4MPGA

Crystal structure of human glutathione transferase theta-2, complex with glutathione and unknown ligand, target efi-507257
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
243
structure length
242
Chain Sequence
GLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase theta-2
publication title Crystal Structure of Human Glutathione S-Transferase Theta-2 (Target EFI-507257)
rcsb
source organism Homo sapiens
total genus 93
structure length 242
sequence length 243
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4mpgA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mpgA01
22GSA 3WD6A 4ZL9A 4FYBA 1J0FA 1KNGA 1GTUA 11GSA 2DSAA 2AV4A 2YNXA 1TW9A 5ECOB 3ZVJA 2HQTA 1QQ2A 3CSJA 2H1DA 2CVDA 1G6WA 2X64A 1RQMA 4EE0A 1MDIA 2JADA 3MNGA 4Z7XA 3I6AA 4PX1A 2EIRA 1ML6A 4N0ZA 3ZTLA 4J57E 5IMCA 1GLQA 4X1UA 3KXOA 4GLTA 3F0IA 4TR3A 3E0UA 3NIVA 4EDZA 3HVVA 2VCXA 3VPTA 1MTCA 2KP1A 5EY6A 3EINA 4K8MA 1DE2A 4POMA 1TTZA 1TXXA 2L6DA 1NM3A 1GLPA 2MZCA 3TCOA 4ZIJA 4JR4A 5F07A 3EMPA 3QCPA 5F05A 2GTUA 4OCFA 3HD5A 3F3RA 4NWYA 1QFNA 2MBSA 4J56E 2IMDA 2E0QA 3ZZXA 2DJKA 5A5KA 4XTSA 2X8CA 1N8JA 4DSRA 1TI1A 2H1AA 3WGXA 1ERWA 4BVYB 3J7Yk 2WRTA 3IC8A 5AIXA 3QAGA 5KN0A 4GQCA 3TKPA 5ELGA 2MMOA 1GSFA 4ZB8A 3LWAA 1H4OA 5EVOA 5A4VA 1HYUA 5B6MA 2PVOC 2O89A 3UEMA 3HYPA 4MZWA 1LU4A 2KHPA 3VPQA 1Z3EA 1F37A 5J9CA 4AGSA 3KZQA 3ZRDA 1ABAA 1YQ1A 1RK4A 1GNEA 4K2DA 3TKSA 2OE1A 2F3MA 3PGTA 4XS4A 5AGYA 4YQUA 1WE0A 1B4QA 4IQAA 19GSA 3DYRA 4MDCA 2VD0A 3TRQA 1A8YA 3CYNA 3NZNA 2HSMB 1UC7A 1GSUA 3LXTA 1EP8A 2C0DA 1PMTA 5G1LA 5GAPD 4KUNA 3QAVA 1O85A 4HI7A 4OO4A 1V58A 3RHBA 3HXSA 3CTFA 3GA4A 1U87A 1GUHA 3TOUA 4ECCA 1NHYA 1E6BA 2PUKC 1K0MA 5G1KA 1OC3A 4G0KA 4MABA 1GL8A 3RPNA 3GYKA 5H5RA 3M9KA 1NW2A 2FLSA 5G5FA 4KSMA 2FGXA 1HNBA 5A4WA 2ZNMA 1K0CA 1XFLA 4OFMA 5DCGA 1VRSD 2MBTA 4BL7A 3QDNA 5J3RA 1AC1A 4I5QA 5CNWA 5DALB 4N30A 4GXZA 3F6DA 2MMAA 1GSSA 5D73A 4JU5A 3GRXA 2H66A 2NPBA 4X0XA 1TOFA 5CRWA 1QUWA 1XBSA 2WZ9A 2DJ3A 3FRCA 3R2QA 5IMZA 2CV4A 4O92A 1XXUA 2DLXA 3C1SA 3H4KA 4ACSA 4L0UA 5C00A 5JWOB 1QMVA 3FYGA 2HSYA 1F3BA 4JZQA 5ECPB 13GSA 3LQ7A 3F4RA 4KE3A 2HSHA 2DJJA 2EIQA 4KAEA 4TR1A 1JZDA 3UAPA 1O8WA 2VCWA 4KX4A 2CAIA 3ZMKA 3DXBA 1R26A 3GIXA 1X5EA 1GTAA 3QPMA 2LJRA 2HNLA 1OKDA 2HZFA 3APSA 2HRKA 3VK9A 2RLIA 3QD9A 3JCML 3ZITA 4GF0A 4YAVA 1JZWA 3C73A 5HR2A 3ZREA 1TRVA 1SJZA 3DKSA 5COHA 1QGVA 2RM5A 3LJRA 3RHCA 1W89A 2VLVA 4F03A 2LNTA 2AHEA 4BVYA 2WDUA 3GURA 3GUSA 4JR6A 4QL7A 3F6FA 1ZZYA 5DJMA 4L0WA 3C8EA 1FG4A 2YANA 3V1WA 1TJDA 2QC7A 1DE1A 3F3QA 3TB2A 5LCZA 3EU3A 5DAKB 1EZKA 1U88A 3C1RA 2RUFA 5LD0A 3Q74A 2H70A 2LQOA 1T4ZA 4ISDA 1GH2A 2HSNB 3DEXA 3BJ5A 5AISA 1DUGA 2P5QA 1Z6NA 2B1LA 2K8SA 1FHEA 4G9HA 1MDKA 3Q19A 4XS6A 1PKZA 4POKA 4IQ1A 1PX6A 2L59A 2FWHA 2LSTA 2PU9C 3LYKA 2IMKA 2CZ2A 4MK3A 3ZYWA 1AXDA 4ZL8A 3QMXA 1GWCA 4ML6A 4XRAA 5JCUA 3OR5A 1PQNA 1V9WA 1OE7A 4MJAA 5B7CA 2JACA 3KP9A 3DIEA 2YZUA 3IC4A 1Y6EA 4H86A 4EL1A 2OBKA 4XIHA 2TRCP 2AJQB 4LMWA 3IXRA 4BWQA 1ZCPA 1VF3A 2P0GA 2C0EA 2C3QA 1X9WB 5JCGA 4WKWA 5DALA 1DSBA 1FB0A 2VM2A 1OC9B 2H71A 3LYPA 2H01A 4TVEA 5ECSA 2YV7A 2DMLA 4LL4B 2VCTA 1TRWA 2L4QA 5HFGA 2NVLA 2I1UA 2RM6A 1URMA 1J9BA 2H0IA 1X9MB 2E7PA 4MF7A 4ECBA 4DEJA 5ECIB 6GSVA 6GSUA 4F0CA 2LRNA 2LUSA 4PNFA 4JBBA 2NBSA 3E9JB 2NTOA 2FHEA 4ZBDA 3VLNA 4MJCA 4ML1A 2RUEA 3W8SA 4I2UA 3DMLA 5CO3A 4MH2A 4D73B 7GSSA 3TJJA 4F0BA 1SJ6A 1XVWA 3FR6A 3PH9A 2IMEA 4NPBA 3TUEA 4LL1B 1ACVA 5CRGA 2KLXA 4KB3A 1GSYA 3P8WA 2A4VA 2VM1A 3GHAA 4PQIA 4KNDA 1USBA 2PBJA 1FB6A 3U6VA 2O87A 2YN1A 3BCKA 2JL4A 4MZBA 3FKFA 3D21A 4IGJA 2H75A 2J9HA 5D9WA 17GSA 4Q5NA 2OADA 2P5RA 2N5FA 1PGTA 1SJIA 1TU7A 2FUG2 1R5PA 1Z5YE 3IRAA 4HJ2A 1OC8A 3GTUB 2LNSA 1B9YC 1TP9A 3FEUA 2VO4A 5DAKA 1AUCA 5DCHA 2C0FA 2VIMA 2IIYA 1Z6MA 4HU7A 1WWJA 2LV3A 1LBKA 1M2DA 2R3XA 1TU8A 2I81A 4X43A 3Q18A 4NV5A 5GSSA 2C3TA 2A2SA 3IK7A 1WMJA 1XOBA 4HEA2 2MMZA 2DJ1A 2FA8A 5G30A 4PQHA 1ZYEA 3WT2A 4TXOB 4Q5QA 2V41A 4MZCA 5F8BA 4ECJA 4GRFA 5DDLA 2GQMA 4HZ2A 4DSSB 4CW9A 3EE2A 4IN0A 16GSA 5INYA 2GLRA 2IMFA 4O32A 3C7MA 3M3MA 1TRUA 5G31A 3K8NA 5ENUA 1O6JA 3VWUA 3ISOA 2X8GA 1R4WA 2AB6A 1Z7RA 1T8EB 2H6XA 1UVZA 3FZ4A 5G2ZA 2VCZA 4QL9A 1K0NA 1TK5B 1SYRA 3M0FA 1WRYA 1EOHA 1QXHA 1S3AA 4N0VA 20GSA 3VURA 4HOJA 4MH3A 5B8BA 3CSHA 3QOUA 1TK0B 1ZGNA 2GSQA 2IL3A 6GSYA 4TR4A 4POLA 2VL9A 2LQQA 3J7Yb 1A2MA 3EU4A 1ST9A 3G7YA 2B6MA 4RI7A 2BMXA 2PMTA 1WJKA 5D9XA 1CQGA 1EV4A 4IJ3A 4I6XA 4EDYA 3UJ1A 3W6GA 3HZ8A 3GKXA 4MMMA 4XCSA 5GZZB 2IPAA 2N5AA 3WT1A 3HKRA 2H0GA 1GTBA 3TKSC 4EVMA 1K0OA 3IAM2 1GTIA 4ZB6A 1T3BA 1K0DA 5DVBA 2E2MA 1VF4A 3I43A 1R7HA 2HLSA 5ECMB 2FWGA 4NXIA 3EWLA 2GT5A 3CXGA 1WP0A 4I97A 1MDJA 4OCEA 3GN3A 2B1KA 1XZOA 4O5RA 3CSIA 4N10A 4AF2A 4TR0A 3HZ4A 4E8HA 1FVKA 2KP2A 1X9SB 1AIUA 5JCWA 4XS1A 1YZXA 3UIWA 2CA8A 3L9UA 4O7HA 3GTUA 1GUMA 1YJ6A 2ON5A 2YWIA 1XWAA 3IAS2 2GSSA 3TDGA 4IHUA 5CRHA 2YPMA 5IO2A 5E59A 12GSA 3F9UA 2LEGA 4G19A 4HS1A 4KF9A 4WR5A 1G6YA 4AJ7A 1SENA 2EC4A 4PUAA 4FYUA 1QK8A 4JEDA 1XPVA 3VWWA 3KD0A 6GSTA 3O6TA 4WETA 4ULXA 5HR0A 3ZMLA 3LEFA 4Q5FA 2AAWA 1KBNA 1E2YA 1C72A 1JZOA 2HRNA 5J5NA 4PGTA 4GSTA 1B48A 4ZBAA 2V1MA 3HVSA 3TRXA 2H1BA 1ILOA 3QAWA 4KDUA 5F0GA 1AAZA 4DSSA 3FZAA 2B5EA 2JZTA 3IK9A 4HQSA 2PN8A 2QKEA 1R5AA 3LORA 3UL3A 1SL0B 2HXKA 4N11A 3TGZA 4L5OA 5J9BA 1SYXA 3WYWA 3PPUA 2FD3A 4LMVA 4J2FA 1VF2A 1SL2B 2X8HA 5KN1A 1SD8A 2TIRA 4RQXA 3A2WA 3LXZA 4HUAA 4USSA 1A8LA 1SKRB 5HR1A 3DVWA 3ED3A 3FR9A 3G7JA 3MAKA 1YF1A 2Z9SA 3F8UA 4GQFA 1PL1A 4KCEA 2XPEA 3GKMA 5IIZA 2B7KA 4V2LA 2DIZA 1OAZA 4MCUA 3N5OA 4TW5A 5BMUA 5D9VA 3G9BA 3APQA 1YEPA 3L0HA 3D5JA 4K1FA 3ERWA 3BCIA 5IOXA 4CHSA 4K7NA 3I69A 1KTEA 5B6NA 3L9SA 2R4VA 3UARA 4AJ6A 1FOVA 1PA3A 2LKUA 3L9VA 5F06A 1NHOA 4F82A 1O8XA 3PINA 1F6MC 1EEMA 3HVXA 3UVHA 1HNAA 1SD9A 3GL3A 2K6VA 2HRFA 2WGRA 2O7KA 3EMXA 4TN8A 3TJGA 5HR3A 4K0GA 1O81A 1EWXA 5CP1A 1ZYQB 1ERUA 2CX4A 2CVKA 2OE0A 3ZVJD 4TXVA 5ECQB 4FIWA 2DBCA 1EP7A 2B7JA 1M2BA 4WF4A 2HSMA 1A23A 4NAXA 2CQ9A 3H79A 2H0HA 3FW2A 3FY7A 2H30A 5H5SA 3ZLPA 4PXOA 3APOA 1HD2A 4V2MA 1XIYA 3DD3A 2WULA 3RDWA 1EV9A 3UBKA 1XWBA 1Y25A 3ME8A 5KN3A 4RQRA 1SK0A 5ECNB 1THOA 3IPZA 3RAZA 4EC0A 1MD3A 5AIVA 5D8IA 3GV1A 3MSZA 4RUVA 2YP6A 5IMVA 1U6TA 2O8VB 4HZ4A 1FVJA 3A2VA 3IV4A 4HU9A 4V2NA 1PX7A 2XBQA 3WGEA 2L4CA 3H8QA 4EF0A 4YAPA 3KCMA 1BJXA 2FCHA 1ERTA 3IDVA 4MJBA 2JSZA 4I2TA 1GSQA 1KEBA 2H19A 3FZ5A 4KH7A 3KTBA 2VLTA 5D9TA 4BWSA 1B9XC 1XVQA 2H73A 1JFUA 2YCDA 4TOPA 1G0TA 2VD1A 4OFNA 3P90A 3VWVA 4E8EA 1F9MA 5EL8A 1YF0A 4KA0A 1PKWA 1VF1A 2PGTA 2GQLA 4PUFC 3UVTA 1TDIA 2FWEA 1V2AA 3F4SA 3TJBA 1AQXA 5ELAA 3HHVA 1MD4A 4WF5A 2F8FA 2F9SA 1BX9A 4I8BA 3C71A 1PD21 1Z9HA 3GSSA 1Q98A 1U3IA 1GULA 1JZRA 1AQVA 4P3YB 3TJKA 4KDYA 4G2EA 1BG5A 2H6ZA 2YV9A 4MA9A 1NSWA 2FA4A 3GX8A 3VWXA 3IBHA 1GRXA 3HCZA 5J4UA 2I9HA 1FW1A 2B3SA 1GUKA 4IP6A 3A2XA 2HT9A 2L57A 3TJFA 2LJAA 3E3EA 3GX0A 2IJYA 2IN3A 1Z7PA 3TKSE 2YWOA 2PWJA 2ZUPA 1MEKA 4OO5A 4XS4B 1M0UA 1UA5A 2D2ZA 4K0NA 5IPHA 2JZRA 2A2RA 4NHZA 2WS2A 1TRSA 5ID2B 5FWGA 4XRDA 5H5QA 2C0GA 2VUPA 2GSRA 2VL2A 4GTUA 1XW9A 3DWVA 1K3YA 3EYTA 2YWMA 3US3A 5IQYA 1F2EA 2I4AA 1F3AA 2GS3A 2OKAA 5HQPA 3IA1A 1FAAA 3IR4A 3A3TA 3ERFA 1VGLA 2MYGA 1BEDA 4OMVA 4IVFA 2CAQA 4CDOA 1YKCA 3D0ZA 1YKAA 1EEJA 1B8XA 1ZMAA 1XCCA 4OWYA 1K0AA 2HRAA 4QQ7A 4JE1A 1TK8B 2NDOA 3GH9A 4BL7B 4PTSA 1DBYA 3I9V2 3O3TA 2PPTA 3WGDA 4K9ZA 1G7OA 9GSSA 5EPFA 5IOWA 4ECIA 4IBPA 3LGCA 1ZOFA 2VOCA 3EVIA 1YEXA 2CZ3A 1M9BA 4G10A 1TI3A 5LNKe 1M2AA 2EIOA 2OBIA 5C04A 3LG6A 1SU9A 1OC9A 3A5WA 5J41A 3ZFLA 5L71A 2G2QA 2REMA 4G0LA 2GDRA 4IW9A 1U3AA 2GVPA 3DRNA 3VI5A 4PURA 3ERGA 1X5CA 4TR1B 3HJMA 6GSWA 5IMDA 3MWHA 4DVCA 3BD2A 1PRXA 3EURA 2PVQA 3DGQA 4GWRA 1WIKA 3N9JA 3KP8A 1W4VA 2AYTA 2HRKB 2XPDA 4TKYA 5FHIA 3RBTA 5JWQB 3GL5A 4D73A 4IJIA 3BOAA 2C80A 4YQVA 2HYXA 5CYYA 1B4PA 2L5LA 1HNCA 4BPYA 2K8VA 1J08A 2VL3A 4BA7A 2V6KA 3GKNA 2C3NA 3PR8A 2VCVA 1A0RP 2M80A 1I5GA 1SKWB 1OVNA 4WBRD 3DVXA 1S3CA 2R5GA 1UN2A 4FO5A 3W8JA 4NMUA 2M72A 1PSQA 2J23A 1PL2A 1M99A 4WXTA 2GGTA 4MJEA 4NV2A 4KGIA 5KN2A 3HJPA 1V57A 1G7EA 2VLUA 18GSA 4FYCA 6GSXA 2CT6A 5ECHB 1O73A 4FH8A 5ID2A 2C1YA 5ECRB 2R6KA 3GMFA 1ON4A 2FY6A 2XBIA 1EOGA 4IKHA 2X99A 3GSTA 1X0RA 1A2LA 2JSYA 4ZXGA 2R2JA 3VI7A 1RW1A 2V2GA 2R37A 4TXOA 5HFIA 3QFAC 3QFBC 2OE3A 1EGRA 1S3DA 3G7IA 2FNOA 2DC5A 3EC3A 2K9FA 5DJLA 4LLRA 2AUVA 2IFQB 5FT3A 2HI7A 3KEBA 1A24A 4ZB9A 3HJOA 2GZZA 1PN9A 3SWLA 3ZIJA 2YZHA 5G5EA 3ME7A 4EO3A 3CTGA 3CRTA 2KUCA 5JWRB 2OJLA 2V6OA 1FO5A 4IELA 3IE3A 2JU5A 3F4TA 3P2AA 2H74A 4NHWA 3LFLA 5B8AA 1XW6A 1HQOA 4HQZA 1M9AA 3S9FA 1BQ7A 4YH2A 5IMFA 2YJHA 1SK1A 4KSOA 1T00A 3KIJA 5GAND 1N2AA 3M8NA 1X5DA 4V1Ag 2CX3A 3TRPA 1OYJA 2LTKA 1SKSB 3D22A 4KW6A 4TRXA 3RPPA 2BTOT 4KDXA 2ON7A 4BVXB 2IWTA 1XOAA 4POBA 1AQWA 2L6CA 3IHQA 5ABRA 2DJ0A 2ES7A 2H1GA 2LS5A 2K18A 4K6XA 2GZYA 4MF5A 2HZEB 4HDEA 3FHKA 4L5LA 2ALBA 4GCIA 2KOKA 1T7PB 4FQUA 4JRRA 4KCAA 4MPFA 5DBQA 5ECKB 1GP1A 3TKRA 4OFTA 1WOUA 1CQHA 3CMIA 3ZL5A 1XWGA 1H75A 1M7TA 4F2IA 1JHBA 6GSSA 4DSQA 2G0FA 4EKZA 3FK8A 2RIIA 3AY8A 3KGKA 3IOSA 4WEYA 1GNWA 3D4TA 2PERA 2YOIA 4G0IA 4V1Ap 3KTLA 2L5OA 3MDKA 3F63A 2E2GA 3R3EA 1WPIA 4ZBBA 2LRTA 4ZL7A 5AN1A 5IMAA 1YY7A 2N5BA 3D4MA 2B5YA 1ERVA 3H93A 2C4JA 2DJ2A 2DIYA 2GT6A 5IPGA 3SBCA 1JLVA 2QGVA 5CRDA 3HDCA 2GZPA 5CREA 1IYIA 3FR3A 1A2JA 1SL1B 2C8UA 1GSEA 2H8LA 2VCQA 5HFKA 10GSA 2H6YA 1I9DA 3CRUA 4YQMA 1ZL9A 3LSZA 3H1NA 2IFQA 4Q5RA 1OE8A 2JZSA 5D96A 3KMOA 1K3LA 1LJRA 2H76A 4WBJA 5DQSA 4F9ZA 4GSNA 4GSSA 1O7UA 2WJUA 4PNGA 3TKQA 5DQYA 1V40A 3U5RE 4HJMA 2GSTA 5KEJA 1AW9A 3QR6A 1T4YA 2P31A 4ILFA 4K7OA 4MPGA 1SK2A 3HY2A 3HA9A 1TKDB 3M9JA 1YDKA 1JLWA 3D6IA 1XW5A 8GSSA 1EGOA 14GSA 2VAFA 1XWCA 2YWNA 2TRXA 4IS0A 3GH6A 2H72A 4MP4A 2LJKA 4MLYA 1A0FA 5D93A 2CVBA 2DMMA 1K3OA 3L78A 3KJYA 4K7IA 4BVXA 3ZIVA 3KMNA 4ZILA 2XC2A 1OKTA 4RI6A 3KH7A 1XWKA 3NOFA 1IYHA 3GKKA 3ZFBA 2I3YA 5E4WA 2B5XA 3TOTA 3L4NA 2HZEA 2HFDA 2V32A 4WR4A 2VL2C 5IO0A 1GSDA 5GSTA 4OD7A 4EXJA 2F51A 2O85A 1BAYA 2MMNA 3GFKA 2ZCTA 2OACA 5IM9A 5A4UA 3UOMA 4PQ1A 3GNJA 4ID0A 2FWFA 3FZ9A 2YJ7A 3M1GA 1K0BA 2WFCA 4IP1A 5ECLB 5CAXA 2HE3A 3VFIA 2F8AA 2M46A 4LA1A 4AJ8A 4L8EA 3Q6OA 3KM6A 2BJXA 3P7XA 1THXA 3O76A 2OA7A 2UZ8A 1Q4JA 4XHMA 1V98A 3UMAA 4EUYA 1T1VA 3UBLA 2XHFA 3BBYA 2GQKA 3KH9A 3CBUA 2WCIA 2IMIA 2QSIA 1BYEA 4MF6A 2LRCA 2WB9A
