA 1CQHA 4FIWA 3UVTA 2CZ2A 5D93A 2WVXB 4WXTA 5ELGA 3PPUA 5J9BA 4J57E 2HSNB 1K0BA 4K7OA 3QAVA 3D4MA 5J40A 2LJAA 2V6OA 2JZTA 1OC8A 2IWTA 4N30A 2JSYA 5ECOB 1QUWA 2B3SA 2V41A 2B5XA 4XS1A 2GGTA 3QCPA 5A4VA 3S9FA 4K0GA 2QGVA 2KLXA 4YQUA 1XW5A 1GNEA 4FYCA 5J41A 2IN3A 1PX6A 2ON7A 2GTUA 2CAIA 2JACA 3APOA 1K0MA 4BA7A 1X5DA 4X43A 4RUVA 3VWVA 4PI0C 3GTUB 4HU9A 1GTAA 5IOXA 4V2MA 4EL1A 5B8BA 1YZXA 1KBNA 1XFLA 1HNCA 3DVXA 1XVQA 4TOPA 4GLTA 2GQKA 1SK1A 3MIXA 3HVSA 2PGTA 2R0CA 2DJ0A 5E59A 2X8GA 4Q5NA 2H71A 5G1KA 1OE8A 1B8XA 2VLVA 4IGJA 2VAFA 5IMCA 2WFCA 1PN9A 4RQXA 1GUMA 4HI7A 1GSEA 5IMDA 4XS4B 1O81A 2GT6A 2GZZA 3ZMLA 2BTOT 3PINA 1V40A 4O32A 2VD0A 5L71A 3D4TA 4FXYP 1URMA 1JLWA 4MF5A 1FOHA 5J4VA 4Z2RA 4OO4A 4L0UA 4K9ZA 4GXZA 3A5WA 3UAPA 4I8BA 4GQFA 4DSRA 3W8SA 2UV8G 3FR9A 4N0ZA 3US3A 1VRSD 3LQ7A 2AB6A 4IW9A 4AJ7A 2YZHA 2HT9A 4I5QA 1T8EB 3ZIJA 1KEBA 4K2XA 2I4AA 4XHMA 1UC7A 5DCHA 4MJAA 1FW1A 1I9DA 1FO5A 2R4VA 4Z7XA 3IK7A 1SD8A 2H30A 3E3EA 2KOKA 2X49A 2OBIA 1GH2A 1M7TA 3EYTA 1U87A 2VM1A 4AGSA 1PSQA 2C0FA 2AAWA 1SJ6A 2VKZG 2PVOC 1F3BA 1Q4JA 1C72A 2YCDA 4HQZA 5IIZA 2HSYA 2IMIA 4XRDA 5ECHB 1SVOA 3ME7A 4AF2A 2HZEB 2PU9C 2FHEA 2LV3A 1JHBA 5F05A 4HDEA 1LU4A 1J9BA 3D22A 1XXUA 2HRNA 2B7JA 5CAXA 1SJZA 5BMUA 2FUG2 4ZBAA 1XWGA 1WWJA 5A4WA 2JL4A 1TTZA 1T4YA 1BQ7A 5D9XA 1GLPA 1YF0A 4NHZA 1XW6A 4K0NA 4KDUA 1W89A 4IHUA 3EMXA 1EWXA 2H6XA 3HY2A 4ICYA 3A2VA 3VWXA 5ID2A 1M9BA 6GSUA 1TI3A 5IMVA 4F82A 4OFTA 2M80A 4F0BA 2CVDA 2A2RA 3KJYA 2C8UA 1VF4A 5KN0A 3BOAA 3HJOA 2VOCA 2Z9SA 3QFBC 3H79A 5AN1A 3IHGA 1ABAA 3FW2A 5KN3A 4PHZC 2DIZA 3JCML 3IE3A 1ERVA 4L5LA 5DALA 2LJKA 1GRXA 3UJ1A 1T00A 4KNDA 5G1LA 5HR3A 1PGTA 2XPEA 2L5LA 1V2AA 2H70A 4PX1A 1NSWA 2VUPA 4CW9A 5DCGA 2H1DA 3RDWA 2H1AA 3DD3A 2PPTA 3HA9A 1YKAA 1QXHA 2EIOA 1S3CA 4HS1A 3HJPA 4PNGA 4I2UA 3GTUA 5DDLA 5CRGA 6GSSA 1G0TA 4KE3A 2MZCA 2L4QA 2LNTA 1MDJA 1OVNA 3GYKA 2CVKA 5EPFA 3HZ8A 1Z5YE 4TR0A 4FYBA 1I1IP 2P31A 4G0IA 4IJIA 1RQMA 4F03A 2YWNA 1R26A 1OAZA 1NM3A 2HXKA 4GRFA 4PUFC 2DMLA 1PN0A 2VCVA 1JFUA 2YP6A 3GKMA 2RM6A 1V57A 2R6KA 5DVBA 1W4VA 8GSSA 3ZIVA 3F4TA 3I69A 3TRXA 10GSA 5FHIA 1NHOA 1AQVA 4H86A 2A2SA 2FNOA 3GURA 4XS6A 3EURA 3CWGA 3KMOA 2OT3A 4ZL7A 3UVHA 3CTFA 1SVLA 3FZ5A 11GSA 1ZZYA 3TJJA 1OKDA 1TRUA 2H19A 3ME8A 2HZFA 5GAND 1LJRA 4KDXA 3F6DA 4KSOA 4WF5A 1HNBA 1O8XA 3W8JA 2WW1A 2O89A 2ALBA 1XWCA 5FT3A 1A8YA 4EIQA 1M3IA 3I6AA 1WPIA 2YJ7A 2VM2A 4AKIA 4TVEA 4POKA 1OC9A 3PR8A 3M9KA 2M72A 3FK8A 2YV9A 2WZSA 3P8WA 3R3EA 1EEMA 4LMWA 2L6CA 2R5GA 4JBBA 5ECIB 1MD3A 1EP7A 2HZEA 3F4SA 2IMEA 4RI6A 4XTSA 3LYKA 3M0FA 2HI7A 4TRXA 2WULA 4ZB7A 2BMXA 2E0QA 5HR1A 1TXXA 3IHQA 1X0RA 4ZIJA 2IPAA 2HE3A 3EE2A 4IKHA 19GSA 1Y1UA 1GULA 4AKXB 4EF0A 5DQSA 2HRAA 4L8EA 2AV4A 4ZL8A 2QA1A 3HJMA 1BEDA 1WOUA 3C1SA 1K3YA 2R0PA 3H1NA 3CBUA 4NXIA 2GQLA 2LQQA 1Y6EA 2XC2A 4BWQA 3G7YA 3VK9A 4WR5A 4XIHA 1VGLA 2QA2A 4POLA 3M8NA 5HFIA 2CV4A 2H8LA 4MPGA 3L4NA 1GP1A 1ZYQB 2LS5A 3M3MA 2A4HA 3EINA 5GZZB 4ZB8A 3IXRA 1S3DA 4E8EA 2MBTA 1V9WA 2KP2A 5JCUA 4YAVA 3IRAA 3KZQA 3CXGA 3GN3A 3WGXA 3A5IA 1K0DA 3DYRA 2DKIA 2JZSA 1T4ZA 2OE1A 4I6XA 3DGQA 4ECIA 4ACSA 1BYEA 2MBSA 4EO3A 4KCAA 3ED3A 5IMZA 1XG8A 2H72A 2NDOA 1U88A 5IO0A 3VURA 2IFQB 2E2GA 2MMOA 2AJQB 5B7CA 4IQ1A 2AYTA 3I43A 2WVZA 3KMNA 1TK5B 1TKDB 1TOFA 3ZVJD 3IV4A 3CTGA 4KB3A 2N5FA 3EWLA 4ZXGA 2VCZA 1Z6MA 3GIXA 2YWOA 4NV2A 5ID2B 3CSHA 1E6BA 2IMFA 1UA5A 4DVCA 1A23A 2H1BA 2V1MA 2E2MA 4HOJA 2N5BA 1MD4A 4IBPA 2ON5A 2R3XA 1GTBA 3FHKA 3GKNA 5DQYA 3BJ5A 1O6JA 2X99A 4KSMA 3F3QA 2OADA 2O8VB 3UIWA 2EIRA 3FR3A 3KTLA 5DALB 4BWSA 1DE2A 1XVWA 4F0CA 17GSA 3LFLA 3NOFA 2LRCA 1TRWA 3A2WA 1AQWA 2GSQA 2J23A 5IM9A 4ECCA 3FZAA 1A2JA 2C3NA 1TU8A 3TDGA 2HSHA 3VWUA 1ML6A 5A5HB 5J47A 4DSSB 4MF6A 2PUKC 4G0LA 4FYUA 4YQVA 4RI7A 4GTUA 5KN1A 1AW9A 2WW0A 3MAKA 1EGOA 1PL2A 5CRHA 2REMA 4GDFA 4KX4A 4KA0A 3ZFLA 3HZ4A 3MDKA 2OE0A 2PERA 3TRQA 3M1GA 3QPMA 1TRSA 18GSA 4MPFA 2FWEA 1KTEA 4QL9A 2IIYA 2C3TA 3L9SA 2DJ2A 2H0HA 2GSRA 4WF4A 3ERWA 4MNNA 3NIVA 2R0GA 3TRPA 4EDZA 2XBIA 1XW9A 1THXA 3J7Yk 4KF9A 1O73A 1BJXA 1XPVA 3IDVA 1X9MB 3GL5A 4PGTA 1GSQA 4D73B 1USBA 1PL1A 1SL2B 3VPQA 3ZYWA 2H76A 4G0KA 3CYNA 3TCOA 2VL9A 4WBJA 1X9WB 2DJKA 3HXSA 1YQ1A 3GX0A 3BCKA 4RQRA 3PGTA 2MYGA 4Q5QA 3VI5A 2EFEA 5KEJA 3O76A 5G2ZA 4G19A 2LNSA 2FWFA 1ZMAA 1TRVA 4P3YB 5DBQA 3C71A 1Z3EA 4LL4B 1A2LA 2H75A 1H75A 4K5SA 3K8NA 1OC9B 2X8CA 5EL8A 3RHCA 3ZRDA 4OFNA 3D5JA 5CP1A 4CHSA 2PN8A 2WDUA 4ZL9A 2I9HA 4A5PA 1TXUA 1X5EA 2NBSA 2IFQA 4K5RA 4V2NA 2RLIA 3CSJA 2YANA 3F63A 4HUAA 4AI6A 3WT2A 2F8FA 16GSA 3UL3A 2CX4A 3GH6A 3QDNA 3GKXA 3GUSA 1WMJA 1F2EA 4ZILA 4PTSA 2VL2C 1UVZA 3QMXA 5COHA 3V1WA 1XWAA 3I9V2 3P7XA 4GQCA 1T3BA 3Q18A 3FRCA 2GT5A 4MA9A 2PMTA 2VIMA 5DJLA 5IQYA 1TK0B 5J4YA 1K3OA 5INYA 4EVMA 2FWGA 3MYDA 2PBJA 1X5CA 3F4RA 2IMKA 4J56E 4HZ4A 4EE0A 5ECRB 3DIEA 4Q5RA 4GWRA 1PX7A 2VLTA 2CZ3A 2N5AA 1XBSA 4EIPA 1Y25A 2L4CA 4LMVA 3N9JA 1B4QA 4J2FA 2LUSA 2O85A 2DBCA 3RAZA 1TJDA 2I1UA
chains in the Genus database with same CATH topology
2GSSA 5ENUA 2C0DA 1SJIA 3LXZA 3BCIA 3H8QA 2VCXA 1AIUA 4GSSA 5A5HA 3FZ4A 4DSSA 1VF2A 2OJLA 1A0FA 5CNWA 4PXOA 1TW9A 4ZB6A 3RBTA 1E2YA 2O87A 4OMVA 5BRTA 2NTOA 3APQA 4OO5A 3C73A 1AC1A 1K0OA 2F3MA 1TI1A 4IS0A 3IR4A 1A2MA 1ERWA 5C04A 3Q74A 2G0FA 4KDYA 3PH9A 4IJ3A 5AIVA 1ILOA 3VFIA 3WGEA 2H1GA 4OCFA 3LORA 4MABA 3KH7A 4FQUA 1K0CA 3LW9A 5IMFA 2H1LA 2YN1A 2DJJA 2GZPA 3KEBA 3A3TA 5KOWA 1FAAA 3O3TA 3ERFA 5GSTA 3GH9A 3KH9A 4IQAA 2DMMA 2WCIA 1YDKA 1PQNA 3HKRA 4D73A 4MF7A 1A8LA 4ILFA 1MTCA 2DJ3A 1EOGA 5F07A 3GMFA 3KGKA 1SKSB 3KD0A 2H6YA 4MJBA 1GTIA 4WKWA 4K6XA 1Z6NA 5IPGA 4OCEA 3ERGA 2YOIA 1O8WA 1QGVA 5HFKA 1RK4A 5HR0A 1M99A 3L78A 3ZLPA 3TOTA 3KXOA 4N3ZA 3CRTA 4MP4A 2HRKB 5FWGA 2LTKA 2OACA 1B9XC 1EEJA 2FCHA 2DC5A 2MMAA 3GL3A 2GDRA 3SBCA 1JZWA 4O5RA 5G5FA 1GSUA 1M9AA 1V98A 2C3QA 5ECPB 1SK0A 5D96A 1FHEA 4QQ7A 5LCZA 3M9JA 3HHVA 4BVYB 4NHWA 2MMZA 1EGRA 4ZB9A 3GSTA 3HVXA 4IVFA 2HQTA 1BG1A 3WYWA 1QQ2A 3RPPA 3EMPA 1ZYNA 4O5QA 3DKSA 2G2QA 2WZ9A 3TKSA 1TP9A 2OKAA 4L0WA 4AKHA 2H01A 4WEYA 1SYXA 3BD2A 3D0ZA 2GQMA 4N10A 3TKSC 2OBKA 1FVJA 3D6IA 4V1Ap 1OE7A 5CYYA 4PQIA 1ON4A 4IP6A 2WRTA 3LGCA 5E4WA 4V1Ag 2CVBA 1DUGA 2WGRA 3TKRA 4NV5A 1M0UA 1XIYA 3GRXA 4MZBA 4EUYA 3CMIA 3TJGA 1A0RP 3LYPA 4IELA 4PNFA 1XCCA 5DAKB 5ECMB 3DEXA 5GAPD 1S3AA 4HEA2 3NZNA 1QMVA 5D73A 1A24A 2HYXA 3D21A 2C0EA 3TKSE 3C7MA 2LKUA 1DE1A 1GTUA 1U3AA 1SL1B 3GV1A 3IAS2 1SKRB 4MJCA 3EU3A 2EIQA 1QFNA 2C0GA 2F9SA 1XOBA 1PKZA 1HYUA 4YQMA 2GSTA 3H93A 4K8MA 2LRTA 2E7PA 4LLRA 1FOVA 4MCUA 2C80A 2GVPA 1SVMA 2KHPA 3FEUA 5HQPA 1GUHA 3QAGA 3L9UA 5D9VA 2H74A 5ECSA 3KIJA 4HQSA 2CT6A 4G10A 4ML6A 3GA4A 1XOAA 1U6TA 4FH8A 3IOSA 4NPBA 5B6NA 1AQXA 12GSA 2H0GA 2ZCTA 4ZBDA 1YKCA 2X8HA 1SKWB 5B8AA 1NW2A 4QMKA 1RW1A 4MH2A 4TKYA 4HJMA 5C00A 3F0IA 1X9SB 2O5VA 4MK3A 3UARA 2DJ1A 2VCWA 5A4UA 5IMAA 1WP0A 2B1KA 2JZRA 5D9WA 2JSZA 4MLYA 3L9VA 3LEFA 3ZVJA 22GSA 3GX8A 1BX9A 3E0UA 3P2AA 2GS3A 2K8SA 2YPMA 2FLSA 1R7HA 2OE3A 2WS2A 1EP8A 2B5EA 2CQ9A 4PURA 2VCTA 2HRKA 1N25A 4ZBBA 2YNXA 3VLNA 3APSA 3ZL5A 2IJYA 2K6VA 3OR5A 1JZOA 5J3RA 3KM6A 4MDCA 2F51A 5ECLB 1B48A 7GSSA 2UZ8A 4Z2UA 2YWIA 3GFKA 5A34B 1KNGA 2V2GA 1XZOA 2XHFA 1NHYA 4EKZA 9GSSA 2DLXA 2OA7A 4BVYA 1R5PA 3MNGA 3DWVA 2XBQA 4I2TA 1QK8A 5F06A 4ECJA 2H6ZA 4PQ1A 4I97A 5B6MA 3O6TA 4DSQA 3QAWA 4ML1A 2HSMB 1MDIA 4ULXA 3DXBA 3TKPA 1Q98A 3IA1A 1PA3A 2YV7A 1PRXA 2RUEA 4USSA 2DSAA 1GNWA 4KUNA 3C8EA 5JWQB 4V2LA 2KP1A 2KUCA 4OD7A 1JLVA 4TR4A 4E68A 5ECQB 5LNKe 1B9YC 3GKKA 5IPHA 6GSTA 3HYPA 2P0GA 1GSDA 2FY6A 2C4JA 4JR6A 1F37A 2YJHA 3L0HA 2YWMA 5HFGA 1H4OA 2NVLA 2B5YA 2LQOA 4BVXB 2VLUA 1EV9A 4JRRA 1V58A 