chains in the Genus database with same CATH superfamily
22GSA 3WD6A 4ZL9A 1BG1A 4FYBA 1J0FA 1KNGA 1GTUA 11GSA 2DSAA 2AV4A 2YNXA 1TW9A 5ECOB 3ZVJA 2HQTA 1QQ2A 3CSJA 2H1DA 2CVDA 1G6WA 2X64A 1RQMA 4EE0A 1MDIA 2JADA 3MNGA 4Z7XA 3I6AA 4PX1A 2EIRA 1ML6A 4N0ZA 3ZTLA 4J57E 5IMCA 1GLQA 4MNNA 4X1UA 3KXOA 4GLTA 3F0IA 4TR3A 3E0UA 3NIVA 4EDZA 3HVVA 2VCXA 3VPTA 1MTCA 2KP1A 5EY6A 3EINA 4K8MA 1DE2A 4POMA 1TTZA 1TXXA 2L6DA 1NM3A 1GLPA 2MZCA 3TCOA 4ZIJA 4JR4A 5F07A 5BMUB 3EMPA 3QCPA 5BRTA 5F05A 2GTUA 4OCFA 3HD5A 2DKIA 3F3RA 4NWYA 1QFNA 2MBSA 4J56E 2IMDA 4X4JA 2E0QA 3ZZXA 2DJKA 5A5KA 4XTSA 2X8CA 1N8JA 4DSRA 2QA1A 1TI1A 2H1AA 3WGXA 1ERWA 4BVYB 3J7Yk 2WRTA 3IC8A 5AIXA 3QAGA 5KN0A 4GQCA 3TKPA 5ELGA 1SVLA 2MMOA 1GSFA 4ZB8A 1H4OA 3LWAA 5EVOA 5A4VA 1HYUA 5B6MA 5KOXA 2PVOC 2O89A 2O5VA 3UEMA 3HYPA 4MZWA 1LU4A 2KHPA 3VPQA 1Z3EA 1F37A 5J9CA 4AGSA 3KZQA 3ZRDA 1ABAA 1YQ1A 1RK4A 1GNEA 4K2DA 3TKSA 2OE1A 2F3MA 4AKXB 3PGTA 4XS4A 5AGYA 4YQUA 1WE0A 1B4QA 4IQAA 19GSA 3DYRA 4MDCA 2WW2A 2VD0A 3TRQA 1A8YA 3CYNA 2HSMB 1UC7A 3NZNA 1GSUA 3LXTA 1EP8A 2C0DA 1YEWC 1PMTA 5G1LA 5GAPD 4KUNA 3HMJG 3QAVA 1O85A 4HI7A 4OO4A 1V58A 3RHBA 3HXSA 3CTFA 3GA4A 1U87A 1GUHA 3TOUA 1FOHA 4ECCA 1NHYA 1E6BA 1XG8A 2PUKC 1K0MA 5G1KA 1OC3A 4G0KA 4MABA 1GL8A 3RPNA 3GYKA 5H5RA 3M9KA 1NW2A 4O5QA 2FLSA 5G5FA 4KSMA 2FGXA 1HNBA 5A4WA 2ZNMA 1K0CA 1XFLA 4OFMA 5DCGA 1VRSD 2MBTA 4BL7A 3QDNA 5J3RA 1AC1A 4I5QA 5CNWA 5DALB 4N30A 4GXZA 3F6DA 2MMAA 1GSSA 5D73A 4JU5A 3GRXA 2H66A 2NPBA 4X0XA 1TOFA 5CRWA 1QUWA 1XBSA 2WZ9A 2WVYA 2DJ3A 3FRCA 3R2QA 5IMZA 2CV4A 4O92A 1XXUA 2DLXA 3C1SA 3H4KA 4ACSA 4L0UA 5C00A 5JWOB 1QMVA 3FYGA 2HSYA 1F3BA 4JZQA 5ECPB 13GSA 3LQ7A 3F4RA 4KE3A 2HSHA 2DJJA 2EIQA 4KAEA 4TR1A 1JZDA 3UAPA 1O8WA 2VCWA 4KX4A 2CAIA 3ZMKA 3DXBA 1R26A 3GIXA 1X5EA 1GTAA 3QPMA 2LJRA 2HNLA 1OKDA 2HZFA 3APSA 2HRKA 3VK9A 2RLIA 3QD9A 3JCML 3ZITA 4GF0A 4YAVA 1JZWA 3C73A 5HR2A 3ZREA 1TRVA 1SJZA 3DKSA 5COHA 1QGVA 2RM5A 3LJRA 3RHCA 1W89A 2VLVA 3EPTA 4F03A 2LNTA 2AHEA 4BVYA 2WDUA 3GURA 3GUSA 4JR6A 4QL7A 3F6FA 1ZZYA 5DJMA 4L0WA 3C8EA 1FG4A 2YANA 3V1WA 1TJDA 2QC7A 1DE1A 3F3QA 2VKZG 3TB2A 5LCZA 3EU3A 5DAKB 1EZKA 1U88A 3C1RA 2RUFA 5LD0A 3Q74A 4K5SA 2H70A 2LQOA 1T4ZA 4ISDA 2H1LA 1GH2A 2HSNB 3DEXA 3BJ5A 5AISA 1DUGA 2P5QA 1Z6NA 2B1LA 2K8SA 1FHEA 4G9HA 1MDKA 3Q19A 4XS6A 1PKZA 4POKA 4IQ1A 1PX6A 2L59A 2FWHA 1I1IP 2LSTA 2PU9C 3LYKA 2IMKA 2CZ2A 4MK3A 3ZYWA 1AXDA 4ZL8A 3QMXA 1GWCA 4ML6A 4EIPA 4XRAA 5JCUA 3OR5A 1PQNA 1V9WA 1OE7A 4MJAA 5B7CA 2JACA 3KP9A 3DIEA 2YZUA 3IC4A 1Y6EA 5KOWA 4H86A 4EL1A 2OBKA 4XIHA 2TRCP 2AJQB 4LMWA 3IXRA 4BWQA 1ZCPA 1VF3A 2P0GA 2C0EA 2C3QA 1X9WB 4K2XA 5JCGA 4WKWA 5DALA 1DSBA 1FB0A 2VM2A 1OC9B 2H71A 3LYPA 2H01A 4TVEA 5ECSA 2YV7A 2DMLA 4LL4B 2VCTA 1TRWA 2L4QA 5HFGA 2NVLA 2I1UA 2RM6A 1URMA 1J9BA 2H0IA 1X9MB 2E7PA 4MF7A 4ECBA 4DEJA 5ECIB 6GSVA 6GSUA 4F0CA 2LRNA 2LUSA 4PNFA 4JBBA 2NBSA 3E9JB 2NTOA 2FHEA 4ZBDA 4YKFA 3VLNA 4MJCA 4ML1A 2RUEA 3W8SA 4W66A 4I2UA 1SVOA 3DMLA 5CO3A 5A5HA 4MH2A 4D73B 7GSSA 3TJJA 4F0BA 1SJ6A 1XVWA 3FR6A 3PH9A 2IMEA 4NPBA 3TUEA 4LL1B 1ACVA 5CRGA 4N3ZA 2KLXA 4KB3A 1GSYA 3P8WA 2A4VA 2VM1A 3GHAA 4PQIA 4KNDA 1USBA 2PBJA 2R0PA 1FB6A 3U6VA 2O87A 2YN1A 3BCKA 2JL4A 4MZBA 3FKFA 3D21A 4IGJA 2H75A 2J9HA 5D9WA 5A1NA 5J4VA 17GSA 4Q5NA 2OADA 2P5RA 2N5FA 1PGTA 2R0CA 1SJIA 1TU7A 2FUG2 1R5PA 1Z5YE 3IRAA 4HJ2A 1OC8A 3GTUB 2LNSA 1B9YC 1TP9A 3FEUA 2VO4A 5DAKA 1AUCA 5DCHA 2C0FA 2VIMA 2IIYA 1Z6MA 4HU7A 1WWJA 2LV3A 1LBKA 1M2DA 2R3XA 1TU8A 2I81A 4X43A 3Q18A 4NV5A 5GSSA 2C3TA 2A2SA 4HSCX 3IK7A 1WMJA 1XOBA 2HSNA 4HEA2 2MMZA 1PFOA 2DJ1A 2FA8A 5G30A 4PQHA 1ZYEA 3WT2A 4TXOB 4Q5QA 2V41A 3RGBC 4MZCA 5F8BA 4ECJA 4GRFA 5DDLA 2GQMA 4HZ2A 4DSSB 4CW9A 3A5IA 3EE2A 4IN0A 16GSA 5INYA 2GLRA 2IMFA 4O32A 3C7MA 3M3MA 1TRUA 5G31A 3K8NA 5ENUA 1SVMA 1O6JA 3VWUA 2A4HA 3ISOA 2X8GA 4CY8A 1R4WA 2AB6A 1Z7RA 1T8EB 2H6XA 1UVZA 3FZ4A 5G2ZA 2VCZA 4QL9A 1K0NA 1TK5B 1SYRA 3M0FA 1WRYA 1EOHA 1QXHA 1S3AA 4N0VA 20GSA 3VURA 4HOJA 4MH3A 5B8BA 3CSHA 3QOUA 1TK0B 1ZGNA 2GSQA 2IL3A 6GSYA 4TR4A 2UV8G 4POLA 2VL9A 2LQQA 3J7Yb 1A2MA 3EU4A 1ST9A 3G7YA 2B6MA 4RI7A 2BMXA 2PMTA 1WJKA 5D9XA 1CQGA 1EV4A 4IJ3A 4I6XA 4EDYA 3UJ1A 3W6GA 3HZ8A 3GKXA 4MMMA 3IHGA 4XCSA 5GZZB 2IPAA 2N5AA 3WT1A 3HKRA 2QA2A 2H0GA 1GTBA 3TKSC 4EVMA 1K0OA 3IAM2 1GTIA 4ZB6A 1BF5A 1T3BA 1K0DA 5DVBA 2E2MA 1VF4A 3I43A 1R7HA 2HLSA 5ECMB 2FWGA 4NXIA 3EWLA 4A5PA 2GT5A 3CXGA 1WP0A 4I97A 1MDJA 4OCEA 3GN3A 2B1KA 1XZOA 4O5RA 3CSIA 4N10A 4AF2A 4TR0A 3HZ4A 4E8HA 1FVKA 2KP2A 1X9SB 1AIUA 5JCWA 4XS1A 1YZXA 3UIWA 2CA8A 3L9UA 4O7HA 3GTUA 1GUMA 1YJ6A 4FXYP 2ON5A 2YWIA 1XWAA 4K5RA 3IAS2 2GSSA 3TDGA 4IHUA 5CRHA 2YPMA 4PHZC 5IO2A 5E59A 12GSA 3F9UA 2LEGA 4G19A 4HS1A 4KF9A 4WR5A 1G6YA 4AJ7A 1SENA 2WZSA 4PUAA 2EC4A 4FYUA 1QK8A 4JEDA 1XPVA 3VWWA 3KD0A 6GSTA 3O6TA 4WETA 4ULXA 5HR0A 3ZMLA 3LEFA 4Q5FA 2AAWA 1KBNA 1E2YA 1C72A 1JZOA 2HRNA 5J5NA 4PGTA 4GSTA 1B48A 4ZBAA 2V1MA 3HVSA 3TRXA 2H1BA 1ILOA 3QAWA 4KDUA 5F0GA 1AAZA 4DSSA 3FZAA 2B5EA 2JZTA 3IK9A 4HQSA 2PN8A 2QKEA 1R5AA 3LORA 3UL3A 1SL0B 2HXKA 4N11A 2EFDA 3TGZA 4L5OA 5J9BA 1SYXA 3WYWA 3PPUA 2FD3A 4LMVA 4J2FA 1VF2A 4ICYA 1SL2B 2X8HA 3MIXA 5KN1A 1SD8A 2TIRA 4RQXA 3A2WA 3LXZA 4HUAA 4USSA 1A8LA 1SKRB 5HR1A 3DVWA 3ED3A 3FR9A 3G7JA 3MAKA 1YF1A 2Z9SA 3F8UA 4GQFA 1PL1A 4KCEA 2WVZA 2XPEA 3GKMA 5IIZA 2B7KA 4V2LA 2DIZA 1OAZA 4MCUA 3N5OA 4TW5A 4BIKA 3RFRC 5BMUA 5D9VA 3G9BA 3APQA 1YEPA 3L0HA 3D5JA 4K1FA 3ERWA 3BCIA 5IOXA 4CHSA 4K7NA 3I69A 4E68A 1KTEA 5B6NA 3L9SA 2R4VA 3UARA 4AJ6A 1FOVA 1PA3A 2LKUA 3L9VA 5F06A 1NHOA 4F82A 1O8XA 3PINA 1F6MC 1EEMA 3HVXA 3UVHA 1HNAA 1SD9A 3GL3A 2K6VA 2HRFA 2WGRA 2O7KA 3EMXA 4TN8A 3TJGA 5HR3A 4K0GA 1O81A 1EWXA 5CP1A 1ZYQB 1ERUA 2CX4A 2CVKA 2OE0A 3ZVJD 4TXVA 5ECQB 4FIWA 2DBCA 1EP7A 2B7JA 1M2BA 2X49A 1PN0A 4WF4A 2HSMA 1A23A 4NAXA 2CQ9A 3H79A 2H0HA 3FW2A 3FY7A 2H30A 5H5SA 3ZLPA 4PXOA 3APOA 1HD2A 4V2MA 1XIYA 3DD3A 2WULA 3RDWA 1EV9A 3UBKA 1XWBA 1Y25A 3ME8A 5KN3A 4RQRA 4EIQA 1SK0A 5ECNB 1THOA 3IPZA 3RAZA 4EC0A 1MD3A 5AIVA 5D8IA 3GV1A 3MSZA 4RUVA 2YP6A 5IMVA 1U6TA 2O8VB 4HZ4A 1FVJA 3A2VA 3IV4A 4HU9A 4V2NA 1PX7A 2XBQA 3WGEA 2L4CA 3H8QA 4EF0A 4YAPA 3KCMA 4PI0C 1BJXA 2FCHA 1ERTA 3IDVA 4MJBA 2JSZA 4I2TA 1GSQA 5A34B 1KEBA 2H19A 3FZ5A 4KH7A 3KTBA 2VLTA 5D9TA 4BWSA 1B9XC 1XVQA 2H73A 1JFUA 2YCDA 4TOPA 1G0TA 2VD1A 4OFNA 3P90A 3VWVA 4E8EA 2WW0A 1F9MA 5EL8A 1YF0A 4KA0A 1PKWA 1VF1A 2PGTA 2GQLA 4PUFC 3UVTA 1TDIA 2FWEA 1V2AA 3F4SA 3TJBA 1AQXA 5ELAA 3HHVA 1MD4A 4WF5A 2F8FA 2F9SA 3HVNA 1BX9A 4I8BA 3C71A 1PD21 1Z9HA 3GSSA 1Q98A 1U3IA 1GULA 1JZRA 1AQVA 4P3YB 3TJKA 4KDYA 4G2EA 1BG5A 2H6ZA 2YV9A 4MA9A 1NSWA 2FA4A 1ZYPA 3GX8A 3VWXA 3IBHA 1GRXA 3HCZA 5J4UA 2I9HA 1FW1A 2B3SA 1GUKA 4IP6A 5J4YA 3A2XA 2HT9A 2L57A 3TJFA 2LJAA 4Z2RA 3E3EA 3GX0A 2IJYA 2IN3A 1Z7PA 3TKSE 2YWOA 2OT3A 2PWJA 2WVXB 2ZUPA 1MEKA 4OO5A 4XS4B 5J47A 1M0UA 1UA5A 2D2ZA 4K0NA 5IPHA 2JZRA 2A2RA 4NHZA 2WS2A 1TRSA 5ID2B 1YVLA 5FWGA 4XRDA 5H5QA 2C0GA 2VUPA 2GSRA 2VL2A 4GTUA 1XW9A 3MYDA 3DWVA 1K3YA 3EYTA 1M3IA 4GDFA 2YWMA 3US3A 5IQYA 1F2EA 2I4AA 1F3AA 2GS3A 2OKAA 5HQPA 3IA1A 1FAAA 3IR4A 3A3TA 3ERFA 1VGLA 2MYGA 1BEDA 4OMVA 4IVFA 2CAQA 4CDOA 1YKCA 3D0ZA 1YKAA 1EEJA 1B8XA 4ZB7A 1ZMAA 1XCCA 4OWYA 1K0AA 2HRAA 4QQ7A 4JE1A 1TK8B 2NDOA 3GH9A 4BL7B 4PTSA 1DBYA 3I9V2 1ZYNA 3O3TA 2PPTA 3WGDA 4K9ZA 1G7OA 1M3JA 9GSSA 5EPFA 5IOWA 4ECIA 4IBPA 3LGCA 1ZOFA 2VOCA 3EVIA 1YEXA 2CZ3A 1M9BA 4G10A 1TI3A 5LNKe 1M2AA 2EIOA 5A34A 2OBIA 5C04A 3LG6A 1SU9A 1OC9A 3A5WA 5J41A 3ZFLA 5L71A 2G2QA 2REMA 4G0LA 2X4AA 2GDRA 4IW9A 1U3AA 2GVPA 3DRNA 3VI5A 3LW9A 4PURA 3ERGA 1X5CA 4TR1B 4Z2TA 3HJMA 6GSWA 5IMDA 1S3RA 3MWHA 4DVCA 3BD2A 1PRXA 3EURA 2PVQA 3DGQA 4GWRA 1WIKA 3N9JA 2WW1A 3KP8A 1W4VA 2AYTA 2HRKB 2XPDA 4TKYA 5FHIA 3RBTA 5JWQB 3GL5A 4D73A 4IJIA 3BOAA 2C80A 4YQVA 2R0GA 2HYXA 2EFEA 5CYYA 1B4PA 2L5LA 1HNCA 4BPYA 2K8VA 1J08A 2VL3A 4BA7A 2V6KA 3GKNA 2C3NA 3PR8A 2VCVA 3CQFA 1A0RP 2M80A 1I5GA 1N25A 1SKWB 1OVNA 4WBRD 3DVXA 1S3CA 2R5GA 1UN2A 4FO5A 3W8JA 4NMUA 4AKIA 2M72A 1PSQA 2J23A 1PL2A 1M99A 4WXTA 2GGTA 4MJEA 2WVXA 4NV2A 4KGIA 5KN2A 3HJPA 1V57A 1G7EA 2VLUA 4G01A 18GSA 4FYCA 6GSXA 2CT6A 5ECHB 1O73A 4FH8A 5ID2A 2C1YA 5ECRB 2R6KA 3GMFA 1ON4A 2FY6A 2XBIA 1EOGA 4IKHA 2X99A 3GSTA 1X0RA 1A2LA 2JSYA 4ZXGA 2R2JA 3VI7A 1RW1A 2V2GA 4QMKA 2R37A 4TXOA 5HFIA 3QFAC 3QFBC 2OE3A 1EGRA 1S3DA 3G7IA 2FNOA 2DC5A 3EC3A 2K9FA 5DJLA 4LLRA 2AUVA 4CY6A 2IFQB 5FT3A 2HI7A 3KEBA 1A24A 4ZB9A 3HJOA 2GZZA 1PN9A 3SWLA 3ZIJA 2YZHA 5G5EA 3ME7A 4EO3A 3CTGA 3CRTA 2KUCA 5JWRB 2OJLA 2V6OA 1FO5A 4IELA 3IE3A 2JU5A 3F4TA 3P2AA 2H74A 4NHWA 3LFLA 5B8AA 1XW6A 1HQOA 4HQZA 1M9AA 3S9FA 1BQ7A 4YH2A 5IMFA 2YJHA 1SK1A 4KSOA 1T00A 3KIJA 5GAND 1N2AA 3M8NA 1X5DA 4V1Ag 5A5HB 2CX3A 3TRPA 1OYJA 2LTKA 1SKSB 3D22A 4KW6A 4TRXA 3RPPA 2BTOT 4KDXA 2ON7A 4BVXB 2IWTA 1XOAA 4POBA 1AQWA 2L6CA 3IHQA 5ABRA 2DJ0A 2ES7A 2H1GA 2LS5A 2K18A 4K6XA 2GZYA 3CHXC 4MF5A 2HZEB 2EFCA 4HDEA 3FHKA 5A1NB 