4LL1B 1SYRA 3VWWA 4GCIA 2X64A 4JU5A 2RIIA 2PVQA 5HR2A 4KH7A 5DAKA 1WJKA 3G7IA 2NPBA 5F8BA 4EC0A 5A1NB 5G30A 3EPTA 2AUVA 1F6MC 3LWAA 20GSA 4MJEA 3KP8A 2YZUA 5H5RA 5AISA 5EY6A 3HDCA 2VO4A 4BL7B 2L5OA 1YVLA 4TXOB 3CRUA 3UBLA 3ZITA 4ECBA 1ZOFA 2MMNA 1MDKA 3F8UA 1SK2A 3F3RA 1FVKA 3LG6A 3TGZA 1TU7A 1Z7RA 5JWRB 2H66A 1OKTA 2FA8A 5G31A 2LEGA 6GSXA 5JCWA 2VL2A 1M2DA 3WT1A 2H73A 2DIYA 2H0IA 1EV4A 3LJRA 4X1UA 3VPTA 2EC4A 3ZTLA 4ISDA 2V6KA 3FMWA 4PUAA 3G7JA 3IAM2 1R4WA 3R2QA 1XWBA 2TRXA 4JE1A 4EDYA 2M46A 3C1RA 1N8JA 4K7NA 4O92A 3DRNA 5EVOA 1DSBA 6GSVA 3UMAA 4N0VA 2CA8A 4POMA 1HNAA 3HD5A 4TR1B 1G6WA 3IC8A 4OFMA 3ZMKA 4K7IA 3VI7A 3TOUA 2IMDA 3DMLA 1TDIA 2RM5A 1BG5A 3Q6OA 4JR4A 1ZYPA 1GLQA 4W66A 1F3AA 5CRWA 1GUKA 1OYJA 2HSNA 5F0GA 1UN2A 1YEPA 1JZDA 3EVIA 1WRYA 4AJ8A 2TIRA 5J4UA 2V32A 2CAQA 1PKWA 2EFCA 4HJ2A 3FY7A 1SU9A 4TW5A 5AGYA 5J9CA 5CRDA 2B1LA 2XPDA 2GLRA 3CSIA 1SD9A 1WE0A 2X4AA 3KTBA 4LA1A 4X4JA 3BBYA 4POBA 3FZ9A 1AXDA 3RPNA 3G9BA 2LSTA 3ZZXA 4KCEA 2FA4A 4JEDA 4PQHA 3N5OA 1ZYEA 5A34A 3UEMA 3Q19A 2K18A 3TB2A 4NAXA 3IK9A 2GZYA 2I3YA 3QOUA 2F8AA 4ID0A 1ZL9A 1M2AA 2L57A 5LD0A 2R37A 1CQGA 1IYHA 5ABRA 3UOMA 1SL0B 4DEJA 1FB0A 3HMJG 3FKFA 3GHAA 2HSMA 1LBKA 4WETA 1T1VA 2L59A 3ZREA 1FG4A 4EXJA 1PMTA 2B6MA 1AAZA 1JZRA 3KCMA 1FB6A 3QFAC 4GSTA 3SWLA 3U5RE 3LSZA 3EC3A 3KP9A 4XS4A 3IC4A 4MMMA 1GSFA 5ECKB 4CY6A 4KW6A 5D8IA 3WGDA 1THOA 2VCQA 4Q5FA 3RHBA 2VL3A 2K8VA 3J7Yb 6GSYA 4BPYA 2A2PA 3TJBA 4BVXA 3H4KA 1IYIA 4FO5A 1YEXA 3E9JB 4HZ2A 4HU7A 1GL8A 1K3LA 13GSA 1MEKA 2O7KA 14GSA 3QD9A 5A1NA 4G9HA 1ACVA 1Z9HA 1BAYA 4QL7A 1XWKA 3QR6A 2HRFA 1HQOA 5ECNB 1Z7PA 2FGXA 2VD1A 3MSZA 5JCGA 4YKFA 5CREA 5AIXA 3DVWA 3F6FA 4BL7A 2RUFA 1YY7A 1BF5A 4TXOA 4O5UA 2ES7A 1GSSA 3IBHA 5IOWA 5GSSA 2WB9A 1WIKA 2FD3A 4NMUA 1YJ6A 3F9UA 3FYGA 4G01A 2TRCP 1J0FA 3U6VA 1K0AA 2CX3A 2R2JA 2K9FA 4CY8A 2I81A 1TK8B 2P5QA 2ZUPA 3ZFBA 2QKEA 1SENA 4G2EA 2LJRA 3AY8A 2C1YA 3LXTA 1I5GA 5G5EA 1G6YA 5H5SA 1U3IA 3UBKA 2DKHA 4OWYA 4F2IA 2HNLA 5KOXA 3EU4A 4N11A 1M2BA 4TR1A 1EZKA 1ZCPA 4WBRD 3HVVA 4MZWA 5H5QA 1YF1A 1ST9A 1ERUA 4L5OA 2LRNA 4NWYA 4JZQA 4O7HA 4XRAA 4F9ZA 2J9HA 1N2AA 4X0XA 1ERTA 1OC3A 5IO2A 1DBYA 5ELAA 5JWOB 5CO3A 2EFHA 2B7KA 4Z2TA 2FWHA 1ZGNA 2JADA 2ZNMA 4IP1A 3IPZA 4WR4A 1T7PB 4AKGA 2HFDA 3GSSA 4KAEA 3TKQA 3A2XA 1HD2A 1AUCA 1PD21 3P90A 2QSIA 3W6GA 4E8HA 1G7EA 2AHEA 4KGIA 5D9TA 4K1FA 2WJUA 1G7OA 1O85A 2L6DA 4MH3A 4YKGA 1F9MA 4AJ6A 4YAPA 4XCSA 2HLSA 2PWJA 3HCZA 2P5RA 4IN0A 4TR3A 1B4PA 3ISOA 3GNJA 4TN8A 4TXVA 2IL3A 3FR6A 2BJXA 4K2DA 3TJKA 1K0NA 6GSWA 3TJFA 2EFDA 3MWHA 3WD6A 4CDOA 5J5NA 4GSNA 4MZCA 4YH2A 1R5AA 2A4VA 4GF0A 2JU5A 5BMUB 2QC7A 5KN2A 1VF1A 1GSYA 1O7UA 3TU3B 5A5KA 2D2ZA 3TUEA 1J08A 1GWCA 1VF3A 1EOHA 5DJMA 1CQHA 4FIWA 3UVTA 2CZ2A 5D93A 4WXTA 5ELGA 3PPUA 5J9BA 4J57E 2HSNB 1K0BA 4K7OA 3QAVA 3D4MA 5J40A 2LJAA 2V6OA 2JZTA 1OC8A 2IWTA 4N30A 2JSYA 5ECOB 1QUWA 2B3SA 2V41A 2B5XA 4XS1A 2GGTA 3QCPA 5A4VA 3S9FA 4K0GA 2QGVA 2KLXA 4YQUA 1XW5A 1GNEA 4FYCA 5J41A 2IN3A 1PX6A 2ON7A 2GTUA 2CAIA 2JACA 3APOA 1K0MA 4BA7A 1X5DA 4X43A 4RUVA 3VWVA 3GTUB 4HU9A 1GTAA 5IOXA 4V2MA 4EL1A 5B8BA 1YZXA 1KBNA 1XFLA 1HNCA 3DVXA 1XVQA 4TOPA 4GLTA 2GQKA 1SK1A 3MIXA 3HVSA 2PGTA 2R0CA 2DJ0A 5E59A 2X8GA 4Q5NA 2H71A 5G1KA 1OE8A 1B8XA 2VLVA 4IGJA 2VAFA 5IMCA 2WFCA 1PN9A 4RQXA 1GUMA 4HI7A 1GSEA 5IMDA 4XS4B 1O81A 2GT6A 2GZZA 3ZMLA 2BTOT 3PINA 1V40A 4O32A 2VD0A 5L71A 3D4TA 1URMA 1JLWA 4MF5A 1FOHA 5J4VA 4Z2RA 4OO4A 4L0UA 4K9ZA 4GXZA 3A5WA 3UAPA 4I8BA 4GQFA 4DSRA 3W8SA 2UV8G 3FR9A 4N0ZA 3US3A 1VRSD 3LQ7A 2AB6A 4IW9A 4AJ7A 2YZHA 2HT9A 4I5QA 1T8EB 3ZIJA 1KEBA 4K2XA 2I4AA 4XHMA 1UC7A 5DCHA 4MJAA 1FW1A 1I9DA 1FO5A 2R4VA 4Z7XA 3IK7A 1SD8A 2H30A 3E3EA 2KOKA 2X49A 2OBIA 1GH2A 1M7TA 3EYTA 1U87A 2VM1A 4AGSA 1PSQA 2C0FA 2AAWA 1SJ6A 2VKZG 2PVOC 1F3BA 1Q4JA 1C72A 2YCDA 4HQZA 5IIZA 2HSYA 2IMIA 4XRDA 5ECHB 1SVOA 3ME7A 4AF2A 2HZEB 2PU9C 2FHEA 2LV3A 1JHBA 5F05A 4HDEA 1LU4A 1J9BA 3D22A 1XXUA 2HRNA 2B7JA 5CAXA 1SJZA 5BMUA 2FUG2 4ZBAA 1XWGA 1WWJA 5A4WA 2JL4A 1TTZA 1T4YA 1BQ7A 5D9XA 1GLPA 1YF0A 4NHZA 1XW6A 4K0NA 4KDUA 1W89A 4IHUA 3EMXA 1EWXA 2H6XA 3HY2A 4ICYA 3A2VA 3VWXA 5ID2A 1M9BA 6GSUA 1TI3A 5IMVA 4F82A 4OFTA 2M80A 4F0BA 2CVDA 2A2RA 3KJYA 2C8UA 1VF4A 5KN0A 3BOAA 3HJOA 2VOCA 2Z9SA 3QFBC 3H79A 5AN1A 3IHGA 1ABAA 3FW2A 5KN3A 2DIZA 3JCML 3IE3A 1ERVA 4L5LA 5DALA 2LJKA 1GRXA 3UJ1A 1T00A 4KNDA 5G1LA 5HR3A 1PGTA 2XPEA 2L5LA 1V2AA 2H70A 4PX1A 1NSWA 2VUPA 4CW9A 5DCGA 2H1DA 3RDWA 2H1AA 3DD3A 2PPTA 3HA9A 1YKAA 1QXHA 2EIOA 1S3CA 4HS1A 3HJPA 4PNGA 4I2UA 3GTUA 5DDLA 5CRGA 6GSSA 1G0TA 4KE3A 2MZCA 2L4QA 2LNTA 1MDJA 1OVNA 3GYKA 2CVKA 5EPFA 3HZ8A 1Z5YE 4TR0A 4FYBA 2P31A 4G0IA 4IJIA 1RQMA 4F03A 2YWNA 1R26A 1OAZA 1NM3A 2HXKA 4GRFA 4PUFC 2DMLA 1PN0A 2VCVA 1JFUA 2YP6A 3GKMA 2RM6A 1V57A 2R6KA 5DVBA 1W4VA 8GSSA 3ZIVA 3F4TA 3I69A 3TRXA 10GSA 5FHIA 1NHOA 1AQVA 4H86A 2A2SA 2FNOA 3GURA 4XS6A 3EURA 3CWGA 3KMOA 2OT3A 4ZL7A 3UVHA 3CTFA 1SVLA 3FZ5A 11GSA 1ZZYA 3TJJA 1OKDA 1TRUA 2H19A 3ME8A 2HZFA 5GAND 1LJRA 4KDXA 3F6DA 4KSOA 4WF5A 1HNBA 1O8XA 3W8JA 2O89A 2ALBA 1XWCA 5FT3A 1A8YA 4EIQA 3I6AA 1WPIA 2YJ7A 2VM2A 4AKIA 4TVEA 4POKA 1OC9A 3PR8A 3M9KA 2M72A 3FK8A 2YV9A 3P8WA 3R3EA 1EEMA 4LMWA 2L6CA 2R5GA 4JBBA 5ECIB 1MD3A 1EP7A 2HZEA 3F4SA 2IMEA 4RI6A 4XTSA 3LYKA 3M0FA 2HI7A 4TRXA 2WULA 4ZB7A 2BMXA 2E0QA 5HR1A 1TXXA 3IHQA 1X0RA 4ZIJA 2IPAA 2HE3A 3EE2A 4IKHA 19GSA 1Y1UA 1GULA 4AKXB 4EF0A 5DQSA 2HRAA 4L8EA 2AV4A 4ZL8A 2QA1A 3HJMA 1BEDA 1WOUA 3C1SA 1K3YA 2R0PA 3H1NA 3CBUA 4NXIA 2GQLA 2LQQA 1Y6EA 2XC2A 4BWQA 3G7YA 3VK9A 4WR5A 4XIHA 1VGLA 2QA2A 4POLA 3M8NA 5HFIA 2CV4A 2H8LA 4MPGA 3L4NA 1GP1A 1ZYQB 2LS5A 3M3MA 2A4HA 3EINA 5GZZB 4ZB8A 3IXRA 1S3DA 4E8EA 2MBTA 1V9WA 2KP2A 5JCUA 4YAVA 3IRAA 3KZQA 3CXGA 3GN3A 3WGXA 3A5IA 1K0DA 3DYRA 2DKIA 2JZSA 1T4ZA 2OE1A 4I6XA 3DGQA 4ECIA 4ACSA 1BYEA 2MBSA 4EO3A 4KCAA 3ED3A 5IMZA 2H72A 2NDOA 1U88A 5IO0A 3VURA 2IFQB 2E2GA 2MMOA 2AJQB 5B7CA 4IQ1A 2AYTA 3I43A 3KMNA 1TK5B 1TKDB 1TOFA 3ZVJD 3IV4A 3CTGA 4KB3A 2N5FA 3EWLA 4ZXGA 2VCZA 1Z6MA 3GIXA 2YWOA 4NV2A 5ID2B 3CSHA 1E6BA 2IMFA 1UA5A 4DVCA 1A23A 2H1BA 2V1MA 2E2MA 4HOJA 2N5BA 1MD4A 4IBPA 2ON5A 2R3XA 1GTBA 3FHKA 3GKNA 5DQYA 3BJ5A 1O6JA 2X99A 4KSMA 3F3QA 2OADA 2O8VB 3UIWA 2EIRA 3FR3A 3KTLA 5DALB 4BWSA 1DE2A 1XVWA 4F0CA 17GSA 3LFLA 3NOFA 2LRCA 1TRWA 3A2WA 1AQWA 2GSQA 2J23A 5IM9A 4ECCA 3FZAA 1A2JA 2C3NA 1TU8A 3TDGA 2HSHA 3VWUA 1ML6A 5A5HB 5J47A 4DSSB 4MF6A 2PUKC 4G0LA 4FYUA 4YQVA 4RI7A 4GTUA 5KN1A 1AW9A 3MAKA 1EGOA 1PL2A 5CRHA 2REMA 4GDFA 4KX4A 4KA0A 3ZFLA 3HZ4A 3MDKA 2OE0A 2PERA 3TRQA 3M1GA 3QPMA 1TRSA 18GSA 4MPFA 2FWEA 1KTEA 4QL9A 2IIYA 2C3TA 3L9SA 2DJ2A 2H0HA 2GSRA 4WF4A 3ERWA 4MNNA 3NIVA 2R0GA 3TRPA 4EDZA 2XBIA 1XW9A 1THXA 3J7Yk 4KF9A 1O73A 1BJXA 1XPVA 3IDVA 1X9MB 3GL5A 4PGTA 1GSQA 4D73B 1USBA 1PL1A 1SL2B 3VPQA 3ZYWA 2H76A 4G0KA 3CYNA 3TCOA 2VL9A 4WBJA 1X9WB 2DJKA 3HXSA 1YQ1A 3GX0A 3BCKA 4RQRA 3PGTA 2MYGA 4Q5QA 3VI5A 2EFEA 5KEJA 3O76A 5G2ZA 4G19A 2LNSA 2FWFA 1ZMAA 1TRVA 4P3YB 5DBQA 3C71A 1Z3EA 4LL4B 1A2LA 2H75A 1H75A 4K5SA 3K8NA 1OC9B 2X8CA 5EL8A 3RHCA 3ZRDA 4OFNA 3D5JA 5CP1A 4CHSA 2PN8A 2WDUA 4ZL9A 2I9HA 4A5PA 1TXUA 1X5EA 2NBSA 2IFQA 4K5RA 4V2NA 2RLIA 3CSJA 2YANA 3F63A 4HUAA 4AI6A 3WT2A 2F8FA 16GSA 3UL3A 2CX4A 3GH6A 3QDNA 3GKXA 3GUSA 1WMJA 1F2EA 4ZILA 4PTSA 2VL2C 1UVZA 3QMXA 5COHA 3V1WA 1XWAA 3I9V2 3P7XA 4GQCA 1T3BA 3Q18A 3FRCA 2GT5A 4MA9A 2PMTA 2VIMA 5DJLA 5IQYA 1TK0B 5J4YA 1K3OA 5INYA 4EVMA 2FWGA 3MYDA 2PBJA 1X5CA 3F4RA 2IMKA 4J56E 4HZ4A 4EE0A 5ECRB 3DIEA 4Q5RA 4GWRA 1PX7A 2VLTA 2CZ3A 2N5AA 1XBSA 4EIPA 1Y25A 2L4CA 4LMVA 3N9JA 1B4QA 4J2FA 2O85A 2LUSA 2DBCA 3RAZA 1TJDA 