4L5LA 2ALBA 2O36A 4GCIA 2KOKA 1T7PB 4FQUA 4JRRA 4KCAA 4MPFA 5DBQA 5ECKB 1GP1A 3TKRA 4OFTA 1WOUA 1CQHA 3CMIA 3ZL5A 1XWGA 1H75A 1M7TA 4AKHA 4F2IA 6GSSA 4DSQA 1JHBA 2G0FA 4EKZA 2DKHA 3FK8A 2RIIA 3TU3B 2WW3A 3AY8A 3KGKA 3IOSA 4WEYA 1GNWA 3D4TA 2PERA 2YOIA 4G0IA 4V1Ap 3KTLA 2L5OA 3MDKA 3F63A 5J40A 2EFHA 2E2GA 3R3EA 1WPIA 4ZBBA 2LRTA 4ZL7A 5AN1A 5IMAA 1YY7A 2N5BA 3D4MA 2B5YA 1ERVA 3H93A 2C4JA 2DJ2A 2DIYA 2GT6A 5IPGA 3SBCA 1JLVA 2QGVA 5CRDA 3HDCA 2GZPA 5CREA 1IYIA 3FR3A 1A2JA 1SL1B 2C8UA 1GSEA 2H8LA 2VCQA 5HFKA 10GSA 2H6YA 1I9DA 3CRUA 4YQMA 1ZL9A 3CWGA 3LSZA 3H1NA 2IFQA 4Q5RA 1OE8A 2O3EA 2JZSA 5D96A 3KMOA 1K3LA 1LJRA 2H76A 4WBJA 5DQSA 4F9ZA 4GSNA 4GSSA 4Z2UA 1O7UA 2WJUA 4AKGA 4PI2C 4PNGA 3TKQA 5DQYA 1V40A 3U5RE 4HJMA 2GSTA 5KEJA 1AW9A 4AI6A 3QR6A 1T4YA 2P31A 4ILFA 4K7OA 1S4BP 4MPGA 1SK2A 3FMWA 3HY2A 3HA9A 1TKDB 3M9JA 1YDKA 1JLWA 3D6IA 1XW5A 8GSSA 1EGOA 14GSA 2VAFA 1XWCA 2YWNA 2TRXA 4IS0A 3GH6A 2H72A 4MP4A 2LJKA 4MLYA 4YKGA 1A0FA 5D93A 2CVBA 2DMMA 1K3OA 1Y1UA 3L78A 3KJYA 4K7IA 4BVXA 3ZIVA 3KMNA 4ZILA 2XC2A 1OKTA 4RI6A 3KH7A 1XWKA 3NOFA 1IYHA 3GKKA 3ZFBA 2I3YA 5E4WA 2B5XA 3TOTA 2A2PA 3L4NA 2HZEA 2HFDA 2V32A 4WR4A 2VL2C 5IO0A 1GSDA 5GSTA 4OD7A 4EXJA 2F51A 2O85A 1BAYA 2MMNA 3GFKA 2ZCTA 2OACA 5IM9A 5A4UA 3UOMA 4PQ1A 3GNJA 4ID0A 2FWFA 3FZ9A 2YJ7A 3M1GA 1K0BA 2WFCA 4IP1A 5ECLB 5CAXA 2HE3A 3VFIA 2F8AA 2M46A 4LA1A 1TXUA 4AJ8A 4L8EA 3Q6OA 3KM6A 2BJXA 3P7XA 1THXA 3O76A 2OA7A 2UZ8A 1Q4JA 4XHMA 1V98A 3UMAA 4EUYA 1T1VA 3UBLA 2XHFA 3BBYA 2GQKA 3KH9A 3CBUA 2WCIA 4O5UA 2IMIA 2QSIA 1BYEA 4MF6A 2LRCA 2WB9A
chains in the Genus database with same CATH topology
22GSA 3WD6A 4ZL9A 1BG1A 4FYBA 1J0FA 1KNGA 1GTUA 11GSA 2DSAA 2AV4A 2YNXA 1TW9A 5ECOB 3ZVJA 2HQTA 1QQ2A 3CSJA 2H1DA 2CVDA 1G6WA 2X64A 1RQMA 4EE0A 1MDIA 2JADA 3MNGA 4Z7XA 3I6AA 4PX1A 2EIRA 1ML6A 4N0ZA 3ZTLA 4J57E 5IMCA 1GLQA 4MNNA 4X1UA 3KXOA 4GLTA 3F0IA 4TR3A 3E0UA 3NIVA 4EDZA 3HVVA 2VCXA 3VPTA 1MTCA 2KP1A 5EY6A 3EINA 4K8MA 1DE2A 4POMA 1TTZA 1TXXA 2L6DA 1NM3A 1GLPA 2MZCA 3TCOA 4ZIJA 4JR4A 5F07A 5BMUB 3EMPA 3QCPA 5BRTA 5F05A 2GTUA 4OCFA 3HD5A 2DKIA 3F3RA 4NWYA 1QFNA 2MBSA 4J56E 2IMDA 4X4JA 2E0QA 3ZZXA 2DJKA 5A5KA 4XTSA 2X8CA 1N8JA 4DSRA 2QA1A 1TI1A 2H1AA 3WGXA 1ERWA 4BVYB 3J7Yk 2WRTA 3IC8A 5AIXA 3QAGA 5KN0A 4GQCA 3TKPA 5ELGA 1SVLA 2MMOA 1GSFA 4ZB8A 3LWAA 1H4OA 5EVOA 5A4VA 1HYUA 5B6MA 5KOXA 2PVOC 2O89A 2O5VA 3UEMA 3HYPA 4MZWA 1LU4A 2KHPA 3VPQA 1Z3EA 1F37A 5J9CA 4AGSA 3KZQA 3ZRDA 1ABAA 1YQ1A 1RK4A 1GNEA 4K2DA 3TKSA 2OE1A 2F3MA 4AKXB 3PGTA 4XS4A 5AGYA 4YQUA 1WE0A 1B4QA 4IQAA 19GSA 3DYRA 4MDCA 2VD0A 3TRQA 1A8YA 3CYNA 2HSMB 1UC7A 3NZNA 1GSUA 3LXTA 1EP8A 2C0DA 1PMTA 5G1LA 5GAPD 4KUNA 3HMJG 3QAVA 1O85A 4HI7A 4OO4A 1V58A 3RHBA 3HXSA 3CTFA 3GA4A 1U87A 1GUHA 3TOUA 1FOHA 4ECCA 1NHYA 1E6BA 2PUKC 1K0MA 5G1KA 1OC3A 4G0KA 4MABA 1GL8A 3RPNA 3GYKA 5H5RA 3M9KA 1NW2A 4O5QA 2FLSA 5G5FA 4KSMA 2FGXA 1HNBA 5A4WA 2ZNMA 1K0CA 1XFLA 4OFMA 5DCGA 1VRSD 2MBTA 4BL7A 3QDNA 5J3RA 1AC1A 4I5QA 5CNWA 5DALB 4N30A 4GXZA 3F6DA 2MMAA 1GSSA 5D73A 4JU5A 3GRXA 2H66A 2NPBA 4X0XA 1TOFA 5CRWA 1QUWA 1XBSA 2WZ9A 2DJ3A 3FRCA 3R2QA 5IMZA 2CV4A 4O92A 1XXUA 2DLXA 3C1SA 3H4KA 4ACSA 4L0UA 5C00A 5JWOB 1QMVA 3FYGA 2HSYA 1F3BA 4JZQA 5ECPB 13GSA 3LQ7A 3F4RA 4KE3A 2HSHA 2DJJA 2EIQA 4KAEA 4TR1A 1JZDA 3UAPA 1O8WA 2VCWA 4KX4A 2CAIA 3ZMKA 3DXBA 1R26A 3GIXA 1X5EA 1GTAA 3QPMA 2LJRA 2HNLA 1OKDA 2HZFA 3APSA 2HRKA 3VK9A 2RLIA 3QD9A 3JCML 3ZITA 4GF0A 4YAVA 1JZWA 3C73A 5HR2A 3ZREA 1TRVA 1SJZA 3DKSA 5COHA 1QGVA 2RM5A 3LJRA 3RHCA 1W89A 2VLVA 3EPTA 4F03A 2LNTA 2AHEA 4BVYA 2WDUA 3GURA 3GUSA 4JR6A 4QL7A 3F6FA 1ZZYA 5DJMA 4L0WA 3C8EA 1FG4A 2YANA 3V1WA 1TJDA 2QC7A 1DE1A 3F3QA 2VKZG 3TB2A 5LCZA 3EU3A 5DAKB 1EZKA 1U88A 3C1RA 2RUFA 5LD0A 3Q74A 4K5SA 2H70A 2LQOA 1T4ZA 4ISDA 2H1LA 1GH2A 2HSNB 3DEXA 3BJ5A 5AISA 1DUGA 2P5QA 1Z6NA 2B1LA 2K8SA 1FHEA 4G9HA 1MDKA 3Q19A 4XS6A 1PKZA 4POKA 4IQ1A 1PX6A 2L59A 2FWHA 2LSTA 2PU9C 3LYKA 2IMKA 2CZ2A 4MK3A 3ZYWA 1AXDA 4ZL8A 3QMXA 1GWCA 4ML6A 4EIPA 4XRAA 5JCUA 3OR5A 1PQNA 1V9WA 1OE7A 4MJAA 5B7CA 2JACA 3KP9A 3DIEA 2YZUA 3IC4A 1Y6EA 5KOWA 4H86A 4EL1A 2OBKA 4XIHA 2TRCP 2AJQB 4LMWA 3IXRA 4BWQA 1ZCPA 1VF3A 2P0GA 2C0EA 2C3QA 1X9WB 4K2XA 5JCGA 4WKWA 5DALA 1DSBA 1FB0A 2VM2A 1OC9B 2H71A 3LYPA 2H01A 4TVEA 5ECSA 2YV7A 2DMLA 4LL4B 2VCTA 1TRWA 2L4QA 5HFGA 2NVLA 2I1UA 2RM6A 1URMA 1J9BA 2H0IA 1X9MB 2E7PA 4MF7A 4ECBA 4DEJA 5ECIB 6GSVA 6GSUA 4F0CA 2LRNA 2LUSA 4PNFA 4JBBA 2NBSA 3E9JB 2NTOA 2FHEA 4ZBDA 4YKFA 3VLNA 4MJCA 4ML1A 2RUEA 3W8SA 4W66A 4I2UA 1SVOA 3DMLA 5CO3A 5A5HA 4MH2A 4D73B 7GSSA 3TJJA 4F0BA 1SJ6A 1XVWA 3FR6A 3PH9A 2IMEA 4NPBA 3TUEA 4LL1B 1ACVA 5CRGA 4N3ZA 2KLXA 4KB3A 1GSYA 3P8WA 2A4VA 2VM1A 3GHAA 4PQIA 4KNDA 1USBA 2PBJA 2R0PA 1FB6A 3U6VA 2O87A 2YN1A 3BCKA 2JL4A 4MZBA 3FKFA 3D21A 4IGJA 2H75A 2J9HA 5D9WA 5A1NA 5J4VA 17GSA 4Q5NA 2OADA 2P5RA 2N5FA 1PGTA 2R0CA 1SJIA 1TU7A 2FUG2 1R5PA 1Z5YE 3IRAA 4HJ2A 1OC8A 3GTUB 2LNSA 1B9YC 1TP9A 3FEUA 2VO4A 5DAKA 1AUCA 5DCHA 2C0FA 2VIMA 2IIYA 1Z6MA 4HU7A 1WWJA 2LV3A 1LBKA 1M2DA 2R3XA 1TU8A 2I81A 4X43A 3Q18A 4NV5A 5GSSA 2C3TA 2A2SA 3IK7A 1WMJA 1XOBA 2HSNA 4HEA2 2MMZA 2DJ1A 2FA8A 5G30A 4PQHA 1ZYEA 3WT2A 4TXOB 4Q5QA 2V41A 4MZCA 5F8BA 4ECJA 4GRFA 5DDLA 2GQMA 4HZ2A 4DSSB 4CW9A 3A5IA 3EE2A 4IN0A 16GSA 5INYA 2GLRA 2IMFA 4O32A 3C7MA 3M3MA 1TRUA 5G31A 3K8NA 5ENUA 1SVMA 1O6JA 3VWUA 2A4HA 3ISOA 2X8GA 4CY8A 1R4WA 2AB6A 1Z7RA 1T8EB 2H6XA 1UVZA 3FZ4A 5G2ZA 2VCZA 4QL9A 1K0NA 1TK5B 1SYRA 3M0FA 1WRYA 1EOHA 1QXHA 1S3AA 4N0VA 20GSA 3VURA 4HOJA 4MH3A 5B8BA 3CSHA 3QOUA 1TK0B 1ZGNA 2GSQA 2IL3A 6GSYA 4TR4A 2UV8G 4POLA 2VL9A 2LQQA 3J7Yb 1A2MA 3EU4A 1ST9A 3G7YA 2B6MA 4RI7A 2BMXA 2PMTA 1WJKA 5D9XA 1CQGA 1EV4A 4IJ3A 4I6XA 4EDYA 3UJ1A 3W6GA 3HZ8A 3GKXA 4MMMA 3IHGA 4XCSA 5GZZB 2IPAA 2N5AA 3WT1A 3HKRA 2QA2A 2H0GA 1GTBA 3TKSC 4EVMA 1K0OA 3IAM2 1GTIA 4ZB6A 1BF5A 1T3BA 1K0DA 5DVBA 2E2MA 1VF4A 3I43A 1R7HA 2HLSA 5ECMB 2FWGA 4NXIA 3EWLA 4A5PA 2GT5A 3CXGA 1WP0A 4I97A 1MDJA 4OCEA 3GN3A 2B1KA 1XZOA 4O5RA 3CSIA 4N10A 4AF2A 4TR0A 3HZ4A 4E8HA 1FVKA 2KP2A 1X9SB 1AIUA 5JCWA 4XS1A 1YZXA 3UIWA 2CA8A 3L9UA 4O7HA 3GTUA 1GUMA 1YJ6A 2ON5A 2YWIA 1XWAA 4K5RA 3IAS2 2GSSA 3TDGA 4IHUA 5CRHA 2YPMA 5IO2A 5E59A 12GSA 3F9UA 2LEGA 4G19A 4HS1A 4KF9A 4WR5A 1G6YA 4AJ7A 1SENA 2EC4A 4PUAA 4FYUA 1QK8A 4JEDA 1XPVA 3VWWA 3KD0A 6GSTA 3O6TA 4WETA 4ULXA 5HR0A 3ZMLA 3LEFA 4Q5FA 2AAWA 1KBNA 1E2YA 1C72A 1JZOA 2HRNA 5J5NA 4PGTA 4GSTA 1B48A 4ZBAA 2V1MA 3HVSA 3TRXA 2H1BA 1ILOA 3QAWA 4KDUA 5F0GA 1AAZA 4DSSA 3FZAA 2B5EA 2JZTA 3IK9A 4HQSA 2PN8A 2QKEA 1R5AA 3LORA 3UL3A 1SL0B 2HXKA 4N11A 2EFDA 3TGZA 4L5OA 5J9BA 1SYXA 3WYWA 3PPUA 2FD3A 4LMVA 4J2FA 1VF2A 4ICYA 1SL2B 2X8HA 3MIXA 5KN1A 1SD8A 2TIRA 4RQXA 3A2WA 3LXZA 4HUAA 4USSA 1A8LA 1SKRB 5HR1A 3DVWA 3ED3A 3FR9A 3G7JA 3MAKA 1YF1A 2Z9SA 3F8UA 4GQFA 1PL1A 4KCEA 2XPEA 3GKMA 5IIZA 2B7KA 4V2LA 2DIZA 1OAZA 4MCUA 3N5OA 4TW5A 5BMUA 5D9VA 3G9BA 3APQA 1YEPA 3L0HA 3D5JA 4K1FA 3ERWA 3BCIA 5IOXA 4CHSA 4K7NA 3I69A 4E68A 1KTEA 5B6NA 3L9SA 2R4VA 3UARA 4AJ6A 1FOVA 1PA3A 2LKUA 3L9VA 5F06A 1NHOA 4F82A 1O8XA 3PINA 1F6MC 1EEMA 3HVXA 3UVHA 1HNAA 1SD9A 3GL3A 2K6VA 2HRFA 2WGRA 2O7KA 3EMXA 4TN8A 3TJGA 5HR3A 4K0GA 1O81A 1EWXA 5CP1A 1ZYQB 1ERUA 2CX4A 2CVKA 2OE0A 3ZVJD 4TXVA 5ECQB 4FIWA 2DBCA 1EP7A 2B7JA 1M2BA 2X49A 1PN0A 4WF4A 2HSMA 1A23A 4NAXA 2CQ9A 3H79A 2H0HA 3FW2A 3FY7A 2H30A 5H5SA 3ZLPA 4PXOA 3APOA 1HD2A 4V2MA 1XIYA 3DD3A 2WULA 3RDWA 1EV9A 3UBKA 1XWBA 1Y25A 3ME8A 5KN3A 4RQRA 4EIQA 1SK0A 5ECNB 1THOA 3IPZA 3RAZA 4EC0A 1MD3A 5AIVA 5D8IA 3GV1A 3MSZA 4RUVA 2YP6A 5IMVA 1U6TA 2O8VB 4HZ4A 1FVJA 3A2VA 3IV4A 4HU9A 4V2NA 1PX7A 2XBQA 3WGEA 2L4CA 3H8QA 4EF0A 4YAPA 3KCMA 1BJXA 2FCHA 1ERTA 3IDVA 4MJBA 2JSZA 4I2TA 1GSQA 5A34B 1KEBA 2H19A 3FZ5A 4KH7A 3KTBA 2VLTA 5D9TA 4BWSA 1B9XC 1XVQA 2H73A 1JFUA 2YCDA 4TOPA 1G0TA 2VD1A 4OFNA 3P90A 3VWVA 4E8EA 1F9MA 5EL8A 1YF0A 4KA0A 1PKWA 1VF1A 2PGTA 2GQLA 4PUFC 3UVTA 1TDIA 2FWEA 1V2AA 3F4SA 3TJBA 1AQXA 5ELAA 3HHVA 1MD4A 4WF5A 2F8FA 2F9SA 1BX9A 4I8BA 3C71A 1PD21 1Z9HA 3GSSA 1Q98A 1U3IA 1GULA 1JZRA 1AQVA 4P3YB 3TJKA 4KDYA 4G2EA 1BG5A 2H6ZA 2YV9A 4MA9A 1NSWA 2FA4A 1ZYPA 3GX8A 3VWXA 3IBHA 1GRXA 3HCZA 5J4UA 2I9HA 1FW1A 2B3SA 1GUKA 4IP6A 5J4YA 3A2XA 2HT9A 2L57A 3TJFA 2LJAA 4Z2RA 3E3EA 3GX0A 2IJYA 2IN3A 1Z7PA 3TKSE 2YWOA 2OT3A 2PWJA 2ZUPA 1MEKA 4OO5A 4XS4B 5J47A 1M0UA 1UA5A 2D2ZA 4K0NA 5IPHA 2JZRA 2A2RA 4NHZA 2WS2A 1TRSA 5ID2B 1YVLA 5FWGA 4XRDA 5H5QA 2C0GA 2VUPA 2GSRA 2VL2A 4GTUA 1XW9A 3MYDA 3DWVA 1K3YA 3EYTA 4GDFA 2YWMA 3US3A 5IQYA 1F2EA 2I4AA 1F3AA 2GS3A 2OKAA 5HQPA 3IA1A 1FAAA 3IR4A 3A3TA 3ERFA 1VGLA 2MYGA 1BEDA 4OMVA 4IVFA 2CAQA 4CDOA 1YKCA 3D0ZA 1YKAA 1EEJA 1B8XA 4ZB7A 1ZMAA 1XCCA 4OWYA 1K0AA 2HRAA 4QQ7A 4JE1A 1TK8B 2NDOA 3GH9A 4BL7B 4PTSA 1DBYA 3I9V2 1ZYNA 3O3TA 2PPTA 3WGDA 4K9ZA 1G7OA 9GSSA 5EPFA 5IOWA 4ECIA 4IBPA 3LGCA 1ZOFA 2VOCA 3EVIA 1YEXA 2CZ3A 1M9BA 4G10A 1TI3A 5LNKe 1M2AA 2EIOA 5A34A 2OBIA 5C04A 3LG6A 1SU9A 1OC9A 3A5WA 5J41A 3ZFLA 5L71A 2G2QA 2REMA 4G0LA 2X4AA 2GDRA 4IW9A 1U3AA 2GVPA 3DRNA 3VI5A 3LW9A 4PURA 3ERGA 1X5CA 4TR1B 4Z2TA 3HJMA 6GSWA 5IMDA 3MWHA 4DVCA 3BD2A 1PRXA 3EURA 2PVQA 3DGQA 4GWRA 1WIKA 3N9JA 3KP8A 1W4VA 2AYTA 2HRKB 2XPDA 4TKYA 5FHIA 3RBTA 5JWQB 3GL5A 4D73A 4IJIA 3BOAA 2C80A 4YQVA 2R0GA 2HYXA 2EFEA 5CYYA 1B4PA 2L5LA 1HNCA 4BPYA 2K8VA 1J08A 2VL3A 4BA7A 2V6KA 3GKNA 2C3NA 3PR8A 2VCVA 1A0RP 2M80A 1I5GA 1N25A 1SKWB 1OVNA 4WBRD 3DVXA 1S3CA 2R5GA 1UN2A 4FO5A 3W8JA 4NMUA 4AKIA 2M72A 1PSQA 2J23A 1PL2A 1M99A 4WXTA 2GGTA 4MJEA 4NV2A 4KGIA 5KN2A 3HJPA 1V57A 1G7EA 2VLUA 4G01A 18GSA 4FYCA 6GSXA 2CT6A 5ECHB 1O73A 4FH8A 5ID2A 2C1YA 5ECRB 2R6KA 3GMFA 1ON4A 2FY6A 