2I1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSS A;  5ENU A;  2C0D A;  1SJI A;  3LXZ A;  3BCI A;  3H8Q A;  2VCX A;  1AIU A;  4GSS A;  3FZ4 A;  4DSS A;  1VF2 A;  2OJL A;  1A0F A;  5CNW A;  4PXO A;  1TW9 A;  4ZB6 A;  3RBT A;  1E2Y A;  2O87 A;  4OMV A;  2NTO A;  3APQ A;  4OO5 A;  3C73 A;  1AC1 A;  1K0O A;  2F3M A;  1TI1 A;  4IS0 A;  3IR4 A;  1A2M A;  1ERW A;  5C04 A;  3Q74 A;  2G0F A;  4KDY A;  3PH9 A;  4IJ3 A;  5AIV A;  1ILO A;  3VFI A;  3WGE A;  2H1G A;  4OCF A;  3LOR A;  4MAB A;  3KH7 A;  4FQU A;  1K0C A;  5IMF A;  2YN1 A;  2DJJ A;  2GZP A;  3KEB A;  3A3T A;  1FAA A;  3O3T A;  3ERF A;  5GST A;  3GH9 A;  3KH9 A;  4IQA A;  2DMM A;  2WCI A;  1YDK A;  1PQN A;  3HKR A;  4D73 A;  4MF7 A;  1A8L A;  4ILF A;  1MTC A;  2DJ3 A;  1EOG A;  5F07 A;  3GMF A;  3KGK A;  1SKS B;  3KD0 A;  2H6Y A;  4MJB A;  1GTI A;  4WKW A;  4K6X A;  1Z6N A;  5IPG A;  4OCE A;  3ERG A;  2YOI A;  1O8W A;  1QGV A;  5HFK A;  1RK4 A;  5HR0 A;  1M99 A;  3L78 A;  3ZLP A;  3TOT A;  3KXO A;  3CRT A;  4MP4 A;  2HRK B;  5FWG A;  2LTK A;  2OAC A;  1B9X C;  1EEJ A;  2FCH A;  2DC5 A;  2MMA A;  3GL3 A;  2GDR A;  3SBC A;  1JZW A;  4O5R A;  5G5F A;  1GSU A;  1M9A A;  1V98 A;  2C3Q A;  5ECP B;  1SK0 A;  5D96 A;  1FHE A;  4QQ7 A;  5LCZ A;  3M9J A;  3HHV A;  4BVY B;  4NHW A;  2MMZ A;  1EGR A;  4ZB9 A;  3GST A;  3HVX A;  4IVF A;  2HQT A;  3WYW A;  1QQ2 A;  3RPP A;  3EMP A;  3DKS A;  2G2Q A;  2WZ9 A;  3TKS A;  1TP9 A;  2OKA A;  4L0W A;  2H01 A;  4WEY A;  1SYX A;  3BD2 A;  3D0Z A;  2GQM A;  4N10 A;  3TKS C;  2OBK A;  1FVJ A;  3D6I A;  4V1A p;  1OE7 A;  5CYY A;  4PQI A;  1ON4 A;  4IP6 A;  2WRT A;  3LGC A;  5E4W A;  4V1A g;  2CVB A;  1DUG A;  2WGR A;  3TKR A;  4NV5 A;  1M0U A;  1XIY A;  3GRX A;  4MZB A;  4EUY A;  3CMI A;  3TJG A;  1A0R P;  3LYP A;  4IEL A;  4PNF A;  1XCC A;  5DAK B;  5ECM B;  3DEX A;  5GAP D;  1S3A A;  4HEA 2;  3NZN A;  1QMV A;  5D73 A;  1A24 A;  2HYX A;  3D21 A;  2C0E A;  3TKS E;  3C7M A;  2LKU A;  1DE1 A;  1GTU A;  1U3A A;  1SL1 B;  3GV1 A;  3IAS 2;  1SKR B;  4MJC A;  3EU3 A;  2EIQ A;  1QFN A;  2C0G A;  2F9S A;  1XOB A;  1PKZ A;  1HYU A;  4YQM A;  2GST A;  3H93 A;  4K8M A;  2LRT A;  2E7P A;  4LLR A;  1FOV A;  4MCU A;  2C80 A;  2GVP A;  2KHP A;  3FEU A;  5HQP A;  1GUH A;  3QAG A;  3L9U A;  5D9V A;  2H74 A;  5ECS A;  3KIJ A;  4HQS A;  2CT6 A;  4G10 A;  4ML6 A;  3GA4 A;  1XOA A;  1U6T A;  4FH8 A;  3IOS A;  4NPB A;  5B6N A;  1AQX A;  12GS A;  2H0G A;  2ZCT A;  4ZBD A;  1YKC A;  2X8H A;  1SKW B;  5B8A A;  1NW2 A;  1RW1 A;  4MH2 A;  4TKY A;  4HJM A;  5C00 A;  3F0I A;  1X9S B;  4MK3 A;  3UAR A;  2DJ1 A;  2VCW A;  5A4U A;  5IMA A;  1WP0 A;  2B1K A;  2JZR A;  5D9W A;  2JSZ A;  4MLY A;  3L9V A;  3LEF A;  3ZVJ A;  22GS A;  3GX8 A;  1BX9 A;  3E0U A;  3P2A A;  2GS3 A;  2K8S A;  2YPM A;  2FLS A;  1R7H A;  2OE3 A;  2WS2 A;  1EP8 A;  2B5E A;  2CQ9 A;  4PUR A;  2VCT A;  2HRK A;  4ZBB A;  2YNX A;  3VLN A;  3APS A;  3ZL5 A;  2IJY A;  2K6V A;  3OR5 A;  1JZO A;  5J3R A;  3KM6 A;  4MDC A;  2F51 A;  5ECL B;  1B48 A;  7GSS A;  2UZ8 A;  2YWI A;  3GFK A;  1KNG A;  2V2G A;  1XZO A;  2XHF A;  1NHY A;  4EKZ A;  9GSS A;  2DLX A;  2OA7 A;  4BVY A;  1R5P A;  3MNG A;  3DWV A;  2XBQ A;  4I2T A;  1QK8 A;  5F06 A;  4ECJ A;  2H6Z A;  4PQ1 A;  4I97 A;  5B6M A;  3O6T A;  4DSQ A;  3QAW A;  4ML1 A;  2HSM B;  1MDI A;  4ULX A;  3DXB A;  3TKP A;  1Q98 A;  3IA1 A;  1PA3 A;  2YV7 A;  1PRX A;  2RUE A;  4USS A;  2DSA A;  1GNW A;  4KUN A;  3C8E A;  5JWQ B;  4V2L A;  2KP1 A;  2KUC A;  4OD7 A;  1JLV A;  4TR4 A;  5ECQ B;  5LNK e;  1B9Y C;  3GKK A;  5IPH A;  6GST A;  3HYP A;  2P0G A;  1GSD A;  2FY6 A;  2C4J A;  4JR6 A;  1F37 A;  2YJH A;  3L0H A;  2YWM A;  5HFG A;  1H4O A;  2NVL A;  2B5Y A;  2LQO A;  4BVX B;  2VLU A;  1EV9 A;  4JRR A;  1V58 A;  4LL1 B;  1SYR A;  3VWW A;  4GCI A;  2X64 A;  4JU5 A;  2RII A;  2PVQ A;  5HR2 A;  4KH7 A;  5DAK A;  1WJK A;  3G7I A;  2NPB A;  5F8B A;  4EC0 A;  5G30 A;  2AUV A;  1F6M C;  3LWA A;  20GS A;  4MJE A;  3KP8 A;  2YZU A;  5H5R A;  5AIS A;  5EY6 A;  3HDC A;  2VO4 A;  4BL7 B;  2L5O A;  4TXO B;  3CRU A;  3UBL A;  3ZIT A;  4ECB A;  1ZOF A;  2MMN A;  1MDK A;  3F8U A;  1SK2 A;  3F3R A;  1FVK A;  3LG6 A;  3TGZ A;  1TU7 A;  1Z7R A;  5JWR B;  2H66 A;  1OKT A;  2FA8 A;  5G31 A;  2LEG A;  6GSX A;  5JCW A;  2VL2 A;  1M2D A;  3WT1 A;  2H73 A;  2DIY A;  2H0I A;  1EV4 A;  3LJR A;  4X1U A;  3VPT A;  2EC4 A;  3ZTL A;  4ISD A;  2V6K A;  4PUA A;  3G7J A;  3IAM 2;  1R4W A;  3R2Q A;  1XWB A;  2TRX A;  4JE1 A;  4EDY A;  2M46 A;  3C1R A;  1N8J A;  4K7N A;  4O92 A;  3DRN A;  5EVO A;  1DSB A;  6GSV A;  3UMA A;  4N0V A;  2CA8 A;  4POM A;  1HNA A;  3HD5 A;  4TR1 B;  1G6W A;  3IC8 A;  4OFM A;  3ZMK A;  4K7I A;  3VI7 A;  3TOU A;  2IMD A;  3DML A;  1TDI A;  2RM5 A;  1BG5 A;  3Q6O A;  4JR4 A;  1GLQ A;  1F3A A;  5CRW A;  1GUK A;  1OYJ A;  5F0G A;  1UN2 A;  1YEP A;  1JZD A;  3EVI A;  1WRY A;  4AJ8 A;  2TIR A;  5J4U A;  2V32 A;  2CAQ A;  1PKW A;  4HJ2 A;  3FY7 A;  1SU9 A;  4TW5 A;  5AGY A;  5J9C A;  5CRD A;  2B1L A;  2XPD A;  2GLR A;  3CSI A;  1SD9 A;  1WE0 A;  3KTB A;  4LA1 A;  3BBY A;  4POB A;  3FZ9 A;  1AXD A;  3RPN A;  3G9B A;  2LST A;  3ZZX A;  4KCE A;  2FA4 A;  4JED A;  4PQH A;  3N5O A;  1ZYE A;  3UEM A;  3Q19 A;  2K18 A;  3TB2 A;  4NAX A;  3IK9 A;  2GZY A;  2I3Y A;  3QOU A;  2F8A A;  4ID0 A;  1ZL9 A;  1M2A A;  2L57 A;  5LD0 A;  2R37 A;  1CQG A;  1IYH A;  5ABR A;  3UOM A;  1SL0 B;  4DEJ A;  1FB0 A;  3FKF A;  3GHA A;  2HSM A;  1LBK A;  4WET A;  1T1V A;  2L59 A;  3ZRE A;  1FG4 A;  4EXJ A;  1PMT A;  2B6M A;  1AAZ A;  1JZR A;  3KCM A;  1FB6 A;  3QFA C;  4GST A;  3SWL A;  3U5R E;  3LSZ A;  3EC3 A;  3KP9 A;  4XS4 A;  3IC4 A;  4MMM A;  1GSF A;  5ECK B;  4KW6 A;  5D8I A;  3WGD A;  1THO A;  2VCQ A;  4Q5F A;  3RHB A;  2VL3 A;  2K8V A;  3J7Y b;  6GSY A;  4BPY A;  3TJB A;  4BVX A;  3H4K A;  1IYI A;  4FO5 A;  1YEX A;  3E9J B;  4HZ2 A;  4HU7 A;  1GL8 A;  1K3L A;  13GS A;  1MEK A;  2O7K A;  14GS A;  3QD9 A;  4G9H A;  1ACV A;  1Z9H A;  1BAY A;  4QL7 A;  1XWK A;  3QR6 A;  2HRF A;  1HQO A;  5ECN B;  1Z7P A;  2FGX A;  2VD1 A;  3MSZ A;  5JCG A;  5CRE A;  5AIX A;  3DVW A;  3F6F A;  4BL7 A;  2RUF A;  1YY7 A;  4TXO A;  2ES7 A;  1GSS A;  3IBH A;  5IOW A;  5GSS A;  2WB9 A;  1WIK A;  2FD3 A;  4NMU A;  1YJ6 A;  3F9U A;  3FYG A;  2TRC P;  1J0F A;  3U6V A;  1K0A A;  2CX3 A;  2R2J A;  2K9F A;  2I81 A;  1TK8 B;  2P5Q A;  2ZUP A;  3ZFB A;  2QKE A;  1SEN A;  4G2E A;  2LJR A;  3AY8 A;  2C1Y A;  3LXT A;  1I5G A;  5G5E A;  1G6Y A;  5H5S A;  1U3I A;  3UBK A;  4OWY A;  4F2I A;  2HNL A;  3EU4 A;  4N11 A;  1M2B A;  4TR1 A;  1EZK A;  1ZCP A;  4WBR D;  3HVV A;  4MZW A;  5H5Q A;  1YF1 A;  1ST9 A;  1ERU A;  4L5O A;  2LRN A;  4NWY A;  4JZQ A;  4O7H A;  4XRA A;  4F9Z A;  2J9H A;  1N2A A;  4X0X A;  1ERT A;  1OC3 A;  5IO2 A;  1DBY A;  5ELA A;  5JWO B;  5CO3 A;  2B7K A;  2FWH A;  1ZGN A;  2JAD A;  2ZNM A;  4IP1 A;  3IPZ A;  4WR4 A;  1T7P B;  2HFD A;  3GSS A;  4KAE A;  3TKQ A;  3A2X A;  1HD2 A;  1AUC A;  1PD2 1;  3P90 A;  2QSI A;  3W6G A;  4E8H A;  1G7E A;  2AHE A;  4KGI A;  5D9T A;  4K1F A;  2WJU A;  1G7O A;  1O85 A;  2L6D A;  4MH3 A;  1F9M A;  4AJ6 A;  4YAP A;  4XCS A;  2HLS A;  2PWJ A;  3HCZ A;  2P5R A;  4IN0 A;  4TR3 A;  1B4P A;  3ISO A;  3GNJ A;  4TN8 A;  4TXV A;  2IL3 A;  3FR6 A;  2BJX A;  4K2D A;  3TJK A;  1K0N A;  6GSW A;  3TJF A;  3MWH A;  3WD6 A;  4CDO A;  5J5N A;  4GSN A;  4MZC A;  4YH2 A;  1R5A A;  2A4V A;  4GF0 A;  2JU5 A;  2QC7 A;  5KN2 A;  1VF1 A;  1GSY A;  1O7U A;  5A5K A;  2D2Z A;  3TUE A;  1J08 A;  1GWC A;  