2XBIA 1EOGA 4IKHA 2X99A 3GSTA 1X0RA 1A2LA 2JSYA 4ZXGA 2R2JA 3VI7A 1RW1A 2V2GA 4QMKA 2R37A 4TXOA 5HFIA 3QFAC 3QFBC 2OE3A 1EGRA 1S3DA 3G7IA 2FNOA 2DC5A 3EC3A 2K9FA 5DJLA 4LLRA 2AUVA 4CY6A 2IFQB 5FT3A 2HI7A 3KEBA 1A24A 4ZB9A 3HJOA 2GZZA 1PN9A 3SWLA 3ZIJA 2YZHA 5G5EA 3ME7A 4EO3A 3CTGA 3CRTA 2KUCA 5JWRB 2OJLA 2V6OA 1FO5A 4IELA 3IE3A 2JU5A 3F4TA 3P2AA 2H74A 4NHWA 3LFLA 5B8AA 1XW6A 1HQOA 4HQZA 1M9AA 3S9FA 1BQ7A 4YH2A 5IMFA 2YJHA 1SK1A 4KSOA 1T00A 3KIJA 5GAND 1N2AA 3M8NA 1X5DA 4V1Ag 5A5HB 2CX3A 3TRPA 1OYJA 2LTKA 1SKSB 3D22A 4KW6A 4TRXA 3RPPA 2BTOT 4KDXA 2ON7A 4BVXB 2IWTA 1XOAA 4POBA 1AQWA 2L6CA 3IHQA 5ABRA 2DJ0A 2ES7A 2H1GA 2LS5A 2K18A 4K6XA 2GZYA 4MF5A 2HZEB 2EFCA 4HDEA 3FHKA 5A1NB 4L5LA 2ALBA 4GCIA 2KOKA 1T7PB 4FQUA 4JRRA 4KCAA 4MPFA 5DBQA 5ECKB 1GP1A 3TKRA 4OFTA 1WOUA 1CQHA 3CMIA 3ZL5A 1XWGA 1H75A 1M7TA 4AKHA 4F2IA 6GSSA 4DSQA 1JHBA 2G0FA 4EKZA 2DKHA 3FK8A 2RIIA 3TU3B 3AY8A 3KGKA 3IOSA 4WEYA 1GNWA 3D4TA 2PERA 2YOIA 4G0IA 4V1Ap 3KTLA 2L5OA 3MDKA 3F63A 5J40A 2EFHA 2E2GA 3R3EA 1WPIA 4ZBBA 2LRTA 4ZL7A 5AN1A 5IMAA 1YY7A 2N5BA 3D4MA 2B5YA 1ERVA 3H93A 2C4JA 2DJ2A 2DIYA 2GT6A 5IPGA 3SBCA 1JLVA 2QGVA 5CRDA 3HDCA 2GZPA 5CREA 1IYIA 3FR3A 1A2JA 1SL1B 2C8UA 1GSEA 2H8LA 2VCQA 5HFKA 10GSA 2H6YA 1I9DA 3CRUA 4YQMA 1ZL9A 3CWGA 3LSZA 3H1NA 2IFQA 4Q5RA 1OE8A 2JZSA 5D96A 3KMOA 1K3LA 1LJRA 2H76A 4WBJA 5DQSA 4F9ZA 4GSNA 4GSSA 4Z2UA 1O7UA 2WJUA 4AKGA 4PNGA 3TKQA 5DQYA 1V40A 3U5RE 4HJMA 2GSTA 5KEJA 1AW9A 4AI6A 3QR6A 1T4YA 2P31A 4ILFA 4K7OA 4MPGA 1SK2A 3FMWA 3HY2A 3HA9A 1TKDB 3M9JA 1YDKA 1JLWA 3D6IA 1XW5A 8GSSA 1EGOA 14GSA 2VAFA 1XWCA 2YWNA 2TRXA 4IS0A 3GH6A 2H72A 4MP4A 2LJKA 4MLYA 4YKGA 1A0FA 5D93A 2CVBA 2DMMA 1K3OA 1Y1UA 3L78A 3KJYA 4K7IA 4BVXA 3ZIVA 3KMNA 4ZILA 2XC2A 1OKTA 4RI6A 3KH7A 1XWKA 3NOFA 1IYHA 3GKKA 3ZFBA 2I3YA 5E4WA 2B5XA 3TOTA 2A2PA 3L4NA 2HZEA 2HFDA 2V32A 4WR4A 2VL2C 5IO0A 1GSDA 5GSTA 4OD7A 4EXJA 2F51A 2O85A 1BAYA 2MMNA 3GFKA 2ZCTA 2OACA 5IM9A 5A4UA 3UOMA 4PQ1A 3GNJA 4ID0A 2FWFA 3FZ9A 2YJ7A 3M1GA 1K0BA 2WFCA 4IP1A 5ECLB 5CAXA 2HE3A 3VFIA 2F8AA 2M46A 4LA1A 1TXUA 4AJ8A 4L8EA 3Q6OA 3KM6A 2BJXA 3P7XA 1THXA 3O76A 2OA7A 2UZ8A 1Q4JA 4XHMA 1V98A 3UMAA 4EUYA 1T1VA 3UBLA 2XHFA 3BBYA 2GQKA 3KH9A 3CBUA 2WCIA 4O5UA 2IMIA 2QSIA 1BYEA 4MF6A 2LRCA 2WB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 22GS A;  3WD6 A;  4ZL9 A;  4FYB A;  1J0F A;  1KNG A;  1GTU A;  11GS A;  2DSA A;  2AV4 A;  2YNX A;  1TW9 A;  5ECO B;  3ZVJ A;  2HQT A;  1QQ2 A;  3CSJ A;  2H1D A;  2CVD A;  1G6W A;  2X64 A;  1RQM A;  4EE0 A;  1MDI A;  2JAD A;  3MNG A;  4Z7X A;  3I6A A;  4PX1 A;  2EIR A;  1ML6 A;  4N0Z A;  3ZTL A;  4J57 E;  5IMC A;  1GLQ A;  4X1U A;  3KXO A;  4GLT A;  3F0I A;  4TR3 A;  3E0U A;  3NIV A;  4EDZ A;  3HVV A;  2VCX A;  3VPT A;  1MTC A;  2KP1 A;  5EY6 A;  3EIN A;  4K8M A;  1DE2 A;  4POM A;  1TTZ A;  1TXX A;  2L6D A;  1NM3 A;  1GLP A;  2MZC A;  3TCO A;  4ZIJ A;  4JR4 A;  5F07 A;  3EMP A;  3QCP A;  5F05 A;  2GTU A;  4OCF A;  3HD5 A;  3F3R A;  4NWY A;  1QFN A;  2MBS A;  4J56 E;  2IMD A;  2E0Q A;  3ZZX A;  2DJK A;  5A5K A;  4XTS A;  2X8C A;  1N8J A;  4DSR A;  1TI1 A;  2H1A A;  3WGX A;  1ERW A;  4BVY B;  3J7Y k;  2WRT A;  3IC8 A;  5AIX A;  3QAG A;  5KN0 A;  4GQC A;  3TKP A;  5ELG A;  2MMO A;  1GSF A;  4ZB8 A;  3LWA A;  1H4O A;  5EVO A;  5A4V A;  1HYU A;  5B6M A;  2PVO C;  2O89 A;  3UEM A;  3HYP A;  4MZW A;  1LU4 A;  2KHP A;  3VPQ A;  1Z3E A;  1F37 A;  5J9C A;  4AGS A;  3KZQ A;  3ZRD A;  1ABA A;  1YQ1 A;  1RK4 A;  1GNE A;  4K2D A;  3TKS A;  2OE1 A;  2F3M A;  3PGT A;  4XS4 A;  5AGY A;  4YQU A;  1WE0 A;  1B4Q A;  4IQA A;  19GS A;  3DYR A;  4MDC A;  2VD0 A;  3TRQ A;  1A8Y A;  3CYN A;  3NZN A;  2HSM B;  1UC7 A;  1GSU A;  3LXT A;  1EP8 A;  2C0D A;  1PMT A;  5G1L A;  5GAP D;  4KUN A;  3QAV A;  1O85 A;  4HI7 A;  4OO4 A;  1V58 A;  3RHB A;  3HXS A;  3CTF A;  3GA4 A;  1U87 A;  1GUH A;  3TOU A;  4ECC A;  1NHY A;  1E6B A;  2PUK C;  1K0M A;  5G1K A;  1OC3 A;  4G0K A;  4MAB A;  1GL8 A;  3RPN A;  3GYK A;  5H5R A;  3M9K A;  1NW2 A;  2FLS A;  5G5F A;  4KSM A;  2FGX A;  1HNB A;  5A4W A;  2ZNM A;  1K0C A;  1XFL A;  4OFM A;  5DCG A;  1VRS D;  2MBT A;  4BL7 A;  3QDN A;  5J3R A;  1AC1 A;  4I5Q A;  5CNW A;  5DAL B;  4N30 A;  4GXZ A;  3F6D A;  2MMA A;  1GSS A;  5D73 A;  4JU5 A;  3GRX A;  2H66 A;  2NPB A;  4X0X A;  1TOF A;  5CRW A;  1QUW A;  1XBS A;  2WZ9 A;  2DJ3 A;  3FRC A;  3R2Q A;  5IMZ A;  2CV4 A;  4O92 A;  1XXU A;  2DLX A;  3C1S A;  3H4K A;  4ACS A;  4L0U A;  5C00 A;  5JWO B;  1QMV A;  3FYG A;  2HSY A;  1F3B A;  4JZQ A;  5ECP B;  13GS A;  3LQ7 A;  3F4R A;  4KE3 A;  2HSH A;  2DJJ A;  2EIQ A;  4KAE A;  4TR1 A;  1JZD A;  3UAP A;  1O8W A;  2VCW A;  4KX4 A;  2CAI A;  3ZMK A;  3DXB A;  1R26 A;  3GIX A;  1X5E A;  1GTA A;  3QPM A;  2LJR A;  2HNL A;  1OKD A;  2HZF A;  3APS A;  2HRK A;  3VK9 A;  2RLI A;  3QD9 A;  3JCM L;  3ZIT A;  4GF0 A;  4YAV A;  1JZW A;  3C73 A;  5HR2 A;  3ZRE A;  1TRV A;  1SJZ A;  3DKS A;  5COH A;  1QGV A;  2RM5 A;  3LJR A;  3RHC A;  1W89 A;  2VLV A;  4F03 A;  2LNT A;  2AHE A;  4BVY A;  2WDU A;  3GUR A;  3GUS A;  4JR6 A;  4QL7 A;  3F6F A;  1ZZY A;  5DJM A;  4L0W A;  3C8E A;  1FG4 A;  2YAN A;  3V1W A;  1TJD A;  2QC7 A;  1DE1 A;  3F3Q A;  3TB2 A;  5LCZ A;  3EU3 A;  5DAK B;  1EZK A;  1U88 A;  3C1R A;  2RUF A;  5LD0 A;  3Q74 A;  2H70 A;  2LQO A;  1T4Z A;  4ISD A;  1GH2 A;  2HSN B;  3DEX A;  3BJ5 A;  5AIS A;  1DUG A;  2P5Q A;  1Z6N A;  2B1L A;  2K8S A;  1FHE A;  4G9H A;  1MDK A;  3Q19 A;  4XS6 A;  1PKZ A;  4POK A;  4IQ1 A;  1PX6 A;  2L59 A;  2FWH A;  2LST A;  2PU9 C;  3LYK A;  2IMK A;  2CZ2 A;  4MK3 A;  3ZYW A;  1AXD A;  4ZL8 A;  3QMX A;  1GWC A;  4ML6 A;  4XRA A;  5JCU A;  3OR5 A;  1PQN A;  1V9W A;  1OE7 A;  4MJA A;  5B7C A;  2JAC A;  3KP9 A;  3DIE A;  2YZU A;  3IC4 A;  1Y6E A;  4H86 A;  4EL1 A;  2OBK A;  4XIH A;  2TRC P;  2AJQ B;  4LMW A;  3IXR A;  4BWQ A;  1ZCP A;  1VF3 A;  2P0G A;  2C0E A;  2C3Q A;  1X9W B;  5JCG A;  4WKW A;  5DAL A;  1DSB A;  1FB0 A;  2VM2 A;  1OC9 B;  2H71 A;  3LYP A;  2H01 A;  4TVE A;  5ECS A;  2YV7 A;  2DML A;  4LL4 B;  2VCT A;  1TRW A;  2L4Q A;  5HFG A;  2NVL A;  2I1U A;  2RM6 A;  1URM A;  1J9B A;  2H0I A;  1X9M B;  2E7P A;  4MF7 A;  4ECB A;  4DEJ A;  5ECI B;  6GSV A;  6GSU A;  4F0C A;  2LRN A;  2LUS A;  4PNF A;  4JBB A;  2NBS A;  3E9J B;  2NTO A;  2FHE A;  4ZBD A;  3VLN A;  4MJC A;  4ML1 A;  2RUE A;  3W8S A;  4I2U A;  3DML A;  5CO3 A;  4MH2 A;  4D73 B;  7GSS A;  3TJJ A;  4F0B A;  1SJ6 A;  1XVW A;  3FR6 A;  3PH9 A;  2IME A;  4NPB A;  3TUE A;  4LL1 B;  1ACV A;  5CRG A;  2KLX A;  4KB3 A;  1GSY A;  3P8W A;  2A4V A;  2VM1 A;  3GHA A;  4PQI A;  4KND A;  1USB A;  2PBJ A;  1FB6 A;  3U6V A;  2O87 A;  2YN1 A;  3BCK A;  2JL4 A;  4MZB A;  3FKF A;  3D21 A;  4IGJ A;  2H75 A;  2J9H A;  5D9W A;  17GS A;  4Q5N A;  2OAD A;  2P5R A;  2N5F A;  1PGT A;  1SJI A;  1TU7 A;  2FUG 2;  1R5P A;  1Z5Y E;  3IRA A;  4HJ2 A;  1OC8 A;  3GTU B;  2LNS A;  1B9Y C;  1TP9 A;  3FEU A;  2VO4 A;  5DAK A;  1AUC A;  5DCH A;  2C0F A;  2VIM A;  2IIY A;  1Z6M A;  4HU7 A;  1WWJ A;  2LV3 A;  1LBK A;  1M2D A;  2R3X A;  1TU8 A;  2I81 A;  4X43 A;  3Q18 A;  4NV5 A;  5GSS A;  2C3T A;  2A2S A;  3IK7 A;  1WMJ A;  1XOB A;  4HEA 2;  2MMZ A;  2DJ1 A;  2FA8 A;  5G30 A;  4PQH A;  1ZYE A;  3WT2 A;  4TXO B;  4Q5Q A;  2V41 A;  4MZC A;  5F8B A;  4ECJ A;  4GRF A;  5DDL A;  2GQM A;  4HZ2 A;  4DSS B;  4CW9 A;  3EE2 A;  4IN0 A;  16GS A;  5INY A;  2GLR A;  2IMF A;  4O32 A;  3C7M A;  3M3M A;  1TRU A;  5G31 A;  3K8N A;  5ENU A;  1O6J A;  3VWU A;  3ISO A;  2X8G A;  1R4W A;  2AB6 A;  1Z7R A;  1T8E B;  2H6X A;  1UVZ A;  3FZ4 A;  5G2Z A;  2VCZ A;  4QL9 A;  1K0N A;  1TK5 B;  1SYR A;  3M0F A;  1WRY A;  1EOH A;  1QXH A;  1S3A A;  4N0V A;  20GS A;  3VUR A;  4HOJ A;  4MH3 A;  5B8B A;  3CSH A;  3QOU A;  1TK0 B;  1ZGN A;  2GSQ A;  2IL3 A;  6GSY A;  4TR4 A;  4POL A;  2VL9 A;  2LQQ A;  3J7Y b;  1A2M A;  3EU4 A;  1ST9 A;  3G7Y A;  2B6M A;  4RI7 A;  2BMX A;  2PMT A;  1WJK A;  5D9X A;  1CQG A;  1EV4 A;  4IJ3 A;  4I6X A;  4EDY A;  3UJ1 A;  3W6G A;  3HZ8 A;  3GKX A;  4MMM A;  4XCS A;  5GZZ B;  2IPA A;  2N5A A;  3WT1 A;  3HKR A;  2H0G A;  1GTB A;  3TKS C;  4EVM A;  1K0O A;  3IAM 2;  1GTI A;  4ZB6 A;  1T3B A;  1K0D A;  5DVB A;  2E2M A;  1VF4 A;  3I43 A;  1R7H A;  2HLS A;  5ECM B;  2FWG A;  4NXI A;  3EWL A;  2GT5 A;  3CXG A;  1WP0 A;  4I97 A;  1MDJ A;  4OCE A;  3GN3 A;  2B1K A;  1XZO A;  4O5R A;  3CSI A;  4N10 A;  4AF2 A;  4TR0 A;  3HZ4 A;  4E8H A;  1FVK A;  2KP2 A;  1X9S B;  1AIU A;  5JCW A;  4XS1 A;  1YZX A;  3UIW A;  2CA8 A;  3L9U A;  4O7H A;  3GTU A;  1GUM A;  1YJ6 A;  2ON5 A;  2YWI A;  1XWA A;  3IAS 2;  2GSS A;  3TDG A;  4IHU A;  5CRH A;  2YPM A;  5IO2 A;  5E59 A;  12GS A;  3F9U A;  2LEG A;  4G19 A;  4HS1 A;  4KF9 A;  4WR5 A;  1G6Y A;  4AJ7 A;  1SEN A;  2EC4 A;  4PUA A;  4FYU A;  1QK8 A;  4JED A;  1XPV A;  3VWW A;  3KD0 A;  6GST A;  3O6T A;  4WET A;  4ULX A;  5HR0 A;  3ZML A;  3LEF A;  4Q5F A;  2AAW A;  1KBN A;  1E2Y A;  1C72 A;  1JZO A;  2HRN A;  5J5N A;  4PGT A;  4GST A;  1B48 A;  4ZBA A;  2V1M A;  3HVS A;  3TRX A;  2H1B A;  1ILO A;  3QAW A;  4KDU A;  5F0G A;  1AAZ A;  4DSS A;  3FZA A;  2B5E A;  2JZT A;  3IK9 A;  4HQS A;  2PN8 A;  2QKE A;  1R5A A;  3LOR A;  3UL3 A;  1SL0 B;  2HXK A;  4N11 A;  3TGZ A;  4L5O A;  5J9B A;  1SYX A;  3WYW A;  3PPU A;  2FD3 A;  4LMV A;  4J2F A;  1VF2 A;  1SL2 B;  2X8H A;  5KN1 A;  1SD8 A;  2TIR A;  4RQX A;  3A2W A;  3LXZ A;  4HUA A;  4USS A;  1A8L A;  1SKR B;  5HR1 A;  3DVW A;  3ED3 A;  3FR9 A;  3G7J A;  3MAK A;  1YF1 A;  