1VF3 A;  1EOH A;  5DJM A;  1CQH A;  4FIW A;  3UVT A;  2CZ2 A;  5D93 A;  4WXT A;  5ELG A;  3PPU A;  5J9B A;  4J57 E;  2HSN B;  1K0B A;  4K7O A;  3QAV A;  3D4M A;  2LJA A;  2V6O A;  2JZT A;  1OC8 A;  2IWT A;  4N30 A;  2JSY A;  5ECO B;  1QUW A;  2B3S A;  2V41 A;  2B5X A;  4XS1 A;  2GGT A;  3QCP A;  5A4V A;  3S9F A;  4K0G A;  2QGV A;  2KLX A;  4YQU A;  1XW5 A;  1GNE A;  4FYC A;  5J41 A;  2IN3 A;  1PX6 A;  2ON7 A;  2GTU A;  2CAI A;  2JAC A;  3APO A;  1K0M A;  4BA7 A;  1X5D A;  4X43 A;  4RUV A;  3VWV A;  3GTU B;  4HU9 A;  1GTA A;  5IOX A;  4V2M A;  4EL1 A;  5B8B A;  1YZX A;  1KBN A;  1XFL A;  1HNC A;  3DVX A;  1XVQ A;  4TOP A;  4GLT A;  2GQK A;  1SK1 A;  3HVS A;  2PGT A;  2DJ0 A;  5E59 A;  2X8G A;  4Q5N A;  2H71 A;  5G1K A;  1OE8 A;  1B8X A;  2VLV A;  4IGJ A;  2VAF A;  5IMC A;  2WFC A;  1PN9 A;  4RQX A;  1GUM A;  4HI7 A;  1GSE A;  5IMD A;  4XS4 B;  1O81 A;  2GT6 A;  2GZZ A;  3ZML A;  2BTO T;  3PIN A;  1V40 A;  4O32 A;  2VD0 A;  5L71 A;  3D4T A;  1URM A;  1JLW A;  4MF5 A;  4OO4 A;  4L0U A;  4K9Z A;  4GXZ A;  3A5W A;  3UAP A;  4I8B A;  4GQF A;  4DSR A;  3W8S A;  3FR9 A;  4N0Z A;  3US3 A;  1VRS D;  3LQ7 A;  2AB6 A;  4IW9 A;  4AJ7 A;  2YZH A;  2HT9 A;  4I5Q A;  1T8E B;  3ZIJ A;  1KEB A;  4XHM A;  2I4A A;  1UC7 A;  5DCH A;  4MJA A;  1FW1 A;  1I9D A;  1FO5 A;  2R4V A;  4Z7X A;  3IK7 A;  1SD8 A;  2H30 A;  3E3E A;  2KOK A;  2OBI A;  1GH2 A;  1M7T A;  3EYT A;  1U87 A;  2VM1 A;  4AGS A;  1PSQ A;  2C0F A;  2AAW A;  1SJ6 A;  2PVO C;  1F3B A;  1Q4J A;  1C72 A;  2YCD A;  4HQZ A;  5IIZ A;  2HSY A;  2IMI A;  4XRD A;  5ECH B;  3ME7 A;  4AF2 A;  2HZE B;  2PU9 C;  2FHE A;  2LV3 A;  1JHB A;  5F05 A;  4HDE A;  1LU4 A;  1J9B A;  3D22 A;  1XXU A;  2HRN A;  2B7J A;  5CAX A;  1SJZ A;  5BMU A;  2FUG 2;  4ZBA A;  1XWG A;  1WWJ A;  5A4W A;  2JL4 A;  1TTZ A;  1T4Y A;  1BQ7 A;  5D9X A;  1GLP A;  1YF0 A;  4NHZ A;  1XW6 A;  4K0N A;  4IHU A;  4KDU A;  1W89 A;  3EMX A;  1EWX A;  2H6X A;  3HY2 A;  3A2V A;  3VWX A;  5ID2 A;  1M9B A;  6GSU A;  1TI3 A;  5IMV A;  4F82 A;  4OFT A;  2M80 A;  4F0B A;  2CVD A;  2A2R A;  3KJY A;  2C8U A;  1VF4 A;  5KN0 A;  3BOA A;  3HJO A;  2VOC A;  2Z9S A;  3QFB C;  3H79 A;  5AN1 A;  1ABA A;  3FW2 A;  5KN3 A;  2DIZ A;  3JCM L;  3IE3 A;  1ERV A;  4L5L A;  5DAL A;  2LJK A;  1GRX A;  3UJ1 A;  1T00 A;  4KND A;  5G1L A;  5HR3 A;  1PGT A;  2XPE A;  2L5L A;  1V2A A;  2H70 A;  4PX1 A;  1NSW A;  2VUP A;  4CW9 A;  5DCG A;  2H1D A;  3RDW A;  2H1A A;  3DD3 A;  2PPT A;  3HA9 A;  1YKA A;  1QXH A;  2EIO A;  1S3C A;  4HS1 A;  3HJP A;  4PNG A;  4I2U A;  3GTU A;  5DDL A;  5CRG A;  6GSS A;  1G0T A;  4KE3 A;  2MZC A;  2L4Q A;  2LNT A;  1MDJ A;  1OVN A;  3GYK A;  2CVK A;  5EPF A;  3HZ8 A;  1Z5Y E;  4TR0 A;  4FYB A;  2P31 A;  4G0I A;  4IJI A;  1RQM A;  4F03 A;  2YWN A;  1R26 A;  1OAZ A;  1NM3 A;  2HXK A;  4GRF A;  4PUF C;  2DML A;  2VCV A;  1JFU A;  2YP6 A;  3GKM A;  2RM6 A;  1V57 A;  2R6K A;  5DVB A;  1W4V A;  8GSS A;  3ZIV A;  3F4T A;  3I69 A;  3TRX A;  10GS A;  5FHI A;  1NHO A;  1AQV A;  4H86 A;  2A2S A;  2FNO A;  3GUR A;  4XS6 A;  3EUR A;  3KMO A;  4ZL7 A;  3UVH A;  3CTF A;  3FZ5 A;  11GS A;  1ZZY A;  3TJJ A;  1OKD A;  1TRU A;  2H19 A;  3ME8 A;  2HZF A;  5GAN D;  1LJR A;  4KDX A;  3F6D A;  4KSO A;  4WF5 A;  1HNB A;  1O8X A;  3W8J A;  2O89 A;  2ALB A;  1XWC A;  5FT3 A;  1A8Y A;  3I6A A;  1WPI A;  2YJ7 A;  2VM2 A;  4TVE A;  4POK A;  1OC9 A;  3PR8 A;  3M9K A;  2M72 A;  3FK8 A;  2YV9 A;  3P8W A;  3R3E A;  1EEM A;  4LMW A;  2L6C A;  2R5G A;  4JBB A;  5ECI B;  1MD3 A;  1EP7 A;  2HZE A;  3F4S A;  2IME A;  4RI6 A;  4XTS A;  3LYK A;  3M0F A;  2HI7 A;  4TRX A;  2WUL A;  2E0Q A;  2BMX A;  5HR1 A;  1TXX A;  3IHQ A;  1X0R A;  4ZIJ A;  2IPA A;  2HE3 A;  3EE2 A;  4IKH A;  19GS A;  1GUL A;  4EF0 A;  5DQS A;  2HRA A;  4L8E A;  2AV4 A;  4ZL8 A;  3HJM A;  1BED A;  1WOU A;  3C1S A;  1K3Y A;  3H1N A;  3CBU A;  4NXI A;  2GQL A;  2LQQ A;  1Y6E A;  2XC2 A;  4BWQ A;  3G7Y A;  3VK9 A;  4WR5 A;  4XIH A;  1VGL A;  4POL A;  3M8N A;  5HFI A;  2CV4 A;  2H8L A;  4MPG A;  3L4N A;  1GP1 A;  1ZYQ B;  2LS5 A;  3M3M A;  3EIN A;  5GZZ B;  4ZB8 A;  3IXR A;  1S3D A;  4E8E A;  2MBT A;  1V9W A;  2KP2 A;  5JCU A;  4YAV A;  3IRA A;  3KZQ A;  3CXG A;  3GN3 A;  3WGX A;  1K0D A;  3DYR A;  2JZS A;  1T4Z A;  2OE1 A;  4I6X A;  3DGQ A;  4ECI A;  4ACS A;  1BYE A;  2MBS A;  4EO3 A;  4KCA A;  3ED3 A;  5IMZ A;  2H72 A;  2NDO A;  1U88 A;  5IO0 A;  3VUR A;  2IFQ B;  2E2G A;  2MMO A;  2AJQ B;  5B7C A;  4IQ1 A;  2AYT A;  3I43 A;  3KMN A;  1TK5 B;  1TKD B;  1TOF A;  3ZVJ D;  3IV4 A;  3CTG A;  4KB3 A;  2N5F A;  3EWL A;  4ZXG A;  2VCZ A;  1Z6M A;  3GIX A;  2YWO A;  4NV2 A;  5ID2 B;  3CSH A;  1E6B A;  2IMF A;  1UA5 A;  4DVC A;  1A23 A;  2H1B A;  2V1M A;  2E2M A;  4HOJ A;  2N5B A;  1MD4 A;  4IBP A;  2ON5 A;  2R3X A;  1GTB A;  3FHK A;  3GKN A;  5DQY A;  3BJ5 A;  1O6J A;  2X99 A;  4KSM A;  3F3Q A;  2OAD A;  2O8V B;  3UIW A;  2EIR A;  3FR3 A;  3KTL A;  5DAL B;  4BWS A;  1DE2 A;  1XVW A;  4F0C A;  17GS A;  3LFL A;  3NOF A;  2LRC A;  1TRW A;  3A2W A;  1AQW A;  2GSQ A;  2J23 A;  5IM9 A;  4ECC A;  3FZA A;  1A2J A;  2C3N A;  1TU8 A;  3TDG A;  2HSH A;  3VWU A;  1ML6 A;  4DSS B;  4MF6 A;  2PUK C;  4G0L A;  4FYU A;  4YQV A;  4RI7 A;  4GTU A;  5KN1 A;  1AW9 A;  3MAK A;  1EGO A;  1PL2 A;  5CRH A;  2REM A;  4KX4 A;  4KA0 A;  3ZFL A;  3HZ4 A;  3MDK A;  2OE0 A;  2PER A;  3TRQ A;  3M1G A;  3QPM A;  1TRS A;  18GS A;  4MPF A;  2FWE A;  1KTE A;  4QL9 A;  2IIY A;  2C3T A;  3L9S A;  2DJ2 A;  2H0H A;  2GSR A;  4WF4 A;  3ERW A;  3NIV A;  3TRP A;  4EDZ A;  2XBI A;  1XW9 A;  1THX A;  3J7Y k;  4KF9 A;  1O73 A;  1BJX A;  1XPV A;  3IDV A;  1X9M B;  3GL5 A;  4PGT A;  1GSQ A;  4D73 B;  1USB A;  1PL1 A;  1SL2 B;  3VPQ A;  3ZYW A;  2H76 A;  4G0K A;  3CYN A;  3TCO A;  2VL9 A;  4WBJ A;  1X9W B;  2DJK A;  3HXS A;  1YQ1 A;  3GX0 A;  3BCK A;  4RQR A;  3PGT A;  2MYG A;  4Q5Q A;  3VI5 A;  5KEJ A;  3O76 A;  5G2Z A;  4G19 A;  2LNS A;  2FWF A;  1ZMA A;  1TRV A;  4P3Y B;  5DBQ A;  3C71 A;  1Z3E A;  4LL4 B;  1A2L A;  2H75 A;  1H75 A;  3K8N A;  1OC9 B;  2X8C A;  5EL8 A;  3RHC A;  3ZRD A;  4OFN A;  3D5J A;  5CP1 A;  4CHS A;  2PN8 A;  2WDU A;  4ZL9 A;  2I9H A;  2NBS A;  1X5E A;  2IFQ A;  4V2N A;  2RLI A;  3CSJ A;  2YAN A;  3F63 A;  4HUA A;  3WT2 A;  2F8F A;  16GS A;  3UL3 A;  2CX4 A;  3GH6 A;  3QDN A;  3GKX A;  3GUS A;  1WMJ A;  1F2E A;  4ZIL A;  4PTS A;  2VL2 C;  1UVZ A;  3QMX A;  5COH A;  3V1W A;  1XWA A;  3I9V 2;  3P7X A;  4GQC A;  1T3B A;  3Q18 A;  3FRC A;  2GT5 A;  4MA9 A;  2PMT A;  5IQY A;  5DJL A;  2VIM A;  1TK0 B;  1K3O A;  5INY A;  4EVM A;  2FWG A;  2PBJ A;  1X5C A;  3F4R A;  2IMK A;  4J56 E;  4HZ4 A;  4EE0 A;  5ECR B;  3DIE A;  4Q5R A;  4GWR A;  1PX7 A;  2VLT A;  2CZ3 A;  2N5A A;  1XBS A;  1Y25 A;  2L4C A;  4LMV A;  3N9J A;  1B4Q A;  4J2F A;  2O85 A;  2LUS A;  2DBC A;  3RAZ A;  1TJD A;  2I1U A; 
#chains in the Genus database with same CATH topology