2Z9S A;  3F8U A;  4GQF A;  1PL1 A;  4KCE A;  2XPE A;  3GKM A;  5IIZ A;  2B7K A;  4V2L A;  2DIZ A;  1OAZ A;  4MCU A;  3N5O A;  4TW5 A;  5BMU A;  5D9V A;  3G9B A;  3APQ A;  1YEP A;  3L0H A;  3D5J A;  4K1F A;  3ERW A;  3BCI A;  5IOX A;  4CHS A;  4K7N A;  3I69 A;  1KTE A;  5B6N A;  3L9S A;  2R4V A;  3UAR A;  4AJ6 A;  1FOV A;  1PA3 A;  2LKU A;  3L9V A;  5F06 A;  1NHO A;  4F82 A;  1O8X A;  3PIN A;  1F6M C;  1EEM A;  3HVX A;  3UVH A;  1HNA A;  1SD9 A;  3GL3 A;  2K6V A;  2HRF A;  2WGR A;  2O7K A;  3EMX A;  4TN8 A;  3TJG A;  5HR3 A;  4K0G A;  1O81 A;  1EWX A;  5CP1 A;  1ZYQ B;  1ERU A;  2CX4 A;  2CVK A;  2OE0 A;  3ZVJ D;  4TXV A;  5ECQ B;  4FIW A;  2DBC A;  1EP7 A;  2B7J A;  1M2B A;  4WF4 A;  2HSM A;  1A23 A;  4NAX A;  2CQ9 A;  3H79 A;  2H0H A;  3FW2 A;  3FY7 A;  2H30 A;  5H5S A;  3ZLP A;  4PXO A;  3APO A;  1HD2 A;  4V2M A;  1XIY A;  3DD3 A;  2WUL A;  3RDW A;  1EV9 A;  3UBK A;  1XWB A;  1Y25 A;  3ME8 A;  5KN3 A;  4RQR A;  1SK0 A;  5ECN B;  1THO A;  3IPZ A;  3RAZ A;  4EC0 A;  1MD3 A;  5AIV A;  5D8I A;  3GV1 A;  3MSZ A;  4RUV A;  2YP6 A;  5IMV A;  1U6T A;  2O8V B;  4HZ4 A;  1FVJ A;  3A2V A;  3IV4 A;  4HU9 A;  4V2N A;  1PX7 A;  2XBQ A;  3WGE A;  2L4C A;  3H8Q A;  4EF0 A;  4YAP A;  3KCM A;  1BJX A;  2FCH A;  1ERT A;  3IDV A;  4MJB A;  2JSZ A;  4I2T A;  1GSQ A;  1KEB A;  2H19 A;  3FZ5 A;  4KH7 A;  3KTB A;  2VLT A;  5D9T A;  4BWS A;  1B9X C;  1XVQ A;  2H73 A;  1JFU A;  2YCD A;  4TOP A;  1G0T A;  2VD1 A;  4OFN A;  3P90 A;  3VWV A;  4E8E A;  1F9M A;  5EL8 A;  1YF0 A;  4KA0 A;  1PKW A;  1VF1 A;  2PGT A;  2GQL A;  4PUF C;  3UVT A;  1TDI A;  2FWE A;  1V2A A;  3F4S A;  3TJB A;  1AQX A;  5ELA A;  3HHV A;  1MD4 A;  4WF5 A;  2F8F A;  2F9S A;  1BX9 A;  4I8B A;  3C71 A;  1PD2 1;  1Z9H A;  3GSS A;  1Q98 A;  1U3I A;  1GUL A;  1JZR A;  1AQV A;  4P3Y B;  3TJK A;  4KDY A;  4G2E A;  1BG5 A;  2H6Z A;  2YV9 A;  4MA9 A;  1NSW A;  2FA4 A;  3GX8 A;  3VWX A;  3IBH A;  1GRX A;  3HCZ A;  5J4U A;  2I9H A;  1FW1 A;  2B3S A;  1GUK A;  4IP6 A;  3A2X A;  2HT9 A;  2L57 A;  3TJF A;  2LJA A;  3E3E A;  3GX0 A;  2IJY A;  2IN3 A;  1Z7P A;  3TKS E;  2YWO A;  2PWJ A;  2ZUP A;  1MEK A;  4OO5 A;  4XS4 B;  1M0U A;  1UA5 A;  2D2Z A;  4K0N A;  5IPH A;  2JZR A;  2A2R A;  4NHZ A;  2WS2 A;  1TRS A;  5ID2 B;  5FWG A;  4XRD A;  5H5Q A;  2C0G A;  2VUP A;  2GSR A;  2VL2 A;  4GTU A;  1XW9 A;  3DWV A;  1K3Y A;  3EYT A;  2YWM A;  3US3 A;  5IQY A;  1F2E A;  2I4A A;  1F3A A;  2GS3 A;  2OKA A;  5HQP A;  3IA1 A;  1FAA A;  3IR4 A;  3A3T A;  3ERF A;  1VGL A;  2MYG A;  1BED A;  4OMV A;  4IVF A;  2CAQ A;  4CDO A;  1YKC A;  3D0Z A;  1YKA A;  1EEJ A;  1B8X A;  1ZMA A;  1XCC A;  4OWY A;  1K0A A;  2HRA A;  4QQ7 A;  4JE1 A;  1TK8 B;  2NDO A;  3GH9 A;  4BL7 B;  4PTS A;  1DBY A;  3I9V 2;  3O3T A;  2PPT A;  3WGD A;  4K9Z A;  1G7O A;  9GSS A;  5EPF A;  5IOW A;  4ECI A;  4IBP A;  3LGC A;  1ZOF A;  2VOC A;  3EVI A;  1YEX A;  2CZ3 A;  1M9B A;  4G10 A;  1TI3 A;  5LNK e;  1M2A A;  2EIO A;  2OBI A;  5C04 A;  3LG6 A;  1SU9 A;  1OC9 A;  3A5W A;  5J41 A;  3ZFL A;  5L71 A;  2G2Q A;  2REM A;  4G0L A;  2GDR A;  4IW9 A;  1U3A A;  2GVP A;  3DRN A;  3VI5 A;  4PUR A;  3ERG A;  1X5C A;  4TR1 B;  3HJM A;  6GSW A;  5IMD A;  3MWH A;  4DVC A;  3BD2 A;  1PRX A;  3EUR A;  2PVQ A;  3DGQ A;  4GWR A;  1WIK A;  3N9J A;  3KP8 A;  1W4V A;  2AYT A;  2HRK B;  2XPD A;  4TKY A;  5FHI A;  3RBT A;  5JWQ B;  3GL5 A;  4D73 A;  4IJI A;  3BOA A;  2C80 A;  4YQV A;  2HYX A;  5CYY A;  1B4P A;  2L5L A;  1HNC A;  4BPY A;  2K8V A;  1J08 A;  2VL3 A;  4BA7 A;  2V6K A;  3GKN A;  2C3N A;  3PR8 A;  2VCV A;  1A0R P;  2M80 A;  1I5G A;  1SKW B;  1OVN A;  4WBR D;  3DVX A;  1S3C A;  2R5G A;  1UN2 A;  4FO5 A;  3W8J A;  4NMU A;  2M72 A;  1PSQ A;  2J23 A;  1PL2 A;  1M99 A;  4WXT A;  2GGT A;  4MJE A;  4NV2 A;  4KGI A;  5KN2 A;  3HJP A;  1V57 A;  1G7E A;  2VLU A;  18GS A;  4FYC A;  6GSX A;  2CT6 A;  5ECH B;  1O73 A;  4FH8 A;  5ID2 A;  2C1Y A;  5ECR B;  2R6K A;  3GMF A;  1ON4 A;  2FY6 A;  2XBI A;  1EOG A;  4IKH A;  2X99 A;  3GST A;  1X0R A;  1A2L A;  2JSY A;  4ZXG A;  2R2J A;  3VI7 A;  1RW1 A;  2V2G A;  2R37 A;  4TXO A;  5HFI A;  3QFA C;  3QFB C;  2OE3 A;  1EGR A;  1S3D A;  3G7I A;  2FNO A;  2DC5 A;  3EC3 A;  2K9F A;  5DJL A;  4LLR A;  2AUV A;  2IFQ B;  5FT3 A;  2HI7 A;  3KEB A;  1A24 A;  4ZB9 A;  3HJO A;  2GZZ A;  1PN9 A;  3SWL A;  3ZIJ A;  2YZH A;  5G5E A;  3ME7 A;  4EO3 A;  3CTG A;  3CRT A;  2KUC A;  5JWR B;  2OJL A;  2V6O A;  1FO5 A;  4IEL A;  3IE3 A;  2JU5 A;  3F4T A;  3P2A A;  2H74 A;  4NHW A;  3LFL A;  5B8A A;  1XW6 A;  1HQO A;  4HQZ A;  1M9A A;  3S9F A;  1BQ7 A;  4YH2 A;  5IMF A;  2YJH A;  1SK1 A;  4KSO A;  1T00 A;  3KIJ A;  5GAN D;  1N2A A;  3M8N A;  1X5D A;  4V1A g;  2CX3 A;  3TRP A;  1OYJ A;  2LTK A;  1SKS B;  3D22 A;  4KW6 A;  4TRX A;  3RPP A;  2BTO T;  4KDX A;  2ON7 A;  4BVX B;  2IWT A;  1XOA A;  4POB A;  1AQW A;  2L6C A;  3IHQ A;  5ABR A;  2DJ0 A;  2ES7 A;  2H1G A;  2LS5 A;  2K18 A;  4K6X A;  2GZY A;  4MF5 A;  2HZE B;  4HDE A;  3FHK A;  4L5L A;  2ALB A;  4GCI A;  2KOK A;  1T7P B;  4FQU A;  4JRR A;  4KCA A;  4MPF A;  5DBQ A;  5ECK B;  1GP1 A;  3TKR A;  4OFT A;  1WOU A;  1CQH A;  3CMI A;  3ZL5 A;  1XWG A;  1H75 A;  1M7T A;  4F2I A;  1JHB A;  6GSS A;  4DSQ A;  2G0F A;  4EKZ A;  3FK8 A;  2RII A;  3AY8 A;  3KGK A;  3IOS A;  4WEY A;  1GNW A;  3D4T A;  2PER A;  2YOI A;  4G0I A;  4V1A p;  3KTL A;  2L5O A;  3MDK A;  3F63 A;  2E2G A;  3R3E A;  1WPI A;  4ZBB A;  2LRT A;  4ZL7 A;  5AN1 A;  5IMA A;  1YY7 A;  2N5B A;  3D4M A;  2B5Y A;  1ERV A;  3H93 A;  2C4J A;  2DJ2 A;  2DIY A;  2GT6 A;  5IPG A;  3SBC A;  1JLV A;  2QGV A;  5CRD A;  3HDC A;  2GZP A;  5CRE A;  1IYI A;  3FR3 A;  1A2J A;  1SL1 B;  2C8U A;  1GSE A;  2H8L A;  2VCQ A;  5HFK A;  10GS A;  2H6Y A;  1I9D A;  3CRU A;  4YQM A;  1ZL9 A;  3LSZ A;  3H1N A;  2IFQ A;  4Q5R A;  1OE8 A;  2JZS A;  5D96 A;  3KMO A;  1K3L A;  1LJR A;  2H76 A;  4WBJ A;  5DQS A;  4F9Z A;  4GSN A;  4GSS A;  1O7U A;  2WJU A;  4PNG A;  3TKQ A;  5DQY A;  1V40 A;  3U5R E;  4HJM A;  2GST A;  5KEJ A;  1AW9 A;  3QR6 A;  1T4Y A;  2P31 A;  4ILF A;  4K7O A;  4MPG A;  1SK2 A;  3HY2 A;  3HA9 A;  1TKD B;  3M9J A;  1YDK A;  1JLW A;  3D6I A;  1XW5 A;  8GSS A;  1EGO A;  14GS A;  2VAF A;  1XWC A;  2YWN A;  2TRX A;  4IS0 A;  3GH6 A;  2H72 A;  4MP4 A;  2LJK A;  4MLY A;  1A0F A;  5D93 A;  2CVB A;  2DMM A;  1K3O A;  3L78 A;  3KJY A;  4K7I A;  4BVX A;  3ZIV A;  3KMN A;  4ZIL A;  2XC2 A;  1OKT A;  4RI6 A;  3KH7 A;  1XWK A;  3NOF A;  1IYH A;  3GKK A;  3ZFB A;  2I3Y A;  5E4W A;  2B5X A;  3TOT A;  3L4N A;  2HZE A;  2HFD A;  2V32 A;  4WR4 A;  2VL2 C;  5IO0 A;  1GSD A;  5GST A;  4OD7 A;  4EXJ A;  2F51 A;  2O85 A;  1BAY A;  2MMN A;  3GFK A;  2ZCT A;  2OAC A;  5IM9 A;  5A4U A;  3UOM A;  4PQ1 A;  3GNJ A;  4ID0 A;  2FWF A;  3FZ9 A;  2YJ7 A;  3M1G A;  1K0B A;  2WFC A;  4IP1 A;  5ECL B;  5CAX A;  2HE3 A;  3VFI A;  2F8A A;  2M46 A;  4LA1 A;  4AJ8 A;  4L8E A;  3Q6O A;  3KM6 A;  2BJX A;  3P7X A;  1THX A;  3O76 A;  2OA7 A;  2UZ8 A;  1Q4J A;  4XHM A;  1V98 A;  3UMA A;  4EUY A;  1T1V A;  3UBL A;  2XHF A;  3BBY A;  2GQK A;  3KH9 A;  3CBU A;  2WCI A;  2IMI A;  2QSI A;  1BYE A;  4MF6 A;  2LRC A;  2WB9 A; 
#chains in the Genus database with same CATH topology
 22GS A;  3WD6 A;  4ZL9 A;  1BG1 A;  4FYB A;  1J0F A;  1KNG A;  1GTU A;  11GS A;  2DSA A;  2AV4 A;  2YNX A;  1TW9 A;  5ECO B;  3ZVJ A;  2HQT A;  1QQ2 A;  3CSJ A;  2H1D A;  2CVD A;  1G6W A;  2X64 A;  1RQM A;  4EE0 A;  1MDI A;  2JAD A;  3MNG A;  4Z7X A;  3I6A A;  4PX1 A;  2EIR A;  1ML6 A;  4N0Z A;  3ZTL A;  4J57 E;  5IMC A;  1GLQ A;  4MNN A;  4X1U A;  3KXO A;  4GLT A;  3F0I A;  4TR3 A;  3E0U A;  3NIV A;  4EDZ A;  3HVV A;  2VCX A;  3VPT A;  1MTC A;  2KP1 A;  5EY6 A;  3EIN A;  4K8M A;  1DE2 A;  4POM A;  1TTZ A;  1TXX A;  2L6D A;  1NM3 A;  1GLP A;  2MZC A;  3TCO A;  4ZIJ A;  4JR4 A;  5F07 A;  5BMU B;  3EMP A;  3QCP A;  5BRT A;  5F05 A;  2GTU A;  4OCF A;  3HD5 A;  2DKI A;  3F3R A;  4NWY A;  1QFN A;  2MBS A;  4J56 E;  2IMD A;  4X4J A;  2E0Q A;  3ZZX A;  2DJK A;  5A5K A;  4XTS A;  2X8C A;  1N8J A;  4DSR A;  2QA1 A;  1TI1 A;  2H1A A;  3WGX A;  1ERW A;  4BVY B;  3J7Y k;  2WRT A;  3IC8 A;  5AIX A;  3QAG A;  5KN0 A;  4GQC A;  3TKP A;  5ELG A;  1SVL A;  2MMO A;  1GSF A;  4ZB8 A;  1H4O A;  3LWA A;  5EVO A;  5A4V A;  1HYU A;  5B6M A;  5KOX A;  2PVO C;  2O89 A;  2O5V A;  3UEM A;  3HYP A;  4MZW A;  1LU4 A;  2KHP A;  3VPQ A;  1Z3E A;  1F37 A;  5J9C A;  4AGS A;  3KZQ A;  3ZRD A;  1ABA A;  1YQ1 A;  1RK4 A;  1GNE A;  4K2D A;  3TKS A;  2OE1 A;  2F3M A;  4AKX B;  3PGT A;  4XS4 A;  5AGY A;  4YQU A;  1WE0 A;  1B4Q A;  4IQA A;  19GS A;  3DYR A;  4MDC A;  2WW2 A;  2VD0 A;  3TRQ A;  1A8Y A;  3CYN A;  2HSM B;  1UC7 A;  3NZN A;  1GSU A;  3LXT A;  1EP8 A;  2C0D A;  1YEW C;  1PMT A;  5G1L A;  5GAP D;  4KUN A;  3HMJ G;  3QAV A;  1O85 A;  4HI7 A;  4OO4 A;  1V58 A;  3RHB A;  3HXS A;  3CTF A;  3GA4 A;  1U87 A;  1GUH A;  3TOU A;  1FOH A;  4ECC A;  1NHY A;  1E6B A;  1XG8 A;  2PUK C;  1K0M A;  5G1K A;  1OC3 A;  4G0K A;  4MAB A;  1GL8 A;  3RPN A;  3GYK A;  5H5R A;  3M9K A;  1NW2 A;  4O5Q A;  2FLS A;  5G5F A;  4KSM A;  2FGX A;  1HNB A;  5A4W A;  2ZNM A;  1K0C A;  1XFL A;  4OFM A;  5DCG A;  1VRS D;  2MBT A;  4BL7 A;  3QDN A;  5J3R A;  1AC1 A;  4I5Q A;  5CNW A;  5DAL B;  4N30 A;  4GXZ A;  3F6D A;  2MMA A;  1GSS A;  5D73 A;  4JU5 A;  3GRX A;  2H66 A;  2NPB A;  4X0X A;  1TOF A;  5CRW A;  1QUW A;  1XBS A;  2WZ9 A;  2WVY A;  2DJ3 A;  3FRC A;  3R2Q A;  5IMZ A;  2CV4 A;  4O92 A;  1XXU A;  