 2GSS A;  5ENU A;  2C0D A;  1SJI A;  3LXZ A;  3BCI A;  3H8Q A;  2VCX A;  1AIU A;  4GSS A;  5A5H A;  3FZ4 A;  4DSS A;  1VF2 A;  2OJL A;  1A0F A;  5CNW A;  4PXO A;  1TW9 A;  4ZB6 A;  3RBT A;  1E2Y A;  2O87 A;  3CHX C;  4OMV A;  5BRT A;  2NTO A;  3APQ A;  4OO5 A;  3C73 A;  1AC1 A;  1K0O A;  2F3M A;  1TI1 A;  4IS0 A;  3IR4 A;  1A2M A;  1ERW A;  5C04 A;  3Q74 A;  2G0F A;  4KDY A;  3PH9 A;  4IJ3 A;  5AIV A;  1ILO A;  3VFI A;  3WGE A;  2H1G A;  4OCF A;  3LOR A;  4MAB A;  3KH7 A;  4FQU A;  1K0C A;  3LW9 A;  5IMF A;  2H1L A;  2YN1 A;  2DJJ A;  2GZP A;  3KEB A;  3A3T A;  5KOW A;  1FAA A;  3O3T A;  3ERF A;  5GST A;  3GH9 A;  3KH9 A;  4IQA A;  2DMM A;  2WCI A;  1YDK A;  1PQN A;  3HKR A;  4D73 A;  4MF7 A;  1A8L A;  4ILF A;  1MTC A;  2DJ3 A;  1EOG A;  5F07 A;  3GMF A;  3KGK A;  1SKS B;  3KD0 A;  2H6Y A;  4MJB A;  1GTI A;  4WKW A;  4K6X A;  1Z6N A;  5IPG A;  4OCE A;  3ERG A;  2YOI A;  1O8W A;  1QGV A;  5HFK A;  1RK4 A;  5HR0 A;  1M99 A;  3RFR C;  3L78 A;  3ZLP A;  3TOT A;  3KXO A;  4N3Z A;  3CRT A;  4MP4 A;  2HRK B;  5FWG A;  2LTK A;  2OAC A;  1B9X C;  1EEJ A;  2FCH A;  2DC5 A;  2MMA A;  3GL3 A;  2GDR A;  3SBC A;  1JZW A;  4O5R A;  5G5F A;  1GSU A;  1M9A A;  1V98 A;  2C3Q A;  3RGB C;  5ECP B;  1SK0 A;  5D96 A;  1FHE A;  4QQ7 A;  5LCZ A;  1S4B P;  3M9J A;  3HHV A;  4BVY B;  4NHW A;  2MMZ A;  1EGR A;  4ZB9 A;  3GST A;  3HVX A;  4IVF A;  2HQT A;  1BG1 A;  3WYW A;  1QQ2 A;  3RPP A;  3EMP A;  1ZYN A;  4O5Q A;  3DKS A;  2G2Q A;  2WZ9 A;  3TKS A;  1TP9 A;  2OKA A;  4L0W A;  4AKH A;  2H01 A;  4WEY A;  1SYX A;  3BD2 A;  3D0Z A;  2GQM A;  4N10 A;  3TKS C;  2OBK A;  1FVJ A;  4BIK A;  3D6I A;  4V1A p;  1OE7 A;  5CYY A;  4PQI A;  1ON4 A;  4IP6 A;  2WRT A;  3LGC A;  5E4W A;  4V1A g;  2CVB A;  1DUG A;  2WGR A;  3TKR A;  4NV5 A;  1M0U A;  1XIY A;  3GRX A;  4MZB A;  4EUY A;  3CMI A;  3TJG A;  1A0R P;  3LYP A;  4IEL A;  4PNF A;  1XCC A;  5DAK B;  5ECM B;  3DEX A;  5GAP D;  1S3A A;  4HEA 2;  3NZN A;  1QMV A;  5D73 A;  1A24 A;  2HYX A;  3D21 A;  2C0E A;  3TKS E;  3C7M A;  2LKU A;  1DE1 A;  1GTU A;  1U3A A;  1SL1 B;  3GV1 A;  3IAS 2;  1SKR B;  4MJC A;  3EU3 A;  2EIQ A;  1QFN A;  2C0G A;  2F9S A;  1XOB A;  1PKZ A;  1HYU A;  4YQM A;  2GST A;  3H93 A;  4K8M A;  2LRT A;  2E7P A;  4LLR A;  1FOV A;  4MCU A;  2C80 A;  2GVP A;  1SVM A;  1S3R A;  2KHP A;  3FEU A;  5HQP A;  1GUH A;  3QAG A;  3L9U A;  5D9V A;  2H74 A;  5ECS A;  3KIJ A;  4HQS A;  2CT6 A;  4G10 A;  4ML6 A;  3GA4 A;  1XOA A;  1M3J A;  1U6T A;  3IOS A;  4FH8 A;  4NPB A;  5B6N A;  1AQX A;  12GS A;  2H0G A;  2ZCT A;  4ZBD A;  1YKC A;  2X8H A;  1SKW B;  5B8A A;  1NW2 A;  4QMK A;  1RW1 A;  4MH2 A;  4TKY A;  4HJM A;  5C00 A;  3F0I A;  1X9S B;  2O5V A;  4MK3 A;  3UAR A;  2DJ1 A;  2VCW A;  5A4U A;  5IMA A;  1WP0 A;  2B1K A;  2JZR A;  5D9W A;  2JSZ A;  4MLY A;  3L9V A;  2WW3 A;  3LEF A;  3ZVJ A;  22GS A;  3GX8 A;  1BX9 A;  3E0U A;  3P2A A;  2GS3 A;  2K8S A;  2YPM A;  2FLS A;  1R7H A;  2OE3 A;  2WS2 A;  1EP8 A;  2B5E A;  2CQ9 A;  4PUR A;  2VCT A;  2HRK A;  1N25 A;  4ZBB A;  2YNX A;  3VLN A;  3APS A;  3ZL5 A;  2IJY A;  2K6V A;  3OR5 A;  1JZO A;  5J3R A;  3KM6 A;  4MDC A;  2F51 A;  5ECL B;  1B48 A;  7GSS A;  2UZ8 A;  3CQF A;  4Z2U A;  2YWI A;  3GFK A;  5A34 B;  1KNG A;  2V2G A;  1XZO A;  2XHF A;  1NHY A;  4EKZ A;  9GSS A;  2DLX A;  2OA7 A;  4BVY A;  1R5P A;  3MNG A;  3DWV A;  2WVY A;  2XBQ A;  4I2T A;  1QK8 A;  5F06 A;  4ECJ A;  2H6Z A;  4PQ1 A;  4I97 A;  5B6M A;  3O6T A;  4DSQ A;  3QAW A;  4ML1 A;  2HSM B;  1MDI A;  4ULX A;  3DXB A;  3TKP A;  1Q98 A;  3IA1 A;  2O3E A;  1PA3 A;  2YV7 A;  1PRX A;  2RUE A;  4USS A;  2DSA A;  1GNW A;  4KUN A;  3C8E A;  5JWQ B;  4V2L A;  2KP1 A;  2KUC A;  4OD7 A;  1JLV A;  4TR4 A;  4E68 A;  5ECQ B;  5LNK e;  1B9Y C;  3GKK A;  5IPH A;  6GST A;  3HYP A;  2P0G A;  1GSD A;  2FY6 A;  2C4J A;  4JR6 A;  1F37 A;  2YJH A;  3L0H A;  2YWM A;  5HFG A;  1H4O A;  2NVL A;  2LQO A;  2B5Y A;  4BVX B;  2VLU A;  1EV9 A;  4JRR A;  1V58 A;  4LL1 B;  1SYR A;  3VWW A;  4GCI A;  2X64 A;  4JU5 A;  2RII A;  2PVQ A;  5HR2 A;  4KH7 A;  5DAK A;  1WJK A;  3G7I A;  2NPB A;  5F8B A;  1PFO A;  4EC0 A;  5A1N B;  5G30 A;  3EPT A;  2AUV A;  1F6M C;  3LWA A;  20GS A;  4MJE A;  3KP8 A;  2YZU A;  5H5R A;  5AIS A;  5EY6 A;  3HDC A;  2VO4 A;  4BL7 B;  2L5O A;  1YVL A;  2O36 A;  4TXO B;  3CRU A;  3UBL A;  3ZIT A;  4ECB A;  1YEW C;  1ZOF A;  2MMN A;  1MDK A;  3F8U A;  1SK2 A;  3F3R A;  1FVK A;  3LG6 A;  3TGZ A;  1TU7 A;  1Z7R A;  5JWR B;  2H66 A;  1OKT A;  2FA8 A;  5G31 A;  2LEG A;  6GSX A;  5JCW A;  2VL2 A;  1M2D A;  3WT1 A;  2H73 A;  2DIY A;  2H0I A;  1EV4 A;  3LJR A;  4X1U A;  3VPT A;  2EC4 A;  3ZTL A;  4ISD A;  2V6K A;  3FMW A;  4PUA A;  3G7J A;  3IAM 2;  1R4W A;  3R2Q A;  1XWB A;  2TRX A;  4JE1 A;  4EDY A;  2M46 A;  3C1R A;  1N8J A;  4K7N A;  4O92 A;  3DRN A;  5EVO A;  1DSB A;  6GSV A;  3UMA A;  4N0V A;  2CA8 A;  4POM A;  1HNA A;  3HD5 A;  4TR1 B;  1G6W A;  3IC8 A;  4OFM A;  3ZMK A;  4K7I A;  3VI7 A;  3TOU A;  2IMD A;  3DML A;  1TDI A;  2RM5 A;  1BG5 A;  3Q6O A;  4JR4 A;  1ZYP A;  1GLQ A;  4W66 A;  2WVX A;  1F3A A;  5CRW A;  1GUK A;  1OYJ A;  2HSN A;  5F0G A;  1UN2 A;  1YEP A;  1JZD A;  3EVI A;  1WRY A;  4AJ8 A;  2TIR A;  5J4U A;  2V32 A;  2CAQ A;  1PKW A;  2EFC A;  4HJ2 A;  3FY7 A;  1SU9 A;  4TW5 A;  5AGY A;  5J9C A;  5CRD A;  2B1L A;  2XPD A;  2GLR A;  3CSI A;  1SD9 A;  1WE0 A;  2X4A A;  3KTB A;  4LA1 A;  4X4J A;  3BBY A;  4POB A;  3FZ9 A;  1AXD A;  2WW2 A;  3RPN A;  3G9B A;  2LST A;  3ZZX A;  4KCE A;  2FA4 A;  4JED A;  4PQH A;  3N5O A;  1ZYE A;  5A34 A;  3UEM A;  3Q19 A;  2K18 A;  3TB2 A;  4NAX A;  3IK9 A;  2GZY A;  2I3Y A;  3QOU A;  2F8A A;  4ID0 A;  1ZL9 A;  1M2A A;  3HVN A;  2L57 A;  5LD0 A;  2R37 A;  1CQG A;  1IYH A;  5ABR A;  3UOM A;  1SL0 B;  4DEJ A;  1FB0 A;  4HSC X;  3HMJ G;  3FKF A;  3GHA A;  2HSM A;  1LBK A;  4WET A;  1T1V A;  2L59 A;  3ZRE A;  1FG4 A;  4EXJ A;  1PMT A;  2B6M A;  1AAZ A;  1JZR A;  3KCM A;  1FB6 A;  3QFA C;  4GST A;  3SWL A;  3U5R E;  3LSZ A;  3EC3 A;  3KP9 A;  4XS4 A;  3IC4 A;  4MMM A;  1GSF A;  5ECK B;  4CY6 A;  4KW6 A;  5D8I A;  3WGD A;  1THO A;  2VCQ A;  4Q5F A;  3RHB A;  2VL3 A;  2K8V A;  3J7Y b;  6GSY A;  4BPY A;  2A2P A;  3TJB A;  4BVX A;  3H4K A;  1IYI A;  4FO5 A;  1YEX A;  3E9J B;  4HZ2 A;  4HU7 A;  1GL8 A;  1K3L A;  13GS A;  1MEK A;  2O7K A;  14GS A;  3QD9 A;  5A1N A;  4G9H A;  1ACV A;  1Z9H A;  1BAY A;  4QL7 A;  1XWK A;  3QR6 A;  2HRF A;  1HQO A;  5ECN B;  1Z7P A;  2FGX A;  2VD1 A;  3MSZ A;  5JCG A;  4YKF A;  5CRE A;  5AIX A;  3DVW A;  3F6F A;  4BL7 A;  2RUF A;  1YY7 A;  1BF5 A;  4TXO A;  4O5U A;  2ES7 A;  1GSS A;  3IBH A;  5IOW A;  5GSS A;  2WB9 A;  1WIK A;  2FD3 A;  4NMU A;  1YJ6 A;  3F9U A;  3FYG A;  4G01 A;  2TRC P;  1J0F A;  3U6V A;  1K0A A;  2CX3 A;  2R2J A;  2K9F A;  4CY8 A;  2I81 A;  1TK8 B;  2P5Q A;  2ZUP A;  3ZFB A;  2QKE A;  1SEN A;  4G2E A;  2LJR A;  3AY8 A;  2C1Y A;  3LXT A;  1I5G A;  5G5E A;  1G6Y A;  5H5S A;  1U3I A;  3UBK A;  2DKH A;  4OWY A;  4F2I A;  2HNL A;  5KOX A;  3EU4 A;  4N11 A;  1M2B A;  4TR1 A;  1EZK A;  1ZCP A;  4WBR D;  3HVV A;  4MZW A;  5H5Q A;  1YF1 A;  1ST9 A;  1ERU A;  4L5O A;  2LRN A;  4NWY A;  4JZQ A;  4O7H A;  4XRA A;  4F9Z A;  2J9H A;  1N2A A;  4X0X A;  1ERT A;  1OC3 A;  5IO2 A;  1DBY A;  5ELA A;  5JWO B;  5CO3 A;  2EFH A;  2B7K A;  4Z2T A;  2FWH A;  1ZGN A;  2JAD A;  2ZNM A;  4IP1 A;  3IPZ A;  4WR4 A;  1T7P B;  4AKG A;  2HFD A;  3GSS A;  4KAE A;  3TKQ A;  3A2X A;  1HD2 A;  1AUC A;  1PD2 1;  3P90 A;  2QSI A;  3W6G A;  4E8H A;  1G7E A;  2AHE A;  4KGI A;  5D9T A;  4K1F A;  2WJU A;  1G7O A;  1O85 A;  2L6D A;  4MH3 A;  4YKG A;  1F9M A;  4AJ6 A;  4YAP A;  4XCS A;  2HLS A;  2PWJ A;  3HCZ A;  2P5R A;  4IN0 A;  4TR3 A;  1B4P A;  3ISO A;  3GNJ A;  4TN8 A;  4TXV A;  2IL3 A;  3FR6 A;  2BJX A;  4K2D A;  3TJK A;  1K0N A;  6GSW A;  3TJF A;  2EFD A;  3MWH A;  3WD6 A;  4CDO A;  5J5N A;  4GSN A;  4MZC A;  4YH2 A;  1R5A A;  2A4V A;  4GF0 A;  2JU5 A;  5BMU B;  2QC7 A;  5KN2 A;  1VF1 A;  4PI2 C;  1GSY A;  1O7U A;  3TU3 B;  5A5K A;  2D2Z A;  3TUE A;  1J08 A;  1GWC A;  1VF3 A;  1EOH A;  5DJM A;  1CQH A;  4FIW A;  