2DLX A;  3C1S A;  3H4K A;  4ACS A;  4L0U A;  5C00 A;  5JWO B;  1QMV A;  3FYG A;  2HSY A;  1F3B A;  4JZQ A;  5ECP B;  13GS A;  3LQ7 A;  3F4R A;  4KE3 A;  2HSH A;  2DJJ A;  2EIQ A;  4KAE A;  4TR1 A;  1JZD A;  3UAP A;  1O8W A;  2VCW A;  4KX4 A;  2CAI A;  3ZMK A;  3DXB A;  1R26 A;  3GIX A;  1X5E A;  1GTA A;  3QPM A;  2LJR A;  2HNL A;  1OKD A;  2HZF A;  3APS A;  2HRK A;  3VK9 A;  2RLI A;  3QD9 A;  3JCM L;  3ZIT A;  4GF0 A;  4YAV A;  1JZW A;  3C73 A;  5HR2 A;  3ZRE A;  1TRV A;  1SJZ A;  3DKS A;  5COH A;  1QGV A;  2RM5 A;  3LJR A;  3RHC A;  1W89 A;  2VLV A;  3EPT A;  4F03 A;  2LNT A;  2AHE A;  4BVY A;  2WDU A;  3GUR A;  3GUS A;  4JR6 A;  4QL7 A;  3F6F A;  1ZZY A;  5DJM A;  4L0W A;  3C8E A;  1FG4 A;  2YAN A;  3V1W A;  1TJD A;  2QC7 A;  1DE1 A;  3F3Q A;  2VKZ G;  3TB2 A;  5LCZ A;  3EU3 A;  5DAK B;  1EZK A;  1U88 A;  3C1R A;  2RUF A;  5LD0 A;  3Q74 A;  4K5S A;  2H70 A;  2LQO A;  1T4Z A;  4ISD A;  2H1L A;  1GH2 A;  2HSN B;  3DEX A;  3BJ5 A;  5AIS A;  1DUG A;  2P5Q A;  1Z6N A;  2B1L A;  2K8S A;  1FHE A;  4G9H A;  1MDK A;  3Q19 A;  4XS6 A;  1PKZ A;  4POK A;  4IQ1 A;  1PX6 A;  2L59 A;  2FWH A;  1I1I P;  2LST A;  2PU9 C;  3LYK A;  2IMK A;  2CZ2 A;  4MK3 A;  3ZYW A;  1AXD A;  4ZL8 A;  3QMX A;  1GWC A;  4ML6 A;  4EIP A;  4XRA A;  5JCU A;  3OR5 A;  1PQN A;  1V9W A;  1OE7 A;  4MJA A;  5B7C A;  2JAC A;  3KP9 A;  3DIE A;  2YZU A;  3IC4 A;  1Y6E A;  5KOW A;  4H86 A;  4EL1 A;  2OBK A;  4XIH A;  2TRC P;  2AJQ B;  4LMW A;  3IXR A;  4BWQ A;  1ZCP A;  1VF3 A;  2P0G A;  2C0E A;  2C3Q A;  1X9W B;  4K2X A;  5JCG A;  4WKW A;  5DAL A;  1DSB A;  1FB0 A;  2VM2 A;  1OC9 B;  2H71 A;  3LYP A;  2H01 A;  4TVE A;  5ECS A;  2YV7 A;  2DML A;  4LL4 B;  2VCT A;  1TRW A;  2L4Q A;  5HFG A;  2NVL A;  2I1U A;  2RM6 A;  1URM A;  1J9B A;  2H0I A;  1X9M B;  2E7P A;  4MF7 A;  4ECB A;  4DEJ A;  5ECI B;  6GSV A;  6GSU A;  4F0C A;  2LRN A;  2LUS A;  4PNF A;  4JBB A;  2NBS A;  3E9J B;  2NTO A;  2FHE A;  4ZBD A;  4YKF A;  3VLN A;  4MJC A;  4ML1 A;  2RUE A;  3W8S A;  4W66 A;  4I2U A;  1SVO A;  3DML A;  5CO3 A;  5A5H A;  4MH2 A;  4D73 B;  7GSS A;  3TJJ A;  4F0B A;  1SJ6 A;  1XVW A;  3FR6 A;  3PH9 A;  2IME A;  4NPB A;  3TUE A;  4LL1 B;  1ACV A;  5CRG A;  4N3Z A;  2KLX A;  4KB3 A;  1GSY A;  3P8W A;  2A4V A;  2VM1 A;  3GHA A;  4PQI A;  4KND A;  1USB A;  2PBJ A;  2R0P A;  1FB6 A;  3U6V A;  2O87 A;  2YN1 A;  3BCK A;  2JL4 A;  4MZB A;  3FKF A;  3D21 A;  4IGJ A;  2H75 A;  2J9H A;  5D9W A;  5A1N A;  5J4V A;  17GS A;  4Q5N A;  2OAD A;  2P5R A;  2N5F A;  1PGT A;  2R0C A;  1SJI A;  1TU7 A;  2FUG 2;  1R5P A;  1Z5Y E;  3IRA A;  4HJ2 A;  1OC8 A;  3GTU B;  2LNS A;  1B9Y C;  1TP9 A;  3FEU A;  2VO4 A;  5DAK A;  1AUC A;  5DCH A;  2C0F A;  2VIM A;  2IIY A;  1Z6M A;  4HU7 A;  1WWJ A;  2LV3 A;  1LBK A;  1M2D A;  2R3X A;  1TU8 A;  2I81 A;  4X43 A;  3Q18 A;  4NV5 A;  5GSS A;  2C3T A;  2A2S A;  4HSC X;  3IK7 A;  1WMJ A;  1XOB A;  2HSN A;  4HEA 2;  2MMZ A;  1PFO A;  2DJ1 A;  2FA8 A;  5G30 A;  4PQH A;  1ZYE A;  3WT2 A;  4TXO B;  4Q5Q A;  2V41 A;  3RGB C;  4MZC A;  5F8B A;  4ECJ A;  4GRF A;  5DDL A;  2GQM A;  4HZ2 A;  4DSS B;  4CW9 A;  3A5I A;  3EE2 A;  4IN0 A;  16GS A;  5INY A;  2GLR A;  2IMF A;  4O32 A;  3C7M A;  3M3M A;  1TRU A;  5G31 A;  3K8N A;  5ENU A;  1SVM A;  1O6J A;  3VWU A;  2A4H A;  3ISO A;  2X8G A;  4CY8 A;  1R4W A;  2AB6 A;  1Z7R A;  1T8E B;  2H6X A;  1UVZ A;  3FZ4 A;  5G2Z A;  2VCZ A;  4QL9 A;  1K0N A;  1TK5 B;  1SYR A;  3M0F A;  1WRY A;  1EOH A;  1QXH A;  1S3A A;  4N0V A;  20GS A;  3VUR A;  4HOJ A;  4MH3 A;  5B8B A;  3CSH A;  3QOU A;  1TK0 B;  1ZGN A;  2GSQ A;  2IL3 A;  6GSY A;  4TR4 A;  2UV8 G;  4POL A;  2VL9 A;  2LQQ A;  3J7Y b;  1A2M A;  3EU4 A;  1ST9 A;  3G7Y A;  2B6M A;  4RI7 A;  2BMX A;  2PMT A;  1WJK A;  5D9X A;  1CQG A;  1EV4 A;  4IJ3 A;  4I6X A;  4EDY A;  3UJ1 A;  3W6G A;  3HZ8 A;  3GKX A;  4MMM A;  3IHG A;  4XCS A;  5GZZ B;  2IPA A;  2N5A A;  3WT1 A;  3HKR A;  2QA2 A;  2H0G A;  1GTB A;  3TKS C;  4EVM A;  1K0O A;  3IAM 2;  1GTI A;  4ZB6 A;  1BF5 A;  1T3B A;  1K0D A;  5DVB A;  2E2M A;  1VF4 A;  3I43 A;  1R7H A;  2HLS A;  5ECM B;  2FWG A;  4NXI A;  3EWL A;  4A5P A;  2GT5 A;  3CXG A;  1WP0 A;  4I97 A;  1MDJ A;  4OCE A;  3GN3 A;  2B1K A;  1XZO A;  4O5R A;  3CSI A;  4N10 A;  4AF2 A;  4TR0 A;  3HZ4 A;  4E8H A;  1FVK A;  2KP2 A;  1X9S B;  1AIU A;  5JCW A;  4XS1 A;  1YZX A;  3UIW A;  2CA8 A;  3L9U A;  4O7H A;  3GTU A;  1GUM A;  1YJ6 A;  4FXY P;  2ON5 A;  2YWI A;  1XWA A;  4K5R A;  3IAS 2;  2GSS A;  3TDG A;  4IHU A;  5CRH A;  2YPM A;  4PHZ C;  5IO2 A;  5E59 A;  12GS A;  3F9U A;  2LEG A;  4G19 A;  4HS1 A;  4KF9 A;  4WR5 A;  1G6Y A;  4AJ7 A;  1SEN A;  2WZS A;  4PUA A;  2EC4 A;  4FYU A;  1QK8 A;  4JED A;  1XPV A;  3VWW A;  3KD0 A;  6GST A;  3O6T A;  4WET A;  4ULX A;  5HR0 A;  3ZML A;  3LEF A;  4Q5F A;  2AAW A;  1KBN A;  1E2Y A;  1C72 A;  1JZO A;  2HRN A;  5J5N A;  4PGT A;  4GST A;  1B48 A;  4ZBA A;  2V1M A;  3HVS A;  3TRX A;  2H1B A;  1ILO A;  3QAW A;  4KDU A;  5F0G A;  1AAZ A;  4DSS A;  3FZA A;  2B5E A;  2JZT A;  3IK9 A;  4HQS A;  2PN8 A;  2QKE A;  1R5A A;  3LOR A;  3UL3 A;  1SL0 B;  2HXK A;  4N11 A;  2EFD A;  3TGZ A;  4L5O A;  5J9B A;  1SYX A;  3WYW A;  3PPU A;  2FD3 A;  4LMV A;  4J2F A;  1VF2 A;  4ICY A;  1SL2 B;  2X8H A;  3MIX A;  5KN1 A;  1SD8 A;  2TIR A;  4RQX A;  3A2W A;  3LXZ A;  4HUA A;  4USS A;  1A8L A;  1SKR B;  5HR1 A;  3DVW A;  3ED3 A;  3FR9 A;  3G7J A;  3MAK A;  1YF1 A;  2Z9S A;  3F8U A;  4GQF A;  1PL1 A;  4KCE A;  2WVZ A;  2XPE A;  3GKM A;  5IIZ A;  2B7K A;  4V2L A;  2DIZ A;  1OAZ A;  4MCU A;  3N5O A;  4TW5 A;  4BIK A;  3RFR C;  5BMU A;  5D9V A;  3G9B A;  3APQ A;  1YEP A;  3L0H A;  3D5J A;  4K1F A;  3ERW A;  3BCI A;  5IOX A;  4CHS A;  4K7N A;  3I69 A;  4E68 A;  1KTE A;  5B6N A;  3L9S A;  2R4V A;  3UAR A;  4AJ6 A;  1FOV A;  1PA3 A;  2LKU A;  3L9V A;  5F06 A;  1NHO A;  4F82 A;  1O8X A;  3PIN A;  1F6M C;  1EEM A;  3HVX A;  3UVH A;  1HNA A;  1SD9 A;  3GL3 A;  2K6V A;  2HRF A;  2WGR A;  2O7K A;  3EMX A;  4TN8 A;  3TJG A;  5HR3 A;  4K0G A;  1O81 A;  1EWX A;  5CP1 A;  1ZYQ B;  1ERU A;  2CX4 A;  2CVK A;  2OE0 A;  3ZVJ D;  4TXV A;  5ECQ B;  4FIW A;  2DBC A;  1EP7 A;  2B7J A;  1M2B A;  2X49 A;  1PN0 A;  4WF4 A;  2HSM A;  1A23 A;  4NAX A;  2CQ9 A;  3H79 A;  2H0H A;  3FW2 A;  3FY7 A;  2H30 A;  5H5S A;  3ZLP A;  4PXO A;  3APO A;  1HD2 A;  4V2M A;  1XIY A;  3DD3 A;  2WUL A;  3RDW A;  1EV9 A;  3UBK A;  1XWB A;  1Y25 A;  3ME8 A;  5KN3 A;  4RQR A;  4EIQ A;  1SK0 A;  5ECN B;  1THO A;  3IPZ A;  3RAZ A;  4EC0 A;  1MD3 A;  5AIV A;  5D8I A;  3GV1 A;  3MSZ A;  4RUV A;  2YP6 A;  5IMV A;  1U6T A;  2O8V B;  4HZ4 A;  1FVJ A;  3A2V A;  3IV4 A;  4HU9 A;  4V2N A;  1PX7 A;  2XBQ A;  3WGE A;  2L4C A;  3H8Q A;  4EF0 A;  4YAP A;  3KCM A;  4PI0 C;  1BJX A;  2FCH A;  1ERT A;  3IDV A;  4MJB A;  2JSZ A;  4I2T A;  1GSQ A;  5A34 B;  1KEB A;  2H19 A;  3FZ5 A;  4KH7 A;  3KTB A;  2VLT A;  5D9T A;  4BWS A;  1B9X C;  1XVQ A;  2H73 A;  1JFU A;  2YCD A;  4TOP A;  1G0T A;  2VD1 A;  4OFN A;  3P90 A;  3VWV A;  4E8E A;  2WW0 A;  1F9M A;  5EL8 A;  1YF0 A;  4KA0 A;  1PKW A;  1VF1 A;  2PGT A;  2GQL A;  4PUF C;  3UVT A;  1TDI A;  2FWE A;  1V2A A;  3F4S A;  3TJB A;  1AQX A;  5ELA A;  3HHV A;  1MD4 A;  4WF5 A;  2F8F A;  2F9S A;  3HVN A;  1BX9 A;  4I8B A;  3C71 A;  1PD2 1;  1Z9H A;  3GSS A;  1Q98 A;  1U3I A;  1GUL A;  1JZR A;  1AQV A;  4P3Y B;  3TJK A;  4KDY A;  4G2E A;  1BG5 A;  2H6Z A;  2YV9 A;  4MA9 A;  1NSW A;  2FA4 A;  1ZYP A;  3GX8 A;  3VWX A;  3IBH A;  1GRX A;  3HCZ A;  5J4U A;  2I9H A;  1FW1 A;  2B3S A;  1GUK A;  4IP6 A;  5J4Y A;  3A2X A;  2HT9 A;  2L57 A;  3TJF A;  2LJA A;  4Z2R A;  3E3E A;  3GX0 A;  2IJY A;  2IN3 A;  1Z7P A;  3TKS E;  2YWO A;  2OT3 A;  2PWJ A;  2WVX B;  2ZUP A;  1MEK A;  4OO5 A;  4XS4 B;  5J47 A;  1M0U A;  1UA5 A;  2D2Z A;  4K0N A;  5IPH A;  2JZR A;  2A2R A;  4NHZ A;  2WS2 A;  1TRS A;  5ID2 B;  1YVL A;  5FWG A;  4XRD A;  5H5Q A;  2C0G A;  2VUP A;  2GSR A;  2VL2 A;  4GTU A;  1XW9 A;  3MYD A;  3DWV A;  1K3Y A;  3EYT A;  1M3I A;  4GDF A;  2YWM A;  3US3 A;  5IQY A;  1F2E A;  2I4A A;  1F3A A;  2GS3 A;  2OKA A;  5HQP A;  3IA1 A;  1FAA A;  3IR4 A;  3A3T A;  3ERF A;  1VGL A;  2MYG A;  1BED A;  4OMV A;  4IVF A;  2CAQ A;  4CDO A;  1YKC A;  3D0Z A;  1YKA A;  1EEJ A;  1B8X A;  4ZB7 A;  1ZMA A;  1XCC A;  4OWY A;  1K0A A;  2HRA A;  4QQ7 A;  4JE1 A;  1TK8 B;  2NDO A;  3GH9 A;  4BL7 B;  4PTS A;  1DBY A;  3I9V 2;  1ZYN A;  3O3T A;  2PPT A;  3WGD A;  4K9Z A;  1G7O A;  1M3J A;  9GSS A;  5EPF A;  5IOW A;  4ECI A;  4IBP A;  3LGC A;  1ZOF A;  2VOC A;  3EVI A;  1YEX A;  2CZ3 A;  1M9B A;  4G10 A;  1TI3 A;  5LNK e;  1M2A A;  2EIO A;  5A34 A;  2OBI A;  5C04 A;  3LG6 A;  1SU9 A;  1OC9 A;  3A5W A;  5J41 A;  3ZFL A;  5L71 A;  2G2Q A;  2REM A;  4G0L A;  2X4A A;  2GDR A;  4IW9 A;  1U3A A;  2GVP A;  3DRN A;  3VI5 A;  3LW9 A;  4PUR A;  3ERG A;  1X5C A;  4TR1 B;  4Z2T A;  3HJM A;  6GSW A;  5IMD A;  1S3R A;  3MWH A;  4DVC A;  3BD2 A;  1PRX A;  3EUR A;  2PVQ A;  3DGQ A;  4GWR A;  1WIK A;  3N9J A;  2WW1 A;  3KP8 A;  1W4V A;  2AYT A;  2HRK B;  2XPD A;  4TKY A;  5FHI A;  3RBT A;  5JWQ B;  3GL5 A;  4D73 A;  4IJI A;  3BOA A;  2C80 A;  4YQV A;  2R0G A;  2HYX A;  2EFE A;  5CYY A;  1B4P A;  2L5L A;  1HNC A;  4BPY A;  2K8V A;  1J08 A;  2VL3 A;  4BA7 A;  2V6K A;  3GKN A;  2C3N A;  3PR8 A;  2VCV A;  3CQF A;  1A0R P;  2M80 A;  1I5G A;  1N25 A;  1SKW B;  1OVN A;  4WBR D;  3DVX A;  1S3C A;  2R5G A;  1UN2 A;  4FO5 A;  3W8J A;  4NMU A;  4AKI A;  2M72 A;  1PSQ A;  2J23 A;  