3UVT A;  2CZ2 A;  5D93 A;  2WVX B;  4WXT A;  5ELG A;  3PPU A;  5J9B A;  4J57 E;  2HSN B;  1K0B A;  4K7O A;  3QAV A;  3D4M A;  5J40 A;  2LJA A;  2V6O A;  2JZT A;  1OC8 A;  2IWT A;  4N30 A;  2JSY A;  5ECO B;  1QUW A;  2B3S A;  2V41 A;  2B5X A;  4XS1 A;  2GGT A;  3QCP A;  5A4V A;  3S9F A;  4K0G A;  2QGV A;  2KLX A;  4YQU A;  1XW5 A;  1GNE A;  4FYC A;  5J41 A;  2IN3 A;  1PX6 A;  2ON7 A;  2GTU A;  2CAI A;  2JAC A;  3APO A;  1K0M A;  4BA7 A;  1X5D A;  4X43 A;  4RUV A;  3VWV A;  4PI0 C;  3GTU B;  4HU9 A;  1GTA A;  5IOX A;  4V2M A;  4EL1 A;  5B8B A;  1YZX A;  1KBN A;  1XFL A;  1HNC A;  3DVX A;  1XVQ A;  4TOP A;  4GLT A;  2GQK A;  1SK1 A;  3MIX A;  3HVS A;  2PGT A;  2R0C A;  2DJ0 A;  5E59 A;  2X8G A;  4Q5N A;  2H71 A;  5G1K A;  1OE8 A;  1B8X A;  2VLV A;  4IGJ A;  2VAF A;  5IMC A;  2WFC A;  1PN9 A;  4RQX A;  1GUM A;  4HI7 A;  1GSE A;  5IMD A;  4XS4 B;  1O81 A;  2GT6 A;  2GZZ A;  3ZML A;  2BTO T;  3PIN A;  1V40 A;  4O32 A;  2VD0 A;  5L71 A;  3D4T A;  4FXY P;  1URM A;  1JLW A;  4MF5 A;  1FOH A;  5J4V A;  4Z2R A;  4OO4 A;  4L0U A;  4K9Z A;  4GXZ A;  3A5W A;  3UAP A;  4I8B A;  4GQF A;  4DSR A;  3W8S A;  2UV8 G;  3FR9 A;  4N0Z A;  3US3 A;  1VRS D;  3LQ7 A;  2AB6 A;  4IW9 A;  4AJ7 A;  2YZH A;  2HT9 A;  4I5Q A;  1T8E B;  3ZIJ A;  1KEB A;  4K2X A;  2I4A A;  4XHM A;  1UC7 A;  5DCH A;  4MJA A;  1FW1 A;  1I9D A;  1FO5 A;  2R4V A;  4Z7X A;  3IK7 A;  1SD8 A;  2H30 A;  3E3E A;  2KOK A;  2X49 A;  2OBI A;  1GH2 A;  1M7T A;  3EYT A;  1U87 A;  2VM1 A;  4AGS A;  1PSQ A;  2C0F A;  2AAW A;  1SJ6 A;  2VKZ G;  2PVO C;  1F3B A;  1Q4J A;  1C72 A;  2YCD A;  4HQZ A;  5IIZ A;  2HSY A;  2IMI A;  4XRD A;  5ECH B;  1SVO A;  3ME7 A;  4AF2 A;  2HZE B;  2PU9 C;  2FHE A;  2LV3 A;  1JHB A;  5F05 A;  4HDE A;  1LU4 A;  1J9B A;  3D22 A;  1XXU A;  2HRN A;  2B7J A;  5CAX A;  1SJZ A;  5BMU A;  2FUG 2;  4ZBA A;  1XWG A;  1WWJ A;  5A4W A;  2JL4 A;  1TTZ A;  1T4Y A;  1BQ7 A;  5D9X A;  1GLP A;  1YF0 A;  4NHZ A;  1XW6 A;  4K0N A;  4KDU A;  1W89 A;  4IHU A;  3EMX A;  1EWX A;  2H6X A;  3HY2 A;  4ICY A;  3A2V A;  3VWX A;  5ID2 A;  1M9B A;  6GSU A;  1TI3 A;  5IMV A;  4F82 A;  4OFT A;  2M80 A;  4F0B A;  2CVD A;  2A2R A;  3KJY A;  2C8U A;  1VF4 A;  5KN0 A;  3BOA A;  3HJO A;  2VOC A;  2Z9S A;  3QFB C;  3H79 A;  5AN1 A;  3IHG A;  1ABA A;  3FW2 A;  5KN3 A;  4PHZ C;  2DIZ A;  3JCM L;  3IE3 A;  1ERV A;  4L5L A;  5DAL A;  2LJK A;  1GRX A;  3UJ1 A;  1T00 A;  4KND A;  5G1L A;  5HR3 A;  1PGT A;  2XPE A;  2L5L A;  1V2A A;  2H70 A;  4PX1 A;  1NSW A;  2VUP A;  4CW9 A;  5DCG A;  2H1D A;  3RDW A;  2H1A A;  3DD3 A;  2PPT A;  3HA9 A;  1YKA A;  1QXH A;  2EIO A;  1S3C A;  4HS1 A;  3HJP A;  4PNG A;  4I2U A;  3GTU A;  5DDL A;  5CRG A;  6GSS A;  1G0T A;  4KE3 A;  2MZC A;  2L4Q A;  2LNT A;  1MDJ A;  1OVN A;  3GYK A;  2CVK A;  5EPF A;  3HZ8 A;  1Z5Y E;  4TR0 A;  4FYB A;  1I1I P;  2P31 A;  4G0I A;  4IJI A;  1RQM A;  4F03 A;  2YWN A;  1R26 A;  1OAZ A;  1NM3 A;  2HXK A;  4GRF A;  4PUF C;  2DML A;  1PN0 A;  2VCV A;  1JFU A;  2YP6 A;  3GKM A;  2RM6 A;  1V57 A;  2R6K A;  5DVB A;  1W4V A;  8GSS A;  3ZIV A;  3F4T A;  3I69 A;  3TRX A;  10GS A;  5FHI A;  1NHO A;  1AQV A;  4H86 A;  2A2S A;  2FNO A;  3GUR A;  4XS6 A;  3EUR A;  3CWG A;  3KMO A;  2OT3 A;  4ZL7 A;  3UVH A;  3CTF A;  1SVL A;  3FZ5 A;  11GS A;  1ZZY A;  3TJJ A;  1OKD A;  1TRU A;  2H19 A;  3ME8 A;  2HZF A;  5GAN D;  1LJR A;  4KDX A;  3F6D A;  4KSO A;  4WF5 A;  1HNB A;  1O8X A;  3W8J A;  2WW1 A;  2O89 A;  2ALB A;  1XWC A;  5FT3 A;  1A8Y A;  4EIQ A;  1M3I A;  3I6A A;  1WPI A;  2YJ7 A;  2VM2 A;  4AKI A;  4TVE A;  4POK A;  1OC9 A;  3PR8 A;  3M9K A;  2M72 A;  3FK8 A;  2YV9 A;  2WZS A;  3P8W A;  3R3E A;  1EEM A;  4LMW A;  2L6C A;  2R5G A;  4JBB A;  5ECI B;  1MD3 A;  1EP7 A;  2HZE A;  3F4S A;  2IME A;  4RI6 A;  4XTS A;  3LYK A;  3M0F A;  2HI7 A;  4TRX A;  2WUL A;  4ZB7 A;  2BMX A;  2E0Q A;  5HR1 A;  1TXX A;  3IHQ A;  1X0R A;  4ZIJ A;  2IPA A;  2HE3 A;  3EE2 A;  4IKH A;  19GS A;  1Y1U A;  1GUL A;  4AKX B;  4EF0 A;  5DQS A;  2HRA A;  4L8E A;  2AV4 A;  4ZL8 A;  2QA1 A;  3HJM A;  1BED A;  1WOU A;  3C1S A;  1K3Y A;  2R0P A;  3H1N A;  3CBU A;  4NXI A;  2GQL A;  2LQQ A;  1Y6E A;  2XC2 A;  4BWQ A;  3G7Y A;  3VK9 A;  4WR5 A;  4XIH A;  1VGL A;  2QA2 A;  4POL A;  3M8N A;  5HFI A;  2CV4 A;  2H8L A;  4MPG A;  3L4N A;  1GP1 A;  1ZYQ B;  2LS5 A;  3M3M A;  2A4H A;  3EIN A;  5GZZ B;  4ZB8 A;  3IXR A;  1S3D A;  4E8E A;  2MBT A;  1V9W A;  2KP2 A;  5JCU A;  4YAV A;  3IRA A;  3KZQ A;  3CXG A;  3GN3 A;  3WGX A;  3A5I A;  1K0D A;  3DYR A;  2DKI A;  2JZS A;  1T4Z A;  2OE1 A;  4I6X A;  3DGQ A;  4ECI A;  4ACS A;  1BYE A;  2MBS A;  4EO3 A;  4KCA A;  3ED3 A;  5IMZ A;  1XG8 A;  2H72 A;  2NDO A;  1U88 A;  5IO0 A;  3VUR A;  2IFQ B;  2E2G A;  2MMO A;  2AJQ B;  5B7C A;  4IQ1 A;  2AYT A;  3I43 A;  2WVZ A;  3KMN A;  1TK5 B;  1TKD B;  1TOF A;  3ZVJ D;  3IV4 A;  3CTG A;  4KB3 A;  2N5F A;  3EWL A;  4ZXG A;  2VCZ A;  1Z6M A;  3GIX A;  2YWO A;  4NV2 A;  5ID2 B;  3CSH A;  1E6B A;  2IMF A;  1UA5 A;  4DVC A;  1A23 A;  2H1B A;  2V1M A;  2E2M A;  4HOJ A;  2N5B A;  1MD4 A;  4IBP A;  2ON5 A;  2R3X A;  1GTB A;  3FHK A;  3GKN A;  5DQY A;  3BJ5 A;  1O6J A;  2X99 A;  4KSM A;  3F3Q A;  2OAD A;  2O8V B;  3UIW A;  2EIR A;  3FR3 A;  3KTL A;  5DAL B;  4BWS A;  1DE2 A;  1XVW A;  4F0C A;  17GS A;  3LFL A;  3NOF A;  2LRC A;  1TRW A;  3A2W A;  1AQW A;  2GSQ A;  2J23 A;  5IM9 A;  4ECC A;  3FZA A;  1A2J A;  2C3N A;  1TU8 A;  3TDG A;  2HSH A;  3VWU A;  1ML6 A;  5A5H B;  5J47 A;  4DSS B;  4MF6 A;  2PUK C;  4G0L A;  4FYU A;  4YQV A;  4RI7 A;  4GTU A;  5KN1 A;  1AW9 A;  2WW0 A;  3MAK A;  1EGO A;  1PL2 A;  5CRH A;  2REM A;  4GDF A;  4KX4 A;  4KA0 A;  3ZFL A;  3HZ4 A;  3MDK A;  2OE0 A;  2PER A;  3TRQ A;  3M1G A;  3QPM A;  1TRS A;  18GS A;  4MPF A;  2FWE A;  1KTE A;  4QL9 A;  2IIY A;  2C3T A;  3L9S A;  2DJ2 A;  2H0H A;  2GSR A;  4WF4 A;  3ERW A;  4MNN A;  3NIV A;  2R0G A;  3TRP A;  4EDZ A;  2XBI A;  1XW9 A;  1THX A;  3J7Y k;  4KF9 A;  1O73 A;  1BJX A;  1XPV A;  3IDV A;  1X9M B;  3GL5 A;  4PGT A;  1GSQ A;  4D73 B;  1USB A;  1PL1 A;  1SL2 B;  3VPQ A;  3ZYW A;  2H76 A;  4G0K A;  3CYN A;  3TCO A;  2VL9 A;  4WBJ A;  1X9W B;  2DJK A;  3HXS A;  1YQ1 A;  3GX0 A;  3BCK A;  4RQR A;  3PGT A;  2MYG A;  4Q5Q A;  3VI5 A;  2EFE A;  5KEJ A;  3O76 A;  5G2Z A;  4G19 A;  2LNS A;  2FWF A;  1ZMA A;  1TRV A;  4P3Y B;  5DBQ A;  3C71 A;  1Z3E A;  4LL4 B;  1A2L A;  2H75 A;  1H75 A;  4K5S A;  3K8N A;  1OC9 B;  2X8C A;  5EL8 A;  3RHC A;  3ZRD A;  4OFN A;  3D5J A;  5CP1 A;  4CHS A;  2PN8 A;  2WDU A;  4ZL9 A;  2I9H A;  4A5P A;  1TXU A;  1X5E A;  2NBS A;  2IFQ A;  4K5R A;  4V2N A;  2RLI A;  3CSJ A;  2YAN A;  3F63 A;  4HUA A;  4AI6 A;  3WT2 A;  2F8F A;  16GS A;  3UL3 A;  2CX4 A;  3GH6 A;  3QDN A;  3GKX A;  3GUS A;  1WMJ A;  1F2E A;  4ZIL A;  4PTS A;  2VL2 C;  1UVZ A;  3QMX A;  5COH A;  3V1W A;  1XWA A;  3I9V 2;  3P7X A;  4GQC A;  1T3B A;  3Q18 A;  3FRC A;  2GT5 A;  4MA9 A;  2PMT A;  2VIM A;  5DJL A;  5IQY A;  1TK0 B;  5J4Y A;  1K3O A;  5INY A;  4EVM A;  2FWG A;  3MYD A;  2PBJ A;  1X5C A;  3F4R A;  2IMK A;  4J56 E;  4HZ4 A;  4EE0 A;  5ECR B;  3DIE A;  4Q5R A;  4GWR A;  1PX7 A;  2VLT A;  2CZ3 A;  2N5A A;  1XBS A;  4EIP A;  1Y25 A;  2L4C A;  4LMV A;  3N9J A;  1B4Q A;  4J2F A;  2LUS A;  2O85 A;  2DBC A;  3RAZ A;  1TJD A;  2I1U A; 
#chains in the Genus database with same CATH homology