1PL2 A;  1M99 A;  4WXT A;  2GGT A;  4MJE A;  2WVX A;  4NV2 A;  4KGI A;  5KN2 A;  3HJP A;  1V57 A;  1G7E A;  2VLU A;  4G01 A;  18GS A;  4FYC A;  6GSX A;  2CT6 A;  5ECH B;  1O73 A;  4FH8 A;  5ID2 A;  2C1Y A;  5ECR B;  2R6K A;  3GMF A;  1ON4 A;  2FY6 A;  2XBI A;  1EOG A;  4IKH A;  2X99 A;  3GST A;  1X0R A;  1A2L A;  2JSY A;  4ZXG A;  2R2J A;  3VI7 A;  1RW1 A;  2V2G A;  4QMK A;  2R37 A;  4TXO A;  5HFI A;  3QFA C;  3QFB C;  2OE3 A;  1EGR A;  1S3D A;  3G7I A;  2FNO A;  2DC5 A;  3EC3 A;  2K9F A;  5DJL A;  4LLR A;  2AUV A;  4CY6 A;  2IFQ B;  5FT3 A;  2HI7 A;  3KEB A;  1A24 A;  4ZB9 A;  3HJO A;  2GZZ A;  1PN9 A;  3SWL A;  3ZIJ A;  2YZH A;  5G5E A;  3ME7 A;  4EO3 A;  3CTG A;  3CRT A;  2KUC A;  5JWR B;  2OJL A;  2V6O A;  1FO5 A;  4IEL A;  3IE3 A;  2JU5 A;  3F4T A;  3P2A A;  2H74 A;  4NHW A;  3LFL A;  5B8A A;  1XW6 A;  1HQO A;  4HQZ A;  1M9A A;  3S9F A;  1BQ7 A;  4YH2 A;  5IMF A;  2YJH A;  1SK1 A;  4KSO A;  1T00 A;  3KIJ A;  5GAN D;  1N2A A;  3M8N A;  1X5D A;  4V1A g;  5A5H B;  2CX3 A;  3TRP A;  1OYJ A;  2LTK A;  1SKS B;  3D22 A;  4KW6 A;  4TRX A;  3RPP A;  2BTO T;  4KDX A;  2ON7 A;  4BVX B;  2IWT A;  1XOA A;  4POB A;  1AQW A;  2L6C A;  3IHQ A;  5ABR A;  2DJ0 A;  2ES7 A;  2H1G A;  2LS5 A;  2K18 A;  4K6X A;  2GZY A;  3CHX C;  4MF5 A;  2HZE B;  2EFC A;  4HDE A;  3FHK A;  5A1N B;  4L5L A;  2ALB A;  2O36 A;  4GCI A;  2KOK A;  1T7P B;  4FQU A;  4JRR A;  4KCA A;  4MPF A;  5DBQ A;  5ECK B;  1GP1 A;  3TKR A;  4OFT A;  1WOU A;  1CQH A;  3CMI A;  3ZL5 A;  1XWG A;  1H75 A;  1M7T A;  4AKH A;  4F2I A;  6GSS A;  4DSQ A;  1JHB A;  2G0F A;  4EKZ A;  2DKH A;  3FK8 A;  2RII A;  3TU3 B;  2WW3 A;  3AY8 A;  3KGK A;  3IOS A;  4WEY A;  1GNW A;  3D4T A;  2PER A;  2YOI A;  4G0I A;  4V1A p;  3KTL A;  2L5O A;  3MDK A;  3F63 A;  5J40 A;  2EFH A;  2E2G A;  3R3E A;  1WPI A;  4ZBB A;  2LRT A;  4ZL7 A;  5AN1 A;  5IMA A;  1YY7 A;  2N5B A;  3D4M A;  2B5Y A;  1ERV A;  3H93 A;  2C4J A;  2DJ2 A;  2DIY A;  2GT6 A;  5IPG A;  3SBC A;  1JLV A;  2QGV A;  5CRD A;  3HDC A;  2GZP A;  5CRE A;  1IYI A;  3FR3 A;  1A2J A;  1SL1 B;  2C8U A;  1GSE A;  2H8L A;  2VCQ A;  5HFK A;  10GS A;  2H6Y A;  1I9D A;  3CRU A;  4YQM A;  1ZL9 A;  3CWG A;  3LSZ A;  3H1N A;  2IFQ A;  4Q5R A;  1OE8 A;  2O3E A;  2JZS A;  5D96 A;  3KMO A;  1K3L A;  1LJR A;  2H76 A;  4WBJ A;  5DQS A;  4F9Z A;  4GSN A;  4GSS A;  4Z2U A;  1O7U A;  2WJU A;  4AKG A;  4PI2 C;  4PNG A;  3TKQ A;  5DQY A;  1V40 A;  3U5R E;  4HJM A;  2GST A;  5KEJ A;  1AW9 A;  4AI6 A;  3QR6 A;  1T4Y A;  2P31 A;  4ILF A;  4K7O A;  1S4B P;  4MPG A;  1SK2 A;  3FMW A;  3HY2 A;  3HA9 A;  1TKD B;  3M9J A;  1YDK A;  1JLW A;  3D6I A;  1XW5 A;  8GSS A;  1EGO A;  14GS A;  2VAF A;  1XWC A;  2YWN A;  2TRX A;  4IS0 A;  3GH6 A;  2H72 A;  4MP4 A;  2LJK A;  4MLY A;  4YKG A;  1A0F A;  5D93 A;  2CVB A;  2DMM A;  1K3O A;  1Y1U A;  3L78 A;  3KJY A;  4K7I A;  4BVX A;  3ZIV A;  3KMN A;  4ZIL A;  2XC2 A;  1OKT A;  4RI6 A;  3KH7 A;  1XWK A;  3NOF A;  1IYH A;  3GKK A;  3ZFB A;  2I3Y A;  5E4W A;  2B5X A;  3TOT A;  2A2P A;  3L4N A;  2HZE A;  2HFD A;  2V32 A;  4WR4 A;  2VL2 C;  5IO0 A;  1GSD A;  5GST A;  4OD7 A;  4EXJ A;  2F51 A;  2O85 A;  1BAY A;  2MMN A;  3GFK A;  2ZCT A;  2OAC A;  5IM9 A;  5A4U A;  3UOM A;  4PQ1 A;  3GNJ A;  4ID0 A;  2FWF A;  3FZ9 A;  2YJ7 A;  3M1G A;  1K0B A;  2WFC A;  4IP1 A;  5ECL B;  5CAX A;  2HE3 A;  3VFI A;  2F8A A;  2M46 A;  4LA1 A;  1TXU A;  4AJ8 A;  4L8E A;  3Q6O A;  3KM6 A;  2BJX A;  3P7X A;  1THX A;  3O76 A;  2OA7 A;  2UZ8 A;  1Q4J A;  4XHM A;  1V98 A;  3UMA A;  4EUY A;  1T1V A;  3UBL A;  2XHF A;  3BBY A;  2GQK A;  3KH9 A;  3CBU A;  2WCI A;  4O5U A;  2IMI A;  2QSI A;  1BYE A;  4MF6 A;  2LRC A;  2WB9 A; 
#chains in the Genus database with same CATH homology
 22GS A;  3WD6 A;  4ZL9 A;  1BG1 A;  4FYB A;  1J0F A;  1KNG A;  1GTU A;  11GS A;  2DSA A;  2AV4 A;  2YNX A;  1TW9 A;  5ECO B;  3ZVJ A;  2HQT A;  1QQ2 A;  3CSJ A;  2H1D A;  2CVD A;  1G6W A;  2X64 A;  1RQM A;  4EE0 A;  1MDI A;  2JAD A;  3MNG A;  4Z7X A;  3I6A A;  4PX1 A;  2EIR A;  1ML6 A;  4N0Z A;  3ZTL A;  4J57 E;  5IMC A;  1GLQ A;  4MNN A;  4X1U A;  3KXO A;  4GLT A;  3F0I A;  4TR3 A;  3E0U A;  3NIV A;  4EDZ A;  3HVV A;  2VCX A;  3VPT A;  1MTC A;  2KP1 A;  5EY6 A;  3EIN A;  4K8M A;  1DE2 A;  4POM A;  1TTZ A;  1TXX A;  2L6D A;  1NM3 A;  1GLP A;  2MZC A;  3TCO A;  4ZIJ A;  4JR4 A;  5F07 A;  5BMU B;  3EMP A;  3QCP A;  5BRT A;  5F05 A;  2GTU A;  4OCF A;  3HD5 A;  2DKI A;  3F3R A;  4NWY A;  1QFN A;  2MBS A;  4J56 E;  2IMD A;  4X4J A;  2E0Q A;  3ZZX A;  2DJK A;  5A5K A;  4XTS A;  2X8C A;  1N8J A;  4DSR A;  2QA1 A;  1TI1 A;  2H1A A;  3WGX A;  1ERW A;  4BVY B;  3J7Y k;  2WRT A;  3IC8 A;  5AIX A;  3QAG A;  5KN0 A;  4GQC A;  3TKP A;  5ELG A;  1SVL A;  2MMO A;  1GSF A;  4ZB8 A;  3LWA A;  1H4O A;  5EVO A;  5A4V A;  1HYU A;  5B6M A;  5KOX A;  2PVO C;  2O89 A;  2O5V A;  3UEM A;  3HYP A;  4MZW A;  1LU4 A;  2KHP A;  3VPQ A;  1Z3E A;  1F37 A;  5J9C A;  4AGS A;  3KZQ A;  3ZRD A;  1ABA A;  1YQ1 A;  1RK4 A;  1GNE A;  4K2D A;  3TKS A;  2OE1 A;  2F3M A;  4AKX B;  3PGT A;  4XS4 A;  5AGY A;  4YQU A;  1WE0 A;  1B4Q A;  4IQA A;  19GS A;  3DYR A;  4MDC A;  2VD0 A;  3TRQ A;  1A8Y A;  3CYN A;  2HSM B;  1UC7 A;  3NZN A;  1GSU A;  3LXT A;  1EP8 A;  2C0D A;  1PMT A;  5G1L A;  5GAP D;  4KUN A;  3HMJ G;  3QAV A;  1O85 A;  4HI7 A;  4OO4 A;  1V58 A;  3RHB A;  3HXS A;  3CTF A;  3GA4 A;  1U87 A;  1GUH A;  3TOU A;  1FOH A;  4ECC A;  1NHY A;  1E6B A;  2PUK C;  1K0M A;  5G1K A;  1OC3 A;  4G0K A;  4MAB A;  1GL8 A;  3RPN A;  3GYK A;  5H5R A;  3M9K A;  1NW2 A;  4O5Q A;  2FLS A;  5G5F A;  4KSM A;  2FGX A;  1HNB A;  5A4W A;  2ZNM A;  1K0C A;  1XFL A;  4OFM A;  5DCG A;  1VRS D;  2MBT A;  4BL7 A;  3QDN A;  5J3R A;  1AC1 A;  4I5Q A;  5CNW A;  5DAL B;  4N30 A;  4GXZ A;  3F6D A;  2MMA A;  1GSS A;  5D73 A;  4JU5 A;  3GRX A;  2H66 A;  2NPB A;  4X0X A;  1TOF A;  5CRW A;  1QUW A;  1XBS A;  2WZ9 A;  2DJ3 A;  3FRC A;  3R2Q A;  5IMZ A;  2CV4 A;  4O92 A;  1XXU A;  2DLX A;  3C1S A;  3H4K A;  4ACS A;  4L0U A;  5C00 A;  5JWO B;  1QMV A;  3FYG A;  2HSY A;  1F3B A;  4JZQ A;  5ECP B;  13GS A;  3LQ7 A;  3F4R A;  4KE3 A;  2HSH A;  2DJJ A;  2EIQ A;  4KAE A;  4TR1 A;  1JZD A;  3UAP A;  1O8W A;  2VCW A;  4KX4 A;  2CAI A;  3ZMK A;  3DXB A;  1R26 A;  3GIX A;  1X5E A;  1GTA A;  3QPM A;  2LJR A;  2HNL A;  1OKD A;  2HZF A;  3APS A;  2HRK A;  3VK9 A;  2RLI A;  3QD9 A;  3JCM L;  3ZIT A;  4GF0 A;  4YAV A;  1JZW A;  3C73 A;  5HR2 A;  3ZRE A;  1TRV A;  1SJZ A;  3DKS A;  5COH A;  1QGV A;  2RM5 A;  3LJR A;  3RHC A;  1W89 A;  2VLV A;  3EPT A;  4F03 A;  2LNT A;  2AHE A;  4BVY A;  2WDU A;  3GUR A;  3GUS A;  4JR6 A;  4QL7 A;  3F6F A;  1ZZY A;  5DJM A;  4L0W A;  3C8E A;  1FG4 A;  2YAN A;  3V1W A;  1TJD A;  2QC7 A;  1DE1 A;  3F3Q A;  2VKZ G;  3TB2 A;  5LCZ A;  3EU3 A;  5DAK B;  1EZK A;  1U88 A;  3C1R A;  2RUF A;  5LD0 A;  3Q74 A;  4K5S A;  2H70 A;  2LQO A;  1T4Z A;  4ISD A;  2H1L A;  1GH2 A;  2HSN B;  3DEX A;  3BJ5 A;  5AIS A;  1DUG A;  2P5Q A;  1Z6N A;  2B1L A;  2K8S A;  1FHE A;  4G9H A;  1MDK A;  3Q19 A;  4XS6 A;  1PKZ A;  4POK A;  4IQ1 A;  1PX6 A;  2L59 A;  2FWH A;  2LST A;  2PU9 C;  3LYK A;  2IMK A;  2CZ2 A;  4MK3 A;  3ZYW A;  1AXD A;  4ZL8 A;  3QMX A;  1GWC A;  4ML6 A;  4EIP A;  4XRA A;  5JCU A;  3OR5 A;  1PQN A;  1V9W A;  1OE7 A;  4MJA A;  5B7C A;  2JAC A;  3KP9 A;  3DIE A;  2YZU A;  3IC4 A;  1Y6E A;  5KOW A;  4H86 A;  4EL1 A;  2OBK A;  4XIH A;  2TRC P;  2AJQ B;  4LMW A;  3IXR A;  4BWQ A;  1ZCP A;  1VF3 A;  2P0G A;  2C0E A;  2C3Q A;  1X9W B;  4K2X A;  5JCG A;  4WKW A;  5DAL A;  1DSB A;  1FB0 A;  2VM2 A;  1OC9 B;  2H71 A;  3LYP A;  2H01 A;  4TVE A;  5ECS A;  2YV7 A;  2DML A;  4LL4 B;  2VCT A;  1TRW A;  2L4Q A;  5HFG A;  2NVL A;  2I1U A;  2RM6 A;  1URM A;  1J9B A;  2H0I A;  1X9M B;  2E7P A;  4MF7 A;  4ECB A;  4DEJ A;  5ECI B;  6GSV A;  6GSU A;  4F0C A;  2LRN A;  2LUS A;  4PNF A;  4JBB A;  2NBS A;  3E9J B;  2NTO A;  2FHE A;  4ZBD A;  4YKF A;  3VLN A;  4MJC A;  4ML1 A;  2RUE A;  3W8S A;  4W66 A;  4I2U A;  1SVO A;  3DML A;  5CO3 A;  5A5H A;  4MH2 A;  4D73 B;  7GSS A;  3TJJ A;  4F0B A;  1SJ6 A;  1XVW A;  3FR6 A;  3PH9 A;  2IME A;  4NPB A;  3TUE A;  4LL1 B;  1ACV A;  5CRG A;  4N3Z A;  2KLX A;  4KB3 A;  1GSY A;  3P8W A;  2A4V A;  2VM1 A;  3GHA A;  4PQI A;  4KND A;  1USB A;  2PBJ A;  2R0P A;  1FB6 A;  3U6V A;  2O87 A;  2YN1 A;  3BCK A;  2JL4 A;  4MZB A;  3FKF A;  3D21 A;  4IGJ A;  2H75 A;  2J9H A;  5D9W A;  5A1N A;  5J4V A;  17GS A;  4Q5N A;  2OAD A;  2P5R A;  2N5F A;  1PGT A;  2R0C A;  1SJI A;  1TU7 A;  2FUG 2;  1R5P A;  1Z5Y E;  3IRA A;  4HJ2 A;  1OC8 A;  3GTU B;  2LNS A;  1B9Y C;  1TP9 A;  3FEU A;  2VO4 A;  5DAK A;  1AUC A;  5DCH A;  2C0F A;  2VIM A;  2IIY A;  1Z6M A;  4HU7 A;  1WWJ A;  2LV3 A;  1LBK A;  1M2D A;  2R3X A;  1TU8 A;  2I81 A;  4X43 A;  3Q18 A;  4NV5 A;  5GSS A;  2C3T A;  2A2S A;  3IK7 A;  1WMJ A;  1XOB A;  2HSN A;  4HEA 2;  2MMZ A;  2DJ1 A;  2FA8 A;  5G30 A;  4PQH A;  1ZYE A;  3WT2 A;  4TXO B;  4Q5Q A;  2V41 A;  4MZC A;  5F8B A;  4ECJ A;  4GRF A;  5DDL A;  2GQM A;  4HZ2 A;  4DSS B;  4CW9 A;  3A5I A;  3EE2 A;  4IN0 A;  16GS A;  5INY A;  2GLR A;  2IMF A;  4O32 A;  3C7M A;  3M3M A;  1TRU A;  5G31 A;  3K8N A;  5ENU A;  1SVM A;  1O6J A;  3VWU A;  2A4H A;  3ISO A;  2X8G A;  4CY8 A;  1R4W A;  2AB6 A;  1Z7R A;  1T8E B;  2H6X A;  1UVZ A;  3FZ4 A;  5G2Z A;  2VCZ A;  4QL9 A;  1K0N A;  1TK5 B;  1SYR A;  3M0F A;  1WRY A;  1EOH A;  1QXH A;  1S3A A;  4N0V A;  20GS A;  3VUR A;  4HOJ A;  4MH3 