 2GSS A;  5ENU A;  2C0D A;  1SJI A;  3LXZ A;  3BCI A;  3H8Q A;  2VCX A;  1AIU A;  4GSS A;  5A5H A;  3FZ4 A;  4DSS A;  1VF2 A;  2OJL A;  1A0F A;  5CNW A;  4PXO A;  1TW9 A;  4ZB6 A;  3RBT A;  1E2Y A;  2O87 A;  4OMV A;  5BRT A;  2NTO A;  3APQ A;  4OO5 A;  3C73 A;  1AC1 A;  1K0O A;  2F3M A;  1TI1 A;  4IS0 A;  3IR4 A;  1A2M A;  1ERW A;  5C04 A;  3Q74 A;  2G0F A;  4KDY A;  3PH9 A;  4IJ3 A;  5AIV A;  1ILO A;  3VFI A;  3WGE A;  2H1G A;  4OCF A;  3LOR A;  4MAB A;  3KH7 A;  4FQU A;  1K0C A;  3LW9 A;  5IMF A;  2H1L A;  2YN1 A;  2DJJ A;  2GZP A;  3KEB A;  3A3T A;  5KOW A;  1FAA A;  3O3T A;  3ERF A;  5GST A;  3GH9 A;  3KH9 A;  4IQA A;  2DMM A;  2WCI A;  1YDK A;  1PQN A;  3HKR A;  4D73 A;  4MF7 A;  1A8L A;  4ILF A;  1MTC A;  2DJ3 A;  1EOG A;  5F07 A;  3GMF A;  3KGK A;  1SKS B;  3KD0 A;  2H6Y A;  4MJB A;  1GTI A;  4WKW A;  4K6X A;  1Z6N A;  5IPG A;  4OCE A;  3ERG A;  2YOI A;  1O8W A;  1QGV A;  5HFK A;  1RK4 A;  5HR0 A;  1M99 A;  3L78 A;  3ZLP A;  3TOT A;  3KXO A;  4N3Z A;  3CRT A;  4MP4 A;  2HRK B;  5FWG A;  2LTK A;  2OAC A;  1B9X C;  1EEJ A;  2FCH A;  2DC5 A;  2MMA A;  3GL3 A;  2GDR A;  3SBC A;  1JZW A;  4O5R A;  5G5F A;  1GSU A;  1M9A A;  1V98 A;  2C3Q A;  5ECP B;  1SK0 A;  5D96 A;  1FHE A;  4QQ7 A;  5LCZ A;  3M9J A;  3HHV A;  4BVY B;  4NHW A;  2MMZ A;  1EGR A;  4ZB9 A;  3GST A;  3HVX A;  4IVF A;  2HQT A;  1BG1 A;  3WYW A;  1QQ2 A;  3RPP A;  3EMP A;  1ZYN A;  4O5Q A;  3DKS A;  2G2Q A;  2WZ9 A;  3TKS A;  1TP9 A;  2OKA A;  4L0W A;  4AKH A;  2H01 A;  4WEY A;  1SYX A;  3BD2 A;  3D0Z A;  2GQM A;  4N10 A;  3TKS C;  2OBK A;  1FVJ A;  3D6I A;  4V1A p;  1OE7 A;  5CYY A;  4PQI A;  1ON4 A;  4IP6 A;  2WRT A;  3LGC A;  5E4W A;  4V1A g;  2CVB A;  1DUG A;  2WGR A;  3TKR A;  4NV5 A;  1M0U A;  1XIY A;  3GRX A;  4MZB A;  4EUY A;  3CMI A;  3TJG A;  1A0R P;  3LYP A;  4IEL A;  4PNF A;  1XCC A;  5DAK B;  5ECM B;  3DEX A;  5GAP D;  1S3A A;  4HEA 2;  3NZN A;  1QMV A;  5D73 A;  1A24 A;  2HYX A;  3D21 A;  2C0E A;  3TKS E;  3C7M A;  2LKU A;  1DE1 A;  1GTU A;  1U3A A;  1SL1 B;  3GV1 A;  3IAS 2;  1SKR B;  4MJC A;  3EU3 A;  2EIQ A;  1QFN A;  2C0G A;  2F9S A;  1XOB A;  1PKZ A;  1HYU A;  4YQM A;  2GST A;  3H93 A;  4K8M A;  2LRT A;  2E7P A;  4LLR A;  1FOV A;  4MCU A;  2C80 A;  2GVP A;  1SVM A;  2KHP A;  3FEU A;  5HQP A;  1GUH A;  3QAG A;  3L9U A;  5D9V A;  2H74 A;  5ECS A;  3KIJ A;  4HQS A;  2CT6 A;  4G10 A;  4ML6 A;  3GA4 A;  1XOA A;  1U6T A;  4FH8 A;  3IOS A;  4NPB A;  5B6N A;  1AQX A;  12GS A;  2H0G A;  2ZCT A;  4ZBD A;  1YKC A;  2X8H A;  1SKW B;  5B8A A;  1NW2 A;  4QMK A;  1RW1 A;  4MH2 A;  4TKY A;  4HJM A;  5C00 A;  3F0I A;  1X9S B;  2O5V A;  4MK3 A;  3UAR A;  2DJ1 A;  2VCW A;  5A4U A;  5IMA A;  1WP0 A;  2B1K A;  2JZR A;  5D9W A;  2JSZ A;  4MLY A;  3L9V A;  3LEF A;  3ZVJ A;  22GS A;  3GX8 A;  1BX9 A;  3E0U A;  3P2A A;  2GS3 A;  2K8S A;  2YPM A;  2FLS A;  1R7H A;  2OE3 A;  2WS2 A;  1EP8 A;  2B5E A;  2CQ9 A;  4PUR A;  2VCT A;  2HRK A;  1N25 A;  4ZBB A;  2YNX A;  3VLN A;  3APS A;  3ZL5 A;  2IJY A;  2K6V A;  3OR5 A;  1JZO A;  5J3R A;  3KM6 A;  4MDC A;  2F51 A;  5ECL B;  1B48 A;  7GSS A;  2UZ8 A;  4Z2U A;  2YWI A;  3GFK A;  5A34 B;  1KNG A;  2V2G A;  1XZO A;  2XHF A;  1NHY A;  4EKZ A;  9GSS A;  2DLX A;  2OA7 A;  4BVY A;  1R5P A;  3MNG A;  3DWV A;  2XBQ A;  4I2T A;  1QK8 A;  5F06 A;  4ECJ A;  2H6Z A;  4PQ1 A;  4I97 A;  5B6M A;  3O6T A;  4DSQ A;  3QAW A;  4ML1 A;  2HSM B;  1MDI A;  4ULX A;  3DXB A;  3TKP A;  1Q98 A;  3IA1 A;  1PA3 A;  2YV7 A;  1PRX A;  2RUE A;  4USS A;  2DSA A;  1GNW A;  4KUN A;  3C8E A;  5JWQ B;  4V2L A;  2KP1 A;  2KUC A;  4OD7 A;  1JLV A;  4TR4 A;  4E68 A;  5ECQ B;  5LNK e;  1B9Y C;  3GKK A;  5IPH A;  6GST A;  3HYP A;  2P0G A;  1GSD A;  2FY6 A;  2C4J A;  4JR6 A;  1F37 A;  2YJH A;  3L0H A;  2YWM A;  5HFG A;  1H4O A;  2NVL A;  2B5Y A;  2LQO A;  4BVX B;  2VLU A;  1EV9 A;  4JRR A;  1V58 A;  4LL1 B;  1SYR A;  3VWW A;  4GCI A;  2X64 A;  4JU5 A;  2RII A;  2PVQ A;  5HR2 A;  4KH7 A;  5DAK A;  1WJK A;  3G7I A;  2NPB A;  5F8B A;  4EC0 A;  5A1N B;  5G30 A;  3EPT A;  2AUV A;  1F6M C;  3LWA A;  20GS A;  4MJE A;  3KP8 A;  2YZU A;  5H5R A;  5AIS A;  5EY6 A;  3HDC A;  2VO4 A;  4BL7 B;  2L5O A;  1YVL A;  4TXO B;  3CRU A;  3UBL A;  3ZIT A;  4ECB A;  1ZOF A;  2MMN A;  1MDK A;  3F8U A;  1SK2 A;  3F3R A;  1FVK A;  3LG6 A;  3TGZ A;  1TU7 A;  1Z7R A;  5JWR B;  2H66 A;  1OKT A;  2FA8 A;  5G31 A;  2LEG A;  6GSX A;  5JCW A;  2VL2 A;  1M2D A;  3WT1 A;  2H73 A;  2DIY A;  2H0I A;  1EV4 A;  3LJR A;  4X1U A;  3VPT A;  2EC4 A;  3ZTL A;  4ISD A;  2V6K A;  3FMW A;  4PUA A;  3G7J A;  3IAM 2;  1R4W A;  3R2Q A;  1XWB A;  2TRX A;  4JE1 A;  4EDY A;  2M46 A;  3C1R A;  1N8J A;  4K7N A;  4O92 A;  3DRN A;  5EVO A;  1DSB A;  6GSV A;  3UMA A;  4N0V A;  2CA8 A;  4POM A;  1HNA A;  3HD5 A;  4TR1 B;  1G6W A;  3IC8 A;  4OFM A;  3ZMK A;  4K7I A;  3VI7 A;  3TOU A;  2IMD A;  3DML A;  1TDI A;  2RM5 A;  1BG5 A;  3Q6O A;  4JR4 A;  1ZYP A;  1GLQ A;  4W66 A;  1F3A A;  5CRW A;  1GUK A;  1OYJ A;  2HSN A;  5F0G A;  1UN2 A;  1YEP A;  1JZD A;  3EVI A;  1WRY A;  4AJ8 A;  2TIR A;  5J4U A;  2V32 A;  2CAQ A;  1PKW A;  2EFC A;  4HJ2 A;  3FY7 A;  1SU9 A;  4TW5 A;  5AGY A;  5J9C A;  5CRD A;  2B1L A;  2XPD A;  2GLR A;  3CSI A;  1SD9 A;  1WE0 A;  2X4A A;  3KTB A;  4LA1 A;  4X4J A;  3BBY A;  4POB A;  3FZ9 A;  1AXD A;  3RPN A;  3G9B A;  2LST A;  3ZZX A;  4KCE A;  2FA4 A;  4JED A;  4PQH A;  3N5O A;  1ZYE A;  5A34 A;  3UEM A;  3Q19 A;  2K18 A;  3TB2 A;  4NAX A;  3IK9 A;  2GZY A;  2I3Y A;  3QOU A;  2F8A A;  4ID0 A;  1ZL9 A;  1M2A A;  2L57 A;  5LD0 A;  2R37 A;  1CQG A;  1IYH A;  5ABR A;  3UOM A;  1SL0 B;  4DEJ A;  1FB0 A;  3HMJ G;  3FKF A;  3GHA A;  2HSM A;  1LBK A;  4WET A;  1T1V A;  2L59 A;  3ZRE A;  1FG4 A;  4EXJ A;  1PMT A;  2B6M A;  1AAZ A;  1JZR A;  3KCM A;  1FB6 A;  3QFA C;  4GST A;  3SWL A;  3U5R E;  3LSZ A;  3EC3 A;  3KP9 A;  4XS4 A;  3IC4 A;  4MMM A;  1GSF A;  5ECK B;  4CY6 A;  4KW6 A;  5D8I A;  3WGD A;  1THO A;  2VCQ A;  4Q5F A;  3RHB A;  2VL3 A;  2K8V A;  3J7Y b;  6GSY A;  4BPY A;  2A2P A;  3TJB A;  4BVX A;  3H4K A;  1IYI A;  4FO5 A;  1YEX A;  3E9J B;  4HZ2 A;  4HU7 A;  1GL8 A;  1K3L A;  13GS A;  1MEK A;  2O7K A;  14GS A;  3QD9 A;  5A1N A;  4G9H A;  1ACV A;  1Z9H A;  1BAY A;  4QL7 A;  1XWK A;  3QR6 A;  2HRF A;  1HQO A;  5ECN B;  1Z7P A;  2FGX A;  2VD1 A;  3MSZ A;  5JCG A;  4YKF A;  5CRE A;  5AIX A;  3DVW A;  3F6F A;  4BL7 A;  2RUF A;  1YY7 A;  1BF5 A;  4TXO A;  4O5U A;  2ES7 A;  1GSS A;  3IBH A;  5IOW A;  5GSS A;  2WB9 A;  1WIK A;  2FD3 A;  4NMU A;  1YJ6 A;  3F9U A;  3FYG A;  4G01 A;  2TRC P;  1J0F A;  3U6V A;  1K0A A;  2CX3 A;  2R2J A;  2K9F A;  4CY8 A;  2I81 A;  1TK8 B;  2P5Q A;  2ZUP A;  3ZFB A;  2QKE A;  1SEN A;  4G2E A;  2LJR A;  3AY8 A;  2C1Y A;  3LXT A;  1I5G A;  5G5E A;  1G6Y A;  5H5S A;  1U3I A;  3UBK A;  2DKH A;  4OWY A;  4F2I A;  2HNL A;  5KOX A;  3EU4 A;  4N11 A;  1M2B A;  4TR1 A;  1EZK A;  1ZCP A;  4WBR D;  3HVV A;  4MZW A;  5H5Q A;  1YF1 A;  1ST9 A;  1ERU A;  4L5O A;  2LRN A;  4NWY A;  4JZQ A;  4O7H A;  4XRA A;  4F9Z A;  2J9H A;  1N2A A;  4X0X A;  1ERT A;  1OC3 A;  5IO2 A;  1DBY A;  5ELA A;  5JWO B;  5CO3 A;  2EFH A;  2B7K A;  4Z2T A;  2FWH A;  1ZGN A;  2JAD A;  2ZNM A;  4IP1 A;  3IPZ A;  4WR4 A;  1T7P B;  4AKG A;  2HFD A;  3GSS A;  4KAE A;  3TKQ A;  3A2X A;  1HD2 A;  1AUC A;  1PD2 1;  3P90 A;  2QSI A;  3W6G A;  4E8H A;  1G7E A;  2AHE A;  4KGI A;  5D9T A;  4K1F A;  2WJU A;  1G7O A;  1O85 A;  2L6D A;  4MH3 A;  4YKG A;  1F9M A;  4AJ6 A;  4YAP A;  4XCS A;  2HLS A;  2PWJ A;  3HCZ A;  2P5R A;  4IN0 A;  4TR3 A;  1B4P A;  3ISO A;  3GNJ A;  4TN8 A;  4TXV A;  2IL3 A;  3FR6 A;  2BJX A;  4K2D A;  3TJK A;  1K0N A;  6GSW A;  3TJF A;  2EFD A;  3MWH A;  3WD6 A;  4CDO A;  5J5N A;  4GSN A;  4MZC A;  4YH2 A;  1R5A A;  2A4V A;  4GF0 A;  2JU5 A;  5BMU B;  2QC7 A;  5KN2 A;  1VF1 A;  1GSY A;  1O7U A;  3TU3 B;  5A5K A;  2D2Z A;  3TUE A;  1J08 A;  1GWC A;  1VF3 A;  1EOH A;  5DJM A;  1CQH A;  4FIW A;  3UVT A;  2CZ2 A;  5D93 A;  4WXT A;  5ELG A;  3PPU A;  5J9B A;  4J57 E;  2HSN B;  1K0B A;  4K7O A;  3QAV A;  3D4M A;  5J40 A;  2LJA A;  2V6O A;  2JZT A;  1OC8 A;  2IWT A;  4N30 A;  2JSY A;  5ECO B;  1QUW A;  2B3S A;  2V41 A;  2B5X A;  4XS1 A;  2GGT A;  3QCP A;  5A4V A;  3S9F A;  4K0G A;  2QGV A;  2KLX A;  4YQU A;  1XW5 A;  1GNE A;  4FYC A;  5J41 A;  2IN3 A;  1PX6 A;  2ON7 A;  2GTU A;  2CAI A;  2JAC A;  3APO A;  1K0M A;  4BA7 A;  1X5D A;  4X43 A;  4RUV A;  3VWV A;  3GTU B;  4HU9 A;  1GTA A;  5IOX A;  4V2M A;  4EL1 A;  5B8B A;  1YZX A;  1KBN A;  1XFL A;  1HNC A;  3DVX A;  1XVQ A;  4TOP A;  4GLT A;  2GQK A;  1SK1 A;  3MIX A;  3HVS A;  2PGT A;  2R0C A;  2DJ0 A;  5E59 A;  2X8G A;  4Q5N A;  2H71 A;  5G1K A;  1OE8 A;  1B8X A;  2VLV A;  4IGJ A;  2VAF A;  5IMC A;  2WFC A;  1PN9 A;  4RQX A;  1GUM A;  4HI7 A;  1GSE A;  5IMD A;  4XS4 B;  1O81 A;  2GT6 A;  2GZZ A;  3ZML A;  2BTO T;  3PIN A;  1V40 A;  4O32 A;  2VD0 A;  5L71 A;  3D4T A;  1URM A;  1JLW A;  4MF5 A;  1FOH A;  5J4V A;  4Z2R A;  4OO4 A;  4L0U A;  4K9Z A;  4GXZ A;  3A5W A;  3UAP A;  4I8B A;  4GQF A;  4DSR A;  3W8S A;  2UV8 G;  3FR9 A;  4N0Z A;  3US3 A;  1VRS D;  3LQ7 A;  2AB6 A;  4IW9 A;  4AJ7 A;  2YZH A;  2HT9 A;  4I5Q A;  1T8E B;  3ZIJ A;  1KEB A;  4K2X A;  2I4A A;  4XHM A;  1UC7 A;  5DCH A;  4MJA A;  1FW1 A;  1I9D A;  1FO5 A;  2R4V A;  4Z7X A;  3IK7 A;  1SD8 A;  2H30 A;  3E3E A;  2KOK A;  2X49 A;  2OBI A;  1GH2 A;  1M7T A;  3EYT A;  1U87 A;  2VM1 A;  4AGS A;  1PSQ A;  2C0F A;  2AAW A;  1SJ6 A;  2VKZ G;  2PVO C;  1F3B A;  1Q4J A;  1C72 A;  2YCD A;  4HQZ A;  5IIZ A;  2HSY A;  2IMI A;  4XRD A;  5ECH B;  1SVO A;  3ME7 A;  4AF2 A;  2HZE B;  2PU9 C;  2FHE A;  2LV3 A;  1JHB A;  5F05 A;  4HDE A;  1LU4 A;  1J9B A;  3D22 A;  1XXU A;  2HRN A;  2B7J A;  5CAX A;  1SJZ A;  5BMU A;  2FUG 2;  4ZBA A;  1XWG A;  1WWJ A;  5A4W A;  2JL4 A;  1TTZ A;  1T4Y A;  1BQ7 A;  5D9X A;  1GLP A;  1YF0 A;  4NHZ A;  1XW6 A;  4K0N A;  4KDU A;  1W89 A;  4IHU A;  3EMX A;  1EWX A;  2H6X A;  3HY2 A;  4ICY A;  3A2V A;  3VWX A;  5ID2 A;  1M9B A;  6GSU A;  1TI3 A;  5IMV A;  4F82 A;  4OFT A;  2M80 A;  4F0B A;  2CVD A;  2A2R A;  3KJY A;  2C8U A;  1VF4 A;  5KN0 A;  3BOA A;  3HJO A;  2VOC A;  2Z9S A;  3QFB C;  3H79 A;  5AN1 A;  3IHG A;  1ABA A;  3FW2 A;  5KN3 A;  2DIZ A;  3JCM L;  3IE3 A;  1ERV A;  4L5L A;  5DAL A;  2LJK A;  1GRX A;  3UJ1 A;  1T00 A;  4KND A;  5G1L A;  5HR3 A;  1PGT A;  2XPE A;  2L5L A;  1V2A A;  2H70 A;  4PX1 A;  1NSW A;  2VUP A;  4CW9 A;  5DCG A;  2H1D A;  3RDW A;  2H1A A;  3DD3 A;  2PPT A;  3HA9 A;  1YKA A;  1QXH A;  2EIO A;  1S3C A;  4HS1 A;  3HJP A;  4PNG A;  4I2U A;  3GTU A;  5DDL A;  5CRG A;  6GSS A;  1G0T A;  4KE3 A;  2MZC A;  2L4Q A;  2LNT A;  1MDJ A;  1OVN A;  3GYK A;  2CVK A;  5EPF A;  3HZ8 A;  1Z5Y E;  4TR0 A;  4FYB A;  2P31 A;  4G0I A;  4IJI A;  1RQM A;  4F03 A;  2YWN A;  1R26 A;  1OAZ A;  1NM3 A;  2HXK A;  4GRF A;  4PUF C;  2DML A;  1PN0 A;  2VCV A;  1JFU A;  2YP6 A;  3GKM A;  2RM6 A;  1V57 A;  2R6K A;  5DVB A;  1W4V A;  8GSS A;  3ZIV A;  3F4T A;  3I69 A;  3TRX A;  10GS A;  5FHI A;  1NHO A;  1AQV A;  4H86 A;  2A2S A;  2FNO A;  3GUR A;  4XS6 A;  3EUR A;  3CWG A;  3KMO A;  2OT3 A;  4ZL7 A;  3UVH A;  3CTF A;  1SVL A;  3FZ5 A;  11GS A;  1ZZY A;  3TJJ A;  1OKD A;  1TRU A;  2H19 A;  3ME8 A;  2HZF A;  5GAN D;  1LJR A;  4KDX A;  3F6D A;  4KSO A;  4WF5 A;  1HNB A;  1O8X A;  3W8J A;  2O89 A;  2ALB A;  1XWC A;  5FT3 A;  1A8Y A;  4EIQ A;  3I6A A;  1WPI A;  2YJ7 A;  2VM2 A;  4AKI A;  4TVE A;  4POK A;  1OC9 A;  3PR8 A;  3M9K A;  2M72 A;  3FK8 A;  2YV9 A;  3P8W A;  3R3E A;  1EEM A;  4LMW A;  2L6C A;  2R5G A;  4JBB A;  5ECI B;  1MD3 A;  1EP7 A;  2HZE A;  3F4S A;  2IME A;  4RI6 A;  4XTS A;  3LYK A;  3M0F A;  2HI7 A;  4TRX A;  2WUL A;  4ZB7 A;  2BMX A;  2E0Q A;  5HR1 A;  1TXX A;  3IHQ A;  1X0R A;  4ZIJ A;  2IPA A;  2HE3 A;  3EE2 A;  4IKH A;  19GS A;  1Y1U A;  1GUL A;  4AKX B;  4EF0 A;  5DQS A;  2HRA A;  4L8E A;  2AV4 A;  4ZL8 A;  2QA1 A;  3HJM A;  1BED A;  1WOU A;  3C1S A;  1K3Y A;  2R0P A;  3H1N A;  3CBU A;  4NXI A;  2GQL A;  2LQQ A;  1Y6E A;  2XC2 A;  4BWQ A;  3G7Y A;  3VK9 A;  4WR5 A;  4XIH A;  1VGL A;  2QA2 A;  4POL A;  3M8N A;  5HFI A;  2CV4 A;  2H8L A;  4MPG A;  3L4N A;  1GP1 A;  1ZYQ B;  2LS5 A;  3M3M A;  2A4H A;  3EIN A;  5GZZ B;  4ZB8 A;  3IXR A;  1S3D A;  4E8E A;  2MBT A;  1V9W A;  2KP2 A;  5JCU A;  4YAV A;  3IRA A;  3KZQ A;  3CXG A;  3GN3 A;  3WGX A;  3A5I A;  1K0D A;  3DYR A;  2DKI A;  2JZS A;  1T4Z A;  2OE1 A;  4I6X A;  3DGQ A;  4ECI A;  4ACS A;  1BYE A;  2MBS A;  4EO3 A;  4KCA A;  3ED3 A;  5IMZ A;  2H72 A;  2NDO A;  1U88 A;  5IO0 A;  3VUR A;  2IFQ B;  2E2G A;  2MMO A;  2AJQ B;  5B7C A;  4IQ1 A;  2AYT A;  3I43 A;  3KMN A;  1TK5 B;  1TKD B;  1TOF A;  3ZVJ D;  3IV4 A;  3CTG A;  4KB3 A;  2N5F A;  3EWL A;  4ZXG A;  2VCZ A;  1Z6M A;  3GIX A;  2YWO A;  4NV2 A;  5ID2 B;  3CSH A;  1E6B A;  2IMF A;  1UA5 A;  4DVC A;  1A23 A;  2H1B A;  2V1M A;  2E2M A;  4HOJ A;  2N5B A;  1MD4 A;  4IBP A;  2ON5 A;  2R3X A;  1GTB A;  3FHK A;  3GKN A;  5DQY A;  3BJ5 A;  1O6J A;  2X99 A;  4KSM A;  3F3Q A;  2OAD A;  2O8V B;  3UIW A;  2EIR A;  3FR3 A;  3KTL A;  5DAL B;  4BWS A;  1DE2 A;  1XVW A;  4F0C A;  17GS A;  3LFL A;  3NOF A;  2LRC A;  1TRW A;  3A2W A;  1AQW A;  2GSQ A;  2J23 A;  5IM9 A;  4ECC A;  3FZA A;  1A2J A;  2C3N A;  1TU8 A;  3TDG A;  2HSH A;  3VWU A;  1ML6 A;  5A5H B;  5J47 A;  4DSS B;  4MF6 A;  2PUK C;  4G0L A;  4FYU A;  4YQV A;  4RI7 A;  4GTU A;  5KN1 A;  1AW9 A;  3MAK A;  1EGO A;  1PL2 A;  5CRH A;  2REM A;  4GDF A;  4KX4 A;  4KA0 A;  3ZFL A;  3HZ4 A;  3MDK A;  2OE0 A;  2PER A;  3TRQ A;  3M1G A;  3QPM A;  1TRS A;  18GS A;  4MPF A;  2FWE A;  1KTE A;  4QL9 A;  2IIY A;  2C3T A;  3L9S A;  2DJ2 A;  2H0H A;  2GSR A;  4WF4 A;  3ERW A;  4MNN A;  3NIV A;  2R0G A;  3TRP A;  4EDZ A;  2XBI A;  1XW9 A;  1THX A;  3J7Y k;  4KF9 A;  1O73 A;  1BJX A;  1XPV A;  3IDV A;  1X9M B;  3GL5 A;  4PGT A;  1GSQ A;  4D73 B;  1USB A;  1PL1 A;  1SL2 B;  3VPQ A;  3ZYW A;  2H76 A;  4G0K A;  3CYN A;  3TCO A;  2VL9 A;  4WBJ A;  1X9W B;  2DJK A;  3HXS A;  1YQ1 A;  3GX0 A;  3BCK A;  4RQR A;  3PGT A;  2MYG A;  4Q5Q A;  3VI5 A;  2EFE A;  5KEJ A;  3O76 A;  5G2Z A;  4G19 A;  2LNS A;  2FWF A;  1ZMA A;  1TRV A;  4P3Y B;  5DBQ A;  3C71 A;  1Z3E A;  4LL4 B;  1A2L A;  2H75 A;  1H75 A;  4K5S A;  3K8N A;  1OC9 B;  2X8C A;  5EL8 A;  3RHC A;  3ZRD A;  4OFN A;  3D5J A;  5CP1 A;  4CHS A;  2PN8 A;  2WDU A;  4ZL9 A;  2I9H A;  4A5P A;  1TXU A;  1X5E A;  2NBS A;  2IFQ A;  4K5R A;  4V2N A;  2RLI A;  3CSJ A;  2YAN A;  3F63 A;  4HUA A;  4AI6 A;  3WT2 A;  2F8F A;  16GS A;  3UL3 A;  2CX4 A;  3GH6 A;  3QDN A;  3GKX A;  3GUS A;  1WMJ A;  1F2E A;  4ZIL A;  4PTS A;  2VL2 C;  1UVZ A;  3QMX A;  5COH A;  3V1W A;  1XWA A;  3I9V 2;  3P7X A;  4GQC A;  1T3B A;  3Q18 A;  3FRC A;  2GT5 A;  4MA9 A;  2PMT A;  2VIM A;  5DJL A;  5IQY A;  1TK0 B;  5J4Y A;  1K3O A;  5INY A;  4EVM A;  2FWG A;  3MYD A;  2PBJ A;  1X5C A;  3F4R A;  2IMK A;  4J56 E;  4HZ4 A;  4EE0 A;  5ECR B;  3DIE A;  4Q5R A;  4GWR A;  1PX7 A;  2VLT A;  2CZ3 A;  2N5A A;  1XBS A;  4EIP A;  1Y25 A;  2L4C A;  4LMV A;  3N9J A;  1B4Q A;  4J2F A;  2O85 A;  2LUS A;  2DBC A;  3RAZ A;  1TJD A;  2I1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...