A;  5B8B A;  3CSH A;  3QOU A;  1TK0 B;  1ZGN A;  2GSQ A;  2IL3 A;  6GSY A;  4TR4 A;  2UV8 G;  4POL A;  2VL9 A;  2LQQ A;  3J7Y b;  1A2M A;  3EU4 A;  1ST9 A;  3G7Y A;  2B6M A;  4RI7 A;  2BMX A;  2PMT A;  1WJK A;  5D9X A;  1CQG A;  1EV4 A;  4IJ3 A;  4I6X A;  4EDY A;  3UJ1 A;  3W6G A;  3HZ8 A;  3GKX A;  4MMM A;  3IHG A;  4XCS A;  5GZZ B;  2IPA A;  2N5A A;  3WT1 A;  3HKR A;  2QA2 A;  2H0G A;  1GTB A;  3TKS C;  4EVM A;  1K0O A;  3IAM 2;  1GTI A;  4ZB6 A;  1BF5 A;  1T3B A;  1K0D A;  5DVB A;  2E2M A;  1VF4 A;  3I43 A;  1R7H A;  2HLS A;  5ECM B;  2FWG A;  4NXI A;  3EWL A;  4A5P A;  2GT5 A;  3CXG A;  1WP0 A;  4I97 A;  1MDJ A;  4OCE A;  3GN3 A;  2B1K A;  1XZO A;  4O5R A;  3CSI A;  4N10 A;  4AF2 A;  4TR0 A;  3HZ4 A;  4E8H A;  1FVK A;  2KP2 A;  1X9S B;  1AIU A;  5JCW A;  4XS1 A;  1YZX A;  3UIW A;  2CA8 A;  3L9U A;  4O7H A;  3GTU A;  1GUM A;  1YJ6 A;  2ON5 A;  2YWI A;  1XWA A;  4K5R A;  3IAS 2;  2GSS A;  3TDG A;  4IHU A;  5CRH A;  2YPM A;  5IO2 A;  5E59 A;  12GS A;  3F9U A;  2LEG A;  4G19 A;  4HS1 A;  4KF9 A;  4WR5 A;  1G6Y A;  4AJ7 A;  1SEN A;  2EC4 A;  4PUA A;  4FYU A;  1QK8 A;  4JED A;  1XPV A;  3VWW A;  3KD0 A;  6GST A;  3O6T A;  4WET A;  4ULX A;  5HR0 A;  3ZML A;  3LEF A;  4Q5F A;  2AAW A;  1KBN A;  1E2Y A;  1C72 A;  1JZO A;  2HRN A;  5J5N A;  4PGT A;  4GST A;  1B48 A;  4ZBA A;  2V1M A;  3HVS A;  3TRX A;  2H1B A;  1ILO A;  3QAW A;  4KDU A;  5F0G A;  1AAZ A;  4DSS A;  3FZA A;  2B5E A;  2JZT A;  3IK9 A;  4HQS A;  2PN8 A;  2QKE A;  1R5A A;  3LOR A;  3UL3 A;  1SL0 B;  2HXK A;  4N11 A;  2EFD A;  3TGZ A;  4L5O A;  5J9B A;  1SYX A;  3WYW A;  3PPU A;  2FD3 A;  4LMV A;  4J2F A;  1VF2 A;  4ICY A;  1SL2 B;  2X8H A;  3MIX A;  5KN1 A;  1SD8 A;  2TIR A;  4RQX A;  3A2W A;  3LXZ A;  4HUA A;  4USS A;  1A8L A;  1SKR B;  5HR1 A;  3DVW A;  3ED3 A;  3FR9 A;  3G7J A;  3MAK A;  1YF1 A;  2Z9S A;  3F8U A;  4GQF A;  1PL1 A;  4KCE A;  2XPE A;  3GKM A;  5IIZ A;  2B7K A;  4V2L A;  2DIZ A;  1OAZ A;  4MCU A;  3N5O A;  4TW5 A;  5BMU A;  5D9V A;  3G9B A;  3APQ A;  1YEP A;  3L0H A;  3D5J A;  4K1F A;  3ERW A;  3BCI A;  5IOX A;  4CHS A;  4K7N A;  3I69 A;  4E68 A;  1KTE A;  5B6N A;  3L9S A;  2R4V A;  3UAR A;  4AJ6 A;  1FOV A;  1PA3 A;  2LKU A;  3L9V A;  5F06 A;  1NHO A;  4F82 A;  1O8X A;  3PIN A;  1F6M C;  1EEM A;  3HVX A;  3UVH A;  1HNA A;  1SD9 A;  3GL3 A;  2K6V A;  2HRF A;  2WGR A;  2O7K A;  3EMX A;  4TN8 A;  3TJG A;  5HR3 A;  4K0G A;  1O81 A;  1EWX A;  5CP1 A;  1ZYQ B;  1ERU A;  2CX4 A;  2CVK A;  2OE0 A;  3ZVJ D;  4TXV A;  5ECQ B;  4FIW A;  2DBC A;  1EP7 A;  2B7J A;  1M2B A;  2X49 A;  1PN0 A;  4WF4 A;  2HSM A;  1A23 A;  4NAX A;  2CQ9 A;  3H79 A;  2H0H A;  3FW2 A;  3FY7 A;  2H30 A;  5H5S A;  3ZLP A;  4PXO A;  3APO A;  1HD2 A;  4V2M A;  1XIY A;  3DD3 A;  2WUL A;  3RDW A;  1EV9 A;  3UBK A;  1XWB A;  1Y25 A;  3ME8 A;  5KN3 A;  4RQR A;  4EIQ A;  1SK0 A;  5ECN B;  1THO A;  3IPZ A;  3RAZ A;  4EC0 A;  1MD3 A;  5AIV A;  5D8I A;  3GV1 A;  3MSZ A;  4RUV A;  2YP6 A;  5IMV A;  1U6T A;  2O8V B;  4HZ4 A;  1FVJ A;  3A2V A;  3IV4 A;  4HU9 A;  4V2N A;  1PX7 A;  2XBQ A;  3WGE A;  2L4C A;  3H8Q A;  4EF0 A;  4YAP A;  3KCM A;  1BJX A;  2FCH A;  1ERT A;  3IDV A;  4MJB A;  2JSZ A;  4I2T A;  1GSQ A;  5A34 B;  1KEB A;  2H19 A;  3FZ5 A;  4KH7 A;  3KTB A;  2VLT A;  5D9T A;  4BWS A;  1B9X C;  1XVQ A;  2H73 A;  1JFU A;  2YCD A;  4TOP A;  1G0T A;  2VD1 A;  4OFN A;  3P90 A;  3VWV A;  4E8E A;  1F9M A;  5EL8 A;  1YF0 A;  4KA0 A;  1PKW A;  1VF1 A;  2PGT A;  2GQL A;  4PUF C;  3UVT A;  1TDI A;  2FWE A;  1V2A A;  3F4S A;  3TJB A;  1AQX A;  5ELA A;  3HHV A;  1MD4 A;  4WF5 A;  2F8F A;  2F9S A;  1BX9 A;  4I8B A;  3C71 A;  1PD2 1;  1Z9H A;  3GSS A;  1Q98 A;  1U3I A;  1GUL A;  1JZR A;  1AQV A;  4P3Y B;  3TJK A;  4KDY A;  4G2E A;  1BG5 A;  2H6Z A;  2YV9 A;  4MA9 A;  1NSW A;  2FA4 A;  1ZYP A;  3GX8 A;  3VWX A;  3IBH A;  1GRX A;  3HCZ A;  5J4U A;  2I9H A;  1FW1 A;  2B3S A;  1GUK A;  4IP6 A;  5J4Y A;  3A2X A;  2HT9 A;  2L57 A;  3TJF A;  2LJA A;  4Z2R A;  3E3E A;  3GX0 A;  2IJY A;  2IN3 A;  1Z7P A;  3TKS E;  2YWO A;  2OT3 A;  2PWJ A;  2ZUP A;  1MEK A;  4OO5 A;  4XS4 B;  5J47 A;  1M0U A;  1UA5 A;  2D2Z A;  4K0N A;  5IPH A;  2JZR A;  2A2R A;  4NHZ A;  2WS2 A;  1TRS A;  5ID2 B;  1YVL A;  5FWG A;  4XRD A;  5H5Q A;  2C0G A;  2VUP A;  2GSR A;  2VL2 A;  4GTU A;  1XW9 A;  3MYD A;  3DWV A;  1K3Y A;  3EYT A;  4GDF A;  2YWM A;  3US3 A;  5IQY A;  1F2E A;  2I4A A;  1F3A A;  2GS3 A;  2OKA A;  5HQP A;  3IA1 A;  1FAA A;  3IR4 A;  3A3T A;  3ERF A;  1VGL A;  2MYG A;  1BED A;  4OMV A;  4IVF A;  2CAQ A;  4CDO A;  1YKC A;  3D0Z A;  1YKA A;  1EEJ A;  1B8X A;  4ZB7 A;  1ZMA A;  1XCC A;  4OWY A;  1K0A A;  2HRA A;  4QQ7 A;  4JE1 A;  1TK8 B;  2NDO A;  3GH9 A;  4BL7 B;  4PTS A;  1DBY A;  3I9V 2;  1ZYN A;  3O3T A;  2PPT A;  3WGD A;  4K9Z A;  1G7O A;  9GSS A;  5EPF A;  5IOW A;  4ECI A;  4IBP A;  3LGC A;  1ZOF A;  2VOC A;  3EVI A;  1YEX A;  2CZ3 A;  1M9B A;  4G10 A;  1TI3 A;  5LNK e;  1M2A A;  2EIO A;  5A34 A;  2OBI A;  5C04 A;  3LG6 A;  1SU9 A;  1OC9 A;  3A5W A;  5J41 A;  3ZFL A;  5L71 A;  2G2Q A;  2REM A;  4G0L A;  2X4A A;  2GDR A;  4IW9 A;  1U3A A;  2GVP A;  3DRN A;  3VI5 A;  3LW9 A;  4PUR A;  3ERG A;  1X5C A;  4TR1 B;  4Z2T A;  3HJM A;  6GSW A;  5IMD A;  3MWH A;  4DVC A;  3BD2 A;  1PRX A;  3EUR A;  2PVQ A;  3DGQ A;  4GWR A;  1WIK A;  3N9J A;  3KP8 A;  1W4V A;  2AYT A;  2HRK B;  2XPD A;  4TKY A;  5FHI A;  3RBT A;  5JWQ B;  3GL5 A;  4D73 A;  4IJI A;  3BOA A;  2C80 A;  4YQV A;  2R0G A;  2HYX A;  2EFE A;  5CYY A;  1B4P A;  2L5L A;  1HNC A;  4BPY A;  2K8V A;  1J08 A;  2VL3 A;  4BA7 A;  2V6K A;  3GKN A;  2C3N A;  3PR8 A;  2VCV A;  1A0R P;  2M80 A;  1I5G A;  1N25 A;  1SKW B;  1OVN A;  4WBR D;  3DVX A;  1S3C A;  2R5G A;  1UN2 A;  4FO5 A;  3W8J A;  4NMU A;  4AKI A;  2M72 A;  1PSQ A;  2J23 A;  1PL2 A;  1M99 A;  4WXT A;  2GGT A;  4MJE A;  4NV2 A;  4KGI A;  5KN2 A;  3HJP A;  1V57 A;  1G7E A;  2VLU A;  4G01 A;  18GS A;  4FYC A;  6GSX A;  2CT6 A;  5ECH B;  1O73 A;  4FH8 A;  5ID2 A;  2C1Y A;  5ECR B;  2R6K A;  3GMF A;  1ON4 A;  2FY6 A;  2XBI A;  1EOG A;  4IKH A;  2X99 A;  3GST A;  1X0R A;  1A2L A;  2JSY A;  4ZXG A;  2R2J A;  3VI7 A;  1RW1 A;  2V2G A;  4QMK A;  2R37 A;  4TXO A;  5HFI A;  3QFA C;  3QFB C;  2OE3 A;  1EGR A;  1S3D A;  3G7I A;  2FNO A;  2DC5 A;  3EC3 A;  2K9F A;  5DJL A;  4LLR A;  2AUV A;  4CY6 A;  2IFQ B;  5FT3 A;  2HI7 A;  3KEB A;  1A24 A;  4ZB9 A;  3HJO A;  2GZZ A;  1PN9 A;  3SWL A;  3ZIJ A;  2YZH A;  5G5E A;  3ME7 A;  4EO3 A;  3CTG A;  3CRT A;  2KUC A;  5JWR B;  2OJL A;  2V6O A;  1FO5 A;  4IEL A;  3IE3 A;  2JU5 A;  3F4T A;  3P2A A;  2H74 A;  4NHW A;  3LFL A;  5B8A A;  1XW6 A;  1HQO A;  4HQZ A;  1M9A A;  3S9F A;  1BQ7 A;  4YH2 A;  5IMF A;  2YJH A;  1SK1 A;  4KSO A;  1T00 A;  3KIJ A;  5GAN D;  1N2A A;  3M8N A;  1X5D A;  4V1A g;  5A5H B;  2CX3 A;  3TRP A;  1OYJ A;  2LTK A;  1SKS B;  3D22 A;  4KW6 A;  4TRX A;  3RPP A;  2BTO T;  4KDX A;  2ON7 A;  4BVX B;  2IWT A;  1XOA A;  4POB A;  1AQW A;  2L6C A;  3IHQ A;  5ABR A;  2DJ0 A;  2ES7 A;  2H1G A;  2LS5 A;  2K18 A;  4K6X A;  2GZY A;  4MF5 A;  2HZE B;  2EFC A;  4HDE A;  3FHK A;  5A1N B;  4L5L A;  2ALB A;  4GCI A;  2KOK A;  1T7P B;  4FQU A;  4JRR A;  4KCA A;  4MPF A;  5DBQ A;  5ECK B;  1GP1 A;  3TKR A;  4OFT A;  1WOU A;  1CQH A;  3CMI A;  3ZL5 A;  1XWG A;  1H75 A;  1M7T A;  4AKH A;  4F2I A;  6GSS A;  4DSQ A;  1JHB A;  2G0F A;  4EKZ A;  2DKH A;  3FK8 A;  2RII A;  3TU3 B;  3AY8 A;  3KGK A;  3IOS A;  4WEY A;  1GNW A;  3D4T A;  2PER A;  2YOI A;  4G0I A;  4V1A p;  3KTL A;  2L5O A;  3MDK A;  3F63 A;  5J40 A;  2EFH A;  2E2G A;  3R3E A;  1WPI A;  4ZBB A;  2LRT A;  4ZL7 A;  5AN1 A;  5IMA A;  1YY7 A;  2N5B A;  3D4M A;  2B5Y A;  1ERV A;  3H93 A;  2C4J A;  2DJ2 A;  2DIY A;  2GT6 A;  5IPG A;  3SBC A;  1JLV A;  2QGV A;  5CRD A;  3HDC A;  2GZP A;  5CRE A;  1IYI A;  3FR3 A;  1A2J A;  1SL1 B;  2C8U A;  1GSE A;  2H8L A;  2VCQ A;  5HFK A;  10GS A;  2H6Y A;  1I9D A;  3CRU A;  4YQM A;  1ZL9 A;  3CWG A;  3LSZ A;  3H1N A;  2IFQ A;  4Q5R A;  1OE8 A;  2JZS A;  5D96 A;  3KMO A;  1K3L A;  1LJR A;  2H76 A;  4WBJ A;  5DQS A;  4F9Z A;  4GSN A;  4GSS A;  4Z2U A;  1O7U A;  2WJU A;  4AKG A;  4PNG A;  3TKQ A;  5DQY A;  1V40 A;  3U5R E;  4HJM A;  2GST A;  5KEJ A;  1AW9 A;  4AI6 A;  3QR6 A;  1T4Y A;  2P31 A;  4ILF A;  4K7O A;  4MPG A;  1SK2 A;  3FMW A;  3HY2 A;  3HA9 A;  1TKD B;  3M9J A;  1YDK A;  1JLW A;  3D6I A;  1XW5 A;  8GSS A;  1EGO A;  14GS A;  2VAF A;  1XWC A;  2YWN A;  2TRX A;  4IS0 A;  3GH6 A;  2H72 A;  4MP4 A;  2LJK A;  4MLY A;  4YKG A;  1A0F A;  5D93 A;  2CVB A;  2DMM A;  1K3O A;  1Y1U A;  3L78 A;  3KJY A;  4K7I A;  4BVX A;  3ZIV A;  3KMN A;  4ZIL A;  2XC2 A;  1OKT A;  4RI6 A;  3KH7 A;  1XWK A;  3NOF A;  1IYH A;  3GKK A;  3ZFB A;  2I3Y A;  5E4W A;  2B5X A;  3TOT A;  2A2P A;  3L4N A;  2HZE A;  2HFD A;  2V32 A;  4WR4 A;  2VL2 C;  5IO0 A;  1GSD A;  5GST A;  4OD7 A;  4EXJ A;  2F51 A;  2O85 A;  1BAY A;  2MMN A;  3GFK A;  2ZCT A;  2OAC A;  5IM9 A;  5A4U A;  3UOM A;  4PQ1 A;  3GNJ A;  4ID0 A;  2FWF A;  3FZ9 A;  2YJ7 A;  3M1G A;  1K0B A;  2WFC A;  4IP1 A;  5ECL B;  5CAX A;  2HE3 A;  3VFI A;  2F8A A;  2M46 A;  4LA1 A;  1TXU A;  4AJ8 A;  4L8E A;  3Q6O A;  3KM6 A;  2BJX A;  3P7X A;  1THX A;  3O76 A;  2OA7 A;  2UZ8 A;  1Q4J A;  4XHM A;  1V98 A;  3UMA A;  4EUY A;  1T1V A;  3UBL A;  2XHF A;  3BBY A;  2GQK A;  3KH9 A;  3CBU A;  2WCI A;  4O5U A;  2IMI A;  2QSI A;  1BYE A;  4MF6 A;  2LRC A;  2WB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...